1T5WB

Hla-dr1 in complex with a synthetic peptide (aaysdqatplllspr)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
190
structure length
190
Chain Sequence
GDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Polymorphic Pocket at the P10 Position Contributes to Peptide Binding Specificity in Class II MHC Proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
total genus 41
structure length 190
sequence length 190
chains with identical sequence E
ec nomenclature
pdb deposition date 2004-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t5wB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1t5wB01
5KZCB 1CR9H 4OZIB 3K2UL 5IB5B 1TQBC 1GOGA 4Z7VF 1MCWM 4F7CB 3T8XB 3QCUH 1J8HD 4ODXB 5L9DH 5JOPE 1NSNL 4N90D 1P7KB 4ZUVA 3RPIA 1UB6A 4PRNB 3GSNB 4OIBA 4U6HA 5K9KB 5I2IA 4GBXB 5JXED 2JELH 4M1CC 4MQXC 4GAJL 4M1DH 1YNKH 5TFSH 3AMLA 3V79C 2F8XC 3JZ7A 5C6TL 2XWJA 4Y2DD 3RDTD 3MUJA 2IG2L 3P30L 3BEVB 3GZKA 3CMOL 3ARFD 4OCSH 1DBJH 4NHCH 5ALBL 4EQ3A 3FB5A 5L2KD 2YPVL 4NGHL 2VABB 5DJZB 1SVZA 1BF2A 1PW3A 5F9WC 1A4KA 2EYSB 3RWFB 2FJHB 4U2YA 4R90H 3LRHA 1JMZA 2M1KA 4K55A 2WINB 4BZYA 2OP4H 5CGYD 3MRJA 3TYFB 3L6FA 1KN2H 1HYRC 4NQXB 4J2XA 5EU7C 4LVHB 1MWAB 4OCLC 5BZWA 2KZWA 2XTLA 4NQDB 3QXAB 3ZLQC 3F62A 3G6DH 5LGKA 2EH8L 4HBQA 4ZQKA 2AGJH 4HUUA 2YEZA 2IADB 3PHOB 3UXFA 2YMXL 4EKXA 1RPQA 3UDWA 5CGYC 2VITB 5DC4B 4HG4K 1KYOK 5GSRA 3UTSB 3B9EA 1S78C 5IJVA 4PRHE 4BJLA 5ACLA 4HT1L 3TO4A 1U8QA 3CH8A 2HTLC 3G5YA 4NCDA 1UJTA 1HE7A 1UWXK 1KJVB 1NGQL 2PXYD 4MCZA 1JNNH 5IG7B 1HINH 2O5ZH 1BQLL 4PJ7A 1S7VA 4YLQT 5C08B 1T1XA 4HBCH 3MRFB 1PKQE 4KRLB 4UMGA 3HA0A 4RFNB 4APQD 5LXGL 1INEL 1C7TA 3WYRA 4Y2DC 5T5NF 4MB3A 1OP3H 4YEEA 3RWGA 4ZTPL 2VDOH 3GSXA 1UVQA 1RULH 3CU1A 3IDNB 1MJ8L 3SY0B 1FFQA 1IM9D 2Z35B 4UIKH 1FVEB 2VO5A 1UC6A 2K1MA 4RGNC 4XP1L 1BEYL 4Y16A 5FB8A 4RMQA 1YPZE 4YXLH 2DJUA 1A6WH 3CFEA 3N9GL 4QF1A 4CVXA 3IS0X 3OAYH 1UCBH 12E8H 4WHCA 2GITB 3WXWL 1HOCB 3NIFE 4Y16D 1T3FA 4M61B 5GZOC 1VCAA 1TZGH 4CVXB 3MJ9A 3O8XD 4TNWF 3PHQA 3B2UC 1NGYA 3D87B 1MLCA 1ZHBB 3VFNA 4P3CL 3MX0A 1JRHI 5CEXA 3WEXB 2ENSA 5SWZD 4CJ1A 5D5ME 1X44A 1E4KC 2AQ1A 4GKNA 1WZ1H 4DN3L 5DS8B 3DTXB 1PYWB 3TPUA 3QR2A 4ZTOH 2H1PH 2A9ML 2VDRH 2UWEE 5CCKL 1U3HA 4EI5C 1LVEA 4YAQA 3KYKL 1RZ8B 1WJ3A 2J88H 3NBNA 4G9DB 1M7XA 1J0ZA 1YUHB 2XKNA 5IVOA 4DFIA 4PRDA 1A6UL 2NY5L 4BM7A 3VI4E 1BFSA 5JA9A 4H0HB 3T08A 2R8SL 1T1ZB 2EDKA 2X4PA 3O3EB 2ED7A 3MRRB 3QXUA 3MLSH 3VRLE 1N0LA 5E2TL 2C1OA 1N5YH 1H3UA 4OGAC 2OL3H 1ZANL 3RUGA 5H37G 4UV4H 1FSKC 1XGPA 1J1PL 3HRZA 3MCG1 1BHGA 4NHUB 4ZFOL 5I0ZA 3ULUH 3BJ91 4PJ8A 3GHEH 3QA3A 1ZLVK 1CDHA 3NIFF 3KPSA 2OCFD 3VI3F 1WF5A 2Q3ZA 5F96H 1E6OL 2AJSL 2IQAA 4TQEL 4WI5A 3FN9A 2A9NL 4ZPTA 4OLEA 1REIA 3WNKA 3LVEA 2NX5A 2BHUA 4NO0A 3QDMB 5FKPA 3QBTB 3VXQB 5IBLC 4LQFL 2IAMB 3H9HA 5T3ZH 2DWDA 4RX4A 5IK3A 4HX1A 5DEFA 2X09A 3KNBA 4FQCH 2UYLA 1ADQL 4HUMB 2RGSA 2Y25A 4NFBA 2D4FA 2VDPL 3JVGC 1JZ3A 4MA3A 4YHYB 1A4JA 1EXUA 3VG0H 5T1DH 4LFHD 3SE8L 3DRTB 1U93B 5HYQA 4JO1L 1HHKB 3LN4B 4OI9A 1F45A 3IRZA 1LO5B 1PSKH 4JDZB 3DRTA 