5KVEE

Zika specific antibody, zv-48, bound to zika envelope diii
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
101
structure length
101
Chain Sequence
VSYSLCTAAFTFTKIPAETLHGTVTVEVQYAGTDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVGEKKITHHWHRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ZIKA Envelope DIII
publication title Structural Basis of Zika Virus-Specific Antibody Protection.
pubmed doi rcsb
source organism Zika virus
molecule tags Viral protein/immune system
total genus 13
structure length 101
sequence length 101
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5kveE00
5AAWC 1SVBA 2GG1A 5KVEE 2I69A 2H0PA 4FFZA 5JHLA 1S6NA 3C5XA 1Z3RA 4UTCA 3G7TA 3J27A 2JSFA 1UZGA 5GZOA 1ZTXE 2JV6A 5JHMA 2P5PA 4GT0A 3UZQB 5IZ7A 4UTBA 4FFYA 3N43F 4GSXA 5LBSA 1TG8A 3UZVA 1RERA 3C6EA 2R69A 3N40F 3N41F 3UAJA 2ALAA 4ALAC 5LCVA 1URZA 4BZ1A 3IRCA 1Z66A 5KVDE 1OKEA 3WE1A 3VTTA 5GZNA 5H37A 4L5FE 4UTAA 3N44F 4AL8C 3UYPB 4UT9A 5KVFE 4UT6A 5B1CA 5AAMC 1PJWA 2V33A 3J2PA 5IREA 3N42F 5LBVA 4AM0Q 4X42A 2JQMA 1OK8A 1OANA 5KVGE 3UZEC 2R29A 4FG0A 2HG0A 3MUUA 3P54A 4BZ2A
chains in the Genus database with same CATH superfamily
2P5EB 3ROOB 3J7HA 3NFPB 4KXBA 3JVGA 2BNQB 1GL4B 3HI6L 4KKPA 1TFHA 1HSAB 4Y5YC 5F0PB 2JCCB 4GG6E 5IJKA 2H3KA 2VXQH 2EDJA 4RCAA 1GGIH 4AOFA 1X5LA 1EAJA 4HEMA 4LMQE 1SXCA 1VF5C 2Z1KA 5BS0A 4YUEH 2UWEA 1JWUB 1J8SA 3TO2B 3ZTJG 4AENA 7TAAA 3MXWH 2IAMB 2QPFA 3QZPA 1FI8C 4AM0A 4RNRB 4KK8C 1IAII 5FUCC 5DC0A 3RWDB 5E8OA 3RBGA 3CFEA 3QHFH 3D18A 5T1KA 3IS0X 5TF0A 5T3ZH 4MNHA 4OLXH 3PABA 2D7OA 3PNRB 3VI3F 5ETUA 5EU3B 3GUTB 5DHYA 3NIGF 4OCWH 3FSAA 2A6KA 3OJMB 3EH2A 5GPRA 1OPGH 2XWCA 3HNTH 4QJ5B 2WKOA 1MQKL 4PB0H 4PREA 3HS0A 1P6WA 4LEXL 4WCYL 2MMXA 2MTPA 4NFCA 1OP3K 1VHPA 2HKAA 3G6JA 1TZOA 3FTXA 3ETBJ 3T0BA 4UU9A 5LDUA 4BKLA 4EXPX 4LDEB 1AQKH 2FD6H 3QPQD 5F71A 1JK8A 4DGVL 4M5SA 3ZTNL 4A37A 3KYAA 5BQDA 1R6VA 2DF3A 3HMWH 4LKCB 4QHNB 1OAYL 5K9QI 1RVFH 3SE4A 3FZUC 5TDNA 3DSFL 1XR9B 2ROYA 2NYYD 2PPFA 3MLYL 4NEHB 2A38A 1MUJB 4XXDB 4U7SA 5ALBH 1G0YR 3RL2A 5CR8A 4EN3A 2YAQA 5BRQA 4RFOH 1VFUA 2DQCH 1KB5B 3LNDA 5I1CH 1XGQB 2WYTA 4OF5A 3TS8A 3QIWC 1ZSHA 4EOWL 4LPXA 3SE8H 2WHVA 1E27A 2GYSA 4XTRC 2RTTA 3ISWA 4GRWE 5FFGA 4IHOB 2N7BA 5CLXA 5CFHA 3HHSB 3DVGA 2QDWA 3BKML 4OF6A 4JRYB 1F58H 5FGSA 2WCSA 5DJ2B 3GMRA 3HEIB 1X5YA 4KROD 5F1SA 3CC1A 5I2IB 3CFCL 1DJZA 3DGGB 1GYWA 1ID5I 4MB3A 2AQ1A 4QT5B 3KPPA 3QULB 2CA3A 5DFVD 4TVUA 1INQA 4FXGB 3ZO9A 1UM5L 5IK3A 5JXED 1WZLA 1NM4A 1OP3H 2DMKA 4LKXA 4KU1A 1C5DA 1UD4A 1LWJA 3WUZA 4L8CA 4WHCA 2DJ4A 3F5WB 4NERA 3QAQA 4NUJB 4Z7OE 2XG4A 3GEFA 1ZTXE 2VDPH 3EG9B 2CHNA 3TVMC 4PRHD 2ZUWA 5FUOH 4U3SB 4MMZC 5IUSA 1DBBL 1KYFA 3HI1A 2C9QA 4ZMNA 4TNVF 3N85L 1JHKH 1IGIH 1CICC 5EO1B 5EEXA 4QRSA 1G7MA 1AACA 3BVVA 3EOTH 2QFRA 1R9FA 4LBEB 4UQAA 2IQ9H 5HHVH 5HDQH 4UQBA 1ZT4B 4WFFD 1ZE3C 2PABA 3D3VE 3RAJL 4UDTA 3SE3C 4HBCL 2OR9H 2ZWNA 3APNA 3EYUL 4BUQA 1M4KA 1NEPA 5GGTA 2OMTA 5J9PA 4LIQH 2X9YA 4Z7WF 4FQJL 5EU6D 1SHMA 3WLWD 1AXTH 5F93C 1I3VA 2YEVB 1A3RL 1KTLA 4TVPE 3TYGL 3KXFB 4Q97A 4D8PA 1G9MC 3BQUD 4PRPA 4C56D 4WGKA 4JFFA 5FB8A 4A2FA 2PXYA 3F2LA 3IJ7A 4LCCB 5CCGE 2DI8A 4RAHA 4XP6L 4ODSH 3RWJA 1NCGA 3NFNA 4M9OA 3U1PA 3PHAA 2RBLA 2BH0A 3X1GA 4U33A 2PWHA 4HOXA 1KNOA 5DO8A 3WO3B 3TURA 3T5WA 3HZYB 3BPLB 2LGNA 3T8XA 4RFEA 4R3SA 3MNZA 4YAQA 4YL4A 4NC2B 2JJSA 4NO0B 4PY7A 4WEEA 5EOCH 4OQ1A 3SY6A 1YPZB 5FECA 4K55A 1BM3L 1L0PA 2G2NA 1I1AD 4ZUWB 5AFAA 4UT9L 5BRPA 1S9VA 3GBLA 4K4KA 5IW6B 5CNHA 3UJIH 4L9LC 1UA7A 4HD9A 4GMTL 4NJ9L 4R84A 3PGCA 3UTQB 1ITBB 2AJYL 1U8QB 3JV6B 4HMCA 3RGVA 1F00I 2FYVA 2BSRB 4HJ0D 4LSPL 1KYDA 2AV7B 4IOIA 5E4OA 2WXNA 4A7QA 2G30A 1W0YT 4OLVL 5H37H 3Q8AA 3SCMB 1BLNA 1CG9A 1DBJL 1PLGL 1UXMA 4EAEA 2OMVA 3QCTH 4D2NA 2XYCA 5E6ID 3PL6A 5D7IB 5FK9A 1KPVB 1HCZA 1DQDH 1FZOB 3GIVB 2Z7ZA 3H8NA 5DJ0A 1C1EH 4X7TB 3T77B 1IQDB 2I27N 3SKUD 1NH6A 2RCSH 4LSTH 3SYPA 1GY2A 4FGMA 2NR6C 1U2YA 3ZDXB 2XSKA 3GPEA 5HYJD 4PS4H 1TQTA 2V2XA 4YZFE 3STLA 4N68A 1OAUH 4F58L 1PZ5B 4H20L 4Y4HD 5KSBF 3DBSA 2UZXB 4QHUB 3SOTA 3MRDA 4GEJA 1KGJA 1PG7L 2NY1C 1T0OA 2X1PA 4J23A 1ZPUA 1TNNA 3DC0A 2EIBA 3NN8A 3UTSE 1WG3A 4GUOA 1PFCA 5BZWA 3FHEA 4LRNL 1R3KB 3NJGA 3DJ9A 1NCJA 3VFTA 2BVQA 2N4IA 4F27A 2ZCZA 3QDGA 2VM4A 2HTLC 4M48L 3NVQA 4OUUB 4NQDE 1E9QB 3G9VA 2CG9X 1O5PA 3X14B 1BAWA 2VJ8A 1HXYA 3VNYA 2ZSWB 3WIAA 1TG8A 4JFDA 4HJIA 3ZHLA 3MCKA 1CCZA 3VFMA 4MA7L 1AGFA 4N25A 4WUKH 4AY0A 1ADQL 4FA6A 3B8YA 3LHPL 3VFNB 3WHE1 4OZIA 2CGZA 2ZOLA 4EBQL 3OZLA 1WT5C 4N0UA 3V4UL 5DMKA 2RHEA 5J1TC 1OGPA 4B9IA 4M5ZH 3AW5A 2CD0A 1QLEH 1WCBA 4P2OC 4N5EC 1BFTA 1RZ8B 3N0PB 3T4AC 3U7AA 5I76B 1ZGLP 3K72A 4XMWA 4WTXA 1X9RA 2BVEA 1JFHA 4PJHE 4ZJ9A 3SPHA 3UX9B 2FWOB 1VACB 4UT7L 5L8KB 4HCRH 3DJZA 1IFRA 1SEQL 2NZ9C 4E9QA 5LGYA 2VLRB 2XETA 1ZHBB 2OX5B 3Q2LA 4XPHH 4NUGH 3S6CA 3ZQWA 4CGUB 2W9DL 4XBEH 3RA7L 2BRQA 3MBWB 4HX1A 4IDJH 3CLEL 4Z3HA 2BHFA 3CFIC 2XWZA 3RIAK 3VFWA 1V8HA 2NY5H 2LT9A 2OI9B 3NEEA 1XBRA 2GTWB 1O9VA 1U93A 4NI6A 4ZUTB 1E2ZA 1BOGB 1FYTA 2H4EA 3MVSA 3MRMA 4OM0H 4DCQA 3RL1A 1JZDC 2Y36L 1BVOA 