5KVEE

Zika specific antibody, zv-48, bound to zika envelope diii
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
101
structure length
101
Chain Sequence
VSYSLCTAAFTFTKIPAETLHGTVTVEVQYAGTDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVGEKKITHHWHRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein/immune system
molecule keywords ZIKA Envelope DIII
publication title Structural Basis of Zika Virus-Specific Antibody Protection.
pubmed doi rcsb
source organism Zika virus
total genus 13
structure length 101
sequence length 101
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5kveE00
3WE1A 2GG1A 3UZVA 4GSXA 3UAJA 3C5XA 1OKEA 4ALAC 4BZ2A 1Z66A 5KVFE 1RERA 5GZOA 2R69A 1TG8A 4X42A 3MUUA 3N40F 3VTTA 2JSFA 2JQMA 5H37A 3N42F 5GZNA 4UTAA 3N41F 5LBVA 2V33A 2H0PA 5LCVA 4UTCA 4FG0A 4UT9A 1OANA 5KVGE 3C6EA 4AM0Q 3UYPB 4FFYA 2HG0A 3UZQB 1Z3RA 5AAWC 5LBSA 1OK8A 1S6NA 1URZA 3P54A 3J27A 5B1CA 5IZ7A 4UTBA 5JHLA 4BZ1A 3IRCA 2I69A 3N44F 5JHMA 5KVEE 4GT0A 1UZGA 1PJWA 2R29A 3N43F 3UZEC 2ALAA 4FFZA 3J2PA 3G7TA 1SVBA 2JV6A 4AL8C 4L5FE 2P5PA 5KVDE 4UT6A 5IREA 1ZTXE 5AAMC
chains in the Genus database with same CATH superfamily
2CG9X 1VRSA 2A83A 3OZ9H 4AMKL 4NQEA 5IJVB 3GSOA 3QQ3B 1LP9A 1MRDH 2VXSH 1RY7B 4XPAL 4ZK8A 1WITA 1IKNC 2MEJB 3LMJL 4OBRA 3FPYA 3CU7A 4Z7UB 2BNQD 1YJDH 3NRPA 3SZ6A 4ZO9A 5L9DH 3QZWG 2QSCH 5B3JF 1ZANH 2A9CA 4LCWA 3DTDA 2CLZA 3K81A 4NOFA 4BWTA 5C0BD 3UPRB 1FC1A 4M62H 5GIRB 1ZT4A 4D0BA 2QGBA 3QG6B 5KS9A 2O5XH 4NM8L 1TVBA 3CFDA 1RZIA 35C8H 3NABL 5DUPH 3K2UH 1XL4A 5CXPA 4PJXB 4GMSH 4AT6B 3G6AA 1OM3L 5D1QA 3HR6A 5JMRA 4OZGA 2I25N 3ARUA 3EF7A 3DGGB 4M7JL 2B1HL 4XB3A 4NWUL 5F44A 1XDTT 4Z7UE 4EE2A 3F12A 4QXWA 1RJLB 2BSSA 4A68A 4A7GF 4F8PA 4NXSA 4MD5A 3O6LL 4MX7B 1KENH 3AG4B 5HXMA 4XPGL 4XX1G 3WTTA 3ZXAC 1MFDL 1CLYH 2YKLH 3IU4L 4NC0B 2WBJC 3BSZH 4PGBA 2X41A 3EOAA 4OB5L 1ZSHA 4I9WE 1KCVH 2NY7L 4KK9D 1NZRA 4PJXE 2G2PA 1F1AA 3RNKB 2TSAA 1ZJAA 4P5TB 1F3RB 1R19A 3Q48A 3H6AA 3DGCR 1OALA 4Z8FL 1JF6A 3P77A 3EGSB 1CMOA 1EGJA 4NO3B 2O61B 3IWVA 1S7SA 2ZSWA 3DV4B 1OOWA 1KB9J 5LN4A 1JXGA 2D2OA 2GSGA 5DVLA 5JYMA 2LAAA 2BNRB 4M6ML 5DVNA 1X5HA 3QORA 4HJ0D 2XQBH 4QHKI 1U4EA 1ZV2A 2K9UA 1HXMA 2AJYH 3QUZD 4NCC2 3K71A 4ZODA 3AREA 1OAYH 2LQRA 1JRHL 2NYKA 5HHVH 2FJGB 3IJSB 1S7RA 2ZJSH 1CGYA 5C08B 1I9JL 4N8PA 4UDTB 1EEZB 2QSQA 4TOYL 1NC2A 5IW1B 4WU5B 2AF2A 2YARA 3FH5A 4QHKJ 4W70A 3C6SB 2XX0A 1K6QH 2VR5A 4OKDA 2JJUA 1GYWA 1V10A 4JMXA 2IQ9L 5I8EB 5D7EA 4D2NA 3CFEB 3FT3A 1MRCL 2K4WA 4JKLA 4K23L 2H1PH 1UQSA 4M1CD 4Y16B 3ZTJG 5BV7C 4O2EB 1VFBA 1T1XA 1JNLL 4XP5H 2JKWA 4Y9BA 3MR9A 4WEUD 1RZJC 2BNRE 4Z7QF 2Q8AL 4LSPL 3SKNA 5JXED 3CZFA 5I74B 5AL0A 5E08H 1FGNH 2V9QA 4XZ4A 3W57A 2EYSB 3CLFL 1GC1L 1FL3B 4K7FB 5C08E 4XBMA 2WWMD 1G7JB 3HS9A 3ZYJA 3ZHNA 3Q8AA 2IV8A 3G5XB 4FC3E 4ZFGH 2CHWA 2X4QA 4C4UA 1NFIB 5IMLA 1A7QL 1B88A 1LP9B 2C9PA 3GSOB 3VGHA 4Y1TA 5FGBA 3HR5B 3TBSB 5CEYB 4KQ0A 2ZX6A 4KK8D 1F1GA 4LSTH 5T1MB 3FUDA 4BCXA 3BKJL 1NCIA 1VENA 4LXFA 4RSVA 2ZXDA 5DQDH 4G6FD 4X4MA 4ODUB 1PX4A 2G2RA 1AVAA 4L9LA 1IGYA 1XSJA 4D0BB 3PJNA 4WHTB 5T3XH 1OAUL 3IE9A 5E6ZA 3A22A 5LQBL 2FQEA 4W4NA 1RZIB 4KHTL 4YDNA 1CL7I 5IHUH 2XV6B 1EZVX 4XNXL 3BPLB 5D1QB 1E28B 4ZFFB 5C0FA 3M6DA 3O4LA 3FFCA 5I0VA 4F2MA 1CE1L 2DM2A 3V7AE 1Z9MA 4U6YB 4JB9H 2OSYA 2UZIH 1RUQH 1Q90A 3IPFA 5DQJA 4MD5B 3LEYL 3QEQA 4GKZB 1MFNA 3WYRA 4Q2ZA 4HK3N 4LRIC 5EZLB 4HUNB 5DMIH 4GEIA 3VH8B 5HD8D 1OIOA 4Y9CA 1FH5H 2OMTB 1MW1A 3MCLL 4PRAB 5TE7H 1NCOA 5BV7H 5FYLD 3R4RA 3FRPB 2DJ4A 4K71B 1CBVH 4I0KA 4XAKE 3BP4B 3I9PA 4FLRA 1ILSA 1RZJH 2AV1B 1EEYA 5DURD 4ZAKA 3ENEA 1QUNB 3O41A 4NB7A 1FBIL 1INEL 4JG0L 2HG5B 1T5XA 1MNUH 4O4YH 2YEZB 1J9QA 1D3CA 4W9CC 5D5MF 4JY6B 4CAGA 1PX3A 3QORB 1KTDB 1KIRB 1MCBA 4BE6A 3S3DB 5CJQH 2DV6A 5JW5A 5H2BA 3F7VA 2MNJB 4DK6A 1DBJH 1G7IB 3HTLX 1NC2B 1FCGA 2NW3B 2NSQA 4AXWB 3H2QA 2JKJA 3V4PA 5EEUA 3QUHA 3D69B 3FT3B 3VWJD 3OKNA 3UFIA 1YNTA 2FCBA 4ZXBD 3PWLB 3UGUA 3D9AL 1WC7B 2L0DA 3CXDL 2CU9A 1NAMB 3MR9B 3BT2H 2HJKA 4AYMC 4JO3L 3RJOA 1DJYA 1QPPA 2OMUA 4TM9A 4Z0XA 1OAKH 3CZFB 4WUUB 5IFAH 2MRYA 5E2TL 1EHNA 1XH0A 1UXWA 4WGKA 1UXLA 4YXKL 3O45A 4JNXA 1BFOA 2X4QB 2RR3A 1T66D 4FRWA 5DJ2A 1LEGA 5AD0B 4KTEH 1ODUA 1PZ5B 2GI7A 1XCWA 3MROA 3VRIA 4FFWD 3ZT6A 2ZOWA 5AVXB 2AHIA 5EEXA 2AABL 7FABH 3BAEH 4GNKB 4MYWB 2EADA 3QFDA 3RKPA 4P59H 3UJJH 2G2RB 2ZKMX 3I3DA 4WUUE 3CFUA 4OGXH 4Y2DD 3QIUD 5EC2A 1DQMH 2IDCA 4PSRA 3HFML 3ABKB 2JB5H 2V2XB 5E00A 4YL4A 1P84K 4W81A 1I1FB 3APNA 4AM0Q 4JVUA 4PCKA 3MX0A 1A14H 2ZUQB 4PRIB 4R0LB 1XF3A 5C07A 5K9OB 2YBGA 3RIAF 2FD6H 2A3TA 4HLZG 3M8OL 2ODHA 3QUMH 4PJBB 3CZUB 1OSPH 4K07A 4KVCH 4R5XA 3RB5A 4S11A 3H8NA 2F7PA 1DVSA 3VXSD 1O6TA 2FUTA 3FSWA 4FG6D 3UPCA 1TNNA 2ZCKH 3P54A 2SODB 4PEEA 3E7JA 1L9RA 1G9EA 2VLLA 2B2XH 4N2IA 3AWFA 4JFDB 5FF6A 1QKZL 2D7QA 1NDGA 1YAZA 5D6CB 4XP4H 4G6AD 5AVRB 3N1QC 4PRIE 3W5MA 3KJ4C 3DHJA 1T0NA 4FXKB 3I6KB 3PRZA 4NZRL 4LMQI 5BS0E 4NQCB 4PJBE 3QCVH 5HHMB 5C0NC 4E5XG 4W4OA 1B6UA 5EOQL 2OJZH 2G9HB 3B6SB 5E2WH 1XF5A 2QSVA 3WE6B 3V55A 5E03A 2CHZA 5SWQA 4CGUB 1LE9A 4TSCH 4JFDE 1P7BA 