2QVMA

The second ca2+-binding domain of the na+-ca2+ exchanger is essential for regulation: crystal structures and mutational analysis
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
185
structure length
116
Chain Sequence
HAGIFTFEEPVTHVSESIGIMEVKVLRTSGARGNVIVPYKTIEGTARGGGEDFEDTCGELEFQNDEIVKTISVKVIDDEEYEKNKTFFLEIGEPRLVGRPILGEHTKLEVIIEESY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords Sodium/calcium exchanger 1
publication title The second Ca2+-binding domain of the Na+ Ca2+ exchanger is essential for regulation: crystal structures and mutational analysis
pubmed doi rcsb
source organism Canis lupus familiaris
total genus 30
structure length 116
sequence length 185
ec nomenclature
pdb deposition date 2007-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2030 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2qvmA00
3E9TA 3E9UA 3US9A 2KLTA 3RB7A 3GINA 2DPKA 3EADA 2LT9A 3FQ4A 2QVMA 3FSOA 2FWSA 2QVKA 2KLSA 3H6AA 3RB5A 2FWUA
chains in the Genus database with same CATH superfamily
1GGYA 1WSST 1YYLH 4J5VA 4OCXH 5L2KD 4KV5E 2BSBA 2N1TE 4OLUH 3SQRA 1QVOA 1G4MA 4QHNA 1JN6A 5FA3A 4BKLB 3D0LA 2P5EB 2CCLA 2WP3O 4BK8A 5L88L 3K8MA 2J1WA 4DTGH 5GS0D 3FRUB 3T6WA 4CMHB 2R2BA 4YDVB 4U1KA 1OTTC 5D96B 3VXPA 5I6LA 4FP8H 4LSUL 3TC9A 2FBJL 2JCCE 2JK5A 4D3CL 3FTXA 4X7CC 3CLWA 3OGOE 3CQPA 2GJ6E 4ZXBA 2XQ0A 4J39A 5FO7B 1RIHH 2HLFD 4UU9B 3UG4A 3Q6GL 2ADGA 2SODB 5ILTH 4GRMA 2O5ZL 1E42A 3BH4A 4HHAA 3US9A 5AG8A 12E8H 4JN1L 5AZEH 2ICWA 4AQ8A 1AXTL 3DDGA 4P46A 4Y9EA 3CVIH 4JO5A 5AVRB 2WYTA 4F2MA 4LGPB 4TTDC 1IGFL 4ALAC 4OLEA 5KBKA 3AXLA 1T03L 5EUOE 3VH8B 3O4OB 5JHDD 3PPEA 5ENWA 1U8PA 3OAUH 4MMZC 1KYAA 5IESH 2C26A 5T3ZE 2OMXB 3FQRB 3NGBC 5GS1A 3MRRA 2VERN 3QIWC 3UYRL 3QK0A 1KXQA 4YE4H 1EAQA 4PRPE 5DI8B 4F3FB 1XH1A 5C8JA 4KZEH 1XSOA 3NCBB 2DQCL 2VDQL 4DSYA 1P4LA 5CD5C 4KH9A 2K3TA 1Y0LB 4N22A 4PY8I 5D2LF 4OF5A 4J4PA 2MOVA 4KJYB 3WDJA 2IXQB 3D8MA 3VVWA 4GXVH 4XVUD 5D7IB 3QHZL 1VPOL 1NAMB 5I19L 1O6SA 1DJGA 2C9VA 3G6JF 3QNFA 2HKFH 1JRHL 1CLYL 1G7PB 4DGYH 4YHYB 3ULVH 2EYRB 1NANI 4JO4L 4XPTH 1C16A 4PGDB 2DQEH 1LWJA 4J3XA 3U9UB 3UOAB 3U6RA 2X4TA 2BPBA 3GMQA 4D8OA 4MFHA 4OCYL 3LJ3A 5HY9A 4BSVB 3FK3A 4O2EA 3MUHL 4XVTL 3QQ4B 3FSVA 4YDMA 2AEQL 3CFEB 4WEMB 2J5LB 5CHNA 4ZTPL 4M6OH 3RTQD 3GSNH 2X89A 3N1GC 4U1MA 2BHUA 3PHQB 2M83A 3DTUB 4HWZA 1BZDA 3RKPA 1SVCP 3MCKB 4NQCB 5DWUL 5FS5A 4BK5C 3GMMB 2CPUA 3L3KA 2Y36H 3LQZA 4FFYH 4N2HA 1IM3B 3AS0A 2YD4A 3GSXA 3R4RA 5FHBL 3ZYZA 4F8TA 3BZFB 4LMQE 2HLAB 3V7MA 4X9YA 1N7ML 3VXMB 2A74A 4FA8A 4MNGA 3U7YL 5JA8B 5D7KE 1KELL 3SY0A 4OUOA 1K6QL 1TZAA 3H3PL 1J9SA 2AABH 1FZOB 3MRKA 4PREA 4LF3B 1DO6A 3VRJB 1I7UB 2QKIB 1KB5B 3TNNB 4NUPA 5H94B 3DETC 1AAJA 3E6HB 3GXUB 4W68A 5DZJA 4P4KC 1ET5A 3VJ6B 3MJGX 3WKNA 1OT2A 4UNTA 2HT2D 3CVBA 3Q6FA 5CO1A 3AADB 5FDYA 4Y4FB 1KJ2L 5EZOL 1AGEA 4P57A 4PV9B 3KLDA 3ILPA 3L3HB 4E5XA 2H6OA 2RAMA 3FCSA 4ZO9A 4KXZI 1GY1A 4ZUSB 1VESA 3NFSH 4NM4H 2FQGA 3EOAB 3ZDXE 2FVNA 4C56E 1HVXA 4LSVH 4MZRA 5ANME 5I1AB 2V17L 3C9NB 1L0PA 5LBSA 1UB6A 1UXWB 3SBPA 3BPLB 1HWGB 1IFRA 4NP4H 4Z7VE 3DO7B 3VTAA 3IVKB 1BEYL 5E03A 3NJNA 3BE1L 4LBAA 1F97A 3FU7A 2JJVA 3OX8A 1ES0B 5TD4A 4WAFA 5B8CB 5LB1A 4KXBA 4OJDH 1KIPB 2RHEA 2GY5A 1TJHL 3S96A 1GCFA 3ZE1F 4XCEB 3O11A 4KUCF 3LKPA 2D7OA 4OZGE 5EU7C 1EIBA 2O5XL 4GKZB 4DP5X 5E9NA 1G0DA 4MYPA 1QTSA 3TEWA 3BDYL 3EDFA 2NR6D 3W9EB 3MTRA 2PPAA 4UF7C 1HEJC 3P11H 3JYCA 3IDXH 4KDWA 3L5WA 1EHKB 1XR9B 2FEDC 1AQHA 3D9AL 2H1PH 5D55A 5DUPL 3DK0A 2D73A 5B1KA 4N2AA 2A6JA 2B4CL 5FFGA 1FRGL 3S4SG 1KN2L 3NDYE 2AVFA 4KVCH 3RDTB 1U93A 3NSFA 4UOQA 2X3CA 3QDMB 5BRPA 2VN3A 3VQ2C 5KG9A 1OVZA 1QFUH 3S0PA 4OM1L 3UZQA 1YNTF 1ASPA 2A99A 3CU1A 3L5JA 2ZX6A 5HHPB 3FO1B 4LLQB 2IFFL 3Q2NA 3C5XA 2VDNH 2FH8A 4GAYB 2QQKH 5F7EH 2BS71 3DRTB 1T7VA 5C6TL 1FWXA 5I1HH 3JTTB 4FABH 5FLVA 3FHQA 4Y4KC 2ITDA 4HGMA 4JY6A 3RRQA 3LZFL 1RK7A 2HFEA 5DD3L 5EBWA 5MEQA 2DLEA 2G5UA 3VD9A 2R7EA 5MERB 5J1AB 4LARL 2GC7C 4CN6A 2DYSB 4QO1B 1G87A 1ZHLA 2HWZL 1KSRA 1GAFL 1N0XL 2YEZB 2XXGA 4PV8B 3T5WA 1KB9J 2C7UB 2I5YL 3GXTA 3TBSB 4NEHB 3L1GA 3ESNA 1VFOA 1DANU 3F62A 1MCPL 5IMLA 4PJGE 5DA4A 3OKKB 4DAGH 5IQ7H 4WJ5B 1HL5A 1UOVA 3MZGB 4J7RA 4Y19A 5FHAH 5E00A 4CVXA 4LPXA 3K74B 1UQSB 5JW5A 4WK4B 4ZSOA 3V0DA 5J3HD 2R8SH 3VFMA 1AGFB 5CR8A 2YQ3A 5D8JH 2IAMD 4D7BA 4JG1H 1T5XB 2DQTL 1T5KA 3FFDB 4OUUA 2HTKD 2V5MA 3RILA 3GJFH 3V6FB 1T66C 5GSRA 4NZ8A 1YEHL 5EA0L 2GTZA 4I0PC 4X4XB 4NDMB 1N64L 3N04A 3VXSE 2VR9A 4EI5C 5C0IA 5ANHA 2F9BT 2J4WH 1C08A 2VUKA 4UV7H 2DEXX 1TF4A 5AZ2L 4KI5E 3T0BA 5LLIC 3MUGA 2JJUA 1G7QB 2XBZA 3EDKA 1HL9A 3LHAA 1RUKL 2HX8A 1G6RH 2XXCB 5AYTA 1RULL 2HPOA 3FT2B 3C60A 3K2UL 1DFXA 2R0WH 4HZAA 5EC1B 3FHEA 1N70A 1YRKA 5I1JH 1J1OL 3UZVB 3MROA 3P4NA 4JKPH 5LGYA 2X1OA 2EDDA 4YHIB 5AB2A 1JUFA 4JGUA 3CHQA 2VXTH 2FL5B 4N0YH 3E2HC 4MQTB 2WWMD 1KTKE 2AF2A 4Z7QB 2X3BA 2NNCA 4ZPVB 5DJZB 3MLRL 3SGJA 3SHSA 4NRXB 4Y16A 3EW3B 1EFXA 3RFRA 1R3JA 5AUMB 4BFBD 5E4EC 1S7QA 3IEAA 4WWPA 3U1QA 3VDAA 2AQNA 2JB6A 2XNAB 3PQYB 25C8L 5I15L 2AV1B 2X4PB 4G80A 3L3DB 3SGDH 2HJLA 1I7TB 1YO4A 2NLJA 1B90A 1A0QL 3O2VL 3ARGA 5FO8A 