3IDMB 1GYCA 2R0WL 3ZE0E 4MA1C 5IB5B 1KJ2B 1J0YA 1D5BB 1YYLL 2CO7A 2YMTA 3KPQA 5FFLA 4B60A 5I15H 4J4PC 4WW1A 3P3YA 2OPCA 1ACZA 4BWWA 3TF4A 3DUUA 2D03H 5I8KL 3CDFA 1FVDB 1QKZL 4FFZA 1A6AA 1PPIA 2PPCA 4PJ8A 2K9UA 5I18H 1QLRA 3HPLB 3QEUB 1FSKB 3U0WH 3BEWA 2EXWD 2F53A 1NIBA 4I48A 5FYLD 3QUZB 2H3XC 4JMNA 1CYGA 4PCYA 5EULV 5IKCA 4MZRA 2YPVL 3BSGA 1G4MA 2CO6A 1P4LA 3GJFB 2E7BA 1YNTB 1P6FA 3S3DB 5LGJA 4I2XE 3WSQL 1AKPA 5DVNA 1WC7B 2ID5A 3CSTA 1KTCA 7FABH 2FECL 3ZYOA 4M7KL 3MV8B 2JELL 1PKQA 3EOBA 3WKMH 3IPEA 4UOQA 2GCYB 1JZ5A 3QISA 3LKQA 1E65A 2HFEB 3ZTCC 4O2EA 1HH9A 4JPQA 3STZB 5KYUA 1U8LB 3VG9B 5ESAB 4R97C 4UQ2B 3V4PH 3BGAA 4OGQC 4OGZA 5AW7B 3MU3A 3MTRA 1FGVH 5C7XL 2GJJA 1BF5A 3FTUA 4AW7A 1ZD6A 5ACZA 3APDA 3C09B 4MJIE 3WI9A 3EGDB 1KT2A 4ES9A 4MJHA 1JVKA 1VGEH 5ISZA 5I8CA 4NZTH 5HHMB 4LCIH 3PDOA 1HJBC 4XPTH 2D3JA 4JG5A 1KBWA 1V7ML 4HC1A 4NLAA 3ET9F 1PCXA 2ATKA 4G6FB 2P5EA 5C08A 3EFOB 2K3TA 2E75C 25C8H 4YDMA 2TAAA 3SDDC 3VAEA 5SX5K 8FABB 5K5YA 5AVYB 3BAWA 5HVHC 2JCCA 4FOMA 4FHBD 3RUGF 4L5FE 5BV7B 4GSUA 4PI0A 4BXVA 4LARL 4YK4B 1CVRA 4KV5F 1KPUB 5JPMA 1M7DA 4P46A 3HHRB 1ZTMA 1S7RB 1U8NA 2H1PL 5HJ3A 1OD9A 1JWUA 3P11H 4HWBH 2FQFA 4OM1H 3TT3H 3O4LE 4PQXA 3J2PA 4PJGE 5CEZD 4ODXA 1GPOH 4YHNB 2F7IA 4D0DB 4H8PA 2W88A 4PRIE 1G1OA 4CC1A 4FYSA 2HFFA 2Z34A 5EU3A 1UT1A 4RGMB 1G6RB 2GJ6B 5IFHH 3DX8B 2BZDA 1FVEB 2GTZB 3GDCA 3FO2B 1FCGA 3L13A 2RACA 3AMLA 3VD1A 2JWYA 4E9YA 2YUZA 1Y6NR 1ND0A 5I0XA 5I8OH 4JM4L 3EFFA 3HG4A 2DMCA 3MRFA 4N8CH 2ZWLT 2ZCHH 3O8XD 3QCVL 4YMPA 2YA1A 3O0RH 3SD5A 4CMMB 3BAKA 3O6MH 4JY5L 2EKSA 2ERJB 2DWDA 4Y8AA 5DF0A 3D69B 5ALCH 1E4KC 3DTDA 4XN8A 3AS3A 1LO3L 1KCSH 4OTXL 5D71L 1KB9J 5E6ZA 4YC2C 3QFGA 1O6SA 2CMRH 1CLYH 4XCYB 3VM7A 1JGVH 5CJOH 1WAEA 1JPTL 3V55A 5JHLH 1DJXA 4GQQA 2J8HA 2YEQA 2BSDA 3VYNA 4UNVA 1DBKH 5EUOB 5AVWB 3LN5A 1OHZA 1YEKL 1MCRA 1NKGA 1SNRA 1QSED 3UO1L 1NMCC 3WTXA 4TL4A 3MOQA 4OKDA 2AKRB 5CM1A 1ORSB 2WP3O 1BD2D 1FZJB 3TLRA 2HN7B 4JKMA 4BDVB 2VDLH 3V6OC 4JN2B 4PJIF 4U1KA 4XE5B 3BJLA 2BSEA 5IVXA 1CI3M 1Z32X 1E3ZA 1IBFA 3BPOC 4BHUI 4G8FB 4LLWB 3L5HA 3TBSA 1WBXB 5AD0A 1TIUA 5CMAA 4AJYV 3KPLB 3KZ8A 4MYPA 3PY9A 1I7UB 1GGIL 5EUKB 2Z3FA 1TLMA 4Z9KB 1C5BL 1RZKH 4IRZH 4JRYA 4X9YA 1SF3A 4YUEL 4D9RE 4PRNA 3I6LD 1M6OA 3D34A 3MXWL 5ILTH 4AQAB 2DS4A 3FL7A 4WU5A 4FXGA 3DX9A 1CE6B 3ROLA 3HG1E 5LBGA 5D8JL 3QHFL 3VWJB 5I6NA 1OCZB 3F5WA 4HJGB 5T3ZL 3SE6A 4NUJA 1O7DE 1WTLA 4KXAA 1RK7A 2ADIA 2OMYB 1UACH 3P4MB 4IIQB 4OZFB 2AJXH 3UADA 5JW5A 5KYXA 1U8OA 2O30A 1Y1DA 2VDQH 2DQDL 2KZWA 4LVEA 5EO1A 4KK5D 4B41A 2OXGB 3BEVB 3HNTL 3QIWB 3GLDA 3UAFA 4LBEA 3D39A 4ABVA 1ZT4A 3ME0A 1SXBA 3RVXC 1RHHB 3X1FA 1YAZA 2B5IB 1MREH 3IU3A 5FLVA 3I3BA 1ERNA 3AFLA 1CC3A 1AZNA 4JRXD 5DUML 3VGEA 3IGUA 2ZONA 3VDBA 3CCHA 1AQKL 5FS5A 2NLJB 5FLUA 2R2HB 1HWHB 5J56B 1I1CA 4HH9B 4JR9H 1UB6A 3BKYL 5LGHH 4URTB 3PWVB 1RVFL 5LLIC 4DVBB 4P04A 3SYCA 4KK9C 4XMLH 2OP4H 4XNUL 3UCQA 3FQ2A 4DKTA 1RAMA 1WFTA 1D9KA 2FO8A 5TJWK 4A7GA 4HSQA 4TXVB 5CN3A 1TITA 4MMZB 4XE0A 5H94A 3QJHA 4G8GE 2FO4A 2DQCL 1UEYA 3WLBA 1CICB 1BQRA 1JMXA 3HRZC 3Q44A 3HG3A 1QRNB 1SOXA 1Y0LB 2PF6A 4G2AA 4KHTH 4F3FB 4OFVA 4BK4A 2ENQA 3MGTA 4HZLB 4NO0A 3VCLA 5GZOD 3V7AE 4AH2A 1YPZA 5DI8A 3LS4L 4NJAL 4NGHH 4LDLB 5IW6A 3BLBA 2H5UA 2R2EB 1JS4A 2H6PA 3UBFA 2ZNWA 1EXUB 1E4XH 5TGBB 5I8EB 4DKEH 2DQUH 4X4ZA 4KC3B 3UTQA 4KKAC 3JV6A 1H0DA 1BQHB 3HPJA 5BQ7B 2E47A 2KT6A 2OCFD 1SJXA 4NWTH 1N26A 1EUUA 4IS6B 1BX2A 4ZRGA 3C5JB 1EZLA 1TSHA 3X17A 3ZDYF 1OAKH 1TZGL 2RMNA 2FX7L 1Q0EA 2DQHH 2EIDA 2X09A 2NSXA 5D7IA 2VDPL 5FUOL 3SSGA 2R56H 1DUZB 3EJJX 4PJDE 1IQDA 3DBXA 2OK0H 1JHKL 2A6IB 1IGIL 5DJXA 5EBLA 5K1VA 1RZ7H 3EOTL 4WWOA 1ZS2A 32C2A 2IQ9L 4QHUA 5HHVL 4LVHB 4OZGE 5IHLB 4Z0XA 3QXTA 3P4NA 3KM2A 1N2RA 1L9RA 2YQGA 5D7JB 4W9JC 4GAJH 4KX7A 3WIHH 4UQ9A 1JCVA 3SQBB 4AZUA 2KBGA 4PJEE 4ZW7A 3ABZA 4OCRH 1TVBB 5H4ZA 3ILDA 1QTSA 3CK0L 5IJDC 2RFXA 35C8H 4XNDA 4LIQL 3UDWC 4OD2B 5BXFA 3E7JA 4RVBA 3P3RA 2YK1H 4MKMA 4EPSA 1YJDC 4JM2B 3G5XB 3VD4A 1E9QA 3KNBB 3X14A 2D9QB 3L9EA 1U92A 4XXCC 2XTSA 3OKNA 4ODSL 1VIWA 1J8HE 1JTTA 3GXFA 4IRSC 3DX1A 2GBTA 2O1AA 4AXWB 1G5AA 3DECA 5TE7L 1MLCA 2BNQD 4ZODA 4LNRA 1JHLL 5KBNC 5EOTB 1OCCB 4FNRA 4WSJA 4BFRA 3S5LB 3U46B 5EOCL 2J1WA 3PS6A 2XXFA 3FT4B 2FNWA 1OP4A 1VEOA 1Q4NX 2LFGA 2PLTA 2FJFB 4OH2A 4BQCA 4ZMVA 3NCMA 3UJIL 3O6FD 2FWOA 2BVOB 4JJHA 2J6EH 1KLGA 1A66A 4I77H 1ZJAA 5IGXL 1A4JA 3KEHA 3SDYH 4FLOA 1NANI 4J3BA 5KYWA 1U58A 1ZHBA 3P3TA 3P0GB 4H44C 4QOKE 4JW3A 1DJHA 1S46A 3JT0A 1KYOJ 3UZVA 2DEWX 1YG9A 2GFBA 2CBOA 2Z64C 4HGMA 4GG6B 2Y6SC 3ML8A 3B9AA 4GKZB 4IMKC 4F5CA 4FTVD 4CU7A 2ZUQC 3N06B 4MD4B 4O02H 3RNQB 4R8WH 2IGFH 3KWUA 4YPGA 4PG2A 1ASPA 1C1EL 3TWCH 1OF2B 1GR7A 5L4MA 1I8LA 3H4FA 3MR9B 5DJDB 3KPSD 2QSCH 3L7EA 4HSCX 5SWSA 4PS4L 5L88H 4PGZA 1NSNH 3H7BB 5IB5A 1OAUL 4RMUA 2C9RA 1KJ2A 3BZ4A 2OL3A 4L4JA 1MW2A 2YGOA 4BZ1L 3FTSA 3L1FA 2WQAA 5ICYB 4HUVA 1MCNA 2J88H 5E6RB 3SGJA 3B9VA 4QXTB 4XZ4A 4XO5A 1FVDA 5B39B 4P59H 2VL5B 3S35L 4UB0H 5IHWA 3MJ7A 5D7KD 5CLZA 4MD0B 2CGRL 5EBMB 2R0ZH 5D9SA 4GBXA 3MTXA 2UXGA 3MJ8A 1QUNB 3DX4A 2FTAA 3QZWB 3AG4B 