5KVEE

Zika specific antibody, zv-48, bound to zika envelope diii
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
101
structure length
101
Chain Sequence
b'VSYSLCTAAFTFTKIPAETLHGTVTVEVQYAGTDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVGEKKITHHWHRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ZIKA Envelope DIII
publication title Structural Basis of Zika Virus-Specific Antibody Protection.
pubmed doi rcsb
source organism Zika virus
molecule tags Viral protein/immune system
total genus 13
structure length 101
sequence length 101
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5kveE00
1ZTXE 4L5FE 3UAJA 1OK8A 3VTTA 1SVBA 2JQMA 3MUUA 4BZ2A 2I69A 2JSFA 5AAWC 4X42A 5JHMA 3UZQB 4FG0A 2R29A 3N44F 1OKEA 5AAMC 3C6EA 4ALAC 1S6NA 5KVDE 1Z3RA 4FFYA 2P5PA 2HG0A 1UZGA 3P54A 5KVEE 4AL8C 4GSXA 2H0PA 5GZOA 5LBVA 1Z66A 1RERA 4BZ1A 3N40F 5B1CA 3G7TA 2GG1A 5IZ7A 3IRCA 5GZNA 1OANA 3WE1A 4UTCA 1TG8A 5H37A 4UTBA 2R69A 5IREA 3C5XA 5KVFE 2V33A 3UZEC 5JHLA 3N41F 3N42F 1URZA 3J2PA 4UTAA 4GT0A 4FFZA 3J27A 1PJWA 3UYPB 4UT6A 2JV6A 3N43F 4UT9A 3UZVA 5LCVA 5KVGE 5LBSA 2ALAA 4AM0Q
chains in the Genus database with same CATH superfamily
3VX1A 5FECB 1I8MA 1OK8A 5CJXC 2WVVB 3KWXA 2VLLA 3OKOA 3TTYA 2EEXA 3CZSA 5F3BB 3PXHA 4XCNB 2WKLA 4GI9A 4DKFL 4WAFA 4LARL 2NXYD 3NOIA 3LKQA 3CLWA 3IDNA 1MHHA 1QTPA 1SHWA 1XGUA 4PB0L 4ZW7A 3WN6A 2Q2LA 2DMBA 1KFAH 2H47C 2QQKL 2O5XH 2OS7A 5F7HA 5KUMA 2EVGA 1KN4L 3O3EB 5KN5B 2XZAL 4XN8A 3WG7B 2FT8A 5FAAA 4ZSOA 1BVNT 1ZANH 2GVYA 5F21B 4YR6B 5FCUH 1HEHC 3FUHA 1DSFL 5CJOL 4B9YA 5JUEH 2DWSA 1RU9H 1BZ8A 2YZ1A 5E8NA 2P45B 3OJDA 2XN2A 4N6QA 1RIUH 5GRUL 3RDTC 1W8EA 3ZE0B 2WBJC 3E80A 4I8DA 4KRNA 2VDMB 2YC1B 4K0OA 5EEZA 4KRPB 1VKXB 4JGNA 4NZDA 4LOVA 4DN4H 3SOTA 4DH2A 4HUWA 3TVMA 4Z7NE 1U21A 4K3DL 1SN0A 5DJAA 1G7QA 3SKMB 4FQCH 4E9XA 4Z3IA 4EQ3A 3QHZH 1C8PA 4ZD3L 1Q9WA 3SGJA 1Z5LA 5GRXG 5HSFA 1NGQL 2X7LA 2X44D 1PX3A 1H3XA 3NFNA 1PGRB 1ZJAA 2F58H 3LRGA 4HIHA 2NY5H 1UA3A 4PS3A 4KK8C 2F1EA 2VJ0A 3LRSB 4N0FA 4LCWA 2ZUTA 4KMTL 4AXWA 12E8L 1NQBA 4M6OL 5IVZA 1TJGL 4UQAA 5F6IB 7TAAA 5L9DL 2ZXGA 2XHNA 3H9SE 4JFEA 4Y9GA 4JY5L 3SGDH 4L8DB 1WFUA 2QPDB 2FB4L 3CSYA 2ZTBA 2X4NB 3VWJA 3FQWA 3GMPA 4OM1L 3ALWA 1MAMH 1MEXL 2OP4H 5BZWA 2YRBA 3E9TA 1BLNB 1FYHB 2AQTA 4TUUA 1E2VA 1PG7L 1CQYA 3T3MF 3O8XD 3S8GB 2KHAA 1J86A 3KPSE 3MRRA 4ZMOA 3OX8B 3BRGC 2WYTA 4FJYA 1OIOA 2PTTB 1F1GA 4QHUA 4YDJB 5DGQA 1XCXA 3C12A 5KYUA 4ZXBC 4KX9A 1ACYL 4G3YL 1NBYB 3CFBB 4CBZA 2X05A 2PXYB 3BPOC 4JPKL 4S1QH 4HC1H 3MJWA 3HUJB 1WPCA 4PJFB 3QEHA 1LNUB 3VXRB 2V7HA 3WJLA 4APXB 3IKKA 4M6AA 1G7MA 4O02B 2ZF8A 3T3PE 2J2ZB 2DKMA 1EDYA 1NJ9A 1OGSA 2B3RA 3RVWD 3ISYA 4AQEB 1SDYA 4PYGA 3CVHA 2XBTA 3GYRA 1IKFH 1NCTA 3MLVH 4FABH 4YE4L 1T0NA 1QO3A 2WYIA 5HHMB 2Z31A 3GDBA 2GCYB 5JW4R 1GRWA 2EIJB 1AGDA 4XC1H 1ZPUA 4I1PA 2GUOA 3RWCB 1UZ8A 2RACA 5I66A 4HIIB 2WYHA 4HZLA 1T1XB 2XNAB 2YS4A 1TMCB 5DURD 4DAGH 4HOZA 2YPLB 4DVRL 4YO0A 2CJ3A 4D0CB 1KNOB 1OTTD 1E4KC 3LPGA 4R90L 3ZUCA 3AJ7A 4U2YA 4KKCC 1AKPA 1PZ5B 4ERSL 3EYVB 2Y7MA 1JNNH 1ES0A 3TO2A 3IRPX 4PJDB 5D7JA 5EFIA 2VDKB 5E8EA 4LSTH 2J5WA 2HLAB 3S35L 4PLOB 3HEIB 3TBYA 1NFIB 2IMMA 1KCRH 1OAKH 5IJBC 2P7TB 3A21A 3HBGA 3RYMA 4CVWA 4YWGL 5ID1B 5IMKA 5JA9A 1M9SA 2YK1H 1OP3H 5JPMA 4XP1L 2E4FA 1YQVH 4MNQA 1J5HA 2OCJA 1FFOB 1JMZA 5CIPH 1K5NB 2ZONA 3BDYL 3VG0H 3KHQA 1FGNL 4CAGA 4JJ5A 5EEUA 3HNSH 4GRLB 5IVNA 1Z9SB 1NAMH 4M9OA 1X5AA 1UA7A 4N25A 3LKOB 4UOJA 4AE1A 4QD2E 2PNDA 1UOLA 4MMXB 4LVEA 1MHCB 4N9OB 1C5DA 3BKJL 2C3VA 4APQC 4HCFA 2AJXL 2FAUA 4NXSA 1T04B 2APSA 4RGMC 2ZCKH 4L3ED 3ZO0A 5A2FA 3ESOA 4N2NA 2ICEB 3G5VA 3LNDA 5IFAH 5DVKA 4M5TA 2B20A 3UMTA 4EZKA 1PEZA 3ME0B 3WEMA 6TAAA 4P2OC 4PP1D 5DVLA 5F7KC 2UZYA 1FLRL 3C6SA 3LKPA 1RHFA 3DLQR 4R83A 1H3PH 5JW4Q 1TSHA 3RGBA 4X7DC 2OMXB 3ETBJ 5GHWH 2ATPB 3T09A 2ZCZA 4KK9C 4PJGB 4F8NA 4JDVB 1ICTA 3BGMA 1L5GA 4TKWA 3T3PF 2WLHA 4QYOB 4YHPA 1RZ7L 3QWOA 1PLBA 1WBXA 4LLQB 3KWTA 2G60H 5CP3A 5CEXA 5I82A 4G71B 5FKAB 4HUNB 4PG2C 1NC2A 3NPZB 2FQEA 1ZTXE 1MFCL 4R5XA 3OZKA 4U49A 5EUOA 4ABQA 4ELMA 4R3SA 3IK2A 4JO1H 1PD0A 4DPAX 2AZUA 1JZ2A 2LFGA 2EO7A 1EEZA 1QP1A 4AIZB 3CWGA 1AO7D 4HPYL 4JG0L 4YBHA 1XV8A 5BRZD 5DRWB 1ZHNB 1PD6A 2HFFA 2XACC 1T2JA 3L3DA 1ZXKA 1FAIL 2B39A 4BXSV 4P23C 4R4FL 4TTGA 1GMEA 3U0TA 1O7VA 3FU9A 1OGPA 2V5MA 4CADB 5G4MA 3MMEB 5B4MD 2JKIS 5AUMB 3T2NH 3GPEA 3O6KH 3QQ4A 1I85A 3L2LA 3CHOA 2DJMA 5DT1H 4KMQA 4YAQA 3RY6C 1HE8A 1OQXA 5FYJH 3VFWA 3VH8A 4RCAA 3GLZA 2HT3D 2WLYA 3MNWA 2WXFA 4LDLB 2HRPH 4R2GB 4H0HB 4Y5YB 2EQDA 4IQHA 4XMPL 2QVIA 3MLUL 1E27B 1NTDA 5JQ6L 4PRHB 1L0XA 1OAYH 4Y2DD 1U8LB 2ATKB 5BRQA 3VB9A 1RP9A 2XIBA 2NY7L 3QDAA 2HN7A 2WXOA 2DQ6A 3GB7B 4PRNA 4WGWB 4XI5C 5E5RB 3KWWA 1GGYA 3KYOA 4TN9A 1INQB 4F5CA 1HYSC 2GEQA 3W56A 1AYRA 4FQIH 1RUMH 3OKNB 3TBTA 1XGYH 1WIUA 3L4UA 2J1XA 4KTDH 2NSXA 3NH7L 5G5DB 1FL6B 3PUCA 3O4LA 4NUJB 3ABGA 4J3UA 1TETH 1DVZA 4QJ5B 2NXYB 1JWSA 4TVPL 3ARGD 4XVOA 3V5HB 3EYQD 1EMTH 2DD8L 2Z9TA 3DJSA 1U30A 4QTIH 1O7DE 1OHQA 2WMPA 3D87B 4JM0A 1OO2A 1CGXA 1XMEB 1TNMA 2NR6A 3NZHH 2MJWA 3QNYA 4WHDA 3TCLA 4AQOA 