4TUKH 5F0JB 5T1MA 3PFUA 3QXWA 2NTFB 3GDCA 1QNZL 3E3QE 3TEXA 4YUEL 1JGVL 2EH8H 5F72S 3ZQWA 3N06B 3RWIB 5DJAB 3QORC 3BQUB 3BKML 5BVPL 5K1JA 2A9NH 3MFFB 3RUGE 1CUOA 2K0RA 4PRHE 2PMZA 1FNFA 3E1ZA 3KYMB 4M8QB 4JPIB 2AS5M 1JPTL 2AAAA 1IBHA 2R2EA 2YUZA 4JANB 4KY1H 4UYQA 5I8CA 3JZYA 5JW4Q 4HK3N 2OW7A 3FH8A 4ZNEA 5DQDL 2RH0A 3VMOA 3F85A 1AGCA 4IOIB 1CFMA 3BYYA 4O5LH 1L9RA 1MVUA 1ORSB 1ZCRA 4PGZA 3UERA 2AHIA 5IF0A 1B6DA 5F7HA 4P2OD 1VJSA 3MLUH 3VFUA 32C2B 1MJJB 1VIWA 4F7MB 3ILQC 1KYUA 5CJBA 3SDXF 1N6VA 2G60L 4PY7A 3LH8A 3FN3A 2FX9L 3IU4L 3SYOA 3HC3H 1LO3H 1SXZA 3MODH 4RDBA 2OK0H 5D72H 2Y7NA 3QEQA 1NBZA 2NY1B 4AYSA 4Z7WA 1T0MB 3S7GA 5JPMC 2WKGA 3VXRA 4D7PA 1PIFA 1YUHB 3FTGB 2UXFA 2F1AA 1CICB 3EHBB 4WIQA 2L8AA 1QBLL 2JWYA 4WO4C 2WUCH 2BNRD 4TXVB 4GRLB 3T0AA 5HTSA 3S5ZA 4KKCC 1DJHA 3APCA 3MRMA 3HBPA 5JXEC 2Y2WA 4YHKH 4N8VA 2W80C 3F05A 3WYRA 3NJKA 3WFZA 4H7VA 5IHHA 1WCBB 2C1PB 2A83A 3P73A 2NX5E 2VDPL 5EIIB 3WXWH 1G9NC 3O3DA 3TZVA 2MKLC 4YN3A 2ZPKH 3K0WA 1LWRA 1RH8A 2FE0A 5C08E 3HS0A 3QCTL 1R3LB 3RGVC 4H40A 4KHXH 4DGVL 1U2CA 1ZT4B 2FO8A 3GHEL 2OR8A 3S36H 2EDKA 5D9SB 1FO0H 5DJ8B 1E30A 2WWKT 1WAAA 4XAKD 1CFVL 4H8WH 2DEWX 4AJ0A 3E1F1 1IAIL 1P5VA 5EBMA 1YEFH 1J8SA 5DHYB 5HYFA 3CG8A 4ODVH 3KJ4C 3GJEA 1WBYA 3T4AA 4ENEC 1JFQH 1MFVA 2AJYL 2HX7A 3DROA 4WENB 3NCWA 3BAIA 4O00A 1ZA3B 3CFDB 1VADB 3BAEL 5KOMC 1QMUA 5AYQA 2FWOA 3VI4A 4HIJB 5ECJE 2QPEB 4FMVA 4KUZL 2AK4E 1AJ7H 3H42L 2RGSA 4MD5A 1QI5A 4K2UL 3GXIA 1W0VA 4JL1A 2BZCA 4XHJD 4P06A 3UGXA 1MHPH 3D05A 2HT3D 4W4OC 2QZQA 2P5ED 5KBLA 1RZ8A 3GBLA 2YGOA 4I18B 4X0KA 5MENE 4BCXA 3X3GH 1CD9B 3WTYA 3DMMD 2VIRB 3R18A 5DS8A 5CLWA 3JUZA 4PGEA 5HHNA 5B39G 4K94L 4YDZA 1D2OA 3KL0A 3IFLL 3KGTA 5DS1A 4K73A 3ETBF 3TIEB 1IGCL 2WK2A 3FTZA 5DZ9A 1AHWA 2DYPD 4F8QA 2WM0A 1OD9A 2CLRA 1OAXL 3DBXA 3SQBA 4OQTH 3NIGE 1VFMA 4WKZA 4ZMQA 3PRZA 4X6DF 4WI4A 1SJMA 5I6PA 3UACA 3VCLB 5LQBH 4NPJA 5H35A 3GKWL 4NSKB 1U3JA 2AEPL 2QLYA 3BKCL 2NXZB 4YXHH 3BP4B 2DMBA 2KMWA 4XP6H 3MBEA 4NKDB 5I1KH 1N4XH 1NJ9B 2YAOA 4HSQA 4JY4B 5D1XC 5EBLB 4C54A 1JG9A 1XF5A 5EO9A 4DP7X 2MQ3A 2DD8L 3I6GA 1CGVA 2V8LA 3QYCA 1OM3H 4JFOB 2C34A 5I1GL 3UO1H 3QUYC 2WVSA 4RISL 4PYHA 1S7RB 2E27H 2NZ9C 5DCCA 3PNWB 1JK8B 4Z3TA 2IC2A 2YAFA 1J0YA 3CQFA 3VWJD 3D69B 5DT1H 2LFEA 2GAZA 1UM5H 3Q2VA 1E8XA 2ODHA 3NOIA 3BPNC 3CSTA 3FO2A 2MCPH 3ULVC 4U0RB 2ZF9A 4MJ6B 1KXVC 5IHUH 4EIBA 4P59H 4ISVB 4NZTL 4UQEA 2C8NA 3BO8B 1FSKB 3SPHA 4G70B 4N24A 1NFIA 3WNPA 4HS6A 2D7MA 3AS1A 4KNUA 1LEKB 1DQJA 3UCRA 1H8NA 2X53A 4FLSA 3HE6A 4MVBC 2GTWB 1SY6L 1QO3A 5C0FB 1KENL 4NN7C 1QASA 1HH6B 4JHWL 3LRMA 3B7SA 5TE4H 5JHLA 1KTRL 4YSUA 5IQ9A 3V4UL 4NQCD 2XV3A 4QR7A 4QRBA 4I1NB 3IDNB 2KS0A 4AW7A 1IM3D 1NCBH 3CX5J 3U48A 1MIMH 3ZDZE 3TT3H 1YMME 3FQRA 4Y2OB 1M1XA 3NT0A 2DQHH 1EAJA 1ZGLA 5JOFB 4IBLT 3OJ2C 4C4KO 1M05A 3P9LB 3T77A 2BSED 3KPNB 4B9PA 4A6YH 1RURH 3GC3A 1TENA 1BP3B 2LTQC 3D4ZA 5FGBA 5D4JA 5AOMA 2X4UB 3L4WA 4A55A 3LMJH 3D18A 3JT0A 1E28B 1DHKA 1LWHA 1GJUA 2BXZA 3QUZA 5C07A 1IKOP 1KYFA 1UA6L 1WO2A 2IXQA 3HAEG 3N91A 5D7IA 5KANG 4KQ3L 3DRQA 4EDWL 1BJ1J 4HA1A 5I1LB 3DXAB 4Y4FD 4S1QL 4PH8A 2WY3B 4NO0A 3W57A 3L4UA 4TNFA 3RWEB 3PHSA 1CG9A 1NC2D 1G7PA 2W59A 2M2DA 2EYRA 2BW4A 4WEBH 5TFSH 3W0WA 2VO8A 4PGDA 1KGCD 1HAWA 4XB3A 5AL8A 1ZHBA 3LNEA 4PJBF 5IROC 5D7LB 3IU3A 1W15A 3RVXC 1UKTA 3NYKA 3TM6A 2HPTA 3UAJA 2XZCL 4RAVB 1BX2A 1WVZA 4BSVA 4WUUA 2VAJA 1F4XL 5CUSH 4NZFA 2ZWYA 5E2TL 1VZGA 5GGQH 5IT2H 3AQXA 5IBUB 1MY5A 2W9DL 3T0EB 3KMDA 1ACZA 1QPPA 3GO1L 2APFA 5EIVA 1EHLL 3FQYA 4QAMB 3F7LA 4FYSA 4KJQD 1HINH 2EQDA 1GGCH 3X3FL 1WFNA 2XQBL 3RX7A 2QQQA 4RFNB 2J25A 2VMFA 4Y4HC 5KJRL 5H2BB 4YSTA 4M7KL 1BIHA 5FGSA 2PCFB 2DI9A 4AM0A 1FL3B 3MC0A 3F3HA 4ZBJA 3GMMA 4DT2A 2ILLA 1SEBA 2ZP8A 5I73C 3SOBH 4LLDB 4L3EE 2ADFH 2F18A 1J8HB 1E0OB 2HLAA 3VXMA 3KPRA 3EO0A 2AEOA 3K6OA 3NPSB 3DOSA 3SYQA 3X1NA 4AYID 5LGKA 2WD0A 3MTXA 3PWPB 4Q58C 4LIQE 2LR4A 4ZOEA 2DBLH 4YX2L 4M3HA 4NC0B 2XPYA 1EDYA 1FZOA 2ZXEB 3CHXA 1U30A 2W8CA 3KLQA 1CCZA 2QKIA 3TYGL 1BVKA 4X0NA 1DLHA 3TNNA 2G5BB 5H94A 3CMOL 3BCFA 3GJFK 3ZYIA 1BJMA 1ET8A 2ODIA 3T2LA 5B7FA 5GIRB 4H20L 2DZEA 2I25N 4ZG1A 3MV9E 5L9DH 1IX2A 3QZMA 4URTB 1XSIA 2AQ1A 3QDMD 2EE3A 1IKFL 3B3IB 1H9VA 1URIA 4ABQA 1CIUA 3US0A 4GI6A 2ZXBA 5EH1A 1GIGL 4NQQA 1GZPB 1BQUA 1OARL 1XB3A 4G3YL 2GEEA 5E1AB 1SFHA 5D2NB 2CRZA 2NY5L 2P3YA 2OMVB 5GXBB 4MAYC 3U7WH 4HT1L 1NGQH 1CYGA 3KPTA 3DSFH 5T3ZH 4G82A 1ZEAL 3B9DA 3SDCA 2C3GA 2EVJA 4OLVL 1V7MH 1D9KD 5FA4B 1URLA 2GITA 1CT8B 5IJKA 1UZGA 1IV8A 2WLKA 3V8CA 1I9RH 1JZJA 4ZAKA 3MVSA 1MREH 2CLVA 4NNXB 3DTXB 1CE1L 1RJZA 3ARFB 4POUB 3U2JA 2VLJE 3OAYH 1F4YH 1KIUA 4F7TA 4OLYH 1M1SA 3ZKND 5I24A 1DJSA 5ERWB 5DJ6A 1RP8A 4M8RA 5J13C 4B9YA 4YDNA 3F5WB 4JRXA 4MZ2A 3I50L 5T8IA 3X14A 2HH0L 2IDCA 4KKBC 1A6ZB 3GZOA 3HZMB 3AAZB 6CGTA 4HC1A 1V05A 1GA2A 1EZVY 2VXSL 1XR9A 4N1EA 2CO1A 4U4IA 3I02B 4YDIH 3GSRB 3T8XB 1SM3H 1ZANH 4IU3B 1P9MC 1MI5A 2QQNL 1N6QL 3RDTA 1KCRH 3GI9H 3U4BH 3FFCA 4HFUH 2BW5A 3F7VA 3JQOB 5EOQL 4JFXB 1QSVA 4PJHF 4N90E 1I8AA 2VXQL 1B2WL 3X1EA 5ICZB 2XJKA 4NHUB 3FQWB 4BBWA 3FO1A 4N68A 1RUMH 2R69H 3B2VH 3ARBA 2IOIA 4E9RA 1N5YL 1CXKA 