1YEEH 1W72A 4P5TC 1YNTA 4RMWA 1C7TA 5D1XA 4UZGA 4X4XB 3T3PF 1ED3B 4KGJA 1K2DB 4Y4KC 2UZIH 1T22B 2FH8A 4HWUA 4FA7B 3NZ8B 3FCTB 4WUUD 4Y1SA 1HQRB 3MLUH 4M8QB 1SJEB 4KHXH 1GW0A 5MERB 2R29A 3MV8A 2O5ZH 3DDGA 4WUKL 1JE6A 5DFWH 5I1KH 2X70B 1CGSH 2AQTA 2EDKA 4A7SA 4MA1B 1AIFB 3ARPA 4GI9A 1KIUB 4N0YH 5IB3B 2X9ZA 2BIIA 1IGJA 1YMHA 1U8LA 4K8RC 1AD0A 1MFUA 1K5NB 2YIHA 4POUB 3Q3GA 1QLEL 2MOQA 4FADA 2WLKA 4AMKH 4XHJC 2WB7A 1HXMB 2J56A 3QI9A 3W9EA 5D7LD 3D25B 3GSXA 4QNPE 4NS0A 3VE0B 4GAGH 2RD0A 1XHHA 4HCRL 2ZSVB 4AEEA 4H26A 3AG1B 3QUYA 4N2BA 1Y18A 1XCQB 4PWEA 4XPHL 1SJHB 4PV9B 4E9WA 4XBEL 3BH9B 4IDJL 5ENWA 3NH7H 4GRWB 1H3GA 3ARGB 4NZRL 2O72A 2NY5L 3D09A 4HKXB 2IDQA 4QRFA 5AVRB 1MF2H 4OZHF 2PPAA 2BJMH 4OI9A 4XN9A 3WD5H 2H2SD 5F0LB 1KPUA 3NZUA 3FS9A 4HWZB 4MXQD 3L9RB 4JDEA 3EW3B 3RWEB 4E68A 1HINL 4RX4A 5HGBA 1NC4D 5D6CB 2BSCA 4R97B 2VZSA 4LLUA 4TL5A 1HIMH 4F7EB 5AW1B 5I15L 2YZ8A 2EC8A 3DMMC 1QO3A 2YMOA 2D03L 4TTGA 4Z7OB 5F3HB 3TO4A 4OF0A 4D0DA 3EO1B 4GXUN 2G3MA 3UBXA 1L9SA 5I1GH 2OQJA 2ZPKH 1UJ3B 5I18L 1T04A 5MI0C 2DLTA 3FHQA 3I9AA 2GJ6A 1FVEA 3KXFD 4H88H 1P53A 1BBJB 2CR0A 3AT9A 4HIIB 2W0PA 3MSPA 1R34A 1SDAB 1HEJC 1KCVL 4JGMA 5D1QA 3ECQA 1JGUH 3E3QC 1LMIA 3ZN6A 4HUXB 1YNKL 7FABL 1QSFA 4CMMA 4LLQA 1M7UA 4NKQB 3WG7B 4EF3A 3WKML 1IAOB 2E7DA 7PAZA 3AXHA 1TJHH 4OT1H 1B4RA 2Z31A 5EEYA 2C9UA 3MRHB 1WWBX 2YUVA 3PP4H 2H32A 5LKNA 1Z9PA 1UUSA 1GAFH 4J3WA 1M71A 5FHBL 3LKSB 4F9PC 3CN2A 3QWOB 4JFHD 4Y19A 2CM5A 3W11D 1FGVL 1QZ1A 3NIGE 3QE5A 4H0LC 5GGTH 2VZVA 2WLYA 4L3EB 1U8IA 3N1GC 3T8MA 4A2EA 1VGEL 3O3UN 4P2AA 1RURH 5GGQH 4LHUD 4NZTL 4LCIL 1ID2A 4Y2DB 3S3JA 3ZKXC 1NPNA 3H42H 1EHAA 2YSSB 3FSOA 4YFLI 3F7QA 2XNAB 5EZLB 4BDVA 2VR4A 4JN2A 4LAQH 1G7HB 1E8XA 2RH0A 25C8L 2W8CA 3H9HB 4XNXH 5DT1H 1FNHA 1KGCD 3CHOA 1KMGA 4Q56A 4G8FA 5CZVH 5IJBC 2DMBA 4L1LA 3T1WA 2AQRA 1KIRB 2BSBA 4EVNA 3HCVA 2NUPB 3QWRA 2CO4A 5EUKA 1N59B 1MNNA 1Q94B 3M1CA 1J5OH 5JXAH 4LCUA 5KJRL 3V0FA 1P5VA 3ZZLA 2GTQA 1XGPA 3DJRA 4FA8A 4OM1L 4AQAA 2UZYB 3TT3L 4LPVA 1TETH 2YUXA 3I9GH 1BZ9B 1HSBA 3LV3B 4AK1A 3ECBB 4FFYL 4J8RB 4N0FB 1YY9D 4Z7UA 1JF5A 4U49A 3TIDA 3GBDA 2YXWA 1TJIL 3MRIA 5HHOA 3VWJA 1NLDH 3QH3B 2I24N 2Y22A 4ZMOA 4DFHA 4OZFA 3MRCB 4U1JA 3P4MA 2I9TB 3V4VB 3EKCA 1MCBA 2J4WH 1HHKB 1RHFA 4TMPA 5IFHL 2WUBH 4H40A 1WITA 4ABQA 5L2JB 3BW9B 3BVDB 4LQ1A 1E50A 1OTTC 4M8UA 3M1BB 1OW0C 5AW9B 3GMQA 4EI5B 3BEVA 5I8OL 3I6SA 4WV1C 3BPOB 2FHBA 4N8CL 3ZT5A 2ZCHL 3UTSB 2F61A 2AEIT 3O0RL 3FSZA 3O6ML 3RWIB 3BN3B 1JMZA 5ALCL 5IR1B 2IPKA 2ETWA 5DS2A 2VN3A 2M26A 1BYOA 1KCSL 4NQDB 2NLJA 3RVWD 2OSXA 3WYRA 1GKEA 3ZUNC 2OR7A 3PJSA 2WZPA 4Y5XB 4S1RH 3GS7A 2W60A 2CA4A 2X4NB 4HH9A 4NC0B 3QS2A 2DWEB 1JGVL 5B1CA 2R4RH 1NBQA 3EGXA 5CJOL 4L0ZA 3SPVB 3QJVB 2M83A 1LJMA 2IOMA 3LKOB 5F7UA 3KLDA 1GTFA 1DBKL 5HDOA 4AYFA 3BVNB 4GQRA 4AM0Q 1CFSA 2VLRD 2HSIA 4N87A 4X8GA 2AMGA 1KWGA 5DU7A 2QZQA 2V17L 4HPHA 3FQXB 1SHWA 3D7PA 1XZ0A 1BQUA 2VDLL 1QRNA 1Y0LA 4TNGA 1L4IA 2IG2H 1MIEH 3OMAB 4GW5B 1J7VR 4HZLA 3AZUA 4AGLA 3HZVB 4O9HH 3KYNB 4GAYB 4Z7WE 2LW3A 2R2EA 1ZHKA 3I6KB 5JHAA 4IW4C 5EU5A 1XCXA 2YQ2A 5I8EA 3RPIB 3MROB 2LAGB 4LFHG 3MV9E 3G7TA 3OGCA 2Z4QB 2VDNB 3FO0H 3QT2A 5F7NC 4B0MM 1Q1JL 2A73B 4JRWA 4C54A 5ILTL 3FFCD 1BLIA 2CDGB 1A4KB 4PJXA 2ZUYA 4HOMA 2ESVE 5BQ7A 2EH8H 2V2WA 3DGCR 2EEXA 2HYMA 5A2AA 3ECVA 3IT8D 1DE4B 4KDTA 4MFHA 2WBXA 5B7MA 3U2SB 2GUOB 1KCKA 4PJ9B 4PTTA 2MCG1 3QUZD 4ZTPH 3GHPA 4FLRA 4PVNA 1UACL 2GHZA 1J9SA 5I28A 2AJXL 1T3FB 2UWEF 1DUZA 4YDJB 1HH6B 3HLAA 3NSFA 3W81A 1PEZA 2X4SB 5JIDA 5J57B 2APFA 1OTSD 2KUTA 1OE1A 4JGUA 1M1XB 4DZBB 1G43A 5DURB 4ZMQA 3GDBA 4P2CG 4XNMA 3AC0A 3FB8B 4ZMTA 5J3HD 1UVQB 2DOCA 2CK2A 3E8UL 5C2BL 2X1OA 3BQUA 4FNLH 2E7CA 4OD2A 5FYKU 4KJWD 4ZQKB 2WKOF 4I2XB 3B1TA 1JWMA 1E9PA 2D7TH 2LTQC 2BP3A 2ZYSA 2EDDA 4JR9L 5LGHL 2GIYA 3QUXD 4JM2A 1UZ6E 2CKNA 3UIZA 4NQEE 1V5JA 4XMLL 3LYRA 4P3WA 3DVNA 4PS8A 2VXTL 3KPTA 4LQFL 4OCXH 5HHMD 4UANA 2EQDA 1LD9A 3G6JF 2FT8A 3G6DH 3D85B 3DXAD 4X9HA 1AHWC 3NGBC 3RGBA 3ARBB 1IBBA 5MHSE 4B9GA 3VACA 5BCAA 2VDMB 3B83A 4HPYH 1G9HA 3TBVB 4GEIA 1AO7A 1DHKA 2MOVA 3OJDB 3VYOA 2BNUA 3WTTA 2WXHA 3P0YL 3M8OH 4PLJC 4ZMWA 1F4XH 1NCAL 3WUWA 5JW4M 3PHQB 1ZVHA 3FT4A 1KYUA 2BWQA 4MB1A 5L2KB 1MH5A 2EYRB 3CFDA 3ZX1A 2GITB 5DGQA 4NC1C 4NGHL 2HRPH 5IOKA 1JGLL 2VDOH 2AEPH 2GK0A 1YZZA 1BV8A 3GMPB 1O5DT 2X87A 4TLSA 1E4XL 4JY6B 4DKEL 1TTAA 3DARA 1FFOA 4A7UA 4TSAL 5E70A 4N1CA 2NW2B 4NWTL 3DO4A 3HKFA 5LDSA 1PEWA 2BOCA 3CBJB 5KVMC 2DMHA 3LNGA 2K7QA 5F0JB 3IGAB 4J39A 1OAKL 2GPZA 4LP4A 4KVCH 1XVSA 4RA3A 4WO4C 2DQHL 1QPXA 1P9MA 4WTQA 4HC1H 1BAFH 2DM2A 1PY0A 2Z91B 2R56L 2HLAB 4POZD 4WI5A 1N5YH 1VSCA 5BXFB 2OK0L 3MA7A 3ARDB 3MR9A 1H8OA 2AXWA 3ZE1B 1BAGA 5JMOC 2NX5A 3C9NA 1BZ7B 3ES6A 2I60H 5HY9A 2F5AH 2VISB 3OHMB 5IB1B 1HKLH 5DQ9A 3MV11 4Q6IA 5C0FA 4QHPA 4BK8A 3BDXA 1EXGA 1UCTA 3FN3A 4UNIA 3NK3A 4GAJL 1USZA 3OAZH 4HWNA 4JGJA 3SO5A 2IFFL 3V5KB 4PRIB 1U8MB 3WIHL 3WHXA 3MLWL 1EO7A 4OCRL 3VH8A 1EJ8A 5HYQA 5F21B 5EBMA 35C8L 2CDEA 4K5PA 1TTBA 4NNYA 2NTSP 4NQVB 5FW8A 1P5UA 1EAPB 2KI6A 5AYQA 3BVXA 4F7CB 2YK1L 2IO5A 3MREA 1CGUA 1HHGA 4WFGD 