1KT2B

Crystal structure of class ii mhc molecule iek bound to moth cytochrome c peptide
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
213
structure length
213
Chain Sequence
ADLIAYLKQATKGGGGSLVPRGSGGGGSRPWFLEYCKSECHFYNGTQRVRLLVRYFYNLEENLRFDSDVGEFRAVTELGRPDAENWNSQPEFLEQKRAEVDTVCRHNYEIFDNFLVPRRVEPTVTVYPTKTQPLEHHNLLVCSVSDFYPGNIEVRWFRNGKEEKTGIVSTGLVRNGDWTFQTLVMLETVPQSGEVYTCQVEHPSLTDPVTVEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class II histocompatibility antigen, E-D alpha chain
publication title Structural basis of cytochrome c presentation by IE(k).
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 43
structure length 213
sequence length 213
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kt2B02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1kt2B01
3MR9B 3VXSD 2Q8BL 4Z7VF 4NNXB 4MDIB 4XVTL 4K94C 3SOBH 4BSWA 3MOQA 4XAWH 4P4RA 4H26B 2G5BA 4JM4L 5C0FA 5EU4A 5C0EB 2NX5D 2XN9A 4BH8B 5I6XB 1AGFA 3UEZA 3WSQL 3MUGA 3VFUB 4L8SC 3SDXE 4EXKA 1S7TA 4P59H 3HUJF 3NA4A 1U8MA 1YC7A 4Q9QL 1V8HA 4JQXA 3X3GL 2H1PL 3DVGA 4P5TD 4JCMA 4QF1A 1FG2B 2R1XB 5IUSA 1MQKL 1NBYA 1X4XA 1IM9A 4L5FH 4RFOH 2X44D 5GGQL 2CRIA 4I1NB 4TSAL 1C5CL 2CLRB 3VWJA 2AEPH 4OF0A 1ZS8A 1ZVSA 3EHBC 5I1CH 3OKMB 1SM3L 4KTEL 4D0BA 3WS3A 1ITCA 3E3QE 1KTLA 2WINB 3P4OA 4PJFB 3O6FC 1TDQA 4M7LH 5EUKB 1RVFL 1CLOH 3K4DA 4XP6L 4Y4HA 1KCKA 3NIDF 4MVBD 2NY5L 5IHZA 3E6FB 3ZTNH 3UBXA 1NAMH 4FTVD 1HHGB 4QHMA 3BIKA 4OKVA 4DN4L 3L7EB 2LU3A 4UQ2B 4KKLC 5EFIB 3I6LD 3QZWA 1E28A 1V7MH 1ADQH 2ZCHL 2AJZA 1AKJD 3ZE1F 1JK8A 5ECJE 5C0DA 3GSQB 2PR4L 2A2QT 2IH3A 2AQ2A 2AV7B 4I0PC 1DZBA 1C08B 3BDYL 5IVOA 5KSAD 5C08E 3QEHA 4ZOEA 4B7IA 3V2AR 1TPXC 3HAEB 3TIDB 1QBMH 5I6XC 3OB8A 5BXFB 3QDME 1JTOA 4YHIB 4L9DA 5CZVL 4MSWB 3IU3A 3BPOC 5KG9A 4HAFA 4UTAL 2J88L 4K9EL 1UM4H 3OHXA 3ZE2F 4EXPX 3HZVA 4HKXA 1CZ8H 3DVIA 3VG9B 1TFHA 4YUEL 2FWOB 4OGAC 3LQAC 4PJAE 5T3XL 1UA6H 3VD5A 4D9RE 4PBXA 1E4XL 2FCBA 2KKQA 1L7IL 5L0QC 3WNMA 4KJQD 4E41A 2NY3D 2LQRA 3SPVA 4ZXBA 1IEAA 3TYFA 4MCZA 3T08A 5GJSH 4OSUL 1I9JL 3O2WL 3P0YL 2DICA 1L9MA 3MBXH 3P9WB 4K94L 4ZYKA 4IRSC 3ROLA 3WL9B 3MLYL 5E8DL 3LHPL 3S88H 1AP2A 4U05A 4MXWH 2IFGA 1MRDH 3EJZD 1K4DB 3C8DA 2Y5TB 5IROA 5KSVA 1ITBB 4JPWL 1ZK9A 4LCWE 3PV6A 1VA9A 5JMRA 4MAUL 4RGOH 1YNKH 3O4LE 3QXWA 5C0BD 1BAFH 4O4YH 3HI5H 3O4LB 4MGXA 1RIVH 5JLZA 3MMEA 2HVJB 4QT5B 2C7UB 4KU1A 1MFCH 1PLGH 2VLJD 5A43C 4X0KA 4R7DB 2IEPA 2FIRT 5ACZA 3O6KH 4HW6A 4U1MB 1JF5A 3F7VB 4LLMB 3NA9H 2W0FA 5AG9A 4PRHB 2ATPA 2EECA 4HKJA 1UH4A 1P4LA 5DFVD 2F8OA 5JXEC 1NFIB 2IMNA 4OGXH 4XNQA 3P73B 1T1YA 3DX9B 3L3KA 5I8OH 5FEBA 4MQ7A 1WUNT 3WIHL 4AM0A 1JFQL 5FUCE 1V3MA 3ARTA 3SKMB 4OZFH 4JKLA 4XNXL 4N9OB 3HB3D 4U49A 3T4AB 4NOFA 4WY7H 4YZFE 4RMQA 4MD0A 3C5ZC 5I66B 3TCLB 4APQB 3A6OA 5CAYB 4AYFA 4X6CA 4WFFD 2EYTA 2P1YA 2WIMA 1MCPL 4BKLB 5IMLB 1CLCA 4QRPD 1AD0A 4AEHH 2J12B 5LVEA 5GGSY 3V95A 3SE9L 4MMZC 5IBTL 4HK0A 3VMPA 3OZ9H 1AI1L 4NRZA 3AS2A 5TQ0L 4YHLL 5BVJB 2EYRA 3ULVC 3MV7A 1JPFA 3K4AA 4HKBB 3VXPB 2CDGB 1QRNB 5CEZL 3OR7B 1NMAH 1P4BL 4JZJC 4KRNA 4LRIA 1HZHH 3MA7A 4DKEH 4WJ5B 4X6DA 2GY5A 3B5GA 1YN7B 3LQAL 4KFZC 3I3EA 1BEYH 3KDMB 1IMHC 2NY7L 1EHAA 4X98A 2AAVA 3DPBA 5CGMA 4Y16A 3WFHB 3GSNA 5IW6A 1CR9H 4DUWA 3S98A 3GUTB 4JPKH 1LK2B 3HA0A 3WFEH 5FECB 3ZDXF 2X41A 3LPGA 4RSVA 5E2WH 3OKKB 1DLFH 1W8NA 3TA3C 3S96B 3U7YL 1JHTA 5CGTA 2H6PB 5CEXB 5C0RH 4XPAL 3ET9F 1TJIH 4JFDE 4DAGH 3U7WH 2Q8AL 4R0LA 3QEQA 1UZ8B 2HAZA 2AJSH 2EDNA 3EYSH 3G04A 2DM3A 4OQTA 1FG9C 1BIIA 1QNZH 1CXIA 3KNBA 4KTDH 3WO4B 2GUOB 3B6SB 1R6VA 5T3ZH 4R90L 2GK0B 4P2QA 5EA0H 4KK5D 4MCYB 3STZA 1S7XB 1PZ5A 4N8VA 3TVMA 2WBJB 2FRGP 4G9DB 3L1OH 5IMOA 4H25B 1YDPA 4MQXD 5DUPL 1BX2A 4OM1L 2G60L 5BOPA 1R3IL 3WLWD 2IQ9L 2UZXB 2VXQL 3WHXB 5ADOH 3BKYL 3R0NA 1A9BB 3SDXA 1Q38A 2C9AA 1H3WM 3BH9B 3TF7C 3FFCD 5F44A 3DROB 3IFNL 3MROB 2R1XA 3P0GB 3UDWA 1AGDA 4XZUA 2FYYA 4NUGH 4TPRH 4W6WB 1KV3A 1T04B 2DQFA 1N26A 5D1XD 3VXTA 1NAKL 3QHTC 5HHQA 4XVTH 3I3BA 4NKDB 4JFXB 5EUKA 2PTUA 5DK2A 5D7SH 1S7QB 4KVNL 1U3HD 1WCBA 2R4RL 4GG8A 2BERA 4OLWL 3VU2A 5D5MF 4AEFA 1YEJL 3WSQH 5BW7C 3QO0B 4XHJC 1DQDH 3LRHA 4NQXB 1I8MB 2OMBA 1BVZA 5KBNC 1XGQB 4DOHE 3SY0B 1EEYA 4JFFD 3HZMB 3S5LG 4MS8C 2DJSA 1KN4H 2BVOB 2HJKA 2XV6B 1NEZA 1DBBL 1NC2A 3O3AA 4D0DA 1OGTA 5FO9B 2VL5A 4TSAH 5ICXB 4WI2A 3SGKC 1A21A 5HHVH 3RTQA 1FHGA 4PTTA 4WFGD 5DT1L 3TBVA 1CD1A 3GJFA 3NMEA 4PGEA 4PJXA 4MJIE 2QHRL 1C08A 4JREC 3BP7A 4MJIB 5GGRB 4LVOB 2YK1L 1NH6A 2C1PB 3ARBD 4LPWA 5JMOC 2KPNA 5C08A 5TF1L 3ILPB 3TIDA 2I26N 4ONGL 4I48A 4D9LH 4LASH 1EERB 3N06B 4YHIA 5C0JB 4V1DE 3QDMA 5HHPB 4F8QA 3L3DB 3NOIA 3GSUA 5EBGA 4LPUA 2YD6A 4RMRA 3L5IA 4GAJH 2K7QA 1DBML 1E4JA 5C0CA 4H5SA 4DN4H 5JQ6L 2CRMA 3JXAA 4PJAA 2EXWD 4X7TA 2FLBT 3MRIA 1EHLH 1JZ3A 3G6DH 2BHZA 3D18A 4GSDL 4ZOBA 1AO7E 2GSGB 2D7QA 2W38A 3QIBD 1NCWH 1CK0L 4IOFD 4F57L 4FZEL 5DI8B 1Q0YL 3HI1B 1K4DA 5SX5H 2NXYB 3NABH 1OSPH 1UGNA 3IJSB 1G9MC 4LEXH 4J3VA 2VAJA 1CTOA 1YYLH 3ULSB 3C09B 4OIIH 1GGIH 1NCDH 3S4SB 3T0XA 1HIMH 4LCWA 3CH1B 3T2OA 3S35X 2DKMA 4IIQB 4FFVC 3GJEA 3ULUH 5LCVH 1JZ8A 2YSSB 