1KT2B

Crystal structure of class ii mhc molecule iek bound to moth cytochrome c peptide
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
213
structure length
213
Chain Sequence
ADLIAYLKQATKGGGGSLVPRGSGGGGSRPWFLEYCKSECHFYNGTQRVRLLVRYFYNLEENLRFDSDVGEFRAVTELGRPDAENWNSQPEFLEQKRAEVDTVCRHNYEIFDNFLVPRRVEPTVTVYPTKTQPLEHHNLLVCSVSDFYPGNIEVRWFRNGKEEKTGIVSTGLVRNGDWTFQTLVMLETVPQSGEVYTCQVEHPSLTDPVTVEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class II histocompatibility antigen, E-D alpha chain
publication title Structural basis of cytochrome c presentation by IE(k).
pubmed doi rcsb
source organism Mus musculus
total genus 43
structure length 213
sequence length 213
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kt2B02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1kt2B01
3WNKA 5F21B 4Y8DC 3F8UB 2WAHA 3KLAA 4LSUH 3V0WH 4ZUUB 1I3UA 5C09A 3ULVC 3CH1A 5JOFB 2X4RB 4K8RC 5C0JB 3QRFM 1AHWC 2Z8SA 1QQDB 3KJ4B 5A3ID 5EUOA 4ZFGL 3IGAB 2EH8H 4JFPB 2EIZA 1NGYB 2VERN 3C5ZD 4YH6A 4RMQA 2D7NA 3FQWB 1ZHKB 3GBMH 3GSNH 5FO9A 4MLIA 4WGVB 4O9HL 4ETQA 5CZVL 3MRRB 4NNXA 1R3JB 2DWEB 3WE6A 1HSBA 2ZG2A 4R3SA 3DV6A 1JHKL 4KTEL 2D0HA 4LKCB 1ORQB 3AM8C 3ZDXE 3QJHA 1VFBA 1AD0A 5GSRB 3ZDXF 4NKMA 1JYVA 1TVDA 4N5UA 1K3IA 3KVQA 4RGOL 3SKOA 4O51B 1C5DB 3EYUH 1OTUD 1GSMA 1ZOXA 4OZGB 4G6KL 2DB8A 4PJ8A 3OL2A 3QCVH 3FN0H 5IFJB 1CGWA 3ILPB 4XCEA 2CKBL 2D2OA 1KENH 4JR9H 3STLA 2LU7A 2GTZB 3K7UA 1F3RB 1YYMH 5B8CC 4IIQC 4LBEA 3MV9B 4K3EH 2IADA 2DWDA 3P9MA 4ODVL 5DQ9A 1OWRM 2X7LB 3OB0K 4HZLA 2CKBB 4AH2A 2CPCA 1A6AA 5AD0A 3KJ6L 3FZUD 4UUJA 5HJ3A 6FABL 1NMCC 2LVEA 1TZIB 4ZPVA 3HZVB 2FGWL 2BNQA 4HJJL 2EXYD 5I17A 2IFFL 3PABA 2CUMA 4OCSL 5DGRA 1J8HD 1N2RB 2HLAA 4OM0H 4G8FB 1NGWB 3QHTC 2V2XB 5T5FH 4R0LB 1N6QL 2YPLA 4OQTL 1C5CH 2J6EA 3U7YL 4YHPB 4L3EB 3RZCA 2C3XA 2Y6SD 4DKEH 2BVPA 1XGYL 1ZAGA 3D18B 3SBWA 3CZJA 2F74B 3ZLQC 1OCWL 3HE7C 1FZOB 1RUPH 3VXUE 2IANA 3X13A 5FO8A 1MHHA 2DL2A 1JGUL 3BGAA 4OI7A 3I50H 3SDCA 1N0LA 3E8UL 4NKOA 3BKMH 2CDFB 3FMGH 3QUZA 3KDMA 4M6MH 1F2XK 4HT1L 4DN3H 3DVNB 4NHCH 1MY7A 3ARGD 2QBWA 3GB7B 4AK1A 5AZ2H 4YDLC 3HB3C 1G9ML 3FT4A 1HWHB 4AMKL 1CE6B 1SMAA 4L4TE 1RIHL 4HMEA 5I75B 3DV4A 5IW6B 4WHCA 1I7TA 2E7HA 1T6VN 5GGVL 5E8DH 2ITDA 2EDKA 5KANG 2E6PA 4W81A 1OQOA 4WTXA 4OCXL 4R7NA 4DW2L 3LKOA 5DD5H 1KN2L 2ZSWA 3QYCA 1IAOA 2CXKA 1PD6A 2Y1VA 2BY2A 3WUWB 3IJHB 5IW3A 5D7IA 2VLME 4M5YH 3PWJA 4ERSH 2A77L 4KK5C 4Z7UE 3VFNB 3MLUH 3L5WA 1QZ1A 5DYOB 4CDGC 4Z7UF 3BKJH 4HGKC 3WKNA 2XWTA 1DDHA 4H0HB 3LN5A 3S35X 5ESAB 1RZJC 3MOQA 5C7XL 3D25A 3MRMB 5E2TH 3HPJB 1JPTH 3BD3A 2GJ6B 1L7TH 1YN7B 2V2WB 2C1PA 3L6FB 4H1LA 4G7YL 4AM0A 2IH3B 5F9AC 5CD5D 4J3TA 1LD9B 3HLAA 2NXYB 3ZKXB 4OLWL 3GFUA 2UUDH 1YMMD 2QADC 2VC2H 3BPOB 4LU5L 4AIZA 2CR3A 4B0MM 4R7DB 5I66B 3PV6B 3QUYA 4LSTL 5F7NC 1EUTA 3ZTNH 3MRIB 5IVOA 2KDGA 1RZ8A 3MOBH 3TH2T 4XPBL 3OJDA 1PG7H 2Q7YB 5GGUB 1I8KA 4F9PA 4P2QA 4JFZH 1NCDH 4FQJH 3ZKMD 1AKJA 4F7TB 3CJJA 2E9JA 5JHLL 5JA9A 3HFMH 2BDNH 4LVNB 1RZGA 3WO3B 1T20A 1DQML 5CILL 4F2MA 4U1MB 5LQBH 2G5BB 2OL3A 3BH9A 3L3HA 5GISL 3ARPA 2X42A 4Q6IB 1DBML 2RFXB 3RVTC 3MRHA 3NCFB 5FYLL 4NRZA 4TTDD 5D1ZD 1DBJH 4X7DC 4NN7B 2W9DL 4J8RB 2KUTA 5FGCE 4DVBA 3Q3GA 1LEGA 5JW5A 4OGZA 1PX3A 2BNUB 3QXAA 1XGQA 1I1AD 4IEFB 3MNWA 3O0RL 3RU8H 3VXUD 2MQ3A 3AXLA 4UV7H 2P24A 5CBEB 3BT2L 3ZKND 1EJ6A 3DJ9A 1IBGH 5C0FA 2H3NA 5F7DB 1N4XL 5HI3D 5GS1A 1DTUA 1AR1D 1NUDA 1CL7I 2A74A 3BIAX 4E0RB 4NYLB 3TBSB 2ORBH 2HKFH 3DGCR 5E5UB 3CX5K 4PJDF 4U3CA 3FQRB 2VE6A 5DQDH 3PDGA 3NCMA 1HI6A 5K9JL 3SGEH 5CGTA 1S9WA 4L4TD 2MNUA 2A6KA 1QSEE 1UQSB 3A6BL 4JQIH 1NLBL 4ONGH 3IDMB 4FTVE 5E8NA 1SMOA 2UYLB 3PWLA 1C1EH 3C5ZB 5L9DL 4X98B 3LD8B 5GS2H 5DJ6A 1II4E 1FC1A 3KAAA 4QT5A 2C4FT 4PP2B 1JGVL 2DBLH 5DQJA 1MCWM 2EDQA 4LLDA 2HFGL 2BMKB 3GSXA 3VXMD 3BIBX 4U6VL 2VLMD 1FYTE 3ARBA 3BPLC 2RGSA 1VENA 4ZTPH 1F42A 4GSDL 5D7LA 5DJDA 1T5WB 2VR9A 3JV6A 5B21A 2PTVA 1TCRA 4OUOA 4GRLD 2FNBA 4ZOBA 4QKXB 3W0WE 4OCWH 4PJ9C 4BZ2L 1BVLA 1BD2E 1ZHNB 5HDBE 2GYSA 3MNZA 3MGTB 2FATH 4K7PH 5GRXG 1FNSH 3OKDA 2PR4L 5HDBF 3EOTH 1YEDA 4OFDA 1HINH 1AHWA 1JTTA 4YBHA 1KOAA 3L95A 1HILA 3ZT5A 1UB6A 4QEGA 4OIIH 1ACYL 4FQLH 5HDLA 3EYOA 2CIKA 4Z7OE 4E5XA 3C8DA 3V5KA 3B4NA 4KAQH 4XGZB 4B7LA 4Y0GA 4R0LC 3FN9A 4M43L 3U82B 1LDSA 2VIRB 3NAAH 2LV4A 5L6YL 1HE7A 1KUMA 4X9IA 5C0ND 2GY5A 3RX7A 3RL2B 2V7NA 1WCQA 1FL6A 1ZEAH 4F3FA 4OF3A 1V7NL 3BE1L 4ODTH 1KLFA 5CP3H 4OLUL 4KJPD 3EJZD 5IBUB 5FOBB 2HJFB 5MENA 4JLRB 5FYKE 4DCQB 3HC4H 5HDQH 5A1AA 3MZTA 5DD3L 1T04A 1BOGB 1PLGL 2CK2A 5T1LA 4BSVA 1WFNA 4NRYB 3PGFH 5C92A 1QRNA 3P73B 4IIQA 1YEIH 2FJHB 2B4CC 3SE8L 4HULB 1KIRB 2ARJA 1ZVYA 3PL6D 7FABL 4ODSL 3F58H 2R4RL 3RWJA 5GJSH 4NSKB 5ETUA 2DLEA 4UDTA 4FA8A 5GHWL 2Q6WA 4IRJD 3OMZA 5FUZH 2VZUA 4KV5E 3ARGB 1P6FA 1GC1H 1WZLA 3HUJE 4FXGB 3NGBC 4E41A 2BVQB 3LKNA 4O00A 4GG8A 4U1NA 3HUJF 4ZUTA 3SPVA 1QSED 2LABA 1YNTA 1D5ZB 2FIKB 4FTVD 3MV11 2G60L 5KJRH 1J0KA 4P46A 4DUXA 4OKVA 3QAZB 1SJXA 4MNGE 4FNLH 1U95A 3DBXB 4MVBD 1VFOA 4DVRH 3U7WH 3C6SA 4UIMA 4NQCA 1JNNL 1CGUA 5IVXE 1FHGA 1X5IA 1H0DA 1FYTD 4D8PA 3SN6N 