4X4XA 4PD4K 6FABH 2AZAA 2NZIA 2FLRT 1T22A 4GQ9H 2ARWA 4ZG1A 3NZ8A 2C9VA 2ZUQB 3UJJL 1HQRA 4ZTEA 2NDGA 4FCHA 3EH3B 1YA5A 3LXAA 1CDIA 4FD0A 4P5KA 1H19A 3HIZA 3F58H 5DZ9A 1AIFA 4KQ3H 3EHBB 1HZKA 1VADB 2Z35B 5GS1C 5KVDE 3H4HA 3MLVH 3PWPA 3MLSH 1UWXK 1K3IA 1K5NA 1QRKA 2J8UA 2AV1A 3C8KA 2HH0H 4ZUSA 3QDJB 1EFQA 3CQQA 2C34A 4RAVA 2OW7A 2Y0SA 4I13B 2WTOA 1D5XA 2WLIA 1JZ3A 4HFWA 1HXMA 3TBYA 3OR7A 5IROA 2H6UA 2X3BA 4PFEA 3PWJB 4K94C 4OFYA 2BSSA 4Y2LA 5EORH 4I77L 3PV6B 4HV8A 3VE0A 1MG3C 3SDYL 2H9GB 4LLVA 3TBWB 1GCFA 1I3RB 3FZUD 4GSQA 3H1ZA 1MFAH 3QK0A 2I85A 4YNYA 2GJPA 5LWYH 3H9ZA 4DK3A 1RK1A 3L3KB 2DLHA 2CBMA 4ETQA 2FWUA 4Y4KB 3R0NA 2DKUA 3IF1B 4L1TA 3QPXH 5IV2B 1G1YA 3NJFA 1KB5H 3KBPA 1A6TB 3ARGA 3DETC 4HKXA 3IDUA 1PZUB 4O02L 5F6HJ 2APTA 4AGOA 2Q3AA 1P7QD 3C2SA 4P5MA 2IGFL 4YSOA 5BUAA 2QADC 4HLZH 5K69A 1Q1PA 1A5FL 1ZIAA 2J8OA 2SODB 3GXTA 3QIWD 4LSQH 2QSCL 4NOFA 4ZMLA 5J06A 5L88L 2GQHA 5FGBC 1NSNL 5D6CA 3CMOH 3KPOA 1A3ZA 3HG1B 3ARUA 4F7EA 4WHYG 2P28B 3OXRB 3B34A 4U31A 5C0GB 1G7QA 2J88L 2R1XB 4ZFFB 2CE6A 5CFAA 2VJ0A 5EEWA 2WY3B 4P23A 5AW4B 4P59L 3DLQR 3LVTA 4UB0L 3DX6B 3DYOA 2DQJL 1HZLA 3VSUA 5IHHA 3L8QA 5FOBA 4L9DA 1BQLH 4L4VB 1MRFH 4N0RA 4MS8C 2CAKA 4BWUA 43C9B 1YEEL 4NRZB 1XSJA 5HYEA 1BBJA 1ITCA 1PG7X 4MMYB 1DVQA 4GO8A 2XBTA 1U8JB 4KV5E 2WB1A 3D3VA 3HNVH 2UZIL 1KFAL 4JZNB 1M05A 3PWLB 2YQBA 3EJTA 4JGNA 1KXQE 5DDHB 3BHBA 1DUYA 5FGRA 3MLUL 1JVOA 4N1HB 4HUXA 5C0AA 1FL6B 1VFMA 3KMDA 2E7LC 1CICD 4KRLB 3WO4C 4CADB 4NM4H 3ABKB 5A2KH 1VGKA 1HHIB 2RALA 1CGSL 3BMVA 4DQAA 4B3VA 4N0YL 4B95C 5HI3C 5C0DA 2O61B 2V0AA 2C7UB 2H47C 1AY1H 3OKDA 1FC2D 3QWOA 4OV6F 3HI5L 4IU3B 4WHTB 1F4YH 4ZMXA 5K59E 5C7ZA 3ZDWA 3BLKA 1QEWB 2I7OA 4G42A 3WXVL 4DPRA 2KPNA 3AU1A 4AMKL 1NUDA 5IP4A 4MVBC 5EC2A 1JV2B 2G60L 4G8GB 5IQ7H 4L1DA 4ONGH 4LF3B 1GIGH 4GAGL 5FKPA 3LS5L 4ANVA 1DCEA 4ORZC 5CD5C 1KY7A 4URKA 5J6HA 4OZIF 2B8OT 1EHXA 1S5IL 1UZ8A 3F04A 2UXFA 4GS7C 1Z9OA 4QRPE 2VRAA 5EZLA 4BSWB 2EE6A 1INEH 1X5MA 3NH7L 1U8CA 1X5GA 5E94B 3NT0A 1MCQA 4NXSA 3GSOB 2NY7H 2WVSA 2OSYA 3ARFC 3EZJB 4KH9A 1MF2L 2BJML 3WD5L 1UASA 5T3XL 5INCB 3RDTB 1XGUA 3WJJC 5INDB 2N1TE 1R5WA 3OX8B 5IHUH 4XX1G 3MUGB 3F12B 1HIML 1MCJA 5E0FA 5CD3B 4AIZB 2DLFH 3BXNB 4QKXB 3LV3A 4B9PA 3K80A 4KMLB 3ECBA 3SO3C 3O2DA 1RMFH 4G71B 1KBPA 3WL9B 5KAQF 2QV2A 2ZPKL 1MQ8A 4ZFGL 4HDIA 3DUSB 3MRCA 3O4OC 1OM3H 1FNEB 4HUWA 1R33A 2IXQA 1X44A 3MNDA 4YIQB 3BW9A 3B6SB 5EEZA 1TTFA 1TCMA 4X6BA 4Y4FC 2ZUVA 3O8XA 5EO9B 2X40A 3A6CH 4WJG3 3VQMA 3TH4T 1KFGA 5EB9A 3U0PB 1HN1A 3NJKA 2JI1A 3K6FA 3L4CA 1UXWB 5DHDA 4BELD 2NR6D 3IN2A 1RKRA 4RRPG 1KTBA 5KJ4A 2GK2A 5DRZB 4JANB 1PJ9A 3NRQA 4OT1L 1A7PH 5DZJA 4UTBA 4N6RA 2NY1D 3SDAC 5DZPA 3TA4D 3OM3B 5I75C 2V9UA 3OV6A 1TYEB 2P44B 4DP4X 4XHQA 1GAFL 4OY9A 5D93B 3F85A 1IO4C 3O2VH 2X4NA 3L5XH 5H37G 3RTQB 2ZX6A 4TULH 3TA3B 4ZAKB 2DWEA 5I5RA 5GGTL 3ESPA 4OLYH 4PGDB 4P99A 4DOHE 2H2PC 2XOTA 4X7EC 1FFNA 1J8HB 1T80A 4DW2L 2HT3C 1RURL 5GGQL 2HTLD 1UD6A 3MLXH 4XPAL 4R5XA 3T1FB 4L18A 1M7IB 3IDNB 4PTUA 1NBCA 4YGAB 4JG0L 2AAVA 2NY0C 1W6LA 3TV3H 1UATA 2NT1A 3QXDA 5IHZB 3HN8A 4U6YB 4LAQL 2FO1A 1UADC 1J9TA 3IB4A 3ULVH 4XNXL 1ZVSB 4Q2ZA 5E8PB 5DT1L 3R7QA 2P8LB 5FHAH 4PRDA 5CZVL 3LNIA 2YR3A 1C12B 4PJHA 1CGTA 3VFSA 1HNFA 1HOCB 4Y8DC 3RX9A 1S7XA 1L6XA 3I02A 1J5OL 5JXAL 3LZPA 5DS1A 3EO0B 1GZPB 4BQ6A 5ABZA 4ZNEE 4S1DC 4N5ED 2VE6B 5CJQH 3GKWL 1U6AL 1YY8B 3GJFK 4OVUA 3X12A 4QOKB 1A4KA 4JO4L 2LV4A 3OKLB 2F68X 2D0GA 2JCCF 1FCCA 5E1GA 2K4AA 2OBGA 4CNIB 5DWPA 4P2RE 2NZ9D 1J10A 1NLDL 3HE7C 3ULUE 1Q9OA 4JFXB 3SDCC 5TPWH 4M7ZC 1MW1A 3O9WB 5DYFA 4JVWA 5AAWA 2J4WL 3MRLB 2WUBL 3TOPA 1LILA 3IDXH 1HH6A 2LU3A 4K15A 3TZVC 2NY3C 3TTSA 2PTTB 4WWKC 3WDHA 3VXRE 1IBGH 3CIAA 1SN5A 4MAYC 3N04A 5DEZA 2X9XA 1M1XA 4MJJA 1XF1A 4N5UA 3F7RA 4OCLC 5ESQB 1IBHA 4APQA 2WYIA 4M43H 1CDHA 4JRXA 5KUKA 4AMXA 4AW4A 4AYID 4HS8H 4JFVA 2LLGA 1YCSA 3IXTB 4AV0A 1KJ2H 3AY4C 3DOIA 3T0EE 2PYED 2JSFA 1SYSA 5JIPA 3ZDYE 4J4PD 4NHUB 1J86A 5ABAA 1E28A 1F3JB 4S10A 3DSNB 4S11A 5K9QG 4I2XA 1PY4A 2JKIS 3LIZH 4NKOB 4S1RL 2ZYHA 1U21A 3Q2VA 3QDMA 1F41A 3OLEA 1T21A 1T6VN 3L54A 3T0AA 3HB3C 2PCXA 1Z2KA 4XP4H 5DK2B 3MGOB 3UZQB 3V8CA 4H8VA 2ZOOA 3V52H 4PY8I 4A7VA 1DBAL 5I74C 1B0GB 2EC9U 4XO4A 1WUNT 4YGVB 3VW3H 1G6VK 3FQ1A 2VM3A 3T4YB 4J6RH 4LGSB 3FK3A 3OWRA 4X6CB 4FQIH 4OCYL 5MEOB 4E9LA 5BVJB 3TBVA 1OCOB 3BUTA 5CINH 2NOYA 3MNWB 1KLFA 1NCHA 3QQDA 3APMA 2BP0B 2R29H 4N2OA 1MIEL 3CFMA 2CK0H 1XEUA 3N1QC 5IMLB 4MJIA 3U83A 1UKTA 1P84K 2VITB 2PTUA 2O4EA 2WINA 5ID1B 5AZ2L 1AGCB 4CL7A 3GI9H 2Y7NA 5D2NA 1AJ7H 1UYWH 5AALA 5DJZB 4JVUA 4XC1H 4Z3FA 2X4PB 5DYOB 1UGNA 4BM7A 4JY6A 2YN5A 1XEDA 4XX5A 4NPKA 2GEQA 4ZZFA 5KYYA 5IVXF 3RFZA 1MOEA 3FMGH 3WN5A 2EH8L 2NW2A 5CZXC 5B8CC 3AXIA 2NYZA 4XBPB 1KBVA 3ATDA 2Y1VA 4I1RA 3IGAA 3C5SB 3MAWA 5G55A 3L81A 1AMXA 1S9YA 1QPPA 2CWRA 4J12A 1MCPH 3IDYB 3WAJA 4ZTPL 2V6HA 2BCKB 4M7JH 4X0KA 1OWWA 1A6UL 3PQYA 3VGAB 1Y07A 3N91A 1XSKA 3SDDD 2JK5A 1FHNA 1WCQA 3ARDA 3C5ZC 1KZQA 3O4LA 5BV7H 4YHKL 1BZ7A 4PJ7A 4WSKA 3TN0B 2LFEA 3NESA 4PJGA 3U36A 1AG6A 1AFVL 1MKFA 1QQDB 1M2VB 3MUUA 1HZHH 1BYPA 4PRIA 5GIRB 