5DUMH 1A14L 5JXAL 1PFCA 1IQWL 4RZCB 1MHHA 5TE4L 4P23C 5C2BL 3MA9H 2VDLL 3EOYG 4CN6A 3D9AH 1JCKA 1QYGH 4OD2B 4LHUB 4Z7VB 1J18A 3O9WB 3UO1H 4P9ML 2D9QB 1S7SB 5IP4A 4RMWA 3VA2C 4NO3A 2GSIB 4C59B 3K3QA 4K7PX 1Q9OA 4JFZL 2IWGA 4QHLB 2CRYA 3HI5L 3CFKA 2DM7A 5C9JB 43CAA 2DBLH 4HS3B 5C8JB 1M7IA 1S9VB 3KLAB 1IEAA 1KEML 3HE7C 3SOBH 1M05A 3TH2T 1H3VA 4YHOH 1XGTA 1FVDB 1CE1L 3RY6A 1IGML 1YDPA 3TC9A 4ZXBD 3S88H 1G0XA 2IH1B 5SX5H 3ZE0E 4L4TD 4W70A 1KIUA 5KVFH 3M8OH 3FFCE 4QRTA 5GRVL 2Y5EA 1PY9A 5DHYB 3IJSA 2WBKA 1F4XH 1BZ7A 5EU5B 5ADOL 2DL2A 3UBXI 4RDQG 1UXWA 5BQ7A 5HHNB 4I48B 2X4UB 4E41D 1I8KA 2N7AA 1Z6JT 1RZIA 1UQSB 5GRXG 1MCPL 5EUKB 3KPMB 5A2FA 4K2UH 1LDPL 4NM4L 1TETH 2BVPB 3TIDB 9CGTA 3TO2B 3E6HB 1RZGA 4FQXB 5E9DA 1EAPB 4Z5RA 5F8QC 3TEUA 2Y5TA 4JRYA 4J7RA 1FYTD 4U1SA 1WV7T 3P4MB 2QQNL 4DKEL 5TQ2L 1XIWB 5L8JB 2ZUSA 4HUNB 4ZYKB 1EEQA 1G1CA 1OAQH 3QUMH 4HKZB 4GXUN 4YHIB 3VWKA 5CIPH 5C0JA 4GG6E 4E0RA 4LPCA 3MLXH 4PJEE 5IWLA 2H6PA 3LN9A 4OD3L 2HFGH 4KVCL 4N1HB 1IFHH 1Z9SA 4OGYL 4XPGL 5HHXL 3IJHA 2DQGL 1OPGH 1YEIH 3HNVH 4D2NA 5EU6A 4OCRH 4PJIF 3WIHH 4KKCC 3MRCA 2A0LC 3CX5J 4MB4A 4I0KA 4U7SA 4QO1A 3ES6A 3VGGA 4OLYL 4M43H 1CDCA 1KT2B 2VLJB 2GAZA 5ANMA 3BWUC 2IPTL 3L5XH 3BXNB 5GGRB 5L88L 2B4CH 1H3GA 4B7IA 3CVIL 1CICA 4BQCA 3QUMA 5GGSB 1AGCB 4WFGE 3WL9A 5GGRA 4NNXB 3WFDL 2YPLE 2HFEB 1B0GA 1MI5E 4XX1E 1ACZA 3VFVB 3INUL 2DYPD 3FOMA 3X14B 3WL9B 3VXUB 3ZE1F 4C57C 1ZA6B 3UTSE 1GC1L 3DARA 2V2XA 3AAZA 2P5WD 4RMUA 4NZRH 3S37X 5INCB 2HKFL 3LV3A 2PTTB 1SBSL 3H3KA 4OLWH 2CGRL 3VD9A 2YD2A 2GT9A 4YHMH 3IVKB 2AEQH 2XRAH 4H8WC 4NRZA 1HH6B 2VZSA 2VQUA 2JK5A 2NY3D 4QHNB 3NACH 1HHJB 4M7ZC 3BFOA 4WO4C 1UCTA 4BYHA 2KKQA 3GMOB 3EO1A 2P44B 4JGUA 3FQWB 1I7ZA 3O0RL 4PJ5D 2VRAA 1EFXA 4CKVX 4ONGL 3QUZA 3GK8L 4RRPG 5D96C 4OI7A 2HT3C 3D0LA 4OSUH 4R4NC 2G60L 4MCYB 4JRXA 3RTQA 3ARFA 1TVDA 1IT9L 2VQTA 1CDJA 3PGCA 1QBLH 1S5HA 3D39B 3QFDA 4M9OA 1WBZB 3IFLL 4ODHL 4YDJB 5EORL 4ELMF 1F02I 5TDOA 2HLAB 3WS3B 4Z8FL 3UTZA 4JZJC 4U0QB 1IAOB 1TZHB 3TN0D 1A9EB 4OFIA 3GSUB 2XZAL 1UCBL 4HIIB 5FCSH 2VH5L 2ZG3A 4P23D 5TDNB 5I75B 5E6IC 5AEAA 3NTCL 1B4JL 1DL7L 3FB5B 2XY2A 3AM8A 3OSKA 2XXMB 5CKAA 2ZCKL 4QRQA 3X13A 1T4KB 4OV5A 3GSNL 4YHPB 4DQOL 5TQ0L 1JNHB 4S1SH 1VESA 3C09B 3RZCB 4ZTOL 5FAAA 5IW1B 1JZ5A 4ZUSA 4DKFH 4GLRH 1X5AA 5ACMA 1W0WB 1MHEB 2NY4C 1NLDL 1MFDL 5T1LD 4J4PD 2A0LD 2FCBA 4F3FB 3BOVA 1YN7A 4PJGA 4OFDA 1MH5B 4R0LB 3PG2A 3CVHA 4Q9RL 3KPOA 3W0WA 4LSSH 3CMGA 1CT8A 1BLNA 4QYOB 3BJLA 1K8DA 2A77L 4LCCC 1OSZB 3PWNA 3O4OB 2Z31C 4QYOA 1MI5B 4LVNB 5EC1A 3TJEL 1NCWL 3BN9C 1AC0A 1F3RB 4OBSA 3VXRD 1CFNB 4W4OC 3GHEL 2JB5L 5C1MB 1T0MB 3TFKD 5H94A 2L7JA 4FZEH 3SDAA 1J0YA 2COQA 4IEFB 4RAVB 1OM3H 4D0CB 1RQ5A 5MHSE 3GM0A 4X99B 4MQTB 4UTAL 2R56H 4CU6A 2ICWJ 3LAFA 5E8PB 5I2IB 5BV7H 3KPPB 1WBYB 1A3LL 2NY1D 4S1QL 2X9XA 2HVKB 5EO9B 1DFBL 3V95A 3RNKA 4WDIB 4KMQA 3STLB 3B9VA 5IFAH 3U4BL 4JO1H 3W2DH 5JIHA 3GJFH 3HE7D 2DN7A 4UZGA 3GBNH 1RV6X 4LEOA 5HI4D 1INQA 1P2CA 1WWWX 1GGTA 3FCTB 2QHLA 2J6EH 1WITA 4GW4A 4OZIA 2F5AL 3SKMA 4XHJD 1G6RA 3IAPA 1ZT7B 1ZAGA 