3UTQB 2R1YB 4P4KA 5HYQB 1W0VB 3QJUB 1N5AB 5HHXH 2KYIA 2X4QB 3QJFA 1IB5A 4P5RA 4WK2B 1H5BC 1YNLL 5HDQL 3Q2CA 3D25A 1B0WA 3E1F1 2HT2D 1C5CL 1TO5A 3MV7E 4HZAA 2P52A 5JMOC 3VCLB 4BFEA 1FHGA 2HX8A 1KJ2H 3UBGA 2XETA 2ZKMX 1WYJA 3F5WA 3KGRA 1T0MB 4R96B 4UZSA 3LRHA 4LRIA 5HI5C 1NLDH 3VGAC 1MDAA 1QVOA 4QRPD 3FRPB 3S88L 2GFBA 5CZXD 4G7SB 1UVQA 3HRZB 1NANI 4GW4B 3LQZA 1KGJA 4JZJB 4DGVL 1ZHKA 2VH5H 3QNZA 2EXWD 5AOLA 5H8DA 3RWFB 2HB0A 3QA3A 4AITA 4A7UA 4EDXA 5BOZG 5C0IA 3LEXA 3MOAL 4Y2OA 3TZVA 1UB5A 5E6UB 4UQ9A 4NJ9L 5F7EL 5HYSB 2XVBA 4DP0X 2ITCA 5JOFA 2VRKA 3KHOA 2EDYA 3C60A 1RJZA 4OW6A 1GAFH 1LGVA 3EO1A 3ARBA 3GLAA 2OTWB 2WWOA 5EA0L 5KYYA 4HJ0D 4GOSA 4AT6A 2XV3A 1HXYB 4UM8B 1I3GH 1NCJA 4UMSA 1A7BA 4NZRH 1WA1X 1AP2A 3FCBA 1NINA 5LWYL 5F3HB 1BQUA 2XKSA 1INDH 3AFLA 1JNJA 3TIEA 3F7VB 2Y6TE 3O8XB 4PRDB 4MZRA 4OCSH 3V79C 3QDJA 5D1QA 1IFHL 4KJYA 5EORH 4TTDC 1A21A 2X4TA 1BVLA 3LNEA 3WS6C 3RE0A 3M88A 4YPGB 4KKZA 2CHWA 1KEGL 3FF8A 1ZA3B 5C0AE 1JZFA 4L8CB 1HSBB 4PJ5E 4AJ0A 3WS3A 3HE6D 1BG1A 3MRFB 2RH0A 3CJJA 4J3TA 5DEZA 3EUUA 2J6WA 5FB8A 3WNLA 1GSKA 1IAMA 5D70H 1EFXD 4P3DB 1X6LA 5I1CL 1OAQH 2B59B 1AXSB 4XBGB 1J05A 4NN6C 4GAGH 3SD5A 2VERN 5EWIL 4OT1L 3ZYOA 5KZCD 5JIIA 5GGSB 3CVDA 5KTEH 3FQ2A 5HHOE 1GS7A 2H8PA 1CTMA 3RX8A 2EEAA 4Q9QL 5DURB 4W9ZA 3BKYH 3HB3C 3ECWA 1KELL 1PPIA 1Z9OA 4YFEA 3CUPA 3MROB 4GP4B 2XWZA 3KBHE 3RG1C 5I76A 1I7ZB 4R7XA 5I17B 2GY7B 4IRJD 4D9LH 3DV6B 4YK4B 4Y19E 4NNXB 3UBXA 4KY1H 4X5PA 3CZLA 5DVOA 4N5EC 3DVFA 3QO1A 3PGDB 1CCZA 1EJOL 5I1LB 2R7EA 2ERJC 1NUDA 3BH9B 2IPUK 4DKFH 3QT2A 4PGBA 3MR9A 2CWRA 2G2NA 4DFIA 5IOPA 4PB0H 2ITFA 1C08B 4N22A 3LD8B 1KYOK 5AL8A 2EKJA 4LSUH 2IDUA 4L8BB 4EUPG 1KN4H 2MQ3A 3DTXB 5AW3B 4JFWA 3L4XA 5SX4I 3OPZL 1CFNB 3TF4A 4LSPL 1L7TL 4OLWL 1G9NC 1ZK5A 5CJOH 1QATA 4NO3A 3VXUE 4MJIE 3D09A 1IAIL 1KCVH 4LFHD 5FGCB 2X09A 3BUBA 3DROB 1RZIB 2H6UA 2J8UE 4TL5A 5D4JA 3NRPA 5AOKA 3V0EA 3BCDA 4D8OA 5H4ZA 1ASPA 4IRZL 3QDGA 2NMSA 3EF4A 1SBBA 1J88A 1JRHI 3D39D 3MJGX 4NM8H 2WTRA 1FVCB 2ODHA 2PO6B 3N1FC 3KPNB 4MNGB 4K8RL 1NDMA 3L3IA 4ZD3H 5DWPA 2VAJA 4P9HL 2IXQB 4XVTL 4Y16D 4YGVB 3LXUX 1GW6A 2BY2A 3L5XH 3B4NA 35C8H 4OUUA 4AGQA 1NUNB 1L6XA 5K9JL 3GMNA 1YNTB 5GRJH 4E9SA 4JCLA 4YHYC 2ADIB 4PJCA 3NBNA 2K45A 3VFOB 1DUZB 3DX7B 4HKZB 3TJHD 4UQIM 1HJBC 2ZUUA 2FEDD 4JQVA 4OGZA 3KYKL 3EHBB 4K8RC 2BERA 2D7QA 3QG6B 2VO8A 3T4AC 3ZGIA 3UJJL 4JY5H 4L8SB 1J0KA 4QCIB 1BAWA 2FBJL 4HISA 2FB4H 3DETD 1IV8A 1DBAL 3T6XA 1AO7B 5BRZB 1KBPA 2WV3A 2AVFA 4FXGC 3L9YA 3OXSA 2GIXA 1AQ8A 2EINB 1MEXH 4KQ3L 5AZUA 3H9HB 5T1MB 5F9WB 3DO3A 3VAEA 4NM4L 4A39A 5C7XL 3UACA 2ODIA 1NBVH 3UJTH 4HLEA 2XV0A 2XG5B 3AWFA 6PCYA 1QLFB 2F7OA 4ZMQA 2X3AA 3TH4T 5GGRY 3MJ7B 1IILE 3VI3F 1ACYH 3N0AA 4G3YH 1XWVA 5LG1A 4UDTB 3FO0L 4IBUA 4LCCB 4M62H 3QZPA 4RFNC 1JPEA 3C8DA 3D2UD 4A7SA 1IE4A 2DI7A 3ZTNL 3ARFA 5IQOA 5D93C 1KGCE 1AZVA 1QHOA 3W3BA 1YJDH 3ZR5A 5BO0D 4Z6AT 3I9GH 3SZKC 3EGXA 3WY2A 4MWFA 3ULUD 1BPLB 5FFLA 1WS8A 3EAKA 1YG9A 3SKNB 4YE4H 1FO0H 5E23A 2LAGB 3VD5A 2V37A 4XC3H 1JGLL 2CKBA 2ICWI 3CN4A 4Q4IA 3P9MA 4F9PC 1HI6B 5MEQB 1T21B 2OXHA 4PIBA 4OJEH 1NGWA 3LQAC 2Q3ZA 2JB5H 3FOMB 5E94A 1KTDA 2CRYA 2NX5D 1A1MA 1ZLEA 1WHPA 2J8UF 4O51B 4UILH 3BMWA 3CX5J 4JZOB 2FJGB 3QJVB 2JIXA 4XCYA 2VWEE 3ASNB 3AUWB 4Q74A 5AZEL 2ITDB 4HWEH 1JXFA 5DHVH 2N56A 4FLSA 1RJYB 3L6FA 4JFYA 3H1ZA 2NY6C 3FFCD 2Y2YA 1G7PA 1S2EA 1J10A 4UAHA 2V4LA 1KOAA 1M53A 2E7MA 1PYWA 1KJ2A 2AJVL 4QT5A 6CGTA 3EJJX 3GMOA 1KYAA 2QGCA 1OAZL 1UWEH 3PL6D 1UM5L 3OKDB 2YEZB 1XR8B 1K8IA 4MXWH 1T03H 1V3JA 3ALXA 2I9TB 1QRND 3T4YB 4QRPB 3VG9C 4WNJA 1KC5L 4DKDC 2P28B 3MGAA 4WWID 2OJEB 4E41E 4ZMWA 1KFGA 1KIPB 4HCRL 4HOXA 3CHXA 1YY8A 2MFNA 1YPZB 2H4EA 1NGYB 2B14A 4HP5A 2KZBA 2AXWA 1TVHB 2J57A 1PIGA 1QQDB 3AY4C 5DZJA 2A7BA 3S36X 3CD4A 3IJEB 1EAQA 2WQXA 4HWBL 3SIKA 3U46A 2E75C 4JPIB 1QAWA 3N40F 5K9OA 2XN9D 4CSTA 3TNNB 1JI2A 3EYUL 2VZTA 3MQIA 3QJRB 1MI5D 3LNHA 2DMKA 1WAAA 4KDVA 4U1GB 5TQ0H 1ASOA 2RQEA 4NYLA 1UD2A 5IJVA 4P4RB 5KSBE 4EI5B 1WT5C 1X9UA 2K3TA 4PFEA 2E9IA 5B7FA 5E1AA 1Q8MA 4X7TB 4B27A 2VT0A 1XGZA 4GNKB 2VXUH 5K69A 4DTGH 1MQKL 4M1GH 3ZKND 3AG3B 4ZK8A 4WIQA 4X6DB 2W0LA 5KVFE 2VLKA 3UZQA 4B7IA 4MS8D 2A6IA 3UTOA 5CEZD 1EDQA 1WK0A 4HG4K 2Y36H 3BPCA 3QS2A 3OG4B 3B1TA 3CX2A 4PD4J 3ZZQA 3VRIB 4DIXA 1F58H 1YECH 3G08A 1JGUL 4XNQA 2FZ3B 1MFCH 5FM5M 4CBPA 4IKJA 3MCG1 4QEGA 3LSOA 4V2BA 4MSWB 1LO5B 1KB3A 1K3IA 5CR1A 3GHBL 1UWGL 1UH2A 2VXVH 1GZHC 4HPYH 3HE6B 1O5DT 3DTUB 3DECA 4PSRA 4QHKJ 1FAIH 3RLSA 2J1KA 1N6QH 2XQYK 4A7GF 3RURA 3SDCD 4G42A 1EFXB 4RLDA 2NY2D 2CGYA 4Z7IA 1CLOH 1VACB 4K07A 4BZ1L 1U4EA 4GKSB 3LZFH 1CI5A 3CPUA 2VZ1A 5KZCB 5DZOA 3PHOB 2WTPA 1GGIH 3DK0A 3PWUB 5I6XB 3QI9B 4J3VA 3MLWL 5IHWA 1QEXA 1P7QD 4FE9A 5JHAA 2DKSA 5AKTA 4AEFA 1C5BH 4FD0A 3KW8A 5I1JL 3VXPB 4L4VA 4DERA 3BP4A 1AANA 5E2JA 3F7YA 2ZWNA 5IBLC 1P4BH 2L7UA 4RRPA 5AB1A 3ARUA 3HJ0A 1T1YB 4IRJB 4PUBL 1OGAE 4AVIA 1H6FA 2DMHA 1KZQA 3PABA 4XXWC 4N0CC 5J13C 3NH7H 3BT2L 3NCJL 3JWNH 3QUZC 1KIRA 2NXZD 1OE2A 3UJIL 5D9SB 5CCGE 4HGWB 2RALA 4TVPH 5KJ7E 5M7QA 2D31A 4LOUC 2EDRA 2GJ6B 3JV6B 2DD8H 5JTWA 4GLRI 