4BZ2A 1T5XB 5E7FA 3GPSA 4W6WB 5LAXA 2VJXA 5CF3A 2IVFC 3AU0A 3A4EA 3LZLA 2LVCA 4FNLL 3FTZA 4H5SA 4UV4H 2W65A 2Y07H 4FFZL 1J18A 1LHZA 5EMYA 4RGNE 1JPST 2X44D 5FO2A 3IGKA 1A1NB 2YAHA 2GSGB 4L3ED 3KYOA 1CLZH 1HL9A 3MRGA 1RPUA 2MKLC 1ZLVK 3TEXA 1G6RH 1I82A 1U8PA 1XIWB 2V3DA 3CZJA 4WNQB 4Q0XH 2A6JB 4Y2DD 2VLJB 3I84A 1JD7A 1NIFA 3F62A 4P2QE 1DEDA 5ES4B 5IMKB 3NTCH 4XGZA 4HPYL 2QMJA 3ISRA 3HZKB 5TF1H 1NQBA 5GS0L 2Z35A 3M8OL 3WNOA 3PU7A 5MEPB 4MMXC 3NIGB 1F4XL 4M3HA 3W82A 4A67A 3G08B 2FZ3A 3AUWB 3SBRA 1DN0B 3O6FA 4LK4A 2Q10A 5I30H 4AGQA 3QZBA 4A7GF 2XQYA 5E4IA 2H32H 3M07A 4JKWA 2Q8BH 4ZNCD 2AEPL 2XFXA 2EDEA 5A3IC 3T3PE 4FXKC 2Y3NA 1CR9H 3QQ9C 4MTMA 2CBQA 1PNCA 3PV6A 5BO1H 1OOWA 2H9GA 4MNQE 3IMSA 5FYJH 4H1LB 1HXKA 4CVXA 4RZKA 1YPZF 3WTVA 1I8MB 2WQ8A 3IF1A 3D1MC 4KVCL 1KXHA 4LMQI 3L4ZA 1AZZC 5AW3B 3KPSA 4HC1L 4M61A 1BAFL 5IOPB 2AK4E 2WJ7A 4P5RA 3BN9C 5FYKD 1FV1B 1A6ZA 3CDGB 3H3KA 3CN0A 3W38A 3GBMH 4C4UA 3BUYA 2QZ5A 3MJ6A 4A04A 4WI3A 5AB1A 3BPCB 4I9XA 2F5AL 1HKLL 3OXRA 3VXSA 4ONHA 1J5CA 4ZFFA 5D7IF 3P2TA 3T3ME 4E9XA 3ZGIA 1CL7I 2AJUL 5GRYA 2HVKA 3DX6A 3QZNA 4FMVA 4IHBA 3FDWA 4NO3A 4K9EH 5JOEA 4L2YA 5F72S 3SPCA 4XRCB 1YLBB 4DUVA 5KSAC 1DQIA 2C3VA 2WAQA 1B3JA 2V5SA 1ETA1 1BJ1J 4WUUA 4NRZA 4JDVA 1PW3A 5FA3A 1CBVH 4TKWA 4AUUA 1HEZA 4OZFH 4Q89A 2O6EA 4LESA 5EIIG 2Z65C 3QIBC 4P06A 6FABL 4U1SB 1JZ4A 4GQ9L 4EDWH 3ZYJA 4KI5F 1TVHA 1WAAE 1TEGA 4C55A 3E38A 4PP2A 2MPAH 3KPRD 4JPWL 3MBXL 4RA0C 3F58L 4OJDH 2FT7A 4PWGA 5EZJB 1WFIA 3RVXD 3Q1EA 1X5JA 3E8VA 4AGMA 1BFOA 3FRPB 2C1OA 3PJNA 3CJJA 2ZUXA 3MLSL 2EDRA 3OLIA 1X7QA 4IU3A 5D7LA 4DT2A 3U9PH 2HH0L 2ED8A 1QEWA 3I6GB 4MWFB 4DAGH 4I18C 2APSA 4JKPH 1WVZA 2ZWZA 2BM3A 3IMBA 1A1OB 1MG2C 3ULVF 2WLLA 4F37F 3I85A 5AOJA 4HLEA 1MHPH 2WOYA 3HG2A 2J5LB 4G8GA 1BFSA 2ILLA 1KXVA 1XL6A 1QZNA 3QORC 4LF3A 5EORL 5BRZE 1AQDA 1WIOA 1JDCA 2DKSA 4KK9D 4JFEE 1MFAL 5JNYA 1I8KB 5LWYL 2VWEE 3CSYB 3O45A 5F7YC 5F1OB 1BVKB 4BSWA 1JHTB 1T0NB 4PJ9D 1IILE 4Z7WB 1RUMH 2K6ZA 3QPXL 4HS6B 3CFKA 4GRLC 3GSOA 4FCAA 2HJKB 2O6PA 1NC4A 2IBGA 3SGEI 2F7QA 4S2SB 5KW9H 2AK1H 3MV9B 5DZNA 5INCA 3RDTA 1EBPA 4X8JB 4QRQA 5INDA 1A2YB 1TNMA 4XPFL 4LSQL 4C83A 1RUKH 3CMOL 3TBCA 1NGPH 4MDIB 3F12A 3K0WA 2CHZA 1N8ZA 4P5SA 1QWHA 1JK9B 3BQVA 1DVFC 3BXNA 4GFTB 5EH1A 1H15B 4ZUUB 4J1UA 1YYCA 4J3OH 4JO1H 3SY0A 4M03A 3EYSH 2H1LM 3VFOB 3SKNB 1GHFH 3ZHFA 1T5WB 4IK7A 4KKAD 3G04A 4UBDC 2H41A 3V0EA 5KSUA 4MSWB 1Q9KB 4MAUH 4PJDA 4TUJA 4R83A 3V6ZB 5GSVB 1BQLL 1NCTA 1MRFL 4KZEH 3I2CH 3ZOAA 3VXME 2CJSA 4K3DL 3MLPA 1T1WA 1D5RA 3BZFA 2M2DA 4FNUA 3QPKA 4XN1A 3V6FB 1JGDB 4OZGA 4EE2A 3VXUE 3HNVL 3ILPB 3N1MC 4NBZB 5TH2B 3KL0A 1SDYA 3U0PA 2Q76B 2NY4B 4PJEA 1UXWA 2WN2A 2FJHB 1I3GH 4W6YB 3O11A 4C8XA 4NM4L 2G5RA 3L3JB 1YMMA 3JT2A 3FQWA 2VH5L 2VN5A 4KQ4H 4IBZA 5LHDA 1YNTF 4PHXA 4WRLA 2DH3A 4J3UA 5L2KD 2GG1A 2PNDA 4PJBE 1AY1L 2ARJB 4A2GA 4JB9H 3SO3B 1Z9LA 1F4YL 4NQEB 4F33B 4ISVA 4L2LA 1L6PA 3TA3A 1A47A 3FN0L 4JAMB 4LHUA 4ZAKA 1OWRM 1PBYA 2OJEB 5KSBB 3ZBMA 4YFDB 2QKSA 3U7YH 1QP1A 4AVJA 2HT4C 3EFDL 3QXVA 4HLJA 2E8YA 2ISDA 4BK5A 3DJTA 1QW8A 4PGEA 3T1FA 4AQEB 5I5MA 5MEQB 4MQ7B 1M7IA 1KDIA 2DM7A 2PO6B 1IM3B 2DLEA 2PCPA 1MDTA 4I3RH 4OLUH 4QYOB 3RYMA 3QFDB 2XTJC 3K3QA 2P8LA 3P2DA 4ICXA 2X4OA 4JZOA 3VU2A 3ATBA 1B4JH 1C12A 5F7DB 3QXWA 3KW7A 1ONQA 1RULL 2NSQA 2OMZA 1HOCA 3IETB 4NM8H 3VRLE 3LB6D 5IHUL 1G5GA 3CH1B 2VXSH 3U6RB 2X2UA 4MDRA 1ZWIA 3C60C 1P4BL 1YY8A 5F7KC 3A4AA 1VZHA 2DLFL 3OKLA 3RJOA 1F6FB 4TUOB 4GB9A 1PY9A 1OGAE 3RPKA 4O4YH 1AKJD 5DMIH 5AOMA 1SFHA 1IM9B 3MLTA 4M8VA 3VRJB 1OM3L 1HJCA 3O9WA 4NZ8A 3BGFC 3WEXA 4DP6X 4NIKB 4F91B 2Y6SD 1KXTA 5FCUH 1SGKA 1PQZB 1XXDC 3M6DA 1EDQA 3RE0A 1WIPA 2I07A 1H5BA 2WQWA 3EYQD 2XRAH 1F11A 1BMGA 2AXHA 5ESQA 4XXWA 1SM3L 4NCC1 4YSAA 3IXTA 1SYVB 1TXKA 4KXCA 1JOIA 1MY7A 2ZKWA 1PNDA 1K8DB 4R96B 1VJSA 3LOWA 3L2LA 2CH8A 4R0LC 5CXPA 4FF9A 2YGQA 4W9LC 3U4EB 4JQIA 5BS0E 3QDJD 3FYEB 5IMOB 4JFTA 2VKWA 3L5XL 3O2VL 2J6WA 4TULL 3DV6B 4OLYL 1CL7H 2WNXA 1EX0A 2GT9A 3UZQA 4WFHE 1PZDA 4PGCB 4K2UH 3JV4B 1MFBH 4LLDB 3SDCB 4M7ZB 1RIUL 5JPNB 1B0GA 4LCWD 4UTAH 1CT8B 2CLZB 1BSIA 1NGXA 3MLXL 4ESKA 4P5TD 3TYFA 3QRFM 2HJLA 5LQBH 3MV7D 1NPUA 2QR0B 4Y4KD 5KEZA 2G2RA 1T7WA 3BESR 3TV3L 5LG6A 3MNWA 1O6VA 3L3IB 2W95A 4OCSH 1U3HC 3ULVL 4DTGH 1OP9A 5FHAL 3RWFB 1JF1A 2H8PB 2G9HA 3B7SA 2ATPB 4M5YL 4D9RD 1MCCA 1RZKC 1JPSH 3WNMA 4CUCA 3QPQC 3NJHA 5IVOA 4W9CC 3FFCA 2VAJA 3ZU8A 3P9LB 1CFVH 3K71B 3GXNA 4K8RD 2X4PA 5DYOA 1U30A 5CKAA 4JM0A 3L16A 1E5UI 2DTSA 3P73B 5CGYC 3GMNA 5DRXA 2JVUA 4YHYB 2ZUTA 2NYYC 2Q6WB 5MENE 1XF2B 1H6EA 3CVDA 3SKMB 4UOW0 4XHJD 4NZDA 4LSRL 4RIRB 1FL5B 1KCRH 4KJYA 4XB8A 4KX9A 5D6DA 1I8AA 1QSVA 2N1KA 3QR1A 2PW2A 5I74B 4MA3B 4L4VD 3MYJB 2VN6A 1FNSH 1NL0H 3WNKA 4MS6A 3WEBA 5TPWL 2YPKB 1CXIA 4OIBA 3QFJD 3WFHA 3WS3A 3L9YA 5C6PB 2HMIC 1GS6X 3IDXL 4FL4B 3GBNH 4GRWH 5F8RC 2EE3A 3U30B 1QBBA 4YXLH 4WZ9A 4ATTA 1IBGL 1XCTA 4Z7UF 1JD9A 1GC1H 3HC3L 4G9DB 2B1OA 1QQDA 4M43L 5I1IH 2EDHA 2F18A 5IWLC 2L8AA 5T3XE 1Z5YD 5GGVH 4HS8L 3WIFA 1KJ2L 1BZDA 1EAOA 2OL3L 4FNQA 1T5XA 2YWZA 2EIJB 1J1XH 1QFWI 2Z8SA 4ZO9A 3KWTA 3SGKC 