1SBSH 4POZD 4ZNCD 3HE7A 4BFBD 5IVZA 4Y8AA 4PJ7A 1HH9B 4K7PY 2PYFB 4AL8L 1K4DA 5JPNB 1OPGH 2LAGB 3KYNA 3CZFB 3W0WD 5INCA 3RWHA 1BD2D 1OGTA 4MB5A 3V4PH 4HEME 3QA3A 5F7UA 2C3VA 2XA8L 1JJUA 1H15B 2FX7H 3MCLH 4LVNC 4EIZC 3LQAH 1YMMB 4H25A 4NNYB 5HBBA 5EA0L 4QTHA 4M61A 1OOAA 5CJBA 1BLNB 4NBXB 1FPTH 5C6PB 4YO0B 2X4NA 4M6NL 1D5BA 1WLHA 3VG9C 2YC1A 1A3RL 1DBAH 5IB4B 5IHZB 1ND0A 1H3WM 2JB5L 1AGBA 2JELL 3VRIA 2NY2D 1VKXA 4OSUL 4JO2H 4FABH 4N0YH 1NAKL 2A6DB 2KQMA 3TPUA 4RGNE 3QNXA 3BP4B 4M62H 3W11D 4ZSOE 4M7ZB 2DYPB 4FQ2H 5IGXL 3N9GH 5JHDE 4K2UH 5EO1B 2GCYB 2QSVA 1M05A 4U7MA 3TEUA 4HHAA 1NANH 1PZ5B 1U2CA 4FMKA 4QXTA 5FYKD 5D1ZB 2O5YL 1R3IH 3CVHH 1DLFL 1JF5A 3O45A 3VI3F 4QNPE 4PJIA 3OSKA 4MA1C 3KYOA 3TH4T 1I1AB 1U3YA 3QXDB 2AJYH 3JWDH 2NY7L 5JMOC 1WBXA 4LHJB 3VXUB 3A6CH 4EBQL 1U2HA 2V2TB 3UTQA 1SQ2N 5C0RL 3C5ZC 1U8QB 4CJ0A 3KPOA 3H42L 4HIHB 3THML 1JMXA 3LD8C 2VXSL 4R26H 2C3HA 1ZLVK 1S7SB 3SGDI 1J1PL 2BY3A 5C0BA 1CFSA 3UAJD 5JW4Q 2Q86A 5TQ2L 3MRFB 1JE6A 1NCBH 1U8MA 2AS5M 5DMGD 2DQDH 1JF6A 2Y36H 3NACH 4YDVB 3RWDB 5KS9A 1DFBH 1X5YA 1AGFA 1NEZA 2XWJA 4ONOA 4P2RB 1FGNL 4NO5B 4GMSH 1U8HB 2VKWA 4LGSB 3RVVD 4YDKH 1FNGB 2G5RA 4PJCE 4ZUUA 3HZMB 4ZD3L 4TRPL 1J1XL 4DKAA 4X6CF 4GXUM 4PJCF 3WS3B 1UYWH 2YD5A 2X4RA 4R6UA 5C0JA 3NPSB 4J23A 3DRQA 3VXMB 1G6RH 3VMNA 3P9WB 3L3JB 5D96B 4MCZB 3RFZC 4M7LL 3VGBA 4JFPA 3OKKB 3RWIA 3BW9B 5DZNA 1SY6L 1ROWA 4UOW1 1JNLL 1ZHKA 3PHSA 5KZCB 1CFQA 2JB6B 4GRLB 5HDOA 5F70A 3MRRA 1R3JA 3HC0B 5BXFA 5ID0B 1B6UA 3UJTH 4Z7VE 5I76B 4HGWA 5IJKA 5IMLB 4L3CB 1EO8L 2P45B 4LKCA 1ORQA 4U3HA 4JRYE 3VFVA 3F6LA 2VDOL 2EE3A 1J88A 5GSRA 3ULUH 1DQQB 1T2QL 4K3DL 4KRPC 4N1EA 4O51A 3VFOB 4OZGA 4YXHL 5FB8B 2NLJB 4HQQL 4RFNB 5EOTA 2H8PB 5L2KE 2MTPA 2Y72A 2AI0H 1ZWIB 3ILPA 4RGND 2GTZA 4JRXA 1ITBB 1A1OA 3MV9A 5JHDD 1BGXH 3BWAB 2OYPA 3O9WC 1F3JB 4JDVA 4RMSA 2X7LA 4KKBD 4OZFB 3G08B 4YPGB 1W0WB 2V5RA 2CKBA 4U1SB 2ATPA 3GMQB 5DMYA 5HYJA 3QEUB 1PG7X 1JTPA 1TZIA 2XG4A 5CEXB 4PIRF 1EJOL 4DTGL 1K4CA 4X6DB 2F8OA 15C8H 3O11B 2ICWI 5IKCB 4LARL 5INDB 1KSRA 2EC9T 4YWGH 3PL6B 5J3HD 1RURH 1DL7H 1EEZB 4UB0H 5A2FA 3L1OL 3QAZC 4G8FA 2ID5A 4R0LA 5J06A 4OD1L 3S35L 4XP1L 3NCEB 4IRJB 4D9LL 4YHPA 1QBLH 3QUKA 2GK0B 3VWJC 5SWQB 1UT9A 3VFGH 3D18A 1JWUB 2X5PA 4XVTH 1FZOA 3ZZ1A 1QSEB 5CINL 4GRWB 1HIMH 3VWKD 3UDWC 3VJ6B 4Z0XB 1F97A 2CDFA 3N1FC 1F6FB 4U6HA 4MCYB 3DVNA 4HD9A 1FDLH 3HMWL 43CAB 2UZXB 3GB7A 1F13A 3VG0L 5CD5C 1RK0B 4MHHG 1AY1L 1CE6A 4G8IB 5IW6A 1AQDA 1DQDL 2WUCL 3N06B 4PY8I 4U2ZA 5C07E 4H26B 4XNXL 2ZUYA 3D9AH 1WSST 5FECA 3MXVL 3W0WB 2AEIT 4PLJD 1J10A 2OZ4A 3LN4B 1T89C 3IVKA 2FX8H 3WUWA 3ZKMC 3IJHA 5F96L 3SKMA 4JRYD 1NUNB 3HKFA 3K2UH 4S2SB 3WBDA 3WN5C 1IM9D 4H8WC 4ODHH 5DYOA 4Y1AB 1RUKH 5F1SA 3MGOB 3TWCL 3UX9B 2W9EH 5L2KD 2IBZX 5DUML 2FHFA 3PP3K 3PWNB 4MJ5B 3MRMA 3HPJA 4KKAC 5FYKL 3BUYB 2VLRE 4NC1E 4K7PX 4IRSD 1YN7A 3AGVA 3L6FA 5B3NA 3B6SB 1T1ZB 5SWZA 2IH3A 1QFHA 1N6UA 3R06B 1LD9A 1EFXB 5TDOB 1D6VH 1XH3B 3NMEA 1HHHB 1AXTL 4KUZH 5I66A 3LEYH 2W91A 3NA9L 3QIBD 4QXUL 3MRIA 4O2CB 4NZRL 2C26A 3S5LG 5EU5B 1MJ8H 1DP0A 1RZFL 1WZ1H 1AR1C 4C83B 1FSKB 1TJGL 4EOWL 1Z0MA 4IJ3C 1DEDA 2E27L 3TM6A 1QBBA 4R4FH 2YN3A 3ARRA 1MLCB 1GHFL 2P44B 4UILL 5LVEA 5JW3L 4WNQB 3GI9L 4XP5H 2BSTA 2G5BA 4ZOCA 4OZ4B 2ADFL 3DECA 1S3KL 3VXPB 3JXAA 1KELH 4L1HA 2Y5EA 2WMPA 4G43B 4MB4A 5TQ0H 4CVXB 2DRUA 4J8RA 3LCYA 1IRAY 2VKXA 2Z9TA 2BNUA 1DQLL 3MLVH 3ZDYE 4WI3A 3GEWB 1J5OH 3H3KA 3MYZA 5A43C 4KMTL 1FV1B 4YFEA 2YD1A 2XQBH 2Z0BA 5CJOH 3ZO0A 4MNGB 4V1DE 4NYLA 5KVEH 4XVSH 3I3EA 3QHFH 4I4WB 1WFUA 4P57B 1MPAH 3RI5F 1MI5E 5IVXB 4I3GA 2DKUA 2CKNA 4HFUH 3OF6D 1UQSA 1OAZL 1I3GH 2IBGA 3IDMA 2UYLA 3M8OH 3C5ZA 4K9EL 5C07D 1PFCA 1X5ZA 1TENA 2ERJC 1KYOJ 4TSAL 5K9KB 4NQDE 5ECJE 3QWQB 2XTJE 3SOBL 3TT1L 2BMKA 4FQPA 5EZLA 3FONB 1XF1A 3ES6B 4D2NA 4U1IB 5GGSY 1U6AH 2EDNA 1UH2A 1XIWD 2ESVB 1QLFB 1T5WA 1GPOH 1OP5K 3BPCB 5DDHB 2LU4A 4ELKA 4ZPTB 4I9WE 4Z7NE 1WBZB 1X4ZA 4DUVA 1ZHNA 3D0VB 3S97C 2VLRD 1I1YB 5JORB 2BERA 4RGNB 1XF4B 1EGJH 1BEYL 1MCRA 4QRPE 1A47A 2E9BA 1GRWA 4ZSOB 2DJ4A 5JHDB 1SEQH 4IMKC 1MCOH 2R4SH 3VRJB 4TPRH 4BH7B 1RZKH 2YHGA 3RHWF 4HX1B 4GKOA 2MPAH 3V4VL 5J12C 4WEMB 4XGZA 1I3RB 2QHLA 3TN0C 4IRJC 2VIRA 3T0EC 4LSUL 2HP4A 2GJZB 4WFEE 5DVKA 3LS4H 4WI6A 3RL2A 1S7RB 1WZKA 2MQ0A 5KSAD 4GAYA 4N0CD 3UROR 1Q72H 5FOBA 1J8HA 2HJFA 3NCYS 4I3SL 4JLRA 4MXQC 1TZGH 4Z95L 5HGAB 3RWGB 2BOBB 3IU3B 1B0WA 3MODH 3FT2B 4I2XE 2L4OA 3FFDB 1S5IH 1HCVA 4O5LL 4R97C 4POZC 3VWKB 3VFWA 3P77B 3BO8B 1U0QA 3O2VL 5GS2D 4WW2F 1UACH 3I3DA 3EYQD 3D6GA 2OI9C 4F7CB 4V1DD 4LLUB 3N0PB 4NSKA 4NQEE 5T1KD 4JFYB 3B5HA 2HFFB 2NXZC 3WJLA 4KTYA 5IBTL 3ARGA 2P8MB 1MI5D 2NTFB 3QCVL 4FXGA 1TVBA 4Z7QE 3FN0L 1MWAL 5J1AB 4Q9RH 3L9RB 4U49A 4M8QB 1MAKA 3UTTE 4JR9L 1NBYB 1CCZA 1D5ZA 3TYGH 2FIKA 3TA3D 2OLDA 4Y19D 2ZUUA 1GAFH 5H35B 1YYML 4K3JH 3OGCB 2VZSA 4HPOL 4NQDD 3DBXA 4Z7VB 2G9HB 1MWAB 2XTJD 1A64A 1MCSA 5F97E 1CIDA 2NY2C 2Y4SA 5ICXA 2H26A 4HG4J 2JTDA 1U3ZA 3MLRH 4KJQD 3WJJC 1IM9B 1T6WA 1HH9A 1CICD 1P6AB 3DYOA 2PYFA 3BQUC 5JPNA 2V5YA 4I9WD 3CZFA 1Z5LB 4U1KA 5L2KB 4C56E 4KPHL 1FSKC 4OCYH 4JY6A 