4MA3B 4FEMA 1K4CA 4P2RB 1WBYA 3RDTA 3KGTA 2WBJA 2WCGA 4L2YA 5TDNB 4MCYA 5D7IE 4G9FE 2WLLA 4CMMA 8FABA 4PTTB 1M7DB 2Z93B 5AZ2L 2AQPA 5CP7A 5KSBF 3N6YA 1OCWH 1F2QA 1M71B 2GJRA 3CLFH 3L4WA 3WTVA 2JKWA 1YNLH 4JANA 5GZNC 4JJOA 2X1PA 1OF2B 5DQJB 1QSED 1J1OL 1C5CH 2ZQKA 1UATA 5E08L 1E30A 3GSWA 1QBAA 1JBJA 5I8OH 3CFEA 3Q13A 4I1RA 2R0KL 1JYVA 1XCQB 2ZX8A 2Q86B 4ZQTA 3EXJA 4WUKL 1AGEB 3IDYB 4F7EA 3QFGA 3D39B 3WL9B 1CK0L 5TD4A 3VTAA 3FQTA 3WDJA 4I9XA 5DMIH 1OSZB 5DUJA 2ZUQB 3HIZA 2LU7A 4L37A 2JXMB 3GMRA 3K46A 4JY4A 5EZIL 2BCMA 4Z7VA 3VFRB 3CH1A 2W95A 3UAJD 2G30A 5F7EH 3W0WD 1LM8V 4OI7A 5DEFB 1KUMA 4KKRA 4CC1A 3QRGH 1TEYA 3QCUH 5DYOA 3OZLA 4ZI8A 1SDAB 4M1CC 1E5CA 1YMHB 3FK3A 2PETA 1GYVA 4HMEA 3ECUA 1E7VA 2CO4A 5I15H 5EA0H 5GIRA 1TJIL 1ZXQA 1UOWA 4B9GA 5LGJB 3AU1B 3FB6A 1U8JA 2D03L 4NCDA 4X99A 5IROC 3MREB 3QQ9C 4Q9BA 5ITFA 5C8JA 5FHBL 2DWDB 4LPYA 4HT1H 4FNQA 3WTTA 1A4KB 3Q5YA 1KCLA 2C1PA 1A9EA 3LZOA 1HAWA 4XMZA 5L0QB 1MJJA 4YHIA 1ZIBA 2C9QA 3DOSA 5D6DA 3ZT7A 1JWMB 1XF1A 3QQDA 5CEYB 3K2KA 1U8KA 4LBAA 2O72A 3V4PH 5AW0B 4BFBD 4AEEA 1GYWA 2G9HB 3A6CL 3JBG7 3NQIA 2BNRD 1RY7B 3IE9A 3QIWB 4OCWL 3QAZB 4J28A 2CLVA 4M4PA 2JFCA 2P5ED 5FS5A 1AQDA 1M6OA 1NCUA 5EU5A 4WZ9A 3D2UB 3KJ6L 1OOAA 1KIQB 4Y89A 3RVXC 1ZMYA 4KROC 4Q2ZB 3ZSSA 1MNNA 1B0GA 3Q05A 2GTZB 5EBLB 1U6AL 3BESR 2FX8L 2JQZA 5KBPA 2MCAA 3MLPA 1A47A 2W0FA 3CZFA 4GJTB 1DQDH 5D7IF 1UFUA 1NC4D 4X7SH 2VLMD 1BZ7A 4O5LH 4ZZFA 3RUGA 5KVEE 2V5SA 3R8QA 1IVTA 3EDJA 3HZYB 1P7HL 1E43A 3F7PC 3MXWH 4F58H 4Q9QH 4MASA 3ZO9A 3BH8B 2QPUA 3NSDA 3QQ3B 4HSCX 4ZFQA 1JZGA 2WINA 1J8HA 2NX5B 3AADB 4XXCC 4LZKA 5SWSE 5FLVA 2F7PA 5EN2B 1IX2A 5BV7H 1J1PL 1LWJA 1SM3H 3CMGA 2ESVA 3NSFA 2C5DC 4LSSL 3CVIL 4RMVA 5DHVA 2FQFA 3W1ZA 3RTQB 4F2MB 5C71A 5KG9B 1CF1A 3IN0A 2V17L 5I23A 4WKZB 4M7JL 5FM8A 3DHPA 3CV5A 1MAJA 3DBXB 2C8NA 5F7DB 3IRZA 4Q0XH 4Z7WE 3GMMA 1EA9C 2BHFA 5HVHC 5K1JA 4APQA 4OCXL 1JYXA 1MG2C 2CO6A 5IFJB 4KJQD 2BNQB 1B4JL 4KAQH 3E3QC 4WJ5A 2G4GA 5TQ2L 3BH4A 1QRNB 3BAYA 4PJ9D 5C2UB 3MXVL 4P5MA 3D30A 4P2OA 4K4KA 4TMPA 4OLWH 3U36A 1IJ9A 1IZJA 3FSOA 3HR6A 1QFWI 3OF6A 4E2OA 4TQEL 3UTTA 4U6YB 1OTUC 2F53D 3L95A 5EBMB 1G6RL 2BY3A 2XN9B 3KPQA 4JDZA 3L9RA 2JI3A 1UWYA 5D2LE 3O11B 1MI5B 2YD5A 4IRZH 5EU3B 1U8MB 4WTWA 5CFAA 5I6MA 5BPPA 2VQ1B 5FYLD 4JRXE 1LK3L 3IU4L 5KYXB 3VE0B 3KLAA 1EH9A 5ES4B 5JMRA 3T0AA 3GRWH 3R06A 5DSCA 5HJGA 5IQ9A 4PG2A 1C9SA 5CS7A 1SYVA 4OCRL 4NO0B 1YEJL 1SRDA 1FVEA 4ODTH 4P9HH 5ESQB 5IW6A 1GTNA 2X4SA 5D2NC 4MCZB 2JB6A 3EADA 5DMJB 5ADPL 4JFED 3MLRL 1QNZL 3O3BB 3G6AB 3ZY7A 2ADYA 2H41A 1Z9LA 4RNRB 4M6NL 1DR9A 1CDCA 3KYKH 1PY0A 4MA1B 3C5SA 2EE2A 2AGJL 5SWZA 4GAFB 5C0JA 1QASA 1QPXA 1T66C 2WIIA 3UJJH 3ERXA 2FBJH 3QHFL 2NTSP 2EVHA 1Q72L 5LHDA 2G5UA 4G1EA 4CN6A 5L88L 2Z8VC 4V33A 4AGOA 3IFPB 1FNEA 1A7RL 4X5LA 1IU1A 4JQXA 2G75A 3ZPDA 4DPCX 2QLVB 3SDCB 2NY2B 3M07A 4JKPL 5FFOA 4HWZB 4DP5X 4E9WA 4J23A 4LQ1A 2VAAB 2Z7ZA 4PS4H 2EDXA 3LN5B 2YGPA 4PM1A 2WVUA 4I89A 1EUUA 3HKFA 3MRCA 4KKPA 2I32A 3ETBF 2XWDA 5ALCL 3ARDD 1P7QB 4GYBA 5FO9A 2XTJD 2Y25A 3E3QE 4TRPL 4OLVL 3ZTNH 1WDAA 4Z7WF 1T4KB 3LCYA 2RAMA 4NQCA 4PJ7E 1F45A 1U58A 1ZVYA 3Q1SL 1JTTA 4LVOB 2Z31D 4LVNB 3RQ3A 5BVJB 4WFHE 3GXTA 2V8MA 1DLHB 3B1UA 3BO8B 4HGKC 2L3BA 4UF7C 2AITA 5ECJE 2E8YA 3ECQA 4HFWA 1HZHL 1J5CA 5I6OA 4PW4A 3GBMH 2H6PA 1YA5A 3FYIB 4MB4A 4M3HA 2VDNL 4AYMC 3OWRA 4ZZKA 4PJAB 1H5BA 3MRIA 1LP9B 1JVKA 5IVXF 2YD6A 4LCYB 3KCPB 2OCFD 2QKSA 3MNZB 4LCIL 4JFXB 3UYPB 2HG5B 5AW6B 5JLZA 1S7QB 4BYHA 2ZKHL 4K71B 3KS0H 1GJIA 3INOA 1R1CA 3HE7C 3CK0H 3H3BC 1CT8A 2OA9A 1FDLL 4FX5A 2CBPA 3CSPA 2NNAA 1NSNL 3FPXA 3S3BB 2CO1A 3U2SA 4CKVX 4F7TA 1ZGLP 1SJMA 4PBXA 5A3IC 1A3ZA 1B88A 4WU7A 1QFOA 3NZUA 3TV3L 3VI3A 5C6PB 1NCAH 1TF4A 4GXFA 3I9AA 2R59A 4N1CA 1AH1A 5LBSH 3STLA 5DHEA 3VFMB 1JYNA 4MAYD 1T2QL 1UM5H 5L2KE 4IIQA 1H9VA 1V3KA 3MN8A 2WXHA 3H7BB 4CVZA 4D94A 1KC5H 3D69B 4V1DE 3DYMA 4CILA 5AAWC 1Q0XH 4UOW1 3FRUA 5JHMA 3CFNA 4J3OG 4HCRH 5K39A 4Q14A 3NESA 1KYFA 3U0WL 4Y2NA 5BZDB 3PY9A 2BOCB 2DKUA 2QJDA 4N8UA 2R1WA 3OC5A 3GS4A 3H56A 5GSVB 3EXLA 2N0KA 3QJZA 3BAWA 4PJBE 1HOCA 4GSDL 5C0CE 2P5PA 2XG4A 4LE8A 3QXDB 3V7MA 1MHPL 4UUJB 4EVNA 1AR1C 5GPRA 2YMXH 4YZFE 3C8HA 2AMUA 3PNWA 4HULB 4MQXC 3ZW3A 4RA3A 3UBFA 1N4XL 4K5MA 2AV7B 4ZMTA 2IV9A 1MQ8A 1MQKH 3VU1A 1BX2B 1LQSR 5TH2B 3HS9A 5JORA 3PQYA 1UASA 4JKNA 4J3OC 3CBRA 4UM9A 5F7FA 1XF3A 2CJTA 1UXMA 2W0PA 2WLNA 3K4DA 4YVNA 3GMQA 2GG1A 3V4PA 2V9TA 4X4ZA 3P30L 4O2EA 3VYPA 4HIJB 1U92A 4JPVH 2BS71 4X4MA 2Q7NA 2FJHB 4WEBL 4DEPC 3B3BA 1DCEA 1A7OH 4NQDA 5D7LA 3CFIC 2XUWA 5LUMA 2EP6A 2P5EB 5ISZA 3MUZ1 43C9B 5DHYA 1CGSL 4M7LL 1S7SA 3CFCH 2ZX7A 2ED6A 3JUYA 4J1UB 4U1HB 4U1LB 5EDXA 5KBMA 5J8OA 1D9KD 5D5ME 3QUXA 2OQJB 2BS8A 4M93C 5AYTA 2AJUL 3Q8FA 3IS1X 3MLYL 2X2JA 2YUXA 3MNVB 5EOQH 1U3HC 2DLFL 3FTGB 1NC4B 4FOMA 3HOGA 5IK3B 4HJUA 3VRLE 4NDMB 4KZEH 5DHMC 1B0RB 5DK0A 1OZTG 4OKVB 2R4RL 4FQLH 5BUPA 4YDLB 2JK5A 3BXNA 3IPFA 1QI4A 1CI3M 1CC3A 1HS6A 3GKZA 4RQQA 4P46D 3ALPA 2AJ3A 2AXFB 1B4LA 3DIFB 3D0AA 1NAKL 3DGDA 4M03A 4KNTA 4ADJA 2X1XR 5AW8B 2YAFA 5H37G 3T0EA 4PUBH 1F3JA 4PB9L 3E9UA 4XOAA 