3O2DH 1JMXA 3WV0A 1YECH 4PY7B 3D25A 1FZJB 4K9EH 1AXIB 2FX8L 3QZWG 1F11B 1XFPA 2V5SA 4GXUM 4YUEH 3ZL4L 1UH2A 2HTKD 4FQ1L 4JDTH 2IMMA 5CJXC 5JW5B 5F9AC 3QJFB 4JO4H 1XCQB 4QRUA 5BZWA 1HXMA 1ZGLB 3P40A 3D0LA 1KIUA 3EZJB 2I24N 1A22B 3QUMB 2PO6C 3BWAB 4ODBD 4OSUH 3KPSD 1M7DA 4K94H 5JUEL 4CJ1A 2WWMC 5HHME 5E8DH 2DQEH 2VLMD 3KS0H 3GB7A 1F13A 1A14L 1AFVL 1CFSA 4I8DA 4JPWH 5BZDB 5EZIL 3PV7A 3PWPE 5D2LE 3MNVB 5CSZB 1XF2B 1T89A 4NCC2 3H7BA 3WXWL 4PJ5B 3MRGA 1N2RA 4JRXB 1N4XL 5MP6H 1JNHA 4CRPA 4L3EB 5DMGC 1BJMA 3VD4A 4DK3A 3O9WA 3P9LA 4LDEB 3EYOB 3LSOA 2Y36L 5T1LD 2X4QB 4WW1B 3W39A 2AJXH 4BKLA 2B2XL 4QRSA 2ID5A 1EA9C 1DLHB 3HE7D 4CW1B 3ARGB 4FQJL 3D1MC 5FDWB 3EOBB 2WWKT 4P57B 5EU6D 2XWBB 4LPXA 1UM5L 3W11C 4PYGA 1EXUB 3ZHDA 3QFJD 3PL6D 2IGFL 5GRVK 3WIHH 1T83C 1J8HD 5CBAA 3IDMB 4XNXH 4PPTA 4WJ5A 1I4FB 1RZGB 1ERNA 4NJ9L 3EDJA 5KW9L 3MLSL 1V3JA 1CD0A 3T65B 1N6QL 2VZVA 2BNRD 5JDSB 3UJJH 2VUOA 1X5LA 3VRLE 2AEQL 3UTQB 4J6RL 2X5PA 1B3JA 1LP9E 1INDH 3MV9D 2OR9L 3QPQD 1CGSH 4XMLL 2Z8SA 1FZOA 1XIWB 4YHLH 5TQ0H 4IRJB 1UB5B 1XGUA 1G9ML 2UWEE 3BQUD 4NRXB 2J6EL 3PUCA 3QG6A 3PHQA 5HI5D 3VRJA 1G7QB 3U2SB 1A4KA 5BVPH 2Z9TA 1ZHNB 1H3PL 1IAII 4JFDA 43CAA 1MF2L 1I8IA 3C8HA 4AG4L 1KPRA 4Y4FB 1UXSB 2P24B 3QDJB 1D5BA 1UXWA 2X9WA 5HVGB 1FH5H 3D85D 2PUQT 1PEWA 3CVHB 4HUXB 4QYOB 3JBG7 4WI9A 4F80A 4WEUD 4KKAC 2CUIA 2D7NA 4WFED 4PJ9C 1EJOL 5E8EB 1YEDA 3A6CH 5IHBA 2VOTA 2KUTA 1DSFH 3IF1A 4G8IB 2MKLC 1NBVH 4XBPB 3DJ9A 3AS3A 4XPAH 5BS0E 3NFNA 2G5RA 2VXTL 1V3LA 2VITB 5B21A 5BS0B 3RKDC 5D96B 4TOYL 1ZA3B 5E8NB 5IB1A 1U0QA 3DROA 1TTUA 3G5VA 1ACZA 4K23H 4K7PH 3GO1L 1J1OH 3AS0A 4JAMA 1KTKE 2XOTA 4M1GH 1UYWL 3E6HA 4KV5F 4M93C 2AI0L 4U1IA 3WLBB 3LD8B 2Z8WC 5EWIL 1KIQA 2DDQH 1OTSD 1BBJB 5IV2B 3O6LL 3TNNA 3WNKA 5CD5D 4Y2OA 1A6UH 3SCMA 5DZOA 5TPWL 1ZHBA 1U2HA 4NQDE 4Y4FC 3PGDB 4X8JA 1A3RL 2FEEL 1V3KA 3AVEA 4PREB 1F6AB 5FGBA 2BC4A 5TE7L 1I7RA 1X5GA 1B9ZA 3ROOB 3IFNH 4WUUD 2Z4QB 2WLZA 3MLRL 4GKSB 3TPUB 4KHTL 1JYNA 3RVWC 3U82B 2VDKH 3LEYH 3BYTA 1NAKH 1EGJA 3HNTL 4EQ3A 5D2NC 1F4XL 4Y4KC 4MA7L 4MJIA 1OOAA 1PY4A 4MZ3A 4OZFB 1H5BC 2C1PA 2YS4A 3TT3H 5J0BA 4K3DL 3DRTB 4RGMB 3WFDH 4R97B 3GHEL 1JHKH 5E5MA 1Z9MA 3HLAB 1ED3A 4V1DA 4B7LA 3C60D 3RZCD 1EBPA 2ZSVA 3ULVH 4HEME 1OTTC 4ZNEE 4PJCF 4M6NL 4OFPA 4P5MA 1A9EB 2DTMH 3KGRA 3NIFE 3W2DL 1T6VN 3BE1L 3VFPA 5EZOH 2ZCKH 1I1CA 5A16B 1MCDA 4L4JA 4GT7A 4H88H 5JNYA 3FZUD 3BISA 5A2LH 3LS4H 4JY5L 1RUKL 4HBQA 3RDTC 1AO7A 1DBAH 4HMDA 5KSUB 4G42B 2X4OB 4XP5L 4X7SH 4OD3L 5HGAB 5J89A 4U1HB 4UTBH 2XY2A 3HI1A 3SDAD 1CGXA 3GMPA 1VADB 2DLEA 2YHGA 2DQJH 2HT4D 1RHFA 1MI5B 4K3EL 4EEEA 1ZWIA 3KYOA 2Q7YA 5DURD 1B0RA 3HE6A 1RJLA 2EDKA 5IKCB 2AW2A 4HEPG 2YSSA 3CDFA 1AIFA 2IPTL 4GRMB 1P2CB 3FN0L 5LBSL 2X70B 1TNMA 4G7YH 5LGJA 1P1ZA 5FO8A 1DBMH 3OAUH 4R3SB 3U83A 5IEKB 3C5JB 1I3GL 1JCKA 1ZT1B 1KT2A 3PWJB 5I8EA 1ZVYA 4XRCA 4LLUB 1NMCB 3QUMA 1QLEH 4GSDH 4IOSD 3TFKC 1G0YR 5DJCB 2XZAL 3HAEG 4F57H 1MFAH 3LVEA 5D1ZC 5JTWA 3TM6A 3WS6A 1F4HA 5AYUH 3AY4C 1FNEB 2IBZY 2FJHB 1VESA 2VXUH 5BZDA 5MEOA 4EOWH 1EO5A 5T3ZE 4YFDB 1ONQB 4NM4H 3QIWC 1AD9A 4BELD 3PWPA 3DVNB 5D2LA 4YDJB 4U7MA 1FE8H 4JM2B 4WWKB 5ESAB 3RVVD 2ATKA 3FO0H 4CVWA 5DUBB 4FFYL 3ZL4H 2I07A 4NUJA 3UZVB 1FNGB 5B39B 1PZUB 2XN9D 3UJIL 2ZPKH 4MNQE 1RUMH 4MNQB 5EO1B 1J1PL 5IQ9A 2BVTA 1FSKC 3CVHL 5ELIA 2NY0D 4PP2A 4M7LT 3V52H 4LSQL 4CU6A 2VDOH 4F7TB 4KDWA 2DMCA 4OGZA 4KJYB 5F1OB 2F74A 1CQYA 1UVQA 2PW1B 3BDBA 4PV8B 4XXCA 1WV7T 1LDSA 4X5WB 1G7HA 3EOTH 2V2XA 3EOBA 1AFVH 2EIDA 4MX7A 1QBLH 4RGND 4DEPB 1ZGLP 4M43H 1LO0L 4NM8H 4WV1C 4XHQA 4NQEE 3EGSA 4FFZH 3TN0A 1TNNA 1ZLWK 4Y4HD 4HS6B 5FV1L 4KKCC 3ZT7A 3BP5B 4XPTL 5C6WH 1LO5A 1X9QA 3WDIA 2AK4A 4P23B 4HLZG 1TJGL 2Q76B 4XCYA 2WUBL 1MREL 2VLKE 2MPAH 5CLWA 3RNQA 2DQUH 5DK3A 4JN2B 3EO0A 1Y6MR 1VCAA 3UTPE 4HFUH 1GPOH 3G08B 1NAMA 2VQ1A 4NBYB 1NKRA 5C2BH 3AM8C 1KNOA 3AAZA 1LP9A 1JNNL 5IB2A 3C6LD 5I19H 3FCTB 5J06A 4NRXA 3BMWA 4M62H 1UWEH 1OPGL 4N0YH 1ADQA 4P46B 4Q9RH 2UWEA 3H42L 4ODWB 2RIKA 4HUUB 5FUOH 4QOKE 1ZHNA 1Q9OB 5CJBA 4X7EC 2FGWH 1NUGA 1EO8L 4JR9L 4Y5VA 1MRCH 1F97A 1R24B 3MRMB 1ZANL 4FXLA 1RHHA 2XZQL 4NKQB 2AGJH 4POZD 1WK0A 5F7EL 5L8JB 3K2UH 3TT1L 3VE0A 4GS7B 5C9KA 5ALCH 3HC3H 4JFEA 1FCGA 3IXTA 4ZUSB 3WXVL 1A64A 4NSKB 2H32A 3U4BH 2LE9A 1N6QH 3FQWB 4P2RE 5HTSA 1HSBA 4P2RB 1A1NB 2I27N 4PRIE 3IAPA 3QEUB 3V5KA 3CFBB 1TVHB 2OR9H 3MV8E 3QUKA 3F7RA 4I77L 4Z78B 5T1KD 5AUMB 1UB6B 4P3WA 3RZWA 3V8CA 4QRRA 4LLAA 4BZ2H 4TSBL 5F1IB 2J6EH 3QNZB 1IAMA 2Q6WA 4Z7UB 1NGQH 3QDAA 4G8GD 5GS2H 1MHPH 5BS0A 3SDDC 1U2CA 4RNRB 5EUOE 1B90A 3QIUB 3R06A 3MRBA 5E24E 1A8JH 4DCQB 5F96L 5E8NA 1Z9SA 4MXQC 4ZUUA 2A6DB 3ZKMD 3DUHA 4NNYA 4XMPL 3BPCA 4RMVA 3CFCH 3MRCA 5HGDB 1YC8A 1T21B 5IEHA 2ZUUA 5DMJB 2AERT 3UO1L 3U6RB 2J8HA 1OAKL 4Y1AE 3ULUE 2BJML 2GAZB 2R1YB 1R3KB 3OKNA 4NJAH 1VKXA 1QZ1A 1Q9LA 2B1HH 3G6JF 3C9NB 2YR3A 3I6GA 3ARFB 1AR1C 4NKOA 4P46C 5C7XL 3L3HB 4R2GB 4CN4A 1VB9A 5J56B 4DFIA 3ES6B 3SKUD 5HYQA 12E8L 1N3NA 2VXTH 4NQDA 2RQ8A 1F6AA 4O9HH 2J3SA 2DAVA 4G43A 3B3IA 4GS7C 1U58B 1OSZB 3IVKB 1RZIB 3VW3H 4P2OA 1SJHA 3BPNB 3QI9B 2XWJB 3NVQA 1JGLH 