5J6GA 3QUXD 3NK4A 2G30A 2YPKA 2UXTA 3TBVB 3KPMA 1PW3A 3U9UA 5DEFA 2ZXAA 3LB6C 3QPXL 2X5PA 1JUFA 3Q6FB 4RZCA 3BH9B 5D7KD 4ZI8A 2RAMA 4LHUD 4N24A 4XMXA 1U6AL 4NQCE 3BIBX 5HDLA 5HHME 1NL0H 3V6OA 2CLVB 4PJAF 4X7CC 5DD1H 4WI4A 5IW6A 5JIQA 4ABUA 5I15L 4H8WL 3RVUC 3C5ZA 5DHVH 1VFOA 3STLA 3DX3A 3H55A 4BFIA 1H15A 2MPAL 3CK0H 4LHUG 2GJZA 2R2EB 5IJCC 4KKPA 1NH6A 1TG8A 5C3LD 3ATBA 5D9SA 4K7PY 4BEIA 5E5MA 1J8KA 3TYGH 1UXWB 2BFVL 5E6IA 4AMWA 3O45B 1JV5A 1BFOB 3P30H 3OV6A 4ES8A 3VFNA 3ALPA 1BF8A 2VSCA 3QHTC 2KPWA 1ADQL 4YH6A 1ZS2A 4XBPA 4ES9A 2FDBP 3BJLA 3IGLA 5AYTA 4DVBB 1M42A 5BW7A 1JFHA 2MWCA 4FQXB 3GSNL 5JHLH 1NAML 3KGSA 4Y4FC 1N18A 5LWYH 2EH8L 5IUCA 1X7QB 1DDTA 3BAIA 3QFDB 4E41D 3QK0A 1L6PA 4JM0A 4PHXA 3FW6A 3P2DA 3BW9A 3ZRCC 4KGJA 3TONA 3DO7A 5EEVA 2BMKB 2O6FA 5K1JA 5IT2L 2D7NA 3AY4C 1CGWA 1DQJB 1YEEH 4B9IA 3ARBB 1EJOH 1RHHA 5D1ZB 4AC4A 3S5LA 1DFBL 5B39A 3ECUA 5I0DA 2JK5B 4QWWD 5DFVD 4IYKA 5F89A 5C07B 2FT8A 2PO6B 1E4JA 1I3GH 4MNQA 3GD1C 3QH3B 1PG7W 2E6PA 2Q3ZA 3U4EB 4HWBA 1F4YL 2AGJL 3U0PB 3ROLA 5E9NA 1WHPA 2I69A 4XC1L 2MQ0A 2WCPA 4TVUA 3RYMA 2OZ4H 1R4XA 4OLXL 3T0EA 1IC7H 4MMXB 5FF6B 3ARTA 2A6JA 2FYYB 2EXSA 3HNSH 1WFJA 5ICXA 1CF8L 4ATWA 3T0VA 3HRZC 4N2LA 1N26A 1NEZB 2PPFA 3T3ME 4YPJA 5CBEB 1X44A 4XVOA 4F7PB 2OTUB 1Q94A 4F1SA 1KJ3H 5C07E 2VMCA 4FCHA 4GBXB 3OMNB 3DX2A 4DH2A 1S7WA 5KTEH 3X13A 4OM0L 1G6RH 4PBVC 1G1CA 1GZQB 5AOZA 1AH1A 3OZKA 1KJ2H 1C1EH 4LBEA 1DVXA 2FJFB 1LE9B 1FGVL 2WV3A 4KKRA 3L9EA 2BCKB 1TTCA 5D4IA 4AVJA 3WLBA 1BZDA 1A6WL 1RZKL 2YPKB 5AVSB 5JIKA 4Z6AT 1LXMA 3AUWB 1QBMH 3CPLA 3UBGA 3HW7A 4PW4A 1FYTA 4RZCB 5DEFB 4L37B 2FB4H 1KEGH 1SYVB 4MMZB 4BYHA 3EGDA 2E7HA 1NTDA 4G8EA 2BWIA 3EFOB 5HGDB 3B9DA 4DGWC 1ETB1 3SGJC 4F5CA 4HS8L 3NUKA 4ZUUA 2PYFA 1E8YA 3NFSL 2X4UA 4X9YA 2FGWL 1N8OE 4LKXA 1JHLH 4AKQA 4C56D 4BFIB 5A3ID 5DK2B 3QR1A 1CJYA 2BK8A 4NBYB 1UZ6F 1ACZA 3B83A 2R4SH 2Y7QA 5GRUL 1JWMA 5F9OH 1GZPA 3N41B 1RQ5A 3P0YH 3DK2A 1DVFA 5E5MB 5EBMB 1NOAA 1SUHA 1BYOA 3BQUA 3U46A 5JLZA 1S2EA 5E6IB 2R4RL 4GXVL 1F4XH 3K0WA 4EI0A 4B60A 3LHPH 1NEUA 2XN9D 2ED9A 3ES6A 4G80A 3SD2A 3IVKA 1ZLSL 4TULL 1JXJA 4NWTH 5EEWA 3QUKB 2CJ3A 3O2VH 1U92A 4EDWH 4TUOA 1VKXB 5D7IF 2W80C 1E4HA 1T4KA 4HEPA 2R39A 3NP4A 1U3JA 4HXAL 2VJ0A 3STZA 2AXHA 2HCZX 1KUMA 1KLGB 1MAMH 3WOVA 4B0MM 4HXBH 2CPCA 3BAYA 3RGHA 3V6BR 1UB5A 2DMCA 1CT8A 1EA9C 2EQDA 1INQA 4PTUA 3BW9B 3TX4A 2OXGB 5DVPA 1OCCB 4DKFH 3O3DB 3DOIA 5JR1L 4JCLA 4HJTA 1UACL 2B20A 3AU1B 5B39B 2C5DC 2BSRA 1JZ7A 1EHAA 4X6BA 3S96A 4YHYB 5E9DA 3PREA 4MNQB 1HIML 1SPDA 4G9FA 1XQ4A 2CGYA 1E4KA 3SKMA 4DP0X 3T2QA 3RAJH 1UZGA 1KYFA 4G7SB 4U6VL 4R4FL 2NXZB 3WJMA 3VI4B 3N9GL 3IAPA 1T21B 4ZOCA 2CHXA 4OF8A 2R56H 2UUDH 4YFLI 4MCYB 3T0EB 2LOEA 2CRIA 1OZUA 1JRHI 4N1HB 3Q5OA 5ICXB 3L3JB 3CSPA 4EI5B 3MRHB 4Z7OB 5DSCA 1UADC 3P3RA 4MVBC 4I5BA 1Q94B 3KAAA 4M3KB 1S9KC 4N2GA 4YDIL 2J88H 1IAOA 1T03H 4ORGB 3A47A 4B41A 1QBBA 4PD4J 2CDEA 3DGDA 5KJ7E 1BVOA 3VJ6B 1A5FL 3VI4E 2VLJD 5E8OA 1KTLA 3BKML 4N6RA 4N8CH 3PABB 4NN7C 1XSIA 4KXBA 1BG1A 3I6GA 5JZ7C 2WAQA 4NUJB 3QJFB 3JUZA 4FHJA 4AYFA 3CXHK 4H20L 4UIKL 4Z7OE 4APXA 3BKYH 5B38G 2XTLA 3DRQB 4HIIB 3FTWA 1J9TA 3AAZB 3GMOA 4TRPH 4ZS6D 5C7XL 3BAXA 2P1YA 1ACCA 4D3CH 1P5VA 2HN7A 3RJQB 5CSZA 2F7OA 1CCZA 3VD4A 4JM2D 2CRMA 2WVUA 1NUNB 3TV3L 5JPMC 1PEWA 2X4UB 2YZ1A 4G6ML 2X05A 3LYRA 4MQ7B 4CILA 2EECA 5MERA 3FQTB 1ESOA 1YYCA 1FNGA 3RURA 3OKKA 2PYED 4GMTL 1XAUA 5KYYB 2IDTA 3VWKD 3IDNB 2R2CA 2Y7QB 4ZJ9A 1IGCL 2GBAA 3LZPA 4PBWD 5JA9A 1IU1A 1DVFB 4HUKB 4FADA 4GOSA 5IB5A 1NCJA 2OTPA 1YEFH 3BQUB 5GS0C 3CH1B 1HHHA 5DI8B 4F33B 1OP5K 4CVXA 4G80B 5K39A 1PYWB 2GW5A 3A0OA 3AABA 3LVTA 4N2DA 3LZFH 1MVFA 1K9TA 4KC3B 1U92B 5E8PB 3DMMB 3ZE1B 2XKNA 4LPYA 4P2OC 4Z3HA 1L6ZA 1C7SA 3ULVF 2ARJA 5L7XL 2NY3D 2WZAA 4HX1B 3W39B 1JN6A 3UO1H 3GSRA 1INQB 2AJSH 3TA3D 4GSDH 3CFKB 4E0RA 4AIZB 1BQHA 4O2FA 3K4ZA 4XBEL 3IGKA 4AWJC 4OCRL 4HPOL 1M1XA 1H9DA 4I77L 3S96B 4QRPE 3ZR6A 1DSFL 4YSQA 1K85A 3F04A 4CBZA 3ZE1E 3PUCA 1N0XH 3SYAA 5IVNA 2YMOA 4NT6B 3DJ9A 2FHBA 3RUGB 3RVXC 5SWSE 2EEFA 5JOPE 4NDMB 3GDCA 2WQUA 2IH3B 1G1YA 3ARDA 5AVUB 5E4OA 2FX9H 4LVHB 4XT1C 3B8YA 4GKNA 1N59A 1NGQL 1PDKA 1Z3GL 5EZOL 3GJEB 4JMNA 1E3FA 1PZBA 5F97E 5DSCB 4MAYA 2FO1A 3D4GA 4IDLA 2ED8A 3PWVA 4I5BB 4LLMA 1OPGH 2I7OA 1YN7B 4WO4C 5JO5B 3VFMA 3G6DL 4N8VA 1ITBB 3WY1A 3DX8A 4ONFL 4Y19B 4PJ5D 3RUGE 5FFGA 2OSXA 5J12C 3P9LA 2VN4A 3ZQWA 2DICA 4LCIH 3WAKA 4YUEL 1MY5A 3W81A 5GS0H 5TE6H 4L1BA 1GKOA 4B5ZA 1FO0H 3GO1H 3IFNL 4PJ9B 2W1NA 2IC2A 2H26A 5JUEH 4BBWA 1WQVT 4EQ3A 3X1GA 2P45B 1D9KB 1D5ZB 4U33A 4UQAA 3R19A 2DYPB 1E5BA 1HK6A 2C1PA 3BCFA 2EDXA 1HL9A 3ZZ1A 4Y19E 5EOTA 4MQXC 2QFRA 3MGTA 3QI9A 2E7DA 4AYGA 2Y2YA 2GEQA 3L54A 2EIJB 1NCAL 1YDPA 1VESA 1AE6L 3CGTA 5MERB 3WJLA 1H5BB 1FNGB 4JM4L 3OKMA 1DUZA 2PPEA 5AZUA 2FR4B 1RFDL 5C0AD 3ZHLA 3W1ZA 2D03L 4Q14A 1RUPH 4M4RB 4P5KA 4TUKH 3GRWH 3N0PB 1A4BA 1P9MC 2MHAA 1O6SA 3ARFD 5GGTH 1HHHB 1NUFA 3RHWF 4XOAA 4PAZA 1URLA 5GGRB 4FFYA 2HT4D 1BIIA 3MAWA 5T1JA 1BWWA 5L88H 1WZKA 4V33A 1TO5A 4XN8A 4L23A 1SQMA 2NLJA 3RVVC 4NPYA 5D4QA 5D6DC 3O3UN 2VIRB 4IBLT 5FV1L 2WD0A 