1XGTA 5ICZA 3D18A 1F3RB 4QPEA 4ZW3A 7PAZA 5GGVL 2KKQA 3SGKC 2CPUA 2LLGA 3FFDA 2GSIB 4YSQA 1JV5B 3V4VL 4PJ8C 1H8OA 3K74B 1G9HA 3CIAA 1QW8A 3CAFA 3R0MA 4S11A 3B7UX 3SKOA 5A2BA 4WVRA 4P4KD 2YZ8A 1AG6A 2N1TE 4XTRC 1DDTA 2X6MA 1VRSA 3LB6D 3TNMA 1J0JA 4PJ9B 2JCCE 1Y0LA 2YPKA 1NCBH 4LASL 4UYQA 2VDPB 5EO0B 1T7WA 3H2QA 4YHOL 4B95C 4PVBA 3CMOH 3BAKA 4UU9A 1B4TA 3C75A 1BFSA 1I7TB 1Y6NR 4F2FA 5K93A 2WXQA 4S1DD 1J1OH 4JHZA 2E46A 3PJNA 3PWVB 2F53B 1CF8H 4BWUA 4G72B 4XP5L 4WSJA 3WXWL 5HYJA 2KLSA 1G1CA 2Z6FA 3IMWA 1J1XL 3MRBB 3B7YA 3H0TB 4POZC 4IRZA 2D2CC 5IF0B 1FG2B 3MV9D 3QEQE 4H88H 4I9WD 5E2VH 5GXBB 3G5WA 4XHJD 1W80A 1K3ZA 1U8HB 4B6ZA 1I7UA 2J5LB 2F5AL 1CK0H 5HJ3B 5GGUA 2W9DH 3GRWA 3K6NA 1NCIA 2IAMD 3ULSA 1CFBA 1WAEA 2E27H 2Y22A 4M7ZB 1A8ZA 4N8VA 4I4WA 4M7LT 5EZIH 3T4AA 4Z76A 3I75A 1THAA 4NRYA 2FWOA 4R97C 3ARBD 4KITB 1S9XB 4FXGA 4GMTL 4POYA 4I3RH 1A1NB 1UJ3C 5D5MF 3JWDL 4IU2A 3TA3A 3HS0C 2FLRT 2DMCA 4NNYB 3ULVH 3VRLF 4NUGL 5C09A 3C9NB 5ICYB 2OMVA 2X0WA 4FXKB 5KS9B 2DYPA 1OLZA 2WVTA 1YN7A 5H94B 3J27A 4RSYA 3SE4C 1WIOA 2V3DA 3C08L 4JO4L 4HUUB 3NRQA 2BCKA 1H15A 1HT6A 1RIHH 2HKFL 2UVFA 3P4OA 3ARRA 3CN1A 1QOKA 1M6UA 3FBQA 4OH2A 4RFOH 1GH7A 1JS4A 3A6CH 3NMEA 2N59A 4YEFA 2BP5M 1NIBA 2B2XL 3BQUC 3CFQA 1N59B 3L4CA 4OCWH 4HXAH 1MPAL 1LL1A 1QFWM 2GJPA 3UABA 2VDML 3RJQB 2DEWX 4JN2A 1AD0B 4OZGE 1J18A 5LBSA 4AQAB 4F9PA 3IMBA 1FZMA 2KC0A 3ARDB 4WI4A 2XTJB 5GRZA 4YHLL 5K1NA 3P2TA 2X9WA 5L7XH 1GW0A 1NFKA 1VEMA 1I1YB 5MEND 4KKQA 4KGJA 2FX8H 1MWOA 3F04A 2QR0B 5T1JA 2JCCF 2VQUA 2Z35A 4LLWA 3WHE1 1A4AA 1AZUA 2I69A 5B1KA 1XF4B 3WNIA 3FUKA 2IWEA 3OHXB 1R33A 1WEJL 1F4YL 4D9QD 3ESNA 3HI6H 3VFSB 2EACA 1PBYA 4GW5B 4LHUD 5AW1B 4NT6A 1UM4L 5FIEA 1EZVY 4J3OF 1ZSDB 1CFMA 2EDNA 4AUYA 4YE0A 1UA6H 1ID5I 4Z3FA 1GYAA 5CHNA 3QEGL 3Q44A 3RGVC 3WAJA 1J1PH 1RJLA 3K4ZA 2KL6A 4F7CA 2CJSA 3UEZA 3IMUA 3IPEA 4FHJA 2R69L 2EYRB 4EBQH 2CDEB 3A6BL 4TF4A 1G43A 5F6IC 3UBXI 1QPKA 1RSFA 1GVIA 2J71A 4NWUH 4Z3EA 2VC2B 4FQ1L 4NO2B 4MAYB 4DPBX 1B4JH 3KW7A 1UTDA 2D2OA 1D6EB 1MCLA 2BP8A 3L5HA 3ZTCC 3CXHJ 3ZRCC 3ZQWA 3S34H 4OVUA 3V0IA 3MXVH 4IEFB 2J8OA 3DVNB 3B3IB 1F2XK 3FSAA 4ONOA 5DK2B 4FFZL 4XN4A 2BSSB 4HCRA 2OCCB 4FCAA 4JO5A 4EI0A 2FWUA 1RK0B 3KJ4B 3MRMB 3BP6A 3N44B 2B9AA 4O02L 4PJEA 3X3FL 4TQEH 1KLGB 1S7XB 3R1GH 5J9PB 1H3TA 1QRKA 2VKXA 3L3KA 3MO1B 3ABLB 5ICXB 3S98A 2CR3A 1BJ1H 2B1HH 2GTWB 3O41B 3MRLA 2PXYC 2X9YA 3QUYC 3VGEA 3REWB 3B9KA 1CQKA 3LHPL 2IAND 4F15B 3WKMH 1LK3H 3D0VA 2LGNA 3OPUA 1N3NB 1BOGB 1S9YB 5EIQA 2X42A 3W11D 5DUPH 1LE5A 2WANA 3HZVB 4OCRH 5D7SH 4X0KA 5DR5L 4U1SB 3DRQB 3RZCA 1TQSA 3MUGB 4QKTA 1T5WB 2BNUB 1DQLL 1K2DA 2XIIA 3AMLA 4JVUA 5C0GA 5E9DE 3E8VA 4B3EA 4XPTL 3I74A 3TYGH 1JCKA 5IMLB 2VDKL 3FPYA 5H35B 3OMNB 1F4WL 4M6NH 1QWNA 2QDWA 4R0LB 4BRJA 1A6AB 1D2OA 3ECBA 1FFPA 3V9CA 4U3SB 4XAKE 3RWEB 2G3ZA 4BUHA 5I5MA 4B5EA 3BAEL 4NQXB 1PAMA 3HLAA 3HI5L 4GBXA 2AQRA 3V0JA 1Q72H 5DQ9B 3JT0A 4J8RB 3NSYA 1HKFA 1EX0A 3DURB 1SJEB 4MYPA 1A4BA 1H3UA 3HG5A 4I1NB 3IFLL 2P5WD 3SDDD 1D9KB 3HHSB 3RWIB 1SHSA 2XIDA 4UCFA 5FYJD 4JKPH 2X6CA 3IJ8A 3FTSA 3L81A 1YZZA 4QRRE 3WDHA 3ZDYE 3SPIA 4NKMA 5FYKD 2UYLB 1XSJA 1DSYA 3UIZA 2HX9A 2A9CA 3QEUB 3GM0A 4XP4H 4QF1A 1JGDB 1FH5L 2W5PA 1F4HA 4GRLC 4TRPH 4TUJB 4MXQC 3KXFA 1SF5A 1F90H 2CHXA 5F0MB 1BD2E 2UXTA 2OLDA 3DO7B 1A7PL 4PI0A 1OQOA 3ETTA 3QP3A 1ORQA 3QCVH 3AG4B 4BCYA 4X9YA 1LILA 1H0DA 1HZHH 1R3KB 2VW6A 3BWUC 3TJEL 3MLXL 3L13A 1ZT1A 4G8IB 4I5BA 2VDNH 4OF3A 4N9GA 4BQ6A 1N5YH 3GKWL 3QR0A 1H3GA 2CSPA 5GZNA 3MA7A 3G6JE 3NFSH 4UTCA 2IOMA 1YN6A 3TASA 1L9NA 2F7QA 2CLZA 1AZNA 4NSKB 3HRPA 4FQXC 4IU3B 1TSRA 5HHVL 3SE3A 4M5YH 3X12A 3WFHA 1QFHA 4QLRA 5IHHA 2FATL 3EZ8A 3LH2L 3MODL 3Q2LA 2R15A 4ILDA 1VFAB 1NIFA 1S9VA 2V9RA 2WJ7A 2NCEA 4OZFA 4W70A 1URZA 2DB8A 3T1FB 5I2IB 4I18A 1BMZA 4PGCB 1CG9A 1JF6A 2NUTA 4OJYA 1R3IH 3O2WL 1MFEL 3HC0A 4Y9FA 3TCXA 5FA3B 5AW9B 1C12A 5ESAB 3MV9B 4AV4A 3F83A 1WFNA 2ZUVA 4KK6C 4HWUA 1OM3L 3NABL 3HAEH 4J6IA 2F74B 5KSAC 1C1EL 1PZDA 2ITEA 3DTDA 3MV8E 2IAMB 4G43A 3I02B 3T08A 4S2SB 5DMKB 3S5YA 1E90A 1AGCA 4HJIA 1NGXB 4BFKA 4AIEA 3QORD 3MGOB 5I9QB 3WY1A 1CTOA 2CIIB 2FO4B 3PGCA 5B39G 3U48A 3M17A 2FR4A 3QIBC 3DKHA 1EO8H 5FOJA 4OD1H 5IVXA 5BNXD 1IIKA 1VGKB 4HJSA 3V0GA 3VXNA 4GSDH 2C1OA 4PRPD 1U9KA 5AVWB 4U6XB 3X13B 4FCHA 3HBQA 2EIDA 3MRPB 4WWNA 1AFVL 4AGLA 3EJQA 4FEIA 3ZDYF 5BXFB 2BSEA 4DKTA 3FTXA 2H32B 1TZ8A 2VLKD 3EYOB 2DL9A 1YEDB 2FWSA 3F7RA 1A6TA 1DSWA 1NFDA 3N41B 4E9LA 4QRQA 3PRZA 1GJWA 4JRYE 1CE1H 4JVWA 5DC4B 1JD9A 5FO7A 3IJSB 1WGOA 2E7HA 5FV2A 3CSBA 4CNIA 2Z1KA 4DCQA 1X5KA 2IPTL 3CQQA 3P30H 4X98A 3PV6B 1FL5B 4G8GA 1MFDL 3UO1H 3CDGB 2FQGA 4IOSA 3ZTEA 1UURA 4RMSA 1NBCA 4LKXA 5I1IH 5HGHB 3W9EB 2BFVL 2NOYA 1N6UA 1OALA 2JQAA 2H1LM 1OT2A 3LKNA 3G6JF 2EABA 3TPUA 4PP2B 3DPBA 5MENB 5DO8A 3ZKSD 4MA8H 1HHKA 3FT4A 2AJUH 3HUJF 1NEZG 4PJFF 3D0LA 4YC2B 3MLYH 1E50A 1P6AB 2DLFH 2ZSWA 3CFKB 1IM9D 1VADB 5MEPB 4X5RA 5I1KL 5I1AA 5IT2L 5JDJA 4YNYA 4ATTA 1B2WL 2EIBA 2DQUL 1U4FA 3VGDA 1IGTB 1IQDB 4LHUB 3C87A 1I3UA 3ISRA 3ELAT 3ZIMA 4HU2A 5EU4A 4JZJC 2Z91A 3FH8A 2PKDA 2PUQT 3ZVVA 2IALA 4NQUA 4IRSD 