1F56A 4XZ4A 3DRTA 3JV5A 4IRSC 4OGXL 1FZJA 3PGFL 2A6KB 1K9TA 4WV1C 2H6PA 3WJLA 3W37A 4I8DA 5KVEH 1MCQA 4RGOH 4XPBH 1NC4A 3E7JA 3GBDA 3SE9L 1TVBB 1DJXA 3GSWB 4JMXA 4WHYH 3RX9A 1U6AH 4MMZB 4N5EC 2ZNWA 2CO4A 5DRNA 3MU3A 2BSSB 2JFCA 3KYNB 4JFYA 4N0UB 5ICUA 1BYNA 2XN9B 4L23A 3QIWB 4FF9A 1KG0A 3K4ZA 2BIHA 2E47A 1TYRA 4XP1L 4FFZA 1C5DB 5KUMA 4AXWB 5CMAB 3WY3A 1TTGA 2B15A 3IAGC 3DI3B 3N5AA 2OAAA 2Q8BL 2GKIA 1C1EL 4ZFZA 1AQMA 3UADA 1BFTA 1KPVB 3OLIA 3CVDA 5KVFL 3P54A 3CLFH 1OW0C 1T5WB 3PQYD 1AGFA 2EIZB 1GKEA 2ORBL 4JCLA 4ZYKA 4LFHD 3OZLA 3Q8FA 1CL7H 5A2CA 1T04A 1TIUA 4MYWB 5IG7A 4DCQB 3ATAA 1JV5B 3SJVD 1ZVSA 4LCYA 2ZUSA 2YFNA 4LOUD 5KW9H 5HGBB 5A2IH 4NENB 3BQUD 2PCXA 4X4XA 1MCLA 3OL2A 5F89B 5T1DH 5K9OA 1S7TB 1D7DA 4YDLB 2APVA 3VM7A 2WQAA 5EOTA 4ERSL 2BP5M 4FQXD 4RIRB 3ME0A 4QXTA 1RVFL 1G9HA 1AMXA 1WRFA 2YR3A 4WHDA 4Z5RB 2VKWA 5AB0A 1IM9B 3QNYA 3NK4A 3VAEA 4CAGA 2Z92B 1A4CA 2ZP9A 2DQIL 2XACC 4PCSA 5CCHE 4WGKA 2Z1KA 5EC1A 5AAMA 2XA8H 1QSEB 2F5BL 4JVPA 1LP9F 1JSYA 4OKVA 3B9AA 1C5BH 3UZVA 4EQ3A 2YD8A 3MACL 1BD2E 2VRKA 3ZE2F 2X87A 1KY6A 4H2AA 2KQNA 3HHRB 4MGXA 1A7RL 3HHSB 4PJ5B 2BVOA 2GVYA 2WSDA 2H41A 3APMA 4IRZH 2OQJB 4TNVF 3SYCA 1KPRA 4MJ5B 4ZMLA 2DLTA 1UM6H 3B6SA 4LVEA 3FSOA 4X4MA 1FPTH 1K2DA 3D3VD 1LMKA 4IDJH 1CC3A 1KJ3H 4NKMB 5DRZA 2NY3B 3GSVB 4A7VA 2DQDH 2QADD 3G6JB 4IBZA 4LCIL 4R26H 1CR9H 4P4KB 2F53B 3EDJA 1IGIL 4X5XB 4FZEL 2JTYA 4WNQA 4BFJA 5D7SL 4L5FH 1I7TA 3NSJA 4E9LA 5ISZA 1A14L 2XQYG 3FT4A 3NG5A 3EHBD 1X4XA 3FU6A 2X05A 2J8UA 4FQJH 5DRXB 2MHAA 2PABA 1A3RH 4AMKL 5IOPA 3ULUD 2WQ8A 3VXNB 2G9HA 2H6UA 2WANA 4N1HB 1TFPA 4CSSA 4LVHC 5C0DB 1Z0MA 1TU2A 1ZY9A 3V4VA 3QC5X 1MH5B 1ZS8A 3WEXB 3MRDB 4W9GC 3ZUNC 1KTBA 3KYMA 3MOBH 3BVVA 4M8QA 5ADPL 5GHWH 1NBVH 7FABL 4G9FE 5E2VH 5AW1B 3X1FA 3VDCA 3I6LE 2PTTA 4I9WD 3TVMD 3BZ4B 1HHKA 2FECI 5EORL 4AKQA 4F27A 2HG0A 3LOWA 3TO2B 2EEXA 1ORSA 4TUOA 4NC1E 2AJSL 4O58L 5F1IA 5AW5B 4MB3A 4MMYB 5GRJH 4UM9B 5KANI 3IDGB 3SDAD 1VHPA 5D93C 2VL4A 1WCQA 2C9RA 4E41B 3MN8A 3CZFB 3ECVA 4H8WC 4MSWB 2BIMA 3ULSA 1MJJA 4F58L 3QJZA 1FYTB 2CBOA 3B5TA 3IS1X 4GMSH 3C12A 2IO5A 4LCWD 2WCSA 1NQBA 5CCGE 4QHKJ 1RPUA 3P0VH 3K80A 4N6RB 1MCSA 2H32A 1T4KA 5GGVH 1D5XA 4XBPB 1QQDA 1EX0A 1M3JA 4K3HA 5ADOL 4IGBC 1T0MA 2DTMH 3QQNA 2OMUA 3EADA 3EYQC 2KL6A 1CICA 4ZW7A 1FG2A 4Z7UE 4HIQA 3CDYA 4MDIB 1AP2B 3HCVB 3IGLA 4C83B 2VABB 2RD0A 2AGJL 2HCZX 4JVUA 4C4KT 2ZCZA 2J71A 2OMYA 1QSZA 1AD0B 1A6WH 3VH8G 1AZZC 2UX7A 1DQIA 5LAXB 5HHMB 3MKGA 4WI9A 1WC7A 1BWMA 4Q2ZA 2BSDA 3B37A 5HI3D 4FOMA 3HG0A 3KPSA 5EIIA 1HYSC 1CFNB 5TF1H 4FLHA 4GEIA 2X9YA 4ADIA 4N26A 3UEQA 2VM3A 3V4PB 3ZE1B 1JI1A 3MX0B 3VWKD 1EO5A 4DQAA 4YHMH 2P1YA 1ZT4A 4Y4KB 4LLYA 4NAQA 3FB6A 1RU9H 1DO5A 1GW6A 2FJGB 1O6VA 5CBEA 3BOVA 3PWUA 1E4XL 3OLGA 1XGZA 5DJXA 3V0AC 4FXTA 5E8OB 3BD4A 4IRJC 2NXZD 4LHUD 1UEYA 5E99L 1NLDH 3NEOA 1HZKA 4LSRL 2X12A 1FFPA 2VH5H 3RNQA 4YBQC 1L9SA 4YOKA 4XMVA 3K2KA 2QDWA 3VXUE 1OO2A 4N85A 4WGVB 1JZDC 1KGWA 1ZA3A 3CFDA 4GKLA 4H13C 1FN4B 2XIBA 4JY5L 3HMWH 1D5MA 4ODTH 1AZBA 3IDMB 3MRHA 1W72B 4PJ9A 2NOYA 1INDL 1CQKA 1UWXH 4M5SA 3QISA 4HFWB 5E9DD 3DGGB 4PB9H 4QI3A 3ARUA 5C3IA 4XO3A 2Y7SA 3T3PF 3QG7L 1YNTB 2DIJA 1ESOA 5D1ZD 2X4NB 5I5IA 3S9DB 1AS6A 5L7XH 3RVTD 1BZ8A 4QIRA 2EIDA 4I0PB 2YD2A 4I18A 4OZ4B 3T9WA 3HG3A 1AR1C 1UD4A 3H56A 2V5YA 4EI5B 2PO6C 4QOKB 2B2XL 4NQXA 1NMBL 2P52A 3N1PC 4O02H 1CDHA 2BVPA 4RNRB 3PWNB 4L1HA 1U3HC 4KROC 1Q94B 5CSZA 3UO8B 3OPZH 4BK4A 1CI3M 4XO8A 3CH1A 3GM0A 5SWSD 4QHMB 2L4OA 2XG5B 4IGBA 1JGUH 1S9YB 2QR0B 4CSZA 4FXKB 4KO7A 2YD6A 4Y1AD 4ODXB 2W0LA 1SYSA 6PCYA 1MZZA 1G9MH 3GIZH 2H3XC 2CDFB 2VDRB 3DARA 1L9TA 2IGLA 3F6IA 4FMKA 2PXYD 3NJMA 4L4TD 4FRWA 1JHKH 2XG4A 4AV4A 2YKLL 2L7JA 4FG6C 2WLIA 4PG9A 1NJ9A 5EBLA 4KZ0A 4D94A 4JY4A 1TLMA 3WTXA 3D2UB 4BWUA 5E4EB 2IVFC 5TGBB 1RZJL 4J2QA 4RZCA 5F1KC 3B9KB 1TZHA 5F71A 2G5RA 3LKSB 2R4SL 5KJ7E 4NQDE 3IFNL 4LKCB 2OKMA 1MAMH 4JFOA 1IC7L 2CRYA 1GS6X 1PL3A 1G6VK 2H45A 5H37G 4KK5C 4QTFA 1S7RA 3WLWC 3BDBA 2JKLA 1MY7A 2AV7B 3DXAD 4KMLB 1QRNE 1PQZB 2DWDA 1GYAA 3BUQA 2Y07H 3LH2H 2CSPA 3D69A 5J12C 3QORB 2ZX7A 1CLVA 2A73B 2WUBL 4YSCA 5INDB 4HBQA 2NNXA 2Q20A 4JEGB 1AZUA 2FO4B 3T1FB 4X9HA 5D7LD 3VD2A 4WJG3 1M56B 2VR8A 3OVUB 2VMDA 4QRTB 4ISVA 2R29A 4TPRL 4JHVA 4NO3B 3U0PA 1AIFA 2Z91A 3NJXA 4NRYB 4EUPH 4I3SH 4MNHA 5DRWA 3OAYK 2WIIB 3LEYH 2G2NA 2GTWA 1UJ3C 2BVQB 1TETH 5GRVK 3WS3B 5ID0A 4W81A 2OM5A 1ECYA 4U1SA 2E86A 1DQDL 4Z9KB 2FECL 1ZLWH 1EANA 5E5MB 2CXKA 2QVTA 4FQ1L 4PW9A 1WFJA 2FO1A 3ZDWA 1IC5H 2G4EA 4XN7A 1HU8A 1PX4A 5FYJL 4NO2A 4OGZA 1UWEL 4GXUN 4ZXBD 1M6OB 4Y1SA 1CLCA 3P9LA 4XX1G 2BNQE 3ZXAC 2NY0C 3SE3C 2ADIA 2NCMA 3ZMRA 4HH8A 1S8DB 3HR6A 4GT7A 3FBKA 2X4UA 4LBEB 4MLSA 2DL2A 3IT8D 4BZ2H 5JUEH 5CZRA 4I87A 1XZWA 1HCYA 1E8WA 4W9CC 1BMZA 4ONFL 5L0QB 3F8UB 5C1MB 5CBAA 1YYCA 2VC2H 4WO4B 1P0SE 3PHAA 3GWJA 5HVFB 3AB0C 1OP9A 2R27A 1DSFH 3MRIA 4DP9X 3U36A 5D5MB 2NUPB 2WHVA 1SOKA 2EIBA 2AXFB 3IDYC 1JWUB 2J3SA 2VE6B 4PJ7E 1IKNC 3IMUA 3VG0H 2V2TA 3WNOA 3MNWA 1AQ8A 4PJFA 5L4MA 1JNNH 2D9CA 4DH2A 3U9PL 1HHGB 4N2EA 2O72A 2GBTA 3RG1C 5I1CL 1J10A 1AXSA 3RGVB 4PGBB 4D0BA 3STBA 3ARDC 2Z4TA 5IHZB 4LAQL 