3DYOA 3HS0B 4CSZA 5JTWA 9PCYA 3MSPA 5TFSH 2J44A 3S5ZA 2A77H 2ARJB 5FFOA 1LE5B 2WXLA 4OCWL 4W9DC 2Q87A 4F58H 3GSRB 4WW1B 3NYKA 3WJJC 1QO3A 3UJTL 4N0YL 1TQVA 2IOMA 4IU2A 2J8UE 3U1QA 1L0PA 2AXGB 4S1DC 4C55A 5ICYA 1ZS8A 4E0RB 1PZSA 4X4ZA 1SJEB 1NMBH 2GB2A 3LCYA 5DLLA 5FW7A 5I6KA 4CADA 1HJCA 1AGFA 1MRFH 1IBYA 1QSFB 2E9BA 2DQEL 3QNXB 3QZBA 4NP4H 2GPZA 1YY9D 4FNPA 3KBFA 3ME0B 4OFDA 5ALCH 2UX6A 3FUKA 4G5ZH 2BPBA 4GKSA 2WTOA 1A7RL 3F00A 2WIMA 3EG9A 4E9XA 1DL7L 1E3ZA 1X5FA 4YXLL 3FU8A 2VXTH 2J73A 2W9EL 5I1KL 4KO6A 4IBQA 3MRGB 4TTDC 4ZSOA 4ZZFA 2FEDC 4FI6A 1FNSH 2UYLB 3CVIH 3CSTA 3OKYA 3V52L 4Y5YB 2IEPA 4LLVB 3VQ1C 5AYQA 5FEBA 1CFNA 4AYSA 3F85A 1H3VA 2Y3NA 3PWPD 4PRHB 2VXQH 2I9LA 3STBA 2APSA 4AEFA 3MJWA 1QSFE 1T2QL 3O0RH 5DZOA 4KAQL 3L95A 1CI3M 1GGCL 3KPTA 2WYHA 4MD0B 3O6FB 2B1AH 3PJSB 2MNUA 2AEWA 1NSNL 3EHBD 3P9LB 3BP6A 2EIEA 2A1WL 1U36A 2H9GA 3WFHB 3F5WB 1A7BA 1BXAA 4OJCA 5IB4A 1MREH 5E5UB 2EDLA 5KSUA 1YY8B 2OMZB 3PGCB 4PRHE 3B9KA 3F7RA 3HC3L 4Z18A 2H26B 5C1MB 5HYJD 5IF0A 1KWGA 2ZOUA 2FUQA 1Z32X 3EDEA 4J3OG 3WMPA 1G7QA 1J1PH 2IH9A 2NNRA 3EO9L 2WBKA 3IFPB 4N1EA 4WI0B 5DO8A 1P5UC 4O02H 4WW2B 5EOTB 1TCRA 2YD7A 1EO8H 3ARXA 3S8FB 3BPNB 2QZ5A 3E9UA 4XCFL 2IGTA 3T6QC 1XD1A 1UHVA 4ZDHA 2ADYA 4HUXB 3LKPA 4PHZA 2RGSA 4GIPD 5IMMB 5F88A 1KN2L 3UTZB 4A6YH 3IJEB 4W1TA 4CRPA 4C83A 2AKRB 3S2CA 3RTQA 1FJ1A 1U8HA 3KJ6H 3SOTA 5TDPB 3DVGA 3QPQC 4XPFL 3FCSA 3OX8B 1GTFA 1MJJA 2MPVA 2WANA 3THMH 3EH1A 3GXMA 4UUJA 3S36X 3UJIL 5IB2A 4ELDA 3ABMB 3QQXA 1Q1JH 2VN5A 4HISA 2HH0H 2A9NL 1QWUA 3VRLF 1DE4A 1L9PA 4LCYB 1V5JA 1U91A 1HE8A 4NPYB 1E9OA 1IAIH 4LDOB 2DIEA 3L48A 4ZD3H 1JZIA 3IXAB 3G5WA 4R26L 5MP6H 2IV9A 2VR8A 5LHDA 3S36H 5DO2C 1I8LA 4GUPB 2HUEA 2OP4L 5LGHL 1SOKA 3D39E 4LSQH 2AV7B 5KVEH 2IOIA 3FOLA 4LNVA 5FO8B 5E1QA 1OPOA 3ZO0A 1ZD6A 3T65B 4PBDA 1AYRA 1ZS8B 1VZIA 2DM7A 2BY2A 1BYPA 2MMXA 4HIXL 4ZW5A 2E75C 1CVSC 4CADB 2L8AA 3WUWG 1L7IH 5F8QC 4AGQA 4PGJA 3HI1A 1B4LA 3P0VL 1LNUA 1SYSA 2WBJD 3EG9B 4OZ4B 3L3IB 4IRJC 5L8JB 2DJMA 2XPGA 3SBPA 4AZ8A 5I1LB 1TIUA 5EIIA 5IWLC 5KSVB 2F9BT 1AR1B 1CR9H 2H3KA 4AUUA 4P2RD 1MW0A 4RNRA 3R7RA 1WBXB 4ZTPH 4NZFA 4JY4A 5C0JA 1OKEA 5KJ4A 3MLRH 4F37K 2VZSA 3L95B 4P46C 1W0WB 5ANHA 1T20B 2L3BA 3VGBA 4OJEH 4AQ8C 1YEKH 2WLLB 3EYUH 4F24A 4HIQA 4FFTA 2ZXQA 4PWEA 5EZIL 3FB5B 4R3SB 4WTZA 3ZHFA 2JMRA 4UQ3B 1P7QB 3MA7A 4N5UA 3VX1A 2OJEA 1I85C 1AP2A 1RZ7H 3SE3C 3M7OA 1I3RA 2Z8VC 2UWEB 5CZXC 5BNXD 4KKBC 3N42B 2H9GB 5HP5A 3APDA 3KDMB 4BWUA 1TTBA 3IRPX 5DS2A 2HRGA 2GTWB 4KROC 1JDAA 3L4TA 3WY3A 1ID5I 2VDMH 1SOSA 1KGWA 3ASOB 5I1EL 5IF0B 3ECBB 3BH8A 1Z9OA 1F86A 1KF9B 2XG4B 4DFIA 3UBHA 3P2BA 4AOFA 3UOAB 1HH6A 2V17L 1RJYA 1MCJA 1TCRB 2QPUA 2QADC 4PG2A 2B08A 4UV7L 2DLFL 4K5NA 1IMHC 3VMPA 3QAZC 2UXFA 2IWKA 3BVNB 2UWEE 3NAAH 1MLCB 5DJYA 2D9QB 2FEEL 5CJXA 4GAAA 3D12B 4U3CA 2ICEA 4WI5A 3LKSB 4K3EH 4C83B 4OLUL 2ZXGA 1M1SA 3QFJD 1BF2A 1X9RA 4D9RD 2KUTA 3TN0A 2X4TA 4JO1L 2DH3A 3FCSB 3ZUNC 1MJJB 3QRFM 5HYFA 5HHXH 1DVYA 3R18A 4GP4B 4GSQA 4N0UE 2P24B 5B8CB 1X5KA 4KUZL 2HFEB 1F02I 2GY7B 4UQCA 2IOOA 3FSVA 5E70A 5SWZD 3ZDZF 1FL6A 5IJBC 1U91B 2ADFL 1TETH 2EEDA 2WXNA 3H1ZA 1PY4A 1E67A 1MH5B 3N06B 3BIAX 4PJEE 2EYRB 1MHEA 2CJUL 4KVNL 5E5RB 1F1DA 4NJAL 2MOQA 2JKSA 4IU3B 4AQZA 1RUML 2Y07H 2HWZL 2UUDK 3VXTB 4DZBB 1IC4L 1WG3A 3T4AA 3VI3A 2AZUA 2DQCH 3FOLB 3P0GB 5LVEA 3ELQA 4FKEA 4P49A 2AEPH 4WWPA 5E8EB 4NO0A 1KXVC 4U1IB 5D1ZI 1A1NA 3PY9A 5KWYC 1YQ2A 2YA0A 4APQC 3UAFA 5I1CL 5F7FA 1AS6A 1AO7D 2QKSA 4HWZB 4FNUA 3HI1B 5I1JH 3LKOB 4JFZL 2YPVH 4YDKL 3DJSA 1FL5A 3RILA 1DBMH 2ZTBA 4L3EB 1SXCA 4AW4A 3MOAL 1WTGT 2C3HA 4KTGA 1EAPA 3PU7A 5A43C 4TL5A 3D5OF 5DHXB 3HE6C 5TE4L 1EX0A 2WIIB 5EIVA 2JKRM 1ECYA 1G9HA 1BD2D 2BWDA 2DB8A 1MCCA 4KNTA 2CGRL 25C8H 2VDRH 1IBGL 4JY4B 1IZKA 1N7MH 2EVHA 1CTNA 5GZOA 1LEKB 1M7DB 2KDGA 3QUGA 3FUHA 3K6NA 4HQQL 2OL3H 1N5AA 1D6EA 2B3RA 4YGVA 1Q0YL 1JP5A 2XJLA 4UQIM 2ESVD 4L3EE 2DQIH 2WVVA 2JQAA 4NCDA 4P23B 4LHJB 2AK4E 2EDNA 3TEUA 4YEEA 1BM3L 1P53A 4GG6F 2CO7A 2C9AA 4EN3A 2QSTA 3DX0A 4OZFB 3WKML 3W38A 1R34A 2YKKA 4NKIH 4P5RA 3UTTB 4ZYKA 5DVOA 1HEJC 3EBGA 5D7HA 3L4XA 2BC4B 2OMYB 4HYTB 4NC1E 2YK1H 2YOAA 5KYUA 1X9QA 1XTLA 2QV2A 4W93A 5SX5H 4ZX3A 1SOQA 5T3ZE 4IKJA 5FKAB 1J8RA 5I9QC 1A6ZA 5DK3A 1A8ZA 3NFPB 2YAFA 5AB0A 2OW7A 2DYRB 3ZT5A 3LPGA 1OAQH 2F5AL 3CDGA 4MASA 2ZAHA 3MBEA 4HV8B 2ICEB 4HD9A 4MWFA 4KJWC 1LDSA 1W91A 2AJXH 2VRQA 1U8MA 2G5BA 4PJHB 5GGSY 3UTTE 2ZKHH 3DHUA 4U1GC 1J18A 4XP1H 2ZG1A 3SGKA 1M71A 4HCGA 3QDMA 5F72S 3N43B 4F3FB 4MAUH 1BEYL 3QHFH 4RISL 5EC1B 5J6HB 4Y9FA 4LDEB 3VQLA 3TEYA 3GSVA 4CDHA 3KLHC 3UIYA 2NY6B 5AW0B 5SX4I 1DJIA 2YSSB 4FXGB 2XOTA 1TJGL 5E8NB 5AW1B 4J2XA 3V9FA 4X6DA 4MJIB 5GS3A 4MCNA 1FORL 3C6LC 4PJHE 3FQUB 3O6ML 4LVOB 3T4AB 4ECNA 3VI3B 2H4EA 2VABB 1SHSA 5A16A 5IOPB 2BJML 2TRHA 2OSLA 5JW3L 4H88H 1A1NB 1AHWA 5JDSA 2VSKB 4N86A 4L4VA 1SM3L 3BUIA 3LTVA 1QTYT 1PNCA 2Q2LA 4MS8C 5DUJA 1S3KH 3HC4H 3BO8A 1E5UI 1T22B 5A2IH 3ALXA 4JREC 4FF9A 1FL5B 5IQ7L 4MJIE 5HDBF 4XOEA 4XXCA 2E47A 4XMKH 2V2WA 2WYZA 2EO9A 3DURB 3LEXA 1HEZA 4PWJA 2QHRL 5BRZA 4MBOA 4DKEL 5C3IA 4XPBH 5IY5B 