2VE6A 5GS3A 4BH7B 3MV7E 1U58A 4X5XB 3FT4A 5JHDA 1R3KA 5EUOA 3MOQA 4JKLA 3UJTL 2BSRB 2IAMD 3VGFA 1I1AA 2JTDA 3MLSL 4NKIL 3RX8A 4NRYB 4OCSL 2VXUH 3RUGF 2EC9T 1MLCB 4CU7A 2IALB 1R24A 3KPTA 5I1JL 2QR0B 1ITCA 2R0WL 3U7YH 4OI8A 4X5WA 2D3VA 2YXMA 2K3TA 4DGVL 3G5VB 5K9OB 2CRMA 4QOKA 4HS6A 1T66C 2J2ZA 3V6ZA 3SDDD 5DR5H 2X42A 5CFHA 1FGVH 4XC3L 2PETA 5J4MA 3H9ZA 1FO0A 3R8QA 2XTJB 4G43A 2DIJA 3P9MB 2E7LC 4Q9CA 4CL7A 1FJ1B 2DQHH 1XH3B 4RMVA 1AGBA 3OB8A 4K3DL 1PD6A 2EYRB 1FO0H 1F3DH 4P4RA 1JWUB 4K2UL 5DUML 1ND0B 1RUAH 1ED3B 4GBXC 4LIQE 5DGRA 4LFHG 5FK9A 4ZO7A 4IOFD 4EDXB 2Q8BL 4TRPL 3D0VA 3MJ7B 3GB7B 1AQKL 1JGUH 2R0LL 4G6FB 2ZUTA 2VYRE 1S7QA 5BRZB 2GIYA 2DL9A 5EC2B 3RGVB 2FGZA 3MLWH 1IGCH 4JY6A 2ITDB 1J1OL 3D0VB 3MJ7A 3O3BB 1U8IA 2WV3A 2CDEA 5D1ZC 1F3JA 4KZDL 2N56A 2B2XL 3LMJL 2NX5B 1HCVA 5DJ6A 5KG9A 3Q3GA 2D7QA 1F3JB 5E8OB 4UTBH 5DRZB 2NNAB 5CIPB 5CJQH 3L3DB 3HKFA 2GJ6D 4JFEB 5KVDL 3HR5A 4LLVB 1HOCA 3HLAA 4MJ6A 3NCFB 1Q94B 2R23B 2A74A 4QGTA 1JPST 4C58B 4XCNB 3EAKA 3BD3A 4OLVH 2HVJA 4Y1AE 4A6YH 4YFEA 3BKYH 2Y72A 1G7HB 2HJFA 5ENWA 2DTSA 2AJYH 5IMMB 1BJMA 1EHLL 4AEHH 1MHPL 1KN2L 2Y6SC 3I6KB 2NW2A 5KS9B 3QDGB 4JCLA 3GMNA 2WM0A 3ESVF 3SDDC 5F21B 1S9KC 4MQXD 3BKJL 1X6LA 2VLRA 4U1NA 5ADOH 1T66D 1MY5A 3ALXA 4PJCE 1A1OB 5DRXA 3U7AA 1YC7A 4G8IB 4G8EA 3RL2A 1UEYA 4R3SB 3CJJA 3RWDA 2VXQH 3BIKB 3CDGA 4D9LH 1OLLA 3LDBC 1S78D 4MZ2A 1QSFE 4KQ4L 3NPZB 4R3SA 1S5IH 3MV7B 1SJVA 5CKGA 3MNZB 1I1AD 3FFCA 1VFBB 4Y5YC 5GGTA 3WEXA 1ES0A 1EUUA 1DR9A 1KFAH 4O51A 4EUPH 1X5YA 2CIKB 4QRRE 4HBCL 5F7HA 1ES0B 3IFOB 2CRZA 3T0EB 3A6CH 4L5FH 5ICYB 3VXPB 4N0FB 5K9JL 4I9WD 1T7YA 1NUFA 4UINH 3D5OF 4KK9D 2JJTA 1UXWB 4LF3A 3PDOB 4KTEL 3HE6D 4JN2A 1O0VA 1QSVA 1I3VA 2DLEA 4M48H 4KDTC 4ZUUB 1QQDA 5KS9E 3E6HA 4OZHE 4YUEL 5I66B 1X5FA 4LSRL 2P5EE 3CLFL 5CD3A 4Z77A 5C2UB 1CBVH 4OQTH 1NDMB 1QLFA 4WUKL 2F5BL 1T5XB 4EN3B 3A6OA 4X7SH 5E8EA 2EC9U 1H3TA 4GKSB 2E7CA 4R2GC 1CG9B 4JM2D 3D2UD 4D0BA 4XNMB 2AQ2A 3S98A 4GG6F 4PJ8B 5C0BD 3O4LE 3MRLB 3IDYC 1IJ9A 5T1KB 4IRJB 5TFSL 2VUOA 4GAGL 1ADQH 4XPBL 5SX4I 1GGBL 4ZPTB 2Z8SA 3VXME 3VGHA 1R3LA 4I0PD 5BVPH 4DQOH 3BH8A 3FZUD 2QSVA 2UUDH 3GBMH 2FEDD 4OZGB 4D0DB 4X7EC 1FORL 2BY0A 2YN3A 3Q6FA 5DJ2A 3S5LA 1SEQL 3CFKB 5ANME 4WWID 1XT5A 5LBSH 4XBEH 5CLTA 1S9WA 3KXFD 3GK8H 3LEYL 1S9XA 2PNDA 2B5IB 4Q9RH 4JDZA 2FEEL 5GRUL 5K59E 2NY0B 2OP4L 5E2TH 2R2HA 3VH8B 4UT7H 4L3ED 4PLNC 1E27B 2APVA 1LO2H 2WIIA 3QUXD 4JFOA 3WLWC 5JIKA 4DWHA 2VLRE 1J12A 3KPLB 3G5ZB 3HZKA 1I9EA 3SCMB 3TJEH 4TSAL 2ADGA 4HC1A 3V5DB 5FKAA 3LQMA 1E6OH 3M17A 3QAZC 3QCUL 3FRUA 1F00I 4U6VL 5ACZA 2NQCA 2AW2A 1FFNB 2F54E 2FJFA 3VXOA 4U1HA 4HH9B 3QIWD 4MVBD 1BD2D 1B4JH 1ZVHA 3G5YB 4GAJH 4M1DL 2ZCKH 5FOBA 4P4KA 3RY4A 5IEHB 1F4XL 4YK4C 1CXEA 4NN6B 4RA0C 1BOYA 1AP2B 3MLRH 2IH1A 1I9RH 4YEFA 1FP5A 3T4YB 1C12B 4LLAA 5ITFB 4PREB 3GBNL 2WUCL 5FYLE 1PG7X 2EDFA 4R2GB 3S3SA 5EBMA 5HDQH 3CNKA 4MJIA 5ITFA 3FN0L 3IDIB 1MFBL 1TZIA 1VFOA 2VLLA 4XBGA 5JQ6H 5C0GB 3IS1X 2A6JA 4NO2B 3UDWC 1KB5L 1ZSDA 1ITBB 1FSKB 5EZIL 5SWSD 3TVMC 4OTXL 3NH7H 4LU5H 4M62L 5C0GA 4KUZL 