1TQBB 4M5YL 2RJMA 4K07A 3CUPA 4JFHE 3RVVC 1G1OA 2D0GA 4MB1A 1MQKH 1VF5C 1QKZL 5INCB 5EWIL 4LSSL 2HA1A 3D7PA 3PE9A 5DSCB 4QKXB 5FECA 3SDXB 4WI6A 3Q06A 1S7WB 2YPKB 3OR7A 1QLEH 5GJTL 1FL3A 4BFRA 2YC1B 2VW7A 4HX1B 2Y69B 4LLDA 1MWAB 4R8WH 1ADQA 1HILB 4NQEA 5HDWA 5C0NC 5CXPA 4OIAA 2WXGA 5HI4C 1OTUD 5JQHC 4JFEB 3WFDH 3WFCH 2XIIA 2FGWH 1A7QL 1OEZW 4X8JA 4U31A 2R56L 4O4YH 3CZGA 5FUOH 2FRGP 5IB1A 3X1GA 3CN2A 4GSUA 3ZKQD 2GJPA 1KNOB 4TVPL 8CGTA 4A2LA 1FV1B 2G5BA 4AVKA 4D9QE 1A6VH 1K4CB 1IZJA 2J56A 1AI1H 3ZN6A 3RWGA 3BISA 2E9JA 3A5VA 3ENEA 5IM7B 3TF7C 1CDYA 1Z5LA 4HWBA 4Q6IA 1X5AA 1KCLA 2UZIH 4JM4L 1PG7H 1OTTD 1Z3GH 1DZBA 1AD9B 4JFDA 3B3IA 4CADA 5F6HJ 1AGBA 3TIDB 2YPVH 5IBLC 1HT6A 4KO6A 1VAHA 2KBGA 3HUJB 1U8MB 5D2NA 5EIQA 1JYNA 1I7RB 4A2MA 4DZBA 3OKMA 1R17A 4NI3A 1DCLA 4YXKL 2EAEA 2DWXA 2DLIA 1ZSDA 3ELAT 3Q43A 4YE0A 4TQEL 5BO0D 4TTDD 1JV2B 2AJUH 2NUTB 3IKCA 4U6TA 1CT8A 3ISWA 3FCTA 1KCUH 1JF1A 4OD1L 3GBNL 1PJWA 2XBDA 3DVIA 1ODUA 3ARFA 3WV0A 2GJ6A 4CVZA 3VFOB 5D1XB 3VGHA 1WWCA 2IFGA 1MCJA 2F7QA 2NRDA 5D1QC 1SF5A 2ZX8A 5IQMA 1U8IA 2JJTC 1DP0A 3QJUB 1PLBA 2B16A 4PVNA 5HGHB 1DYZA 5CD5D 2Z3FA 3MRGB 2NW2A 3X1BA 3X13A 5GISH 3ALPA 2WYHA 1A6ZA 1ZKAA 2P7TB 2Y22A 3HZMA 4FTVD 5AAWC 3WY4A 1P6AB 4EN3A 5HYSA 2I24N 3FJTA 3DUHA 4ZMXA 4PUBH 3QXVA 3I02A 4GQPH 5DMGC 5E0FA 1GC1H 4G6FB 1MNUL 4RDQG 4CGTA 1IIIA 1SXBA 2KT6A 1U58B 3MA7B 3RWFA 4PRPA 5LDUA 2EICA 1NCCH 4L4VB 1YEGH 2CXGA 5C6PB 4S0SD 3WENA 1T4WA 1I1FA 1ML0A 1PX8A 3FUHA 2CMRH 4B9JA 1HHHA 1XV8A 4P5RA 4JGMA 4NHUA 5DD5H 5CFHA 3HJEA 5E8PB 3GHBL 2H8PB 1GOHA 1KIRB 4JDEA 2W9EH 1UC6A 3DUSA 4ODSL 4JLRB 4K71C 1S9XA 1YJDH 4MXQC 1NCAH 4NN7B 4BFEA 4GAAA 1J8RA 1TQVA 4DF9A 3IGKA 3P4MA 3GSNB 4PWFA 2QPUA 4LIQH 1WZKA 1SXNA 2QQLL 2WKLA 4K8RL 1BA9A 3LRLA 1X9RA 3ESVF 3LZPA 4NJAL 2BSSA 5IP4A 4N2CA 1HSAA 3P40A 4YL4A 1XF1A 4ZD3H 5C2BH 2RA1A 1FDLH 2OXGA 1NCTA 3O6KL 4F2EA 3EH5B 2GK0B 2HFGL 2A9DA 2HTLC 2LTQB 3QJVB 4AXWA 1EEYB 4ODWB 3PGCB 5B1BB 3G6AB 4G5ZH 1I85A 4OZFA 5A7EA 5CP3A 1K4DA 3DETD 3V0HA 2JCWA 4AQ1C 4P4KD 5CIPH 2F53D 2ZT9C 5EIIG 1EAPB 3CNKA 5JHMA 1OWRM 4HLZH 3BLKA 2V9TA 1OLLA 4H0IA 3WKPA 4XXWC 4FI7A 5HVHC 4P5TC 3T8VA 2G2PA 2HXAA 5SX4I 1LL1A 5M95B 3N41F 1JV5A 3WY1A 3ZZQA 2IBZY 3A67H 1MDTA 1E6JH 4MRBA 2R0KL 3GLAA 1HKLL 3DJSA 1I9IH 5KJ4A 4HPYH 2Z35A 1U8OB 1DQQB 5AVUB 5ACZA 1VGKB 5KYXB 4RIRA 5KS9E 1BEXA 1Q0XH 1JZFA 2UZXB 5B38B 1ZK5A 1BXVA 1NBQA 1OF0A 2DQMA 4LNRA 4KZDL 3QO0A 3ZT6A 1IM9A 3O6FB 3DV6B 4MKMA 4I13B 4WTZG 1BSIA 4M61B 3GK8L 1B3IA 5JDSB 2HKAA 4NAJA 2HN7A 5CINL 2O5YH 4ZI8A 2X7LA 5DUBA 4GKSB 2WC7A 4OFDA 4X4KA 3T08A 2ZONA 3K7UA 3HPLB 5I73B 3OXSB 1TZOA 3AG1B 3GPEA 3ZSTA 5KYWB 8PAZA 4S1DC 1EXHA 1KEML 4PJ5A 5E8EA 5D2LA 1UWXK 2X44D 4G1EB 2OQJA 4YO0B 4UOW0 2Y5TA 3QXDA 1MFNA 1FBIL 1R3KA 3MRBB 4Z7VA 4ZDHB 3WO3B 5F97E 4NKMA 4KK8C 3ETBJ 5BS0A 4E9WA 4JO2H 3QDJA 3FN9A 4HS3B 4NPYB 4LPUA 4X5QA 2Y2TA 5D7JB 3OZ9H 3HG1D 3V0GA 2FEDD 1QAWA 4PHZA 2WYZA 2H1XA 4YHZH 5SWZE 3L95A 3D0VA 4B9IA 1HESA 2XICA 4DP6X 5AALA 1CE6B 4N8CL 3WTVA 5HP5A 2RACA 5E95B 2E9BA 4ANXA 1FVCB 3SDDA 4F33B 2DDQL 3QXTA 4UQ9A 4HSCX 3IJ8A 4CN4A 5AW0B 5HHMD 5FKPA 1EFXD 1MH5A 2ENYA 2G2RB 4UOJA 4MAYB 3TYFA 2DAVA 2NZIA 4KAQL 5EUKB 3KWTA 1SDDB 3D52A 3L5XH 3NESA 5DR5L 5A3IC 4IYKA 4KNQA 2VDNB 3LN5B 2VLLA 3JV4B 1J5OL 2GBVA 3CDGA 2GI0A 2Y9RT 3OHXB 3ARGD 3BZ4A 3CZKA 5JIPA 1OSEA 1JGEA 5EC2B 4NXKA 5J56B 4TVUA 3ZK0A 3TO2A 1KEGH 3VE0A 4K9EH 2UY6B 4R97C 4UM9A 5E9AA 4IMLA 4YVNA 3UC0H 2IWGA 2LW3A 1USZA 3QA3A 1LDSA 3GINA 4OIBA 3UTTE 4GQ9H 3N6YA 4U6XB 4A7TA 3WLBA 1FYTA 4ZUUA 4HISA 2PF6A 4V1DE 4YDLC 3MV7B 2OFQA 3FW6A 4N6RA 3EH1A 3UYOD 3P3YA 5LHDA 2WZ5A 3UXFA 4XBPA 1MXDA 1O0VA 3UG3A 4DQOL 5JHLL 3MO1A 2J72A 5B3JE 2BSRA 4KU1A 4YDKH 3VD5A 1OAZL 2A9ML 3KG5A 4YR6A 1E9OA 1SOSA 1TZ8A 3CC5A 3E3QC 5E6RB 1WT5C 3B5HA 4MXWH 4ONGH 4HQQL 5LG1A 1MN4A 1TTUA 3KXFE 2B1AL 2DJMA 2XY1A 3BZEB 4MCZB 4APQB 1T66D 1FGVL 4I0PD 1W6LA 2DI8A 4ONHA 4NO5A 1SZNA 2DQUH 3GJFB 4LEOA 2B7DT 1XF3B 4TRPH 4EI5D 5TDNB 4QOKD 3VFGH 3CFBB 4FQ2H 3P2TA 4AK2A 1IRAY 1AR2A 3RHWK 1NAML 1CFNA 3MV8E 4IRSB 1MCEA 1EO8L 4K3DL 1XWVA 4N2GA 3KVQA 5DLMH 1ZLWK 3ETTA 1I8KA 1NEUA 2B9BA 4WV1B 4M4RA 1CFQA 3FPYA 3V4PA 3AS3A 4TKWA 4JFQB 4KPHH 3T3MF 2BY0A 4IBUA 2LVEA 4YPGB 4BUHA 3L13A 3AM8A 3WE6B 1RZGB 2FJGA 4JFFB 5A2AA 1JZIA 4DKAA 2RALA 3SBWA 2VDLL 5E8OA 2FBJH 4D3CH 1J0ZA 4Z78B 2KI6A 1G9EA 3MI6A 3DV4A 1FA4A 3GMOB 4GNKB 3BESR 1PYWB 5IMKA 4WFFE 3BH9B 1NFAA 3BJ91 2O5ZH 4NBYB 5DFVD 4QLRA 4I48A 5ITFB 1Q72L 2CJUL 1AXTH 2AJ3B 4L48A 4ZFQA 4K7PY 4ANUA 4BGDA 2LE9A 2GSIA 2WAQA 4HFWA 5KSAC 5IBUG 1IGFH 2ETWA 1VKXB 2XIDA 2NXYC 2P44B 4PB0L 4PJHB 1TKWB 4EBQL 4NN5C 2P5WB 2BLFA 4OFYA 4LDCA 2ADJB 1OE3A 1ZTXH 3G5VB 4CBZA 1UOLA 2DMKA 2IV9A 5JO5A 4R6UA 4OZ4A 3UYRH 4TLTA 1NCIA 2EINB 2NPLX 4ODBD 5CILH 4AI7A 5IQOA 2VDQH 1Z9LA 2FK9A 5I18H 3L3JA 4H25B 3LYRA 5EFIB 3PWNA 1EHNA 2HB0A 3D39B 5HHOE 4JDZB 3S34L 2GK2A 3QHZH 1VPOH 1A25A 3B1UA 3GRWH 3CDZB 3IE9A 4QHMA 2XG5A 5I19H 3FT1A 1JMZA 4TOYL 4XN4A 3GEWB 1JRHH 1ZHKA 1CLYH 3KJ6L 3MRFB 4FXKA 4KRPB 4JO4H 2VR5A 4JX0A 4M7JL 5HGAB 2BO0A 3RUGA 3INOA 2IANB 4I0KA 4PJDF 3ILQD 4OCYH 3MRPA 3QCUL 3DX0A 1DN2A 