1RU9H 2OSLB 3G6AB 4NHUA 1D5IH 4IRSB 2RQ8A 3MRPB 1T4KB 4YFLI 4UNVA 3UJJL 4RFOH 4HKXB 4QRPD 3INUH 2GQHA 4DKEL 1I7UA 2D9QB 4H20H 4Z76B 4J3OC 1BLNA 2NYYD 1H5BC 1YN6B 4GRMB 4YO0A 3LKSA 3UTPE 3QIBB 1PY9A 5IB4A 3OZ9L 2YD4A 1O5DT 1AIFB 1WISA 3ESVF 3UAJC 3E3QE 1T89A 3ARUA 4WFED 2X41A 1MHEA 2EO1A 2A6DA 5HVHC 4M1DH 1J11A 4UAOC 1MVUB 3TBVB 2AGJH 5A16B 3WN5A 4DAGL 5AZ2L 5IVNA 5EO1A 4NQUA 1JPFB 2FH8A 5CWSB 4FQIH 3L7FA 4MGXA 2V9RA 5BVPL 1SVCP 5E70A 1KCUL 3L5XH 3B9KC 1DCLA 5D1ZA 1TLKA 1J86A 1H3TA 4B50A 1D3CA 5E8DL 4ZFFA 4YUEL 4LKXB 2ICEB 4ELME 3NFSL 1HNGA 1I9RH 1OP3K 1I1AA 3QXDA 4JGJA 2EC9U 1RPQA 1XMWA 4CW1B 5KTEH 3UJIH 2W38A 3VXUA 1N7MH 3IDIB 2V2TA 3RVWD 4M5YL 4ERSL 1U8QA 1MY5A 4HIHA 2X4SA 3GMRB 4NQED 1S7SA 3G5ZA 5DEFA 2OX5A 3P4OA 1RHHB 3MRFA 4OLEA 4JJHA 5I16B 3CXDL 2A73B 4QRTA 3GJFB 1FVEB 3GRWH 5D72L 5L0QB 3ZTJG 4YDVA 2HMIC 3C09B 5FCUH 4L4TA 4IDJH 3UTTD 3FFCE 1L7TL 4JFFE 4YHOL 4NO5A 1JMZA 3CLEH 1U8HA 3LHPH 5C07B 2YZ1A 1R5IB 3MCG1 2VC2L 3SE4A 3GSUA 1TNMA 3TBWB 2QSCH 4MA7H 3QUXD 1GGCH 3WS3A 3ARTA 1PG7L 3L5IA 5T3XH 4JO4H 2FD6L 2ZWLT 3QEGH 4FG6D 1HQ4A 3L3JA 3MJ7B 2OJEB 4MAYC 4Z7UA 3MQIA 4FQJL 5BZWB 3OKKA 1XIWB 4Z5RB 1KT2B 5J6GB 4U1GB 3ULUF 3V6OE 2BDNL 4P3CH 2JB6A 2VITB 4KKBC 4GRLA 4ONHB 5ID0A 4FHBD 4C56D 1MFAH 5I76A 4PJFB 3T4YB 4PD4K 2XRAH 5IMLA 5GGQL 3SDXF 2NTSP 4YR6B 1Z9MA 3LQZA 4PBXA 4L3CA 2B2XL 5ESVB 5GQBA 5C2BH 5JLZA 1IAKB 2XN9E 2OTWA 1MRCH 2XZCH 3CXHJ 5SX5K 3ZKSD 1XFPA 5D8JH 4YQXH 5EORL 2IQAB 3UTPD 5AYQA 3VFOA 5DR5L 3RU8L 2P47B 4HKZB 5FB8A 4UV7L 3A6OA 2WW8A 2NLJA 5KG9B 3CFEB 2H8PA 1UM5L 3STZB 2J4WH 1ZWIA 4X4ME 2X1WL 4LPVA 4MDJB 1JUFB 5D7SH 2I60H 4N8CH 2A83B 1PY4A 3D0LA 4F58H 4UIKH 1G7JB 3QZWG 5BV7L 1NBZB 5KSAB 3BWAA 5FK9B 5KOMC 3TBTB 4JB9L 1F3JA 5EH1A 3VWKC 5EPMA 5IB2B 3G08A 3AS2A 4KQ3H 4JQIL 1KB9K 4ONGL 1ZS8B 1YC7A 5F9WB 5F3HB 2X4UB 4Q97A 4NQSB 2JIXB 4LASH 5BV7B 3GM8A 3IRPX 4U1HB 1E0OB 4RZCA 4XI5D 4G80A 1QFWL 1L9MA 4U0RC 4JDTH 4I3RL 4IMKA 1FE8H 3PXJA 3PL6A 3KGRA 3RNQA 4ZTPL 2V17L 4F8QA 5EZIH 1Q0XH 1UJ3C 4V1DB 5TF1H 4F80A 5JPMA 1GGBH 5T1KB 3P30H 1YEJH 5GGTA 4IRJA 4JM2F 3U36B 2GK0A 5SWQA 1QKZL 1MI5B 3CX2A 3R1GL 1A0QH 1LQSR 2A6IB 2X9XA 1P7HL 1FNSL 4N0FB 1DUZB 5GPRA 2F9BT 3FFCD 1OB1A 4JFFD 1QSEA 4PJEE 5IQ9B 1WK0A 2PF6A 4XPHH 4FTVA 1CFBA 3G6JB 1KFAH 4Y19B 3TA3B 3BP6B 5BOZG 1MQ8A 4Z0XA 3UMTA 1P4IL 2FLRT 3NTCH 1OTTD 1YYLL 4NQDB 3RKDD 2O93L 4D9QE 2XTJB 3BH8B 4MCYA 1LO0L 3OKOB 4BFGA 4OAWA 5A2JH 2A0LD 1A3LL 1FYTA 4HBQA 4G8IA 2H2SD 1CICB 2IG2H 2ZG3A 2J5LC 3KHQA 4H26A 3V4UH 3QIBC 3LRSB 4OF6A 5ESQA 1U92B 1FCCA 3W0WA 2PXYD 3DYMA 3BSZL 1BD2A 3CFIC 3LKQA 5IEHB 4JFDE 1EA9C 3MACH 3Q6GH 4OLYH 3EYSH 2XN9D 1G7HA 3RBSA 8FABA 2Z31B 4QRPB 4G9FE 4S2SA 4XXDB 1ZA3B 3MJ9H 1ZE3C 3G9VA 1U41A 1AP2B 1QFOA 3SCMD 3WXVH 1JWMB 3PGFL 3ABZA 4GG6F 1OL0A 1YEIL 3MGOA 2P8PA 4F7EB 3PWNA 4MJ5A 3CLFH 1T21B 4NO3A 2ZJSH 3BUYA 5CEYB 1OHQA 4JKPL 3B6SA 1T1ZA 1UWGL 5D5MF 4R4ND 3R06A 1K9TA 3RWEB 1OF2B 1XH3A 2ZCLL 4WU5A 1HHHA 1QBML 2X05A 4CDHA 1FIGH 3KHOA 2KBGA 2WIMA 4MD4A 2C3WA 3MFFA 1H3VA 4QHNA 4WHTB 2W1NA 1NSNH 2KQNA 3AMKA 5EU5A 5I19L 1BF8A 1P9MC 2DICA 4OLVL 5I1GH 2A6JB 1DANT 1AC0A 5HYSB 1Z6JT 4I2XB 3OV6A 1IKNC 1MLCA 4YXKH 5L0QC 1ZLSH 5GZNC 5D9SB 3VFRB 1LGVA 4WNQA 3ZE0F 1WV7T 5DRZB 2MJWA 3H9SE 3RWCB 3G5VB 3VXPA 2HKHL 4OLZL 4U05A 3GO1H 4NQEB 3RVUD 4G43A 4RIRA 3SKJL 2ED9A 7CGTA 4P4RB 2HT4D 5J7CC 1CDBA 3ZHDA 3HUJA 4YXLL 2R23B 3U1SH 1KJ3H 2UVFA 5I1LA 3BD5A 2GT9A 3T3MF 4EIGB 3UTTB 3OR7B 3RDTD 4TSCH 2WWKT 1FV1A 3EOAB 4Q2ZA 4RWHA 2H32H 3MCLL 4QLRA 4FP8L 1WJ3A 1H8NA 3LQAL 5E2WH 4JEGB 4MNGA 3MLSH 3S37L 1ZLWK 5DJZB 4D9QD 5LAXB 4I4WA 3QUXB 4P57A 4AENA 2EKSB 4BSJA 5ADOL 4NC1C 3TLRA 1C7SA 4Z0BH 3O6MH 4WY7H 5GSVB 4JO2L 5IIEA 3PNWB 4NPYA 5MEPB 3BN9C 3NZHL 2GI7A 1OSPH 3UPRB 4K2UL 3K46A 3LEVL 3QCUH 5FUOL 4C56B 5I74B 2VR5A 4JHWH 4MAUH 4MSWA 2FEEL 4JFDD 3VFPB 4EUPG 2CDEB 5A2LH 1EAJA 5ITBL 3TIEB 5F6HJ 2GUOB 1L0XA 4PJAE 3ES6A 4N5EC 4U1IA 2AQ3A 1R3IL 2UY7A 3CVHL 1H8SA 3G5XB 4G9FD 8CGTA 1ZLUK 4PRHB 2MCPH 1QLFA 1A6WL 2AJYL 2VDPL 3D1MC 3JWDL 3BZDA 3NFNB 1X4YA 1AC6A 4ZPTA 4AQ1B 1HHKB 3D0VA 4X9BA 1GGTA 3UZVB 5E24E 1S9XA 5DHVH 3B2UD 3VFMA 1F02I 3K8MA 1MAJA 5B3JE 3DO7B 4OTXH 2FJGB 5FO7A 1I1YA 3LS5H 3EHBC 1XF4A 4ZSOA 2HLFD 5KVFH 4HF5L 5JHDA 4RRPA 1KV3A 4GOSA 3RQ3A 5JDSB 4GMSL 4EI6B 3T2QA 1LMKA 3WCYA 4ELMB 1GH7A 2GJZA 5KN5A 4LF3B 1B2WH 1S7RA 4P48A 4R90H 3OB0H 1G6RL 3H9SD 1E6OL 2AJZB 3BI9X 4UNTA 3C5SB 3H6JA 3T1WA 5HGAA 3ECBB 1XZ0B 3ZE1F 1C12B 3RWGA 2BOBA 4X6EB 2V6HA 3RIAF 4XC1H 1E28B 4LDOB 5DC9B 2P7TA 3UJTL 1G6RB 1RHFA 3MUGB 5CGYD 4ZAKD 1YEEH 4IMLB 2D7PA 4L29B 1LO5A 4NBYB 2QQLH 2YBRB 3VWKA 3QXUA 3P77A 1A7NH 3BO8A 2R0LH 1RJLB 2W65B 4PJCA 4LLUA 1JBJA 4JFYA 1VA9A 4DKFL 2HFFA 3WKMH 3B9EA 4QXWA 4DK3A 2CQVA 5DC4B 2P8MA 5DA4A 1T2JA 2NTFA 4XB8A 4F33B 5E1HB 2AI0L 4Q9QH 5J1AA 3L3IB 3V2AR 4OGAD 3L9RA 4OZHB 1RZ7H 1NMAH 4NIKB 1P7QD 5FM8A 5HHPB 1NBYA 2EICA 4Y2DD 3GZKA 3IDUA 2NYYC 2P1YA 3OGCA 4KVNH 1UJ3A 4CU8A 2DDQL 1BGXL 2XY2A 1BAFH 2PXYB 5TPWH 4HS8H 4Z7VA 2EYRA 2G9HA 1MWAA 1S8DB 4PG2C 4MXVF 1A7BA 4KQ4H 3H0TA 2R8SH 3OJMB 1NFIA 5F7YC 1G9NL 3MLWH 4BM7A 3HR5B 