3WJLA 5I15L 1T04A 1JE6A 4QF1B 2Z92A 3RY6C 2VAAA 4CU8A 2QQKH 3DOSA 1JGVL 1A7NL 4M00A 3DYMA 2OXGA 3O6MH 4JKKA 2ERJB 2Z8RA 4HEPG 4UIMA 2WLYA 2XFXB 4C83B 2ICEB 2X9YA 4Y88A 1WUNT 4QCIA 4P3CH 1FYTB 3ZDXE 1JTPA 1BD2A 1UACH 4AY0A 2Z93B 1RY7B 3QIUB 5DVOA 3BMWA 1PYWA 4ZFZB 5J11B 2DMKA 1IGMH 3TT3L 1BZQK 4ORGA 1UFUA 3QHTC 1N26A 3D85A 4S1QH 3PWVB 4PJGB 1OAYL 1JNNL 4L8SC 3BE1L 3ROLA 2DQHL 5IVNA 3L7EB 1GPOH 3SHSA 1EMTL 1CFTB 4X9HA 2ADIB 5I74B 5GXBB 5ICXB 2EIBA 2ZOKB 1LDPH 4NM4H 4WHDA 1CXKA 4PTUB 3UROR 5MHSD 1NBQA 4XAKE 1Z2KA 1MIML 4PJDE 1DEEB 1LEKA 1ZT1A 3K8LA 1Z9OA 2VDOL 4BQ6A 3WO4B 3QUML 1AR1C 3LRGA 1FH5L 5DMKA 1MRFH 4KKNA 1ZT1B 5IM7B 5IFHH 1ZGLM 4JEGB 5DEGB 4O9HH 4OZHF 2R4RL 1DBBH 1K5NB 1CD1B 5FFLA 1C5CL 2NY7L 1CFVH 1YMMB 1UB6B 4P5TC 1WWAX 1NKOA 5IW6B 1P4LA 5JW3L 3WFEL 5IUSA 4RNRA 2NLJA 4LGPB 4RFEA 1XFPA 4AL8H 3DIFB 4OT1L 3D3VD 2DWDB 5CJOH 4OB5H 1JGLL 5SWSE 2Y07L 2DLGA 2V6HA 3IKCA 2VR4A 4F33B 5DK2A 2NCMA 1KTDB 3VH8G 4QXUH 2HTLD 3ULUC 4OF5A 1A4JB 3CC5A 1LNUA 5D1ZB 1PDKA 3STBA 3GSVB 3O6LH 4LAJH 1BFVL 3U0PA 5T1DL 2VL5A 1QSEA 1KBGL 1LO5A 5M7QA 1G1YA 5C9KA 4GKOA 2JB6B 2GJ6E 3GMQA 1SEBB 3T4AA 2Z31D 3B2UD 3UX9B 3DVNA 3EUUA 1HILB 3GSUA 5DA4A 2VR9A 2NYYC 1KCSL 3TYFA 3BIAX 4IJ3C 2BVQA 4YDIH 2ARJB 3QWRA 1MELA 3LKRB 4P46D 1PEWA 4JFXB 4DEPB 5JR1H 3BEVA 4JPWH 4WWKD 4JFHE 5EORH 5J0BA 3ULUL 1AQDA 2OXHA 4HS3A 1KEGL 1NC4B 4JLRA 3CSGA 4DUVA 1ZS8A 2FO4A 5LQBL 2AXGB 2XQBH 4KXZH 4XXDB 1OAXL 1KEMH 3QJFA 2FJHA 3CFBA 3PF2A 1LK2B 5F9WB 1MAML 1LEGB 4PJ9C 1OTTC 4CVZB 3WSQL 1MHEA 4FFZH 4NKOB 3CPLA 3DX8B 1PGRB 3K0WA 5HGHA 1M71B 4IJ3B 4H20L 5D1QA 3B9KA 5FHAL 2VZ3A 1AO7A 3B5HA 5HGHB 4FXGB 3QDJB 4FHBD 3O2DH 3TZVB 3Q6GL 1F90L 4M9PA 4AM0A 1SMAA 3FKUS 1LEIB 1Y18B 2DQFB 3ORJA 2FWOB 2ID5A 1CU4H 1PX4A 3BZFA 3ARGB 4ODTL 4G9FB 1EA9C 1U3JA 1I3RA 3QULA 4K7PY 2Q87A 5DMIL 3NIDF 5MEOB 5DRZA 3AU1B 2NNAA 1OF2B 3H9SA 3WN5C 4ETQA 2BSRA 1H8NA 2H3NA 5BVPL 2UV3A 5E8PA 2E9BA 4HIJA 4Q9QH 1OF2A 3H9SB 2IFGA 4GRMB 4QHKJ 5CJXA 2RB8A 4Z0BH 5IG7A 4NP4L 3VXRB 1S3KL 1R24B 1HH9B 4M5ZL 1S7VB 1HHIB 3H3PL 1IL1B 2A2QT 3RNKB 5IMMA 1ZHBA 3VFNB 1HI6B 2DBLL 1KG0B 1HHIA 5F9JB 3LKPA 1R3HA 3SPVA 4QRSA 5DI8B 4BFIA 3LHPH 3MOBH 2QADB 2W92A 3HE6A 1KPRB 2BSSB 3GMNB 1KG0A 3UYPA 1QA9A 3LEYH 3SPVB 5KN5B 2AP2A 4LLUA 2OK0L 1IZJA 3PDGA 4YBQD 4HXAH 1MRCH 5CZXC 5DD1L 4XH2A 5SWZA 4G5ZH 4LCCA 1Q38A 1UGNA 3GJEA 3QDME 3RVUC 4MHHI 1BGXL 5IEKA 1IILE 5ID1B 1MVUA 4JANB 1XH3A 3B5TA 4WUKH 4IHOB 5IKCB 1AGBB 4GH7B 2ATPB 4XXCC 5IESH 4EOWL 3MRJB 1ZOXA 2IH3B 1RUQL 2B4CC 4MQSB 1TCMA 4DKAA 3OXRB 5IMLA 3BPLB 4P5TB 2CGRH 4EDWL 3VFGL 1QFUL 4PJXF 4GFTB 3PWLA 2DD8H 2AEPL 1RZ7L 1OP3K 2XRAL 3WXVH 1Z3GL 2YS4A 1HZHH 2NXZC 2WANA 3H9SE 3ARQA 1U9KA 2VLRD 3V4UH 4RBPK 4F7PA 1UXSB 1I3GH 3MBED 1EEZA 4L3AA 4NBXB 2DQGH 3M45A 3VXSA 5E5MA 3J7HA 1NFKA 1EDQA 3IDXH 2PTUA 1PKQB 4X6CE 1CZ8H 3VFSB 4G80A 1YEDA 5C71A 3AY4A 1NFDB 3OAYK 4HV8B 2IAMA 3IF1B 1MUJB 1P7QB 4X9FA 5FUZH 4U1JA 2YUVA 3WUWG 1HKFA 5LBSL 3IXTB 2JIXA 5DO2D 5ETUB 3VXNB 4JQXC 4NQVA 4ALAH 2RIKA 2BNRE 3QFDB 1MUJA 4HJJH 1F6FB 3UMTA 3VA6A 4D0BB 2FIRT 