4PW3A 3VI3E 1XV8A 2PWFA 1IQDA 2F53E 2NOYA 4J3WA 3JWNC 2PWDA 1WCQA 2HYMA 3PF2A 4FA8A 2ZONA 1OSZB 5C0ND 1EFXA 5FK9B 4JFFB 2WW8A 3LRLA 4KJYB 2NTSP 3A6BL 5IBLC 1F4WL 1U42A 3FF8A 2L7JA 1OCRB 3KPRD 3I3EA 5I8KH 3UBXG 4J6IA 5EUOA 2BVYA 2WO4A 3QG7H 3DVNA 1FRGL 4NUGL 3M1BA 2C7UB 2NZIA 5DJAA 1YQVL 4U1NA 3H7BB 4H1LH 3LNDA 1HTYA 4HLJA 1IC5H 4XP6L 3LB6D 2ETWA 3MRDA 5HHOA 1GJIA 4EN3B 1XF2A 5IBTL 3MNZB 3SD5A 1L7TH 3OLIA 4JFFE 4WUKH 1XBDA 2Q2EB 4NM4L 1M6UA 5GSRA 3IPEA 3RVUD 2CDGB 3SO3B 1GGBH 2HLAB 3MJ9H 5CIPB 1KIPA 5DZLA 1CD8A 3L2MA 4WK4B 3HI5L 5AW8B 2P5WA 3ARGC 3LS4H 3RG1C 3DROA 4IIQB 2CKBH 2WXIA 2BS71 3Q7JA 5I0YA 5T3ZL 4ZO6A 3VXUA 4OT1H 5AYUH 3W37A 3KPPB 1A6ZB 3IDYB 5CILH 3AT0A 3WUZA 5HYQA 2B3IA 5TGBA 1BA9A 2ZXCA 2WNWA 4J1UA 1ED3A 4I18C 1QYGL 5T1DH 1DJXA 2MQCA 3QHZL 3WL9B 2D31A 3WDIA 4GW5A 3RGVB 3OXSA 1UB6B 5E99H 4I3GA 4F7CB 3QIWB 2Z91B 1NGXA 3P4MB 2LE9A 3B1TA 4XMLL 5E8DL 2AMGA 4Y4FD 4BDVB 3QDGD 1LO2L 4BA8A 2VDPB 3I75A 4RGMB 3QISA 1OWRM 5AL8A 2K3TA 2VQUA 5D7LA 3EOYG 3MV8D 4AVHA 3MYJA 4PGCA 3HBPA 3JWNH 2KZ1B 3QS3A 4X80H 2D7TH 3HG4A 3V6FB 5A6MA 1KCWA 4XR8C 5HGGS 4J3TA 4GI8A 1IM9A 1XR9A 4ZTOH 5IFHL 3IWUA 4JRYA 4YDJB 5GXBB 4U1SB 4N90D 1GXEA 2KL6A 2X4SB 4V2CB 5E1AA 3FSOA 4MNHA 3K6OA 3HRPA 4EI6B 2FX7L 2PNDA 1IV8A 3SBWC 4ODVL 4L4VB 3S9DB 5EFIA 5FC9A 2TRYA 3SE9L 1XZ0A 4AGMA 2BDNL 5FUOH 4NFCA 4Y4HA 4JAMA 3VXRA 5JIDA 3J7HA 1A7NL 3WHXB 3CHPA 3IDUA 4P8QA 3TF4A 2EUWA 1NC4A 4LL4A 2EIZA 2WO2B 2OMXB 1C5DB 1U58A 4BK8A 4KHXL 5JQ6H 4CMMA 1Z9SA 3RDTC 1KCSL 1IGIL 3I50L 3NJXA 4PREA 2KI6A 3GS7A 3MA9L 4XN5A 2F1EA 1JHTA 1SJVA 3AITA 5KSAC 5FO7A 4AQEB 2B5IB 2IGFH 1EFXB 5D96B 1U3HA 3NT0A 4MDJA 5EBLB 2VXSL 3INUH 1T1WB 3OL2A 3UTSD 5DZJA 3BZFB 4W9HC 3WO4B 4AK1A 3N6YA 4F8TA 5L9DL 5ISZE 1UOLA 2WQXA 3ZLQC 3DVNB 1TR7A 3F8UB 2ARWA 2XWBA 4HAFA 4YBLC 4QNPF 3RIKA 3TVMA 1A47A 3SSGA 5T3XE 2ITDB 3QWNA 5I1IL 3F3HA 4RFOL 2L7EA 1ZDSA 4Z77A 5IHZB 1ZLWH 4WV1A 1DQLL 1I1AA 1FLTX 1NCWH 1AIZA 4KMTH 2XVBA 4JFHE 5MI0C 1I4FA 2R0LH 5FOJA 1JD9A 5FM8A 3REWA 2K9FB 4DPCX 2Z31A 1JGUH 1XSOA 4MB1A 1RK1B 1G0DA 3X3FH 1PSKH 2X6CA 2BWQA 3FTUA 1WVZA 1QHOA 2FATL 3GSNA 4EUPH 3OAYK 3GMQA 2FRGP 5JHDD 4WY7L 1AANA 4HOXA 1HSBA 5DUML 4QLWA 3D2TA 3W9EB 3C8DA 3VM7A 1P4IH 3MRQB 1R24B 4G11A 2Z34A 3B37A 3VYNA 4LLAA 3AS1A 4GW5B 2OK0L 1GGTA 4I48A 3L3HA 3DX6A 3CDZA 4UTBL 2ZOLA 5I2IA 1JCVA 2DW5A 3GC3A 2NR6A 4K0OA 1LDPL 1O7VA 2AZAA 4QRQA 1L9QA 1XEDA 3GK8L 3HE7C 4FEMA 3BD4A 1KLUB 2A4EA 4JFYB 1IC1A 2MIZA 1RJZA 2WLZA 2VR7A 3KWVA 4GINA 3L3OC 5I73C 4ACPA 1V7NL 5EULV 3VXME 2VNCA 5I1AB 3I75B 4BK4A 2XA8L 2YQGA 3NZSA 1P7KB 2Y7SA 3MYJB 4OLEA 1O0VA 3QZPA 1GY1A 1QLEB 3PV6A 1TT6A 1YLBB 2R2BA 5IQNA 1Z1WA 2UXVA 2G4GA 1IM9B 2H41A 4JRYB 2A74A 1EAOA 1Y1DA 5EF2A 4ZOBA 4MNHB 1K6QL 3K1KC 2YQ3A 1TTGA 3UAJA 3K8KA 1KLFB 1ZIBA 2DF3A 5EFIB 5GGVL 4Z7WB 2KZKA 3D48R 2BVTA 4ONHA 2BNUB 1BBDH 4OGYL 1KCRH 12E8L 4HJUA 1AQKH 5DD6A 5KS9F 3VVVA 5FV2A 1EH9A 1NLBH 2VDPL 1QFPA 2E8ZA 2Z92A 2A9MH 3FBQA 3TT1L 4PLNC 2EIZB 5CEZH 3K6IA 4GAYA 2HZHA 1DO6A 3HPJA 3MC0A 4PIBA 4X5XA 3D3VD 2VWEE 3KPNB 3EYFA 4CMMB 2BY3A 1A2YA 4E9LA 5DRZB 4IGBB 4OZGF 1AKJB 2NY2B 4MVBD 1PJ9A 1MIML 1KG0B 3A4DA 1IAIM 5IMOB 5FW8A 1T6BX 2UY7B 4RMWA 1WJ3A 3MPCA 1KY6A 3PAUA 5I17B 1VPOL 2BLFA 3IFOA 4Z7WE 2GI0A 2A6DB 1HSAB 3AS2A 2VLRB 3PP3K 1JGIA 4R6UA 4HKXB 2VRAA 5JZ7D 2X2JA 1GZHA 1S78C 1W16A 1IARB 3CSYB 4PYHA 4XX5A 4B9PA 4OD3H 1JTTA 4W68A 3SYQA 2OYKA 4UTAL 1ML0A 2YGPA 2V3EA 5T3XL 2FEEI 4WV1B 3QDJD 3DXAD 2B7DT 4R97C 4YHMH 1EJ8A 1ZY9A 3D4ZA 4ZMYA 5AAPA 4TLUA 5EO9A 3MV7A 3L4CA 3E6FA 1OGTB 5F7WC 5C0GB 4ETQB 2JCCA 2DMBA 1W0VA 1ZA3A 3RIAK 3MTRA 3ZDXB 1G0YR 4JB9L 2VLRE 3T3PB 3FT0A 4TSAL 4HUUA 4NRXB 3UG4A 1UWFA 3QZWA 5IUSA 1CGSH 3V0EA 2VDOH 5JW4M 5LBSL 1JE6A 2GBVA 3ZU8A 1BIHA 1N5YL 1SBSH 5LDSA 1G7LA 5I16B 3EJRA 5KBMA 1YEDB 2X4RA 3K0YA 1SN0A 5GS0D 4A67A 3W2DL 4M00A 4FA7B 3IDIB 4AYDC 4WFFD 3EYOA 2BNQA 5EU5B 1I7ZA 5TE7L 5BV7L 2IXQA 2QVMA 3DX6B 4TNWF 5C0CB 1CBVL 2YGVA 1JPSH 5KVFH 2ZOLB 3GMRA 4ODWA 3UIZA 3C75A 5C0BA 3ROOA 3ZDXE 2EE0A 3I9GL 2GJ6E 1CXEA 4IOIA 1E27A 4NGHH 2D0HA 4RRPG 5F7DB 1DQQB 3T3PE 3U2SA 1PAZA 1FFOA 1KOAA 2DLGA 4P2OD 3HLAA 5GS1A 4IRSC 5FIEA 2PR4H 2J8HA 4Z7VB 1XGTB 5FWRA 3WAJA 1KT2B 2EKSB 2N1TE 4MCZA 1CL7H 1QFUH 4KXCA 1UVQB 3TOPA 4Y5VC 4HU8A 5C0EA 4M5TA 2W65A 4HIHA 1UWGL 2EDYA 3P40A 2WCGA 1S5HB 3PV6B 5DZ9A 2JB6A 4XCYA 5CJQL 5C0IA 1WA2X 1JZ4A 2R2BB 5IKCA 1BG9A 4JQIH 4AQ1A 5C9JB 1A6TB 4JDEB 1HHJA 4KQ3H 4XOBA 3FFOA 3CVHA 5C0CE 1OCZB 5TK4A 3SEPA 5IR1A 4BSWB 5BVJA 2E6JA 1CDYA 5LGJA 1A9BB 1MHPL 1LEIB 3ZZLA 5AOIA 3PGDB 2DJUA 2EDWA 3RVXD 1VGEL 4OUUA 1BFVH 3FUFA 4PCTA 4Y1AD 4RIRB 1XGQB 1RZ8B 4Z7VE 3BT2L 4QXUH 4KX8A 5B1JC 4MDRA 3F6JA 5HI3C 3L3KB 1OAKL 1UH4A 3NEEA 1FFTB 4GAYB 4PGDA 5JNYA 4W9IC 5EBWA 4ZX5A 5IFAL 3MNVA 3KWTA 4XMUA 1L5GA 1A2YB 1VGKB 1FDLH 1BXXA 3CNKA 3Q0HA 1IKFL 1U8IA 3QVAA 3BAKA 3KL0A 4JCWA 4WO4D 1BJ8A 4OQTA 4DSYA 5F9JB 1JGEB 4DZ8A 2Z93A 4HOWA 1H3PL 3L9RA 2WKGA 4HPYH 4QF1A 1KWKA 2L4OA 3I02A 3D7PA 4P99A 5HTSA 3MJ6A 3IFOB 2WXQA 3QUZA 3SDAC 1D5XB 1R3KB 4UT9H 1CD1B 4NENB 2JELL 1DEDA 2XWTA 7FABL 4FQIH 4FABH 3PNWB 1OHZA 