2XN9B 4JRYA 1IAIH 2HTLD 1GYAA 1MFBH 5DJAA 4PUBL 1ZANH 1FC2D 1IM9A 4LCIL 3SCMB 5IWLA 1GVIA 1Y0LA 4XHJD 2VXUH 2WLZA 3SGKC 2BHZA 3IKCA 4WENB 2HFEB 1Z5LA 3ESUF 3AFLA 3PUCA 1MCLA 5L2KA 1RURL 3U0WH 4UINH 1DL7L 3GMLA 3QDGE 1NKOA 3MRDB 4IRSA 3ARXA 1GC1C 4WCYH 2EDXA 3MRPA 3O4OB 1T4KA 1WAAF 3CFDB 2WWKO 1NMBH 4BA8A 1OW0C 4CNIB 4Z76A 3AY4C 4KU1A 1YN6A 4GRMA 4JY5H 3QIBA 1EO7A 5FDWB 3V6FB 4GAFB 4CN1A 4XCYA 2X6MA 4Z7WE 1AIFA 1KCLA 4X8JA 4JG1H 4ENED 3ARDC 4X9FA 5I1KL 4YX2H 1A1MA 3NN8A 1CDIA 4PYGA 1J0ZA 1R6VA 1MVUA 4LOUC 1FDLL 4QWWC 2Z4QB 3CPLA 1BBDL 1T3FB 5AWNH 1PG7W 1KJMB 1HYSC 1NANI 5E08L 1JPFA 4LQFH 3CCHB 2DIAA 1E4KA 2R0WH 2YSSB 4PTUB 1JGDB 2ICEA 4JKWA 1EMTL 4OGYH 5SX4I 4XNUH 4DEPB 1CE1H 1DN2A 3NH7L 4LCCB 2YD8A 1B0RB 2OR7A 5MERA 4FG6C 2ZUSA 4CW1A 4PJEB 1RSFA 3WNLA 4FQXD 3RDTB 3IDIA 4PJBE 3K2UL 5E99H 3CNKA 3GMRA 3QIWD 3GSRA 4ODHL 1P9MA 5EC2A 1A5FH 4MQ7B 4YFDB 2OR9H 3S4SB 4DOHE 2A73A 2AXFB 2W9EL 3GJFA 1IKNA 3TVMD 1F4YH 1P5VA 1KCRH 1CLZH 4GH7B 3OF6A 1P2CB 5DTFA 2XTLA 1AO7B 4MX7B 5C07A 3V6ZB 5CEZH 4OM1H 1D6VL 4RDQG 3VW3L 2VXQL 3WIHL 1MQKH 4KUZL 5I71B 3TBWA 4OF8A 3ELAT 1R3HB 5DZLA 5TFSL 2AK1L 4HLZG 2KZ1B 1A8JH 1MJ8L 1UCBH 1WEJL 1WZ1L 3CX5J 4UT6H 4M6AA 5CCKL 3ZL4L 4WEUD 3SO5A 2OJEA 4G9FB 3JUYA 5IFAL 5BZWA 1XIWA 4Z5RA 1KT2A 4UT9L 4WEBL 5J6GA 3VXSB 4XC3L 3BFOA 1FRGH 1JI1A 3MRQB 2DS4A 2VITA 4I77L 4JREC 4ONHA 5C70A 2BC4B 1S7UA 1YJDH 1AJ7H 3UO1H 2NY5L 4FZ8L 3QDGD 3QCTH 2EIDA 4HWBL 2VLRA 4EDWH 2E6QA 3WHE1 4YR6A 5ESVA 4K94L 2BNRE 4NGHH 4XI5C 5L88H 5FYJU 4DGVH 3FB8B 2IQAA 5DSCB 4AJ0A 5DD0H 4HKZA 2Z8RA 4FFYL 3OXSB 1WUNT 4QTIL 2C7UB 1CFVH 5KG9A 3CFEA 3B8SA 3TC9A 5FM5O 1UG9A 3DYPA 1ZGLA 3KPLA 4WFFE 3K74B 1JUFA 4XVSL 2DQGH 3QHFL 2A83A 5ITFB 1KB5H 1CYGA 1G7JA 4PB9L 1S7XB 5D2LF 1NBZA 5KSAA 5FK9A 4S1RL 3H9SB 2YUWA 1XF3B 3TBTA 1VGEH 2ZUWA 4XPAL 1XEDA 5IB2A 1WITA 3VFTB 4ODBD 1A1NB 1ZS8A 3M8OL 1OTTC 4TVPL 3RKDC 5F3HA 1S7WB 1CFTB 4PY7B 3CDCA 2AQ1A 4NQSA 4Y4FD 1KC5H 1YC8A 4EN3C 4U1HA 4ODWA 1ONQB 1INDH 5AYUL 5F6IC 5EO0A 3G5YB 2FRGP 3ULUC 4IS6A 3MLTB 3BMVA 3IXAB 3DX7B 4D3CH 1ED3B 2H2SC 4RISL 1A21A 4HGMA 4V1DA 4XMKH 5T1KA 4HS6A 1IC1A 1A7QL 2XZQH 3U36A 1RIVL 5LG1A 1EPFA 3ARQA 1MI5A 2E6JA 5I8OH 2QTEA 2A6IA 4B53A 1LK3H 2CRIA 2H9GB 4G6MH 2APVA 1R5WB 1T5XB 4QRQB 5CIPH 5IQ9A 4JZNB 4UTAH 4P9MH 4Y2DB 3TA3A 4NM4L 3BP6A 3DROB 4KKLC 1SJEB 3KR3L 3LKPB 3T2OA 5CJ5A 5HD8D 4OI9A 5DHXB 1FFPB 1ZK9A 1AD9B 2DLFL 4TPRL 4NQDA 2DMBA 5DUPL 2GTWB 2M2DA 3IJYB 5CKGA 3CFBA 3TZVD 3BH8A 2MPAL 4XNZC 3HI1B 4P2YA 3OKOA 1KCSL 4I1NB 2WM0A 4PJAB 4R4NC 3F7RA 4YHYC 4IDLA 3LS4L 4J12A 3MBXH 5DFVD 1CICA 2BFVH 1HKFA 2DQUL 1F4XH 2E7LC 3R4DA 1MCPH 3LRSA 2IMNA 5GRJH 1OWWA 5BRZB 1BREA 4MNQE 3OBAA 3WFBL 1I4FB 1KJ2H 3IS0X 2GFBB 1T0PB 1KBGH 2D31B 2EDOA 3PQYE 4NZJA 2BNRD 1G7LB 1EUUA 1C7TA 4QRPA 3WSQH 1S9VB 4XXDA 1ZA3A 2X1OA 1AP2A 1X3DA 5CP3A 2IFGA 1JWMA 3W9DB 2CGRL 4XMLH 1YMHB 1CD9B 1IE5A 4L9LC 1C5BH 4HWEH 1WF5A 4JM2C 1S7TB 4PG2A 4PRIB 4J6RH 3KYMB 3G9AB 1X5HA 4PJXE 4YHMH 4WFFD 5CEYA 4S1SH 3FQTA 4LCCC 4NC0B 5L8LB 3RWEA 1X5JA 4C55A 2RAMA 4KZDL 2OQJB 4IHOA 3D3VB 3RDTC 3TJHC 1IEBA 4NT6B 3KPRE 3SDYL 3D39E 1FNLA 1CU4H 1VDGA 5BO1L 3TYGL 4RBPK 2ZG1A 3WO4B 1GAFL 5D71L 1A7RL 1KACB 3GMOB 5D6DA 4JPVL 3QDMB 2GJJA 5HYSA 2YRZA 4I2XA 5E0QA 3Q1SL 5D9SA 1OW0A 4FQXB 5DRZA 4JO3L 3G5VA 4QF1A 5KVDH 3MLRL 1FGVL 4CJ1A 3QIWB 4NQEA 5E9DE 2VDQH 4HCRH 5C9KA 4P4RA 1J05A 3ARDA 5K9OB 4NO2A 1CZ8L 5H2BB 2P8LA 3VE0B 1W0VB 1K8DB 3TVMB 2B7DT 1D5IL 1YDPB 3T0WA 3T1FA 4LP4A 3UTTA 3OR7A 3O2DH 5TE7L 3EOAA 3H9YA 4LVOC 3UBXB 4RFOL 3INUL 4NKIL 3MFGB 1OAQH 3CIQA 4H20L 5ALCH 5LAXA 1UKSA 3QUXA 4LAJH 3ARFD 3B2UC 1V3MA 4L8CB 1B88A 3K4DA 2PTUA 1X5AA 5E95B 1O0VA 1IVLA 3FO0H 3KLDA 1DEEB 5GSVA 3PNWA 3MV7B 5MEPA 4M1DL 2FO4B 4GW5B 1U8OB 3D2UD 5D7KE 3UPRA 2FB4H 4MNQD 3RVXD 4C56A 4LEXH 5K59E 3BP5A 4PGJA 4NWUH 3QDGB 3VFPA 2CDEA 3L5XL 2A9NL 5K59F 3PQYD 3TIEA 1Z9OA 3ZKQD 1CXLA 2FBJL 3B3IB 4ZFOL 1I9RL 3G5XA 4M1GH 5AAMA 2AABL 2BVYA 1N59B 3TGXA 2BHYA 1Q9OA 3NFNA 4XP9L 5KTEL 1N0XL 3WFEH 5ACLA 1N7ML 3WLWC 3RY6C 3QDJB 1HHKA 1F4WH 1A6ZB 4ZFOB 4EJ1C 3CVHA 4P3WA 4RGMC 4I0KA 3P9LB 4G6AD 5C08E 3QG7H 3F5WB 1CL7H 1VFAB 5CGYC 4EQ3A 4ZAKC 4DN4H 3P4MB 1BJ1H 3OPZL 1QR1A 4MS8D 1R0AL 1UB5B 3ZDZF 2YUZA 2NMSA 2B8OT 5JIHA 3R8QA 2EYTB 1CIUA 3D39D 4P4KD 4XBPB 1GOFA 4L9DA 3W2DL 1NC4D 5JDSA 5KSUB 1JPGA 3QPXL 2X89D 1ZT7B 5ADPH 3RUGB 4ELMA 2RJMA 4Y4FB 1YEHH 4MA7L 3REVA 1GZQB 1IGJB 4X80H 2ZCHH 1BFSA 2EEAA 5MP6H 3S96B 3BIKA 1H3PL 4PJBB 3QEGL 1O7VA 1CXEA 1UWXK 1MFEH 3I9GH 3EDFA 1HHGB 5E9DD 4MJ4A 1DBBH 3ECBA 1XZ0A 2H1PH 1C12A 4XPFH 4K23H 2Z8WC 2W0PA 2BRRL 3TO4C 4DOHB 3E1F1 3KYAA 1G6RA 3S9DB 1MFAL 4P59H 1KCVL 2XRAL 4IMLA 2HTLC 3BZ4B 4L29A 3FFCA 4JFFA 1W72L 3CFCH 3SKUD 4G8GE 1YQVL 1MRCL 1RZKC 3EO0B 1RJLA 4LLYB 4XHJC 3O8XD 2W65A 4NCC2 5H94B 4YQXL 3PHQB 5FF6B 4XNQB 3TZVB 5I30L 3EZJB 1AGEA 1W72B 1KCKA 4POUB 3L3IA 1Y18B 2FL5A 2J4WL 3LDBB 4P23B 4HIXL 5IB5B 5D7SL 3WFCL 1G7PB 1JRHL 4NN5C 3WNOA 4UIKL 3V6OA 2NY3B 1ETZB 3C60C 3QR2A 3SE3A 2PTTB 5D7KD 2ZNXA 1EERB 2CDGB 3ZTJH 1KPVB 1S8DA 4BFEA 3PE9A 1QHPA 1QVOA 4KGJA 1E4XL 1MFDH 4M4RA 3HR5A 