4HKXA 4KI5F 3QRFM 1HXMB 4JE4B 4LL9A 2B1HL 4M8QA 4Y4FB 5KS9A 4D9QE 3GSNA 5IBUB 5K9KA 1D3CA 4OCWL 5EB9A 1YPZB 1QVOB 5E2WH 1FRGL 2G5BA 1A3RH 3BN3B 4N8VG 3OKLB 4WFGD 2W38A 1IAKA 3ROOA 3GNML 3D85D 4UAOB 2L7UA 3PHSA 2PW2A 1MCJA 3VMNA 3V6OE 5DJ2B 2D03H 4TUKH 4XCFH 3KLHC 4PRPD 3GI9H 2CIIA 2Y06H 5EUOE 4MQ7B 4JG0H 3U9PH 2P5WE 1VSCA 5CEZE 3JV4A 4RISH 5C9JA 2VN7A 1BJ1H 1UB5A 2DYPB 1U93A 5HYQB 3IYLW 4XNUL 2WWMC 3DV4A 2CKBL 4JVWA 3IFOA 5E2UL 1YYML 1S7TB 4AENB 1CD0A 4NKMB 5EBLB 5T33L 3UEZA 3ZKNC 4YQXL 1S8DA 2PYFA 3BGFC 4KI5C 1QLEL 1FZOA 3E8UL 1NEZG 3QHFH 1VKXB 3CX2A 7CGTA 5C0CB 1P4BL 3GJFA 5CSZB 4YIQB 2CLZA 3CXHK 1BLNB 2PCPA 1U3HB 4ONHA 4X7TA 4HUKB 3D18B 3O9WA 3HC3H 1U8MA 1J1OH 4YHKH 3CK0L 3QZWA 4G9DA 3MV11 4IMKC 5GIRA 3E6FB 2H9GB 3FB7B 4L4TA 1V3JA 4U1HB 2W1NA 3MJ6A 5C0RH 3K4DA 2XZQL 5CUSH 1T1ZA 4KY1L 2CK2A 2OZ4H 1IBGL 2BMKB 4HG4J 4GKSA 2APXA 2D31A 3BYTA 2NX5E 3DURB 4AEIH 5DFTA 4LPUA 1ZLUK 1LK3H 4OT1H 3ALPA 2R69H 1XR8A 3QH3A 5D5MB 2YRPA 3HRZB 5HPOA 3SE9H 3IU3B 4BK5A 1A3LH 2RR3A 3IDJB 2CD0A 2ORBL 1KJ2B 4LVOB 4CAGA 4F58L 4LSRH 4JPVL 3TT3H 4J3OC 2VLMD 4NN7C 1KULA 5EU6B 4MJIB 3IDJA 4Y1AB 4KDVA 1N8ZB 1SJHB 1RMFL 1V05A 1TZIB 3BIBX 5EZJB 4HUVA 2CLVA 3VGDA 2A6JB 4NO2A 3BKJH 4FQXC 4EN3C 3ZZ1A 1CCZA 3ULUF 3PGDA 5IOPB 1NL0H 2Z35A 3D69B 1KLUA 5C09A 5MI0B 3FONB 3LEVL 1FG9C 1NKRA 2Y5TB 4JRYB 4YH6A 4XC1L 3PJSA 2Y7QB 3L3JB 1LO4H 3OWEA 4NKIH 4OZGF 5DYOB 3SO5A 1OSPH 3VH8A 3VGEA 5I1AB 5TJWK 2E27L 3W9EA 4IRJA 1NGYB 5HYJB 1KFAL 1OGAA 4XZUB 4FTVD 2ESVA 5I1AA 5E8DL 4OM0H 3G5ZA 3HZKB 1FORH 2XWTB 1CXHA 1NBZB 3HE7B 3OKDB 5FO7B 2ESVB 4OCNC 3OZ9H 3LV3B 5I73B 3MYZA 1INDH 2ARWA 3O45A 3CAFA 5HYSG 2OMBA 3ES6B 1BWWA 4D0DA 5L8LB 3Q6FB 3N1FC 5GRJL 3S5LB 4LSPL 4O5LH 3GIZH 4PBWD 3UPRB 5D2NC 1Z0MA 3U83A 1UH4A 3LDBB 2HG5B 1N6QH 2UY7A 3F7RA 1I1AC 5ISZA 5F7FA 4KK5C 2R2HB 4MSWB 1M05B 1FNEB 1UM6H 3UJJL 3VXUA 2AERT 2EEBA 3C5ZB 1A0QH 4HCRH 5GQBA 5D1XC 1FPTL 5MEPB 1PLGH 5ERWB 5KSBA 4ODTH 1R0AH 1QR1A 1MOEA 3V5KB 2I60H 3BZDA 3HFMH 3QPQC 1MF2H 1BZ7B 1KCSH 2NXZB 3MLWL 4R7NB 1NBYA 5INDB 5GZNC 1DBAL 2QSCH 1AO7D 4RFEB 4BZ1H 2KDGA 5GRYA 1FIGH 1MCKA 1ROWA 1UJ3C 3OR6B 2RCSL 3HZMB 3TIDA 3ZDYE 4MJ4A 3GEWB 5T1LB 4PGJA 1W72H 5HVHC 3RVVD 2YN5A 1HSAB 4LCWB 2Z8WC 4U1SB 3Q48A 2W07A 1K4CA 3MRMA 3JXAA 4Y4HD 2FX7L 4WU5A 4MCZB 4J6RL 1BWMA 1JV5A 4I2XA 1K4CB 4EIZC 4WVRA 4OGZA 1P5VA 3O8XA 3U0PB 2QKIB 4WU5B 4OZGE 1FYTA 3WN5A 3BGAA 4BKLA 1JNHA 1CF8L 1I9JL 1FGVL 4LRIA 3DSNA 3RHWF 6FABH 1KJMB 4O2EB 1D9KC 4HAFA 4K9EH 1VADB 4HFUH 1RHHB 4OCXL 5F97E 3VXSD 3WFZA 1XR9A 5DK3A 3DVNB 1X5IA 5FHAH 5D72L 4ZUSB 3QCTH 1RZJC 1NCBL 1AXTL 2WWKO 1YYLH 1XR9B 4LHUA 3RWEB 4HIIA 4Y89A 2EXWD 4A2LA 3OBAA 3RI5F 2GSIA 1EJOL 2RFXB 1Q1JH 2PXYB 3AUVA 1UKSA 4L4VB 3DBXA 3G6JB 4MXQD 4M3JA 1ZLWH 3BSZH 2WBWB 1OAZH 2EDDA 2ICEA 5D2LF 5GRZA 2B20A 5LAXA 4NQEE 4JHBA 3WE6B 3RVTD 2PF6A 1NCAH 3ARBC 5DJDA 3HE6C 2H2PC 4JZOA 3O3DA 5IM7A 4ZFZA 5SX4H 4WI9A 1P4IL 5H94B 4LCWE 1DVFC 5ABDE 1BOGB 5E1HB 5E1AB 3TPUB 1E4KA 1FGNL 5KBNC 5E1AA 2CUIA 4V1DE 4EUPB 4J3TA 3BISA 3SGJC 3R1GL 4PIRF 5JLZB 1CLCA 1WZLA 3QIUD 