4Z3JA 4JO8A 2DB8A 3DMMD 1LE5A 1CYXA 3QUXA 4CJ0A 1ZTXH 1TPXB 5AWNH 5I6KA 4BSVA 1A1NA 4GNKB 4GAAA 4CW1A 1NCCH 2VDPB 3US9A 2BP8A 3B3IA 1A6WH 1NEZA 3HBPA 1FPTH 4XBGA 4XP4L 1FN4B 3UPRB 4G6JH 3V52L 5I66A 2VDKB 1XIWA 3TBTB 4N4YB 3JTSB 3VW3L 3L3GB 1W72L 3I75B 4J6RL 4KRNA 1UH3A 4NN6C 5IMKA 3ARWA 4FQIL 1ETZB 4AIXA 4BJLA 5HGDA 5B38G 5J6GB 2WIIB 3K4AA 4B9KC 2YAMA 3KDMA 3CFJA 4K3EL 4JE0A 5C0BD 2R29L 2B2XL 2V9TA 3LXUX 1SLWA 2CK0L 1QWUA 1J9RA 4R7VA 1KCLA 1XTMA 3VMOA 3VFGH 1QSZA 5FM5O 5I16A 2DBJA 2WXJA 3LKPB 3LEVH 3FF8A 1T66C 2AQQA 3GI9L 3DTXB 4TVPH 1AJ7L 1UYWL 2WZAA 2V7HB 2ITEA 3WLWC 3S4SG 1B6UA 4UAHA 3G5VB 7CGTA 1EEYB 3VWKC 3OAUH 4IBQA 1PZSA 2CCLA 3FMGL 4HKJB 1AGBB 2XFGB 4X9IA 5HYSG 4FE9A 5C0CE 1OT2A 3L45A 5E8DH 4WEBH 4ZX4A 1PYWB 1MCPL 2OMUA 4JN1H 4N9OB 5CWSB 4DGIL 4M6OH 4M7JL 5JQHC 4U3HA 4I4WB 3VX1A 2A74B 2VLME 1A7OH 2Z8VC 3FU6A 1DLFH 2I5YH 3CDGA 4PJXF 3DX2A 4DH2A 1JUFA 2P7TA 1W8NA 3HR5A 3Q8CA 5H35A 5BV7L 5E8NB 4RRPM 1CF8H 2ICWB 1P2CB 1OPOA 4OAWA 4L1HA 3VXPB 3ARRA 5I6XB 2YLHA 4Z8FH 2R4SH 4X7SH 5ADOH 2IALA 3ZSSA 1AC0A 4FMFA 2YWYA 3HS8A 2V8LA 1E6JH 5B3JF 1HE7A 3O2DH 5HVFB 3GMOB 3RTQD 4GUPB 1RJYA 4X4ME 2Y07L 4PLKC 2F8OA 5F3BA 2VW6A 1JDAA 5GSRA 1N67A 3ZT6A 4KXZI 3S97C 1S7WB 1CLZL 1U4EA 5DEGA 2F74A 3D9AL 3PHOA 3V4VH 5DSCA 5HP5A 1I1YA 3ARSA 2YMXL 2Z1PA 3F6IA 2HX9A 3ZHNA 4Q0XL 1LO4H 4GKSB 1OTTD 4GIOA 3VYPA 1O9WA 4LOUC 4F7PB 3NTCL 5F9JB 2OJZL 4QIRA 4APXB 1Q9WA 2JQAA 3D33A 2Y4SA 2VABB 4ZOAA 2X88A 1G7PA 1S9XA 3PGDA 4IIZA 4AYMC 4JM2F 1KZYA 4KWUA 4UT6A 5F7HA 4HMEA 3TU6A 4K7PH 4G1EB 2O5XH 4XBMA 4DOHB 3CXFA 1E3XA 2G9KA 3D48R 4EXKA 2LE9A 2AC0A 4UTBH 4JPKL 2GC7C 1U36A 1IAIM 1X5AA 2Q8BL 3R4RA 5A16B 3SGDI 4AT6A 4HHAB 3U25A 5A2IH 3MFFA 1JPGB 3FQYA 3B43A 2XTLA 1N64L 4U1GB 5GZND 5IFJA 2OSWA 5C09E 4QOKD 1CR9L 2YD2A 5BO1L 1H3UA 1WBZB 3BT0A 3N0AA 1FLTX 5FYJL 1MJ7H 2Q7YB 4OR1A 3QIBB 1P7QA 4G8IB 5EU7C 3BO8B 4LEBA 3V4LA 1UCBH 1FH5H 5CP7B 4KKBC 3FYIB 1ACYH 2BS9A 3A67H 5FM5M 1R5IA 4HS6A 5CHNB 5E6YA 5EBWA 5F3FA 3ZHKA 4XPGL 2QBWA 3IDIA 3R1GH 4I0PA 5GGRB 3S36H 5TE6H 5C0EB 1MFMA 4LPCA 3FO1B 3GBML 5IJCC 1QLEB 2WBWB 3AITA 3QGVA 1A9BA 5HTSA 2ESVA 4F8NA 2ZXDA 2GKIA 3LN4B 5DC2A 3ETBF 3CFBA 5FGCE 1IQWH 4B5ZA 5GHWH 1SVCP 4N8VB 1NDMA 4B9FA 5EN2B 4ZW3A 5D96C 5DJAB 4OV5A 2MNUA 4AQ1B 3TEZA 1FA4A 4K9EL 5DVMA 5GSVA 4GO9A 3EOAA 5IQ9B 1W2KT 4P3DB 4YHOH 1DQJB 5AOLA 2EH7H 3TVMA 3BFOA 4J6IA 1FBIH 1E5YA 3DYPA 1OAXH 3VXRB 1BIHA 3VGHA 4F20A 1CBVL 1JGDA 4NWUH 2VAAB 4QI3A 5F7EH 5AKSA 5FUZH 3ILPA 1LQBC 1CFNB 2EP6A 1W0WA 3NK4A 1XB8A 3LQZA 3RKPA 3T0EB 3IKKA 4PVLA 5ICXA 2E4FA 3T2LA 2MPAL 4M6NH 3GSUA 3SE3A 3ZDYB 5I6PA 2QV4A 1E4WH 4HJJH 1IBDA 4KK6C 5M95B 5AVUB 1YECL 1XAUA 4NRXB 1FYTE 2VT0A 4ODBD 5FAAA 1WS7A 5I9QC 3RI5K 1DVFB 3SOBH 1VLXA 1QA9A 3H9SE 1U95A 4F33A 2X2JA 5A7EA 5CGBA 4DAGL 1AAJA 2OCJA 2OJEA 4B0MB 5EC1A 1KEMH 1CFQA 4XCEA 3SE4C 5TK4A 1SXNA 3FQNA 3OPUA 3QA3B 5CJXC 1OL0A 2C9SA 3RRQA 3N9GH 4HIHB 2IAND 3ETSA 5MEQA 2X4UB 3MRNB 3UC2A 1PJWA 5J0BA 2GBUA 4IRJB 3MOAH 2J8UF 2PO6A 1F97A 3CWGA 3UGEA 4UNTA 4QKTA 1N8OE 3KM1A 5FFOA 4CC4A 5IF0B 3D2TA 2W94A 1RUML 4QWWC 2J71A 3PUCA 4LVNB 2VMJA 3UC0H 3SDXE 5F7DA 4OGYH 2Y7QB 3SYAA 4GQPH 3P0VH 4YVNA 5KW9L 2AK1L 4ZZKA 4ZOBA 1AOHA 4OUOA 3KS0J 4R5VA 3KLAB 2ED7A 2P45B 1AR1C 4L9LA 4HP5A 1YUHA 1IARB 4CVZA 4Z78A 1RJCA 1NGPL 1FIGH 2WNWA 3GZKA 1QHPA 1V3MA 3IE9A 2L7UA 3IXAA 5L7XH 2QJDA 5ADPH 3VD5A 4PEEA 5B1BB 1YEHL 2NY6C 4HCIA 3EYSL 3MGAA 2ZP9A 1MVYA 1GHFL 1NDGA 2KDGA 3TEUA 3GKZA 2PETA 1Z9MA 3DIDA 3EYFA 4JDTH 3VRJA 4L3CB 5IBLC 1ZT7A 3I2CL 4KUCD 4X6FB 1RPKA 5ISZE 4L5FH 5L0QB 3RNKB 3HC2A 3BZEB 5KVFL 3D8MA 4WO4D 1PQZA 2VLKD 3ORJA 1JRHH 1L7IH 1KSRA 4L4TB 5DHXB 1MLBA 2F8IA 4Z7OF 2VLJD 3O3BB 4Y5VB 3KPNB 4RWYH 5C08E 3RURA 4JLRA 1ZT1B 3OC8A 3LEYH 3EYVA 3BRFA 3PXLA 3O2WH 4IJ3B 1KG0B 5DJCB 4KQ4L 5FA4A 4W9GC 2ITCA 1K8DA 2VXUH 2WSPA 2C1PB 3CVHB 4R96A 4RGNB 2EUVA 5C0RH 5HPMA 3CSFA 2BVTA 2X0WA 4XCFL 3SJVD 4UQDA 1BM7A 1IJNA 3FB5B 3NCFB 4JB9L 4ODUA 4BZ2H 2HKFH 2PWEA 1R5VB 4XMUA 4FJ6A 1HU8A 3TTYA 1TQUA 3NACH 2EVGA 1G1CA 4Q14A 2WWNA 5B21A 1J8KA 4HOWA 1F1AA 3F3HA 3T0XA 1AI1H 4P2QB 3RILA 5JPNA 4AITA 1ES0A 2B59B 1Z0MA 5EIVA 5AUMA 2F7RA 4S0SD 1MI5D 4NO5B 1JZ7A 4HUUB 4KVPA 3PIQB 3X3GH 1CXKA 4I3RL 4QGYA 2OTWB 4M00A 5BW7A 4HUMB 1GJIA 4AKPA 1WT5A 3VFRA 1KPRA 3UMNA 3RWFA 3BUBA 4NNPH 2V2TB 1K8IB 4UINL 5GGUB 1CD1B 3T3PB 4P2OA 3CFTA 3RLSA 4NM8L 1SY6A 2A2QT 4MNQB 1NIDA 2ZX5A 2XX0A 5DQJA 3G3LA 5F9OH 4P8QA 2VXSL 3NFSH 3LD8C 5AYUH 2V5RA 1HESA 3B7RL 5I1DA 3M46A 4XVSH 2KKQA 4YLCA 3UABA 1ASQA 1L9MA 4HETA 4O4YL 1T2QH 3LZNA 5DMIL 2AK4B 2X6MA 4HIEB 2MQ0A 2VIRB 4C4KO 3MO1A 2I69A 2PCFB 4LP8A 1Q8MA 5KN5B 4YHPA 4UM9D 1MRDH 4RISH 5DWUH 3IRPX 4GG8B 4W9DC 4XR8C 5GRJL 2VDLB 3KWXA 5K33A 4MCYB 3U4KA 1C08A 2QLYA 2CZNA 2JQZA 1GKOA 3X11A 4DNLA 3V6BR 3KJ6L 4PSPA 4WFEE 3DETD 1U3HB 2NNXA 4MCZB 1U4FA 5KBMA 3L5JA 2PYEA 2QADD 4G9DA 3SB3A 2NNRA 4IOSA 4UQ3A 3T3MB 3ZRCC 3OG4B 4MJ2A 4NX0A 2NYKA 3JQOB 5JIMA 1LGVA 2BDNH 4YZFF 5DO2C 5C86A 3V2AR 3II2A 4LPTA 4IGBB 2HVJB 4FYRA 2EYTB 2Q2LA 5JHDB 2XN9E 3RU8H 2AANA 1AZRA 1IKNC 2OSLB 4KTEL 3VJ6A 2BNRE 4BQ8A 2Y7SA 