1RZKH 2E6PA 4OZFA 1IT9H 5T3XD 5HVWA 3KPNB 3UTZA 3DIFA 4ODVL 1FL5A 1SY6H 1RY7B 2Z8RA 2ZG1A 1P4IL 3SJVD 4LSPH 1RV6X 1FVEA 2VC2H 3QIUC 3LN4A 3L5XL 4KAQH 3R8BB 1CL7L 2G9HA 3MREB 4ZNEA 1GZQB 1TTFA 2BK8A 4PJBF 4G8EB 5IBLC 2YPLD 3QUXA 5IWLC 2VZUA 3DX6B 3MV7D 4Q0XH 4ELKA 4P4KB 4F33B 3U0PA 1QFPA 4L8DB 2BNQB 1IAIH 3HNTH 5D93B 1F4XH 1N5AB 1ZT4B 4C55A 3KJ6L 5HGAA 4E9LA 3BIAX 5F93C 2VJXA 4JPIB 1YY8B 2DKUA 4KVCH 2VLRE 2VMFA 4X6CF 1X5XA 4Y2DB 5SWSB 5DWUL 1G9NH 4M6AA 4KI5F 4PJDE 4A6YA 4Y16D 3HTLX 3F58H 5T5NG 2IPUG 2B4CH 5TQ2H 3BPLB 1CDJA 2GTZB 2DWDA 3FT3B 1MFBL 2JELL 2F5BH 4ZPVA 1FZKB 3NCFB 5DYOB 4LLUA 4ZFFA 4QHUB 3QDGE 2CXGA 5F6HI 4XBGA 2M1KA 5D7LB 3P77B 5J13C 5GGVH 1EEQA 5FA4A 1P84J 3ZE0E 1B0GB 4HMCA 3TO4C 4XP5H 4NHUB 4OGYH 1AGCA 1YA5A 3SGJA 2X89A 4G6ML 1A7RL 4KKLD 3RL1B 1KN2L 3Q6FA 4NYLA 5C70A 5F7UA 1KENL 2MTPA 1N0XL 4JM2A 1PEZA 3MRFB 3KPMA 1C1EH 1Q0XL 1W0WA 2J5LC 3DMMC 3RWGB 4RDQF 1XGPA 5DVKA 1CXLA 5D7JC 4JO1L 4G6AD 4J8RB 4OAWB 2X4TB 2ICWI 1HYSD 3IB4A 1I3GH 1T6WA 4KQ4L 3GEWB 2XFXA 3GMRB 3V7MA 3E8UL 1I1FB 2F53E 2HKHH 5CEZD 1BREA 1U42A 2F53B 3ZO0A 1SYSA 4F7PA 2JIXB 5L7XL 1I1RA 4BSVB 4AQ1B 3IJYA 2PW1A 1LHZA 3FAWA 3S4SG 1FDLH 3N1QC 5CJQL 5IIEA 5GRZA 3BYYA 4TUOB 2DMBA 5DO2C 4ZUTB 3VWKA 3WFZA 3NIGE 3FB8B 5CBEB 5C9JB 4JRYA 4O2EA 3FQRB 1FIGH 2B20A 3BKMH 3MXVH 5DFWH 2VDQH 4K3JH 4ORZC 4M5ZL 3UC0L 3Q3GB 4HS6A 4NQEA 1KLFA 1LDPL 4XVJL 3F7PC 1I7ZB 2CIKA 4XC1L 1TZGH 3BKCH 3UJIH 2C3GA 3SDXF 4NZUH 1J1PH 4PLKD 1SBSL 2XICA 5I18H 4FQIH 3H0TB 2VABB 4HXAH 5E6ZA 3T4YB 3WNNA 2VLKA 3KPTA 4XNYL 3QWQB 4YHKL 4F7EB 5ITBL 3VFWA 3ARDA 1Z5LB 2VZSA 1BOYA 1ZLUH 4X4XB 5CWSA 3CMGA 2OLDA 3C87A 4YGVA 3ZKNC 5HI3D 3O8XB 3OKLB 1DVFC 1KXVC 3CC5B 4NO0B 1R3LA 3OG4B 2E7MA 1A47A 1SVCP 3THML 1IGIH 3GSWA 7FABL 2EYSA 4QOKA 4PR5A 2NY2C 1TZIA 3D3VB 1I3RA 3EKCA 4S10A 4TNVK 3QO1B 3VFMA 4NCC1 1HINL 1MEXL 3EOAA 1PKQB 2VISA 4HS8H 4LP4A 5I8KL 4OF6A 3MGTA 1HCFX 4ODUB 3V6OE 3BZ4B 1KPUB 4K55A 4RWYH 2EE2A 2ENSA 3K7UA 1KIRA 3V0WH 2WUBH 1MREH 5EULV 3ULVE 3L5WA 5I17A 4OLUH 4GMTL 4FQXA 1VGEL 4PD4K 2OL3L 3QEUA 3CFBA 3SQOH 4RBPK 4PRIA 5I1AA 1LO4H 4JO2H 1VFAA 3MV8A 2X4UB 4M4PA 4LDLB 5FYKD 4HBCL 4PJXF 1PX3A 4R8WL 1UC6A 1S9VA 1RUAL 4DCQA 1EO8H 4PJ8A 1SQ2N 1JN6A 5EUOA 2H2SD 1DANU 5E8OB 3UPCA 1GRWA 2Y23A 2D31A 2IG2L 5HGDA 3TT1H 1P6AB 4WW2B 3V5DA 4I3SL 2C4FT 2XQYK 5C07B 1JL8A 1W0VB 3O4LD 2GSIB 4L4TE 1Z0NA 4Y1AA 3O2DA 5HHOB 2X6MA 4PJAF 4L4TB 4AZ8A 2NR6C 3VFGL 5D7IE 5GS1B 1GJIA 5A3ID 3SKOA 4K7FB 1A7OL 5MENB 5JORB 3OGOE 2W9DL 1MQ8A 3RWIA 3V6ZA 3MJ8B 3AREC 1MPAH 2PYEB 1NGXB 5C6PB 2VE6B 1AC0A 3QQNA 5A2FA 4K71C 4WHCA 3WN5A 2OS7A 1EAPB 4PRHD 4ZO9A 1A02N 4PRNB 4NN7B 4YDIL 3GI8L 4QXTA 1KLUB 3OQ3B 1OSZA 4YHZH 4U1JA 5IR1A 1T3FB 2FX7H 2OJEB 1D6EA 5E7FA 1BOGB 5KTEH 5MHSE 1NCCL 3QUYC 1IQWL 1R5WB 1S9WB 1RIUH 2Y7QA 4APQD 4UAOB 4Q9BA 1OP3K 3REWA 5TDNB 2MHAA 4U6VL 1X6LA 3TBTB 2JJTA 5ICZB 2KQMA 3RWEA 3T09A 4OUOA 1RK1A 1K3ZA 5FA3A 3I6KB 4XVSL 1OVZA 1OD7A 3OGCB 1GZQA 1WIUA 1GOFA 1ORSB 4ZPTB 3QCTL 2DI8A 3MZGB 3IU4H 4HCRL 4B41A 1K8IA 5BRZE 3MOBL 4G80B 4P4KA 3UZQA 4AENB 1QRND 3T0EC 1KC5H 5BV7C 2HT3C 3PGFL 3PJSB 4X6EA 4YZFF 4GW5A 3WIHA 5IG7A 1CXFA 5I16B 3WKML 4CADA 4J12A 3O3DB 5A2KH 4AL8L 4NHCL 2VLRA 4LARL 4Y2DA 1P4IH 4HLJA 2BOCB 3CZFB 4R4BB 1C16A 1U8NA 1YMME 4HC1L 3MCKB 1DQJB 4O51A 3CX2A 2AJ3B 4PJDA 3ESUF 3L5XH 1GOGA 3IDJB 3RIFK 4RFEA 2FECL 1KELH 1RULL 3MRJA 5C0AB 1DL7H 3OB0H 4I0PA 1RZFL 5B3JE 4CUCA 2F8VA 1P5UA 1S7RB 4LCUB 4F58L 2PKDA 5I30L 4I4WB 4QHUA 1T80A 1ZSDA 1YYMH 4XHJD 2FD6H 1OP5H 3QDGA 4OZFG 3V8OA 3BKJH 4KMLB 4L29B 3HC4L 4BA8A 5JW4N 5KVFL 3W9EA 4JFHE 3S36H 3L3OA 2ADFL 5I9QB 3RWHB 1WCQA 3BZEA 2MCPL 4K8RC 1MRFH 2AKRB 5ANMB 2IC2A 4P0DA 2X40A 5TE6L 5I74B 3IDGB 5LAXB 3GIZL 4KK8C 4QCIA 1T7YA 4OB5L 5CCKL 2WBJD 1I1AA 3MRFA 43C9A 4XWGH 4N0FA 4N9GB 1FORH 4UBDD 1F8TH 3RGVB 1G7MA 1UG9A 5ID1B 4IRSA 2P5WB 2WANA 4NO2A 5JZ7D 5DD5H 1YEHH 4YXLL 2QADC 2B0SH 2IPKB 4UIMA 1CYGA 5I8CA 4BSVA 1P7QA 2PYFA 3GSXA 1JF1A 4R4NC 2F9BT 3FTGB 2O5ZL 3M8OL 2FB4H 3F6IA 4K2UH 4UNTA 4M03A 4H8WL 4OFVA 4OIBA 1UEMA 5CBEA 1T5XA 3VGFA 4X7DC 1FGVH 1PD6A 1EVTC 1D5ZB 3T1FA 1LILA 2E8ZA 4IMKC 5D1QC 3FB7B 3VMNA 1RZ8A 3QH3B 4OLZH 5TF0A 4QHLB 4JQVC 1VSCA 1RUPH 2L4OA 1IBGL 2V9QA 1NCAL 1F90H 4CDGC 2A6KA 2L7UA 3ZDYE 1S7SA 4GQ9L 4R9HA 5SWZE 1QSEE 3D2UA 3FQNB 2VKXA 1BGXL 4TYUA 5IVXF 1TETH 1JMZA 4UT6L 5E6IC 5BV7L 5INDB 2OP4H 3RPKA 3WFCL 3IJHA 4K7PX 2QQNH 4ZS6D 4XBEL 2CLVB 4JFZL 3V0VB 3HR5B 5CJQH 4PGDB 1HHHA 5GGTL 5I74C 2OMNA 3MLWH 5E99L 4MDJB 5F3BB 5L8LB 5J1AB 3C5ZA 2R2EA 2QKIA 4J1UA 1JPSH 2IPUK 4OD1H 1HEZB 6FABH 4HJ0C 4U6XB 3OKDB 1D5IL 2HMID 3IT8D 2DBJA 3HMXL 5B39G 4MJID 5GGRY 3IFLL 4UUJB 4LCCB 1QLFA 5H8DA 3UC0H 2IANE 1LDPH 1EDQA 4MMXC 3KXFE 1QFOA 4OCSH 1A1MB 3KXFB 5L6YH 2PTVA 4WI3A 5GGUB 5DDHB 3T2NL 4WFHE 4XVUC 1MIML 1VGKB 1IGML 3BH8A 3C5SB 4PLNC 1B4RA 1D5XB 1U8IB 2HKFL 1QPXA 1N6UA 1ZLVK 3GSVB 3CK0H 1OQOA 3IKCA 3QWRA 4UI2A 3UTTE 1KCUH 4JZJA 1UQSA 4HX1B 3HS0B 5EBMB 4O2FB 3X11A 4K8RL 5EOQL 4EI5C 1PVHA 4X6FA 7FABH 3HNSH 3R4DA 4JFOB 3IAGC 5DVNA 1MEXH 2DF3A 1LEKB 1TITA 2NXYD 4YBLB 1VEPA 5HHNB 3FHAA 4RRPA 