1L6XA 3GSXA 4CGTA 1YCSA 1ZGLP 4WWKA 4JY5H 4Z0BH 6FABL 2HUHA 2G75A 1IGJA 3BQVA 2X2UA 4KY2A 5PCYA 3GJFA 2JJWA 1EMTL 3G9VA 2UY6A 1I7UA 3MV7B 2AXFB 2VN3A 2ZYIA 3BDYH 5B1CA 3RL1B 5DHEA 3VRJA 4GXUN 2JCCB 3BMVA 1V7ML 5JXEA 1HX0A 1P84J 5DC2A 2B59B 4JANB 1QLFB 4W6YB 1ZV9A 4P3DA 1SJXA 1MJUL 4EZLA 4R7DA 4XNUL 4YHKH 2AERT 1R47A 1ZT1A 1B0RA 3GSUB 5FYKE 1T7WA 3ELAT 1J9CT 2KZWA 3P11H 1G7LB 2QTEA 3WS6C 2BP8A 2YPLD 3DI3B 4XP4L 1A4KA 1KYOK 2OQJA 2WXHA 3NEXA 1HESA 3GBML 3UO8B 4LL1A 1QAWA 1I7ZB 4K4KA 2VDKB 1XAKA 4HCRL 1YNTF 3OMIB 1KZYA 4F93B 4U2YA 3RVVD 5GHWL 1NWPA 2G5RA 2X4NB 1E42A 2AEIT 4WAFA 4Z3JA 1N10A 4XPHH 2EABA 2HX7A 2Y2WA 4WSJA 1EDQA 4FQ1L 4UNIA 1KN4H 3HLAB 2WJ5A 3OHXA 1J1OH 3QEGL 4J3UA 4N22A 1MI5D 3S5YA 4HUWA 3MUJA 4PQXA 2DWDA 3EJCA 2CAKA 3DX4A 1E8ZA 4S1DD 4TVPH 3CZNA 1U8JA 2CUMA 2WHVA 2ZOKB 1C7TA 3BP5A 4PB0L 1I7TA 1ZLEA 4QUOA 3CVHB 1BQ5A 3BIKB 1IFHH 2YIHA 2WUCL 3V0VA 5BCAA 1NL0L 3ZTNH 1WFNA 2W59A 3PUUA 3NSJA 2EXYC 4OLVH 4CC1A 5EN3A 2FH8A 3D4CA 1NGPH 2B1OA 1E9QB 4TTDD 2FEDD 1S9VA 3HZMB 3UADA 1FAIH 4KKLC 4ODXA 4PGDB 3KM1A 5JNYB 2Z6FA 1NCGA 3MNVB 3N04A 4X99A 4XXWA 1AQ8A 4JHBA 2YGNA 4UB0L 1L5GB 5KSBA 3TYGL 1BQKA 5H35B 1EJFA 1Q9WA 3CZSA 4IBSA 3V0DA 3N1PC 1KTBA 1R3HB 1AXSA 1TKWA 1CU4L 1TDQA 2VXUL 3RP1A 3KXFD 3BEVB 4FLQA 3BVUA 3FDWA 2QQLL 5T5FH 4I0PC 2VDLH 4ANWA 2E7BA 1CFSA 4L29B 4ZUWA 5JHLL 4CN4A 4Q9QL 4U1LB 3SPGA 4L8SB 2FBRA 2RCSH 4NCC1 2FJHB 2YN3A 2C1OA 2EVFA 4PWHA 1OB1B 3HS8A 5IZ7A 3U7YL 1IGJB 2NCMA 5EPMB 2P8PA 3VWJA 5HVHB 3OQRA 4DAGL 1VF5C 3MMEB 2PW1A 4ZXBA 1FZKA 1VERA 2O72A 4LK4A 1K5NB 4JPWH 4QRRD 4BZ1A 4UT6H 4KKZA 5I5IA 1JXFA 1I7UB 3KCWA 3LQAC 5MEOB 3VYPA 5MHSD 4IDJH 1FZJB 1F4AA 5DMKB 4JZJB 4HFUL 1BMGA 5C97A 1TJMA 1PIGA 4PJCF 5CMAB 5HYSG 1KB5A 5FYJH 1RVFH 1ZT1B 1B0RB 3RTLA 3FH8A 1LQBC 3L7FA 1M7IA 4PJFA 4OSUL 4F2FA 3I2CH 4P5MA 2WPGA 5FYKL 4Z3EA 1CLVA 3PQYB 1JI2A 3QPQD 5BRQA 1PL3A 1X9UA 3TWYA 2A0LC 5DFAA 1F11A 1M2OA 1A7OH 43C9A 5DCCA 5EU6D 3T2NH 4P06A 1JNNH 2PCFB 1QRND 3EDFA 4HH9B 4PW9A 1IVLA 1ES0A 3TTYA 3DJZA 2I60H 4XHJC 1QA9A 4ZMNA 2ZCLH 4RVBA 2XN0A 4N5ED 1C5BL 2DLTA 4Y2DA 3O3AA 5DJ0A 3QIUA 3VD0A 2VAAB 3HN5A 5AAMC 1G6RL 1PKQB 1U8PA 4H7VA 2GG1A 2K1MA 3ARRA 4PJ7E 3N2JA 3OHXB 5B22A 3WLWC 3AGVA 1XIWC 4H0LC 4FS0A 3L7EA 4JZOA 3HZYA 3PQYE 3HKZA 5K9QI 2XYBA 5CU9A 5GGSA 5SV3A 4KDVA 2H8PA 1JPTL 4KQ4H 4G1MA 4X42A 4QAWA 3VXSA 2ZWNA 3HG1B 2VDKL 5HDOA 2PABA 3ZDYF 2LU4A 2PCPA 3L1FA 1EZVY 4E5XA 4L8DB 1CQKA 3NZ8B 1FHGA 4IRJD 5F1SA 4A7GA 2CO6A 1PKQE 3DSFH 1UT1A 1YMMB 1GSKA 2ALWA 4V1DB 5I0WA 3T1WA 2Q86A 4XO4A 4LF3B 5IEHA 3WKPA 1HILA 4MBRA 1S9VB 3C8KA 3RWEB 4NO2A 2IVFC 4EEEA 1D6VL 1UEYA 2R4SL 4BGLA 1IB5A 3CDCA 4OGQC 1SFHA 4ODXB 3T0XA 4BCYA 3LQAH 1RK7A 4X99B 3HZ3A 3ULUF 3VD9A 3HG1E 2H0JA 4R2GC 4WJKB 4RAVA 4P46D 3VFOB 3QRBA 3A21A 2XXFA 4O58H 5GGQL 1W8EA 3OBAA 1YMME 4V1DE 5LCVL 2HFFA 3BWAA 4G8FA 2X4OA 3DTXB 4K3JH 2QGCA 2ZUXA 4HGWA 5CZXD 4ZUWB 4F7TA 2ZX8A 4KKBD 2PKDA 3N44B 2G9KA 4PV1C 4X8JB 1IQWH 1MAML 4LHUA 2IG2H 1EXUA 3C12A 3LZQA 4HXBL 4KROD 3ULAB 5B7FA 2QBWA 1J0HA 2NTFA 2LU7A 2HVKB 1QUPA 5DMJB 3FCTB 4HFWB 4XPAH 4ZXBB 1A1MB 1FZKB 3DWTA 3V6ZA 4G8IA 2FH6A 1ZVHA 4X83A 4YDZA 5KANI 4G7QB 2E86A 4IMLA 2DKSA 5ELIA 1ZPLA 2QADD 1SQ2N 3QWRD 1QP1A 2WTRB 3BE1L 3FOMB 4NQVA 1NBYA 2AS5M 3E2HB 4OZHA 3VNZA 5DA4A 2VZVA 3RAJL 1HHKA 2L04A 3NN8B 1WWAX 3L08A 4NJ9L 3VFVB 4NM8H 2NY4B 4JQVA 1E7UA 3NABH 3L7FB 4FULA 3V10A 3ASNB 1I1YB 3OWRA 2JLLA 1OM3H 1TPXB 2GJPA 4L48A 5EF0A 3WGVB 1E6JL 3WELA 43C9B 4M7JH 4Z7NF 5FFLA 2B1HH 1BM7A 3WV0A 4NWUH 2XWRA 2FE0A 3W11D 1QA9B 1WH0A 4HHAB 3WTUA 1K4DA 2Q3XA 3O6LH 5B1KA 3SQBB 4E41A 4XPGH 4UQ9A 2I32A 2X2YA 3NZUA 4N9GB 4ABVA 3VDBA 1MFEL 2FWOA 1YNKH 1MFDH 1BECA 2BVOA 4HIEA 4PVMA 3BVXA 1U8PB 2HJFB 4M7ZB 5E7BA 3Q8CA 4G9DA 4ZMQA 4OB5H 4JGJA 2NY7H 2H32H 3KBEA 1KBBA 3HZYB 2CQVA 4MJHA 3FO2A 2F7QA 1YEGL 1KB9K 3SOBL 5FM5M 1A0QL 2H8PB 2A9AA 3SE4C 4QXGL 4APQD 4Z8FH 2A9DA 2VUYA 3S4SA 2ZNXA 2XIBA 4JKWA 3FRUA 4EQ2A 3ESPA 2N4IA 1EZLA 2PCPB 3JV4A 4KNQA 2WLJA 3CXHJ 4RAUA 2AQSA 4HKBB 3FU6A 4IOFC 4M6MH 4WK2B 5H4ZA 3L5JA 2CO6B 1DN0A 5B3JE 1QFHA 4YHIA 5FM5O 1NIBA 2V7HB 5IEHB 2PP8A 3IJYA 4Z3FA 2PPAA 3JV5A 1ASQA 4EXPX 4QYOB 3CBRA 1JRHH 1IEAB 1O9VA 1I9JH 3CE1A 3HE6D 4XXDA 4IK7A 3RGBA 4TVSa 2IQ9H 3OB0K 3LH2H 3OKEA 1YEFL 4JFED 2GVYA 1MRCH 4K23H 4QR7A 5HJBA 3TXAA 1F41A 2XZCH 4RAVB 3WFZA 3CFBA 2DD8L 2KYIA 4GLRI 3RHWK 1AD0A 3QRLA 4GW1B 5EZPA 4U3HA 3D1MC 4LSPH 4G8FB 2X4OB 2ZG2A 3LHAA 5B1BB 1DSYA 4K73A 4NQDB 2CIKA 5KZCD 3UH8A 1K72A 1EXUB 2EILB 1FNEA 2XY1A 1Q1PA 1T0PB 2CH8A 1R5IB 3UGEA 1A7QH 4EBQH 3HAEH 2DY2A 3FB6A 4C56A 5F7HA 4P5TC 4GH7B 2Q76A 3QQDB 2X3CA 2ZF8A 1PQZB 3BKJH 3DUSB 4MNGA 3UTQB 4FL4B 1OF2A 5F7UA 1RP9A 1NBYB 4Q56A 4AE1A 1GL4B 2YD1A 3LSOA 5ITBL 3MLVL 4NQDE 4W9KC 2VW6A 4X7TA 5LQBH 4ELMF 3GUTB 4KJWD 1KXTA 1YHPA 2XN9A 1CXHA 2V9UA 3WN5A 3OWEA 3QO1B 5ID0B 3KL5A 4XNXH 2FX9L 4OFQA 1HNGA 2OXHA 1W72A 2HKAA 2X6BA 4QTHB 5DK0B 3RWIB 1KNOB 1TMQA 3KLHD 2VLME 5MEQA 4H1LG 5DTFA 1A9VA 3GSQA 3LEYH 4Y16C 4E41B 5JHBA 4XVUC 3GMMB 3LAFA 4IOSD 4UANA 2VL4A 4FQQA 4Z95H 1ZSDA 4Z7QE 4J27A 1S4IA 4JDZA 1NBZA 3C6LD 3IGUA 