2QVMA

The second ca2+-binding domain of the na+-ca2+ exchanger is essential for regulation: crystal structures and mutational analysis
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
185
structure length
116
Chain Sequence
HAGIFTFEEPVTHVSESIGIMEVKVLRTSGARGNVIVPYKTIEGTARGGGEDFEDTCGELEFQNDEIVKTISVKVIDDEEYEKNKTFFLEIGEPRLVGRPILGEHTKLEVIIEESY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The second Ca2+-binding domain of the Na+ Ca2+ exchanger is essential for regulation: crystal structures and mutational analysis
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Metal binding protein
molecule keywords Sodium/calcium exchanger 1
total genus 30
structure length 116
sequence length 185
ec nomenclature
pdb deposition date 2007-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2030 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2qvmA00
2QVMA 2LT9A 3FSOA 2QVKA 3RB5A 2KLSA 2FWUA 3EADA 2DPKA 3RB7A 2KLTA 3E9UA 3E9TA 2FWSA 3FQ4A 3GINA 3H6AA 3US9A
chains in the Genus database with same CATH superfamily
1IL1B 4WI4A 2FL5B 1Z3RA 4GT7A 5BVPH 5KYXA 3IS1X 1CFTA 1BREA 1AJ7H 2VR7A 3GGWA 5HGHA 2B16A 1VRSA 4QRSA 4Z7VA 4NYLB 5T1JA 2ZYSA 2QMJA 3ARUA 1JV5A 1E42A 4IRZH 4XVJL 1JAEA 4GRMB 1A3RH 2VDPH 3QXTA 1A6TA 3NFSH 5EF0A 4F7PB 4ZFOA 3KPSD 3V0VB 2D7QA 3IKKA 3HAEA 3O3DA 4E9RA 2ATKA 2N7SA 3IMSA 1YN7A 3OV6A 3HKZA 3NCWA 4MNGE 4U1KB 5CAYB 8PAZA 3NJFA 4TQHA 3BN3B 3GFUA 2VDNB 3LEXA 1JXKA 3JWOC 5H4ZA 5D7SL 3CSBA 2XQYG 3HW7A 4TSAH 4ZMAT 2TRHA 5FECB 1YDPB 2KHAA 3ZR6A 1LMKA 4X4XB 5A2IH 1I8KB 1UZ8B 4L2LA 1UM6L 4HUMB 4WU7A 5EU6E 3V0GA 2BERA 4PJ8B 4KDTA 4MB1A 3TJEH 3PNRB 1BQRA 4N5ED 4MTMA 4R4ND 1YEKH 2CE6A 4MB3A 2GITA 5E56A 5J57B 4KVNL 1TVHB 3RGVA 4Q9QH 4QYOB 2XY2A 4CVWA 4NB7A 1SFDA 1HH9A 2YD4A 3C60D 3KBFA 3PCYA 4M1CC 4Y9EA 4ODXB 3B83A 1NC4B 5JW5A 1EDQA 1U95A 1UZ6F 1YY9D 4O02H 2QDWA 4P9HH 1KMGA 2GIMA 4JQIL 2H3NB 4PJ6A 4JFSA 4QTHB 4N5UA 1SXBA 5E2VH 3BDXA 2V4LA 3QC6X 2A9AA 4LPYA 4UAOB 3I6KB 5D5MA 3HAEG 4DGVL 5EN2A 4Z3TA 3DOHA 1N2RA 3H2PA 2X4UB 3KCPB 2YA0A 4LAJH 3VGHA 4LLVA 1YYML 2PR4L 2WUBL 3GSVB 1YEHL 4FCHA 3KNBB 4PCSA 1QD0A 3MJ8A 1IB5A 5I8EA 4APXB 4PRPE 4WWKB 3VFRA 1N70A 3O11A 3ILQC 4C54A 3LDBC 1L9TA 1MWOA 4TVSa 3B2VL 4RNRA 5ECJE 2H26B 3HZYA 1I7RA 1A8ZA 1LO5B 3VSTA 1VKXA 4MCYA 3RI5F 2A1WL 1NFIB 1M56B 2J1XA 4MX7A 4URKA 2CUIA 2V5SA 4BWTA 3VXPB 2VRAA 3V9EA 3MO1B 4OCWH 3ZPDA 4CBZA 4N2GA 3FTUA 3ROOA 3WELA 4AYBA 1E5YA 1YNLL 3FJTA 2V7NB 3REWA 4RCAA 5FK9A 2XVBA 1E9OA 4HUVB 1U8JA 4NQUA 3D06A 3FUFA 1DVUA 2Z8RA 5B7MA 2WOYA 3RZWA 5F9JB 1IM9A 5M95B 3O6LL 5E5MA 4JFOA 1ZV9A 1CB4A 1P7KB 2WCPA 3L9YA 4CA4A 3LKNB 1JZFA 4P3DB 2NNXA 2LR4A 4MAYB 1UXMA 3CQFA 4CJ0A 1MAKA 4OZGA 4XAWH 3QJUB 2V9QA 4MSWB 4P4KD 2BHZA 4Z7VE 4ZS6C 1RHHA 5IFJB 4JLRB 3SDDB 5C0CE 2MRYA 3BVUA 1BG9A 4LSTL 3MCYA 2V3FA 2JQMA 2J71A 1BQLH 1G5GA 3T3MF 2GPZA 3M17A 4L0PB 1Q9LB 1QSEE 1GZQB 1HINL 5E5RB 3SPCA 2KC0A 2GABA 3H9SD 4JKKA 5KTEH 1PG7W 4M93B 1R47A 4PJ5B 3QPQC 2V5TA 4FMFA 3SBQA 1J48A 1S7VB 3JYBA 4WTWA 2R1YA 3OAUH 2HB0A 4RFNC 1ASQA 1B6DA 3OKNB 1R5WA 2NY1C 2NY2D 1ML0A 2P43B 2K4WA 4LQ1A 3SDDC 2APFA 5JHLL 3V6ZA 3VWJC 4AEFA 2R59A 3NIGE 5LGJA 1KGYE 4BFRA 1GKEA 2KLRA 4GB9A 5JZ7D 1YN7B 4X98A 1AXSB 1F4HA 3P3RA 5ESVB 4UU9A 5KSVB 2APVA 2HX7A 4EZLA 4EI6B 2AGJL 3Q0HA 4LF3B 3VWKB 5LNDA 1K9TA 4K3GA 3SQOH 3UZQB 4Y9GA 4OFPA 3BQVA 3BAWA 3KD4A 3TBSB 3HMXH 1G9NH 3CDZB 1KYOJ 2YD9A 4D0DB 2AXWA 2LW3A 1DBMH 5DZPA 5E4IA 2K0RA 1EH9A 4F15C 4UOQA 2FWLB 3BO8B 1CE1H 4O00A 1DJZA 5A2AA 4AVJA 2JJSC 4JRXB 2GG1A 2X4TB 2Z8VC 3QQ9C 4U2YA 2XPZA 2Z1PA 4GQPH 1FLTX 1UD3A 2JSFA 3DXAA 1ID2A 3T0XA 2FVNA 1CDYA 3O4OB 4JRXE 2ZUYA 2Y23A 4S1SH 4XHJD 4F9PC 1RURL 4I88A 3ILPB 4UM9A 2BOLA 1WZ1L 4QHMB 5CP3H 3FSVA 1QI3A 4HPYL 3RNQB 2BVUA 3SGKA 4ZOCA 3QCTH 4UNUA 2Z34A 1SJHA 4P2RA 1AQHA 1NZRA 2BXYA 5DXWA 1CLYH 3WIFB 3OJ2C 2IO5A 3LQAL 2V9RA 2XY1A 3PYCA 1H6UA 1ORSA 3NIGF 3TURA 1KLUB 4ZOBA 1XGQB 1WFMA 3IMTA 4X6DB 2YIHA 3IDYB 3I6LD 3GLEA 4WQOA 3TESA 1RK7A 4QRQB 4ZMVA 3AREB 4PQXA 3FHAA 1BJ1H 4Z95H 1LO0L 3ASOB 1NGQL 3HZYB 3MRJA 4XCCL 1UGNA 4MA8H 4Z7VB 3UGUA 1NIEA 1WBYB 1FL3B 4FQ1H 4QKXB 1JOIA 4K71B 5HGBB 3L95A 3RWFB 4F7CB 2MOVA 4XH2B 5HPMB 4J28A 3Q1SH 2EYSB 2GT9A 3BPLB 4QLWA 1QHPA 2YJQA 3E7JA 5DC2A 2DEXX 3Q6FB 2O5YH 5CHNA 1O6VA 1BZ7A 3KPNB 5CD3A 1DBBL 2ZOWA 4H25A 3D69A 3X11B 5JPMC 3ARFD 2Y1AA 4H1LG 2XRAL 5C92A 4BFFA 5IESL 1TQCB 3DVNB 5AVZB 3PJLA 1JMZA 1HL5A 4XPTL 1OARL 5FM5O 4XNZC 2DQHL 3LKQA 2QBWA 3EJZC 4G6AD 4TNFA 5HHME 5LQBH 3CZFB 4YLQT 4NNXB 1WUNT 1X5YA 2CCLA 2H45A 5B1JA 4ZUTA 4XMKL 4K7PY 3OAUL 3WFEL 5KVDE 4DGVH 1I8IB 3QUXB 1E6JL 1T0NB 1MELA 3VVVA 4QGTA 3KLHC 4ONHB 1NMCC 2FEDD 3V0JA 5ITBL 4U6YA 3RDJA 3RVWC 1NGPH 1JPSH 3MNZB 2BJMH 4RRPA 4DVRL 1DL7H 4Y5VC 1J5HA 2Y5TB 1R75A 4FQ2L 1P0SE 2FIRT 4ZO7A 3K5SA 4JFVA 4UYPA 3TCTA 4HKJA 7FABL 1IFHL 2X44D 2CBPA 2ZOLB 3DMMB 3L7EA 3K2UL 1L9PA 1TJIH 2CIKB 3OAYH 5FKAB 2EH7H 3EDJA 1JXFA 3LMJL 3NTCH 2K4AA 1UM5L 3QDAA 3BSGA 2C7UA 5JHDD 1LL1A 4G9FB 4JHVA 3SPHA 2DQTL 2X4QA 1QZNA 3QEQA 4E2OA 1N3NA 3QWRA 3QI9B 3KBEA 2ZOUA 1IMHC 2E5EA 2UVEA 4WFEE 4CVUA 2JKRM 2BNRD 3NVQA 3SD5A 5DDHA 5I76A 