1OGAB 1OM9A 3P3SA 2R59A 4TSCL 2X6VA 1JWMA 1FFQA 2AEQH 5F0PB 3BP6B 4XMWA 2V2XA 3B9KA 5HYJB 1UH2A 4KJPC 3LKSA 1XD0A 4OCWH 1U8CB 4ZTPH 1SHMA 3LKOA 4LKCA 1A7NL 2X4SB 3R1GL 5TQ2H 1T1YA 3MOAL 2WKOF 3QDGB 2N0KA 4LZKA 4WWKA 5T5FL 3L48A 4HCRH 5GS2H 1UH4A 3BGMB 3OGCA 4XE0A 1F13A 4WO4D 5DWUH 1PZBA 5AOIA 5FHBH 3UTQA 1KYOK 4LOEA 4Z3HA 4DPBX 2BMKA 1N7MH 4LVHB 2A73A 4HH9B 4KKCD 3OKEB 1RY7B 3MBED 4I89A 3QUXC 3U7YH 1RK1B 5LWYL 2WLZA 3GXNA 1KELH 1Y6NR 4XCFH 3G04A 5LBVA 4EI6A 1L9NA 4HC1L 5EU6B 3H3PH 4OFQA 3ZDYF 4G9DA 1C7SA 1ZLSH 1B0WA 2GSGA 4G7YH 1ZA6B 3EFFB 3SE4C 5D7EA 1TSRA 3QBTB 4YEFA 1XQ4A 3FRPB 2QTEA 4NRYA 1FNEB 1LP9B 3RGVD 3WJMB 1N9PA 3BN9D 1P2CB 3KYOB 3ZE2B 2ZSWB 4P9HC 1KJ2H 5EZOH 5KSAA 3QB7C 3SYPA 5KBDA 4X4YA 5DJ0A 4HUXB 1UM4L 4Z3GA 2BVQA 5EOCL 5KVFE 3OMNB 5D93B 5AOKA 1LEIA 3GSQA 1H5BB 3BUYA 1KBKA 2PWHA 3QIBC 15C8H 2NX5A 4XXDB 1G7LA 5DUJA 2BHFA 1DDHB 1C9SA 2CG9X 1M6OA 1G7HA 3FB8B 4JFED 5BW7A 3VDBA 1V10A 1ZXQA 3V5HB 1TTFA 1AXIB 2ICES 1BEYH 3D6GA 1YC7A 5ITBL 3FN0L 3WNLA 3SPGA 4D9RE 3HE6D 4B60A 3LEVL 5FCUL 4UINL 4I3GA 4EUPA 1CDBA 3NIFF 5D4QA 5DEGB 1TJXA 2VT0A 1LMIA 3MREB 4QTHA 1TJHH 1MF2L 1XIWA 1MFEL 3IDIB 5A6IA 2DV6A 2EO9A 3CPUA 2O5XH 1DL7L 4PVMA 1L5GA 5I71B 1VB9A 4GRWE 1IEAB 2VE6A 3BDYH 2XVLA 3D25A 1NFDE 5GZOC 2AK4A 4TNWK 1Q0YH 4JG0H 5F7AA 4JRWA 1YY8A 5AVWB 1LE5B 4KI1A 2XKSA 1UTDA 3EH2A 5IB5A 3QUZD 2PYFB 2O5NA 2ZKYA 4S10A 3FQNB 5DUPH 2ZX5A 4D0DB 4JJ5A 5I0ZA 1BMGA 4MCYB 3CVHH 5I82A 2ICCA 2B4CH 1EJ8A 4IW4C 4NO0D 1E3XA 3Q3GB 1KN2H 4GS7C 5INCA 4BHUA 1T2QL 3EO1A 5MENA 3VGAC 2OZ4A 2ARJQ 3LQAC 2ALWA 2E56A 5T1LA 1S7WA 4IRJB 3W0WD 5I8EB 1PY0A 5JIQA 1TYJA 4EDXA 3BMWA 3TESA 4JMNA 2H0EA 4PI0A 5DA0B 2IFFH 43CAB 4OZIA 4TNWF 3KPQB 2FR4A 4HJSA 4JFUA 1X7SA 2Q86B 3B7YA 3D4GA 4X7SL 3MLSL 1F8TL 3OD3A 5C6TH 4RMWA 3QUYD 4OZIB 5I2IB 1K8IA 3VFWB 2R4RL 1BFOB 3ESOA 4MS8C 2XPGA 1EJOL 4OVVA 1E27B 3LZFH 5DD3H 4Y5YC 4G6FD 2EYTB 3KVPA 4LARH 2N7AA 3CBJB 3STLA 3WN5B 2HWZH 4MAUL 1GAFH 5JYLA 2P49B 1UD6A 4N9OB 3LHPL 2B3IA 2I5YH 3I9PA 5K39A 4KY2A 3VQLA 3ULVD 1N19A 4YK4C 5C0BA 3BZDA 4L4VD 1QW9A 5ALBL 2PO6B 1MCPH 2YEVB 4PW3A 2OX5B 1FH2A 1U3HB 2Y25A 1ZIAA 3NJLA 4KROB 5FYKD 4RGMC 2EIEA 3O3EA 1I7RA 2XTJE 4XN1A 4H2CA 3WIFB 4YHNB 5DDHB 2XYBA 1I75A 1G7MA 4MD0A 3BQVA 3RI5F 2DQTH 1RAMA 4D9LH 2IBGA 4F2ME 1YJDC 2BWDA 1TEGA 2NUTA 1MCWM 3S37X 1YNKH 1YMHB 2YO3A 2GFBB 1CS6A 1YEHH 2WJ5A 3WXVL 1TJMA 4HJ0C 1RQ5A 1XF2B 4X9BA 4OCSH 1ZK9A 2W94A 3RAJL 3ZPDA 1TCMA 1AOZA 1NGYA 3OWRA 4FL4C 2NNAA 3LS5L 1MUJB 5GRUL 2IWKA 4QXGL 1WA0X 3HC0A 3GMPB 2BZ7A 1UOKA 3B9VA 5HGHA 1XCWA 5DMIL 1OPOA 4A6YB 1LDPL 2YBRA 5KTEH 3T6VA 1HI6A 1RUKH 1I8MA 3B7RL 4ADJA 1RULH 3TV3L 2X2UA 3AY2A 3SDCD 3K2UH 4Q9QH 1X5YA 4PJ8A 4P23A 4PRNB 4GSRA 2ZYRA 4YSAA 1J1OH 2HSIA 4QXVA 2HFFB 1BM7A 1JTPA 2VITB 4ZAKD 5J12B 1RI8A 1I3RA 2QGEA 4EZKA 2BP8B 1B0GB 1H3PL 3HOGA 1AMYA 1X4ZA 4NUGH 4RX4A 1N3NB 4M1CD 2YRZA 5IROD 3GGWA 1HDMB 1BQSA 5E4AA 4JRXD 4U6VL 1QG3A 5BRZD 2IBBA 1EXGA 2J1KA 2CO2A 2MPAL 2YD7A 4POZD 3KHQA 3EKCA 4U6HB 1AZCA 5I8KL 4X6DA 4JFVA 4HAKA 5I15H 25C8H 4AQEA 1F2XK 4JLRA 1GZHC 4FD0A 4QRPB 1A0QH 3O2VH 1TYEB 3CN1A 1RJLB 5HYIA 1MCBA 2CUIA 3EJSA 4PCYA 4DK5A 4Y4HD 4U7KA 1MI5D 4K4KA 5FGCE 1QNZH 1XGQB 4WWOA 4YUEH 1JGVH 3GNML 1DBJL 1F58L 4HJGB 1HXYB 1ADWA 1NDGA 5BVPH 2R2HB 3FFCD 4AZ8B 1CIDA 5BZDB 1NH6A 1NPUA 1XH0A 2ERJC 3FUEA 3HR5B 4MNGE 5JW4R 2W38A 4GUOA 5IVXB 2I9LA 1JZ2A 1DUZB 3MJ8A 1Z2KA 1IAOB 1JPTH 3HLAB 3OMZA 1R24A 4AZUA 2DB8A 4WFGD 1EEYA 4ES8A 4ODWA 1WBXB 3G6AA 2APSA 3MLVL 4OJCA 3C5JB 2BRRL 5E1IA 2IQ9L 3JVFC 4YSRA 4HJ1A 4YHOL 2WIMA 4LDEB 5DQDH 5I76B 3TV8A 5KEZA 4OJFL 3FHAA 4L37A 2D4FA 1HH9B 1TSHA 1NC4D 2V7NA 1V7NL 4U1GC 2EYSB 3QHFL 3AB0B 2PYEB 4K7PX 1OPGL 4GLRH 1HIMH 3O9WC 4YZWA 3T09A 5LCVL 1BG9A 2ICWI 1UYWL 4GW1B 2VQ1A 3QI9C 5E7FA 3HLKA 3IAPA 4FLOA 1BVLB 2IPTL 3ZTNH 3FCBA 2FX9H 4P2CG 3IU4H 1KPUA 5DQ9B 4F9LC 2JNZA 1VGKA 7PCYA 5B3NA 2APTA 1A1OA 3AW5A 2WBJC 3ISRA 4MAYD 3ARDB 5J6GA 3M88A 1I8IB 4LPYA 5IHWA 1DVQA 5IIEA 1IL1B 3BUTA 2CO7B 3O6FA 5EUOB 5IGXH 4LU5L 1ZLDA 4OD3H 3HZVA 4M61A 4QWWC 3BN3B 4MWFA 5C0JB 4HD9A 4I7ZC 4NLAA 3HKFA 1V3LA 4OJAA 3TFBA 1MLBB 3O3UN 1DEEB 2YAQA 4HV8A 4FFTA 3H9SA 4UQAA 1A7OL 1TPXC 1PKQA 1GCYA 4BE5A 5BUPA 3BEWA 3WBDA 3PF2A 2CA3A 2J1YA 3OXSA 1I1YB 2RBLA 4Y8DC 4FG4A 4K9EC 5CLTA 2C1OB 3ZHFA 5DHVH 4G1EA 5AD0B 3UJIL 4LASL 2ZUQC 2VDPH 2HRGA 1M71A 1RIUL 1YVLA 3TO4C 3TJHC 4C58B 3ATFA 1WZAA 1OT4A 4ZDHA 3MV7D 4HOWA 5K5YA 1E5ZA 4LESA 4MZIA 4XT1C 3QCTH 5C09D 4TNGA 35C8H 1FVEB 3RL1A 3JTSA 1E43A 2GQHA 4JKKA 4UQCA 2EP6A 3GHEH 4M62H 1VEPA 1Z7JA 5EEZA 4K3JL 1CFVH 1NEZB 1ONQA 2OTUA 1CVRA 1UGKA 4PJBA 2OYPA 1IAIH 2VLJA 4KK9D 3SPCA 1UVQA 2C7FA 2E5EA 2Y3AA 5DJ2A 3VFTB 4BZ1A 3TEYA 2NZ1A 4HHGA 5HDBE 2QFPA 4E9SA 2X9ZA 4L9DA 2AJYH 3DJ9A 3BPOC 3I2CH 3BAEH 4ELME 3G5XA 5J1SC 4KKAC 4XMPL 3NA4A 5B1JA 3V5KA 4TV3A 5ICYB 4IRSD 4KUZH 5FYJE 4FG0A 4U1NA 1KGIA 1ZXKA 4K2UH 3V0VA 2H2SC 1C12A 1WP6A 3NACL 4P5MB 5ISZD 2JKIS 3GBML 2YLKA 3MMEB 3OHXA 2MNUA 1YEWA 2P80A 5EC2A 5IHLB 5E1HB 5KUKA 3VFNA 1A9EA 1AKJA 1UCTA 2HG5A 4KBPA 2DRUA 4WWID 2R29L 1CGSL 3MNVB 5PCYA 2NT0A 2W91A 3JVGA 1U8KA 3QQDA 3MNMA 2J88H 4EKXA 5D1QB 