2MHAB 3FCSB 3GJFH 2D3JA 5EOCL 3CLEL 4K23L 4TYUA 3O6ML 2ZSVA 2H26A 3M6DA 1PU0A 1G87A 1KV7A 5CIPB 4FQ2L 5INCB 5SV3A 1CGUA 2EDWA 1SMAA 2UWEB 2AKRA 4MHHI 4ZFOB 3H3KA 3VNZA 4D2NA 2JJSC 5HHQA 5KYNA 1K6QL 2UX6A 4XO9A 4KTYA 1NAMB 3QRLA 3AROA 2UY6B 4JFOA 2XZQL 1DVUA 3BP7A 2D0HA 4W1TA 4CA4A 3RFZB 4LASH 2CZNA 4WO0A 4WW2B 1JFQH 4YHOH 3PHAA 2W9LA 2C3WA 4A7VA 4XMTA 2DQJL 3T5WA 3O8XC 3KVDD 1NDTA 4XN2A 2V0AA 3NSXA 5IJDC 3QHTC 4IBSA 3IS0X 3LNIA 4F93B 3S4SA 4N28A 1FG9C 4N6RA 4MRBA 3KLDA 5HXMA 1G6RA 4K2UL 2PCXA 4UINH 1URLA 1HFUA 5D2NA 4MGXA 2OYLA 5C6TL 4MD0B 4BQCA 4Y1AA 1JPST 2IANB 4TSBL 4HPOL 3JVFC 2OJZH 4KJWD 2LABA 1I75A 4ZJ9A 3BWUF 1S6NA 4XVUD 3AG1B 1ACXA 3D3VE 3FCTA 1AHWA 3G04B 1D5XA 3RVWC 3OKEA 4AM0A 1BW8A 1AIFA 5SV4A 1QD0A 3P2DA 4XXDA 2ZG3A 5TPWH 3BW9B 1ED3B 3KPTA 4GQRA 1BQLL 4NUQA 2A74A 3MCYA 5C0BD 1KCBA 1NOFA 4XPBH 4A66A 4YX2L 4KO7A 2JJVA 2WNWA 3JWDH 4WTZA 2JELL 5EDSA 4OFIA 4OF6A 3VRJB 2YAOA 1B9ZA 5E6IA 1OTTC 4NUGH 4ZFFA 4MX7A 4XVSL 1G94A 4KKLC 5B1BB 2J72A 3CG8A 3DX8A 3GSXA 1I8LA 3MBWB 1KV3A 4R8WL 1OCRB 5BMFL 4GG6E 2LVCA 2MCPL 1S4IA 4PRAA 4JO4H 4YHML 2P5WB 5HD8C 2IFFL 1UT9A 5I8CB 4PV9B 4NO5A 3FKUS 2B4CC 4O2FA 1G1KA 3TBBA 2DLIA 5ABDE 4F80A 4LRNL 1BGXL 3L5JA 2P8PB 2V33A 1JERA 3LD8C 3PWNA 5HGAA 1TTAA 1EGJL 3IDMB 3NIDE 1T6VN 3CFJB 4OV5B 2YLKA 5EC1A 4RAVB 3IVKB 3BUYA 4MMZA 1JXGA 3MFFA 3STZA 3GJFK 4HW6A 2NLJA 1RV6X 4RBPH 4OLXL 3PG2A 2Y23A 3DOHA 3IFOB 2VN6A 4F3FA 3SKJL 3HE7A 2CALA 4UNIA 2EH8H 3NJVA 3V4UH 1PZBA 4HK0B 1WEJH 4PRID 4BA0A 5I73B 3VWKA 1SLXA 3W39B 3GBNL 4J2XA 1MRDL 3X1EA 5FLUA 4Y7OC 1BBDH 1N6VA 1UM4H 2BVOA 3MRKB 1WUNT 2O5NA 3TBVA 2A5UA 1DN0B 3OR7B 4JZNA 1KACB 3MJ8A 4BE5A 1XO8A 4KK5C 3QEGH 1E9PA 4YXHL 4GKNB 5JIKA 4BKTC 5CN3A 4MQ7A 5J6GB 3T6ZA 3RNQA 2HVKA 5EF1A 2OTPA 2NZ9D 3ARPA 2VDQB 1EJ6A 4BDVA 2J7LA 2UY7B 4Z0BL 4PCTA 4E0RB 2VXQH 2VLJD 1JZ6A 5CJQH 1CDYA 4ONGL 3I6SA 1WCBA 4WFFE 2IEPA 4L8SC 3PWLB 4EIZC 4G7VH 3MX0B 4WFEE 5L4FA 2WB1A 3H8NA 3ROLB 2ARJB 2JKRM 3Q8EA 5DJ2B 1E6OL 4U0RB 5AKSA 1KSRA 1NGZA 3HAEA 4OM0L 2VM9A 5F9WC 5A16B 1JPGB 4QJ3B 2FRGP 5ID0A 3QORB 5B4MC 1BVNP 2H0FA 2X70B 4O02H 1T6BX 3X3FH 3WFBL 2FO1A 1MIML 3IYLW 3ASWA 1FNAA 1TKWB 1YMME 4LGRB 5PAZA 1PKQB 3BUPA 3UC0L 4GG6F 2MOGA 1XAUA 2O6PA 2HT3C 4ZUVB 2K4WA 5TGBB 3UXFA 3NJIA 3HZMA 2D7PA 2ZJSL 4PRPB 1OANA 1IJNA 3I50H 4RMWA 4Y2DC 1S46A 5DJ0B 4MD5A 3HMXL 3SPVB 2P9RA 4JFQA 3KPRD 2FJFB 3FO1B 2XTLA 5J6HA 2NTFB 5C3IA 3HW7A 2XZCH 2MKLC 3NIDF 2X6VA 4LLVB 4FGMA 4FKEA 1JMXA 3DMMB 3QPKA 3WUWG 1ACZA 5EPMA 4N2HA 2MQ0A 2WZ0A 3NIFE 1I9IH 1CD0A 4MBOA 1E4XH 5B7MA 4LIQE 4WY7L 3QULA 2ZWSA 3MOQA 2WJ5A 1F4XH 3VGGA 2VDKH 4G8EA 3SYAA 4ZODA 3VVVA 3WO4B 3ARGC 3BUDA 4CMHC 3EZJB 3EYQC 3LXBA 1BVKA 4OZ4A 5E9NA 5I6NA 2RTTA 4OZHE 4XX5A 5I5JA 4IGBD 2WXLA 4NIKB 3SHSA 2BSTA 5ACLA 3HI5H 4HGMA 4RBPK 4ZOBA 1CDJA 2F1BA 3X11A 4PV8A 3WNOA 1O6SB 1LK2A 5JIHA 2FSEA 1DQQB 5FC9A 3JYBA 3IFLH 4R7NB 1S7VA 2OMTB 4HZ1A 3WIFB 2HT2C 2AS5M 2VXSL 3TTSA 4NZ8A 1GC1L 1L9PA 2MMXA 4AC4A 4X4YA 5KYWB 3GWJA 2BMKA 1IM9B 5DUML 1RFDH 3VFVB 2IC2A 2X4PB 5H4YA 1QSFE 5CCHE 1PLCA 4I3GA 4NQCD 3MLTB 3QFJD 5IW3A 3SGKA 3SQBB 5CZXC 5EEWA 3ELQA 4JHVA 4Z0XB 1KXVC 1ZV9A 3BZEB 1P7BA 2EXWC 3WY3A 4NQVB 1ZLSL 4FA6A 1FYTA 4TSAH 1IEBA 1KCWA 4EDWL 4G59C 2C3XA 3US1A 3GHEH 4IDLA 3PWPD 1FPTL 2DQMA 3BGFC 1G7JB 3TJEH 1PZCA 1WIPA 4ZAKA 4U1NA 1T5XA 2IBBA 1J8KA 3V4VA 3GKWH 2C9PA 4PREA 1DJYA 2ZCLL 5E2WL 4Y4KA 3WI9A 4HJ0C 4TSCL 3TBSB 2NY4D 2WO4A 2J1ZA 1DBBL 5CBEB 4XVJL 3TWYA 2Q7YB 2YN5A 4HYTB 5HHVH 3S7GA 3TIDA 1XF2B 4JLRA 3SDYL 2X0VA 4QO1B 4TULL 1Z66A 4GFTB 3ARED 1H3VA 2HJLA 1A6ZB 3V6FA 2FATH 2Y69B 4PLKD 1CTNA 3LH2H 3V0VA 1A6WL 3IKCA 1TZIA 3B34A 4OBSA 4P2QB 4WDIA 4B96A 4BCZA 5KBLA 2EVIA 5E6RB 4YHZH 1N8OE 2VZSA 1CFSB 2GPZA 1GHFL 2IBZX 5JHDE 3V52H 3WSQL 4BXVA 3NIFF 4YHNA 1CGYA 3V0WH 2HPTA 1BEYL 3C8KB 4BFOA 2AJYL 3F7LA 4PJ6A 4DQAA 4LQFL 2B15A 2VB5A 3FO2B 3WFZA 5C07D 2P24B 4R9HA 4X5XA 5J1AA 3HE6C 2ZOLA 3DPDA 3WEAA 5CD3A 4GAYA 4OCYL 4GXVH 4NNPL 3GDCA 3NFPB 4XMXA 1ZA6B 2UXFA 2D4DA 5TK2A 4AH2B 5C08D 3REVB 4LF3A 1BQHG 1H6TA 1T20A 2VDRH 4RMUA 4Y1TA 1T1ZA 3AG2B 4NLAA 3EGDB 2WXRA 3HC4H 4X6EA 4F24A 5C3LD 3IJHA 2IO5A 4PJXB 1NUFA 5FECA 2MNUA 1CBJA 1OE3A 2WVVA 5C0BB 5T1KD 5EHFA 2W65B 4J5VA 1QFUL 5F3BA 2NPLX 3FQNA 1QR4A 4XCNA 1MCRA 4AYEC 4F2EA 2EADA 2WUCL 2C9AA 2HUEA 3VD9A 2W59A 4MAZA 2F5BL 5I1EH 4UM9D 4RRPM 4K5PA 2OMUB 3C2AL 2R29H 4ES9A 3IB4A 2XC8A 2A77L 4JAMB 1S3KL 4I2XE 1QLEB 4TPRH 1DVTA 5CUSL 5GS1B 3BKMH 4YR6A 3RBSA 4H8WH 1HC1A 3CCHB 3I2CL 2Y1VA 1RVFL 1QR1B 1HL9A 4B50A 5ISZD 1Y07A 1MCIA 1ZE3C 5IGXL 4NCC1 4EXKA 5GJSL 2FD6L 2CDFB 2YC1A 3FSZA 4K15A 1VKXA 2PYED 3NACL 1CLZH 2DQIH 4WFGD 3VFTB 1FQ9C 1G7HB 2D9QB 1F86A 4XNYL 1FO0B 2EIMB 5IWLA 4HUVB 3SKMA 4ISVB 1IGCL 3FB5B 4XPGH 2VR3A 3BEWB 1WO2A 3MU3A 3MPCA 2XXMB 3P9LB 4ECNA 3IDXL 1LXMA 1FVDB 1KCUH 3D85B 4LPWA 5F1NB 5F93C 3AACA 4F91B 1O9VA 4NFDA 4JR9L 4PRIB 2GBTA 4Y9EA 1CFTB 4R4ND 3IGFA 2OMYB 4EEEA 3BCFA 2KT6A 3LRSA 3AS0A 4U1JA 3B2VL 3UFIA 4GSXA 3M45A 1YYLH 2CK2A 1XSOA 5DZVA 3VDAA 1CVSC 1XL6A 2ZUQC 1WC7B 4CW1B 3S36L 5KVDL 2ADFL 1EO7A 5M95B 3GINA 2HFTA 4L8DA 4RWYH 