3W57A 1WEJL 1MY5A 2CIIA 4YFLF 2MHAA 1EZVY 5C6WH 4KX7A 4PLJC 2VC2H 4UTBL 3QPXL 4PD4K 3RWGB 1IQWH 1H3VA 3U1PA 3BUQA 3PDGA 3JZ7A 5C7XH 1XSKA 1KEGH 3ZDXF 4JPKH 4X6FA 1AR1B 2GB2A 3S88L 3D09A 3P4MA 3WIHA 3IFPA 2UUDK 4G8GD 4P4RA 2VZ1A 1XF5B 5TJWK 1Y18B 2HT3D 3KPPA 5FGSA 4QT5A 5GIRA 5ETUA 3ZL1A 1ZHLA 4PGEA 5B8CC 3BXNA 5F2FA 4G6FB 3T1FB 5JQIB 3ARBC 3FK3A 5ALCL 4DW2H 5BZWB 4MFHA 3E6FB 2Y6SC 4LOUD 2O5XH 1FORH 2UWEE 4Z3HA 4L8SB 3APMA 4GMTH 1JI1A 2ARJQ 1PYWB 2LVEA 3GGWB 1ET5A 2R69A 1ILUA 5JNYB 5HTSA 1Z9MA 3JV6B 4PRID 4FQLL 5D7IB 7FABH 4PVBA 3HFFA 2W95A 3PQYB 2YUXA 4ZMQA 1Q4NX 4H8QA 2J6EA 2VR5A 1N10A 5C0JB 5F6IC 5E4OA 1O75A 4ATTA 3WU1A 2QKIC 3UPRA 4GIPD 4B5EA 1RERA 2ZP9A 1PNDA 4JKMA 3WKMH 4GAJH 1KLFA 2HRGA 3HFML 4LSPL 2HG5B 1KTDA 2DZEA 5KBMA 5L0QC 1DFBH 3CFMA 4XN7A 3NYKA 4H40A 1RUQL 2UY6B 4HSCX 1HXYA 3UZEA 1FL5A 2BNRA 4LOVA 3FDWA 4KI5E 4K94L 4PCTA 4NHUA 5E5LA 1BP3B 3UO1L 2OMWA 3LH2L 3P4OA 3UTPD 4I13B 5J11C 4HIJB 3OKYA 3O8XC 4AY0A 4AJWA 3QHZL 3WXWH 2Q6WB 3LKQB 4DIXA 5ESVA 2BNQE 3EDFA 2EUWA 1SDAB 3U9WA 1ZT7A 3LN5A 1Z7JA 1QTPA 1QI5A 4U3SB 3DETD 4AXWB 2DIJA 1YY9C 3E3QC 2YZ1A 3D2TA 1ZE3C 1ZV5A 2W80C 3B2PA 2YGPA 1QA9A 1ZTXE 4K3HA 4BZYA 3GXIA 1MI5B 5DMGC 4XXDB 5CUSL 3SO3C 4KNSA 4EI5A 1WCQA 4M43L 3FH7A 3D6GA 2G75B 1A0QL 1VLXA 3NJLA 2WIIA 1WYJA 1D5RA 2QADD 2NY2C 1KCRH 1E3ZA 1BD2B 3B9EA 4PJ7A 5EF3A 4YAQB 5HVGB 1THCA 3V10A 2YEZA 3QIBC 3ZKNC 4HKXA 4X6CF 5CLYA 4N6RA 5I1IH 4EKXA 2C1PB 2VLRB 3GXUB 4HUWA 3Q9QA 4TTGA 4G42B 5BS0A 3HJ0A 2WXJA 5ITFB 1MIEH 5GGVL 1UURA 4H5SB 2FEEL 4YSQA 4MB4A 4KXZH 5E6IA 2IALB 3VRIB 4KGLA 1RUPL 4P04A 3WTYA 5F7KC 3BVTA 4UM9D 4P5KA 1OCRB 1FYHB 4LVOC 1DVSA 4PB9L 3RZCB 4YQXL 2IXQB 4JM2D 3QFDB 4NRZB 1FP5A 4PJBA 4GSDH 1A7OL 4KK6C 3CZKA 3ME0B 3OC5A 4B9ZA 3HAEB 4N2CA 3LVTA 5IW1B 4OCRH 1ZCRA 3W1ZA 4XNMB 2DDQH 5C09E 5HPMA 3TIEB 1MCWM 1Y7VA 4HT1L 3UX9B 1A66A 2B77A 2VWEC 3EHBC 2VZUA 4MAYC 2OP4H 4WEUD 3TWYA 3NK4A 4WWKD 3IDXL 1E3FA 5DYOB 1X6LA 3KPPB 3LRKA 3VXNB 5JHLH 4TN9A 5C0RL 2DMGA 4AV5A 4FXKA 3VFNA 3DHMA 5JW4M 2V2TA 1NLBH 3NUKA 4TS6A 4WEBH 2X2HA 2ZWSA 4M62H 3UJIH 4Z7UB 4OGAC 4PG9B 3BSHA 3KDPB 4ZTPL 4JFYB 4Z7QB 2XZAL 2YA2A 2BSRB 3IFLH 4FZ8H 1HESA 4LOEA 4WNQB 5F0MB 3AVEA 2LU4A 5FXCH 2Y5TA 1BQLL 2H6PB 1VGKB 2R1WA 4RWHA 5I71B 2XXGA 1QABA 3PQYA 4B6ZA 5HY9B 1I9IL 3MODL 3REVB 2KLTA 5SV4A 4I5BB 3MBWB 4TQ8A 2ZX8A 5HD8C 3EYVA 2WTRA 4KUCF 4X5XB 2R9HC 4Z3EA 1X9LA 4IBZA 3UADA 5HDBB 5J3HD 1CTMA 5CKGA 5I19H 4U1KA 5ADOL 32C2A 1I9JL 4NC1C 4OJFH 3D05A 1JS4A 4HFUH 5K93A 4DGUA 4Q6IA 5F7FA 5KYYA 1HZHH 3OPZH 1LILA 4BWUA 3LB6D 1DN0A 1BWWA 1GW0A 2C3GA 3ZJAA 4C57C 3UABA 5B22A 2WQSA 3GSWA 3KLHD 1KTBA 3DX2A 1OSZA 4NKMA 5DRXB 3Q3GB 3HG0A 2HLFC 2HFGL 4MVBD 4CMHC 3ASWA 5FHAH 1DQML 1PAZA 3BPOC 5FWQA 1G7JA 3U7WH 4LPVA 3B2XA 2Z92A 4G9FD 5F88A 5A3ID 4FLHA 3FB6A 1YMMD 1NGWA 4XI5C 4LLYA 2EH8H 5D1XA 2QGDA 4RISL 1BZDA 1ZGLA 3STZB 5EEVA 1HNGA 1WH0A 1MWAH 2WAQA 1QZ1A 4JFUA 4IOSA 2F54A 2XCMC 4N68A 4UV4H 3FUKA 1CTNA 4ZS7H 2NUTA 1BF5A 2R4SH 2DYPD 2WMPA 3QZWB 1ZSDB 4QKTA 3VCLB 3V0DA 5I8EB 2VZTA 3C8DA 1Z5LB 4I18C 4M1DH 2ZWKA 3BW9B 3KH3A 2VLJE 2MTPA 4KFMA 5MP6L 5IT2L 1IC4L 1F1DA 1BYOA 3NESA 4XODA 2AQQA 3ZKMD 2H0PA 2XZCH 3CHPA 2WO2B 3O6FD 5LUMA 1THAA 3MR9B 3S5LG 4UZGA 9CGTA 3ULUL 3NSDA 1AQ8A 2E59A 4DJMA 5HHMD 5ACZA 3HPLA 4NT6A 1BA9A 1SLWA 1FE8H 4J1UB 4YDVB 3II3A 2KDGA 4FQXB 2IWFA 3KM2A 4JFQB 4QRRB 5GRZA 3GZKA 5BRPA 3ZHFA 3FQRA 3GIZL 1D5MB 5EEZA 3GMLB 1CD1B 1F4YL 4IK7A 3WN5C 4HT1H 2UYLB 4ZNEE 5SWZB 2WWMC 3LQMA 2R83A 3UOAB 1XR8A 4AUUA 3L9RB 1E65A 1G6RA 5LXGL 4LNRB 1FDLH 4XMLL 3WNMA 3RDTD 2A4ZA 1CDJA 4BHUA 1A3RL 5K9QG 1MJUL 5BO1L 5EIQA 3UH8A 4N86A 3BKYL 4I87A 1LWJA 2GTWB 5DD6A 5EG6C 3OJMB 2VOTA 2YXFA 3QNZB 3I74A 1M2OA 1XCXA 4Y5XC 3VFSB 2NY3C 2A6KA 5HJBA 3FZUD 1VA9A 2O5NA 3MV8E 1BV8A 2CIKA 3PHSA 1HI6A 3SQBB 4O02L 2Z7ZA 5KVGH 1Q0YH 3RL2B 2XETA 3AG1B 5B7EA 3P11H 5C08D 2X40A 1A4CA 2Z1KA 3ARDA 5C9JB 3AMKA 4LLVB 3VFTB 5FEBA 2LVCA 1WTLA 4WVRA 4OQTA 4KBPA 4P46A 3TU6A 1OTTC 1QBML 3DBXA 1CGTA 4PJAE 1OCCB 4ZUSA 1IEAA 4RIRA 2VLRA 2J72A 2JIXB 2YD7A 2OXHB 2BOBA 4NIKB 1F6AA 6PAZA 3AZUA 1FH2A 4PAZA 5ITFA 1DEEB 4M7KL 5K69A 1PIFA 1BFVH 1BXVA 4N6QA 1QSFD 2FR4B 2QQLH 2D3JA 1F8TH 3G5VA 5CGYC 4ETQA 3L2MA 2X6CA 4XNUL 4NJ9L 1K2DB 1W8NA 1TTRA 4IMLA 3S96B 2WZPD 2X41A 5IMOB 3B7UX 1D2PA 1R4XA 4OLXH 4ODWB 3T3PB 3DGGB 4EF3A 1BXXA 3CUPA 1NTDA 4XMUA 4P0DA 4TLUA 3T4AC 1LWHA 1N5AA 3RVXD 4FNQA 3SJVA 5CCKL 3GSUA 1FBIH 2JQAA 1BZ9B 1N0LA 4KRPD 3UGEA 2D3LA 1FH5L 3NSXA 4JRWA 3DHUA 4NRYA 4FP8H 4UOW1 4XP9H 1GXEA 2E46A 3L3KB 3MNWB 3QI9D 4N0CD 3TYFA 3L5IA 1K5NA 2ICWJ 1QLEL 1DUZA 1PKQA 5HGHB 3OG6B 5DD0H 5DHYB 2WY3B 3NN8B 3UROR 5FDYA 3KR3H 4BCYA 2O6DA 2R0LH 2WZAA 2Z65C 3SZ6A 3EBAA 2F5AH 2PYED 3DTUB 3AREA 2IAAC 3EH4B 3DKHA 4FYRA 4K9EC 2ED7A 2EZ0C 3BUPA 5FOBA 4HAKA 3L5HA 4JPWH 4N2IA 4UINL 3LNDA 2IPTH 1NUFA 2P1YA 3H55A 4OZHA 2WBXA 4GI9A 4FTVD 2GC7C 3RJDA 2C7UB 2HJLA 2R1YB 1FLRH 1F6FB 3HE6C 5AAMA 2DEYX 4E9WA 4JFWA 3F83A 3WD5L 3SDCC 2OKMA 3O4LE 3MBED 5I6XB 1INEH 3IN2A 2B2XL 3X13B 5LNEA 4Z0BH 2Z7YA 3HE7A 4PCYA 4AQAA 3EJUA 3MKGA 2X2YA 3CPLB 3F7YB 3PWNB 4EMZA 3DLQR 4ZPVA 5DJZB 4YN3A 1E9QA 1Z3GH 