1DVFC 2BNRB 2XN9A 3QUMH 3EOYG 4RA0C 4LASL 1T22B 5CP7B 4CMHB 3GK8H 3SCMA 4LCYB 1DR9A 2UWEE 5DK0B 5IT2L 5FUCE 4JDTL 1BIIA 4XMPH 2HFEA 5IJVB 3QH3B 4QRSB 4YNYA 4JAMB 4X4MA 1OAXL 1GGBL 3M17B 3OAUH 5C08D 4U4BA 2YRPA 3P30L 5F7WC 3CFDA 4CMMA 1FQ9C 5EC1B 2MCG1 1QP1A 3Q2CA 5E6YA 2B5IB 3PP3H 4XPHL 3HI5H 3V6FA 5FDWA 4WJ5B 1IGIH 3W82A 3BGFB 35C8L 2SEBB 3O6LL 5DS8B 4MMXC 1MNUH 4L8DB 4S10A 4BK5A 3QEQB 4JQVC 4PRBB 5D1QB 2F8XC 4WU7A 2WINA 5ERWB 3JSSA 4JVWA 2Z4QA 1T3FA 1M4KA 1KJMA 3ZHKA 1EHAA 4U3XA 1V7MH 3CCHA 1MUJB 5ELIA 3CFJB 4JM2A 4AEFA 3LAFA 1BWWA 3IJSB 3GGWB 2YSSA 1TFHA 4MQTB 4PTUA 1JGDA 5H37G 5I1IL 1I8IB 3NIFF 2AP2A 4LCCA 2I5YH 3QNYA 1SYVB 2R29L 4XVJH 4UDUA 3LEXB 2ZCKH 4ZO6A 4PJEA 3RDTA 2PNDA 3EYSL 2VUYA 3K0WA 1OLLA 4G8GD 2X4TB 4OFYD 4Z9KB 32C2B 5D7LE 4MJ6A 1F45A 3IB4A 3WUWG 3HPLB 4I0CC 3TT3H 3ARFB 3QEHA 3S4SA 5DJCA 3ULVE 5FAAA 4WTZA 4ZG1A 1T1YA 2V7HA 1B4JH 4LSVH 1NJ9A 3MBED 1Q9WA 1TVHB 1CFNA 5I9QC 5GS0L 3STBA 5F7EH 4OI8A 3ISWA 4MX7A 3V6ZA 4QHUB 5DVOA 3D69B 3T3PF 3TNMB 5JXED 3BYYA 3AU1B 4GQPH 1R3HA 5AZEH 4JFDA 2DQTH 3PQYB 4OB5L 1ITCA 5DK2B 4R2GD 3C8KB 1FNHA 3FL7A 4QOKE 4G9FA 3CU7A 4WTWA 2CIIB 1JI2A 5GRVL 4Q0XH 3U6RB 4ZOAA 4PRDB 4OZHF 5HHME 4W68A 3GO1L 3ILQD 5KANI 4PJXB 4ZYKB 3RGVB 1A7OL 3Q5TA 2WIIB 4Y4FC 1X4XA 3LIZH 3BISA 5K9QG 2YD6A 5HY9B 2FWOB 1OP5H 2VQ1B 2J8UE 1IGYB 3LOWA 5DT1H 3U1SL 4OFVA 4AG4H 1VPOH 5F1NB 4HS3B 5C6TH 3D39B 4P49A 4XBGA 1XGTB 3OXSA 4HWBA 4FQHB 1NC4B 2C7UA 4N90E 4TVSa 3QQ3A 1GOGA 2PYEE 3KLAB 4RAUA 5B38B 3O2WL 3GUTB 4ISVB 3MV8E 5C09B 1IEAA 2F5BH 3QPQD 1BVZA 3P2TA 4I0PC 2D4FA 1JNHB 4Y88A 1IILE 1CDHA 1LP9F 5EUOB 1CXHA 3H9SA 1MCJA 1XF3A 2FCBA 1BQLL 3O6ML 2Y23A 2EIZB 4JPWL 3VFTA 2K7QA 5HD8C 5E9DB 5E5MB 1OSPL 1S7WA 5DURD 3PP4H 1CFTA 4TQEL 4PY7A 4TSBL 3WE6B 2WUBH 5T33L 5DHYA 3LB6D 1PSKL 4EKXA 3B2VH 1JVKA 4JHWL 4MAUL 4R3SB 5CJQH 3DV6B 2BVOB 2KPNA 3MLXL 4ZAKA 4ZXBD 4BELD 3MRCB 1KG0B 3MCKA 5J0BA 2ILLA 3MLTA 1AD0B 3IXAA 5GZOD 1MHPL 5DFVC 1FVDA 5D7LD 1J0JA 5FYJE 5EBWB 3O8XB 3DVFA 4Y2OA 3ULVD 3I6LE 4PLOB 3CDFA 4JFXB 4XCEB 2WWMC 4F15B 2H9GA 3STLB 4KK6C 1P7QA 4QRQA 3A67H 5TH2B 3VRLF 4N1CA 4JZNA 1X5FA 1MEXL 2RCSH 1IGTB 3LS5L 4LBEB 3DROA 5JIPA 1SJEA 4PRAB 4HWUA 5DQ9B 3QDAA 1FFPA 1AD9A 5CHNB 2O5XH 4N9OB 2ENSA 2BJMH 5BQ7A 2GTWA 3IJYA 4P2CG 1N5YH 4LRIA 1GJIA 4AH2B 4DQOL 1A6AB 5AD0B 4UBDC 5HJ3B 4JPIB 4PJAA 1YNLH 4ZPVB 1EGJA 4QOKD 2Z8VC 1PQZA 3SQOH 5I17B 4ZS7H 3MUZ1 3ZSTA 1Z3GH 2MKWA 2D03H 3UTZB 4R90L 5HHMD 1TJIH 2W0KA 3UP1A 2HLAB 1I4FA 1JF1B 4HPYH 3H3PL 5LGHH 2GFBA 3NOIA 5C08B 4CVZA 2D31A 1F2QA 4DGIH 4N1HB 1G7LA 2EEDA 3RZCB 3U7AA 4XRCA 3RP1A 1CLOH 1KTLB 1S9VA 1J1OL 5IBUG 1DE4A 4GJTB 1GGIH 5E4EB 3P11L 2IANB 4EUPH 5FO8B 1MHHB 4H8WH 4J2XA 2QQLL 2YD7A 4N90D 1V8HA 2Y07H 5DWUL 1S7TA 2PYED 5J11B 1LO3H 5AG8A 5D1XD 1IQWH 4NKOB 4YHZL 3KYMA 3OXRB 4W4OC 3MV8D 4NJAL 5FHBL 5ICZA 5DLML 1SM3L 2OQJA 4HG4K 2VXTH 4OCRL 1MCIA 4NT6A 3DSNA 4XXCA 3VDBA 3DV4B 2JCCF 1I7TB 5CKAA 3OX8B 1RIUL 3QNZB 4AQOA 1RD6A 2DJSA 3F7QA 5E2VH 3GMOA 2AJSH 1LK2A 1EEQA 3LKOB 2WANA 3GI8H 4XWGH 2R2CA 3W9EB 3NFPB 4KQ4L 5EN2B 2R8SL 1V05A 4FQXA 3MLWL 3DMMD 1E27B 4G8GB 1IAIL 3O6FC 2CO6B 3LV3B 5FYJD 1MFBL 3L5WB 3L5HA 3HMXH 3WFDL 3QIWA 1OP3H 2XWTB 1FAIH 1DDHB 3TJEL 2J8HA 4NZTH 5K9OA 3D25B 1G0DA 3I6LD 4W6YB 5H2BA 4JQVA 3GJEA 2NZ9D 4G6JH 1W0VA 1K8DA 2J8OA 3VE0A 3TVMA 2X70A 4H1LB 3MBEB 3QRGH 4X6BB 3HLAB 1IT9H 2UZIL 4KK8C 4G7VL 3UBXA 4LHUD 3MRLB 1INEL 3VXQA 3QSKB 4XH2B 4LPYA 4JY5L 4HWZA 5BJTA 1QYGH 4POYA 5HYQA 4Y5VC 4YDIH 4L8CA 3BKYH 1I8KB 4QY8A 5ABDE 5IMOA 3X3FH 1UXWB 4R2GB 1Q1JL 2OCFD 4OT1L 5EZJA 2IEPA 5HPMA 1KEMH 5CLTA 4KK5D 4MS8C 5GRWA 4YX2L 4NDMB 2UWEB 3BMWA 2FO4A 1P4LA 1U8OA 1CGYA 3LMJL 4P4KC 3U9PH 4FZEH 2BX5A 4LK4A 1BP3B 4Z77A 3TNNA 3SDAC 4NOBA 3FB5A 4JN1L 4NRZB 3U0TB 3QDGA 1WAAA 5HHVH 2R0WL 3B5GA 4XAWL 1QPXA 3B3IA 1LEGB 4XPGH 3QXAB 2Y9RT 3QQ9C 4XNUL 3MNWB 1CE1L 3BN3B 2QADD 4HWNA 1IC4H 2XICA 1JZ3A 3MLYH 2W59A 1T66C 2F15A 1FFOB 5BVJB 2ARJQ 3C9NB 3N50A 4Z7WA 2QQKL 2XKUA 2R0ZH 4ZFOA 4AEHH 3P9LA 3F7VB 5SX5H 5T3ZD 3GIZL 3F5WA 1VFAA 4A6YL 3EGSB 1MJUH 2OR9L 2VO5A 3P4MA 1OSZB 1UB5A 2P4AB 3FTGB 5ENWA 2A6KB 4AEIH 1U58A 3L3DB 1EVTC 4XBPA 5E8NB 4HUMB 3PWLB 4GXVL 12E8H 2L7UA 3U30B 4QHLA 1CR9H 1BPVA 5KSUA 4U6YB 4PR5B 4Y5YC 1BECA 1ZT7A 4IRZL 4OM1L 5DURB 4A6YB 2JKXA 4M93B 1WGOA 1L6ZA 4LPWA 1JHLH 4Y4FA 3GRWA 4NQVB 5F7HA 2VUOA 1LO2H 2XA3A 1GZQA 2DM4A 4ZXBB 1JHTA 4F15C 4HMDA 2PETA 1UCBL 3ULVL 2P5EE 4UT6L 3S96A 2VDMH 1FNEB 4PJBA 4C57C 1JGLH 4PLNC 5LWYL 5D7LB 5DJDB 1GGYA 1HHGA 3JV6B 1KB9J 1TCRB 2NX5E 3LPFA 1WT5C 1BVLB 5MEQA 4R8WL 2Z93B 3DLQR 1Q38A 2FX9H 3OKDB 4KWUA 3KLHC 3K4AA 4KHTH 3BZ4A 4EDWL 2R56L 3V5HB 3VXTB 1XGRB 2XNAB 1HILB 3TP4A 4NGHL 3FO2B 1CGSH 3EO0A 3EYOB 2CIKB 4E5XB 3V5KB 5T1MB 2DM7A 4LSQH 3PHQA 5FF6A 3TCLB 4OGXH 3TZVA 3CC5B 3BHBB 1CFVL 1IGML 1W72A 5DVNA 2VDLH 3O3BB 3QWRD 1Y18A 3K8LA 2K9UA 4KK9D 4QOKB 1HH6A 2DMCA 2DQGL 1FL6B 4LNRB 4W6WB 4F3FB 2IALA 1ETZA 3MLZH 2QEJA 2PTTA 3S34H 1T03H 1G1CA 1A14H 3WNPA 2CDGA 5HHMB 1CG9B 1VGEL 5MENB 1N64L 1KPVA 2XYCA 5E7FA 3N85L 1A6VH 4MQXC 4PJ9D 3MV01 3FQXB 1IAII 3BX7C 5IBLC 2AV1A 2BNRA 1T04B 