2H8PA 1T83A 4URTB 3REWA 2B1AH 3RL1B 3TNNA 5JHLL 1D5BA 2MQ3A 2E6JA 2R0KH 1ACYH 3K81A 3MGOB 4E42B 4KAQH 3RWHB 1WIOA 3FQWA 5I15H 2X10A 1QLFB 5EU4A 2NY2C 4I3SH 2R4RH 3MRRA 5JORA 1ZT4B 3MCKA 4JO2H 5E03A 2NY6D 4FFVC 1RK0B 3MLTB 3RTQB 3FL7A 2XA3A 1EK3A 3PGCB 3S5LG 5JMRA 1A02N 3LRSA 3SKOB 3LKSA 1U41A 4KHXH 1QHOA 3JV0A 3BP5B 5D6DC 4KKBC 5E99L 43C9A 1JF1B 5IESL 3WIFB 5GJSH 1XF2B 3JUZA 2FD6H 1JHTA 4FXLA 4ODXA 1GGBH 1IAOA 2X4RA 1N6VA 3WIFA 3DRQA 4JFDA 5HVHB 5DC0A 3LKRA 1IGTA 3WIHA 5L2KA 2P24B 3VFTB 4L4JA 5DI8A 3QDMA 5TE7H 4BFIB 3CX5K 1FH5H 4LBEB 4BQ9A 1J1XH 3STLA 3QXVA 5D6CB 3GBML 4RISL 5C0AD 5IFHL 4M7LT 4BUGA 5F1NA 5JO5A 1X5XA 1V7MH 3BAEH 4L8SA 4JRWA 1IAIM 3V6ZB 5D6CA 2EIZA 3EFDL 3GSWA 4LVNC 4Z6AT 1CFVL 1CDUA 1IC1A 1L6XA 4UBDC 4FG6D 5BXFA 4XH2B 5GGSA 4DUXA 3BKMH 3S36H 4LCCB 4XP5H 5DJ0B 4G7VL 3WUWA 1JFQH 5C0FA 4JFOB 1GC1C 5L7XL 3J8F7 2EXYD 1I1AB 5SX5K 1MJUH 4PRPB 3BP4B 1FYHB 4AMKH 1FG2B 5B38A 1QP1A 4G7YL 1HYSC 2C4XA 4P59L 1SBBA 1CBVL 3FQRB 2EYRA 1BFVH 1CE6A 3F58H 1Z0NA 2XQBL 3VJ6A 3CFDB 3PP3H 4E41E 2ZOLA 5DJCB 5E95B 4NQDA 3VGAB 5DUPH 2OI9C 2VDKH 5I73C 4U4BA 4JLRB 4APQB 1JGLH 1MAJA 5HI3C 3QQ4B 4ZAKD 4X8JA 1U8IB 4FQJH 3HZYA 4GMTH 4HLJA 1OTTD 2F8VA 3PWPE 3P0VL 4UDTB 2BY1A 2LU7A 5IIEB 1H15B 4MLSA 3BRFA 2EDYA 2DLFL 5IJVB 4XVSH 2JIXB 1BX2A 5D1QB 3VXRE 2X4QA 2YWZA 1BQLH 1KEGH 4NQTA 4M7JH 4PGBA 4PGDB 4Q6IC 5EZOH 4KK6D 2EH7H 4PJHE 1DSFH 4P4KC 2W0PA 4AM0B 1V7NH 3FN0H 1I1RA 4HFWA 4WI2A 3IKKA 4OF3A 1I8KB 1T2XA 4TUOB 5A16B 2MKWA 3P4LA 3MRBA 5DHVA 5IVZA 4GAFB 4JREC 4FFZL 5J11C 4PRPE 4JPKH 3OKLA 1EAPA 4AG4L 1I1FB 5HHOD 4NM8L 1DZBA 4YWGH 1NAMB 4M93C 1U8LB 1DBML 2C5DC 3SDXE 5AYUH 4E0RB 4UIMB 3V0VA 4QOKE 1I9IL 4WO4B 1T4KA 5I6XB 1GGYA 4IHOA 2G9HA 2E7HA 1Y0LB 1IBGH 3LHPL 3MOBL 4ZFOB 5I1GL 1I7UB 5KOVC 2Y4SA 4YXKH 5IW1A 2IQ9L 5DD5H 5C3LD 2GK0A 5F7LB 1IKFH 4BFBD 4WO4D 4YC2C 3STZA 2VZ1A 5LJYH 1KB5B 1S7TA 1KB9J 4JFDD 4M6NL 4N9GA 3SGDH 3G08A 3I6GB 4BZ2L 4QXWA 4BFEA 2PR4H 2V2WB 1IM3A 3QXDB 2DMCA 2X70B 3RKDD 1YN7B 3SCMC 5ICYA 2Y9RT 3Q6GH 5D70H 3CVHB 1HKLH 4GOSA 4PTTB 3GKWH 3KPOB 3W0WB 5B4MC 1S7UB 4YGAB 4RSVA 3F65A 1TVBB 2VZVA 4IRJD 4AT6A 4JFHD 5D96B 1A1OA 1OGTB 4PTTA 1K8DB 3ARUA 2QQQA 2J88L 5BS0A 3F8UB 1M7DA 1G84A 4TTDC 1OGTA 1MFAL 3VXNA 5BS0B 3MJ9H 1FFOB 4PP2B 2XKNB 3PP4L 3EDKA 1LO4L 1MCFA 2MNUA 2I9TA 4OUOA 4QTIL 5I1KH 3JVGA 4BZ1L 2X4PB 4RWYL 4GRWH 1EIBA 3TBYA 5DZNA 2X7LB 2LAGB 5I8OL 2YPVH 4NGHH 4NIKB 2OL3L 5D7IA 1GH7A 4XNMA 4NQCD 4WUUB 4E41A 1ZHKB 4P46A 3L9RA 3OF6D 4UV7L 4KZEL 3BPOB 1VGEH 2G5BB 4CVUA 1EEZB 5FUZL 3KPRD 3U36B 3QUYD 5E7FA 3O3BA 5EOTB 3ARXA 5EUOF 4L29B 4TQEH 3HMWH 1RUKH 3LQZB 4HGKC 3IDYB 4OLXL 5DJ6B 4YDLC 3SO3B 1SYSB 2EDHA 1RHFA 5E8OA 1MSPA 2Q76A 3I02B 3UAJC 4PR5B 2CIIB 3THML 2DDQH 5F1SA 4DOHB 4XCCL 3IDMA 2EDXA 4XI5D 1UWEL 3CH1A 1Q94A 3BE1H 1Q9LA 5D93B 4MD5B 1S5HB 5MENA 3G6DL 4HKXB 3HAEB 1UM6L 1YEGL 1B2WH 5TDOB 2XYCA 3RPKA 4TN9A 2IAND 5DURD 2LE9A 1CZ8L 1IC4H 1T03L 2W9DL 1X4ZA 1AXSB 3MLUL 4H25B 5F7YC 5C0CE 5ICZB 4X6EB 4Z95H 1QLRB 3HFML 2JELL 3LPFA 4JAMB 4YXHH 1AXSA 4H25A 2JJTC 3KYOA 4IMKA 1U8MB 3NAAL 