5B39G 2IADB 1EZVX 4V2CB 3NZUA 3LTVA 1EHLH 3CFJA 1TVBA 4S2SB 3ZMEA 4UQEA 2PF6A 1PG7X 3FU8A 3RWCA 4MB5A 4QY8A 4OCXH 3IFOA 4A2LA 3AM8C 5ITBH 3EFFA 2X0WA 3RTQD 3NA4A 1JNHA 1XSJA 3E6HA 2DIAA 3ULVC 3L3IA 3P0VL 3CXFA 2Q3AA 4MBRA 3SJVE 1I8AA 2P47B 4DO4A 5IZ7A 4QRPA 3KS0H 1RSFA 5CINH 3MV9B 1S8DA 3FF8A 4JE4B 4MJIE 4XPGL 3BPOB 12E8H 4Z7AA 2B9BA 1CL7L 4N8VB 1U92A 1YEWA 1OP9A 4MNHA 3S35X 1JERA 3OGCB 1G6VK 3GRWL 3HAEH 4X7SH 2CO6B 2CR3A 5D96B 4PRPB 1DLFH 3SPVA 3R4RA 4J3SA 1SEBA 1PL3A 4GYBA 1BFOB 4UB0L 1EQWA 3ESMA 1JE6A 2H8PB 1R24A 2NY6D 3D39D 1ZLUH 4Z7OE 2CUHA 4PUBL 2IDUA 4LHQB 4DP0X 2D2CC 4HUKB 4PRDB 1VFAA 4J4PC 5AAWA 2FLMA 1HHGB 1KOAA 5D1ZA 1FNFA 1U9KA 1IILE 2E0PA 5DEZA 3GMOB 3ATBA 1CI5A 2DWEA 1IO4C 1DL7L 3PV6B 3CX5K 1LD9B 5I1HH 2EIZB 5L7XL 4FQPA 4GG6A 3UZVA 4I7ZC 3RJQB 3F6IA 4YDIL 5KYWB 1MRDH 4BELD 1QWUA 1J0YA 1YDPA 5GIRB 3CN1A 4B53A 1UA7A 1ZTXH 1WFIA 5CF3A 1CF8L 1EEYA 3RWDB 2L7QA 4E36A 4XOCA 2XRAH 4WFHD 5FGBC 3JYCA 4PVNA 1HZKA 4NNXA 3ARYA 4HK0B 1TCRB 4K0OA 4BKSC 1V5JA 4ONOA 1T0NA 1H0DA 4XP6L 1TTUA 2VDLB 2Z0BA 5C0NC 4HJUA 3VXTA 1PGRB 2A9MH 3BGMB 2CMRH 5KBPA 1U2CA 4XT1C 4A66A 2C4FU 1KTRL 4I0KA 1JZ4A 2YRBA 1I75A 4NUGL 1ZHNA 1UA6L 1MI5D 5EOTB 2UZIH 4R90L 2AJZB 2A83B 3DOSA 3MA9H 3R18A 5IKCB 4KZEL 2XWJA 3V6ZB 3K74B 1CFQA 3ZT5A 3GSVA 4LSDA 3SBRA 1IVTA 1J1XH 2JCCF 4GG8B 4N2HA 3SDYH 4NKOB 5C0AD 4ZFGH 4JJ5B 2QVMA 5DHMC 4RA0C 3EOTH 4K3EL 5DF0A 3FQ4A 3QT2A 4PJDF 3TEWA 1G0XA 1AXTL 1ROCA 4WHDA 5GSRA 4N3UA 4DSYA 2EE0A 5DVPA 1G6RH 3VXUE 4ABWA 2GK0B 4I3SL 5JOEA 4DGYH 3RG1C 1BCIA 5TF0A 4X6EB 3UAJA 3ZTCC 5AKTA 4XMPH 3IU3A 3WE1A 1VZHA 2G9HA 6FABL 4QPEA 3BAXA 1TXKA 5IT2H 1HCYA 4WFED 4W93A 3MCG1 2YPVH 5C08A 1T5WB 3CZUB 2VDLL 2BRQA 4FN0A 4WZ9A 3GSRA 3PRZA 4QHMA 4CC1A 1J9QA 4EXPX 3TH3T 1UOVA 3MV01 4K23L 5KW9L 1W0WB 1BOGA 3S34L 1MUJA 4GUPB 1Y07A 4R2GB 3MLWH 3P0YH 1SQMA 4L1LA 5KS9E 4J5VA 2HVBA 2Y7MA 2VXVH 3L8QA 4XN2A 3L1OL 5FR3A 3QZOA 2EAEA 4L29A 5GRVL 4BH7A 5ABAA 2GY5A 4WWPA 5FYJU 3E2HB 1JVKA 1PCSA 4G59C 5I5MA 4GKNA 2BVPA 5DZOA 4YZFE 5I18L 2KT6A 2NYZA 2FJGA 1Q1JH 4YBLC 2MMXA 4L4JA 3MRJB 5J4MA 3IRZA 4L3CB 4P8QA 5IB3B 3GSNH 3WCYA 5C0EA 3CZGA 4B7IA 1MXDA 1DDTA 1F3JB 2A99A 2DDQL 1R3IL 2OCFD 5AENA 2Z4QB 3Q8AA 3BVNB 1OTSC 5DHVH 4Z5RB 2ZUXA 4DP9X 3LD8B 4LPXA 3Q6FA 3A24A 3Q8EA 3ISYA 3N42F 2X0UA 1GW6A 1KB5B 4PBDA 3SGDI 2HH0H 2I07A 1KLFB 2XJKA 3QB7C 1ZLEA 4YBQC 1B4JL 3VM7A 1OT1A 1X6NA 1YPZB 5D1XE 3MRCB 4RETB 2DQTH 4PV8A 1F4WH 4GAGL 4X8XA 3N6YA 3RHWF 4DGIH 1OV8A 4N0CC 5D8JL 2YWYA 3FFCB 2NQDA 2VO5A 5I1HL 2XXMB 3I02A 3EF4A 5CP3A 5E6YA 4PREA 5B3SB 4G1EB 2MKWA 1JL8A 3CTTA 5CJXC 2CPUA 2NY7L 4JGUA 3QXDB 3RA7H 3WKNA 3EH3B 4MD5B 5LG1A 4FKEA 3DI2B 5J13B 4JFDB 3B56A 4HJ0D 2XWTA 1LVEA 2W9LA 4BK5A 2FT8A 2F74B 3GI8L 1CBVH 2EVIA 2BY0A 3FCTB 3KBPA 4AK1A 3OHXB 4KH2A 2DICA 2IOMA 4Z1PA 5DC4B 2Z92B 3MACL 4WGWB 4XXDA 4UZUA 1E7UA 3WJJC 2C9UA 4OD3H 2EDJA 3MBEB 4MMXB 1T3FA 5KYNA 5HJGA 1XGUA 2VQTA 5H37A 4R7NB 1ZA3B 2WO3B 5D7SH 4KRPB 4HV8A 3IDXH 4HGMA 3ARXA 2F54B 2WN2A 2W07A 2XBTA 5FOJA 2VSKB 3PHOB 3D34A 4BZ2L 4RMUA 1U36A 1MW1A 3KYOB 3PUCA 5AVVB 1N64L 2CO7A 3DRQB 4JVPA 4FI7A 4GXVL 5BVJB 2IDTA 4XNYH 3I2CH 3OGCA 4PSRA 3UBGA 3GINA 4QTFA 4O5LL 2NUPA 4JO8A 4TUUA 4BFKA 2YAPA 4LHUG 1MFEH 3A4FA 2IALA 3TJPA 2TSBA 2XDHA 3FU9A 4LT7A 1FAIL 2XWDA 2HFFA 3GQFA 3H9SE 2J3SA 3L5JA 4MA1C 4R0LA 4XB7A 5FA3B 4P5KB 2XV2A 2P5ED 4RAVA 2ZCHL 2FNBA 3QPQD 4TQEH 4GW4B 1RZJH 1EUUA 1IGTA 1ANUA 3VACA 3HI6H 2AV7B 5EUOE 1XB3A 4G7YH 1OF2B 4X7TB 3GTVA 5GPRA 5C08B 4LNVA 5KEZA 2ENQA 5AVUB 2OR7A 2DH2A 3LXBA 2ZG3A 1MHHA 4HEPG 4OIAA 1BEXA 1YG9A 4ZUTB 4P5RA 4R2GD 5ICZA 1LO3H 1TSHA 4Z76B 1LE5A 3T8MA 3LIZH 2ZWYA 3ECUA 4L8SA 5DQ9A 3TVMC 4S1SL 5DSCB 1X3DA 2J6EH 5KSAB 2F7OA 2VW7A 3OSKA 3LEYH 1KJVB 2X28A 1QFWL 3NT0A 4ZFZA 4FJYA 2G4EA 2GTZB 3AB0C 4B9FA 3TA3B 4RMBA 3O3AB 2IDFA 2DW5A 5F21B 3ML9A 2Q3ZA 1LDSA 3FN9A 4B9GA 3B6SB 2HAZA 4L37B 2AZAA 3FB5A 3QULB 4F7EA 4XGZB 3AY4C 1BG1A 3JV0A 1YO4A 4M62L 2OZ4H 2XKUA 4G6KL 3TYGH 1A4AA 1A14L 2APSA 4HS8L 4YHKL 4H0IA 4JRXD 2HN7A 3TT1H 1ZT1B 2GI7A 4R6UA 3ZIMA 1QKZH 1XXDC 4XP9L 4HCFA 5E9DB 3FUEA 1A6TB 5E6UB 1ETJA 4XNYL 1E5ZA 3AU1A 1BQUA 4E42A 4XNXL 4PJAB 4HIJA 3VD4A 4Z18A 3QCUH 3QFJA 3W2DL 2PNDA 4E41B 2BK8A 2HX9A 1OAUH 4ZZKA 1KJ2A 1MF2L 1UJ3A 1P9MA 3SE8L 1GIGL 2DLHA 4APQC 3U0TB 3GNML 2AJVL 4D8PB 3RYMA 1QP1A 2EDXA 3AB0B 3CFJB 4P3WA 4N87A 5GGVY 2ZX6A 5HPOA 1A1MB 1DQLH 2MJWA 3IDGB 5A16A 1OPGL 1TMQA 2JB6B 3JXAA 2CCVA 5TTRA 1E3XA 2J6EL 5K9KB 5F3BB 3CJJA 4Y7MA 4LKXA 1AR2A 3ARGA 1OF0A 2F53E 4MXQD 2Y06H 4NC2B 1F1AA 5FV2A 1A8JH 2GI0A 4PI0A 3L3GA 3HZKB 3T1FA 2VSMB 1HHKA 1L9OA 3ZL4L 1NMAH 4Y4FD 4PWFA 4Y4HC 5KVEL 3PWLA 1CBJA 3NRFA 1WT5C 4AEEA 1ADQA 1EFXD 4NLHA 1BXUA 4R7DA 4ZRGA 5E8EB 5IBTH 4MA1B 4WK0B 43C9A 3LN9A 5H94B 2RJMA 5JPNA 4Y2NA 1ZS8B 3UZEC 3T6QC 1JNNH 1SJEA 4G6ML 2XTJE 1OM9A 1RK1B 5I1EH 4F5CE 3KWXA 2P3YA 4R7VA 1A4JB 1KNOA 2BCMA 2EO1A 2DWDA 3U7AA 3CDGA 5I30L 3P73A 3HI5L 3ARFA 4MQXC 4ZD3H 1ZGLP 2W59A 1U41A 4L3CA 5K39B 2BCKA 4FULA 3V0IA 4R4FH 2VISA 4YSEA 1AS8A 2E3VA 5LXVA 1X5HA 2ED8A 3HUJE 3VI4F 3ZHDA 2R0WH 4LLMA 3DX0A 5E8DH 3C09C 1LHZA 3MXWH 3LNEA 3MGAA 2CJUL 2R23B 1VACB 4HUUA 