1M7XA 2PXYB 5J3HC 2FIKB 2COVD 3LIZA 5I74C 2I27N 4KDTC 2CO2A 4P2QB 3GO1L 2QR0B 4FNQA 4MHHI 3A4AA 2ZYHA 4FQHB 1LJMA 4FNRA 5DMYA 1UH2A 4MS8D 3S4SB 3VA6A 2MQGA 2Q9OA 1XGUA 3W0WD 2XWZA 2FL5A 2GYSA 3FRUB 4NP9A 5F9DC 3X11B 3RA7L 1FBIH 1U95B 4JG0H 4Y89A 1MCWW 4JL1A 5J1AA 2AK1H 5EO0A 3N40P 2WY3B 1JERA 5DFTA 1DN0B 3FN9A 2C3VB 4YHIB 5EG6C 3PYCA 4NYLA 3K2MC 5FWQA 2J25A 4R90H 2R27A 1LWJA 1E4XL 5DS8B 3WN6A 4PFEA 4P2QE 4M03A 1ZGLM 2AANA 2LVEA 1JYWA 3N1MC 1T1ZA 3ZTDC 4N25A 2EH7L 5B38A 4XGZB 3OKEB 2ADGA 3GBNH 5CZRA 2WUBL 3IXTA 4I7ZC 2VLJA 3BPLC 3MYZA 5D1QC 4GRLB 3GHBL 1C16A 3D9AH 2XWEA 3V4VA 1AD0B 1KDIA 4GSRA 3OR6B 3JWNG 4H8HA 2FNBA 3K3QA 4JO3H 1KFAL 4ZX6A 4U1KA 4N3TA 2IH1A 2YRPA 4ZPTA 5E2TH 3KYMB 2G5UA 3QEUA 4Q4EA 5I8OH 5D5MB 2A77L 4FFZA 4YXKH 3FU0A 3G7TA 4WNSA 5EH1A 4MMYA 3U9WA 1Z9LA 4F58L 4NX0A 1WWBX 1E2WA 2D7PA 1JZ3A 4JM2A 4HUMB 4DQOL 4A66A 2YFOA 3RQ3A 5IOKA 3ARGD 2VC2B 4NQXA 4UU9A 4K71C 2PYEA 2Z4TA 4BQ6A 1JGDB 2AABH 3VWKA 4WHYH 2W38A 5EMYA 4CU6A 4H8WC 4G5ZL 5GGUA 3KPQA 5G4MA 4DERA 5IQMA 3DV6B 2RB8A 3TIEA 4X7TB 1IM3D 2VXTL 3PIQB 5ITFA 3HFMH 5D5ME 1CN4A 5EIQA 1FNSL 1K8DA 1OWWA 2BZ7A 3F83A 4W9JC 1YG9A 4WRLA 4U49A 5C8JA 3GINA 1V55B 4R96A 3L6FB 5K9JL 4NSKB 1NANI 2VXQL 3E80A 3ZHKA 1WWWX 1X5XA 2X89D 3QJHA 5DTFB 3NRFA 4X4YB 1N68A 3JV6B 5J0BA 1EAQA 1RZFL 1NMAH 5T5NG 4RETB 1QKZH 3TA3A 1LILA 3KLAB 4TF4A 2GEEA 3BPOB 5F7LB 3SJVD 1U2HA 3HMXA 3SPIA 4QGTA 3UACA 4EUPG 5J13B 2BVQA 5JIIA 4NZRH 1CB4A 1MREL 1AGBB 4CW1A 1ACXA 5J11B 3WEAA 2PF6A 3FQWA 2IAMB 3LN5A 1KZQA 4F57L 1RZGB 5EOQH 5F2FA 3P3YA 5C0DA 3QULB 2FL5B 1G7HA 1DEEA 4NKOB 2EDOA 3DDFA 4CNIB 1FZOA 4FZ8L 5FGBC 3MRLA 4OLYH 1EO8L 4YHOL 1G7PA 5IBUB 3RDTD 5DC9B 1FG2A 3RWHB 4OV5B 3ZYZA 3TYFA 3RJDA 4FTVE 3PXLA 5FA3B 1KIQA 5A2JH 5KSAD 5JXAL 1EPFA 3QPXH 5HHPA 2NW2B 3FU7A 4K9JA 5DEJA 4XI5C 4EOWL 1U6AH 4KZEL 5I76A 3DUUA 2EINB 5I15H 1T6VN 3QJRB 4FNSA 3IXTB 2VLJB 4H8WH 2ZUQC 4R0LC 4MB3A 3KNBA 4ELKB 2HH0L 1A9EA 3V4VB 3W9DA 2MPAH 4FHBD 4Y9EA 1E50A 2O4EA 2WLYA 4RLDA 4KWUA 4D8PB 1J0YA 2H1XA 4ZD3L 1JF1B 2EIDA 4FJYA 2IH1B 3FB7A 4F92B 4ZPTB 2JLPA 1L9TA 2XRAH 3WTVA 2XZQL 3EJQA 3KPSB 3C5JA 4S1RL 5CEZD 1HXYA 3NA9L 1RZKC 2HKHL 3RU8L 1GGYA 2OMVA 1SJMA 4HKZB 3MO1B 5AEAA 4CU8A 2RA1A 2P5ED 5HHNA 5IIEA 3CLEH 1D5MB 5E2JA 1ADQH 3V0WL 1W6LA 3B7SA 1MCFA 4FXKC 4UU9B 2PN5A 1KCUH 4PJAB 2WXFA 1NAMH 5C0AA 4KI5F 1NFDA 2OMNA 4JN2B 2R0KL 4NRYA 2EH8H 4JFWA 5MEND 1ZLUK 3KPQB 2N0MA 2ENQA 5T33L 3KPSE 3GB7A 3QJOA 3ARFA 3U25A 5H94A 5IT2H 5CUSL 5DJDA 2ICWA 1SF5A 1B0IA 1K8DB 3ARVA 1DFBH 3WIHA 5F0PB 2WP3T 5AENA 3PP4L 4JJ5A 2DDQH 4KXZI 3SY0A 3CFIC 2R69A 4PGZA 1CR9L 3D18A 2VC2L 3HE7D 3HZKA 4NRZA 5JOEA 5I6OA 1AQHA 1YMHA 4MYPA 3NIGF 4PJAE 1F4YH 5ESVB 2AGJH 2Y3AA 4AIXA 4LLWA 4OCYL 1GOGA 2NY3B 5C6PB 4R4BA 5L2KD 4OLXH 4OCLC 5FO9A 4I85A 1U8LB 4N0FB 4PUBH 4DP6X 3BLPX 4MA3A 5I1GH 1GYUA 1CF8H 3FMGH 2FLRT 4U1JB 1HAWA 3QXDB 3DO4A 3PWUA 2XWJB 4PMFA 3ZVVA 1AC0A 3PJLA 2VMFA 3O4OB 4CW1B 1Z0NA 2DZEA 1PFCA 4X5WB 4YZFF 2VDML 3A67L 4OM0H 1YPZA 3QQ9C 1JPST 2LFGA 2YAHA 2P46B 3EYSH 4OF5A 2X2IA 5G5DA 1Q9KB 1FZOB 4QOKB 3GTTA 4D0DA 1FGVH 5DD0H 3ILDA 3VAEA 1G7PB 1JDCA 4P57A 4FQXC 2YA1A 1TVHB 1A6WH 1RZKH 3PWPA 2X40A 1H8OA 3TYFB 1P69B 2GITA 2NY1B 4HS6A 1NBVH 4PP1C 2ADIB 3PHQA 2Y5TB 2HVJA 4KRMB 1U93A 2WXKA 3FU7B 3VXPB 4QJ3B 4TUUA 4EIGB 5I76B 2OTWA 3GFUA 1CYXA 2DMGA 4HS8H 3ARBC 5D1ZC 4DPRA 3MFFA 3L3GB 3NFSH 3VFWB 1MVUA 9CGTA 2PO6C 4QOKE 3S7GA 3AMLA 2VH5L 1S78D 3TLRA 3MUGB 3BSZA 3FO0H 1TETL 1KJVA 2E3VA 5ID1B 2JXMA 2PLTA 3AZUA 2Y7NA 5C2BH 5GRUH 3MDJA 3GIZL 4JDTH 4KO5A 1UD6A 5HYJA 2R2HA 1A65A 1R5WB 4LVNB 4ZBJA 2HB0A 4HC1L 3C5JB 4UM9B 1ODAA 4OKVA 1TTAA 1CYWA 4MMXC 4GXVH 2RALA 4XN7A 1BAWA 4HGMA 3ZL1A 1WCBA 3CZEA 1ZLSH 4TULH 4HGKC 3SIKA 3P4OB 5I75B 3V0AC 1AI1H 4LAQH 1IL1A 1JTPA 1U8KA 2FNWA 4IQHA 4GBXC 4WZ9A 2ED7A 5D1XE 4HXAH 1OP3K 2FT7A 3VFTA 3X14B 1XGPB 1ECZA 3EH2A 1ZK5A 4NRYB 5I1JL 4LLUA 4TYUA 3T5WA 1JNHA 2VQ1A 1AR2A 2E9WA 5TQ2L 3GB7B 3UYRH 3R06B 4WI8A 1HH9B 5H94B 1TENA 4A55A 2VMJA 3CZLA 2ICWB 4GO8A 5DJDB 5JR1H 4HZLB 4QHNA 2KHAA 4JJ5B 1C5CH 3BZ5A 5DHYA 4HJJL 3EIFA 4XP9L 1HIMH 3HZKB 4WK0B 4MMZC 3ZQXA 25C8L 3SDXF 4NOBA 4R4FH 4MXWH 3VXQB 3N9GH 2B4CC 2WC7A 3WUWA 4XTRD 3IAQA 1MDTA 2F8IA 2GFBB 5D7IB 3E8UH 4HSCX 5FO9B 3WIIH 5HYEA 3TNMA 1V27A 3ETTA 1SEQH 3K74B 1UZ6E 3OKDA 1CDGA 1OT4A 4PD4K 3NJJA 4Y7OC 5GRWA 1OANA 3Q13A 5DJ8B 1D2OA 3LKNA 5GJTH 3Q06A 2BIIA 3QPKA 4JLRB 2X44D 4NKIL 4YDIH 3DX7B 2XN1A 4UINL 2YLKA 2WBJA 4KMLB 5I18L 1UTDA 3FCBA 1JGVL 1KTKE 2YK1L 5BOJA 1A5FH 5IHWA 3W5NA 3QEHB 1G7MA 3QXAA 3IT8D 3BKMH 2FK9A 1WFUA 3MOBH 5D7IE 1P0SE 5D7SH 5HI3D 4D0DB 4ZMTA 4U05A 4BINA 5E95B 3GIVA 1EXHA 3WKQA 1XSKA 1IAKB 1OAQL 1PZDA 2N56A 4P2RA 2NPLX 1N12A 3TBTB 4K9EL 1U93B 5AQ0A 1U3ZA 2AJXL 4N4YB 3OB8A 3UZEC 1T7XA 1Z5LA 4TVPD 5J7CC 1MEXL 2BERA 3GS0A 1L4IA 2J6WA 4MDIB 4H26A 3TZVB 4M43L 3TV3H 3SDAD 1I8IB 3FPXA 4G6MH 3SPHA 1MVUB 4YHYC 4OQ1A 4CN1A 5E6UB 1RPKA 4D9LL 4RGNB 3ZTJH 1U3NA 4GMTH 1KJVB 4JRFA 3CSGA 2NXZC 3GMLB 1IGCH 5CFHA 1PY0A 2NUPB 2APWA 3QA3A 3O2DL 4LLYA 3H9SE 4J3XA 3T0EC 4A7UA 2F54B 1BBJB 4PRBA 1AXIB 1WCBB 5IQ9A 1SDDA 4EI5C 