4Y16C 4WGVB 3TXAA 3MDJA 2X4NA 2C7UB 2BVQB 4C57C 4Y4HD 2EYTB 3OAUL 2KUTA 2Z7YA 4L4TE 4TQIA 4K3HA 3SDAC 1RUKL 3RIAK 5AAPA 1M57B 1N9PA 2R69A 5EOCH 2C4XA 1ZT7B 1BLNA 3TJHC 1MXDA 2R2EB 2FEDC 2VXQA 3MRGB 3OHMB 3OX8A 2VLJB 2UZXB 5A40E 3KMDA 1TQCB 1NLBH 4LP5A 4YDJA 1NCWH 1N70A 4K9EC 3SJVE 1YQ2A 3UIYA 4B9JA 3CFBA 1HSAB 4HCIA 2P4AB 2PXYA 4ZFZB 5LGHL 1UB6B 1DJHA 1NH6A 5ACZB 4FYTA 4G6ML 4FFZA 4U1IB 3HUJA 4PJFA 3VXRA 1LNUA 2B7DT 2HVJB 4X2UA 4APXA 2IBGA 3GLDA 2IDCA 1N0XL 2XX0A 4O02A 5EN3A 2J2ZA 1HHHB 4AG4H 2ALWA 3QB7C 3ULUL 1XB3A 4AQEA 1X7QB 3MFGB 4JEGB 3IJ9A 4KVCH 5KVGL 4QDGA 1X5HA 4UQEA 4C56B 5IB4B 3FSVA 4N2MA 4YDIH 2GCYA 2R83A 4R6UA 1IAII 5EG6C 3GUTB 3RWCA 4HIIA 1T1XA 2XNAA 4FF9A 3GXPA 3DV4B 2YPLA 4WNQB 4FQHB 4JE4B 1IBBA 1ETJA 3FL7A 3FUEA 1KNOA 3KPRB 4D0CA 3ULUC 4OD2B 5EU6E 4GRWE 1YAZA 5IR1B 2LFEA 1VGEL 1KY7A 2V3EA 1L6ZA 3O9WD 4WV1B 1FIGL 5CAYB 4K5LA 3S3CB 1PZ5A 3FB8B 3EYVA 3HMWL 5I18L 3GI8L 4A2EA 2NY0B 3TA3D 1DLFL 1TYJA 4W4NA 2BSBA 3SQRA 1QBLL 2HLAA 2QDVA 4PSPA 2FX7H 1A9BB 1INEH 4HF5L 5C09D 3UTSD 4X6DF 4E9RA 5DJCB 2JELH 2WOBA 1NFIA 4XWOD 1G6VK 4MDJB 2VCOA 1P0SE 3NRFA 1A0QL 2P7TA 4HUKB 3WBDA 3LH9A 3ETSA 5ID1A 2W38A 1ZEAL 4IGBB 3I6KB 2HLFD 4XVSH 4KOCA 2C3GA 1FFOA 1G1OA 5LDUA 1K5NA 5AVSB 1KGWA 2APTA 4R8WH 3SE8L 5IFHH 3GXDA 4ANUA 4GRLA 4YHMH 1Z9SA 4EI6B 3KG5A 2BRRL 5IP4A 3LKOA 3VJ6B 1KF9B 1UFGA 1XQ4A 4MMXA 1MHCA 2CUIA 4LRNH 4Y7MA 1FORL 3N85L 3PL6C 3ILPB 1VAHA 1EGJH 1T04A 3WO3B 1L9TA 1XZ0A 5ANMB 4BH7A 2ICEA 4MDIB 5FGRA 1AS8A 3QFJB 4QYAA 4H20L 3ZE2B 1SJHB 2OW7A 3J7HA 3R7RA 3ME0A 5JW3H 2WQUA 1BF2A 4HKBB 4LLMA 2ZKXA 4WJKB 1A14H 3LZLA 3QC5X 4XO8A 3U7WL 1A1OB 4FQXA 4DK5A 1UT1A 3KM1A 5AVZB 3C5XA 1DVQA 2OMXA 3QBTB 2CU9A 4PWKA 5BO1L 5HDBB 2MTPA 2ATPA 4XPFH 3PWPB 2LU4A 3HG0A 4PJGA 1R19A 4JDVA 3ZTJG 4JPSA 2DQGL 5CEZL 1XVSA 4QYOA 3RX7A 4LLQA 1D5IH 1LEKB 3FCGA 3N06B 2XKNB 5FKAA 1JN6B 4PY7B 2PCFB 5KBNC 3BI9X 1P69B 2BM3A 5DLMH 4QRSB 1ZV5A 2HKHL 2V6HA 4EN3D 2IVFC 3KE0A 2J20A 2BW4A 4AIZA 2EH7L 3AREB 5DRWA 1ZHNA 1LWRA 1JZ7A 1HH9B 4LLDB 2GSMB 4HIEB 2WAQA 4D8PB 4PGZA 3RWDB 4UV7L 1NWPA 5KVGE 4CADA 2X38A 5I1HH 5F89B 1HHGB 3LS4L 3UTPD 4GRWF 2P8MB 4ONFL 2IDFA 3MMEA 2HT4C 1P4UA 2AXGB 2X12A 1T5KA 1NCDH 3N1GC 3EBHA 3X1BA 3DNKA 1J9QA 1R17A 5TE6H 5DJZB 5C07B 4GUPB 2VMJA 2XDHA 4OM0H 4W93A 4Y5YA 2HTKD 3KYNB 4N0UB 1M05B 1E27A 4PRHA 1U8LA 2ATKA 4YQXH 4YSDA 4ZMZA 4CSSA 4KXAA 1SOKA 2A9DA 3AS2A 3GB7A 1USQA 5FUZL 4FHKA 3FFCE 1INQA 4E68A 4F7MB 3OKNA 3C6LD 4JFFD 5T1KB 5GGRB 2G2RA 4OFQA 1SBSL 3O4OB 5G5DA 1NCNA 1FL6A 2WIMA 4NUJA 4Y9BA 4JHBA 4TUOB 3QNFA 4KJPD 1Q9KB 4OGAD 3D1MC 2A4CA 3GJEB 3HMXH 4UTBL 1MY5A 4KX8A 4LVNC 5F97E 4K94L 4IMKC 5E99L 1BCIA 5CGTA 3L45A 2AK4E 2R56L 1A6VL 2R1YA 4XBPB 1WHOA 5HYQA 1W0VA 1N5AA 2X4QA 2NXZC 4WEMB 1F13A 3NGBB 4EZLA 2BRQA 1FBIL 1U8QB 4P3WA 3BP5B 3VXSB 7CGTA 1Q90A 2H6OA 4JDTH 1ZGLB 4N0YL 5DEGB 2PPAA 1EEYB 4IBLT 1T0MA 2KS0A 4FNLL 4R96A 2PTUA 1MFUA 1XSKA 2PYEB 4WI7A 3WLBB 3GSQB 3FTUA 4PAZA 3FRPA 3QDMD 4BD4A 3RIKA 1KWKA 4LVHC 3HRZA 3EH2A 3UL4A 1NKOA 3FCUB 4JZJA 4QTHB 3QZMA 1EEUA 2VXSH 3RWFA 4JFDD 3NUKA 3J2PA 4HFUH 2AK1L 5L6YH 5HYSA 3ULUF 4WHTB 3CIQA 2XA8H 1MAKA 3VXME 2Q6WB 2O5YL 4K7FB 2EC9U 4MJ2A 1VEPA 4A55A 4OF0A 3FU8A 4DP7X 1IKNC 5BV7B 2OTWA 4G5ZL 5JYLA 5C0EB 3D48R 2VLRD 4TVSa 4LOEA 5IEKB 3QXAB 5LXVA 4B5ZA 2WQAA 1HXYA 4UM8A 4F37K 6FABL 1ZLSH 3V0FA 1NEPA 1SOXA 2NY3D 5BCAA 2EECA 3SYQA 2Z4QB 5DFWH 2E6JA 3KL0A 4L1SA 4MS6A 4Y4HB 3TEUA 2X88A 3O2DL 3TH3T 2NYYD 4HXBH 3CN3A 4YUEL 1PZAA 1TPXB 5F3HA 5LGYA 4B9IA 5B3JE 2ZYIA 1YEEH 3O8XA 4PRDA 1GR7A 5G4OA 1JI1A 2PYFB 5J12C 3INUL 4M48L 4FTVD 2E0PA 1OPGH 1DBBH 5IIEB 2EEDA 4YPGA 3GZKA 4ATWA 1R3LB 3QZWG 1YEFL 1ZA3A 1GKEA 1HSBA 1ZHBB 3F3HA 4PW3A 1M1SA 2A83B 1NGPL 3J8F7 3MRFA 5B38G 2LR4A 3ZU8A 1BPVA 1SOSA 1X4XA 1I9RL 2HXAA 4HKJB 5IQ7L 4QLWA 3WJJA 2YPVL 3B83A 4P3DA 4XPAL 1MCBA 2QKIC 2TAAA 5E1HB 2B59A 1AXSA 2BO0A 2FO8A 3DSNB 4XBGA 3SPJA 1I9EA 3BPLB 1HZLA 2QADD 3M1BB 5GGSA 1LO3H 1UEYA 3FOLB 3I3BA 2FCBA 4AYSA 1OAJA 2YJQA 2ISDA 4RSVA 2IFGA 5BS0E 3MROA 4PTUA 5A43C 1AVAA 2V9UA 1UHVA 3HG1E 5EF0A 3O9WB 5M94B 1I7ZA 3Q43A 3BWZA 3MJ6A 5I17A 3IDGB 2X6AA 3IDNB 3DV6A 1HU8A 4NNXA 3HPLB 2X10A 4WUUD 1KN2L 5F7NC 1QSEE 4F1SA 3SDXE 1F00I 3BRFA 2A1WL 2QV4A 3H3PH 3PWJB 4DOHB 4URKA 3ULVD 4XO5A 1PZUB 2VJ8A 3PGDA 3UTSB 3LQMA 5I1LA 3BH9A 1HH6B 5KVEH 4F7PA 4PJIE 4LBEB 1CZ8L 1TTFA 2WUCH 5JOPD 4OJFL 1FRGH 2CQVA 2FJSA 5T3XE 2RA1A 4BK5C 4DO4A 1C08A 5JW5B 3OQRA 2JTDA 4X8GA 5DMGC 2P43B 4L8BA 1PD1A 5BJTB 3DTXA 3FU6A 3NVQA 1CFNA 1S3KH 1B9KA 4MYWB 5EO9A 1U3NA 5L8KB 3DJZA 5D71L 1OT4A 3I2CH 3W0WE 1RVFH 3EJZD 5CILL 4P05A 1QI3A 2D73A 2G3XA 3MUHL 3NPSC 3MCLL 5F7MC 2QHRH 2YUZA 1EGJA 5I30L 3SE9L 4ODHL 1MF2L 2Y7OA 3QUMB 5IGXH 1EAJA 2FD6H 2HRGA 1RZIA 2QPFA 3DROA 4L3EA 3CH8A 4PJ9C 1K8DB 1J5IA 4AY0A 3NACH 2IQAB 5EIIG 1A6PA 4ODVH 2B0SH 2LLNA 1NM4A 4OZIE 1R5WB 2WZ5A 1WRFA 3DX3A 4GAJL 5FYLL 5I6PA 1G9MC 5EZJB 4ALAL 1FVCA 1NICA 4DGYH 1QLRB 3IWUA 2PO6A 1HKLH 3KPNA 4KOBA 4MNGA 1F56A 2WCPA 5IUCA 1IAIM 4JPWL 3KPPB 1Z9PA 1BQKA 1QACA 2FL5B 2IXQA 4YGVA 3B5GA 5DI8B 4YSSA 1KYOJ 4XO4A 4ZUUB 4JR9H 4Z7UE 