4K3JL 2BWQA 4XAKD 4CDHA 4AE0A 5I1AA 4ODUA 3MNWA 3S36X 1LP9E 3TBWA 3VFUA 1P7KA 3QSKB 4XNBA 4OLEA 2FIKA 5AOLA 1S9KC 3UYPB 2LTQB 1UM4L 4KQ4H 2CBMA 2NXYC 3PXJA 4XVUC 2GJRA 1A6VH 4UNTA 1L3WA 2FHCA 2ZUTA 2FEJA 5EIVA 1E2VA 4MMZC 4B9PA 2F61A 3ZRCC 4F7MA 1T2JA 5C6PB 2WIIB 4NNPL 3WSQH 2UY7B 3O2DL 3ZTJH 4PS8A 2CM5A 3EYVB 3WD5H 3IE9A 4PH8A 4J6IA 4RRPM 1UWGH 1F02I 1V7MH 4NPJA 1BGXH 3ZLQC 3MV9D 4LBAA 1XGRB 5L2JA 1RZKL 2G3XA 4MKTA 2DLTA 3IETA 3M1OA 2H3XC 1EMTL 1KUMA 2CO6A 2N0MA 3HMXL 4XTRC 3AROA 3QEHA 2VXTH 4JMXA 5AKVA 3WDJA 3GC3A 1N7ML 4XO5A 3SPVB 2IBZX 3P54A 5FF6B 1F6LL 3SDYL 4FNLL 3TTYA 5I1LB 3GO1H 4NUQA 2X87A 4FE9A 5LGJB 1B2WH 5DJCA 5FUOL 1VSCA 5FX3A 3IVKA 1P2CA 1LP9F 3QQDA 5I26A 3P69A 3A4AA 1JWUA 1NICA 4NRZA 1OK8A 2NZ9C 4MGXA 1YN6A 3CHSA 4FEMA 3RBGA 4FZEH 3VYPA 3P2DA 4YSRA 3QWRD 4FFTA 3QQ9D 1PZ5A 3S3PA 3MTRA 4PRAB 2EUXA 1OALA 2ATPB 5FYKD 3QWQB 3VH8G 4P2OC 2NNRA 5I8CB 3L2NA 3BLBA 2ZXDA 3NFNB 1WAAA 5C0AB 1L6PA 3QAZC 2ICWA 2YGOA 5G5DB 3SDXE 4JFXA 5JOFB 1IC7H 5CJ8A 3HZKA 3AUVA 5E8PA 5TQ2L 1GTNA 3DECA 4UQAA 1WWWX 1FO0A 1G4MA 3L3OC 4M48H 3GB7A 2W91A 1U8HA 1G1OA 4OY9A 4AYEC 4DKEH 4J3XA 1J87A 1VCAA 5FB8B 4M7KH 1W0VB 1AP2A 2GJPA 1G9ML 3DTXA 3H2WA 4DT2A 3ETBF 4P23B 1OTSD 3S48A 3BD4A 5IREA 2BSED 2X1PA 5I9QC 3LIUA 2P24B 1IGCL 1DJYA 4KJQC 5DI8B 3UJJL 1YSOA 4MNQA 2K45A 3DOIA 5EO1A 4ZFFB 5KSBE 4JK0D 4JPWL 2PP9A 3ZIYA 1VFAB 2WGNB 3DUHA 5EOTA 1NPNA 5HHXL 4HIQA 4GAYB 4Q7DA 1QRNB 2APTA 3HB3D 1Q0YL 3B9VA 3O3DB 2CGRH 4KRLB 4ORGB 2ZPKH 3UMNA 1WBYA 3MLRL 1P5UB 5AOKA 3A6OA 2H2SC 2QADB 4NNYA 5AKSA 1U8NA 1T2XA 3MA9L 5SV3A 1XL4A 2BWDA 3WBDA 4LRNH 1S7VA 3BFQG 4J3VA 4AGPA 1X7QB 5B38G 3LKPA 2MCAA 4EUPB 4OCRL 3BZEB 4TOYL 5CGBA 1P4IL 2FK9A 5HSFA 3RFRA 2C34A 5DD5H 2YBRA 5T1KD 5J89A 3VQ1C 3LIZA 3OAYK 5E5UB 2CO1A 5K1VA 1R0AL 1E4XI 1NGXB 3QR0A 2HJKA 1AD0B 2OM5A 3LS5H 5DD6B 2A9CA 3MV8D 4LIQL 2DYSB 3TVMA 4LCCA 5CLTA 3GLZA 3NFPA 2ZNXA 2OFQA 3I6GA 5L2KE 3H3BC 2PXYC 2X70A 3NIFB 1Z0MA 2MEJB 1F5WA 2H6UA 1JPFA 1E27A 1RIHL 3HG1D 4X4MA 4JFZL 1SXSA 5IQMA 5L2KB 3CFKA 3QUKB 5I1KH 4PR5A 1GGIH 4DPBX 1FCGA 1S7RA 1VDGA 2VDOH 5DC9B 2QDVA 2YQ3A 1PIGA 5FCUH 3UTTA 1Q94B 1RIVL 3WGVB 3GRBA 4IJ3C 4LB8A 2M83A 1IGJA 1A0QH 1MJJB 3GIVB 4JPQA 2NY5L 1A6ZA 3P2BA 5MEQB 3BW9A 3CIQA 1IIKA 1QFPA 2PCPB 4MJID 1M71A 2YWZA 1TQSA 5E8DL 1MW2A 3IXAA 1TTFA 3WFDH 5IEHA 4TLSA 3KPQA 4MHHI 4HJ1A 5JHMA 1E4XH 3QE5A 5C0EB 1RUAL 2DN7A 4LVEA 1BAWA 3SYPA 4UB0H 5H37H 2CLZA 4FXLA 5F1NB 3QQXA 1CICB 3CZSA 2FYYA 1HILB 3GSQB 3NP4A 4WHYH 2Q87A 2R2CA 3RL1A 3BRDA 2EDYA 3ESVF 5CIPA 5IF0A 2OXGA 4B9IA 1L6ZA 3CMGA 1IEHA 2XYCA 5F7LB 2XXFA 5T3XL 1GHFH 5D7IF 5G2NA 3H7BA 3IMBA 5FW8A 1CURA 2PW1B 4HUXB 1FAKT 4H8UA 1YEHH 4XBGB 4QRRA 1HSBB 1OB1A 2Z0UA 4F33B 1K5NB 3TM6A 2KL6A 1MUJB 3B5TA 4O2CB 4Y5YA 5E7BA 3FU5A 3KWWA 1I9RL 2VDPB 3B9AA 4Q9CA 3QORB 2PCYA 4GAJL 1OSPH 2W0FB 2XG5B 5DS8A 1FGNH 4ZXBD 4JW3A 4FLOA 2X10A 4B9JA 1WHPA 4N3TA 1M6OA 4UTAA 2PN5A 3CDCA 4XZUA 5FB8A 4N2NA 1K6QL 5C86A 1HZHL 1I1CA 3WKPA 1XFPA 4LCWA 3GJEA 3IMUA 2VJXA 4MJ5B 4IGBC 3B1UA 4I3RH 1RZIB 3QA3B 4Z77A 3DROA 2DQGH 4F27A 4DGIL 5JHBA 2CDGA 4N8VG 1IM9D 2YARA 1JZ3A 1WA2X 2G30A 5FYKH 3NOIA 5DEJA 4PJ9C 2NLJB 3HNSH 1HEZB 2QQNH 2IQAB 1IV8A 2UUDH 1MREH 3BWZA 4RWYH 4JFTA 3W3BA 5FCSH 4BUQA 2IIJA 1S5HB 3EOTL 4JDZB 2FX7H 2RH0A 4X4KA 1SDYA 3K81A 4B0MM 3EJJX 4FQCL 4Y2DB 2Z31B 3O11B 4TL4A 3VWKA 4FG6C 5KVGL 4ENED 3RY6A 4YHIA 3MYZA 5E8OA 3CDZA 4YDKH 1Q72L 1FZJA 2GCYB 2HFTA 4MD4A 5C3LD 5DJCB 4HWEH 3FN0H 1I3VA 3WHE0 3MOBL 3CBRA 4HHGA 3RVUC 3VSVA 4L9DA 4GLRH 5GRYA 2KZ1B 2WANA 2YFNA 3LQZB 3MRNA 3MJGX 1A6AB 4M1CD 4AITA 1IBDA 1O6TA 3BIBX 4JQVA 4KK9D 5EU4B 2IDSA 3IDUA 4W9FC 3SJVB 1TO4A 5JXEA 5KN5B 3STLB 3AQZA 3H3KA 1HHKB 1AHMA 2FQDA 2B1OA 1E4WL 15C8L 1S7TB 3JVGC 1ZOXA 4FQJH 4DZ8A 2C5DC 2IAMD 4M7LT 1KIUA 1TSRA 1G94A 1A7OH 5DUBB 5HXMA 4QOKA 3DNKA 3TBTA 3IRPX 2Y72A 4NERA 4AL8L 3MLSL 3MRQB 2J8UB 2VR9A 3WIAA 4IKKA 4KKNA 4M7JH 2JJTA 1LNUA 1J5DA 1DBKL 5JO5A 1DBAL 5I8OH 2AF2A 2YHGA 3VAEA 3B43A 4GRLA 2YGNA 2BP8A 3ZR5A 5CEZL 4AIZA 1TR7A 1JI2A 2NY3D 1A6VL 2VLLB 2FRGP 2B15A 2UZYB 4KV5E 4P2OD 1P7BA 5EIIB 4YHYC 1KSRA 2IWKA 5D7KD 2IBZY 4HUVA 1KB5A 1GOGA 4ALAH 1T83C 4H25B 1MPAH 1PX8A 4E41E 4XBPB 1IGMH 3R1GL 3HI1B 3V8CA 3CFNA 2NT0A 1HX0A 1KJ2B 1UJ3B 5CIPH 3TIEA 2K3TA 1RZ7L 3GJFB 3HC3L 1KXVC 1NOAA 3H85A 2ZKYA 4XWGH 3DSFL 5HI4C 2XN2A 2BVEA 2Y2YA 2OMWB 3CLEH 3P4OB 5DWPA 3VXOA 2XG5A 4ZFZB 4Z7WE 4OLWH 5JHDB 5AW1B 2IF7A 1JD9A 1EHNA 4C55A 2WKOA 1YAZA 2UXTA 3IXTB 1S9YB 4HKZB 3CLFL 5EHFA 4G8GE 4E0RB 3VFGL 3ISRA 1X4YA 1QYGH 3WNPA 3DHPA 4HIHA 3VQLA 3VM5A 4PJEF 4F7TB 1WAEA 3FTVA 1PEWA 4H8WH 1CDGA 1FPTH 2BFVL 5DK0B 2L7EA 4FQIL 3LNGA 2HXAA 1CFSA 2B4CL 2R1WB 1VGKA 4NLAA 4QTHA 1PFOA 1U8PB 5L9DH 5T1KB 2VLKE 3OPZL 3QQ4A 4LCUA 3WKML 3IKCA 2JCCA 3L5XH 1XTLA 5ERWA 4YSSA 1JGUL 2R2EA 4PJ7B 4V2BA 5I8OL 1EFXB 3LKSA 3QEQB 5FYKL 1ORSB 4HEME 2X4OA 1P4BH 4Y9CA 2B59A 1S78C 1OZUA 4JFFE 3KLQA 1RUKH 4OQTL 1AAJA 2D7NA 5H35A 2CRZA 3AFLA 2H3KA 5FA4A 3HG1A 3H9YA 1LEIA 3SKNA 4HA1A 4PY7A 2NY1B 4K8RH 1AZVA 1LO4L 3QO1B 3R7RA 1FFNA 2EIZA 2QSCH 3RKPA 1AQKH 4UBDC 5GRVK 4BJLA 5JW3L 1YUKB 1U8KA 1KXVA 1FQ9C 4LXFA 2FNWA 