4X5RA 3FPXA 4XOAA 1HWGB 4RSVA 1MXGA 1HAUA 3CHXA 3CX5K 4K2UL 1MFBL 1S78C 3TBTA 4KH2A 4Z7VE 4XAWH 4XAKD 1FQ9C 4NAMA 4D9QD 5AVSB 2OMXB 3JTSA 4Z5RB 4XNZC 2YBGA 4KK5C 4KUZH 1S8DA 2EYSB 3I75A 4AC4A 1AXSA 3ALXA 5LQBL 5LNEA 1T4KB 5T5FH 3QAZC 4FABH 3W0WB 1DR9A 2EVHA 4YXKH 3N41F 4RESB 1YHPA 3U7WH 1UD5A 4XB7A 3PF2A 4IMLB 1AMYA 4OCSL 4DTGL 1EDHA 4U3XA 3BAYA 4NP4L 2XPYA 4TTDD 3D39E 1JPSL 1D5MB 5IEHB 2X4RB 3LKPA 3VSQA 3X13B 3I50L 3DTXA 5BRZB 1CFVL 3GI8H 2G5BA 1NGYB 1L5GB 5SWZD 4Y7OC 4ZFOA 4JFEB 1FNGA 4JFSA 5GRVL 3G5VA 1EMTL 4QRPA 3F7YB 2G75B 2IV8A 1AGBA 3HN3A 4MVBD 1MCWM 1S9KC 4HAGA 1IL1B 1CDGA 1KCRL 2R83A 4ZXBC 4BKSC 4ODHH 4PJHF 1OP5K 5JQ6H 5CD5D 3PDDA 3R8BB 3KG5A 4LRIC 4HF5H 1FNSL 1NL0L 1WZMA 2QMKA 4YE4H 5DLMH 3IAGC 1F4AA 1QTYT 4DQOH 3K6SA 2ICEA 4QF1A 1LO5B 3A4DA 4Q4IA 5C97A 1XF3A 4I4WA 2A74A 3GBNL 1UEMA 3FFOA 4YXLL 1WH0A 3E6HA 4RQQB 2CIIA 2N01B 4LSDA 2JJUA 4JPSA 2Q87A 5HDWA 1DANT 3GT6A 3ARFD 2W91A 1GC1L 3WY3A 2A4ZA 1P2CA 3H0TB 3CZSA 3IU4H 5IM7B 1JI1A 1ACCA 2J7LA 5GGVL 5HVGB 2FIRT 4R7DB 3TPKA 4WKZB 4BQ9A 3EYOA 4AX3A 3GTVA 1O75A 1UOKA 3VGFA 3ZE0F 5IT2L 3VXMB 2JJTA 3O6LH 2CO3A 3SEPA 3Q06A 1I8UA 4X98B 3EGSB 5F88A 3L95B 3QG6B 4PJ8C 3TL5A 5BO0D 4P3CH 2RIKA 4N28A 4NQED 1J0HA 4F7TB 3S8FB 3ILEA 2PWDA 4WW2C 3TJPA 4PR5B 4DN3H 4X4YA 3VXUB 2CDFA 5AWNL 5E5MB 2PP7A 2Q7AA 2UUDH 4PWKA 1X4YA 1NCCL 1MVUA 2OM5A 1A6WL 4PW3A 4WK4B 2B39A 1FPTL 2YD3A 4Z7AA 2C4XA 3BH4A 4KZCA 4XO3A 4G6JL 1KWKA 3RVTC 2KYIA 4OI8A 3L1GA 1OGTA 3W39B 3D0LB 1SEBB 5JIKA 5E4EC 2DWYA 3UBGA 3MRRB 3CTTA 4JREB 4PJBB 2NY2C 4BH7B 4ZO8A 2FWSA 4MQTB 2YJLA 3T2OA 3CDYA 4NQXB 2WW8A 3VFGL 1S5HB 1ANUA 5EDXA 3SDAD 3IPFA 3K5SA 3JVFC 3LEVL 3OXSB 4TVPL 4HHAA 1DSWA 1JPGA 4LB8A 3RZWA 3C87A 1OT1A 4ETYA 5IQLA 4MZ3A 2YZ1A 1EEZA 3BFQG 2BC4A 2H2PD 4RDQG 1LE9A 4OIFA 1Q9LB 2HT3D 2IQAB 5E8DL 4WEBL 1IBYA 3UCRA 3VXQB 2LAAA 2HPOA 3TCLB 1FO0A 2K1MA 3HBQA 3F84A 1J05B 2NY0D 4LEXH 4CBPA 1JG9A 4WCYH 4ZBJA 1A7OL 3VB9A 3IE4A 1DLFL 2I5YL 2WV3A 4N2LA 4ZNEA 3WTWA 5JORA 3FO1A 3OKOB 1MCWW 3LZFH 5DK0B 5FOJA 3REWA 5JPMC 3ULVE 1E90A 3LEXA 4P46C 1NMAL 5ESVA 1NCOA 5AW6B 3EXLA 2E9IA 1CF8L 3LN4A 2ZKHH 3WOVA 4MLSA 2MCAA 4KQ0A 4FFVC 2IAMC 5HHQA 3CPLA 4P2RA 4YSCA 5LXVA 5EN2A 4Z8FL 2R4SL 1JP5A 1HHJB 4X7SL 5ADOL 4PH8A 1AS6A 2EICA 4DEPB 3GSWA 3MLYH 4ZTOL 3VXTB 1E6JL 4JQVA 2IH3A 2B16A 4P3DA 3O2DL 5DD5H 5T3ZD 1U42A 3CPUA 2D7QA 3FB6B 4PJ7F 1KEGH 3P3UA 4PJGF 4I9WE 4OSUH 3CZKA 3Q2NA 3TC9A 4O02B 3BFWA 4ORGB 2VAAA 3SDCD 2NXZC 3EDFA 3KPRA 2F5BH 3AAZA 3ARQA 3CGTA 3WY1A 3EJRA 4EOWH 3T0EA 3TZVD 2D2OA 2NY3D 4HU2A 1BYNA 2WP3T 1QG3A 4WWKD 4FS0A 4MAYD 2F15A 5KVGL 1FE8H 1OQOA 1QYGH 2XIDA 3UG3A 1MAJA 3BKMH 5BS0B 4CSTA 4B9ZA 4X9BA 1T0MA 4NRXA 1PX4A 4AENB 3RFRA 3A5VA 2FIKB 4A2MA 5J8OA 2O5XL 5TQ2H 5SWSE 3X3FL 4N22A 4AM0B 4UTBL 1PAMA 4WTWA 5D96B 1AQ8A 1U3JA 4HT1H 4LLYB 3C2AL 4BV1A 4JQIH 1RLBA 4MNHB 3PABB 4BINA 1HL8A 3DRQA 5ETUB 2D0FA 4PG9A 1GGCH 2H26A 4OGXL 2FECI 3MRNA 3HB3D 5DHYB 3JWDH 1DBBH 4K73A 2A6KB 1MJ7L 1H8LA 4P05A 4NQCA 2XWTA 3VSTA 3HRZA 4YXHH 2ZICA 3F00A 1UCBL 1FH5L 4M5TA 4D3CL 2JH2A 5IF0A 5D1XE 4K5NA 3ZYIA 3HS0B 1V54B 2H0JA 3OPZL 2YXMA 3R1GL 1Z6JT 5TE6L 3S36L 3UIYA 4F2ME 3POHA 4P57A 5FV1L 3INUH 2EIZA 3G6JB 4X8XA 2COQA 4QMEA 1EK3A 4UU9B 2WQUA 4BKLB 4FQCH 4KNQA 2YQ3A 3S96B 2P80A 4FQJH 2XWDA 3LSOA 3GQFA 1CBJA 1GH7A 2OFQA 1A3RH 4FXGC 1E2WA 1T4WA 4G6AC 6PCYA 4UQCA 3ZE2E 5TDNB 1O7SA 3QEQD 1CTMA 1FFPB 1ODAA 2Y1AA 2I25N 4YHOL 4L3CA 2FLBT 1TMQA 1SLVA 4ZMYA 1WIUA 4EN3B 2EH7L 4KNSA 4X6FA 1FBIL 3OB0K 1OAXL 5C07E 3HVNA 3ASOB 1NCUA 3NCEB 4AYDC 4NWUL 2APXA 4NYLA 5F7EL 1W0VB 2WJ5A 1G7IB 3L4TA 5FUZL 5AL8A 4ENZA 3KPNA 3Q9PA 5A6LA 4HIPA 3NCCB 1E27B 3OC5A 4M8RA 3C5ZD 1BM3H 4M6NL 5AVQB 4CSSA 4UT9H 3L5IA 1E4WL 3LRKA 4H8QA 3DVGB 3JWNG 3B7UX 4HJJL 5B4MC 1P69B 3FU9A 3CVHA 2VQTA 3GMRB 1QACA 4FULA 4BUHA 3SOBL 3UDWA 2FBRA 2E8ZA 3KPPB 4N1EA 1INQB 4LSPH 2NY6B 5E8EA 5IK3B 3G5ZA 3HAEG 1BCIA 3QVAA 4LKXB 1EV2E 3OWEA 1C5DB 1DBJH 2VSCA 1PLGH 1KEML 2WXKA 5KBKA 4L8CB 4QYAA 4Q52A 1EBAA 2XG4B 4G9FE 1HYSD 3N9GL 4FZ8H 3CVCA 3ECUA 1KC5H 4NO5A 4IRSA 4ADGA 1G0DA 2XJKA 1WA0X 3HI1B 4QUOA 4HW6A 3MOAL 3OAYK 1J8RA 2Y2TA 1EPFA 2QVKA 2IH1B 4D8OA 4KMTH 1IFHH 4QRSB 2ZQKA 1DO6A 2XG5A 3ZZSA 4H20H 1A14H 3OKEA 3BPLC 2ZUUA 2F54E 4I1NB 2VOTA 4Q6YA 4UDTB 2O5YH 3P0VL 4B3EA 5D1QE 3KYMB 2DD8H 3GEWB 3IVKB 5IESH 1QSFE 3IJ8A 2IJ0C 4DN4H 3BDYL 5J12C 5J9PB 1AKJA 1FIGL 5DS8B 5E56A 1MCFA 4Z23A 1ZANH 3AM8C 5A3ID 2JCWA 5L7XL 4KZ0A 4M48H 4N24A 4YN3A 5LCVA 1SN0A 1KTLB 3NSDA 4D8PB 5I73B 2K70A 3QQ9D 5B7FA 4PRPB 4H0GA 4UIMA 1SVZA 4JFFB 2XV0A 4G70B 4L1BA 3SCMC 5FB8B 4F92B 2ODIA 2PCFA 3D30A 1A3LL 3F6JA 1EGJA 3DPBA 2TRYA 2PXYB 5F7MC 4MHHI 1G9NL 3CZFA 4NNXA 3CMGA 3RWJB 3NFNB 4YL9A 4FG2A 1J12A 4Y1AA 3RZCA 3MACH 1KNOB 2M8XA 1EZVY 5L9DH 3V5HB 1U8KA 2BWIA 1JRHL 3H2PA 4EBQH 2PW1A 4TNVK 3T8XB 2EDOA 4RFEB 3BN9D 4M1DH 3MNZB 1USQA 1LVEA 4W4OA 5SV3A 4PY7B 4KKRA 4PJDF 1N5AA 3LEYL 3PNWA 5FECB 2XJLA 1S9VB 3O2WL 5HI5C 1G9EA 4X6DE 4MZIA 2X1XR 2JQMA 2XV3A 4P2YA 5F6HI 1OANA 1D5IH 4KI5C 5E2UL 2VXUL 4IGBA 2HVJA 3HUJA 3PGCB 4OZGF 3U1SH 5C0RL 5E9DA 4KITB 1MWAA 3QZMA 1XAKA 1SEQH 