2ZUXA 3F8UB 4G6JH 1U8LB 1ZKAA 1UACL 3LKRB 5TDOA 3TA3A 1JTTA 3JZ7A 4Z7VB 5A2JH 4GUPB 3B9KB 3QPXH 4GMTH 1OB1A 1T0MB 1ETZB 1V7NH 1Z9LA 3DECA 2OL3H 4L4TA 4DGIL 5C3LD 2XTJB 5EORL 3INUH 2A6IB 3FN3A 2W60A 5K9OA 2NMSA 1UH3A 5D7IA 4ZAKB 4JKPL 1KTDB 3GBNL 5E8PB 1U8HA 1IM3B 1M6OB 2A9NL 4HIHA 1MCWM 3GMMA 3HUJE 2NY6B 4JDZA 4C58B 3HUJB 2AK1H 3QCVH 4BH7A 4S1RL 3UROR 5DMKB 2G75B 3OKEA 3VXQB 1WTGT 3P4NA 4MA1B 4RMSA 4M8QB 4OCXL 1JPGB 4W4OC 2QSQA 1IEHA 5D6CB 4PG9B 2HJLB 3MYJA 4YIQA 1JRHL 2ZUQB 4PJ5D 4JRXD 1G7PB 3VXMB 1Y0LB 1PGRB 4RQQB 1A7BA 1F2XK 2FJGA 4HGWB 4L3ED 1H15A 3DSFL 3LMJL 4WO4B 1S9WA 1XF4B 1KB9J 2UUDH 1G9EA 5HPMB 1A7OH 3CD4A 5GRYA 2IAMB 4PGZA 1XR9A 5KVEL 1QSFB 5J9PB 4PGJA 4YEEA 2ARWA 1AJ7H 4EIZC 4M7ZB 5GQBA 4NZTL 2A0LD 5C92A 3RVTD 1KPVA 3WIFA 4OZHA 4OF3A 2R0KH 3U46B 3GSRA 4M5YL 1XCTA 5AD0A 3IDIB 3IRZA 3ARGD 1DUYB 1L7TH 1ZVHA 2X7LB 1ORSA 1NBZB 3TWCL 2RBLA 5C09A 2P8MA 2Z93A 5D2LF 4HJGB 4XAKD 2BMKA 2GCYB 3VG0L 1CT8A 5BRZA 3QAZC 4AENA 1DN0A 4OKDA 5BW7A 5KJRH 1HHKB 2L0DA 1AGBB 1CICA 2BOBB 4O00A 4LHUA 4S0TD 4PJ7E 2A74B 2AJUL 4JB9H 4ZAKC 3P4LA 4ORGB 1SYVB 2K9UA 4XNMB 2JB6B 4C54A 4ZFOB 3MBEB 2NY6C 4P99A 2BOCA 1YEEH 1EFXA 5AAMA 5HBBA 3MLXH 4N1HB 1VDGA 1T0PB 1HI6A 1FFRA 3VGAB 4FA8A 4JDVA 1YMMA 5IB3B 3C08H 2AJ3A 4HPOL 4Q6IB 1S9KC 4PRBB 5JW4M 4K3GA 3RAJH 4XVSH 5D2NE 1GC1L 4G5ZL 1NDMA 3U0WH 1XIWD 1ZMYA 4IJ3C 1YUHB 4WU5A 2CK0L 5E70A 4IRJD 4W68A 4LSRL 4LLQB 5KVDH 4JY4B 4G7VH 5CP3H 2ICCA 3JV6A 2N4IA 3U7AA 1CFBA 3DV6A 3GBML 1KJ2B 1NUNB 1ZE3C 1CBVH 2R39A 3O4OC 5DJDA 1BFTA 1NL0H 3RWHA 1T4KB 3QDJD 4DVRH 3PP3K 2DWEB 4G9FB 3KAAA 1FLRL 1KXQE 5IMMA 4LARH 4YHYC 4O5LH 4WGVB 4P5TC 1RI8A 5DD0L 4L1DA 4KHXL 3W5NA 3NPSB 2XQBH 2HLAB 3VRLF 1J1XL 4M6ML 3HZKB 1LP9F 5DVMA 5IM7A 1X44A 1PAMA 1RULH 3RGVA 5D7KD 3L3JA 3MRNA 1AHWB 1WIOA 2UWEF 4QY8B 4GXVL 1FVDA 1T20B 4CN6A 1FBIL 3HNVL 3VXUE 3NTCL 4D8PB 2F58L 2J6EA 5BS0D 1ZLSL 3HC4H 4ONOA 4MVBC 2ADFH 2HYMA 2AXFB 4FFWD 3U1SH 3PWVA 3SE8L 4CN1A 2NTFA 3H8NA 2ADIB 4DZ8B 5CJXA 5HJ3A 1J9CT 3NACH 5DQDH 1JZ7A 1BLNB 1GIGL 1MJ7L 2FO4B 3GIZH 3KYKL 2K1MA 2SEBA 4I5BB 4R4FL 5CP7A 4Z77B 1D9KB 2PO6A 4HPYL 5EZJA 5B38B 4ZFZB 2VH5H 4QHLA 1JGDA 5JW4Q 1QFUL 1J5OL 4HZAA 3JSSA 4ODHL 2WP3O 4PG2A 4ERSL 5ADPL 4YHML 4L4VE 5KSAC 4WU7A 1CGTA 3B43A 4H20H 5SWZA 3TJEL 1QSEA 4FG6D 4XCEB 4M8VA 3EYVB 4XB8A 5INDA 4EBQL 2HFEB 1T66D 2D03L 5F9WC 1HQ4A 1BQHA 4PGDA 4AT6A 2BSTB 4HUMB 5C8JB 4P2OD 5H35A 2ZNWA 5J1AA 3L6FA 5GSVA 2J8UE 4RFNC 4U6XA 5DRNB 3TFKD 3GI9H 2JJUA 3Q48A 1QRKA 2JJSC 4UUJA 2JE8A 4BFBD 5JHDB 4KJQC 1AHWC 2KZWA 2D7TL 4TULL 1MELA 2NW2B 4TUKL 5DMIL 3ZHLA 2IANA 4JFPB 1XGRA 2GITB 4AY0A 1T1WB 2ARJA 1KOAA 1J18A 2FIKB 4NP4L 5E00B 3IXAA 2EDFA 4OJFH 1ZEAL 2DQDH 3ARXA 2A77H 1F3JA 5C2UB 3EJZC 5JO5A 4YBHA 4ZS7H 1BGXH 4EQ2A 1HH9A 4C83A 4QXUL 4UT6H 1GAFH 4LGRB 3HG1B 1JF6A 1T83A 3IRPX 3OJ2C 3UTTA 2V9RA 4K3HA 4R26L 4OF8A 1NCBH 3JUYA 1MLCB 5K93A 3CU7A 1UENA 2BY3A 1D9KC 4PJGE 4DTGH 1DN2A 1DUZB 5I1KL 4MD5B 1CG9A 5EIVA 3MV01 2HFGH 2NYYD 4RISH 4F37K 3D87B 1F6LL 5FYJU 4Q6YA 4LAJH 4TQEL 2XPGB 3VDBA 1MUJB 2G2RA 1MI5D 2Y6SD 1X4ZA 4U7SA 2COQA 1LNUA 4X83A 1OCWH 4HH9A 4IS6B 5T1DL 1MIMH 1MNUH 2MWCA 4ZQKA 1CFNB 4FHBD 1QR1B 3PQYA 5JPNB 1KLGB 1IEBB 3NIFF 3DXAE 5DFVC 5CSGA 1Q9KB 2VXVL 4ZFOL 5F71A 4F7CB 4OLXH 1NSNH 3VFNB 4KKCD 1M05B 2GKIA 4HZLA 3DX8B 1IAOA 3HB3C 2BVUA 1I9RL 1Q72H 1U8JB 5H2BB 5HDLA 2R1WB 3BD3A 2N1KA 3O6MH 4MJ5A 2G75A 2IBBA 3H9SA 5KANI 2X89D 4M8QA 1FFQA 2WUCH 2MMXA 4PJ9A 2XXMB 3W0WB 1KBGH 4P5KB 1N7MH 2E27H 2CDFB 3MCLH 2C1OA 5F7FA 4PG9A 1ZHLA 2Y06L 4DZBB 4XNZC 4FQPA 4X80L 4JM2D 2D7MA 4WWKD 1S7WA 1KJ2L 1C5DB 1Y0LA 4WUKH 5FDYA 3RHWK 1C7TA 4DGIH 1XEDA 4OCMC 4LRNL 5HPMA 3I2CL 5FYJL 1G7IB 4MLIA 4MNQD 1CFQA 2A9NH 5D5MB 5GJTH 3QT2A 2EICA 2R23B 2EDOA 1MHEB 4FP8H 3RWCA 2VIRB 4GBXB 3RVUD 2EDTA 2VLLB 4S1RH 3RJDA 5EPMB 3D0VB 4N8CH 2YUVA 5INCB 3VI3F 4CBPA 4OV5B 1O7VA 1DUYA 1G0DA 3R8QA 1K4CB 1YQVL 5HVHB 5LG1A 3CX5J 2YZ1A 3LS5L 3NN8A 5D1XB 1R3HA 4F3FB 4AH2B 1P6FA 4GAGH 1HHKA 4YH6A 1QKZH 1AGBA 3TLRA 2J1KA 4UB0H 3DSFH 4YE4L 2VNCA 1E0OB 4OTXH 4PJ7A 5BCAA 5F9JB 5LWYL 1EZVY 5I1JH 1UWXH 4ALAH 4P23D 4LSTL 1WWCA 1IGCL 5F9OL 5ESQB 2V2TA 2ILLA 3DBXA 3MRQA 4PRBA 3ZLQC 1B6UA 2WAHA 3UTPD 2PTTB 1OAYL 5D2NA 5FM5O 5B8CC 5DJXA 1KB5H 4KUCF 1H5BA 3QQ3A 1WBYB 4H1LH 3ZKSD 3ZDZF 2NXZB 1BVLA 4U1LA 4OM0H 4XC3L 2N7AA 1YEIL 3G6AB 2OSLB 4MQXC 1F5WA 2VTFA 4BK5A 3WLWC 2HFTA 2VKWA 3JWOH 3QFDB 2Z31B 1PG7H 4EDXB 3RU8L 4OI9A 3UP1A 4FQXD 2P8LB 5F89A 1RURL 3HZKA 4P2RD 5I1LA 3P30H 4NQSA 3LB6D 1AQKH 3HFMH 4G5ZH 3RDTA 5HVHC 1U91B 3LQMA 3DV4B 5SV4A 5D1XC 32C2B 4LSRH 2HWZH 1Q94B 1T20A 2E5EA 4DJMA 4M61B 5FKAA 1JV5A 1CWVA 3BO8B 4LHUG 3VXUA 4KGJA 1F58L 2NQCA 3F5WA 3OJDB 5HSFA 2A38A 5LXGL 2ZJSH 5L9DL 1EUUA 1U3HC 2GJJA 1KEMH 2XA3A 1JHLH 5I76A 2HN7B 4QTIH 5C1MB 1EH9A 3DO3A 5EBWB 4YHOL 1OT2A 2EKSB 2P8PB 5H37H 4RIRB 4U1KA 4EN3B 5FF6A 5IBLD 2ADIA 5GZND 5IGXL 5FHBH 3EO9H 4Z0XA 4ZTPL 4NQCE 4S1QH 2IALB 2Z91B 3MXWH 5DD0H 1MCBA 5SX5K 4NQCB 4GO6B 2BCKA 2FO4A 1NGYB 2ORBL 2V5YA 1GYAA 1T5WA 1OAUL 2VDMH 4MNGE 5H94A 2ICEA 3ARFD 5E7BA 2EDYA 3FO1B 5CMAA 4GW1B 4MNGB 4GXVH 