3O45B 4HC1H 4JDTL 4Y4FD 3T0EC 1QSZA 1J5OH 1Y6MR 3GIVA 3MMEB 1FIGL 1I3GL 2XACC 4O9HL 4HS8L 4JFYA 3KR3H 5E2UH 4MQ7A 5JPMB 4PS4L 4JFZH 3GIVB 3MMEA 5T33H 3IGAA 3HTLX 1RAMA 5LQBH 1K85A 4NC2B 3D48R 1YQVH 2WBJB 2OX5A 5HPMB 1FRGH 2VC2L 3RVXD 1PEZA 1J9CT 4G43B 4J6RH 2HJLA 3EJYD 1B90A 3P9MA 4NKOA 1RUML 3CPLB 3VU2A 4HUXB 4R90L 5CEZH 1FJ1A 5IT2H 3UTTB 3EBAA 2FR4A 5I1HL 2ZJSL 4N0RA 4HKJB 1CE1H 3MRGA 5CWSA 3UJIH 4Y5XB 1KTKE 2R9HD 1FBIL 4P23B 2Q8AL 3ULUE 4JQVA 1GRWA 1MWAA 4YXLL 3KPLA 3K80A 2YD4A 4Y5VC 5EZJA 4HUVB 3S8WA 2ADGB 5E2WL 1UENA 2W60A 3GJFK 4S2SB 3FB7A 3CZFA 1YMHA 2AGJL 2B8OT 4OZFH 2ZUWA 3RUGE 2ZUXA 1GCFA 4XMLH 3WJJA 5I1CL 3VW3L 5BQ7B 5E0QA 4NJ9L 3LKNB 2NW3A 1RJYA 2CUMA 3GMRA 5EOQH 4F9PC 2V7NB 3VDCA 5ELIA 2JJSA 1T7ZA 2NXYD 3ZDXF 2MHAA 5DYOA 3K46A 1BVKB 1I8IB 2H41A 3SKJH 1I7TA 3T09A 1TENA 4KTDL 4OFYD 2H26A 1T83C 3WN5B 3O9WC 3DYOA 1DVFD 3QI9C 4IMLB 1NGWB 4QRSB 5T3XD 3V7MA 4JZNA 4OLZL 5J6HB 5HHOE 5L8KB 3VFRB 4FQHB 4GO6B 1WSST 4YR6A 1KPVB 4PJBA 1WFOA 1IVLA 1QFHA 3QQ3B 5SV3A 5FUCE 2A6DA 3RWGB 2CLRA 4JY4A 4U1LB 1N5YL 1PAMA 3MPCA 4MDJA 4XVTH 1FE8L 4PGZA 1ZANH 3ARZA 3OQ3B 4N1EA 2IPKA 4U1LA 3UTTE 5E8DH 3O2DL 3BO8A 4Z7NE 1NFIA 1A6WL 3RWCA 2AABH 1EZVY 2KQMA 2IPKB 2OJZL 4QLRA 1MFEH 1T22B 4PTUA 4W6WB 4C56A 2PN5A 2P8MB 4UOJA 4AQ1B 3JTSA 4POUB 5FYKL 5FF6B 4TULL 3V5KA 5IB2B 1FAKT 1SYVB 1NPUA 1A6VH 5A1AA 4I4WA 1MFCL 4B5EA 2HWZL 5IB2A 1CDBA 1MAKA 3DO7B 1MHCB 1KCLA 4MNHB 3V2AR 4KQ3H 2X4TB 3NCCB 1YMMA 2DI9A 2R0ZH 4XGZA 5T3ZD 5IW6A 1UYWH 4M5ZH 2E6PA 4LEXH 3MFFB 4G42A 5F7EL 1HSAA 4LCWA 5EA0L 1JHKL 2V7HA 2DM2A 5ISZB 2E7LA 4PV9A 3HMXA 3IXTA 5I19L 3PUCA 2VJXA 1DQLL 1V7NL 3LIZL 5KW9H 3O0RH 1LNUB 5D1ZA 1DEDA 5FUOL 2XTJC 4P2RA 5IROA 3G04B 1GVIA 1JWUA 3C60A 2W65A 4GAYA 5E6ID 1ZHLA 3NCBB 3QSKB 4JKPL 2BY3A 2BXZA 1IGIH 5DLMH 2E3VA 3MUY1 1LILA 5JDJA 3LQAL 4Z7OE 2EZ0D 2ZSWA 1MJJB 3HI5H 1IAKB 3ROOB 2EDLA 5EO0B 3FT2A 2HLAA 4J4PA 4X83A 3WS3A 5J57B 3MUGA 5K9QI 2A9NH 5DD6A 3TYGL 4Z7QF 3WFHB 3EIFA 1RK1A 4JGJA 5JO5B 3AROA 5DD5L 3VXQA 3TLRA 4LLDB 4I2XB 2DD8L 1SJEB 1BJ1J 2Y06L 2DOCA 3CGTA 4IS6A 1V3MA 3F7VB 3PQYE 4TNVK 2BK8A 3RU8L 1F97A 5IQ7L 5GS0C 5DFWH 5D2NA 1DN0B 1DBAH 4XX1G 3PXJA 5FDWA 3ARYA 5ALBH 7FABL 5E9DD 1LQSR 3QIUA 2VQ1A 1KOAA 4WWKA 4QRRD 3BYYA 4PJAF 5DJXA 3PGFH 4EBQL 4RDQF 5I8KH 5KJRL 3PV6A 3REVA 1FNAA 1OHQA 1DQJA 2CMRH 4M6OH 1X5JA 1Q1JL 1FG2A 5B38B 1J87A 4ZO9A 2MPAL 4HIEB 5I1LB 3QIBD 3B83A 2XG4A 3LSOA 5DUBB 3MA9L 4OZIF 3PV6B 4OUUA 3D9AL 1CXIA 3SCMA 4JFDE 3BHBB 2R4SH 3LKQB 4DGYL 4KRPD 4M7KL 4RAUA 1IC5L 1I7RA 1X9QA 3TPKA 1SQ2N 3TZVA 3CFCL 4NUGL 3FRUB 2XN9D 5I1KL 2EC8A 4HMCA 3OTTA 4RAUB 4AG4H 2HH0H 4O58L 1Y18A 1WWCA 4R6UA 4NM8H 4L3CA 4LRIC 3QG7L 3EW3B 2I07A 4S10A 5DJYB 5DJDB 2DI7A 2X9WA 2WK2A 3T3MF 2I07B 5B3JE 5KSAC 3UYRH 2HAZA 1RUKL 2DICA 3SOBL 4F9LC 2UWEF 4BH8B 4PJ7F 2H3NB 1U8OA 3BZ4B 1WQVT 1JHTB 1IKFL 3DUSA 3AVEA 4PJHF 3O9WD 2MQ0A 4LVHC 1A7PL 1FLTX 2IC2A 4FXGA 4PPTA 3QDJA 3DUSB 3QCTL 4LBEA 3TVMB 1HSBA 1WCQA 2NZ9D 3IJSB 3OGOE 3LKPB 3RWHA 4F15C 2NY4B 3PGDB 5IOPA 3TBWA 4WDIA 4DFHA 4LSVL 1LEIA 2EIZB 3P40A 4KGJA 