3TT3L 5JHBA 1YNTA 1SVCP 1JPTH 3DJRA 1YEHL 4DO6A 2ADIA 1MCPL 2WNGA 2BNRE 4ICXA 2J5LC 1DUZA 3DX7A 4HKZA 5EU7C 3VFOA 2OMNA 4ALAC 1VFBB 3FQWB 5EZLB 5I19L 3IJ7A 1UCBL 1LDSA 5KOMC 3S36H 2ADFH 2FGWH 3NYKA 1G7LB 3QG6A 4AL8H 2G0LA 4PJAF 3EBAA 4L8SA 4QCIA 3MRRB 5DS2A 4EN3B 4HH9B 5C1MB 1DHKA 4MDRA 1AO7A 3EH3B 4NRXB 4DP6X 5BRZA 2Q5BA 2HG0A 3D4GA 3OAUH 1AZZC 5TE7L 4C4KO 4E42A 5CFHA 1RUKH 2JWYA 1F8TL 2A4EA 2VOTA 3MOBL 2WWKO 4N2AA 3H9HA 4XP6H 1MJ7L 5LB1A 4R26L 4HIXH 3A4AA 4ZO6A 5EBGA 5EZOL 2XG5A 1YUHB 1QLFA 3ZDXB 3DGGB 1BAFL 4XAWH 1Q9LB 3MJ7A 4DUVA 5CBAB 2OK0H 4ZO9A 3CN0A 4BUGA 3PFQA 2P3YA 4EPSA 4UDTA 1XL4A 3OLDA 3SYOA 4LCCA 5LGHH 2YD4A 1KMGA 3CVHB 1XGQB 4G6MH 3DIDA 4PJIF 1OAXH 2NZIA 4O2CB 2QMKA 5TE4L 5CN2A 3BWAB 3GSRA 1N0XH 3ZR6A 2AQQA 2GUOB 3N3EA 1CD8A 3F84A 4HLZG 1E5AA 2F54D 4QHMA 2JLLA 2OI9B 3SKNA 2P47B 3C6LB 3SPHA 3WJLC 3FT2B 5DUBB 4NQED 3IFNL 1HI6A 5FWQA 4ZO7A 5MEQA 1T21A 2VSMB 2PMZA 2XTJC 4U1MA 5K1VA 1E5ZA 3HMXA 4ZSOE 3IMTA 2EUVA 4DJMA 1VDGA 3FOMA 1JK8B 5IJKC 2Z31C 2AC0A 2OSXA 4O51A 1VGEH 4JZOA 2FJGA 1KPVA 1FIGH 3GSUA 1T83A 2ITDA 2YQBA 4WI6A 4WU5B 5EC2B 3EOBB 4OZIF 1RZPA 3GI8H 4ZX6A 1RJYA 4LLYB 5E6ID 4PLNC 3VFPB 1AI1L 3D9AL 5D8JH 4UV4L 4LMQI 3PDOB 4S1SH 3HI1B 4GFXA 1U3JA 4Z7UF 5K9KB 2VC2L 3C2SA 5EU7E 2N1KA 1QEWB 5D7JC 3CXDL 3OKDA 2XWEA 1XR8A 3T1WA 2I9TA 4GAAA 3T4YA 2JSFA 4M56A 4QRPA 4WCYH 3QDMB 5GGVY 4DGIH 1L0YA 1RUQL 2OJEA 4GO6B 3DXAD 4DUWA 1KIPA 4X6CB 4LCWE 4JM2B 4U4IA 4P2YA 3UTZB 1YPZA 4U0QB 2P8LB 1NMCB 1FORH 1QQDA 1TVHA 3GS7A 1B6UA 4JFEE 4KXBA 5HGBB 3WIIL 3Q6GL 1LO2L 3MYZA 3HPJB 3IJEA 2JKJA 4H1LB 4AMKH 4JPIA 3LKPB 1RUAH 3TNNA 1WGVA 4EE2A 1JZ8A 1ZVSB 2NW3B 2PR4H 3SQOL 1XB6A 3EIFA 5DCCA 3TO4D 5LNGA 1KWGA 3RY5A 4P4RA 3BN9D 4HIQA 1KGYE 2R0ZL 4XHQA 4GSUA 4FC3E 1TYRA 2NY3B 3EOYG 2WO2B 5GS0D 2DQTH 1OP5K 1LE9B 3BD5A 2B5IB 4P59H 1EVTC 5FGBA 3NDYE 5BO1H 1GOFA 4X6DA 3ZIYA 1PSKH 2O1AA 3GO1L 4M43H 1R24B 2QQLH 1I8IB 5ALBH 3U1PA 4AQ1B 2GYSA 3OC8A 4KPHL 2OPCA 1JGVL 2R23B 3UYRH 3VRIA 3PJSB 1G0YR 4FTVB 5H2BB 2VO5A 4BWTA 2FZ3A 5F0PB 2NCMA 3VXOB 4MSWA 1LDPL 1BIHA 1LO5A 3FN9A 4MD4B 5EULV 3BPNB 3VH8G 2EH7H 3HE6A 1FWXA 4EN2A 3DUUB 2I60H 3JWOL 4X6BB 1N64L 4YAQB 2HKAA 4UV7H 4JG9A 3GF8A 5AW7B 3RHWF 1N10A 1EQWA 1ZOXA 2JI2A 4PWHA 5IBTH 3K7UA 1EFXA 3NZ8B 4QY8B 1ZLWH 3BKCH 4ENZA 1KTJA 1VACA 3T65B 3H4HA 4BA8A 2QADB 3DX0A 1TZAA 2F19L 2J4WL 3BVVA 3PHOA 3UC2A 5ILTH 3TN0D 3ZHNA 1PY9A 3TWCL 3MNMA 4IDJL 4JFSA 3PWUA 4UQDA 3WTXA 4XT1C 1I9JH 3IXTB 3QI9A 3MAWA 4AEIL 3TGXA 4HG4J 1V27A 1D9KC 4EO5A 2IQ9H 2BWDA 3PPSA 3VXPA 1MCKA 5I71C 4K73A 1FHNA 4QRFA 4WK0B 2JJTA 1T1YA 4IRJA 5D1XB 4KX7A 2DPKA 4WUUB 4MNQE 4PY8J 2YA1A 5A2KH 4FNPA 5DHDA 3LJ3A 4Q6IB 3RTLA 3IEAA 3AXLB 4WI5A 2Z34A 1KFAL 4HK3J 3M8OH 2X89D 1JAEA 5D9SA 4P46C 4G8FB 3IWVA 4HGWA 1Z9MA 4AUUA 1I31A 4W9FC 3ZE1B 4M5ZL 3JV6A 4M6MH 4UTBH 4M3KB 4RISH 4P2RA 4K94H 3VD0A 1R5VB 1ZANL 4DZBB 2Y2WA 5LDSA 5E99H 5TDNA 4DPRA 5FCUL 5JUEL 2R56H 3K1DA 1A6VH 1RU9L 1P2CB 2W60B 1M7DA 2Z93A 1SZNA 4PTTA 3F5WB 3ZYJA 1M71A 4CGUB 2L7EA 3IDJB 3DX1A 2ZWZA 1FBIH 1OF2A 5DQJA 4BFFA 5J11C 2NR6C 5DQDH 1YHPA 4XX1G 1R6VA 4P4KC 4DN4L 3ZDWA 5B3NA 4N0YH 5ACMA 1GL4B 4NZFA 1ZLUH 2L4OA 4D9RE 2YD3A 1XCQA 1RIVH 4GIAA 1IT9H 2Q86A 3QHZL 4YBQD 1AGEA 5BW7A 3D39A 2QMJA 4WTXA 3WL9A 2Q2EB 3ZT6A 2L7JA 1OSZA 2G5RA 3C60B 1MRCL 4S1DC 1RZJL 2F58L 2JXMA 1KY6A 1YAIA 2NY5L 4LRIC 4JFPB 2YBGA 4Y16A 4JFTA 4XNUL 2QL1A 3VFRA 4J7RA 5KANI 5EUOE 4ELME 2XTSA 4BHUA 1TZGH 5DEFA 4AK2A 5CD5C 2EUXA 3U7AA 3VFNB 5DVNA 1SHXA 4XHJC 5C9JB 1YEGH 1YMHA 3F01A 1XGPB 3FT1A 5CWSB 5GRVK 4XNMB 1UOKA 1KG0B 4N8CH 2YKKA 3QFDB 5LGJA 2NY5C 1NMBL 3AU1A 4GSRA 2CDGB 1UQSB 2FQDA 3CN2A 4XCEB 6FABH 3MREA 1MAML 1P4LB 2OP4L 2ZX5A 2DWDA 4E36A 4UQCA 2AV1B 4M7KH 4ZAKD 1HQRB 3KH3A 2JCWA 3N04A 2XQ0A 2N3JA 3ARBC 4FTDA 4TNWF 2K6ZA 2LTQB 3O2DH 1ZLWK 4U3XA 4YUEH 3ZL1A 4L29B 2X4UB 2XXFA 4P2CG 3H9SD 1JWMA 2AMGA 4ZUTB 5CEYA 2WLIB 1B3IA 4M48H 1PLGH 4KI5C 4OQTH 4S1QL 4HC1L 3O45B 3E6HA 3SBPA 3NIGB 3IJHB 2QLYA 4C58B 3QIWA 4F5CE 1YEFH 1OK0A 4P5TD 2BX5A 2ZIDA 3DDGA 5D1QC 3D2UA 1E42A 1KB5H 1KIQA 2ZZUT 3KPSD 3QZBA 3UP1A 4Q2ZA 3MLVL 1IKFL 1I9RH 2GTZA 5EBLA 3O4LE 3QWNA 3OAZH 1TQUA 2F54B 3WKYA 5B3SB 4JO8A 2YPVH 2DY2A 3EGSA 4XPAH 1UKSA 4XC1L 1K5WA 1WP6A 1ETZB 2CCVA 4AOFA 3N44F 3MJ9L 3OB8A 4NQEB 3HZYA 1CDBA 1GOGA 4UT7H 4G1MA 5T3ZL 3BH8A 2KDGA 3QQ3A 3PDDA 1MFBH 1E28B 3U2JA 4WI3A 2X2YA 1BQRA 2NX5A 1M3IA 4Z8FH 1XBRA 2I7SA 5EN2A 3EKCA 3TEYA 2OR7A 4U7MA 4LSTL 1LYQA 3QW9A 4ANVA 1EZVX 2ZCHH 5TFSL 3RTQA 4F2MA 1OAKL 2DQCL 3WN5B 5KG9A 2A1WH 4WKZA 3QDHA 4PJHB 4P3CH 1T1WB 5F44A 4A63A 2YK1L 2ILLA 1DQKA 5H37H 1ZLUK 2ZNXA 3DBXA 3FONB 1YQVL 3SGEH 5F7DA 1CZ8H 1MHEB 5AOMA 4ZFOL 1TVDA 3S96B 4QOKB 5EUOF 3VA2C 3VG0L 4ELMF 5IFJA 2BNQA 4OLEA 3IMSA 2MIZA 5IZ7A 5DTFB 4XOEA 3US9A 1NAML 3FB7B 4XX1E 4PGEB 1QRNA 1ZVNA 3KLKA 4FFWD 2Y9RT 5A6IA 5E5UB 2L8AA 4KUZH 3IAGC 3WTYA 3BAXA 4UQBA 2J1YA 2VDPH 3BFOA 4QHNB 4BQ8A 1I82A 1VERA 2PPDA 3DXAB 1U8PB 3IT8D 1D2PA 2EE9A 3QDGB 4NHCL 5CILH 3U7YL 1DE4B 3PXJA 3T77B 2HH0H 3JT2A 5IFAL 1OSEA 5CKAA 5EBMA 4JFHE 3S0PA 1QABA 2XN9A 3NJNA 2P80D 1CFQB 1CYXA 3RFZC 3O11A 