4M7LT 4K94H 1YHPA 1MHCA 3AU1A 4FNLL 3I9IA 3M17B 5C0AE 4G8IB 2XZAL 1H3VA 4DVRL 1IGCH 2ZOWA 4Y19E 3KS0H 3TWYA 1CMOA 2AQTA 3GUFA 3C09C 1TO5A 3SO5A 2PCYA 1OAXH 3L6FA 1LD9A 3BC9A 3ZQ9A 1F1DA 4GQZA 3AITA 3LKQB 3TBYB 4BWTA 3L4VA 1ETA1 3GKWH 5IEKB 2P5WD 4C56B 4APQA 3RWHB 3ABZA 1YSOA 3GMRB 1FNSL 4ORGB 5DUMH 4ETYA 4PP2A 3VMPA 4NCC1 3WTWA 1JWSB 5TDNA 1JGLL 2DD8H 4JO1L 1HEZB 4EQ2A 1HHJB 2NY2D 3WMSA 1J5DA 2UZYB 2Z8SA 5CLZA 3D39D 5I1GH 2JQZA 3TTYA 5JR1L 2ZYHA 4YIQB 4UIKL 2YQGA 1Q9OB 1KZYA 4NC1C 1II4E 3G9AB 3PREA 4JFQA 2HTKC 4HZLB 1DN0B 4WU5A 4TVPE 4QRRA 5DJCA 1TZIB 4EN2A 4FCHA 4X5LA 1X5ZA 4JFFA 3ELQA 2IAND 2VLKA 3FKUS 3O4LD 4IBQA 4QF1B 3MLTA 4R4BA 1MFBL 3ROOB 2KYIA 3GMNB 4BFKA 2EDEA 4GFTB 4NZTH 3STZB 4QRUA 1TEFA 3C5ZC 2YWZA 1RLBA 2OSXA 3KPSD 1PYWA 4XE5B 1H6UA 3C6LB 4L3FA 4E42B 1ACYH 1Y18B 4AQ1B 3DX8B 1SBSL 5ITFA 3SPVA 1WISA 2I9TB 4N2LA 3AREA 1SY6H 2AJ3A 4K23H 4F20A 4AOFA 5FXCH 1KENH 5HVHB 1AFVL 1P7QB 3QDGD 1AANA 4JHWH 4P5TB 4XR8C 1ADQL 5TK2A 1Z32X 3GUTB 2YMXL 1TKWA 4KKLC 2WWMC 3V0JA 2IQAB 4UV4L 4W9EC 4L9LC 2XYCA 2A7BA 3L3IB 5L4JA 1RZIB 3V6OC 3EJUA 5DZAA 5JIDA 5HYQB 3S37L 1OCWL 4FXGC 3HPJA 1OF2B 4NKIL 4HOZA 5HHQB 3B5GA 1UURA 5DTFA 1NM9A 2Q3AA 3OB0H 1XXFC 3VGEA 1QUNA 4X7TB 5JQIB 3CFJA 3ERXA 3RE0A 5AVSB 4GG6A 3WIIL 2YPLE 1S7UA 2VRQA 3HZYB 4N0FB 2DBJA 3UPRB 1GTNA 4S1QH 3AWFA 3PGDB 5CU9A 2B1HL 4XVJL 5EZJB 3BRFA 4PTUB 3IXAB 4MCNA 4PJEE 4P4RA 3OKLB 3A24A 1AHKA 3ZYOA 4KKQA 1BZ9A 5DGQA 1T1XB 4BZYA 2ZUUA 4Y2DC 2WBWB 3EOYG 5KZCD 3A6CH 3VW3H 4LLAA 2XZCH 3LRHA 4RQQA 3LSOA 4FX5A 1TT6A 4ZQKA 1M7DB 1OGAA 2XKNB 3HNSL 5PAZA 1F4XH 2CHZA 1GSMA 2VLMD 4RAUA 4ZFOA 2W9DH 4O2CB 2AZUA 5ICXB 3GO1H 4DOHE 5F96L 4OLWL 5HYJA 4Q8BA 3QEQE 4IGBD 3N41B 2X1QA 3EXLA 3EYUL 4Z7WE 4MJJA 4UTBA 3QZPA 1KFGA 1MG2C 4DO6A 3X3FH 3GQFA 3EYQD 4P2OC 1GMEA 4M7KH 4QYAA 3HNVL 5CEYA 3WUWG 2Y7QA 4L8BB 4JAMA 2CHWA 1PZUB 3DX9B 4G2AA 3VXSB 3TXAA 3RIAK 2ATPA 4AYEC 3P4OB 2DS4A 3DHPA 5A2FA 1K5NA 2R0ZH 4L8CB 2EVHA 4MZ3A 1JK9A 3NRQA 4E0RA 1SMOA 5DQJA 4X8XA 5EU6A 4NUJB 3D33A 4YX2H 4DK6A 3BSGA 3F84A 4LNVA 1A7PH 1RV6X 4QYOA 3TYGH 4MMXC 4PRIA 3OSVA 1FNAA 3CMOH 4XNDA 3SSGA 1CDJA 2PLTA 3RWCA 4EOWL 1UXLA 2ED7A 2ZUWA 1MCRA 1WZMA 2V6HA 2HRPL 1WJ3A 3RJOA 3ZE0F 4BCYA 4H20H 1J1PL 1MVYA 3O41A 4FFWD 1QLRB 5CZVL 5E7BA 3NIDE 2LFGA 4IEFB 4XMXA 4R97B 2Z1PA 5T1KB 5CJXC 2OTPA 5DD0L 4JM2C 2B4CC 3H0TA 4Z3JA 4IRJD 5KSUB 1EFQA 2VW6A 5AOJA 3H55A 3V55A 4C59B 1H5BA 3EXJA 2XN2A 4N25A 2HAZA 1BQHA 1GIGH 1T21B 1UEMA 1OARH 4PJCF 4K7PL 4YBQD 1PAZA 1XHHA 2AXGA 3QFGA 4OF7A 5DZLA 3TT1L 3WIHH 1Y6MR 4F7EB 5I1EL 2NY5H 1PBYA 4HF5L 4HP5A 2HVKA 2CJ3A 3FB8A 2E59A 3WO4C 3UH8A 3X12B 5DEJA 4TSBL 4K5PA 3FOMA 4HT1H 5IV2A 3UTZB 1ZLEA 3BYTA 2B1OA 1ZGLM 3IFOA 3TBCA 1MRFH 1ZEAH 1YCSA 4RSVA 4OLVH 4ZUTB 3TBWB 4BFGA 3CHOA 3A4AA 5GRZA 4EZMA 4A7GA 3GZKA 2IPKB 3DX4A 4Z7OE 1R33A 5I66B 2WSPA 2Y0SA 4M7LL 1CE1H 1FZMA 4JRYE 3KGRA 5FYLL 1Z9PA 1G0XA 5C0CE 3VXUA 1AR1D 5IB4B 3SDYH 4BH8A 2F8VA 2FWSA 2BHZA 4I77L 3I50H 4Y8AA 4YSEA 2HH0H 5E2WL 4J28A 3W9DB 1U3HD 2IALB 4BSWB 3UTPE 4MD4A 1H19A 1MCDA 4O02B 4IBTA 5DK2B 2VXSH 1BXAA 3K6FA 2C3XA 3PCYA 2FJHB 2PYFA 2FNWA 2B59A 3L7FA 2IIJA 5CZKA 1EA9C 5EBGA 1T22A 2QQNH 1F0LA 1IBDA 4DPAX 4OLZL 3R06B 1CZ8L 1U3NA 4Q89A 4KH2A 1I31A 2V7HA 2CHDA 1F90L 1LHZA 3O8XB 5EOQH 4JG9A 4NYLA 4ZNCD 5JYMA 4FG6D 1OAKL 2AQ3A 1E9QB 1EBAA 3MJWA 5TDPB 1HXMA 3OWEA 2Y1YA 43CAA 4DO5A 3MNDA 1N5YH 3SB3A 1FE8L 4OGXH 4MTMA 1F6AB 3UTSB 1IC4L 3L3OC 3PGFH 3IMSA 3MJ9L 5IFJA 4B6ZA 5B38G 1D2PA 3VFWA 3WLWD 5DFAA 1R47A 4BSJA 2NXYB 4WTQA 3KZ8A 3IRPX 3SGKA 4XCNA 4AYFB 2YARA 2OTWA 3WN5A 4QNPF 2KDGA 4JZJB 4RMUA 3BIKB 1TQCC 4UT9A 3HI6L 3O6ML 2VAAB 4PRAB 5DVOA 4NQED 3JTBA 4XP1H 1WA1X 5GGTA 5C08B 1NDMB 1TR7A 1F3JB 3OM3B 1CLOL 5FKAB 3MA9L 3PDOB 2CHNA 2Q8BH 3IPFA 1C1EH 2FZ3B 4HKBA 3T3MB 2OX5A 3KE0A 4WRLA 4LDLB 2Z93A 2P5PA 5KVFH 1EJ6A 1OXYA 5DDHA 1QRNA 2CO6B 2ORBH 4QRPD 3TH4T 5HJ3A 4YDJB 4MAZA 1A9BA 3VWJC 3IWVA 4XAWL 1OAQH 2AANA 4Z95L 2V9QA 1KTDA 4N2IA 4WU7B 4XRCB 3CZSA 5FYJU 2WXHA 2GFBA 3NRFA 4JFDD 4ZFGL 3ZHDA 3FF8A 1I7ZA 3EH4B 1SHSA 4ERSH 1B88A 1EXUA 1RVFH 2NY0D 4LLWB 1SRDA 1JD9A 1R46A 2FHCA 3QNZB 5F6HI 4MDJA 2IADA 1AO7B 4LP5A 1JOIA 3EYVA 4ECNA 3IK2A 5ES4B 2OL3B 3DX2A 4YQXL 2DQIH 1WBZA 4OI8A 4A68A 3DA0A 5D7IE 4UDUA 3G5ZB 2F5BH 4U3SB 3EH3B 4OAWA 1RHHA 2HFFA 2F5AH 6PAZA 1NPNA 1OLZA 1A7RH 4HBCH 4NWUL 3FS9A 3NAAL 3QUXB 4UT7H 1OWWA 3ESPA 1I1AA 2EDRA 4HCGA 5BV7B 2BNQA 4ANVA 4LCCB 1ZV2A 1DUYB 3B4NA 3E6FB 4M5TA 5MEOB 2X41A 3CFTA 1E2ZA 2VR7A 4ELKA 4LCIH 2V8MA 3LXUX 4UBDC 2W60B 1IGIH 2VLRB 2IGFL 4FZEH 1FFNA 1U8JB 5D7SH 1GR7A 3TBTB 1A14H 3ABMB 1U9KA 3MLWL 4QHLA 4POYA 4R90H 1L7TL 4PJDB 3O3AA 2YSTA 2ESVA 1JNLL 4RMTA 5T3ZD 1UA3A 4U05A 3KCWA 2FB4L 2BP0B 4AMKH 1O5PA 2MTPA 4AEIL 1XGQA 5A7BA 4XO9A 4PJ7A 3G3LA 1HXYA 4XNYL 2DJ4A 4PRPD 3QIBB 4J8QA 4K9JA 3EFDL 1R5WB 1SHWA 5DJDB 1S7XB 3EJTA 3KPRE 1QEWB 4KDTA 3VXME 1MJUH 5EN2A 5BZDA 5C0GB 3EJRA 3HR5A 3PPSA 1T6WA 4GUPB 3V4PL 2FYYA 2CIIB 1I8LC 3BGAA 1DUZA 1JAEA 5AEAA 4IJ3C 4HLEA 4Y5XC 7FABH 2JLLA 1GGIL 2XLLA 2MPVA 1H9DA 1MFAH 3TA4D 3T2NL 2WXRA 5TDOB 4YHLL 1U91B 3I9AA 4P9MH 5EORH 1SXSA 4Z3EA 2EKSB 3EJPA 3L16A 