1NCUA 3S3CB 1H3TA 4CADA 1UH2A 2EXWD 5I8CA 4N2OA 2RCSL 1NBQA 2QPDB 2YC1B 2YD6A 5EU4A 2XFXB 4XB3A 2RAMA 2L8AA 1BLNA 4BXSV 3C8KB 3W2DH 2YRLA 4R9HA 4MMYB 5DD0L 4R96A 4RSVA 4U0RC 3U7WL 1I4FB 4JKPL 1A6WH 3GSNA 1GC1H 4MNGB 1CIDA 3FUMA 4XBEH 2O6PA 4DK3A 3PU7A 3LS4L 4W6YB 3OLGA 2LFGA 1EGJL 1U8MA 3CK0L 1WEJH 3RUGF 3JBG7 3TV3H 1WFNA 2H47C 4PGBB 5B1KA 4L8DB 4CNIB 3WL9A 1C8QA 5CBEB 4OCSH 3NRQA 3S3SA 2WBWB 1Q9OB 4GXFA 4URTB 1TNNA 5J1TC 3FB5B 2D73A 2X4RB 4LEEA 4PEEA 5D2LB 3VXQB 2IVFC 1NAMA 4X80L 1JPST 3SDCA 1YMME 4D3CH 4YSDA 3WLWD 2VXQH 3FCSB 3R4DA 4OQTH 2G5BA 2WK2A 1KCVH 4N2AA 2ZXEB 2ZOLA 4LOFA 4BQ8A 1OAYL 2DKSA 2ADFH 4O9HH 4ORGA 4AIZB 5IM7B 1V05A 4PJBF 2ICEC 4DP8X 2EKJA 3K1KC 4XP4H 5KUMA 3WNOA 1CC3A 3R0NA 3WTWA 1ZWIA 3DGDA 3D0VA 3VW3L 2IANB 2L7JA 4HDIB 4L3AA 5HHOE 3RY4A 4DVBA 1SMAA 4QJ5B 2EDMA 5E00A 3TFBA 1L9MA 4LDOB 4LVHB 1E4WH 1KXHA 5DMIL 2WNWA 3NK3A 1YY8B 3AUWB 4IDJL 2YBGA 3VRJA 1PVHA 3VI3F 4JDEA 5KSAC 1IVLA 5IB1B 2WLMA 4Y2OA 4FADA 2AHIA 5K59E 3HG1E 4YHIB 4GRWF 5ADPH 3CVBA 3CLEL 2XOTA 2VMDA 4OFYD 4Q9BA 5L4MA 4KVCH 1KIPB 2ZKMX 1GYUA 2NT1A 2VN4A 2KZWA 4N24A 1NH6A 4MCNA 2OR9L 3VWKD 2FSDA 2BVQB 1CD0A 2WSPA 1G7QB 4K7FA 2F2HA 2D0FA 1MRCH 1TJGL 3TT3L 4GKNB 1W16A 3WTSA 4O58H 4XN8A 1MCCA 3EO1A 5GRUH 1KYDA 3DK2A 3QIUC 4KMTL 1PY9A 4P5MB 1RQ5A 2BSTB 3T2PA 5GGRY 4JR9L 2RA1A 4LHJB 1YC8A 2QQLL 1RAMA 1PYWA 2EADA 4Z6AT 3CFEA 3U25A 1WBZB 2H9GB 4I9WE 4P23A 1SEQH 5EULV 2J8UA 3OAWA 1BM3H 2E9IA 3HNTH 3VRIA 1RVFL 3JTTA 1NC4D 4FF9A 4HX1B 5A2BA 3SCMB 5I17A 1BX2A 1HH6A 4FCAA 4AT6A 1I9EA 5EBWA 3M8OL 1A1OB 1WWCA 5KSBB 3KM1A 3D3VE 1LEIB 2I07B 1BM3L 2Y7QB 4JRYE 4F2EA 4JQVC 4GRWE 4YO0B 4JY4A 1VIWA 3ZQWA 1P6FA 4G6JH 2NY2B 1A4KA 4TMPA 2WXLA 5HDQL 4QF1B 2X6VA 5SWZE 4P46D 2C9QA 1JN6B 4M48L 1HSBA 2OMYB 4H1LH 2C9RA 5IQ7H 3FUJA 3UCQA 3WMPA 3SE9H 5IWLC 3SOBH 2VXUL 2Z64C 3LKRA 1RK0B 4HQQH 4MA3A 4TUOA 3VB9A 5T3ZH 4G9DB 4OZGB 3TIDA 4XMKH 4B3VA 1UD8A 5DVKA 5E51A 3QISA 1HHJB 4M6NL 2R0WL 1MN4A 4ELKA 5J5EA 3LZLA 3VI4E 4MMYA 1MJ8H 2X0VA 5DQJA 1IBBA 4EQ3A 5DQDH 3K0WA 2UZPA 4P2OA 5F6HJ 1HXMB 3HN5A 3D1MC 1P4IH 3G6JF 5FC9A 2VM3A 2LQRA 1D7CA 5L8KB 4B9KC 3WLBA 1M7IA 3ESOA 1K4DA 4QHUB 4AEHH 3TTSA 3MJ7A 3Q1SL 4WO0A 5D6CB 5BVPL 1OD9A 3QIBA 1MCOL 5EA0L 5E1AB 3LDBB 3U83A 3HHSA 3NIDB 3ZE2B 3RWEA 4YFEA 4Y88A 2NYYC 2O5ZH 3NZHH 1QUPA 3SKJL 4NI6A 5DU7A 3KPRD 4HH8A 4IOSD 5TE4H 2Y5QA 1M42A 2Z93B 1MG2C 1XH3B 2MNUA 2XIIA 5A6IA 1AZRA 4EVNA 3ZOAA 2C26A 5G4OA 2DIBA 4S1QH 1C9SA 1WHOA 4FMVA 3RE0A 1ZVYA 3IDIB 2UZXB 1SUJA 1F18A 3B3BA 3X13A 2XACC 1HZLA 4PJXB 4FQLH 2XN0A 2QZQA 4GAFB 5ENWB 4E68A 3GUTB 3DBXB 3EHBD 1JGVL 1MZYA 1NGXA 4NC1E 3NPSB 1PLGH 1A65A 2D7TL 3ZSTA 5JIKA 5J1AA 2W9EL 2J7LA 3K6FA 4JGMA 2LHAA 4WEMB 5AWNH 4B9CA 3N0AA 5GGQH 2IEPA 1F11A 3HBPA 4UQBA 2NQCA 5F70A 4Z8FL 2X70B 2JXMA 3C09B 5E6ZA 1U3ZA 2WWNA 1IU1A 1ZHKB 2ERJC 4MWFB 5ESQB 3V4PL 1NDGB 1E5AA 3QUYD 4HCIA 4PYHA 1PPIA 4N2DA 5TGBB 5LGYA 2VR4A 3SQOL 5A2KH 1NEZG 2GEQA 4DPCX 1OP3H 1HKLL 2KI6A 3BP6A 3VCLA 1R3LA 2FSEB 2WAHA 1HQRA 3SDXF 1B9KA 2DLIA 1M71B 2XWXA 2ZXQA 1DUZB 1PKQB 1AR1D 3K6IA 2GSIB 5LBSA 4ATWA 4PJFB 3RWFA 4F7CA 4WTZA 5HYJD 3PWPE 5IVZB 2MPAL 4LLDB 3FAXA 4LP5A 1I1AB 4X7CC 1X5AA 5G55A 4NO3A 5F71A 4ANXA 1DQJB 2HTLD 3M6DA 3FHEA 2YUZA 5IGXH 1OEZW 2YEQA 2VCOA 3ETBJ 4KY2A 5GS2H 2HG5A 1NQBA 3FT2A 4GKSB 4Q56A 2E27L 3DI3B 5GS0D 1H15A 5EZOL 3PL6D 4NGHH 3D39A 4I9XA 1EJ8A 3PUUA 4RZCA 4WW1A 4Y19A 2WO4A 3MKKA 3D39E 4JCWA 1JHKL 3JWNH 1NFDB 2PW2B 4L1TA 3IDGA 4NQDE 3LQAC 4DVBB 3AY2A 3VTAA 4M4RA 2A6JA 2F1BA 3L4XA 3N44B 4QRTA 5GZNA 1IM3D 2X4TA 1J8HA 4KX9A 3AS0A 1S9YA 4OLVL 2E74C 1NIFA 1WV7T 3MXVH 4P2OB 3R8BB 2X6MA 4ODBD 5E2UL 3RQ3A 3GSOB 3PWPA 3QNZA 3QR1A 5ANHA 4Z7WA 4ZW8A 3WFBH 1JK8A 5I2IA 5FLVA 1AZCA 4YSAA 3BGMA 2IAND 2QJDA 1MF2H 4MAZA 5E1AA 3UMTA 4KTDH 1UJ3C 2I9LB 2WBJB 1F4YH 3J7HA 2D0HA 3QIWB 4BK4A 4BSVB 1F4AA 2KPNA 3MTXA 4Y4KA 2J1YA 4AM0A 1JNJA 4DCQB 5EBLA 3HR6A 3ESUF 2X3CA 3BUIA 2V7HA 4I3GA 4AW4A 4HP5A 2FHFA 1QTYT 2QHLA 3MXVL 2OMNA 5HGDA 5I76B 2Q2EB 5FYKE 3TA3C 4M7LH 5E8NA 3OMAB 2D9QB 2AEIT 1G7HA 3ETSA 4ZI8A 4K9EH 1V7NL 5DRZB 4Z7NE 3BDYL 3V4PH 5B3JF 4P9HL 2ZKXA 3QJOA 4XR8C 1WWBX 2HRHA 3OHMB 4GT0A 4GW1A 1KYFA 3MV8A 4M5ZH 4U1LA 5BJTB 5I0YA 1DDHA 4I89A 1WIPA 1YNTB 4NQSA 5DK2A 1IBGL 1PLGL 4H1LB 4YPGA 1YEKL 5C0AE 4A55A 4AL8H 2C9AA 3UAAA 4BSWA 5F9AC 2GBAA 3H9HA 3DV4A 5L4IA 3GB7B 1JNLL 3ARDD 4XAWL 2IWEA 1X5IA 3MNDA 4ONGL 3ZE1B 5TDNA 3TASA 4L5FH 3EXJA 3QO0A 1F0LA 3UYPA 3N06B 1PCXA 3EJTA 1KPVB 3A6CL 4KDVA 1QNZH 1CFNA 1E5BA 4UIKH 1B4JH 5JHDE 1NDMB 4DEPC 1MWAL 1ZIAA 3MV7A 4I1NB 1OT2A 1PAMA 1V10A 1G6RB 3D18A 1KCWA 2I85A 4LSVL 4XRCB 2ZCHH 5E2TH 2I60H 1XCQB 4UQ2A 2P28B 3WNIA 5JIMA 1AOZA 3RTQA 2L04A 2K9UA 2FZ3B 2NNAB 3FYIB 2YAMA 3T0EE 4DK5A 5EORL 4BQ9A 3MA7A 2P44B 1TZAA 3GHEL 3HBQA 4ZSOE 3N40P 1K4DB 4ZAKA 3KPRA 4ABVA 2ICWI 1BIHA 5EZIL 1XAUA 4NO0D 3FO9A 1U8IB 4L1SA 5AAMC 2A1WH 3QCVL 2BNRB 1AKJB 1N64H 4XC1H 3ABGA 2DL9A 4HS8H 3OC8A 4J23A 2AK1H 5HHNA 1IZJA 4PJHF 1NFKA 3IDJA 2IBBA 1M3JA 4YL9A 1D9KC 1XF3A 3CSFA 5K1NA 1JP5A 4CN4A 1VGEH 4NQCA 3QEQE 3CPLA 2OMUA 5DJ6A 3T08A 4RSYA 1OLLA 4O02B 5K9QI 5D7JA 2CUAA 1YUHB 3GUFA 1J9CT 3MZTA 