1MI5A 5EU3A 4G7YH 1U8MA 4KI5E 2VQ1A 1H3PL 3TO4B 5KYXA 3VE0A 1XCTB 3QJHB 3L4TA 3P0YH 5GHWL 2R51A 3WMSA 2DIAA 3QDJE 5D1QE 4NO0A 5E5MA 3L7EB 2C26A 3WU1A 1TTCA 2W9EH 4MXVF 4HA1A 5ESQA 1A25A 1JHKH 1FZJB 1Z5HA 4MCZA 4BV1A 2Y3NA 1E3FA 3TT3H 3K8LA 1AS7A 4ZXBD 4A2FA 2E74C 1ZAGA 2CBMA 4ETYA 3O3BA 4L3FA 5KUKA 3G6AA 4PCYA 4KKAD 4RNRA 4JO1L 1SHMA 3QISA 1M7IB 1UCBH 1WUZA 3W11C 3I6LE 3NCEB 5FDWB 3LYRA 5DD3L 5AALA 1CB4A 4KXZH 1W0WB 5F7UA 4AQZA 4DT2A 3JZYA 3AB0C 3OAZK 2MCG1 1RSYA 4XPHL 4JQVC 3IFPA 2BSCA 3MOBH 3T2NL 3O6KL 2YFOA 4HMDA 4JCMA 3EDEA 4R26H 4IHOB 5DT1L 1CDHA 5EZOH 3SDCA 1Q1JH 4WHYH 3UROR 4GXUM 1V5JA 2VXTL 4HWZA 5FYJL 1J8RA 1BAFH 1WITA 2HRPL 2VAAA 4IJTA 4FRWA 2DEYX 5FYKL 3TN0B 1OAYL 3LN5A 3QYMA 4PR5B 1VPOH 1S7RB 4GRMB 4KKCD 1NMAH 1P7QA 4LOFA 4GKOA 3SDDC 3IXAB 2CKBB 5ESVB 1DJGA 2XWTB 1FV1B 1RUML 5E56A 2XWJA 3B56A 4L1TA 4AGNA 4EMZA 1TJHL 5BVJA 2CNZA 2L0DA 4GINA 3EUDA 1HILB 1DLHA 1D3CA 5DDHB 2F7IA 3BO8A 3K3QA 3ZDZE 3MA9H 1TETL 1J0HA 3MNDA 4RMTA 3CBJB 3BVUA 1BHGA 1U0QA 1S3RA 1YRKA 2Q87A 3X14B 1EMTL 1NCGA 1MW0A 4QTIL 3CZKA 3T3MB 1T22B 4PJAA 1NA8A 2J56A 3P9WB 2OMBA 4GO8A 1LP9A 2CXKA 4UTBA 1FGVH 3A24A 3KCPA 2CXGA 1REIA 5FR3A 3MNZA 4JO2H 1P53A 4JFXA 3UYPA 2HG5A 3AVEA 3DVGB 1S7QA 2UZPA 2VJXA 1MW2A 4KI5F 2OYMA 5JXED 1KXTB 2EEBA 5LAPA 3MRQB 3RVUD 4FULA 3RP1A 2YIHA 5IKCB 1OGTB 1K8IB 3CPLB 4N3TA 4QMEA 3N41F 3QDGE 4TQHA 4UV4H 1JTPA 3BLKA 3F12B 4XH2B 3OXRB 2VDQL 1N26A 1WFIA 8PAZA 3VFMA 2Z65C 4PJIA 3CXDH 1I8KB 1OD7A 1OP9A 4TLTA 4NEHB 3MLSH 3H7BA 1NEUA 1MRFL 4UOW0 1MKFA 2VH5L 4YLCA 1KGIA 3S5LB 3D69A 4FZEL 5CCJA 1KXHA 2FIRT 4KKBC 4PJCE 1QUNB 3MV7D 4RDBA 4UMGA 5K9OB 3LRLA 3WEXB 1IC0A 1PCXA 1CE6B 1IGMH 1VZGA 2ZG2A 3TPKA 2R8SL 5GQBA 3F58H 5BZDA 2BOCA 1EK3A 5TDPB 3B2UC 3TA4D 3UAJA 3WIIH 3VD4A 1LO2H 3W0WA 1FNLA 1PG7X 3MHZA 4GT7A 4RIRB 5GSVA 5FUCC 3U4EB 2YOCA 2R4SL 5F1KC 4A6YB 1E9OB 4NQSA 4ZUSB 1I3GL 3O0LA 3QXDA 2V2XA 1HQ4B 3UZQB 3GJFB 1TLKA 4UUJA 3KLLA 4NZRL 5I5RA 2R0ZH 3DHUA 3QORC 4OZIA 4M3JA 4ODWB 4P23D 3PAVA 2UV3A 1IC5L 2AV7A 1LJMA 2LHAA 3GGWB 1BX2A 1J0ZA 1E5BA 3EG9B 3O2DA 4OCSL 5TH2A 5JXAH 5EORL 2JF1A 3H9SB 2WWMD 4KPHH 3RKDD 4W4OA 3ZZLA 5C97A 2Y5QA 3BYYA 4HIJA 1BF5A 2XN0A 5ADOH 1ZTMA 4ZFGL 2EICA 2FJHA 2ZAGA 3N5AA 3WFEH 1RULL 4A2DA 2GW5A 2UWEF 2E4TA 3W38A 2P5EA 4P5TB 43C9A 3D05A 3T2LA 4XI5D 3VA6A 2NZ1A 5D70L 3ML9A 3CFUA 2YEVB 3KPSB 3NCFB 1UT2A 1N64H 2N01B 2V2TB 4J1UA 4U1LA 5KJRH 4U1HA 1YDPB 3FN0L 4GAGL 2OQJA 1GGUA 2YPVA 3LN4B 4ZMAT 3MNVA 1H3WM 2PP7A 1CVRA 3L1OH 4FQJL 3FTGA 3KYAA 1NC4A 4RRPG 5IK3A 5C0AD 1WF5A 4A7TA 3NJKA 3NCYS 4NDMA 4R2GD 3L54A 4MHHG 1EXUB 2F19H 1B0RA 2V5YA 3TWCH 1H8SA 1YO4A 2PR9A 4IDJH 4AIOA 3T3PB 1R4XA 1DQMH 1DTUA 5J3HC 2AXFA 3DIFA 4D9LL 5DWUH 1RZQA 1KIRB 4KY1L 4G82A 2W1NA 2DQHH 2VMDA 1MELA 2QBWA 3S8WA 5EBWB 4KTEH 5HHOD 4UAOB 3BLPX 4LEXH 1KIUB 5IQNA 4PJCF 3RDTB 2ZX9A 3ROOA 2GSIA 1AE6H 4LSUL 1JV5A 1F1AA 5CP7B 1KGXA 3FT3B 5D4IA 3L4YA 4M5ZH 1IFRA 4IRSC 4Y19D 5T33L 4PJ9A 5F3FA 5BQ7B 4YSTA 1VENA 3G5YA 1O9WA 3P0GB 3MI6A 5EO0A 4MKMA 3QZNA 3RU8L 2K7PA 1EHNA 1KCVL 1N67A 1I7TA 4TNVK 5IEHB 2WSDA 4CU6A 3KS0J 1WAAE 3FAXA 3W2DL 5GS2H 1VESA 3PWVA 5EOTB 2F53A 3F6LA 3U9UB 4DGUA 2PPFA 1VF5C 2MOQA 4GQZA 2WXMA 5IESH 4NM8L 3MRBA 3H0TA 2TRHA 2A6DB 5IF0A 1FG2A 3UBHA 2XFXB 1XB8A 1U8HA 2ZG1A 1LLAA 2VLKE 4XRCB 2QVFB 4J3BA 3NSJA 1HCFX 2YGQA 4MJID 3L5XL 2GJZB 35C8L 5DYOB 1MRCH 4M00A 1RZJH 3KNBB 5ERWB 5GRJL 2DV6A 1DO5A 1GS6X 3JUZA 4XNUH 5EIIA 5GIRB 4AJYV 4TTDD 1ZWIB 1S9XA 4ZXBB 1A1NA 4E9QA 3MVSA 3K81A 4P07A 5C0FB 2VN5A 3BPOB 1XGRB 2WBKA 3AUVA 4XVUC 2BHUA 3PS6A 4NNYA 2QVMA 1NMBH 3COOA 2IDQA 2QSVA 4OQ1A 3C9NA 5ICYA 3Q6FB 2WCSA 4FXKA 8CGTA 5KS9A 2H32H 2RB8A 4A67A 1S9KC 4Q9RL 1NBVL 3UJTL 1UENA 5H94A 3CFDB 2ICES 3IBOA 4AGPA 3LX9A 1IBHA 1FIEA 1I1FB 1X5LA 4HUUA 3GSNB 1V05A 3WFDL 2OZNA 4B0MB 2V2WA 3ATBA 1MDTA 1JPSH 3T71A 4M62L 4MB5A 3QUHA 3EDKA 3HB3D 4L4VE 3VQ1C 3VGFA 3W5NA 1N59A 3D07A 3ZHKA 5E8DH 1UYWL 1YJDL 5D6DC 2VISB 1AD0A 3I9GL 5IB5B 4AQAA 3SYPA 3ARDA 2FBRA 3MKGA 3LZPA 1I1YA 1FO0L 4Y9CA 5D7HA 1WA0X 3WHE0 4HEMA 4XC3L 2CRIA 1TCRB 5IJKA 3L3HB 5ABZA 4LDOB 2QR0A 2APVA 3WD5H 1MCHA 1XF4A 1S5IH 4H0IA 5T1LB 3OHXA 3MJ9H 1UGKA 2LT9A 1YJDC 1EHLH 1YEWA 4F9LC 3GXFA 2JB5L 4GW5A 3B2MA 5D55A 1KGCD 1WAAF 5T3ZH 1QKZL 4UILL 2EIEA 1WTLA 2VDOH 1ZSDA 2A4ZA 4HWEL 2RHEA 5BQDA 2K78A 2XOTA 4R7VA 1SUHA 5E95B 3CZEA 4MB3A 5A2IH 3EW3B 5DS8B 1U8NB 5TFSH 1EHAA 2DQCH 3OSKA 4WF7A 3Q9PA 3K5SA 2EYRA 1UWEL 2CDEA 1ACCA 3HR5B 2O61B 2DWYA 4MXWL 1T03L 5FOBB 4FFVD 4BEIA 5C9KA 4KVNH 4NO2A 4RH4A 4YL4A 3ZSTA 4MAYA 1GGBL 2YRLA 4LNVA 3JTSB 1D6EA 3FUJA 4Z7VE 4ORGB 2EYSB 4MAUH 4IEFA 3DVNA 1BLIA 4EJ1C 3L95B 3B3IA 4KXCA 4BJLA 5DK2A 4N2LA 3IU3B 3MV7B 2P1YA 4JDZB 1DEDA 1DVFD 2HFEA 4JHWH 5I6KA 1RK0A 3GMLB 2J55A 1ET5A 3MRMA 4NHCH 3V5KB 2EDHA 3U7YH 4FZ8H 1KLGA 1S7XA 5J9PA 1XTLA 4DHLA 3MO1A 5ICXA 3Q9QA 5TQ0L 1AAJA 4MJ5B 1NIDA 2GTWA 2OW6A 3O41A 4HAFA 4ADIA 4CC0A 3REWA 2OL3H 2PO6D 4E41D 3WNKA 4YDKH 1A7NL 1NUGA 2VXUL 1BOGA 1S9YA 3Q2VA 4DTGL 4H0LC 4M1GL 2WWKT 4IOFC 4P23B 3HZVA 2WLJA 3FC8A 3DRQA 4U1SA 2Y36L 2ARWA 3H6AA 1T5WA 2BNUA 3NQKA 5CINL 2XWBB