4R2GD 1BFOA 1OY3B 3UTSE 4YEFA 3U30C 2HG5A 3AY4A 2CKBL 3KPSB 3UTSB 2V7NA 4L4VA 5EUOF 1DQLL 3CFIC 2QHLA 1ZLSH 4G6KH 2DYPA 3ALPA 4XCEA 3EYVA 3NBNA 3TP4A 5E9DB 1NJ9A 1WAAA 3S37H 3VFSB 3KYNA 2CGRL 5FOJA 1MVFA 1X5KA 1NLBH 3QI9D 4NN5B 3ULUF 4KQ3L 5K9QI 2ZUWA 3B2VL 3BXNA 3BFOA 3PNWA 5IFHH 3GIVA 2J8UA 1F4YL 5L2KE 3KYKH 4WCYL 4H0HB 2EXWC 3KPQA 1WSST 4HPYH 5L2KB 2F54E 1FC2D 4P3CL 3GHBL 1U92B 1MWAB 2QR0B 4D9QE 5I15L 3BUYB 4PGCB 3QIBC 2V7HA 3L95B 5E00A 4CVZA 4IOFC 1DFBL 4X5XA 1JI1A 4NWUL 3IDXH 3A6BH 2QSTA 3CPLA 3TJEH 1SMAA 4EBQH 1LMKA 4WV1A 4EN3C 5K33A 3QHFH 1T22A 3CLEH 3QA3A 4JHZA 3NZHH 2OQJA 2FBOJ 2ITDB 4XP4H 4P4KD 4HS3A 5C0GA 4YPGB 2BNQD 2H26B 3FL7A 3PP4L 4PBVC 2HTKC 3K80A 4YC2B 1DUZA 4KZDL 1A5FH 3PDOA 4PJGA 2DD8L 3LDBC 4DGYH 5HYJB 3O3UN 1G7JA 2D7TH 2ADGA 2VDPL 2ZOLA 4TULH 1DR9A 4XT1C 3K81A 5DMIH 5JR1L 5SWSD 4Y2DD 2XXCB 5DHVB 4M9OA 3O0RL 1FO0B 4MA8L 2GI7A 1M7IA 4FMKA 1CFNA 5GRXG 1DQTA 3X14B 5GRJH 5JHLH 5JPNA 3RPIA 4XNUL 4R96A 3VCLB 1U9KA 2PCPA 2NW3B 3EFFA 3DXAA 4UQ3B 2ZSWB 3ZT5A 1FL3B 1LEGA 1U8QB 3NGBB 4HHAB 1E27B 3BEWB 1FNLA 4YXHL 5D7LD 2B5IC 1L6XA 3L3GA 4KROB 1KJVA 2B8OT 2R69H 4LAQH 4ZTOL 4XPHH 5I1KH 1T2QH 4G3YL 3D69B 4FQ2H 5DGRA 2UYLA 1LVEA 1KG0A 2GJZB 3RX8A 3MGOA 1A0QL 1KIPB 2YD4A 4TQEH 2CLZB 4UT7H 1OAQH 3VA2C 3LKQA 2CDFA 1FL6A 4KV5E 4YK4B 3BUTA 4A2LA 3GMQA 4UOW1 9CGTA 2YRPA 1A6WH 3HE7C 1C5DA 3LQZB 4HWBL 4IRZH 4MD4B 5EOCL 1YNTA 2CR3A 1KCLA 3UX9B 3SDDA 1ZV5A 4XTRD 3QNXA 2GYSA 1WEJH 2LTQB 5CILH 1RFDH 3DGGB 3FQUA 5DD3L 3PL6C 4GMSL 5F21B 1OF2B 4IMLB 3OMZA 1E6JL 1T03H 3MLUH 3QUZB 4MAYB 4YC2C 5IB4A 2F53D 1CFVH 2O26U 2DJUA 2JIXD 2O5XH 2Y4SA 3ZE0F 3MRRA 4L3CB 1P7QD 4U0RB 5D9SA 3GMNA 5L88H 2EXYD 3KPRB 1NMBL 1A7NL 3AUVA 2X1QA 5EIQA 3SDYH 4PV9B 1BD2B 3CSPA 4R6UA 3GZKA 1CLZH 4XPGL 4F3FA 1FNSL 3L3IB 2Y06H 4WTZG 1QP1A 1PSKL 3AU1A 4L9LA 3QPQC 3RJQB 4ODXA 3TH2T 1LWRA 4JVWA 3OPZL 5ISZE 5F9JA 2FZ3B 4BZYA 3UPRB 5HI5C 15C8H 1JPST 1ZTXH 4FQHB 3NCMA 2K3TA 3I75A 1HXYB 3IGAB 3LKPB 3D48R 4PS4H 1IILE 5ESQA 1XF5A 4N0CD 1NCTA 4L8BA 4LF3B 1OAXH 5JOPE 4PJCE 1MIEL 3QJHA 4JG0H 5DJYB 1M1SA 1WBXA 3KWWB 4PJCB 1INEH 2PW2B 3OXRA 5MEPB 2E9BA 1UJ3B 4Z76B 1PFCA 3O8XD 2DBLL 4NO0D 4TSCL 3KR3L 3FOMB 2XWTB 3UAJD 2J4WL 5CGYD 3H9HB 1UCBH 2ED8A 1TIUA 3D3VD 1G7LB 1QLRB 5DS8B 5E2VL 4PRAB 3FJTA 4JFQB 4OT1L 2FR4A 3P11L 4LKCA 4BUGA 2FL5B 3HRZB 3MFFB 1JGUL 3HPLA 2WV3A 4EDXA 3VMOA 3C60B 3V4PL 4XXDA 4NC1C 1OGAB 3R1GL 2X4PB 4HKZA 3SE4C 3S35H 4Z0BL 5MERA 5IWLA 1NFDE 4XP1H 4NQTA 4NNPH 1QA9B 3DV4A 1ACYH 1SBBA 4HUVB 5DEFB 1EJ6A 3AXLA 3VFTA 3WHE1 4DGVH 5ETUA 1HQRB 4JFYA 3Q1SH 4XGZB 3TH3T 2PXYB 3FB5B 1OTSC 1RZ7H 2CMRL 2NPLX 1YNLH 4ZD3H 4XC3H 5F1SA 4OFIA 5DC9B 1ZHKA 5HGBB 3NCJL 5TH2A 5CD5C 2UY6A 5I1DA 5E08L 3LV3B 4CVUA 5HDQL 4AIZA 2YPKA 5GRVL 3VFRA 3VXRB 3FRPA 4RIRA 1PQZA 5I71C 1J86A 4LKXB 4NRYA 5E4IA 3ZSSA 4ETYA 1CD9B 2AABL 3ULVF 5C07D 1KF9B 3ZSTA 3BAEL 1SEQL 1FVCA 2EZ0C 3Q0HA 4Q2ZA 3WUWA 4DW2L 5HHOD 1W72H 3MNZB 4L4TD 4P3DA 2OL3A 2YPVL 5MEND 1P69B 1U41A 3OTTA 5DJAB 1IGJB 4PRDB 4UDUA 1KXTB 2PYED 2YUZA 2ICWA 4HF5H 2EIEA 4YO0A 5IF0A 1FO0L 2BVQB 4OD2B 2AVGA 3PWLA 5J12C 2CRYA 4HK3N 5DRZB 4UINL 3OJMB 4KZEH 4LEOA 4UIKH 3MSPA 3PHOA 5IT2H 3DMMA 4V2CB 5CFHA 3C60C 3RIAF 5DUMH 4D0CA 5IGXH 4OLYL 4ZTPH 4I0KA 5KN5B 3LKOA 3EBAA 1J87A 1K5NA 1MJUH 2Q3ZA 3EFDH 4NO3A 5F7KC 1U8KA 4BSWB 2G5BB 3KLDA 2FX9L 4JQIL 1H3TA 5D7IF 5L2KA 1W8OA 2EH7L 5EU4B 3EYFA 2R2BA 2F54A 1AGFB 4JO3L 1U92A 3FZUC 3MUGB 2E7LA 3HZYA 3PXJA 1S7TB 5SWQA 1IARB 1U8MB 4NQVA 1A1OB 5EC1A 1IFHH 4NN6B 2WIIA 2GJ6E 1CE1L 3H3BC 3GSOA 1MHHA 3X3FH 2HRLA 3SDAC 2R0WH 2WQRA 2VB5A 1NBYB 3K2MC 2HT4C 2EKJA 1IM9B 2GIYA 4LU5L 5FM5M 2VDLH 2YKLL 1LO2H 1CS6A 3IETA 1WZ1L 3VWJB 1MOEA 4FZ8L 1ZS8B 2X9YA 4G8FA 4MA3A 1C12A 5T33L 1ZVSB 1DBKH 3QRGH 3MJ9H 4KQ3H 4D0BB 3WS3B 4TVPL 1KTLB 5B38G 4I18A 2GFBA 5DJ8A 1KYOK 4AEEA 3G5XA 1MCOH 4U31A 1S8DA 5J11C 5IHZB 2W92A 4NT6A 4P3CH 3ALWA 2C3XA 5I15H 2W0LA 2ZKHH 2AV1A 1U6AL 5DHXB 3O3EA 1OAZL 5EO9A 2L7JA 4OZHF 2R0ZL 4WHYG 1DFBH 4X9GA 4M6OL 3UBXB 4NWUH 4MHHI 4QHMB 3BIKB 1K2DB 1L0XA 1KACB 3QZWB 4UQ3A 1FL3A 3ZTJG 2AJZB 5ALBH 1WZLA 1AXSA 1JK8B 5TGBA 4LQFH 1HOCA 5CP3A 2IH3B 3RVVC 3RL2A 3MJ7A 1NCNA 3D5OF 5D72H 4KDTA 4KZDH 5HHXH 1GZPA 1KULA 2DQCL 5FV2A 5GS0L 5KS9E 4JY6A 2OK0L 5D70L 2NY0C 4QO1A 3DURA 4O58L 1NGPL 5DJ0A 3MUHL 5KG9B 3MRLA 1PG7W 3OHXB 4HKXB 3GMLA 1SJEA 1UZ6F 1T1XA 2EC9U 3G6JE 3RGVD 4M3KB 2XG5A 3NAAL 2WNGA 4FQCH 4XB7A 3V4VH 5B3JF 4ZSOE 2IFFL 2P5WD 4JE4B 3RBSA 1MHCA 3VWJC 4E41B 2P5EA 5LQBH 3MLVH 4ZSOB 4ZXBB 1IEAB 3TYFB 4MCZB 4Z95L 1OF2A 4IMLA 5E56A 4F8TA 5FXCH 4ZYKB 3ROLB 1EEZA 8CGTA 1AP2B 4Y4HC 4ZTOH 1YQ2A 4YFEA 2P48B 3DWTA 5KSVB 4GRLA 4U2ZA 3DO7A 1QG3A 3VGEA 3OX8A 5C6TL 4G6FB 1DQML 4LBEA 4D2NA 5BMFH 2XA8H 5JXAL 3REVA 3WE6A 4AMKL 2I9LB 3AREA 3BN3B 4PRPE 4UT9H 5L2JB 5JLZB 3LH2L 3MMEB 4XMKL 3C6LC 1R0AH 4ZO8A 5IK3A 4OUUA 4DKAA 1S5IL 4X0KB 2LABA 5ISZA 3LEVH 5ACZB 2MSPA 4LVNB 4ZFGL 3HI6H 3MRHA 3CH8A 4OBRA 4POZC 3CFJA 1JWSA 2FEDC 1O5DT 3N9GL 1GGBH 4F9PA 2W0FB 3CDCA 5DJYA 3KWWA 4PJCA 4HKJB 4HT1H 1CVSC 4PJBE 1P4LB 1D3CA 2RGSA 3DETD 3QUYA 3BN9D 4XNQB 1EGJH 3GFUA 3L3KB 