1OSYA 2E9JA 2LVEA 2JFCA 3GZQA 5CSZA 3RGVB 2P3YA 4BZ2L 1D3CA 2E6QA 4IOIB 4LCWA 1H3XA 2EEAA 4PJEF 1TCRB 1RQ5A 3FUFA 4S1QH 1WAAA 1BLNB 1CG9B 1BGXH 3MV7A 1F2XK 3BJ91 5KSAD 1ORQA 3R7RA 5H8DA 1ZIBA 2DYPD 1WZ1H 1IU1A 1SN2A 3WMPA 4Z5RA 1D7BA 3PL6B 5FK9B 2EYSA 4G6KH 1NJ9A 3DTUB 4QXGL 2P5WD 5DJ0B 3QIBD 4I1PA 1YDPA 3X3GL 1BZ8A 2AAAA 2V2XB 2R0WH 4IMLA 4NOBA 4PJCA 3RX8A 3MODH 4BQBA 3MRDB 4R4NC 4NNPL 2WWKT 1NFDE 4I8DA 4OB5L 5KSVA 4UT6H 4CKVX 1QKZH 4YPJA 3NN8B 3HN5A 3NCWA 4V1DD 2TRHA 5FEBA 1XR8B 1L5GA 1NGYA 2VSKB 4R26H 5F9OL 4LNVA 5BZWB 3NFSL 5AYUL 5CS7A 3T65A 5H4YA 3F7YA 2R8SH 3E6FA 2G75A 3VFTB 1I9EA 2BVQB 4WJ5B 2YPVH 1RZGA 3O3DB 2XZQL 3QO0A 1UM6H 3FONB 1OLZA 3QFJA 4G43A 4JHBA 2GUYA 3QORD 4XN4A 4XVTH 1HXYB 4XNZB 1XF4A 4DPAX 3II3A 1MRDL 1VCBC 5DWUL 3V0VB 3VXRD 4JFDB 2OI9C 3EF7A 3QAZB 3OVUB 2XWXA 3MCKB 2VYRE 2F6AA 3T6VA 4XMTA 4Y2NA 4PG2C 1X9QA 1URZA 2XN1A 2DQTL 2LR4A 4GRLD 5FGCB 4OZIB 3PAUA 3BAJA 2H7WA 4YBHA 1DDTA 4KMQA 2NPLX 3QNYA 2K6YA 5CJBA 4OKVA 3H0TA 1WCBB 4DUWA 1QFOA 1DBMH 5C7XH 2D7NA 2LU5A 4FLHA 3K72B 4W6XB 3FUJA 1DVFD 1M9SA 3QG6A 4PM1A 1FSKC 3RU8L 2I9LA 2AP2A 1TQWA 1ZLUK 5E5MA 1INDH 1P0SE 4UBDD 4PJXE 5CZKA 1PIGA 2ZE0A 2I7SA 1KTKE 4HX1B 1K9TA 5ID0A 3WEAA 2VLLA 3DWTA 4L3FA 4RBPH 3MDJA 4PRHE 3VFWB 2UYLB 4LASL 4EQ3A 4KUZL 4AWJC 2AQ3A 2ZG2A 1GMIA 2DL2A 2EO9A 2GIMA 1U93B 2VSDA 4IRJD 3HKZA 5KVFE 4FABL 4LARH 2VZ3A 1FYTB 4YXKL 4DCQB 3RL1B 1M3IA 4FRWA 4PJBA 4BKTC 3U7WL 3H9SB 2H0PA 1I85C 2H1PH 2Z9TA 3W1ZA 1KYAA 4N2AA 4WFFE 2CO7B 3KPQB 1NGQH 4J3OG 2Y3AA 3VG9C 4XOBA 3P4OB 4F9PA 1SMDA 5IBUB 1S5HA 5LJYH 5TFSH 3DUUB 1U91A 1BQHG 2LOEA 4NQSB 1FZMA 4FZEH 4LGRB 3AGWA 1WGVA 3C09C 5DD1H 5DUBA 1A1MA 1QLRB 3FUIA 3QI9C 4AL8H 4HJSA 1TR7A 3TWYA 1YEGH 4I48B 3DA0A 2JB6A 1ZS8A 1DFBL 1V05A 3L6FA 2AVFA 2CO6B 1P4LB 2HT4D 2K3HA 3QUYC 1Q9LA 4C56E 4DP2X 4P4RA 3KL3A 5JQ6L 4LL1A 4QNPF 3UXFA 2DWTA 3VXQA 3Q5YA 5DTFB 1L7TL 1NIAA 4HF5L 4JO2H 4YE4L 5DLML 3TCLA 4MBOA 1YEDA 5E4EB 2D9CA 2MHAA 2YSTA 5BV7C 4LOFA 3NIDF 1PKQB 1WP6A 3EOBB 1RCYA 3STBA 2W0LA 1BXXA 1V7NH 2ICWI 4L4TD 4YK4C 5A40E 4MRCA 2EDQA 5JTWA 5DK0A 2DV6A 1HH9B 4O2EB 1CD8A 4JFOB 4E5XG 5D71H 2HKHH 5KOVC 1OGAA 1G94A 3TASA 3IU4L 3S98A 2P24B 3KWWA 2AQNA 3LKRA 4R7NA 2EINB 4YS4A 3PPSA 5ACZB 1LDSA 1JPTH 3C60D 4RGND 4AEHL 1J0IA 1KT2B 1L6ZA 5ISZB 1XZWA 3CU1A 4YHMH 3CDCA 1C9SA 2PR9A 3CC5B 1E5AA 1YEKH 3H3PH 3PDOB 1E5ZA 2R7EA 3UO1H 4M3KB 4DN3L 2Q3ZA 3NZSA 3IS1X 1JYXA 4POZC 1IKFH 1ZVNA 1OW0A 4P2QD 5C08B 2KLSA 1LP9E 4WV1A 1XH0A 2AF2A 1B88A 1JWSA 2BCMA 3S5LG 1NAKH 5F9WB 3TONA 2F7OA 4M6MH 4U1LA 2VR7A 4EEEA 2DI7A 4XPBH 4EJ1C 4U1IB 4FKEA 5HYJE 1M7DB 5JPMB 4P46B 3DX7A 2ERJC 4WEMB 1C5BH 1J0JA 1U8NB 5HJ3B 1LYQA 3PCYA 1WTGT 2FIKA 2JKSA 3BWUF 3DRTB 3H3BC 4PBDA 5FO7B 1LWRA 3U2JA 1TYRA 2DBLH 2NX5E 3IMUA 3NCBB 3O0LA 1I8IA 1JL8A 1EXHA 1E3FA 2EDBA 4ODXB 3VXNA 1XGTA 3ZTJH 1BFVH 1KN4L 5D8JH 5E2VH 5IEKA 1HI6A 4LLYA 3US0A 1GSMA 3W56A 1PZAA 1JZ8A 2OS7A 4NDMA 2HXAA 1EVTC 4ODVH 2HFFB 2YN3A 2VNCA 4IBUA 3T6QC 5D7SL 4JPIB 3HA0A 3PXHA 4I88A 5I1HH 2G4EA 2APWA 2AK4D 2NXZB 2DQDH 1ND0B 4OCMC 4QHMA 2ZOUA 3B2XA 4GKLA 3EFFB 2VR6A 5DC9B 3QHZH 3QWQB 5KVDH 2WBJA 3RWGB 4X9GA 3MRFB 3IM1A 4YR6B 1MFDH 4O2CB 5G5DA 2CCWA 4FHJA 2EKSB 1OZTG 1U3HD 2DWDB 1TKWA 4JFWA 3TCTA 4KKZA 3LZFL 1S7QA 4GO6B 3F65A 3ULSA 5B39G 5MENA 5DUMH 1CDBA 1HILA 5F7BA 2GC4C 2BK8A 2QQLH 4J2QA 4PB9H 4PU2A 4Y9EA 2BFVH 2ZKHL 3S96A 1SY6H 1O6SB 3DROA 2GW5A 4JS7A 3QYCA 3BKYH 4Q9RH 3PWPE 3QZWG 5FV2A 2Y69B 2J8UE 1T5KA 5CGYD 1QI3A 4IKNA 1FFPA 4XNUH 5JHDD 3VWJC 4N2MA 4HJUA 2CLRA 2R69A 3GIZH 3LN5B 4QO1A 5JW4R 1H6UA 5DD5L 5EO0A 1ZV5A 4IIQC 3DI3B 1KEGL 1M56B 1T1YA 1DJGA 3LNEA 4OSUL 1TENA 5LNGA 1IE5A 2ZCKL 4B96A 4E41D 3ARZA 3IKCA 1W0VA 4ACPA 1G7IA 1NKRA 4U1KB 2F5BL 1HCYA 4LHJB 5IVXB 4OGAC 1JNHA 2HMID 1F2QA 5F7AA 1EFXD 2UVFA 3TBSB 3W0WD 5AD0B 3OKMA 3LZRA 3LS4H 5CMAB 1YEFH 3UG5A 4NJAH 2V5MA 2QVTA 1LEIA 4G6MH 4GP8B 2GEEA 1FE8L 2XN9B 2B5IC 2EILB 2YPLD 4IEFA 1QYGL 2LU7A 2H6OA 5EFIA 2XWJA 3D06A 1COBA 2JIXB 3H54A 4P9HH 4PRNB 1M6OB 2OYPA 2QSVA 5TQ2L 4WU5B 3ESNA 2F8XC 3DX9B 3ROLB 3BUDA 3GJEA 4Z7VB 3NSCA 4HT1L 2ZNXA 4FC3E 1TZGH 2NSMA 3F64A 4JQIL 4L37A 3FB7A 3LX9A 4PJAE 2FX7H 4WWPA 4Q9QH 5FYLE 1RZFH 3NP4A 2ADIB 1GGCL 4K5LA 4Z95L 1AHWA 5JW5B 3JWDL 5KYXB 4BRJA 1U8OB 2VDKH 4Z76A 2IH1A 2B3RA 4YXHL 2EAEA 2D0HA 1N3NA 5CKGA 1ZGLA 3D39B 3VD9A 1YUKB 4JMXA 1LK2A 3ME0B 3KEDA 4L3AA 5E7BA 4TOYH 5B1JC 4YSEA 4HBQA 1OOAA 1E7VA 2KZKA 2XHNA 1W6WA 3IU3B 3KYMA 1OCRB 4XWGH 5ABDE 5C0AE 3INUL 3G5YA 1XBDA 3IVKA 1UXLA 1YC7A 3CK0H 3GMLA 1CPUA 3ALWA 4N86A 3UEZA 1HDMA 1KIPA 4FQCL 4J3OC 3CCHB 5DS8A 1N18A 2DQMA 5C0CA 1T66D 2DM4A 2LQRA 5EZOL 4FI7A 2EABA 2BVPA 1UB6B 2BPBA 5CILL 3JUZA 5FX3A 1TZIA 3MHZA 3VXMD 4NKMA 1RJZA 5I1LB 5C8JA 2XBDA 4KDTC 3VWKD 1F02I 2ARJQ 1A25A 2AXJA 4WO4A 1D9KB 5I0DA 3NMEA 2VLKA 3MXVL 3UERA 4PAZA 5H94B 3J8F7 3QJHB 4JFYA 3COOA 2FO4B 1PFOA 4JFQA 4ODTH 5E5UB 3WLBB 2G2PA 5E99L 5TE7H 3V5HA 3GWJA 1JHLH 3CZEA 1CO1A 3HMXA 3CLWA 3MGTB 3GSNA 4LVHC 1OTUC 3VCLB 4AH2B 2ENYA 3PE9A 5DI8B 5D7JC 3SJVA 2H6PB 1DSYA 3WNIA 2R15A 4X4MA 4LAJH 5J12B 3NSYA 3QJSB 1FH2A 1IZKA 3T2NH