5CJ5A 4YSTA 4AQOA 2B4CH 4HWUA 3KWWA 4ZMLA 4M5SA 5DEGA 3TBCA 5I0ZA 3D33A 1SXSA 4MRCA 1Y1UA 2RQ8A 1JF5A 4HJGB 4RGNE 5HY9A 4X4XB 5C09E 5L0QB 5M7QA 5ESAA 3EJUA 4JO2L 4LLUB 2AQ2A 3TU6A 3QFJA 3TO2B 5L7XH 1JNHB 3VSTA 3AC0A 3MLSH 3N40F 5AKRA 4BD4A 2F54E 4NO5B 2VL5B 3G5ZA 3INOA 3JVGC 3NCYP 1AQDB 4LDCA 4UZGA 4OCRH 5SWZA 3K91A 4HPOH 1LO5B 4M7LL 4BUQA 5E0QA 1HDMA 2WMPB 4R5VA 4AM0B 4E42B 1ICTA 1DSFH 1OGAD 5DRNA 4RDBA 5DJCA 5HGHA 5SX4H 1HCZA 3NZHL 1SRDA 2V33A 4KKQA 2JIXD 2RD0A 5F93C 4XAWL 2GSMB 3ZQ9A 1JDDA 4FHKA 3QG7L 2YLHA 1WTLA 3BD3A 1A6AA 1GRWA 1QACA 1MZZA 2CIIB 5FYJD 3IDGA 1HQ4B 2WZ0A 3OKDB 4L8CB 1ACYL 1IC5L 1OV8A 1E4XI 1Z3GH 3GM0A 4XN2A 1AO7A 1BAFL 4RX4D 5AAWC 4WUKL 1TZOA 1I82A 3M7FB 3G6DH 4LRIA 3BQUC 3X12B 5CCKL 3L5HA 3TJHC 2EXYD 1UGNA 4ONFH 3R7QA 4KFMA 2YWZA 1G7MB 1K3IA 3BEWA 1R3JA 2NSXA 1XB8A 1U8NB 4D9QD 4X6DF 4YUEH 5F96L 1Q9LB 5FDWA 4IRZL 4PCSA 1QR1A 3DMMC 1WS8A 3ZYOA 4AZUA 3B3IA 5DGRA 3ULVE 1BD2A 1QSED 3IMWA 3IFNH 2ATPA 4QMEA 1MJ8L 2F1BA 1A1OB 2M2DA 5ICUA 1L9OA 4JE0A 4QRTA 1Z5HA 3V79C 3F7KA 3TEZA 3QUMA 5H4YA 2XZAH 2Z64C 1UM4L 4Q8BA 1QX1A 3U0TA 2F58L 1QHQA 4I0PD 2ZUTA 4H26B 1EQWA 3TNNA 2ESVA 4BZYA 3PHOA 5LNDA 3IDMA 1I31A 5DMGD 1AE6H 4YE4L 4U4BA 3IK2A 2E8YA 4JM4H 3F62A 3KEDA 1MHCB 1RP8A 2WLMA 4PRPD 3CMGA 2D03H 4KTDH 3BFOA 1JWSB 4M8QB 4X80L 1IE4A 1P4LA 3BWUC 4M9PA 3FQ4A 3VB9A 3OG6B 1G84A 2EDDA 3F84A 2AQ3A 4ZMOA 4PRBB 4LVHC 1ROWA 1TU2B 4U1MA 1BZ9A 1E2ZA 1NPJA 4JFQA 2R1YA 3O2WL 2WINA 3MRNA 5EUOF 2Y24A 3AXLB 5FAAA 5LAPA 2HXAA 1R6VA 3LPFA 5F0MB 3SODB 2RFXB 3FAWA 4JHWL 2XPYA 5CGTA 1MFMA 2NX5D 2H6PB 1F2XK 4Y4KB 4WEBL 4JJOA 1JPEA 1BSIA 1U33A 2KLTA 3MKGA 4BUGA 2XTSA 5T1KB 4OCWH 4BE5A 1W8OA 2A0LD 3AQDA 4AYBA 1KULA 1RV6X 3UJTH 1TQUA 3BC9A 4N0YH 1T3FA 2J1WA 3RBGA 5FA4B 5GZNC 1LK2B 4XHJD 5TDNA 3G5ZB 4FEIA 4PJ9C 1Z7JA 3EOBB 4DEUA 5DHVA 3S37L 2IGFL 4QXTB 1QWNA 1F3JA 2DI7A 2DQEH 1D9KC 1HDMB 2FWUA 2WGXA 1BZQK 2ZSVA 2YXMA 4NLAA 1VCBC 3WLWD 4YXLH 2E7MA 1XIWD 5CS7A 4HLZH 5I1KH 6PAZA 4Y5XA 3EFDL 3V52H 1CXKA 1H5BC 5AALA 4M29A 4ZOEA 3KVQA 2OSWA 1AD9A 1ZVNA 2C3GA 2CM5A 2G3ZA 3CFJB 4ZMPA 2BZDA 1AAJA 1QD0A 3ULSA 4BHUI 1BZ7B 4PY7B 1S7TB 3K8MA 3V9EA 4LPXA 4NPJA 1T2QH 5AVYB 2JKLA 1UT2A 2RHEA 2ZP8A 4KAQH 1L9SA 1PSKL 3ZZSA 5CKAA 5JHLA 4H44C 4DGYL 2XCMC 4G8GB 4EO5A 1QFOA 1T6WA 2WB1A 4U0RB 1NINA 5C6WH 1KB3A 3RWCB 3VACA 3P9WB 1NSNH 3UBXA 2CRYA 3SPJA 1ZHBB 5A7EA 1QR1B 1VFAB 1BLIA 1P4IL 1CFTB 3HS0C 3RZCB 1VAHA 3ULVL 4AV5A 2YFNA 4F2EA 2WQVA 3HC3H 4R2GD 3GTVA 4QRTB 1H6FA 3KPRA 2K6ZA 3BPCB 4CVUA 2QKIB 4P4KB 3EO9H 4QHMB 4N6QA 1DSWA 5JIHA 4G8GE 4TNWK 3LDBC 1SVZA 3HKFA 2ESVB 1CDBA 4XCFH 4YR6B 3PHOB 3D0LA 2OZ4A 5A1AA 3MGOA 3BESR 3HBGA 3ETSA 5DU7A 2AQNA 3DYPA 4PV9B 3LV3A 2CLRB 2FJUB 3Q5TA 4J12A 4PGEA 2GUOB 4AV4A 4G82A 4MKMA 3VW3L 1E9PB 5I6XB 3RX7A 4AI7A 2XBTA 4ZNEE 4Y5YC 3UJIH 3ZIMA 2O5NA 2J55A 5D2NB 4QHUB 4G5AA 1G6RA 3E38A 2A9NH 2K8QA 3H56A 3IBEA 3OJDA 5PAZA 2WINB 1KJ2A 5DZNA 3ESNA 1UJ3B 2VE6A 4Z3GA 1ZT7A 4R26H 1CTMA 3B34A 4X8GA 5E6RB 2IANB 1J8SA 2FVNA 3O6FC 1GIGH 2XIDA 5BUAA 2OP4H 2WJ7A 4FN0A 4LCUB 4XNMA 1LLAA 1NAKL 4Z9KB 1NLBL 5LGHH 1DR9A 4W9FC 1PGRB 1I9RL 3BP7A 3VX0A 2PTUA 1TZ8A 1T3FB 1XR8B 5BUPA 4Y4FA 5D2NE 4HOZA 3QDGA 4HIXH 4FP8L 4FGMA 2C9QA 2DKUA 3RZWA 2A9BA 1I8KA 1F3JB 3J07A 5FPIA 1SHWA 1R17A 2VM9A 3MV8A 3P0VH 4YDLB 1ZMYA 3M86A 3AY4A 2IANE 4NN5B 1S9YA 4BFGA 4WW2C 3AM8C 3WEMA 5AKVA 3BPNC 3P73A 4Y5XB 4JKMA 1WZAA 3HAEG 3U9PL 2J6EL 3MRPB 1S9XA 1CFMA 5ESQA 2XBDA 3UP6A 5F3HA 4LLQA 1A4JB 2GTZA 3LPOA 3OKLA 4OJFL 5ANMA 4I2XA 2VQ4A 4DP7X 4KNUA 3BMWA 2EDBA 4JK0D 3AACA 1VLXA 3K2IA 2VJ8A 3DPDA 4G43A 2X10A 5EZIH 1A6UL 2OR8A 2Z65C 4U7KA 3VGAB 3VRLE 1I8MB 3HRZA 4HAKA 1JPGB 2XICA 3VG0L 4BRVA 1TZAA 2JWYA 3WY2A 3D25A 4JUSA 3Q05A 4U4IA 1XH3B 3DIFB 4J23A 3BFWA 1EUUA 4BFBD 3EAKA 3G08A 4I9WD 2BRRL 2O6PA 2VAJA 4WFHE 2A4CA 3ARQA 3UTSA 5FB8A 1HQRA 2DLEA 3RFRA 4ANXA 5DT1L 5KYXB 4GS7B 2OX5A 4UOZA 1KPUB 1I9IL 1RIHH 1BVZA 5IMKA 3GI8L 2V17H 1NICA 2JE8A 2V5YA 4N9OB 3SCMB 4Q89A 4UV7H 2DLFH 3V5KA 2YD4A 3D0LB 3DARA 3ILPB 4I1NB 1JK9A 2X1OA 3MV01 2VLKE 3JTTB 3GUFA 4RWHA 1GGUA 1UA7A 3D09A 3IMVA 2NNCA 2NY5L 3SGJA 2QLVB 2OMWB 2DYSB 2XVKA 1CL7L 1QFUL 4MSWB 4OLUH 1HJBC 3UABA 2VTFA 2ZYSA 1AG6A 1NOFA 3GXIA 1VJSA 1RCYA 5JHDA 4JO1H 4I4WA 4G6JL 4LBAA 5ACZB 4N2AA 4P5TD 3DX1A 4UV4L 2DEWX 4LOVA 1ZEAL 5AUMA 1AZVA 1YC7A 4FXTA 3MV9B 3KG5A 1WFOA 4ALAL 3OJDB 3F05A 2ADFH 5FR3A 4NAJA 4YN3A 3VMNA 2EDMA 4XHQA 4X9IA 2VE6B 1BVLA 4WSGA 4L4TB 2Y4SA 1ZHLA 2CJUH 2BNRD 2DQDL 1GHFL 1OSEA 3QUYB 4NJAH 4U6HA 3FQXB 4GRWF 4WDIB 5I5JA 3R4DA 1RUMH 4MGXA 4NKDA 2HWZH 3HIZA 2EDRA 5INCA 3S6CA 4PRDB 2FO4A 4O2CA 4LMQE 5C08D 5IEKB 1D5BA 5INDB 1DUYA 4YAQB 5DVKA 2UZXB 4JRXB 2NUTA 5I1CH 4N2NA 3MV9E 3US9A 3VXNB 3G04A 4Y16D 4XVUD 4HPYL 3BN3B 4H0GA 3W82A 1TCMA 2DTML 1IGTA 4LZKA 4JFZH 4L4TE 8FABB 3ZDZB 4UT9L 3NP3A 5KN5A 4QT5A 4LFHD 3T6VA 5J3HD 4QRFA 4U1HA 3I84A 1IEHA 3MOAH 4PP2B 1X5AA 1DANU 4FABL 5ECJE 2FBJL 2NXYC 3K80A 2FSEA 2XG5A 4PJIA 1DZ0A 5ES4B 4B7IA 5TE4H 2XY2A 2BHFA 2N3JA 1UA3A 5BZXA 4JRXE 4LLQB 5JPNA 2GTZB 4WHYG 3OKLB 5IJKA 2CGRH 3LRHA 2A6IA 4LFHG 5KG9B 3K6SA 1XL6A 