5E95B 3QHZL 4MQ7B 5DHYA 1WICA 3MC0A 5D8JL 1UM6L 2CUMA 5A1AA 3H9HA 2FSEB 5FGCB 4MD0B 4WNQA 1HKLH 4QKXB 4EUPA 4X6CE 1S78D 1OL0A 4X6CB 3KXFD 5JOFA 1RU9H 2EYTB 3QBTB 2ICWJ 3SO5A 4N1EA 1JZ6A 1UCTA 3ZKMC 5IROC 1NFDA 1A3LL 3AROA 1TJHH 4LLYA 2Z92A 5FOBA 1FYTE 1B2WH 4QWWC 4IM8A 1JPFB 1XGYL 2GW5A 1HQRA 5GGTA 1FAIH 5J6GB 3TYGH 4BUHA 4KY1H 1V05A 1F4WL 4P9ML 4N8PA 1YN6A 1G6RH 4Y5XB 2MKWA 1DBJH 3MA7B 1FJ1A 5E2VH 3PDGA 2RAMA 5CINH 4GW4A 4FNLL 2ERJB 3IFPA 3WHE0 4XPBH 5EC2A 5K9KA 4EVNA 3T0DA 5F6IC 4X98B 2EDJA 1BZQK 3V4PH 4CAGA 4TTDD 3B9KD 2HA1A 5C0IA 4Y16B 3GSNB 5IW6B 3ABZA 2V2WA 1T7XA 4OFYA 2XTJD 2R4SL 3QXDA 5FYLL 1JHTB 2NX5E 2V6HA 4GH7B 4KDVA 4ZAKD 3KPLA 3FOLA 4EI6B 2OCFD 3V4UH 2BSSA 2NY6D 3QEQE 2W1NA 4QHNA 1B0WA 4R0LB 3QEQB 1A6ZA 4MXVE 2NY4B 5GGVY 5HDOA 4X4YA 1EFQA 3G04B 1XH3A 3PXHA 1BIIB 1QTYT 4JG1H 3KNBB 5HDQH 4J4PD 4QXGL 1X7QB 4P2QE 3P2TA 4Z6AT 1CE6B 5DZNA 3T8XA 4P2QB 4MNHA 3MLTA 1GL4B 5KN5A 3STZB 3DUSA 1PZ5B 4N8VB 3BAEH 3TVMB 1A6TA 2DIBA 3VXMD 1N8ZA 5IMOB 4I3RL 1J0YA 4WO4D 1YDPB 1E4XI 1Q9WB 1BX2B 3BOVA 3ARQA 3VFVA 2IAMD 1IC4H 2BDNH 2DQIL 3MRPA 3FFDA 1QSFD 4JANA 5LGHH 1A1OA 3SDXB 2VWEC 4FQLH 4U1GC 1L4IA 2GJ6A 1I7UA 1SEBA 3NCYP 4JHWL 2OR7A 3FRPG 5ERWA 1AGDB 4UV7L 4XZUB 3CGTA 5HD8D 1CCZA 4OCWH 2FYYB 2VN7A 4M7KL 1GGCL 4IMKA 2DQFB 2Q1EA 5D1QA 3BZDA 3VXTB 1F00I 4Y16C 5HHQB 3BEVA 4JQVA 1KJMA 2V5TA 1H3UA 4J2XA 4KRLB 5DK2B 3ME0A 3BSZL 1UADC 5MI0C 1WCBB 4GG8B 4PFEA 2LFGA 3MNWA 2UZIH 3GKWL 1A6AA 5AWNH 4JO3H 5E6IA 3MBED 1QYGH 3CXHJ 4NIKB 2P43B 2W9LA 2AJVH 4ONFL 2NY4C 1EEYB 4Z18A 1HH6B 3NCBB 3F7QA 2HJKB 3LOWA 1K2DA 2OTUA 1NEZB 1UWGL 1ES0B 4AJ0A 2DN7A 3O3AB 1NC2B 5T1MA 4D0DB 1OGTB 4KRMB 2VL5B 5FO7A 2DJ4A 5EZLA 3FKUS 1WZ1H 4PJXE 3RTQB 1KB5A 4PTTB 3TBVB 1CD1B 3GJFB 4JHAL 4PGEB 4PJXB 1ZLUK 3TVMC 3A67L 4H1LA 4XCFL 3MACL 3BP7B 4RMWA 4PJ7F 2X4SA 4G6AC 5C08B 1HYSC 1DE4A 1ZOXA 4I48B 4J23A 3TBSA 3ECBA 4G9FD 5KS9A 5FYJD 4HIXH 3QDMB 2H32H 1LO3H 1BJ1J 4YPJA 3H3PH 2C3WA 4NKIL 2F5AL 4NZDA 1U6AH 3BGFB 3GSUB 3FT4A 4PJIA 4RAHA 5C0BE 4N0UE 5CKGA 1HNFA 5C0CE 4EI5A 5EO0A 4PJHE 1OP9A 3V6BR 5C0CB 4H5SB 2J8OA 3G6JA 4PJAB 3BJLA 4X7TB 2VLJE 5KZCB 4BZ1H 3RGHA 4YHPA 3Q5OA 4ZSOA 2JK5A 3MRIB 2PF6A 3G5ZB 5EBLA 3D18B 2N7BA 1CU4H 3Q6GL 3FQTA 25C8L 2DQTH 1H3XA 3E3QC 1MJJA 4HULB 3M17A 1X5YA 4OLVL 2FATL 1PG7X 3CCHA 4PLKC 4FABH 2AEWA 4LMQI 1XF3A 3CLFL 2BSRA 4JHBA 4LCWB 4O58H 3MO1A 1JGVL 2A73A 2MCG1 5BO1H 3T2PA 3GJEB 4IEFB 2R29H 3AC0A 3D25B 2I9LA 3JUZA 5L2JA 2HP4A 4JLRA 3O2VL 1MH5B 2IQAA 4ODSL 1D9KD 4PRPA 5HI3C 2A83A 3HMWL 4GLRI 4X6BA 2NY1B 3T2QA 4LCIH 7CGTA 4QRUB 5BZWB 1HXMB 2B1AH 4NPYA 2IFFH 3TZVA 3D0LB 2ZZUT 3DVFA 2HVKA 3AB0B 3OR6A 2I9TA 1M7DB 3M45A 3NCEB 4F15B 4W4OA 3L9RA 5GISL 2DYPD 3OG6B 2H2PD 2A6JA 5TE4H 3GB7B 1I7TA 5HXMA 2XACC 3N50A 1CFSB 3BMVA 1J0IA 3MUY1 2YMXL 4PJBA 1FFNA 2Q20A 3RI5F 4R7NA 4X99A 1CLYH 5FUZH 2Q86A 3H7BB 4YWGL 3MRGB 3VG9C 1N2RB 1YEFH 1J05A 5E2TL 2LVCA 3RQ3A 5IB5A 2VXSH 2FSEA 4OQTL 5ICYA 1JNHB 3LH2H 3RNKA 3BWUC 1U3JA 5JHDD 4XMKH 5FM4A 5GHWH 5GSRA 1C5BH 5T5FL 2NZ9D 1S5IH 3O9WB 3P9LB 1MFEL 1OM3L 3R0MA 1CD8A 1IAKA 3OL2A 2IJ0C 5FIEA 3LSOB 1ND0A 1A7QH 1H3GA 1BFVL 2DQGL 4PLOB 1IGTB 3W39B 3GKZA 3MCG1 2A1WL 2H2SC 4QRSB 3S37X 1WAAF 3N9GH 4YR6A 5F3HA 2CUHA 4ZUVA 2X4RA 3HG1D 1JWMA 1N5YL 1FYTA 4L3AA 2D0FA 5FCUL 4TVSa 2J8UF 5DD1H 5DTFA 5J6GA 1EMTL 2DQHL 5D8JH 2VO5A 5CBAB 4YDKH 5A3IC 1G6VK 2D7OA 2NY1C 4Y5XA 3S34H 4I2XE 4Z8FH 4KMTH 4OCRH 1XF1A 2B39A 5AZ2L 3VXSA 4A6YH 3FB6A 1RJZA 4JN1L 1VFOA 3MOAL 3OXSA 3OAYK 1JBJA 2VDNH 4YQXL 3TJHD 3LZFL 2NZIA 5DZLA 1F2QA 3F7YA 3JTSA 4MJ6B 1FZOB 5FYKU 3VA6A 1PYWA 1XGUB 1E4WH 2NX5A 1T89C 2NLJB 4EI6A 3QG6B 3PHQB 3VRJB 4KK9D 1A4KB 4LLVA 4P9HH 4S1SL 4KC3B 1UEYA 5FUCC 1VFUA 4JFDB 4PJGF 43CAB 1I8IB 2R56L 4P5TA 3FFCE 1KPRB 1F4WH 4HXBH 1WF5A 3CVIL 5B3NA 5DSCA 1AXTL 4APQC 4RAUA 3O9WC 4GAYB 4I9WE 1URLA 1D5BB 1UXWB 3B8SA 2X4NA 1OP5K 2XIDA 3K1KC 3W0WD 1X7QA 1CE6A 4S11A 3TNMA 1JIBA 3F12A 1ZLWH 2BHUA 3JVGA 4HQQH 4LSVH 1BM3H 2ED7A 1I9IH 3NH7H 1YEDB 3CFKB 1Q9WA 3IF1B 4LSUL 2AJYH 3E2HB 5CEYA 5DK0A 4DKFL 3NFNB 4NZJA 2ZUTA 2W9EL 3W5MA 4GBXD 4JFFE 4HUKB 4YX2H 2H3NA 2V17L 5ENWB 5IVXE 5IB1B 4P49A 3CSBA 3D39E 4FTVA 5IVXB 2I60L 3J8F7 4FMFA 3G5VB 4DVBA 3O41A 3N1FC 1NC4B 4JAMB 5FYKL 2Q8BH 3E6HB 1VPOL 1JNLL 1I8KB 1PW3A 4WFGE 1AKJA 4U1IB 3CDGA 1MAML 4DUVA 3K8MA 1KIQB 4ETQA 3RVXD 5KSAA 3TNNB 4MJ2A 4JM4H 4QHKJ 3T1WA 2D0HA 3SCMB 1QO3A 1ZHBB 3U9UA 2VSDA 4Q9QH 3X3GH 2H1PH 3MJGX 1HH6A 4X8JB 4DOHB 3S8WA 1K8DA 5EN2A 2GT9B 2BC4B 1I7RB 3HC0A 1E4KC 4JHWH 3WO4C 1MQKH 3OKOA 4LSSL 1ES0A 5DVLA 2CJUL 5GGQH 2HT2D 2JJSA 1C5CH 2BY2A 1OLLA 2NXZD 3HPJA 4U6YA 2WBJC 1SM3H 4KTEH 4UBDC 2YC1A 4OLEA 3RWDA 3ARRA 2LU4A 3RY6A 1RVFH 4LCYA 4ENED 4S0SD 4XP6H 5JZ7C 5JIKA 2NY5H 1MJ8L 5E5MB 4M48L 2QV2A 4LIQL 2Z31D 4YXKL 3RX7A 1YEGL 2CRZA 1ED3B 4V1DB 4J7RA 2ZSVB 4MQSB 3NFSL 4M1CD 4V2BA 5C0BA 1FPTL 2BRRL 4N0UA 4P5MB 2KBGA 4PJHA 3VFPB 1YJDC 2BVEA 4KI1A 4M00A 4WWID 5CJOL 5IJKA 1MVUA 2HLFD 2XZZA 2ZCHH 4U0QB 2VLJA 3G5ZA 2HRPL 5JNYB 4KJWD 5E4EB 2PR4H 3V6FA 1AO7B 1BVKB 3BDYH 4QRTA 4Q58C 1G6RB 3GMPB 4LLWA 3SCMC 1YEKL 5CZVH 4EN3D 1ZWIB 