2AJSH 4O58H 5GRYA 3WTTA 2PYEA 4I4WB 1NCWL 2ARJB 5GPRA 3T1WA 3N9GL 3RLSA 1Z9SB 2Y06L 1DVSA 3DX6A 4GKOA 4RMRA 4F58H 3TA3A 1NIDA 4PD4K 1ZVYA 3ABKB 3UGEA 4TUJB 5IBLD 1JYXA 4AIOA 5F7UA 4QTIH 2NYYC 3BVNB 5D6DA 4ABVA 4ZUWB 5LKNA 5F9AC 5MEPB 3IMBA 2C3VA 5ADOH 5A6LA 1KT2B 4NJ9L 2GIXA 1P7KB 3L8QA 3QNXB 5IB3A 4JQIL 1LO2L 3T04D 5LJYH 1HXKA 4GS7B 1KXTA 5JOPE 1NLBL 3VGAB 4ZMPA 2UXGA 3B2MA 2OJEB 1YMMB 1K8DA 1MLBA 3RL2A 3QYMA 2WLHA 3RZCC 2Z31C 1F3DH 2AGJH 5I1IL 3PNRB 4RBPH 2BFVL 4MNQB 5D7KD 2IG2L 2MMXA 4LHJB 1NCHA 1V3MA 4CVWA 3QJXA 1GW0A 4B0MM 5KYNA 2DH3A 4Z3FA 1I1YA 1T7YA 5ACLA 4OCRL 3U2SA 3VXTB 5D1QD 1PNCA 2OBGA 3AVEA 4MXVF 3JXAA 3NIFB 3GZPA 3OPUA 3H53A 3C2SA 4WW2C 1J7VR 3CZEA 4K94C 3F01A 4IKNA 4XTRC 4YFLF 4ZQTA 2PW2B 4X99A 1FFOA 1W0YT 1D9KC 2FIKB 4PJXF 1R5IB 3P3RA 1Q9KB 3QUKA 1BZEA 5DMGD 5I0WA 4Y5YB 4WVRA 2VDRL 4CBPA 3DK2A 3F58L 3KL5A 5E94B 1NUDA 4PLKC 1HE7A 4JL2A 1E4XH 1XH3A 2WZPD 3DUUB 4C56D 4FNQA 3OB0K 4B5ZA 5E99H 1BYPA 4YK4B 4D0CB 5BO1L 4BQ8A 1YQVL 4LSRH 4XX1E 1VFBB 2L7EA 3MGOA 1TQUA 5J1TC 2MOGA 3VRIB 1QSFB 5E08L 4RGMB 4QJ5B 5JMRA 1NCJA 3D06A 1AC6A 4X9FA 5DHVA 1WIOA 2P24A 3N40F 3PXJA 4GOSA 5L2KB 3ALXA 3NCXA 5KAQG 2ARWA 2ZE0A 2ATKB 4MXQD 2FEEL 5EEVA 2P8MB 1YYML 2FSDA 1YAIA 3MRLB 5J9PA 4MJIA 4XCCL 4B27A 4PJAF 4GFXA 5L8LB 3BVXA 1SN2A 5F0LB 3WS6A 5AL0A 4AVJA 3EGDB 3DIFA 4ZS6C 4KKRA 3P77B 1ULVA 3L1OL 4HD5A 4GBXC 4XI5C 2QPDB 1OTSC 3SCMA 2YJLA 2V9RA 3QQ3A 4UIMB 3MRCB 3EZJB 1PY9A 1FFRA 3MZTA 4FL4B 5CJ8A 3TFKD 4HKZB 2J5WA 1NMBH 2HTLD 3VU2A 3FQXA 3P30H 2VW4A 4PIBA 3GSOB 3S5LB 1H3WM 3IETB 4PR5A 4LVNB 3FOLA 2PCPA 3B56A 4DUWA 3M1CA 2XKUA 3GFUA 4LSQL 4XPGL 3MV9B 5CIPB 5JHDB 3JV6B 3FRPG 4N87A 2XDHA 1P7QD 1XCTA 1A4KB 2RFXA 2XWJB 4P5TD 1ZV5A 2YGVA 1T89C 5D4IA 2NY6C 5IEKA 5B39B 2QVKA 2IH3B 5HD8D 5LBSH 5K1VA 2QSVA 3BSZA 4AT6A 2AW2A 2YKLH 1CURA 5DYOA 4YPJA 1NSNL 1AY1L 2WLYA 1A5FL 3EO9L 1C8PA 2X4OA 4HDIA 4WTXA 1O7DC 1JWSA 2Z6FA 1RZJH 2H9GB 2ZOKB 1HHJA 1T83A 4N2KA 2GT9B 2Y5QA 4B95C 1UXSB 2PTUA 3IFNH 2N3JA 1GXEA 1IC7H 2XXMB 4UQDA 1E5BA 1BM3L 1ND0B 3QCVH 1P5UC 3N85L 2WO3B 2EDLA 3N42F 1BZOA 4HZLA 4LOUC 4ZO8A 5IFAL 5CLYA 1E67A 2QHLA 2YRLA 3MUUA 5F9OL 1S3RA 4LCUA 2NT1A 5FF6B 4R0LB 2WINA 3ULUF 2ERJB 1E4WL 3WEOA 1O7VA 4Z7QE 3ROOA 4XNMA 1B3JA 3GMNA 5I1DB 5E8DH 4X4ME 4LLMA 4WI8A 4KK8D 4WI0A 3RNKB 3VYOA 5KSBF 2EDBA 5SWQB 4L3CB 2BP3A 2YD9A 4DERA 2COVD 3C6LA 4OU3A 1YLBB 2W07A 2X4QB 4YBLC 3RTQB 4M9PA 1YEJL 2IV8A 3TJEL 3BP5A 3D5OF 4XC1L 1K3IA 2OZ4L 3FQ4A 2HRLA 4PCKA 3II1A 3U1SL 3VXQB 3ZKXC 1M6UA 3GI8L 3QC6X 1B0RB 4M8VA 3KH3A 4AQOA 1DQDH 3RVUC 4HOXA 3LNIA 4F7CB 2CLZB 4FQ1H 3VXSD 3HAEH 1E9PA 1FC1A 1A65A 5ETUB 3GXPA 1RZIA 2CDEB 3QJFB 1UWEH 3B7TA 2MWCA 4K3GA 4R7NB 3QPXH 1NGZB 4M8UA 4GG8B 4GW5B 3DOHA 3HRZC 3IXTA 4HCIA 4AX3A 1LO5B 1GKOA 1YYLL 5A3ID 3NMEA 3LPWA 2PWDA 2VZUA 2BSTB 3DSNB 1QYGL 3QFJA 4ONFH 3EZ8A 3HBGA 4MA3B 3M1BB 1SY6A 2K7QA 4PTUA 4N9GA 1RZ7H 2YHGA 5B1CA 5EO1A 3KWUA 3B2DC 3A4FA 4J3TA 3VD0A 2VKXA 1T1XA 4UT6A 3NVQA 3QIUC 3T6XA 2EUWA 3TO4B 4Z7NF 1RIHL 1BLIA 3FFOA 4JN2B 2KKQA 3LCYA 3U9PH 5ILTL 1DQLL 5I1CH 2CHXA 2F1EA 4M00A 4BCZA 2EEDA 4O2CA 2NY5C 4LAQH 3TVMC 1KZQA 3MJ6A 1FGNH 2CR0A 4JJHA 3CVIL 2JXMB 2XFGB 1NPJA 2WNXA 4RFEA 5EWIH 4PWEA 4LSSH 4K7FA 3MKKA 5ABZA 2G75A 1UKQA 3OAUL 2L7QA 4H8QA 3Q1SH 5GJTH 3UTTA 1JD7A 1QP1A 3DX3A 5HPOA 1NKOA 3DX9A 1A6TB 4PRHD 5FDWA 1GHFL 1NM4A 4YNYB 3P4OA 4V1DA 4IJTA 4L8CA 3BPOB 3HE7C 1R3HB 3SKNB 4HKJA 3PWJA 1OSZA 4Q52A 1A7QH 4PM1A 4QHUB 2R56H 1CVSC 1ZWIA 1A22B 3II2A 5SV3A 4CSPA 1U8LA 4TVPH 1P6FA 1XCQB 5KBMA 3CH8A 3U46B 1DJWA 1E3FA 1IAKA 3TN0C 3ARQA 3KXFA 2VGLM 4WWKD 5E4IA 4A37A 5BVJA 2X9XA 3OJDA 2J1XA 2E9IA 2UXTA 4IHOB 5FIEA 1QLRA 1UD5A 1FIEA 2CM5A 4JGNA 1JHTB 2Q9OA 4PP1C 2R23A 5C2UB 4JM4H 3W11C 3PJLA 2H26B 2V2WA 4FFVD 3MXVH 5K9KB 2AVGA 2DMGA 1CDGA 2H1LM 4YSDA 3E9TA 4G8GA 2N7BA 2ROXA 3G08B 3GM8A 2YSSB 1PEZA 4HGWB 1ITCA 4PAZA 4JFPB 1X9LA 1FHNA 2H2PC 4ZFFA 4B7IA 2PWFA 3AGWA 3C09B 2J73A 1XX9C 3UTZA 3PWLB 2VSKB 4M6OL 4YXKH 1MXGA 2VB5A 4TQEH 5KSAD 3TBWA 3B2XA 1S7VB 2XWRA 3MXWH 2CGZA 2G9KA 1A64A 1Q0EA 2N01B 3GBNH 4P2RA 4AG4H 3JBG7 3V9FA 2LT9A 2ZKMX 3X11B 1SYVA 4BXVA 3UAFA 2NX5D 1MQ8A 4J8RB 1WIPA 2AABL 1IIKA 3MLXL 4IIQC 4KNSA 4UM8B 4WFHE 5C08D 2KLTA 4ZPVA 5DJZA 4G9FB 5I74C 3SGDI 3BIBX 2BOBB 4FJYA 3MLZH 1LK2B 2VDQB 3W9DA 2IALA 1N8ZB 2IAMB 2YXMA 4B50A 4P07A 2EDQA 1RP9A 1UD2A 4KXAA 4PWHA 2KZKA 5JHAA 1GYUA 4YGAB 3K2MC 5E6IA 5D1ZC 1MNUH 4G72B 2ZF8A 5DXWA 4PFEA 2GUOA 4P2QA 1PEWA 3K1KC 4NM4L 2A1WL 1XIWD 4OZHF 3T2OA 1NCUA 1CF8H 3K71A 5FK9B 4HS8H 5BMFH 4G7RB 1A6AA 1RK0B 3O8XA 2SEBA 5EZLB 4Z77A 3RWJB 5CEZL 1KLUB 3C5ZB 4IBYA 5HHOA 1HL8A 4OV6F 1E9QA 2DI7A 2V5RA 2AK4D 3GHBH 1WZ1L 2H47C 2ICEC 1U92B 1HZLA 4KJPD 3S4SA 2WXLA 1EHXA 1F6AA 3UTSA 5MHSE 1N59A 1BIIB 3QPQD 3ZGIA 1DSYA 2EDMA 3U0TA 4X80H 1IT9L 1U95B 4NX0A 4L8SC 5MEND 4HEPG 3FQUB 5KSVB 2QQLH 4WW1B 3VSQA 3FONB 3U4EA 3VG9C 4APXB 3HN3A 2J55A 4AYFA 2PXYC 1SQ2N 1RJYA 4IQHA 4W9ZA 4JZJA 3BIKA 3IDUA 1L0XA 4LP8A 4X42A 4AIEA 5GZNC 2VAAA 1QLFB 2VYRE 3O6KH 3HS8A 4X7EC 2HFGH 5HDLA 5FFLA 1HQ4A 3OB8A 5AVZB 1F3JA 1G5AA 4Q7DA 5EHFA 4XP5L 3RY6C 4DW2L 2D7NA 1I9JL 2VXQA 4QEGA 4NKQB 