3CSPA 1MJ7H 1Q9KB 3ALWA 5T1LB 4H5SA 1HHIB 1KC5L 2J8UB 3AC0A 4JRWA 4OZFG 5B8CB 3KYKL 1INDL 4IIQB 4NFCA 5DK0A 2HWZH 4HLZH 1AE6H 4LPXA 5MI0C 5IOPA 4G5ZH 3L7EB 5D1XB 2DD8H 4JAMA 3MV8B 3OJ2C 1DN0B 5EO9B 3M17A 1OP9A 4PBVC 1NMCB 3RL1B 3WIFB 2Y06L 2VLJE 2NY4C 3MO1B 3LPGA 5I8OL 4B7IA 4OFKA 4GG8B 4U1NB 2I24N 2AEQH 3ROOB 3SKNB 1LK3L 1E6JH 3KNBB 1VSCA 5HGHB 2VYRE 5C3TA 4WJ5A 4OLXL 4LGRB 4OKVB 1MF2H 1QR4A 2SEBA 3QIUC 3VXOA 5FYJL 1RVFH 5EWIH 5FXCH 4CAGA 2ITCB 4L8DA 5I15H 1DLHA 4PRBA 5ERWA 3DIFB 1VEOA 2P5ED 4FQ1L 2EE2A 2AJUL 3HE7B 3BAEH 1MAMH 3GBNH 1AI1H 3LSOB 3GDBA 2VISB 2Q8BH 4X8XA 3I84A 1MUJA 1NEUA 3GJFK 3LY6A 5JXEC 1TIUA 1RULH 4AZ8A 2NX5D 3DARA 3IJSA 3GGWA 1F4XL 5CGMA 4L5FH 5I2IA 3KYNB 4ZTOL 5INCB 5GRJL 2EDRA 1I8IA 2DLTA 1MREL 3QJFB 4ZO8A 1KJ2L 4R2GC 3LEXA 4RQQA 1TETH 3RUGF 2P42B 4YDLB 4KXZH 4OZIE 3GMMB 3T2PA 2X4TA 4XP4L 1TXKA 4L8BB 4LHUB 32C2A 3WSQL 2F53E 4MJIE 1JPSH 3I2CL 3O41A 2I9TB 4EVNB 2O61A 4HEPG 1D5BB 1NGZA 5LGJB 2YC1B 1KJ2B 4XMLL 4OIBA 3HPLA 3WEXB 3WIIH 2UUDK 3VRIB 1I9IH 4HAFA 4J6RL 3LH2H 1VKXB 3C6LC 1RZJL 1TVHA 5SWZD 3HE6D 3MJ9A 4UTBH 4NP4H 3TPUB 5DMKB 3VXRE 1ZLWH 5C0GB 1HN1A 3D69A 3D2UA 5FHAH 1MRDL 1M05B 1IAMA 3NIGE 2P5WE 5B4MC 4MNQA 4WHYG 3V95A 3AU1A 4QXTB 2VDNL 4TOYH 1QFUH 4PJGE 3NZ8B 4LSSL 3PQYA 3QWOB 5DK2A 3C8KA 1YNKH 3O45B 4NO0D 5T3ZL 2IMMA 2VXVH 2CIIA 4G3YH 5DD1H 1WBXB 2QADB 1JFQH 1SBBA 2VSCA 4PRDA 3OR6A 3H9HB 4MHHI 1Q0YH 5CFHA 1CDGA 4WI4A 4PGZA 4M4PA 2XZAL 4P3DB 4PJXA 2F5AL 1ZLUH 1WTGT 1CFSB 2WIIA 2HN7B 4OV5A 3LB6C 2DQIH 1NBVH 4WO4C 1AXIB 4LNVA 5GRYA 2VLJD 2FWOA 2ATKB 1D9KC 2VQ1A 1IGYA 2OXHA 1DBKL 1SHMA 5KS9B 1M6OA 1NEZB 5GZOC 3KPRA 3M1BA 4HS3A 4NRXA 2BSED 3D39A 4P4KA 1S7QB 1XGTA 4P9HH 3O2DL 1NC4A 1VHPA 1I9JH 3SDAA 1F58H 1IKFH 2IGFL 2X89A 3AUVA 3UPCA 3BJLA 5B38A 1OAQL 3GUTA 4ISVA 4GW1B 1PZUB 3KXFE 1ES0A 1JNHA 1QLEL 3DRQB 2DI8A 3RPIA 3ZE2F 4UI2A 4YHKH 1TQCC 3RWIB 3V0VB 2FIRT 5E9DA 4YC2C 1YJDC 5E5MA 1CFQB 2ZOLA 2Y5TB 5BXFB 4O4YH 5TE4H 3BDYH 5KW9H 4LDEB 2FB4L 4HGWB 5LCVL 4J3WA 2VAJA 3VGAC 2WP3T 2BVOA 4X5XB 4JPKH 3MRCA 1KG0A 3MREB 3GNML 3MZGB 3VFVB 3HNSH 1ZGLM 1QBAA 2F53D 4MJID 4M1GL 5EBWA 3O8XA 1NFDF 3CVIL 4EI5C 3RAJH 3N1MC 3CMGA 5EU7C 3WFEL 5EOTB 3EFDH 2BHUA 3IU4H 2AJXH 4UV4L 1RI8A 1UVQB 4JFXA 2HT3C 1ZTXL 1K6QL 1SVZA 1IFHH 5T1DL 2EDJA 5TH2A 1LWRA 1NCWL 4JG0L 5JZ7D 4YBLC 1CL7L 1NCAH 1IGTA 3VXRD 3BPLB 4JRXB 5IM7A 1A1OB 4PRAA 1INQA 4JDVB 5D70H 4PJ5E 5CHNA 2R0KH 3NCJH 1N6VA 4CUCA 2A9ML 4PJ9B 2ATPB 5D1XC 2I9LB 4XBEL 4NUJA 4X7SL 5HYJB 2W07A 2VZTA 4XAKE 4JPIA 1RFDL 2EH7H 1K4CB 4XP6H 1QFWM 2NCMA 2R69H 3MR9B 1GIGH 4PV8B 3G6DL 4KRPD 5FV1L 4L4JA 1FH5H 1OM3H 3UTZA 4UQ3B 2YMXL 3SE9L 1I1RA 4GQ9L 4XWOD 1LNUA 1EHLL 1JF1A 5HHXL 5KSBF 5C08A 1DBBL 2H1PL 3S88H 4XPFL 1MCKA 3QUKB 1I7RB 4ORZC 4ZOEA 2VH5H 1KTLA 4H88H 5IB3B 2PO6C 1X9QA 4GAGH 1BQHB 5I1AB 3DMMC 3JVGC 3MRNA 4TNWK 2DQFB 1D5XB 1UM4H 3O9WD 4S0TD 1IGFL 1KGCE 2B4CL 3HS0A 3VGHA 3O6KH 3OXRA 4JGUA 1L4IA 3HI6H 2EDWA 3KXFD 4RX4D 4U6HB 1AGDB 2NZ9C 1YECH 4HUWB 3U4BH 2QQNH 2P5EB 4KHXL 2OZ4L 4C59B 3BJ91 5DEZA 2DQJH 3UXFA 1AQDB 3OX8A 3BPNB 3QNZA 4OF0A 2NX5B 5GGRA 5FECB 3V52L 3EFFB 3W9EA 1MFNA 2BY1A 3NFPA 4PJHF 3VWJD 5ICYB 5JXAL 3IVKB 5EN2A 5FM4A 3NGBB 3SKMB 1HCFX 5IHLB 3QUML 2RIKA 1E27A 4G8GA 4JM4L 4S0SD 5FA4B 4OFYA 3LV3A 1EZVX 3J8F7 3R8BB 4ALAH 3EO9L 1WTLA 3GK8L 4OKDA 5FGSA 3OKNA 3EOBA 3QIUA 5J9PA 2BOCB 4JO1H 4FXLA 1TQBC 2ZZUT 1NAML 1FZJA 1MRFL 4XMPL 4YE4H 2IPTH 3QUMB 5GRUH 3TPKA 4JHAL 3MBEA 3VU2A 4ZFZB 5SWZB 1KEGL 3HE6B 3VCLB 1JL8A 4X6BA 1A7PH 3ME0A 3MRLA 3X12B 4LEOA 3ARSA 1NAMB 4XH2A 4PJ5D 5JXEA 3WXWL 1BFVL 1LEIA 2ZUVA 2DQHL 3JTTB 4XAKD 3QI9C 2QKIB 1UXWA 4M1CD 4NO0B 5J6HB 5DRNB 4K3GA 4ZFGH 1X7QB 1WQVT 5I1JH 2OK0H 1FN4A 4NDMA 3KWWB 4UZGA 1QHOA 2RBLA 2UWEA 1BWMA 2J12B 4YZFF 2BSTB 2P48B 4KRNA 3T8XA 3MJGX 4X4XA 1BQSA 4O9HH 3VG9B 4DKDC 4LAQL 3U0TA 3G04A 3U4AA 4DZBB 2WP3O 2NY0C 4KKAD 3Q6FA 1JHKH 4KTEH 5M94B 2VLJB 2E7CA 4TUOA 2R1XA 1N8ZA 5DJ8B 4ZQKA 1WWBX 4X7EC 4YBQC 2I5YL 2HG5B 4QRRE 1CS6A 4RGOH 3ZT7A 1FFOA 4LPCA 5BVJA 1JNJA 3C9NA 3QB7C 1KGCD 3UTOA 4Q74A 4G6KH 2GW5A 3DI2B 1YEGL 1FIEA 1TJHL 4PJDE 3F7VA 4BFIA 2P46B 3RWFB 1A6PA 3T0EE 2X9YA 3V0AC 4LCWE 3EGSA 4OFPA 4XCCL 4MA1B 4ZUWA 1AXSB 1OSZA 1V3JA 4M7LT 5I1CL 3FTGA 1B4JL 1HWGB 3FRUB 3L3DA 3S36L 3C87A 4O58L 4U6YA 4PR5A 2JE8A 4A6YA 2BVUA 3KJ6H 4WI5A 2YK1L 4NQVA 6FABH 4WO4A 4ZXBA 2XZZA 1D9KA 3BXNB 4HJJH 3I6GA 5EZLB 5AZEL 4KK9C 3MOAL 4OZIB 2IFFH 1T7WA 2E9IA 1FNEA 1WWCA 4D0CA 4HK3J 3BRDA 3GSOB 5HGBB 4MJIB 4LSRL 4AEEA 3VMOA 2EKJA 1G1YA 4ELKB 5CBAA 4Q0XL 1N6QH 2W92A 4OQTH 3EZ8A 3U7YH 2D7TL 2Z93A 3RBGA 2JJTC 2CLZB 5SV3A 3V5HA 5I6XC 3VXTA 1XGRA 2XNAA 1OCWH 3WNNA 1WIPA 3VXRB 3FO2A 4RWYL 5H37H 4LVEA 4YK4C 4QCIB 5DT1L 5T1MA 1PYWB 2OJZH 3E8UH 5D7IF 2AERT 3TCLA 3N1GC 4PJGB 3CC5A 3BHBA 1RJCA 3DURB 4HT1H 4JFQB 1A9EB 3O3BA 2CO7B 4QOKA 3AM8A 1G9MH 4CBPA 4RDQF 4AMKH 2QHRL 1FG9C 1RIHH 4LNRA 1FL3A 4KRPB 3IDXH 2WQRA 4GAYB 4BQ8A 2FYYA 5TJWK 1CG9A 1J8HB 4OCXH 4DW2H 1KN2H 5DVMA 3FQXA 3ZYIA 5JQ6H 4HBCL 1CQKA 1KB5A 3PP4L 5J56B 1Q9KA 3CDYA 3BEWB 1HHIA 2HYMA 2J8UA 2A77H 3U9UB 3EJJX 4GUPA 5B8CA 2ADGB 