1IBGH 3BDYL 3RL2B 2XFGB 4KRLB 5FYJU 3OSKA 2OV0A 3VFSB 1SVBA 4HQQH 4WJ5B 1Q0YH 3ZDZE 3D3VA 5B8CC 4ESKA 1JSYA 1KXQE 2J12B 4N8UA 4PRNB 3T3MF 3N50A 1BM3H 4L0ZA 3MRJA 3BZ4A 4K5OA 4WIQA 3UTPE 4LOUC 1LD9A 3LN4A 3FZUC 1ZWIB 5F9WB 3ESUF 2YUXA 3T04D 4DT2A 5LLIC 4XRCA 1JK8A 1HQRB 5L4MA 3NK3A 4KX7A 4JFSA 3WNIA 3AGWA 4XAKD 3N0AA 4UWQB 3WE1A 5EU4A 5AVZB 1GYCA 3FHEA 3OVUB 1KYOJ 1UD3A 3ZRFC 4JFXB 1T83C 4Z78A 3H0TA 3QDJA 1YN6B 3DXAA 3LPWA 4KKAC 4XE0A 2F5AH 4G7YL 3HMWL 3VD7A 3F58L 4POYA 5C7ZA 3ABZA 3EGXA 2K4AA 2R0WL 5JPMA 4GG6B 5ERWB 2EUZA 4I8DA 1QLRA 4JHUA 2CZNA 3SZKC 4ZQKB 1BEYH 4RISH 1IFHL 5AUMB 4KUCD 3T4YA 1NM4A 2OYMA 3DOSA 1MW2A 1VZHA 3EZJB 1XZWA 4MJ6B 3HCVA 2EKJA 3VH8G 2W9LA 3KPLB 1H3WM 5EEYA 1SJHB 4RRPA 4NC1C 1HNYA 1DBBL 3G5VA 4OLVL 3KS0J 5IQOA 2LV4A 3FRPG 1FO0A 1VFMA 3GLAA 4NKDB 3QIBB 1FORH 3QP3A 1N8ZB 3O6MH 5INCB 4YVUA 1FAIL 2BOCA 1WUNT 1YEIL 1E2VA 3BI9X 4P23C 4GG6E 3H2WA 1EUTA 2BJMH 2BOBA 2ICWI 1O5DT 1BQLH 1NFKA 5I6LA 3CFCH 4XWGL 3RVTC 3EO1B 4P2OA 3T1FB 4UIMA 3DBXA 2I85A 4NFBA 5LGKA 2DIAA 3KCPA 1MXGA 2FWLB 3EW3B 2QV4A 2VDLL 5T1LB 3MACL 4PPTA 2MOVA 5IQ7H 2YMXL 2GQHA 3REVA 5FS5A 1JBJA 5CR1A 2QHRH 4DKEH 4WFEE 4WUUD 5DQ9B 2BINA 3GRWA 1U30A 3UX9B 4HP5A 2FSEB 4FOMA 5GGTA 2BS9A 4RA0C 1OAXL 2WVSA 3PL6B 4YHNB 3NSYA 2UVFA 5CJXC 2QVIA 1HHIA 2ICEC 5IVZA 2Q10A 4N85A 2DMHA 1OTSC 5JPNB 1RL1A 1U41A 2J1XA 3A6BH 4HT1L 4Y1AA 2A6IB 4UT6L 4YDMA 2BH0A 1F4WH 2DTSA 4X6CA 3ZBMA 3JTBA 4L18A 4KRNA 4K94C 1CLZL 3O8XD 2J5LB 3AS0A 1FRGH 3KPOA 1MCOL 3D3VB 3AY2A 4PTTB 1YYLL 2NY6C 4OCNC 3BVWA 4FXGC 4XP6H 1BQRA 1RVFL 4WO4A 1FNFA 3MREA 3ZKSD 3CCHB 3MRJB 4XI5D 1UOVA 5IBTH 3IU3A 5HDBB 2VN7A 3OXRA 4POZC 5EUKB 3TO4B 1P1ZA 5TK2A 4AUJA 1FVCB 4NM4H 2W07A 4UMSA 4F7MB 2PW2B 2DOCA 1A7OL 4LVOC 2XBZA 3T4AC 5D2LA 4PRID 4WCYL 2KQMA 5BS0D 4LSRL 2BCMA 5CJOL 2TAAA 2ZCLL 1DZBA 2I07A 5T3ZH 2QQNL 4B9FA 1VZGA 5E2UL 1J0KA 2DIBA 4WENB 3SDDB 1AZUA 3H0TB 2XDHA 2MCG1 3MUY1 1XCTA 1NGYA 1QYGH 3F6IA 4MKTA 4B50A 4Q0XL 1BQUA 3V5HA 4DETA 3PFQA 1I1CA 3H85A 3QHZH 1WT5C 1DJHA 4JFDD 3WNLA 2BP0B 5HDBE 3B2PA 3OJMB 5KSBF 3DDGA 4OZFH 4ZFOB 3A5VA 5D55A 3SKJH 4AJYV 1T5WA 3FONA 4A37A 3HNTL 1J9SA 4ICXA 4KQ4L 5TD4A 4KO7A 4FTDA 4NQCD 5LBVA 4P9HC 4XMLH 2I7SA 5HHMD 2ODIA 4DJMA 1JFQH 3H9HA 1LO2H 3AJ7A 1ZA6B 1WS7A 4HG4K 4PYGA 3HCVB 1N3NB 4Q9BA 3ISYA 3L81A 3UTOA 2D2CC 2YPLA 1OK0A 1P9MA 3DSFL 3UDWA 5FECB 5ETUA 2BXZA 5KVMC 4LNRB 4J3OC 4BQBA 4EZJA 1MWOA 4XNQA 5IFHH 3MXWL 3C2AL 4X6EB 5KOVC 1SLVA 2DI9A 4KO9A 2PCYA 4GUCA 3D0AA 3NCWA 4HZAA 1J8HB 2Z7WA 5D6DA 4K94H 4OAWA 4WFGE 2FX7H 1F6AA 4BV1A 4EN3C 1AMXA 4NUPA 4ODVH 4O02A 1BX2B 1ZVSA 2EDTA 3SE9H 2BDNH 1JI1A 2K70A 1ZHKB 3DBXB 2IBBA 4MTMA 1MI5A 4TS6A 4O58L 3SO3C 1A7NH 2UVEA 3MRKB 3WJJA 4JHVA 3DRTB 3NCYS 3QC6X 4XE5B 5IGXL 2XFXB 1PNDA 2A73B 4K3JL 4IIQC 4A6YA 3EYVA 3LQZA 2GT9B 4PJFF 4F7KA 4KHXH 3GKWL 3RPIA 4K7PH 5IG7A 1IGIH 2CR3A 1HS6A 3I50H 3IDYC 4D7BA 3MA9H 4AV0A 1K4CA 1J8HE 4HK0A 4C59B 3DLQR 3QDHA 5GISL 5MEPB 3L5WA 1VADB 3ARZA 3JYBA 1UD5A 5CINL 1KPRB 5CN2A 1BVKA 3MRBB 3QQ9D 1ZXKA 3RGVC 4QCIB 3MRFA 1OZTG 2X70A 4X6CB 2GTQA 4PV8A 2ZD0A 3VFPA 2IALB 3QIWC 3QNYB 4NZTH 2VZOA 4A7TA 1E7VA 2I5YL 2JI1A 4FQXD 1CFVL 3U30B 2YN5A 4DW2H 1QTPA 5I1IH 4RFOH 2GBUA 4JO8A 1X5JA 1DQLH 4DKAA 1EZSA 1W15A 3MREB 2P3YA 4RGMC 4X98B 5ICZA 5LN8A 1UGKA 2HKFL 3KXFA 3TGXA 4NQSA 3E8VA 4P9HH 3ARBD 5D1ZD 2X2HA 5DJZB 2FATH 5E56A 4BZ2A 1Y07A 4R9HA 4WY7H 2PO6D 2FAUA 3EDDA 2EVJA 2P7TB 3TCLB 5E23A 1XB3A 2I07B 1HZHH 2AJZB 3EOTH 5DUMH 4C47A 1PBYA 3LRKA 3MN8A 4J3OH 1PEZA 1YNKL 5HYSA 2FEJA 2B15A 4RMTA 3V5HB 4QRRA 3FT4A 1MQ8A 1DLHB 2OK0H 4ZW3A 1UKSA 1LO0L 4DUWA 5AFAA 4UTBH 1TFHA 2C34A 1LDPH 2F6AA 5CIPH 1T1YB 1NPUA 2XV2A 5BJTA 4GBXD 1JXKA 1NKRA 1MUJA 1SMAA 2B5IC 3GK8H 4YMPA 3KYNA 3CN2A 5D96C 4IHOA 4MQSB 3H9HB 5K5YA 3FAXA 3FK3A 3R8BB 1P7HL 4GXUM 5DRWA 4XO8A 1MWAB 1V7NH 3HUJA 3GMNB 3FN0L 1NEZG 2KKQA 3T77A 3WFDH 3WO4C 2XT1B 2XA8H 1KGXA 3W3BA 4RSYA 5EU6A 4YSCA 5DHDA 1CICB 2B16A 2J2ZA 5C9JA 4QNPE 1QRNA 1DO5A 4UQDA 4PH8A 2RTTA 4HIJA 4ZFOL 2R1WA 1ORSA 1JTOA 3O3EA 32C2A 3C60B 4WGVB 3HNVL 4LRNL 2EYTA 1JHKL 3EFFA 3OAWA 4YNYA 1V3KA 4FG2A 3PPEA 1FVDA 1F6AB 3LH2L 4NN6B 4AGNA 3NFNA 3MLZH 1BLNB 2QJDA 2XZCL 4A63A 2CALA 3SDCB 4OZHF 5GGVH 4IK6A 4OGYH 3CX5K 2OULB 3UZQA 12E8H 5CN3A 4JDVA 4ZUSB 7CGTA 5KEZA 3NGBB 3OR7B 2VDPH 2CR0A 3TT1H 1B4TA 5K1NA 4J2QA 1ZKAA 2J8UF 3NCBB 4BSJA 5IG7B 5LAXB 3UMNA 1MIMH 3A6CL 2CK2A 3CHOA 2A83B 2K8MA 2LLGA 3DI2B 4AYEC 2L7QA 4NQEB 1BAGA 1XBRA 3D8MA 1T7ZA 3N1GC 3OLEA 4IRJA 4EBQL 2HMIC 2P9RA 3A4FA 4PJ6A 1DJWA 1VPOH 4OIBA 5GRZA 1UG9A 4ZW8A 5K33A 4FYTA 4P4RA 4HU2A 1OF0A 4LCWB 5IWLA 3EJJX 4U2ZA 3I6LE 4HJSA 2CLZB 3CIAA 4OV6F 4UTAH 1ZT4B 1GGIL 2V0AA 5KS9B 1UXSA 1TVBB 3CFDB 1EWHA 4P46A 4MS6A 4AQ8A 1UT9A 2KC0A 2B0SH 2D3VA 4IBTA 4HUVA 4NQEE 3KXFB 4NQSB 3G6AB 3IM1A 2B9BA 3MRMA 2VWEC 1LP9E 1EK3A 4OZGB 4GLRH 1OP5H 4AIEA 5AB2A 1KCLA 3SE3A 3D50A 2BRQA 3CC5A 3D06A 4X7SL 3F12B 2YPVA 2BSSB 4BSVA 1TYJA 4TSAH 1J10A 2VZ3A 2VERN 4LCWE 1CZ8L 1JOIA 4PR5A 5CM1A 1MNNA 2NXZD 2EICA 5LBSH 2Y9RT 2BFGA 5KS9E 1N5YH 2H47C 4P3WA 5B39G 5JYLA 2ITCA 4Z95L 1YO4A 4PGBB 3BGAA