2WKOF 4AM0Q 4NZRL 3P3TA 4LLWA 2EYTA 3WJJA 1L7IL 4HOXA 3LIZL 1IGFH 2Z8WC 3ARBA 1RUKL 2WXIA 4JM0A 1GYAA 4UCFA 2WBKA 2NYYD 2OTUA 3FFCD 2YD3A 1AO7A 3M8OH 4L9LB 3S37X 4DVRH 2A9DA 4A7GA 1S7RB 2TRYA 3H53A 3IN0A 3GDBA 4ZNCD 1JRHH 3BP4A 5CEXB 4TSCH 1T5WA 4PRIB 2N1TE 4LLYB 4QJ3B 5DK0A 1FO0B 2W92A 1EXUA 4KZ0A 4HFWB 3TS8A 4PRHA 4F57H 4HUWB 1QWHA 4TLTA 4EO5A 3F84A 3HR5A 1FPTL 4IU3B 2EVJA 3MOQA 1JXJA 5EZIH 1E4KA 2EDNA 2OW6A 3FKUS 1ZT4A 2I9LA 2RGSA 3MRQA 5FYLH 2NY3B 4PN6A 5BV7B 2R15A 1MEXL 2H8PA 4BHUI 4DCQA 4QXGL 2BP3A 1XSOA 2ICEB 4BDVB 4BYHA 1EBAA 4XWOC 2ZIDA 1VJSA 4WWKA 4X9BA 3CCHA 1NCBL 3L7FB 4IBUA 4MQ7A 2ZCKH 2FJFA 1O0VA 4G6MH 3W39A 3T2NL 5DFWH 1EZLA 4JN1L 2JJSA 2M26A 4NN5C 1CTOA 4DESA 1URZA 2KUTA 3MR9A 3WN5B 4P5TC 1KELH 4GINA 1U3HB 4KXBA 5JDJA 4JPVL 4U1HB 2X7LA 4GW5A 2J55A 4WI3A 1WA0X 1HWHB 1JYNA 4RX4D 4AYID 3RLSA 4DO5A 3TIDB 3EDEA 3BESR 2P8MB 3OKEA 4M7ZC 2UXVA 3WMQA 2X9WA 5EF2A 4PW9A 2FO4A 3UCRA 1F1GA 5K9JH 1HIMH 1NEZB 2HX8A 4J3OD 1AD9B 3KJ6H 4M3HA 5IJBC 4KI5F 1CFNB 1UOKA 1FSKC 1IARB 1TQUA 1GJIA 1FA4A 2XUWA 5H8DA 3GZOA 1NA8A 1QUNB 1NCIA 3CV5A 4MSWA 5PAZA 5EU6D 4TNWF 2LFEA 3BDBA 4RMQA 4DGYL 3MOAL 2NX5B 5BOZG 3D33A 2Y7LA 1J5CA 4Z7WF 4ETYA 3L5WA 1XGTB 5DD3H 4PR5B 1PDKA 5IESH 5TF1L 4HG4J 3V4VH 4G80A 4DP1X 3S9DB 4PP2A 1OAUL 4HLEA 5EU3B 1JPTL 3PL6C 2HTLC 2BP0A 2CAKA 2N7BA 3AACA 1A9BA 4WI0A 1NSNH 3LCYA 5I1DA 3UTSE 2K8QA 1E9PB 2I25N 4WKZA 2YQBA 5F89A 5C09D 3DYOA 5F7HA 1A6UH 3MLVL 3CQQA 3CXHJ 4GH7B 4LRIA 4OH2A 3U6RB 1GZPA 2PPAA 4P2YA 1WS8A 4D94A 5ADPL 2D8KA 3MRGB 5DHVA 4HJJL 3L1EA 3W81A 1EJFA 5IBUG 1XB6A 2BZDA 4KRNA 5DRXA 1RIUL 1UFUA 4QEGA 1T04A 3T6WA 2VIRB 3CPUA 4JFFD 2PPCA 3CVCA 4PJ7E 4DP6X 1CQKA 5FO8B 3NACH 3H7BB 2WXNA 4G5ZL 4YO0A 2KMWA 3H56A 2B8OT 1FFNB 3SIKA 1CU4H 4K23H 5ES4B 4XMXA 2JXMB 3F58H 4KO7A 1DQKA 4LL9A 4F8LA 2FX7L 4LSRH 1FNEA 1IGIL 3DGGA 4M29A 1KTJA 5E99H 1ZTXL 3A3YB 3CXDH 1YNTA 1J05A 4Z0BL 1G0DA 4KMQA 1WZKA 2BSEA 3P30H 4L3EB 2QKIA 4ZUUB 2YLKA 1F3DH 1PJWA 3AU0A 1B88A 1LJMA 1ZRUA 2WWKO 4XPBL 3K4DA 1L9NA 1XCTA 3K0YA 2WXFA 1M6OB 1P5VA 1T1XB 1P53A 4R83A 1BD2D 4U4BA 5GISL 4JFYA 4S11A 4NO5A 3VU2A 4K3EH 1WIUA 5L4JA 3JWOL 5DLMH 5D4QA 1RXLA 3IWUA 2VDOB 1NINA 2P8PB 4X0KA 1G9HA 5AUMB 4JN2A 2XKSA 4ZAKD 4FA8A 1TF4A 4RGMC 3HS0A 1W80A 3ZYIA 1OGTB 1BEYH 3NJVA 4KJWC 4NO0A 1TLKA 5FUOH 2IH3A 3VXUD 1KGCE 5I66A 2XN9A 2HZHA 2PETA 3HTLX 5ACLA 5CP7B 4W68A 3KPRB 1IAKB 4GKZA 2XA8H 3OJDA 5CGMA 2YSSB 1H8OA 5F96L 3VXMA 4O51B 3TN0D 2IV9A 1J86A 1MRFH 2ITEA 5GS0H 1MQ8A 43CAA 1EBPA 5CZXD 3M88A 3WY4A 3PE9A 1PD1A 5E00B 4RGMB 3GEWB 1UWYA 4LNRA 4BQ6A 4L5FL 2VLJB 1EVTC 4TPRL 2P5EE 1HNFA 2QGCA 2P5WE 3GSWB 1I1RA 3H9SA 3QJSB 4HK0A 4RGOH 4L9LC 4X6EA 5ICXB 5JMOC 4KKBC 2YPVL 1AD9A 1OOAA 4DGWC 4X6DE 5CSZA 2IANE 1AYRA 4KJPD 3T3PE 4A2FA 4EIZC 1CICD 4W9LC 3GRGA 5H37G 4BXVA 1HHIA 1U3YA 3C2AL 3LPPA 4MWFA 1TEFA 3BSZH 1JPSL 1QSEB 2HKFH 3MRLA 5DT1L 4WFHE 5FGCE 1BVNP 2ZZUT 4UNIA 2B2XH 1KYAA 1ZK9A 5DRWA 3VSQA 3BN9C 2CM6A 1K3IA 1AQDA 4JFZH 1FRGL 1RZ8B 4DKAA 3BGAA 1CLVA 4PFEA 5EB9A 2ITDA 1NUNB 3ARBD 3D85A 1KCRL 3RX7A 2A77L 4FHKA 3UBXB 2VT0A 1ESOA 2BSDA 4O58L 1GS7A 3V6OA 2Q20A 1BFOA 3L54A 4JRYA 2RQ8A 3A6BL 4JG9A 3N41B 3ZQXA 2QSTA 1WZLA 4IBVA 4K8RC 4CGTA 3THML 5DURD 2B20A 1SXZA 3NFSL 3MCLH 3K71B 1F00I 2AQRA 1ZA6A 3I3BA 1GZHA 2A73A 5G4NA 3FRPG 1LO2H 1SN5A 3NAAL 4KQ0A 2LAAA 4JFHD 2P7TA 1A9VA 1E9OB 3THMH 2AEOA 1NL0L 3NIFE 3GSUB 2JJVA 3S35H 1IJNA 1TYEB 2VXUH 4HQQL 5HGBA 4BSWB 1FZKB 2CH8A 1YQVL 4JM4L 2OK0H 1TT6A 1USQA 3D39B 1WFOA 2P45B 3B37A 3WYRA 3DO7A 4HG4K 4B0MB 3VXRD 4GSRA 1A6PA 2F58L 2UX6A 4NKDA 3OL2A 4NWUH 1TCMA 2QQKL 4YDIH 2IWGA 3PWJA 4KXAA 3Q48A 4F8TA 5D7LD 2CKBH 2FD6H 4OF7A 3ESNA 1WIOA 4RWYL 1KDIA 3CIAA 1Q9WB 5EN3A 1ILSA 3TBYA 1W72H 3I9GH 5HDOA 2DYPB 1GZQA 5DWUL 4YSUA 4NOBA 3IGKA 2AERT 3UPCA 3G6JE 1U95B 3E2HC 1UB5A 1YLBB 3N85L 3N04A 1NJ9B 2BHFA 3EFDL 1AKJA 2HYMA 3VVWA 1DVXA 3MRIB 1A7BA 3NCJL 3QCUL 5IMKB 4BFIB 4ODVL 3GD1C 4ZUVB 2O5ZL 4FLQA 1JGEB 3P3SA 2LLNA 4NO2A 5A6LA 5IVXB 4ZMTA 1N4XH 4PV8B 4HIXH 3US9A 1SDDB 2DLFL 3OJDB 1S2EA 3B5HA 3H0TB 4DPAX 2OSYA 2FB4L 1O7DE 4WGVB 3CQPA 4U4IA 4F5CA 1U3NA 1HXKA 4RNRB 4HC1H 1A02N 2NUPB 4G6AC 5JXED 5MEPA 1DQDL 1TLMA 1AZNA 5KWYC 4TXVB 5CBAA 1INDH 3GMPA 4PWJA 5C6TL 1MLBB 4NZ8A 2V5MA 5CN1A 4IJTA 2B0SL 3L3IB 4LP8A 5EUKB 5CCKH 3VXRA 5FIEA 2VWEE 4KKLD 1BVKB 3CVHH 3DVIA 1QBAA 3C08H 3SE9L 3HE7C 4OJEH 1TKWA 4DO6A 4AIEA 1PSKL 4UZSA 2A77H 3QUHA 2CLVA 4I9WD 5MEND 2NY0B 2BWIA 4Z76A 5T5FH 3SSGA 2GJ6E 2X53A 5DCCA 5T1LD 1J05B 2APBA 4GI8A 1YEDA 1BD2A 3HC4H 4H44C 5H94A 2DJMA 5EC1A 3RVTD 3LX9A 4MJHA 4RAUA 1AQMA 5SX5K 5T8IA 4AJ0A 3TZVA 1A4BA 1BAFL 1AMXA 2R29L 1K8DA 5I1CL 1P5VB 2YKKA 5F8QC 3RY6C 4B60A 1X7SA 4LQFH 2BNUB 4RDQF 2ICES 5F97E 3GHBL 4KROC 2NR6A 4LPWA 2K6WA 4EN2A 3KG5A 1NGPL 2AMUA 4YFDB 3X12B 5ABZA 1S4IA 1I1AA 4RAVB 2JE8A 1D5IL 4CKQA 4PRBB 1UZGA 5C70A 1GC1L 1IGYB 3VX0A 2AEPH 3VI3A 3FQ2A 2IC2A 1IBHA 1AYOA 4MJIB 2YAHA 4ZFOB 1NIDA 3WNKA 2PXYA 2A9NL 2W5PA 5GXBB 1XEDA 1JPEA 4WWID 3BIAX 2NXZC 4LKCB 4DKFH 3X3GL 3RIAF 5LQBL 2Q86A 5DFVC 3DSFH 3UGXA 1IAKA 4RMVA 3HA0A 4CN6A 4Y4KD 2E4FA 4K3DL 1X5MA 3FQYA 3ZT7A 1V3JA 3DUSB 3QUGA 5D7LB 