5LXGL 1TVHB 4RBPK 3NTCL 4NUQA 4O51B 4M7ZC 3DC0A 4UDTA 1JPST 3Q2WA 3LS4L 4M6NL 2DQFB 1KJ2B 4K5MA 1NWPA 3EJQA 2XTLA 1V8HA 3UDWC 2WCPA 4Y2DB 1CGWA 1QFUL 1NEZG 1HKLH 3QIBD 3POCA 1BBDH 3CIAA 3DHUA 2HVJA 2ZOLA 3ECBB 3RA7H 3KM1A 2VDNL 5BUAA 1NKGA 2QQKL 2X6UA 3RGHA 2DOCA 4XNQB 1WK0A 2APBA 5BPPA 1XF4A 3CN0A 4H8VA 4KZDH 3TPKA 2ITCA 5MI0B 4ZODA 5ACMA 5BZWB 4FABL 3GK8H 2WXPA 2JH2A 2OL3A 1MHHB 5CINH 4BELD 3U30C 4P2OB 1CLZH 4XWGL 4YJZL 3OXRA 2R9HD 3S88L 2VXUL 4QT5A 3OR6B 4JQVA 4LQFL 4PRBA 3PIQB 1KEMH 1JZEA 3PL6C 5GGRA 4BUGA 3AS2A 4ZXBC 1S6NA 4WHYG 2XTJC 3E6FA 5MEOA 2IPUK 2Q3ZA 3QJHB 3AY4A 4ABUA 1SGKA 3AMKA 5GZOD 2R1WB 3FQTA 3BDXA 2X4RB 2J6EA 4MMXB 5LAPA 5BNXD 5IB2B 4AQ8C 3BW9B 4Y9BA 2OMBA 4P46C 2R8SL 5ID1B 2W60A 4AW4A 2VLRA 5D8JL 1UT1A 4W6WB 4HK0B 2AJXH 2CE6A 3T0EE 1U8JA 3MOQA 4HUWB 2WOBA 3PV6B 4P23D 2BNRB 3POHA 5GGVY 1N2RB 1LNUA 2PR4L 3D51A 4PJDA 1PTZA 3RFZC 3LRSB 4X6CF 3CVHB 1YMMD 1XVSA 4N8CH 5GS1C 4HIXL 2QVMA 4FQQA 1MJ8L 4RX4D 4LP4A 2DDQH 2OMZB 3EYFB 1NFDA 2OCFD 2EIKB 5T1JA 2WQWA 1OIOA 5CJQL 4V2CB 1J8HE 4LQ1A 2OMNA 2YJQA 2WN2A 43C9B 3PWPE 4J4PC 3J7HA 4HPOL 1UZ6E 2WKOA 4U6YB 1KLGA 4JDVB 5CU5A 2JB5L 5DO2C 2VUOA 5FW8A 3VD1A 5KYYB 1J5OH 2AKRB 2E7DA 2MQCA 2R1XB 2UY7B 4BDVB 4AUYA 4BV1A 4MS8D 1U91A 4G71B 4JKPL 2NCEA 1RXLA 2D4DA 2VXTL 4DN3L 5G2NA 4HUCA 3DGCR 2I26N 2N0MA 3REVB 2HMIC 1JF6A 2ARJA 2GSMB 4GO9A 3MYJB 3VFVA 4Z6AT 2VSCA 4NKOB 4U1IA 1WS7A 1WTLA 2BOLA 1TCRA 3DVNA 2FQEA 1DQVA 3OKOB 2Q6WB 5D2NE 3ZE0B 3ZKMC 4DQOH 1FZKB 5JHLH 3BAJA 4FADA 5E8NA 2A9MH 3MRQA 1U36A 4A38A 1URZA 1HZHH 3RPIB 4TUKL 3ES6B 4HQQH 4EXKA 3KPLB 2EDNA 2B1AH 3C5SB 4KK6C 4PJCB 2ZKWA 4L3ED 2OJEA 3PHOA 4XP4L 3DMMB 5IR1B 3CXDL 2A74C 5DEFA 3VQ1C 2A9NL 1RL1A 2BH0A 4HJ0D 4YEEA 3HFFA 2KQMA 1HSBB 3IJ9A 3PL6A 2G4GA 5EZIH 5CEXB 4OCMC 1SNRA 4LKXB 3TCLB 2K6YA 1A4AA 2F7PA 3EGSA 4FC3E 4KJWC 4IS6A 1NWOA 3T6QC 4KY1L 2DYPB 4FHKA 1EO8H 1QABA 1OE2A 3NFNA 4HAGA 4K3DH 4NBZB 3CDFA 4KO5A 1MOEA 4PI2A 4PWJA 2G0LA 2B08A 5IK3B 3SZKC 3MV9D 4UILL 5KVDL 1N68A 4N0RA 2XFXA 1OSPH 3S3PA 3RFZA 3PWVB 5C0EB 4RESB 4S2SB 2YD0A 1XEUA 2OV0A 1FLRL 1Z9MA 2VDLH 4R3SB 4WDIA 1MFUA 4DJMA 4ZFOL 4LRNH 1TMQA 1NZRA 5FB8B 3JWNE 3D87B 5DURB 4UTBL 1CDUA 5AVXB 2O6EA 1FJ1B 1QSFA 3FTUA 3GXDA 3QH3B 2OK0L 5D72L 2M8XA 1Q72H 2CJUH 5L2KA 3O3BB 3U4KA 2CR3A 1RZJC 1BOGA 1IGML 2ATKA 1UB5B 1EWHA 1LO0L 4UZGA 3S35L 3VWJB 4BUQA 5IKCA 2WUCL 4EBQH 3EGDA 4RA3A 1RHFA 5C3TA 2WZAA 4E9QA 3O45A 2VLJD 2WXQA 4R96B 3HKZA 4AITA 3QYNA 4KXCA 3VRLF 5FYKH 1P4IL 1SJHA 4N0UE 2XN9E 1NCDH 2C9AA 4NIYE 3BAWA 4BH7A 5HBBA 2Q76B 2Q8AL 4LEXL 2OXHB 2QLVB 2ZPKL 4LE8A 4L1BA 4PJIF 5FYLE 2Q7YB 4CJ0A 3GSOA 3SEPA 4U49A 4M43L 5LN8A 1FYHB 1N5AA 1JPSL 1NCNA 3RIFK 3EG9A 3T65B 4W6XB 3S34H 2AFNA 2I07A 1F11B 4TOYH 2Z34A 1BFVH 1DZ0A 3BPCB 4UTAA 3KJ6H 3H85A 2XWJA 4H4NA 3D85A 4M7JH 4NQVB 5I17A 2R1YB 3PS6A 1SVBA 1AKJD 4EIZC 3O9WD 1QFWM 4MBRA 2MCAA 3S3SA 5B39A 3QULA 4N90D 5F1NA 1FORL 2CIKB 1JFQL 3UMTA 3QI9D 2Q7AA 8FABB 1WS8A 1T2JA 3QCUH 1H15B 3H9ZA 4HUUA 4TSCH 4L29B 2EACA 4A7UA 2WBJD 2F1BA 2H9GA 4AGQA 3UYPA 4PLNC 4KC3B 2VJXA 4ZMYA 1AJ7L 1UXSA 3APFA 1A7NH 3R1GH 3V0FA 5F88B 1G7IB 3MOAH 1XDTT 4QWWD 3IF1B 1MAJA 1ND0A 1NC2B 4H0GA 2R0LL 2A6IB 1P1ZA 5JORA 1NGWB 1QSEE 1KIQB 5FUCC 4Z7AA 2A6DB 3IDJB 3L7EA 3WNMA 4N20A 2PETA 5LWYH 3F04A 4PGCB 1NGXA 4J1UB 4JFZL 4PJ5E 3BWZA 4HC1H 4R0LA 4X6FA 2A77L 5D2LE 5GGRY 4LLUB 5DD1L 5JIKA 3TO4D 4BJLA 3TJHD 1DE4A 3EFOB 4Y5XB 2FSEB 3B8YA 4L3CA 5BS0E 1D5IL 4IDLA 3QDJE 3G6JE 4F15C 3RTQA 2YZ8A 2WLNA 2CM6A 5C92A 2F53E 1BLNB 2XWBB 4K3EL 4OQTL 5F3BA 3IB4A 4LRIA 3K72A 3CZNA 3M7OA 4F8OA 1FNLA 2AEIT 3VXQA 4XH2B 1UM4H 3THML 5EOCH 1A2YB 5GSVA 4UNVA 4GW4B 1A3LH 1XGPB 2CD0A 4YHPB 4YWGL 2FCBA 4NRZB 4YXHL 2JKXA 4A2EA 5GGUB 3C8KB 5I1KL 1M7UA 1QFHA 1KLFA 3LN4A 2NMSA 3HEIB 4UQ2B 3KPMB 3MNZB 3A4EA 3QJFA 4C8XA 1R0AL 3TBVA 3FUIA 3HB3C 3W38A 2WQRA 4KKAD 4FA6A 2YZ1A 2YD1A 2YEQA 4GG8A 4OB5H 1QI3A 4GW5A 4YZFF 1M42A 3M6DA 1XGRB 3JWDL 5ITBH 3W56A 2AJZB 3ARZA 2H2SD 1A4JB 3C60C 2ISDA 4F57L 3MBWB 5FCUH 4UINH 1ZIBA 1CFSB 2YOCA 1MKFA 2EH7L 1BD2D 3GTVA 4UT9L 1OB1B 2YMTA 2Y7OA 4Y5VC 1YC8A 2NQDA 1E2VA 2Y5EA 5DT1L 4FFZH 5F9JA 1MF2H 2PP7A 3CBRA 5GGTL 5F7LB 4PG2A 1DL7H 3EOBB 4Q0XL 3BP7B 4ELMA 4E41E 1JPFA 3SGJC 4Y16C 3KYKH 1U8QA 1DJIA 1FYTE 3HAEA 4IMKA 2W0FB 4DZ8B 4LMQI 2ZWLT 3OKDB 1F1AA 5EMYA 3K46A 1J11A 1XD1A 1DBKL 3UROR 4RWYL 1ECZA 4NWTL 2F54B 3PP4L 1D9KB 3ARGC 3UJJL 4P3DA 3V9EA 1DVFA 1DLFL 1PU0A 3WEBA 1IGYB 3SE8H 3KPPA 4WSJA 2V37A 3K3QA 1MIML 1H3TA 3LEXB 3TT3L 3MYZA 4LB8A 2DY2A 2QV4A 2YAMA 2NR6A 2EDXA 2GPZA 1CWVA 5C0AA 4H8PA 1W6WA 3SKNA 4L1SA 3T8MA 4A6YL 1GTFA 4G9FD 3EYOB 2GCYB 4ZMNA 4X7SH 3IN0A 1CL7I 3I6LD 1F8TH 3VXOA 3BWAB 4IK6A 5ALCL 3SO3B 3CV5A 1S2EA 3VB8A 1Q8MA 2R4RH 3ZE1E 4NP9A 1EJOH 4NNPL 2FX8L 5IWLA 1AZRA 4N6QA 4L0YA 1D5ZB 3IFPB 4MAUH 4WEBL 1YPZF 3FSAA 3QZWB 1BBJB 3V95A 1WAAF 4AH2B 3CFCL 2K9UA 4AQAB 5EPMA 5I6OA 4HKXB 2WMPB 2H26A 5ALBH 1ETJA 5F7MC 5FWRA 3COOA 3OKNA 2XN0A 1J05B 3C5ZD 2Y6SD 3C87A 3G08A 3IJHA 3CCHA 5CUSL 4PJXB 2C9PA 3QAZC 1MCNA 4HGWA 3X2QB 1MFDL 4JFPA 3TLRA 2YBGA 3TS8A 1MLCA 1AQDB 1MELA 4ESKA 4HMCA 2J7LA 3GMLB 4KTEL 3ZJAA 2CAKA 2BOCB