5I1EL 3KYOB 2Q7YB 3UBXG 1B0RB 3HE6B 5DEZA 3BVNA 3ORJA 1RJLB 2F15A 3EYUL 1Y18A 4UTAH 4NQCD 3WMSA 2J88H 5FGBC 1AIFB 1IC7L 4W6XB 3VRIA 1CF8L 1MH5A 5HYFA 4ZS6C 5LGJB 1E6OL 4C57C 1P1ZB 5FO8B 4NDMA 5T3XH 1BF2A 2YZ8A 1W72A 1E4XH 4KJPC 4NZRL 3UYRL 1L7IH 1KT2B 3B2UD 1Z3GL 5I8EB 4XRCB 2HMIC 1VFMA 3MTRA 1I9JH 3UTSD 2A9ML 2DLFL 25C8H 3O2WH 3P0YH 4ONHA 4LVOC 3K3QA 5DF0A 3MLYH 3LHPH 4LP5A 4NBXB 4O02L 5HHMB 4OLVH 5E9DD 1AQDA 4QRPA 3W9DA 4NOBA 5GGSA 1BF8A 3G9AB 1PJ9A 5MEOB 4RAVA 4KRPB 4CMMA 1IGFL 5EU6E 4MAUH 1AD9B 1BWMA 3PWPB 5D2LB 2ENYA 1IC5L 1EIBA 3T04D 3L5HA 1KJ3L 1A6VL 2MQCA 2ATKB 3MPCA 1HDMA 3HHRB 3CXDL 5L2KD 2I07B 4NUJB 2OI9B 2IADA 2BSED 3HMWH 2F54D 1WWBX 4YDLB 3BRDA 3WFBL 1GHFL 3O3BA 4JKKA 5IQ9B 5E4EC 5E5UB 5DJ6A 4PP2B 2BNRE 1IGTA 4UU9A 4U1NA 2UUDK 3AS1A 5TDPA 1J12A 2CKBA 2NXYC 2F74B 1TVBA 1UVQB 4UOJA 5E2UL 1G7HB 3C09C 4HWEL 5H37G 2V2XB 1Z2KA 2LAAA 4MX7B 1O7SA 5JW4R 4IIQC 2VZ3A 1RIHL 1IQDA 1WFNA 4HMEA 1HN1A 3QG7L 3M1BA 1VEOA 1P7KB 3MA9L 1JFQH 4QRQA 4KPHL 5HY9B 5F7YC 4XPFL 3MJ9A 1BZ7A 1T2XA 3EGSB 4NGHL 3TN0B 5HYJD 5IW3A 4I2XA 1WC7A 1GVIA 1RQ5A 1EBAA 2AK4E 1YJDL 4OCNC 1MFEH 3SDCB 3T77A 2QQKL 1LO5B 2AK4B 4GKZA 2FBJL 5CHNA 4XCYB 3DYPA 5B8CA 1BFVH 3BP6A 3RNQB 1MCPH 3EO0B 4JKWA 1NUFA 2FEEI 4WFEE 5C3TA 1NAMB 2VQ1B 3WS6C 3G5YB 1KNOB 3AAZB 1LP9B 3LN5A 3SE9H 4MJ6A 5IBTH 5IB2B 2QSCL 1AI1H 2EH8L 4S1DC 1CVRA 2YBRA 2NLJA 3VH8A 2UWEB 1IL1A 4WEMB 4IDJL 3GBLA 1S3KL 5D4QA 5CEZH 4KROD 4PJEE 1P4BH 4NC1E 4Y5VB 1HHIA 1RHHB 3FFCA 4GAYA 3QRFM 4HIJB 3LQAH 4XP9L 2ZCLL 2OJZL 3VE0B 4JFEE 5E94A 4M1DL 2A0LC 2VAAA 4JFEB 2NY7H 3IXTB 2H32B 1MCJA 1RMFL 3RVTC 5DQ9A 1A4JA 5IHUL 1HSBB 4JJ5A 3FQXA 2DI9A 3ARGC 3LZFH 4XXCC 3V5KB 3GM8A 3LIZL 2VDRL 3QUKB 1LK3L 4QRRE 3CFKA 5ILTL 4GLRH 4P2YA 3U7YH 1GXEA 2I5YL 4QRRB 1U3HA 3FONA 3QQ4A 3NFPA 5JA9A 3OV6A 2Q6WB 3SKJL 5A2IH 3QUZD 4MAYD 4S1SH 1CDUA 4TVPD 3VJ6A 2Q8AH 5K59F 2BRQA 3R06B 3MRBB 5ENWA 4JFFA 4ZUUB 3EO1A 3DYOA 3CVIH 5EG6C 1AXTH 5IVXA 3KPRD 4NNYB 4WUUE 3BPCB 3D39A 2O5YL 3MRCB 1XGTA 1NC4A 5AG8A 1YZZA 5IEHB 1BD2D 2EC8A 1G1YA 1I8KA 3WD5L 4R90H 5IOPA 3OKNB 1VKXB 4RDQG 4ISVA 1Q9LB 4QTHB 2YWZA 2ZOKA 1XIWC 2VYRE 1R5VA 3HAEH 4HWBA 4IRJC 2ESVE 5DUPH 1U3ZA 3I6GB 3ARBA 4OM1H 2G60H 4NKOB 1HHJA 1R3IH 2IQ9H 2VXQH 1U93A 3BKYH 1BJ8A 2EDQA 2X1PA 5HYQB 1N3NB 3CJJA 4NQDB 2FHBA 4ODTL 4QNPE 2GT9A 2EZ0D 3C6SA 1IKFL 4XH2A 5GS0D 4G43B 3B3IB 3ESVF 4J3OC 4IDLA 1AY1L 4F9LC 2BVPA 1A2YA 4P2OB 5FYKH 1SJHB 4N8VG 2B7DT 4BQ8A 3GNML 3QUML 3QB7C 3STLA 2RCSL 3QIBA 1A7PL 1YPZE 4Z7QE 1HWGB 4KVNH 3UTZB 3DIFB 1B4JL 2R4RH 2R15A 4LOUD 1FL5B 1HSAA 4OLWH 2Q3AA 4NBZB 1YEJH 1GGYA 3D9AL 4PUBL 1FVEB 3LN4B 1OGAD 5D96C 1ULVA 2EIZA 3SOBL 3B9AA 4NFDA 2PNDA 4XAWL 2G9HB 2GTWA 1AGEA 1FLTX 4FFWC 3IDYB 1DBBH 2YWYA 3CUPA 5AZEL 1INQA 4RCAA 3QUXB 4E5XA 2XNAA 4ELKB 3LD8C 3U0PB 5DT1H 3TBWA 2PXYD 1BVKA 3UZEA 2QHRH 4HLZH 3UMTA 2YOCA 2YK1H 4PTUA 4MWFA 5TF1H 1G6RA 2E9WA 4ONGH 2NNAA 4L5FL 3VXRD 4M48H 4LIQH 5DJZA 3U4EA 4YXKH 2AEPL 1FC1A 3BESR 1MY7A 4A6YB 4FG6C 3DRQA 1NEZG 5I1CL 1NFDF 1F02I 1T66C 2DWDB 2LAGB 2C3HA 4M7LL 3F62A 5JQ6H 3VXNA 1CLOL 5IP4A 4ZPVB 4P2OC 4O2CA 2DLGA 1FP5A 3ARSA 2X1WL 3HCVA 4ZFFB 4CMHB 4XBGB 1H3VA 2E7HA 3RA7L 3OAZH 3ZTNL 5FA4B 3QXAA 5T1LA 3K46A 1CK0H 4FZEH 1NAML 2EEBA 1AGCB 4LVHB 4RGMC 5F7DA 3VI3E 1Q0YH 4R97C 3B8YA 3HE7A 1MCFA 3N85L 4RGNE 1V7ML 3LKNA 3WEXA 3Q6FB 4NYLB 3FT2B 5EU6A 3KPOA 3KPMB 1W0WB 2DIJA 3QFJA 1I85C 2FX8H 1IZKA 1XGPB 3I3DA 5KSBE 1J8HA 2KH2B 4FQ1H 3L5JA 1QBML 1YMHA 1ORQA 2IH1A 5FKPA 1Z3GH 2XFXB 2JCCE 3VGBA 4OZIA 4MYWB 3FHQA 2A9MH 1SYSB 4F7PB 4H0GA 2BNRA 4Q97A 4TUJA 5JUEH 1A3QA 2NYYC 1UM4L 3IJYB 3MX0A 3LEXA 5CD3A 4O02H 1QEWA 1IM9D 1A14H 1UA6L 5FK9A 5IIEB 2APTA 2Y6SC 2DRUA 2JF1A 3VWJD 5ITFB 4JGUA 3VWKB 4JRYE 5EZIH 1KFAL 3BQUA 5GJSL 1C7SA 3F65A 3ZDZE 4ELME 4JRYB 4O2EB 1P7KA 4EJ1C 3WXWH 5EIIA 5HY9A 3GRWL 1N4XH 3BGAA 4HUWA 3S88L 4MXWL 2APBA 4NQEB 5FYLD 2CIKB 1NMCC 3SDCA 2EE6A 3D85A 2Y36H 4RGOL 4HFWA 3JV4A 5F7HA 2VLKB 1BAFL 2Y07L 3HI5L 4O4YL 5CLTA 3TESA 2B2XH 3VFWB 3ARDB 2W65A 1RIVL 3G5YA 3SGEI 5CWSB 1S7VA 3CDYA 4YGVB 4LNRA 1P5VA 1QFWL 4FQJH 3TO2A 1MFCL 1PLGL 1D7FA 4BFIA 2AXJA 1R3LB 2DS4A 4JM2C 4W4NA 4WWKC 3GSWB 1UM5H 4G8GE 2OXHA 2EYSB 4JVUA 4QOKB 5DC0A 4PR5B 2IGFH 4M9PA 1TZIB 1I3RB 3VFMB 3DUUA 1NDGB 5F1NA 3EOAB 4PBWD 4PJEA 2VISB 3NA9L 2FEDD 3ALXA 5IW1A 2RHEA 4HIJA 1PKOA 3MGTB 3BD5A 1JZ2A 5EOCJ 1YJDH 4NJ9H 1B6DA 5KW9H 1MLBA 2X42A 4OGXL 3MLSH 1FV1A 1KIRB 3RVUC 3L5WB 5I17B 5I8OL 8FABA 4FQXB 3QNYA 2AEQH 1ZT7A 1CL7I 4J6RH 2FDBP 3BW9B 4PRIB 5I1AB 4XMLH 1VFAB 4OV6F 5CSBA 3P3YA 1REIA 3MV8B 4E41D 4DEPC 4BQCA 4ZXBD 1EO7A 1G9MH 4GG6A 5ABDE 1QBBA 1S9VB 2MJWA 1WBZA 5BQ7B 1H3PH 2GEEA 3RY5A 4DKDC 1MF2H 4PJ8B 4AG4H 1JN6B 5EUOB 1CTNA 5KS9F 4AEHL 3IFOA 3RWJA 1JPTL 3EDFA 2J7LA 2D31B 3OZ9L 4P23C 4WUUA 3V5DB 4PJIF 5EU7E 2RJMA 4G6FD 3DX7A 1RMFH 4QWWD 4LFHG 2CIIA 2DI7A 4U7KA 2XY1A 5IHUH 4Y1AB 1F3RB 1MCIA 1NMAL 4QTHA 3SBWA 3RWFA 1EJOH 5T3XE 2BFVL 2VDRH 1HZHL 3SKOB 3VH8G 4DKEL 4N68A 2DKSA 3RWIB 3V6ZB 2ESVA 4OCLC 4X9FA 4BFEA 1BEYL 3DLQR 5ID0A 1ZLVH 1YY9C 3RZCA 4TOYH 3WN5B 3TIEB 4XWOC 4EKXA 4JPKL 3WFEL 1D5MA 