1A1NB 4M03A 4DFIA 3WJMB 2WINA 4Y4HA 4WHTB 4KZDH 2IH1A 4XVTH 3TEYA 3U2JA 3LXCA 3UIYA 3O3AA 3EFFB 4TTDD 3BAIA 1HEJC 1L9SA 2P8LB 3WS3B 5HDQH 2Y36L 2AMGA 4KI5C 5F44A 1ZS2A 4MZ3A 5CSZB 4W81A 2OJEB 35C8H 3S97C 1NC4A 4PP2B 4XPFH 3T2OA 1FV1B 4JAMB 4QNPF 2X9ZA 5DUMH 1K5WA 1SOKA 4HFWA 4P9MH 3MNMA 2XZCL 5CGTA 4RGND 4WO4D 1OE2A 2YFOA 2D3VA 4H8WL 1AIZA 3IDIA 1J88A 1O6SA 2OSWA 4W9IC 1IAMA 2YD2A 2Z35A 1OQXA 5MP6H 5I73C 4NQCB 1I1YB 1QFWM 1ZVNA 2BIMA 2CQVA 3PAVA 2DD8H 4WEEA 4ANWA 1SBSL 4X98B 2XWZA 4NC0B 1TJGH 1Z32X 3IVKB 3WJLA 3UTSA 2Q9OA 3MRPA 3MLUH 4GSQA 4KTEH 3LD8C 1A4JA 3TBSA 5AZEH 3WO4C 2CIIB 3KLDA 4O2EA 3CSPA 2FT6A 2XKNA 3QRLA 5C0IA 4Z7OF 1AC0A 4PIRF 4RISH 3KR3L 1MZZA 1W2KT 2WYTA 3G5XB 3GM0A 4NM8H 4S1DD 1OP5K 3QIWC 4U31A 2Z31D 3IFPB 2OULB 3UO8B 2PTUA 3CVIH 2C4XA 3QUXD 5JDSB 4CMMA 1MFBL 3HE6B 5BXFA 4P2RD 3VD9A 2BPBA 2WHVA 2K6ZA 1PZ3A 2WOBA 3ATAA 1MSPA 3ISWA 4NZJA 3C2SA 5HYSA 1EK3A 1RUQH 3CH8A 5HYJE 1RZGB 2VLJD 3BZDA 5KYXB 4OZ4A 1V3LA 1ND0B 3RPBA 4TVPE 1BZ8A 3B9KC 4ZO8A 1T03L 2R4RL 4DK6A 43C9B 4BA8A 5DR5L 3T3MB 4QHKI 4ANKA 2IDCA 1RHHB 4ADGA 4UQ2B 3BVVA 3VXRE 3ULUF 2YEVB 3AXLB 3GMNB 4UT6H 3FNKA 3N43F 3L17A 4NQVB 4CVZB 5JO5B 4JFDE 5D7LE 3FU7A 4LSTH 3V5DB 1S7SA 1P1VA 1IGFL 1G7LB 1NUGA 1OZTG 3NQIA 5MERA 2CRMA 4OVVA 1QO3A 4UI2A 3WFCL 3VNYA 4U1NB 1LTXA 5CSBA 2C1OB 4Y2DD 3QARA 3CN2A 3K72B 5AKRA 5IHLB 4GIOA 1BXAA 1NCDH 2ZOTA 4JM4H 2OK0L 1VACA 3QUYA 2DQUH 4KDWA 2ZYHA 3DRTA 3RP1A 2CA4A 2CDFA 2PYFA 1UA6H 2WZPA 1D5MA 1J9SA 5C0RH 1HDMA 1IQWL 4QOKE 4WJG3 4X7EC 3UBXI 1UEMA 4YMPA 4PJDE 4D0DA 1XR9A 4PWHA 2ZJSL 4TSBL 4ERSH 3HUJF 4KK8D 1B2WL 1KBGH 2WUCL 1HK6A 4N28A 2F5BH 2UWEF 1MCBA 2G5UA 2WXHA 3E0GA 3V6OE 2CKBB 1HNYA 1MXGA 3QNXB 1MFAH 4R7NA 4WW2C 4G3YL 1I7ZB 2MWCA 3E3QE 2EIBA 3TN0B 3U79A 2WV3A 2Q10A 1A6AA 4N0UE 3QIWA 5F72S 5J7CC 4K94H 3MROA 4PY8J 5HJ3B 4JHAH 4DTGL 3G9AB 5IB2A 3FU0A 4EE2A 5D1QA 4UTAH 4WSKA 3QYCA 3HVNA 2PO6D 3MLXH 4OI9A 1UXWA 2MIZA 4GMSL 2R56H 4BE5A 2R69H 1HYSC 4MD0A 4KNQA 2CNYA 1YEDB 1L0XA 4YWGH 3VFTA 1PG7H 4NAMA 5CWSB 5IROD 4JFHE 3EGSB 1IC5H 3VE0A 5I0ZA 2LTQC 4ZOEA 5DLLA 3AADB 1JPGA 1ORQB 1RY7B 3IU4H 3PDOA 4KFZC 2OL3H 4GO9A 1BBJA 4LBEA 4I1PA 3O0RL 1PZUB 4MQ7B 3P02A 5C0JA 1TEGA 5CZRA 4WI9A 4NQEB 3ECBA 5K1JA 5D8JH 5KOVC 2J88L 3IS0X 4UTAL 3F7VB 3KEHA 5EBGA 4TSAL 3P4MB 4TULH 1CR9H 2DQHH 1R3JA 2ODHA 4G8FA 4OZFB 2YOCA 3HE6D 4DAGL 3FT1A 4V1DA 2CJTA 2FJSA 4LLUA 1GIGH 2ID5A 4A7TA 2NW2B 1YECH 1C1EH 2TAAA 5GGSY 3K7UA 1DBBH 4EJ1C 4MJJA 4A2MA 2WWKT 5TPWL 4HMDA 5DD1H 4AV0A 1ZK5A 2OR9H 4GAAA 1I4FA 2XU9A 4JMNA 1RJYB 5GHWL 2F5BL 1HAWA 1CL7I 2Q8AL 3OMZA 5J6SA 4ODTH 3UO1H 3NA9L 2A4EA 2GHWB 3DXAE 2E47A 2HT4C 4FA6A 3TO4B 3D0LA 3EH5B 3V7MA 2NOYA 3QJRB 5IIEB 1ITCA 3RKDD 1I1FB 5EO1B 1DFBL 1E4HA 3FH5A 4KNUA 1A64A 1E50A 1N9PA 2XA3A 5HY9A 1XCWA 1SOXA 2LV4A 3DUUB 3KYMB 3C5ZC 2O4EA 1KY6A 1RSYA 4HU8A 3ALWA 1Q94A 2ROYA 4PLKC 1OCOB 2JQZA 2NZ9D 5IVXA 2OMUB 5DJ6B 1QO3B 1S5HA 3PNWB 4F91B 1VFMA 5INDB 4NQTA 4QCIB 4ONFL 1MQKH 3ARFC 2O6FA 5BS0B 2OMXB 5BQ7B 3D0VB 1BVLA 4FNPA 4RFNB 6FABH 3UAEA 4OLYH 2A0LD 5F1IB 3U9PL 4ES8A 3BKCL 1QR4A 4EOWH 4DH2A 4DW2L 1QSFA 1LYQA 5A43C 3PWNA 1CYGA 1E5CA 4LKXB 3CN3A 4YL4A 1FYTD 1RULL 5DJYB 1U30A 1XXFC 4JDVB 1ZLWK 4NBXB 5HHQB 2WXKA 4XCEA 2VR8A 1RIUH 1DHKA 3HC0B 4AC4A 4J3OF 1N6QL 3W5MA 1E90A 2V2XA 4GO6B 3NSJA 4YVNA 3FUNA 5IW1A 4P59H 4KI5D 1KXQE 2OA9A 2W94A 4FAAB 3IJSB 1XH0A 2EXSA 4X6CA 1OB1B 4MZIA 4XPTH 4LARL 5B1JC 2H32B 3OR7B 2A38A 4R0LC 3UPAA 1M57B 4XCYB 2AXJA 4AYFA 3MU3A 1OCZB 2FWOB 1FN4A 4UT9A 1ZLSH 4GEJA 4JB9H 3MSPA 2X2JA 1GPOH 1B0IA 5ILTL 3BH9A 2OZ4L 3Q6GH 4XC3H 3RVVD 3SDAA 2QSVA 1HCZA 4OZGF 1SY6H 4E5XB 1Q9LA 4UIMB 1XTMA 2X4SA 3OTTA 5GGTH 5JNYA 5CO1A 2FGZA 3NCCB 2VSDA 4NKIH 1QSVA 1G9MH 1XQ4A 4HOMA 2ZKHL 4JN2B 2DMKA 4TVPD 4APQB 3MBXL 4GP8B 4FJZA 2P46B 3EF7A 2XJLA 3EFOA 1FVEA 1QATA 4IBSA 5D1ZC 3W0WE 5EBWB 4HJEA 1WC7B 1B4TA 1QQDB 2JNZA 2VN3A 3IDJB 2OL3L 4JL1A 2MFNA 1FZMB 3ZO0A 3MVSA 3DK0A 2BO0A 3W0WB 1BYNA 3MFFA 1RIHH 3IM1A 4JFDD 3NCMA 4N8CL 3CC5B 4NZUH 4H8WC 4NFDA 4F33A 2HKFL 4UUJB 4JVUA 3JWNG 3DO7B 1OAJA 5CCHE 1HSAB 3IPEA 2CO3A 5D55A 3QAQA 4WW2F 3G3LA 1H8NA 1EVUA 4HXAH 4HZLB 1PQZA 1FZJB 1KCSH 2RTTA 2X9XA 3X3FL 4L8BB 2WXRA 1UKQA 2E7HA 3D50A 1CN4A 4N1CA 4KZDL 4YXHL 3I2CL 1H0DB 3IJYA 3IDMB 3QHTC 5T3XH 5GZOC 1BQHG 2VDKB 4A7SA 2C9XA 2VRQA 4D9LL 4JFEB 5CLWA 1DZBA 4PRHB 2YPKB 3T3PF 2IG2H 4N2KA 4POZD 1IM3A 1SXNA 1JNHB 2AJ3B 3E6HB 3I6SA 5D9SA 4NENB 4NFBA 4QRFA 2WLIA 3BPNC 1G84A 1P84J 1S46A 1Q8MA 4YDMA 4WSJA 4BFIA 5I18H 3RURA 3NJKA 2XZQH 1E7VA 1JGEA 1TG8A 3B9KB 2NYKA 1U3JA 2Y24A 32C2B 1QW8A 3BQUA 5JOPE 3SOTA 4DEPB 5IQ7L 1J11A 3EOAB 5HHVL 1G7MA 4YBHA 3B9DA 3MUUA 4PV9A 4PLJD 4RX4A 4JRYB 4HJGA 3WENA 1DEEA 1CLYL 4HPHA 5HHPA 3X2QB 2YKLL 1QRND 2XSKA 3G6DL 4HPYH 4MDIA 1WFUA 1FNEB 3DA0A 3MUY1 2Q2LA 3F12B 3AGVA 1NMBH 3D3VD 3MPCA 3PL6B 3BMVA 1DE4B 2Q7YA 4N26A 4WO4B 2R23A 4HUUB 4XPHH 1QR1B 2VC2B 2IAMC 4M9OA 4HOZA 2E7BA 4IRSB 2BY1A 4ZYKA 2HKHL 5FYJD 4KXDA 4XX5A 3GEFA 1DBML 3ABZA 4ZOAA 3OWEA 3H3PH 1EO7A 3RGVC 5LWYL 1U2YA 5TE4L 4DP2X 5IJKA 1A1NA 3MRDB 2X1QA 3ZE2E 2AJSL 1J1XL 2DQFA 2ZOKA 4R26L 4J12A 1YNLH 2XTLA 4FQHA 3AXHA 