5CJQL 4F7MB 4GAJL 2VLKE 1VESA 3O9WB 1F6AB 4P5TC 3QT2A 3VFWB 2XFXA 5EFIA 5IEKB 3BPNC 3WUZA 2PYEA 3L7EA 2Q1EA 5D1XA 4PPTA 1F90L 3MV8A 1CK0H 3D87B 1DN0A 3KXFB 5EO9A 3TN0D 4BJLA 3PG2A 5ACMA 3AMLA 3RL1A 1FLRL 3T0ED 2QSQA 4LCWD 3WIFA 4G7YH 1NGQL 3B5TA 3MO1A 3S5LA 1TVBB 1H9VA 1U8JA 1OD7A 2X4QA 4OLWH 3PWPE 4LU5H 2M26A 3ROOA 3SKNA 2Z92A 3WS6C 5E6ID 3KNBA 4LSTH 2Q8AL 5HGHA 3IFNL 4M9OA 2VOTA 4WWID 3C08L 4XPBH 5CMAB 2XWBB 4MXQD 1U8IA 2ITCA 1RUMH 2O5XL 4KY1L 4Y4HC 3VWJB 4P5KB 3CGTA 5JHLH 5CIPA 5ICXB 3DSFL 3DIFA 3MRJB 4HFWB 1BQUA 4XCFL 3HE6C 2CR6A 2H26B 3DMMA 4RBPH 1DQMH 5CILH 1YNLL 3HCVB 2YD9A 1N26A 5C86A 5GISH 3LSOA 2VISA 3RRQA 1DBMH 4ZS7L 5FYLH 3W5MA 3FCTA 2VRAA 3HA0A 4U1KB 2NXZD 2EYSA 1RZIB 3QJFA 1TJIL 2DTMH 4JY6B 3QHZL 4NHUB 5LGHL 3GMMA 5IESH 3O3DA 5KAQG 4L8BA 3BT2H 4OJFH 1I7UB 1QO3A 4GMTL 4LHUA 3MXWL 2ICWB 2MKLC 2IAMD 4PJ5B 1N4XH 4EVNA 2I9TA 3LKSB 3DRTB 4K71C 5LGJA 3ETBF 1KJ2A 1F11B 3WEXA 4H8WL 4N0UE 2Y07L 3GKWL 5TDNB 1LO3L 4RMRA 1MHEB 5GGVY 5K9JH 3L3OB 2NW3A 2FECI 5DMKA 1NLBH 4TUKL 5C0GA 3WN5B 5L9DH 3RA7H 1L0YA 2VXTL 4JDZA 3BQUD 1FP5A 3L7FB 1JGVH 3MPCA 3U83A 1NLDL 2IBBA 3NZ8A 1DJSA 3AS1A 3UTSE 3VI3E 4ZFFB 1JZ2A 2HFGH 3QWOA 2AJSL 4KDWA 3V79C 2R2EB 3GI8L 4Y16C 4U6VH 2FEDD 4NJ9L 5SX4H 1I75A 2VLKD 3F62A 3U2SA 2GSIA 2HRPL 3CMOL 3H9HA 5DUBB 1J12A 4HC1L 2X4SB 5HYSG 5J1TC 4BZ2H 4MDIB 3DX9B 4P3DA 3HMXL 5IR1A 5ISZE 3G5ZB 1UM6L 43C9B 1ZXQA 4IJ3B 5DEFB 2PR4H 2HN7A 1MIML 3P4OB 3BEVB 1XR9A 1BM3L 2ATKA 4QRTB 5J57B 1HKLH 1S5HB 2VN7A 4NWTL 3PWPD 4L4TB 1AQKH 1S7QA 4KTDH 2XXMB 2B1HH 1U3HC 2K7PA 3GBLA 4X6CE 1AGCB 4HCRA 3B9KD 3GSUB 4M43H 3MROB 4GW1A 1PDKA 5L6YH 4E42B 3H3BC 5DJ0B 2F54A 1CDCA 4LCUB 4QO1A 1NGPL 3O2DA 1HQ4B 5JZ7C 4WWKC 4Y4KD 4Z7UB 1V7NH 5KBNC 2ADJB 3V0VA 4BH8B 4OLUH 2GK2A 4JFOB 5ILTL 3P0YL 5BS0E 2ZUQC 2WNGA 4KI5F 2Y5TA 4FZEL 1NC2D 2N56A 1PLGH 1BF2A 1UWXH 4X5XA 3SEPA 2NW2B 5JLZB 3LQZB 5FIEA 1B3JA 5HHVL 5E8OA 3MREA 1P69B 2OTWB 2HMID 2E8ZA 2BP3A 3SE8H 1MCCA 1L0QA 7FABH 4ODSH 3C2SA 4NUGL 2R4RH 3EYFB 2ERJB 1U8LB 1BHGA 3V9FA 4F37F 3QXWA 4XWOC 4PJ7F 4M7JL 1UVQA 1YEKL 5LBSH 1UADC 2R0ZL 3QWRA 2WBJC 5CJXC 1KXVC 3D0LB 1LE5B 4MAYD 5F7KC 2G60H 4ZNEE 1T7VA 3ALPA 4UMGA 1KXTB 1FJ1A 5EPMB 4GBXC 1T1WB 4PJ9A 5EOQL 2I9LA 3UTSD 1JNNH 5FGCB 1CXFA 3QFJE 1JHLL 4L8SC 4BUGA 3DTXB 4RZCB 4G80B 4ZO9A 5GGTL 3P4LA 3MR9A 4PV8A 1BX2B 2DKMA 4AL8H 3V7AE 4UQ3A 4KRMB 3RNQB 3S7GA 3GM0A 5JPMB 1PAMA 5J12B 5ISZD 3B43A 3TN0B 1ORSB 1VACA 3VI4F 3T0EB 4PLKD 2QLVB 1I7RA 3GSVB 4RMWA 5IB3A 5J13C 1BQHA 4W70A 2FX9L 5I1AA 4CADB 5EA0H 5I1EL 1OB1B 2WBWB 4TULL 5E6IB 2DQFA 2XOTA 1D5XA 4FTVB 4PJIF 2AJVH 4M6NH 2LU3A 2CJUL 1XGUB 2J2ZA 5KVGL 1A3RH 4M48L 5FFLA 2JELH 4JCLA 5I8KL 1YY9D 4Y5XC 3BZEA 2EIBA 1AGDA 4S1QL 4OSUH 3LRGA 4OGXL 4HUWA 1NAKH 1OARL 4OAWB 2P5EA 5FM5M 5GJTH 1FYTB 4R97B 5IGXH 2FLBT 3FQNB 1YPZE 4JFEE 2CMRL 3V6BR 4O2EB 4P5TA 3CDGB 1UA6L 1YPZF 2C4FU 4PB0L 2YKLL 5BS0D 1FG2A 2NX5A 2OI9B 5ESQB 3S34L 2NXZB 1T03L 1BD2B 3EFFA 1DLFH 3LKQB 5ICYA 3RNKA 2PCPB 1W0YT 4NC2B 4M1CC 5EZOH 2NY7H 1G7HB 4BSWB 8FABB 5FA3B 2WQ8A 3WS6A 5FA4A 4EBQH 1X6LA 3TYFB 5AAWA 5C0RH 1EEYB 2YEZB 1L6XA 1PEZA 2IAMB 3H42H 3THMH 1QNZL 2VXSH 5D2NE 4JZOB 4U1LA 2HWZL 3I85A 2P8PB 1J1PH 1WC7B 2BOCA 1M71B 4MA3B 4CU6A 1KPUB 5TQ2H 3QUMA 4NO3B 2P49B 2NY2B 1L7IL 4YHIB 4YDJB 4FFWC 4ZFZA 3T0AA 3HE6A 3VCLA 3M45A 1FGNH 3AREC 2XIDA 1FZMB 3QQ4B 4WRLA 4WU5B 3WDHA 3X12A 1HZHH 1TZHA 1NAMA 4MD4B 4A2MA 3MFFB 2X1PA 4QHNB 3BQUB 3ZSSA 4PV9B 4N8VB 3E0GA 4HJGB 4MZ3A 4NKDA 5K93A 2I25N 3JTTA 3T0XA 3V8OA 2QKIA 2E9WA 1MF2L 3QFJD 4J1UB 4NO0A 4OZGF 2VL5B 5J6HA 1RVFL 5DRNA 1IARB 2ZSVB 1X7QA 5IK3A 4R4BA 5I15L 5JA8B 4M7LH 4MWFB 5ID1A 1CTNA 3KWWA 3QISA 4HK0B 1SY6H 3BWUC 2D0FA 1LDPL 1CWVA 1JNLH 1H5BB 1EH9A 5D6CB 3FN3A 1MAML 3GBNL 2CK0L 3RJDA 3DNKA 4RIRB 4DZBA 1CF8H 2XY1A 3BZFB 2VLJA 3KG5A 3HUJB 1CGXA 5DJ8A 4OD3L 5HVHB 2VDOH 4UAOB 3FAXA 5I1LB 3CFKA 2GT9B 2HG5A 2N7BA 4P2OD 1TETL 1T2QH 4K3DH 2KH2B 1OAYL 2F19L 5LXGL 4Q2ZB 2WSKA 4KUCF 1PKOA 1EBPA 1NCCH 1CD0A 4YXHH 1U42A 1T7ZA 4HQQH 4LFHD 5B22A 3B9KB 1JPSL 4G6FD 4OZFH 3O3EA 3RWFA 2APTA 4YIQB 3ARWA 4AENB 3WIIL 2APXA 4HXBL 1AXSA 4L3EE 2OXGA 1I9IL 4NQTA 4UT7H 5GZND 4Y4KB 3BKCL 4MYWB 4XTRD 4JFED 4JN2A 3FRUA 5EBLB 3RTQD 3Q0HA 5IIEB 2WLYA 4NPYB 1ZMYA 4NP4L 3GHBH 4LGPB 4M6OL 5A40E 4JE4B 3S4SG 5IHUH 1T83C 4WTZG 4PGEB 2EDTA 3QDHA 1NC2B 1NGXA 4MSWB 4MA8L 3OKMA 4XB7A 4PJ8C 3BXNA 1EJOH 1T0MB 4WVRA 3T09A 1T2XA 4OZIA 1RV6X 4LARH 3GSOA 5I0DA 5HGBA 2F53A 4MJIA 2VXVL 5F44A 4DJMA 4LSPL 4F57H 3L1OH 4GRWH 5F3BA 1FFNA 2DOCA 4OD1H 4JQXC 4N0UB 5IMKB 3BRFA 1M7DB 1S9XB 1OY3B 1YY8B 3VFMB 2ENYA 2Z35B 1MIEL 4J7RA 2CLZA 5FO7B 1RUQH 3HTLX 4MAYB 1RJZA 4HKJB 5CINH 3VXRA 4DGYH 2IPKA 1Q94A 5EIVA 1AFVH 3I6KA 4QCIA 4KVCH 3BN9D 5BMFL 2P5WA 1PYWA 2YWYA 4QGYA 3Q5YA 2ZUTA 4PJGA 3DURA 3UTSB 4HKBB 4LSDA 1XF5A 3HMWH 4JFQA 1A9EA 1HK6A 3V0WL 5KN5B 3QXVA 4QXGH 3VG0H 2B0SH 4N5ED 1AY1H 2GJ6E 3UEZA 1DQDH 3S3PA 5E6IC 1TPXC 2V9TA 2X4PB 4U33A 5HHOE 3UZQA 4I8DA 4XNXH 2NY1C 4CU7A 2EH8L 3OAZK 3J7HA 3MXVH 1YUHA 1T0NB 5ISZB 3GBML 3GSNL 5C1MB 1S9YA 5CJXA 2P7TB 5F96H 3BEWA 5KW9L 4JKLA 3EHBD 3QUZC 