5E2WL 4QXTB 1EHXA 1DLFL 2BXZA 3ARWA 4JEGB 4U1JB 5IR1B 3GO1H 1D6EB 2YPLE 1UYWH 1JGEA 1PBYA 4FQXC 3WD5H 5C0RL 5J6HA 1TJIL 5GPRA 2AI0H 4L8SB 3ZYIA 4DAGL 3LB6C 3U7WL 5DRWA 2R0LL 2VZTA 5EWIH 5E1HB 5F7NC 1SHMA 1YPZA 3O6LH 2Y7QB 3UJTL 1XR8B 3REWB 2MHAB 4Q74A 4X4MA 5TPWH 3RWEB 4DWHA 1RK1B 4OZGE 5T3ZL 2XKSA 5EA0L 5FA3B 4KI5D 4X5LA 5JPMA 4E0RA 1A3RH 5TE7H 3L1OL 1IKFH 1S7UA 3O6FB 4JKMA 5GZNC 3MLRH 4NO5A 4KHTH 1WGOA 1K8IB 5ADOL 5K9QG 3GNMH 4Z5RA 3E1F1 3GMOA 2BX5A 5BOZG 3AGVA 4MA7H 4X6EB 4Z7WE 4GW5B 5IG7B 1OD9A 1JYWA 1LD9A 4CADB 3ARFC 4K3DH 4R2GC 2VLRB 3GHEH 3S5LA 2JJVA 4NUGL 4TPRL 1C16B 1U8NB 3MLZL 1OLZA 4O51B 1HK6A 3D9AH 4PUBH 1IKNC 4PJDB 3WN5C 5HI4D 4RFEB 5EU3B 4M6NH 3MRJB 1CGWA 1VACA 1QVOA 4I0PB 3LRSA 3V5HB 3W2DH 1CQKA 4NKMA 5D7SL 3BE1H 1MCKA 3KYMA 3BPNC 3QI9C 1TPXB 5AZEH 1K9TA 5E03A 1CFTA 1ZSDB 5CKAA 3PGCA 1RZJC 1DQDL 1T1ZA 3BRGC 2BNUA 3QDGB 4JY5H 5CEZE 1RUKH 3QEQD 3X12A 5C86A 3W9EB 1NGWA 2NY4D 1NGZA 3ARPA 3BPOB 3L3OB 4OD3H 1QFHA 2IBZX 1KN4L 2WSKA 2E7CA 3BZEB 2P45B 1HE7A 2JJTC 4K3EH 4LMQE 4P2QD 5DD6A 5HHVL 5L0QB 3FT2A 2FHCA 2WW8A 2XYCA 4QCIB 2O93L 3TVMD 2IPTH 1I1AB 3FN0H 4PJFE 5LBSH 3PHSA 43C9B 4N0FB 4E42A 3QP3A 1G7MB 2CO6B 2EE9A 3DSNA 4YAQA 1MFNA 4IRSB 5KSBA 1FFOA 4NO2B 3LPFA 1D6VL 4P4KC 4D9LL 4LASL 4HIEA 5D93C 4RZCA 5HGHA 3RA7H 2JCCA 2XZAH 4MXVF 4UIMB 5I8CB 4NQUA 4BJLA 2C4FU 1P7QB 2PYFB 3GSXB 1Q1JL 1JF1B 3N0PB 4GAJL 4Y2DC 3FO2A 1ZA6B 3N85H 1LEIA 5DR5L 3C6LA 3MRDA 5ITFA 1NFKA 3MYZA 1ZGLM 1EHLL 1T5XB 3G6DL 3L7FA 3BPLC 4ELMA 1NCWL 5MEQA 1RAMA 3PP3H 3T1FB 3BP4A 4MB5A 3T0VA 4FFYH 3I02A 1RZ8B 2FJFA 3FO9A 3NABL 1OSPL 4LEXL 1DQQA 4RWHA 4WI8A 1YYLL 2A6KB 3CVHH 4OIIL 1GGIL 1NCDL 1HIML 1S7SB 4LSQH 3SKNA 1SJXA 1QOKA 2ZUVA 3D2UB 3X13A 3LRGA 4Y5YA 3P9MA 3ULUL 5LCVL 3O2DL 3S9DB 1WWAX 1YECL 3RUGA 3IJHB 5FAAA 1DEEA 1NC2D 4JDTL 5EU5A 1HHHB 4JO4L 1TTGA 5FYKE 4LPYA 5T1KA 3RTQD 4CNIA 3C5ZB 2R2EB 2QKIB 4J1UB 1BZ9A 1KFAH 1I1AC 1LO0H 4W6YB 4G8GA 1UKQA 4YFLI 3GRWH 1MAKA 1NDGA 4XTRC 3SO3B 3GJFK 5C08D 1MCSA 2DQEL 1QLFB 2HFFA 2YEZA 4F2MA 1X6NA 3WKNA 3BZFB 3QDMD 1H0DA 4XPTH 3CIQA 5DLML 1VEMA 1TJGH 3U36A 1WZMA 1RZJL 3BH8B 1H8NA 1R3JA 2EXYC 2Y07H 5C0CD 3IKCB 4YNYA 3BW9A 2VERN 5MP6L 5ESVA 1JNNH 1QFWH 4JZJB 4D9RD 1UQSB 5KZCD 2WM0A 3WNPA 3X11B 1OPGH 2R2HB 3H42H 3MODL 2R9HD 4WI5A 5BQ7A 4X6FB 5GIRB 5IFJA 3FRUA 2AJXL 1JYVA 4JR9H 4YHNA 4U6HA 1ZANH 4GXUN 2XZQH 4PRHE 1Y6NR 5F7EH 3PIQA 2OTWA 1U8PB 5EOTA 3K0WA 4LIQE 1KCSL 2MQ0A 4YBQD 4N0CC 5TDOB 4LCWD 2IBGA 3TA3B 3WXVH 2ZG3A 1M71A 1OB1B 4PJHF 2FECI 2ED9A 2MFNA 5J1TC 5DRXA 3STBA 1U95A 3KHOA 2W60B 2NY1D 3O8XC 4I77H 5K9OB 5D7IB 3CFDA 1FRGL 1U8HB 4HIHB 3ARUA 3UAJC 4TSBH 3WIIL 3GMMB 3P4MA 4KWUA 5CGYC 4JDZB 1T7ZA 3V79C 3EOYG 4HJJL 1DDHA 3SJVA 5I1GL 4Y19E 4BH7B 3UJJL 3SO3C 3T0BA 1X5FA 2X1OA 1XZ0A 4Y19B 3GGWA 5F96H 3NZ8A 3TIEA 1WFOA 3OKEB 1INDL 3KLSA 4XMPH 3P4NB 1CGSL 1JPTH 4AQOA 3V6OC 2OM5A 5FFLA 3MYJB 4YIQB 2YPLA 3UO1H 1JYXA 1OAKH 4UDTA 1QRNE 5BVPL 2BJMH 4L8SA 2KL6A 1L9NA 1QHPA 4X9BA 2FJGB 1H15B 5DQJA 1IGYA 2BFVH 1MAJA 2C3VA 4H8WC 4PIRF 3O9WD 1XR8A 3B4NA 2OXGA 5C7XH 1XR9B 4WDIA 1AE6L 1FH5L 4J3SA 4OZHE 12E8H 4OZGA 1KPVB 3WIFB 1LE9A 4OZHB 2HTLD 3GSRB 3U4AA 2P7TA 1XCTB 5AD0B 1WFUA 1T0NA 3SGEH 4JZOA 4WW2C 4JZNA 1VFBA 2Z35A 5C09E 3A6CL 3O6FA 4YJZL 5AYQA 2FO1A 5C09B 1DSFL 2ADJA 3IDNA 1FCCA 2P8MB 4X7FC 2Z93B 1QFWM 1U8OA 1NBVL 2BMKB 1CT8B 5BRZB 4Q9CA 2H8PA 1VHPA 1DN0B 3PG2A 1CICB 4UNVA 5GS1C 4KK6D 4LHUB 2R0LH 4I0CC 2RFXA 1TZHA 4Z7WA 1I1YA 4ODVH 1BQLL 3UJTH 3MR9A 4K23L 1EFXB 4K7PL 4OCYL 1J1OL 4B50A 4M1GL 1HI6B 4JDVB 1YMMB 4IHOB 4NNXA 5GZOD 4MDIA 1UZ6E 1CL7H 4NN7C 5EU3A 4LFHD 2DDQL 4H26A 1NDMB 3V5HA 4JREB 4X9IA 1GCFA 4WU5B 3MQIA 5C0EA 2VSCA 4U3CA 4BH8A 3JV6B 1A6UL 3VFUA 1BPVA 3DV6B 2EE3A 4JFDD 4MB3A 3KLAB 5M95B 2ZP0T 3KJ6H 5DJDB 4UAOC 1FG2A 3K4ZA 4I9WD 3WCYA 5IMMB 3EYQC 1BQUA 5J4MA 4Y8AA 1J0HA 4Z9KB 5DWUH 3MLZH 2CLRA 4BK4A 1R5IB 3OJVC 2VDKL 3LEYL 4MHHG 1F3DH 1HCVA 3OKMA 5IM7B 3CFEB 2RB8A 3W82A 2WINA 4PJFA 4AIOA 1MFBH 2JELH 3TT3L 3L3JB 1TLKA 3MRNB 1MCNA 1MY5A 1N64L 3WFDL 1FVDB 5I1HL 1JHKL 3E6FA 1CICC 4DFHA 1M7XA 3TPKA 3ULVL 2DLTA 2YXFA 5EB9A 1NCUA 1K85A 1HHGA 3D39D 2DTML 4QXWA 3L7EA 1JJUA 3PWVB 4G6MH 2NTFB 4UQ2A 1A7RH 1NC4D 4N5UA 1ZA6A 5EZOL 5EFIA 2ZCKL 2DOCA 2ZG2A 5HJ3B 4H88L 1KN2H 1KENH 3LS4L 1N0XH 3GSQA 1WJ3A 2SEBB 5CP7B 1DBAL 1FNFA 2AV7A 1Q0XH 2PO6B 4X7SL 5EZJB 3ARYA 4UTBL 1JGDB 4JO1H 4U33A 3HAEA 5BXFA 3SCMD 1D6VH 4KQ4H 4UNUA 2DQJL 3E8UH 4MSWA 3DYMA 5JXEA 4WU7B 5L7XH 5SWZB 1QSEB 5I9QC 1Q1JH 3VXOB 4G7YL 1TENA 2FWOA 2APVA 5I75B 1HQ4B 1BQHB 3OAUL 4GRWF 5CS7A 4AT6B 4KJPD 3VD7A 2WBKA 1FIEA 5H35B 5DR5H 5B4MD 3ARVA 3L6FB 5GSVB 2P4AB 4NC0B 1JRHI 1QLEL 3RGVC 2APWA 1FNAA 3WL9A 1MFAL 4M5ZH 3ILQC 4XVJH 3BX7C 2Y5TA 3KHQA 4XC1H 3BZFA 1Z0MA 2IANB 5AYUL 1XGRB 2Z0BA 2ARJB 3WUZA 2VXUL 1SBSH 4CJ0A 4V1DD 3O45B 3IXAB 2QLVB 4EOWL 3U48A 4WI7A 1F3JB 4NM4L 1CDBA 5JO5B 1FE8L 1HH9B 4OBSA 4XNYH 4YHKH 3O4LA 4C83B 5ITBH 5IHLB 2IWGA 2DM2A 3FO0L 2HVJA 3UTTB 4QT5A 4LSDA 2C7UA 5JOEA 2ZPKL 4FN0A 1RUML 2Y9RT 2CO7B 2EDDA 2R2HA 3QWOB 4R7DA 3THMH 1AO7D 5GIRA 3WBDA 3V52L 1GC1C 2VDOL 2DL2A 1CG9B 4U1MA