3BT2L 1T6WA 1HQRB 4IBWA 5J13C 4NQED 5SX5H 3BH8B 1OAXH 2VQ1B 4JPIB 4OFYA 4XP5H 3TO2B 3WUWB 1JK9B 4J3TA 2VL5A 4UT9H 4G80B 4HJIA 5DFTA 4BWWA 1AGFA 1P5UA 3C6LC 3QUZC 5EO0B 1A2YA 1TQBB 2UZYA 3EJPA 3KPOB 3PWUB 4YS4A 5IB4B 3VXMB 1SVCP 1GCYA 4PRBA 4N85A 1EAPA 5GGUB 1ONQA 3D4GA 1DSFH 4HS6A 3WO4B 3DX7A 3VFPA 1QFHA 1QQDA 3O2DH 2ADJA 1P7HL 5ANME 4XMTA 3V4VL 1KCBA 2B1AL 3F7LA 2ZP0T 1OW0C 2AVGA 3BZ5A 4BKTC 1S7UA 3CFBB 1VEPA 4FYTA 1OP3K 3VI4A 4ZPVB 1G5AA 3QUMH 5DJZA 3FQRB 4W70A 4C4KO 4K4KA 5IWLA 4JDEB 4UUJA 5E2JA 2BOBB 4ZNEA 4I48B 3LZFL 3OKKB 2VITB 4KV5F 3F01A 4PY7B 2NXZB 2UZXA 4KHXH 2MQCA 5CBAB 1E8XA 2YD1A 1Y0LB 3GNMH 4JHZA 1M53A 2XX0A 1NGZA 5EFIA 4CC0A 2GITB 2WJ5A 2V2WA 2XZQL 1FL6A 3IDMA 4YAQA 3QZBA 2BS8A 1AC6A 4M8QB 4CAGA 1TZHB 3IFNH 3I3EA 4N0YH 2PO6C 3W9DB 5IUSA 4JQIA 4KMTH 4J4PA 4AJVA 4ELME 2BHYA 1CE6B 4O4YH 4JX0A 1YNKL 5CLXA 2PP8A 4B27A 3RWHA 3T2QA 4EXKA 5KBKA 1KACB 3WE6A 4NN6B 1BLIA 1FIEA 3GTNA 4N2LA 3DXAD 2K7PA 3GRWA 4GLRI 4BUHA 1IAIL 4ELMB 5D93B 4R4NC 2E4TA 5I30H 3D51A 1YCSA 3HRZA 4QHLB 5DD3L 5IEKB 3MZGB 4FMKA 1GJWA 3C60C 3L3DB 1BJ1J 2WUBH 1IL1A 5B1CA 3QFDA 3PPSA 4Z7IA 1LWRA 3P0VH 3ME0A 2GBVA 3F62A 3I75A 4U1JB 1KPRB 2NY6B 3MRKB 3V6FB 3IJ9A 1LO3L 1UATA 4L4VD 5A2FA 2H0EA 3DO3A 4XO8A 5J12B 1JN6A 3GS7A 4HK3N 5LCVH 1KXTA 4R7XA 1XBDA 4L3ED 2QHRL 4E5XG 4FFYL 5JPMB 2EC8A 4JUTA 1SN2A 1OP5H 3VSUA 1GR7A 1RMFH 2VMFA 4NQDB 4Q89A 1FZMA 1Z3GL 3EJYC 3KLSA 5JQ6H 1XF2A 3H9HB 4AGQA 5C09B 3ZDZE 4WU5A 3HNTL 5C0CD 1Q1PA 4IOIB 3P3UA 1KPUB 1AD0A 5C0ND 5J6HB 4WW1B 4Y19B 3ES6B 2CJUH 4P3DA 4I77L 3IPFA 1A47A 5BOJA 3DUSA 4APQD 1RFDH 3FF7A 2DYPA 4I8DA 2R2BB 2VAJA 3X17A 2JCWA 5AW2B 2AEQH 2HMID 4OV5B 4MXVF 2NY4C 2E7LC 1S7XA 3IMRA 4FQHB 2V17L 1EGJA 2X4RA 1ZHNB 2DLEA 4L8BA 3VXQA 4OCSL 1C5BH 3T1WA 2ARJB 2HVKA 2CK0L 2HJFA 3SHSA 2MQ0A 2F5AL 4JZJC 4QAMB 2VDPL 1XH3A 2WQRA 1ZT1A 4Z7QE 5EUOB 3QH3B 4RFOH 4UM8A 4EN3B 2GC4C 1ED3B 2PYEB 3MAWA 4MNHB 4XB8A 2RHEA 3P4NB 4HKBB 3S36L 2EEAA 1BPVA 3B5GA 3OKNA 4JDTL 5BQ7A 5E8OB 2WP3O 3DTDA 4AEIL 1TYJA 1VPOL 1NCDL 1O7VA 1RULH 4V33A 3ZDYB 2CO7B 3KDMA 2FYYB 2QPEB 3MRPB 1U33A 1FFOB 3EBGA 4FTDA 1N18A 1T4KB 3TZVC 1QMUA 2YXVA 5SWSB 5T3ZE 5FGRA 4A7UA 3CG8A 3VXSD 1J8KA 3NDZE 5D1QC 2Y07L 3LSOA 3APDA 5AAPA 3LPFA 1NPUA 5FYKU 3QXVA 1I9JH 4OJFL 2YRPA 4CVXA 3MV8B 3HBGA 5T3XE 3REWB 1W0WA 1X5ZA 5FAAA 3ARGB 1VF5C 3NMEA 2G2RB 1A7RH 4TUKL 3O6ML 4OSUL 3PGCA 2CCWA 1OF2A 2ZD0A 2IPTL 3EUUA 4K55A 5HJ3A 4KH9A 1IGIH 1DJHA 1MCQA 5HGAA 3ILPA 1J1OL 3KPLA 4JO1L 5HYSB 1Z5LA 2F1EA 5D2NC 4XC1L 4Z7UA 2YAQA 2Q76A 1VFBB 4AQ8A 3WKYA 1EA9C 1JGDB 1X4XA 4U1SB 2Q5BA 4FZ8L 5HI3C 1MWAB 3SYAA 1NFDE 2DIEA 5HYFA 1CPUA 4D0CA 4G8GB 2VC2L 2WLKA 3NSFA 4QRSB 2K7QA 2JTYA 5IB3A 5C07A 5JUEH 2VKXA 3SGEH 3BPCB 3K6NA 3FTGB 1Z66A 2DQIH 4F93B 3TNMB 4ANUA 1VZIA 3C5SB 5LJYH 3GYRA 1KCUH 3QYMA 1N26A 1MCNA 1KWGA 3MCLL 3PGDB 2Y69B 5CZKA 5CS7A 3KPOA 1IKFL 1U8IA 3BI9X 4C56A 1C5BL 2X12A 3LYRA 2DQEH 3FO0H 1QG3A 2LGNA 2GAZB 3FOMA 1NGYA 1NAML 1JDCA 3HE7B 3K5RA 1NFDA 1FNSH 2AI0L 2CWRA 1HHJA 3MRFA 5HD8D 5MEPB 1EEYB 3RWDA 5I6OA 1VEMA 2NY1D 1A7RL 4TUKH 1FRGH 1BFVL 2VUOA 3IU4L 5T5FA 1S7QA 4E9LA 5FPIA 3OXRA 1L7TH 4F1ZA 4BGDA 3VFUB 3IU3B 3CHOA 1Q0XH 5D7EA 3OM3B 4XOEA 4UILH 1AO7E 1XGPA 3NCYS 3D0LB 2WQWA 2WYZA 5LKNA 4YGVA 2AQTA 2XNAA 4YZFF 1UD2A 1UKTA 4JAMA 4YEEA 5KVFH 4A2GA 3ARQA 3U7YL 2ENJA 3NZ8B 3A5VA 3VG0L 1CK0L 1U8PA 4NWUL 4H0LC 4N2BA 4N5EC 3VFVA 2BH0A 4QWWC 1SMDA 4QOKB 1FGNL 2AAAA 1FNSL 2AI0H 4HKJB 5DRNA 3ZVVA 4QR7A 3BIKA 5C2BH 3M46A 1MCDA 2WMPB 1DJSA 3NCFB 2VKWA 4HWNA 4KKQA 4AMXA 1U93B 1NAKH 2GKIA 4ILDA 5IB2B 1DJIA 5ISZB 4ALAC 5DEFB 3CLWA 4NQCE 2GW5A 3BZ4A 3ORJA 2FL5A 4BZ2H 2HFEA 5BQDA 4Z7UE 1KFGA 1JG9A 2JLLA 1HYRC 2ZJSH 3O4LD 4PI2A 5EOCL 2WYIA 4HALA 4IRZL 1ROWA 5JPNB 3FS9A 4NSKB 4OZIA 3L1GA 1KN4H 3VXPA 2VW4A 3T2LA 1KTCA 2JELH 4MXWH 2A9NH 3U0WH 1KYUA 4OD3L 4IKJA 2BIQA 2ZG1A 5B8CB 1IGML 2PXYB 3R1GH 4F2MA 4PJDA 2EUVA 3T65B 2AKRA 1RUAH 4AUYA 4H20H 3P0YL 4XBPA 1S9VA 5I75B 1CFBA 4MJ6B 1FVDA 2EIMB 1ZHKA 3QEQD 5CJBA 2Q8BH 4AQEA 4XBGA 2YQ2A 5BW7C 3H3PL 2DJUA 4G2AA 2B3IA 4G8FB 4GFXA 4YDLC 1UCBL 1RK0A 3ULUH 1BQHB 1ERNA 5DSCA 5F9DC 4QO1B 4NQEE 1N67A 5HHOB 2DWTA 1U2HA 4IRZA 4KMLB 3WEBA 3T3ME 5I1KL 5LNGA 2IGFH 3AQDA 4PJ5E 4U3HA 2XVLA 3SDDA 3B2DC 2IAMA 3SODB 3N91A 3L2LA 3MLSH 3RFZB 1UENA 3VD7A 5K5YA 4JO3H 3GXPA 1WUZA 5T1DH 1L3NA 3VGDA 1NCWL 4KJWD 3MA7B 5A3IC 2YKLH 1NEUA 4X5LA 4BFGA 1OPGH 1AGFB 1C08B 1CG9B 1V8HA 4P4KC 2BVOA 3BPCA 4MZ2A 4UDTB 3VGFA 4YIQB 3SDCD 4ZS7L 2D2OA 4G5AA 2P48B 2D03L 5CGYD 3V52L 1OSPL 3UL4A 3VFPB 4JANA 3JT2A 5JIIA 4Y4KB 3O2WL 4W4OA 4U7KA 3GBML 1CVRA 3ARGC 3OKMA 5BVJA 4MCZA 2OZNA 1JZGA 3MV7D 3SCMC 3G7TA 4UT7L 1HDMB 4OD1H 1JZ5A 2ZUUA 5IQLA 4HIXL 4AQOA 1HS6A 1VKXB 4WI6A 4O2EB 4XE0A 5DZ9A 4X42A 4QY8B 1TQWA 4I18A 5D2NB 2XN9D 3QXDA 3TP4A 2E8ZA 2FO8A 3QI9A 5AWNL 4YHKH 1KCKA 1JFQL 1T66C 2Z91A 4N1HB 4M9PA 1NOFA 3APCA 5E2TL 2PWHA 5LGKA 1VADB 3X14A 4GXUM 5EWIL 5F3HA 2IH8A 4CADB 2O6CA 2R29H 5D7JC 2FH6A 4NP9A 1OAQH 4HBCH 5D6DA 3N41F 3HC0A 3DJRA 1S5IH 5KANI 1KIRA 1FL6B 2E7LA 3ELQA 4WWOA 1MRDL 3CWGA 1S9XB 4FG6D 3ENEA 3ECVA 1RUPH 3IJSA 1N8OE 5IQ9A 1JHLL 1DCLA 5D1QB 2F8IA 4