5HGGS 4WHYH 3U9UA 3MRGA 2ADGA 1HXYB 4F7MA 2CUIA 4UU9B 1LO5B 3ALXA 3O9WA 1F6AA 3DOSA 4KDVA 5IEKA 1B0GB 1R3LB 3GSNB 3HNSL 1UH3A 3MLPA 1A3QA 3D85A 1N5AA 4X6CB 2AKRB 3Q5OA 4PJCB 5DGQA 3IAPA 3EYUL 25C8H 3KXFA 4JKKA 4RX4A 5FYKH 3EAKA 3D5OF 4DUWA 3IU4L 4FOMA 4L3ED 5AEAA 4XX1G 4U0RB 2F8VA 2IQ9H 1AXTH 1IFHL 1KENL 4L4VE 1HOCB 2D7OA 3NA9H 2IAMC 5FYLE 2XKSA 5BS0B 1RZFH 1UJ3B 5CMAA 2XWBA 4K3EL 4ZODA 1TJGH 4EOWH 5DXWA 2DJUA 2EYRB 2E27H 3U4EB 2X2YA 3H0TB 3VWJA 1EDQA 1NFIB 4P5KA 1VB9A 3HRZB 4HFWA 3MRJA 1JWSB 1GHFH 3EDEA 4JRYB 4UILH 4M5ZH 3WDIA 3V7MA 5JW3H 3GI9H 3ZYOA 2FBOJ 3HCVA 5DJAB 1I1FA 5CZKA 3GSQB 2EH7L 2JJSC 2ADFH 1S3KH 1Y6MR 1QOKA 3UDWA 1Y0LB 3DWTA 1GIGL 1KNOB 3IKCB 3SJVE 3QUYC 3OKLB 4Y5XA 1A4KB 1RZIA 1SYSB 4KRLB 3GMLB 4QYOA 4I18B 4KXZI 4OM0L 5T5FL 1DQLH 4HZAA 1C5CL 5HYEA 1G6VK 2FEDC 3CSYB 4KMTH 2VH5L 1FBIH 2ICWA 4PJ5A 2J5LB 2HRLA 5HHNB 1RUPL 3DRTA 1F11A 2FSEB 4XCYB 5JIKA 1U3JA 3QO0B 4X8JB 3I50L 5TDNA 1QD0A 3BKML 4NN6C 3OKEA 3FMGL 3E6FB 3HI6L 1A1MB 1P4BH 3NN8B 4M6ML 3L3OA 4DN3L 4O2FB 3HC3H 4NHCL 1YECL 3CPLB 5HHOD 2FR4B 4NFDA 4K9EH 3W5NA 2MHAB 4TSAH 1U8KB 3P0GB 1EV2E 3PGDA 5GRVK 3OJVC 3TT1H 4RAVB 5GS1C 1E4WH 1HHJB 1UFUA 1HSAB 3GMPA 2DLIA 1H3GA 2R2EA 5DD5L 3OG4B 3OHXA 1QFPA 1UZ6F 5MERB 4GLRH 3RY5A 4Y4KC 4P2OB 3MA9H 4LP5A 5DUBA 5IMMB 4JZJC 3MLUL 3GSRB 3DX9A 4MDIA 4NCC1 5TDPB 3U0PB 4ESKA 4G6FB 3BKJL 3EJYC 43C9A 5JUEH 5EC2B 4BYHA 3DHMA 3ARDD 3BEVA 4JO1L 1KLUB 1S5HA 4HC1A 1BEYH 1KIPB 5E2TL 2IPTL 1JPTL 4LOUD 4GS7C 3P0VH 4QWWD 1BZ9B 4NQXB 1V3KA 3CSGA 5J89A 2A1WH 1RY7B 1LILA 1HYSD 4L4VD 3HMXA 5DTFB 5FYLD 3ARBC 3V4VH 2DM2A 1AGCA 1H3XA 1GZPA 1JGEA 3MROA 3ZTNL 3CD4A 2R1WA 3MOBL 5HYFA 1NBQA 2O5ZH 4E42A 5DJ0A 4LCUA 3HAEG 3PDDA 3UBXG 3MA7A 2XT1B 4JFZL 2BSRA 3ULUE 1NCDL 4KJWD 2ADJA 4BH8A 5JW4N 3L3KB 4ZDHB 5I1JL 3HFML 4JFOA 2OK0L 4HIEA 4I3SH 1REIA 1UEYA 5D2NB 5F1IA 1LE9B 1QLRB 3X11B 3SJVD 4Z95H 1S7UB 5LQBL 4OBSA 3SDXE 4FFVC 2VLRB 2GEEA 5HHQA 2NW2A 4O5LH 1DBJL 1J18A 5CUSH 3WMSA 5IV2A 4HH9A 3SO3C 4P9HC 3R0MA 4XPTH 3O2VH 3EYFA 1U8LA 4ZS6D 1T83A 2AW2A 4IOIB 2EXWD 5EB9A 1K8IB 3B9VA 5IBTH 1IBGL 3VMPA 3U79A 4PLKC 3BP7B 1ZGLB 3KPLB 1MWAH 1EIBA 3IAQA 2ORBL 2HKFL 3P40A 1LE5A 1MH5A 5DQDL 2CRYA 1YMME 3EKCA 4HPOH 1T1WA 1OLZA 4JQXA 1C1EL 4KH2A 4BQ9A 3QULB 2J3SA 1YY9C 4KKCC 4GFTB 3T2NH 4BK4A 4ODWB 2DBLL 3DTXA 4BQBA 2HTKC 5EO0B 3AB0C 4QRRA 1BX2A 1PBYA 2H2PD 3K1DA 4IS6B 3UYRH 3TH3T 4KI5C 4RAHA 4KPHH 4PJDA 4HS6B 4P46C 4YHNB 2NNAB 3TN0A 1ORSA 3TF7C 3GHEH 3T0EA 4LCWA 4OCWL 3GSVA 3UJJH 4K7PL 2FATL 4CADA 4ONFH 3EOTL 4GW4B 5E6IA 1HINL 3DETC 4D94A 1QEWA 4X6FB 1H3UA 1XGUA 1I9EA 1NPUA 1O7SA 3OZ9H 4FQLL 4OIIL 3RX5A 5F89A 4PG9B 2OJZL 3CFBB 4I18C 2QR0B 4KAQL 2APWA 1F4AA 4EN3D 3OQ3B 5GIRB 3I75B 5FKPB 3NAAL 3ULUD 2DI9A 4DAGH 2V5TA 3FQNA 5E2UH 4O2EA 2YOCA 1RJYB 3CDGA 4G9DB 3T04D 4P2RE 5BVPH 1ZEAL 1PVHA 4J3XA 5I1HH 1KCUH 2OP4H 3IDXL 4ODTL 1X5LA 4YUEH 3WD5H 4HUNB 3MUHL 3NFSH 1B6DA 5DO2D 2PCPA 3HC4L 5HDQL 2CUHA 5JQ6L 4BSWA 4KJYA 3H2WA 5FA3A 2MSPA 3GJFH 3VXME 4Z8FH 2D7QA 3TYFA 4GG6E 5C9JA 1EEYA 2YEZA 2IAMA 1U91A 4D0DA 2VWEC 4KKLD 4JZOA 1WC7A 1M71A 1MJJB 3FHQA 1X5KA 3F58L 4MA3A 1KPUA 5DEGB 5D5ME 5E2JA 3CXDH 1EHXA 5GJSL 4GO6B 4BZ1H 5D72H 4YHIA 4YDJA 1CK0L 4OD2B 3FQTB 1UKTA 2D3VA 5FUZL 4YHOH 1FZMA 1GC1L 3QQ4A 4IHOB 4P2OC 4YAQA 3WJJA 5HHOB 2JJSA 1IEBB 1U9KA 3BQUA 1HYRC 4PV9A 4N8VA 1KLGA 3DVIA 2MOVA 4HJGA 1BFOA 5KJRL 1VGKB 3X14A 4J1UA 4LLMB 3PV7A 1V5JA 2VL5A 4FNLL 2FD6H 5HI5D 5L8JB 2ZSVA 1TTUA 4DVRL 3U7WL 1RUML 3ZE0E 4MWFA 2VLKA 4HK0A 4XTRC 3ZMRA 2YR3A 5D7JC 2CRMA 3RTQC 4WW2B 1IAIM 1H5BA 4ORGA 2DYPD 1SBSL 2CD0A 4QF1B 2DLGA 5D6CA 2X1QA 1Z9SA 4JM2D 1G7QB 3BZFA 5GGQH 1J05B 1OPGL 3ARDB 5DJ2B 2B2XH 4NO2B 4J4PC 1L9NA 3T3ME 1CVSC 2P8LB 5IROC 2VSDA 1QSFE 2DTML 3V4PL 1EAPB 3PWPA 3DPBA 1FNFA 3T1FB 4HLJA 3KJ4C 4OCNC 4X6DE 5EORH 3TJHD 4L4VB 5DR5H 2FX7L 3BDBA 5IESL 4X6DF 4WFHE 5D2NC 2E7MA 4OJFL 3B9KA 3EDKA 1FPTL 1UM5H 4B5EA 1K5NB 4YIQA 1DBAL 1DUYB 4X83A 5B39G 4GT7A 4BKLB 2UY6A 5IJKC 4Y4KA 2VQUA 5BV7H 5EBLA 4JB9H 4FABL 4N0YL 1EO5A 3B9DA 3NVQA 4P2RD 3DI3B 4M62L 2GITA 4CGTA 2EEBA 4GRWE 4FQ2L 4JZJA 3VDAA 3N9GL 1A4JB 3SJVB 3FRPG 3RA7L 2ED8A 4PGEA 4GRWF 3NABH 1NC2A 3BP5B 4NZDA 2VN4A 1T0MA 1QFWH 2L7JA 5CZXC 4I3RH 4LPUA 1OAKH 4OQ1A 4I13B 1UC6A 2V17H 1Q9OB 1Q8MA 1TTGA 3A6CL 2AV7B 1MCQA 1DSFH 5DRXB 5KZCD 4N0UA 1NL0H 5IMKA 1ZT1A 1M7DA 3VGEA 4APQD 1QKZH 1YY8A 3CVHB 3CU1A 3R1GH 4R26L 2Z35A 1UXSA 1X5XA 4FQQB 4D0BA 1C8PA 5IG7B 4MAYA 4HKJA 1NCBL 2NR6C 2Z91B 1QR1B 2DQDL 1OGAE 3PIQB 2Y36L 1HKLL 3NACL 1MLBA 1FYHB 1DFBL 4OIAA 4JREB 1P4IH 3KPNB 4MD5A 1AQKL 1YYLH 2C4XA 4Y1AE 4KTDL 1JPGB 2B1HL 4WDIB 1DZBA 3UTSA 4HKBA 4Z7OF 5J8OA 1LO0H 1FL5B 4M3KB 4YDKL 3FO9B 3REVB 1A3LH 1UYWL 4M02A 4OFIA 5D4QA 1QACA 2X4PA 3BIKB 3OG6B 5B38G 1FCGA 4RSVA 3WLWD 3ZE1E 4F8TA 3QFDB 4YGVB 4FFZH 1T0NA 3BSZH 5ISZA 3LRHA 1Z2KA 3LPWA 2MFNA 1XCQB 1AR2A 4X7FC 3WV0A 1QSFD 1JZ5A 2XQYK 1A6TB 1HXYA 4X5WB 4UU9A 3FFCB 2YS4A 4JFFB 1MCFA 1I8MB 3TESA 1GXEA 1B0GA 1R3LA 3GSNA 4WFHD 5I75C 5LKNA 5DRWB 3ULUL 4MNHB 4X6CA 4WUKH 1ACZA 2AKRA 4P5MB 4X99B 3VH8B 2E5EA 3IFPA 4JKPH 4LIQH 1UWGH 1AGEB 4F37K