5EUKA 3KPMA 1WICA 4NZRL 4PJHA 3VMPA 1OQOA 1A1MA 3H2WA 4TUJB 3MLUH 4LEOB 2BOCA 3R1GH 2IGFH 3SKOA 3O6FA 3QYCA 3HC3L 1W8OA 2DB8A 1GIGL 2G9HB 4MNGA 1D5IL 3H0TA 4KJWC 5ESQA 1LGVA 4D9RE 2LAAA 2XWTA 3CVIH 3BAEL 1BEYH 3GSQB 4V2CB 5C0RL 1I8MB 1VACB 4FQ1L 3EDFA 2AI0H 3F12A 4ZS6C 1IARB 3NZHH 1VFUA 1FGNH 3MV8D 1MCQA 3QXWA 3SJVE 4K3EH 5C0CD 5CBEA 1CL7L 4XP9H 3ROLB 5JOEA 5IR1B 3T2PA 2XQYG 4GXVL 1D5MB 2FZ3B 3KAAA 4FN0A 3CDFA 4HJGB 5HBBA 2JE8A 1TVBA 2VNCA 3LQAC 3ABZA 1MJUL 2ADIA 2B4CL 2KQNA 2MWCA 5HY9B 4XP4L 4HT1H 4ACPA 1P69B 3GGWA 3W81A 4PJGF 3B4NA 3S4SB 4I3SL 3VFSA 3TT1L 4XCCH 2R2CA 4KFZC 3VFVA 3PXHA 4PD4K 4HCRL 1E27A 4QXGH 4JDVA 2XZAH 4U1JB 3MUHL 1B88A 5EU3A 2HMID 2PYEA 4MYWB 4ZPVA 5ETUA 4OKDA 5DUPL 3U30B 4LGRB 4QHKI 2CDFB 3EFDH 1WBXA 3H9YA 2P46B 4UNUA 5EN2B 4AQOA 3RX7A 5EU3B 5IMLB 1U92B 3DROB 1FNLA 5C07B 1KXTB 5A16A 4NSKB 4JVUA 1JYVA 5IVZB 4PBXA 3A0OA 4ZFGH 1AQKH 2R0LH 3WS6C 2NLJB 2GEEA 5F3HB 2ENYA 5GGVH 4Y5VA 1E0OB 2VXVL 3H7BA 4KTDH 1AHWC 3AM8C 2D4DA 5IEHA 3BKCH 2K9UA 3QFJA 1QFPA 3TH4T 3VMOA 2QKIA 4DW2H 4F2MB 4BUHA 5HHQA 4X6CF 1XIWC 4JKMA 2F54A 3B3IA 4ERSH 5JDSB 2BRQA 1I7UA 4KV5E 4PGDA 4PGBB 1TVHA 1QSEB 4U0RC 2VWEC 1XAUA 1CN4A 4ZOEA 2F54B 2AV1A 2AKRA 2R23A 3EYQD 3IRPX 4O4YL 3I85A 4K71C 4F80A 3C08H 4TUOA 4X8XA 2V5YA 1GGIL 1IC7L 4P57B 4PRAB 1WC7B 1CVRA 1MHPH 3GSNH 1NCBH 2A1WH 4I0PC 3V4PH 2IFFH 2VDRL 2K7PA 2VDMH 5EBWA 4FQ2L 1T04B 5IB4B 1PLGL 3SQOH 4UAOC 1EJOH 1T80A 1FZJA 1R5WB 5TE4H 3VD3A 5TDNA 4N8PA 1NGXA 3GI8H 1MCOL 4CDHA 4NJ9H 4UU9A 4LASL 4HWEH 3DGCR 1LO3H 1Y0LA 2SEBB 5CILL 2DS4A 2LTQC 3ARDD 3VI4F 5D93C 4PJ8C 4P9MH 3QEQB 5F6IC 4Z78B 5KANI 5D7SH 2YR3A 1ODAA 2SEBA 4U0RB 4JPKL 3STZB 2RQ8A 3BPNB 3U0TA 2OZ4A 1MCHA 1IAMA 1GHFH 1BREA 4H1LB 4MHHG 1QPPA 3DURA 3GDBA 3MLZH 4M1GH 1IMHC 1Q9KA 4N68A 4NWTH 2F74B 1BQHB 1L7TL 5DDHA 3MRGB 5CWSB 5EFIA 4I0PA 1JPTH 4O02H 5DGQA 3TA3D 3BZEA 1MFAH 1ZEAL 4PRBA 4WEMB 3LQZA 4PJ8D 2ZSVB 4FQLL 4KDTA 4KKLD 1NC2B 4U49A 2IQ9H 5ILTH 4LRNL 2JJSC 1U6AH 4MS8D 4ZMAT 3LH2H 3SDCC 2ZNXA 4PJFE 1RJYB 1GSMA 3S97C 2HTKC 4QNPE 4WNQA 5GGTH 2NXYC 4KTYA 4ZUUA 4H1LH 4JQIH 3AU1A 3BP6B 3HAEA 4FS0A 5A2JH 2F5BH 4HWBA 1MCPH 3PJSB 2D31B 4HIJB 1MWAL 1T5XA 4WUUA 4IRSD 2C3GA 2CKBA 4PUBH 5A3IC 1SMOA 3L9RB 4KH2A 3FRPA 5C2BH 5I17B 3PWPA 3PL6C 3F7YB 3EOTL 1HI6A 2MFNA 1EHAA 5I8EB 1A47A 1QFOA 5F1NB 5TPWL 3CFJB 2OL3A 4Y1AA 4J3VA 1SYSA 5DK2B 2EDRA 3LD8C 2BSSA 1R3LB 4RWYH 1F6AA 1TFHA 2Q76B 3RGVC 4ZXBA 4HWZA 1X5KA 4LCUB 2EKSA 5IVXE 3IGAB 2VB5A 4OQTA 4PJCF 4MD5A 1R5VB 1P2CB 1G0DA 3FCTA 3WUWB 4U1KA 4P2OA 4YGVB 2JB6A 2D7NA 1H3WM 2GJZB 5A2LH 5I16A 4LLYA 1UB5B 5HYSA 5JHDB 4JPIA 3DV4B 4NQXA 5GRUH 3EYUL 1J5OL 4BSVB 4K8RD 3MLVH 5ICZA 2AJZB 3FQNB 1FZOB 3CXHJ 4OBRA 5F71A 2H32A 4X6FA 4EIGB 4L8DB 5I8OH 4G8GD 5DLML 4Z0XB 1SYVA 4JFXA 1DQMH 4HUUB 2PCPB 2IBGA 1CFSA 4X7TB 5H35B 3WLBB 3CLEH 4KROB 4Y8DC 5D7JD 3WJJC 4DGVH 4D9QD 3IXAA 1BBJB 5CHNA 1AQDB 4JCMA 3S6CA 4F15B 1BM3H 1SHMA 4M03A 4R7NA 4I1NB 4MJ5B 2C26A 4L4TB 4A6YL 2FD6L 1YECL 3R8BB 4P4KD 2AJYL 1MIEH 5I1HH 3OR6A 3QI9D 4XXDA 2D0GA 4M4RA 1G7MA 3PP3K 1PG7H 3DI2B 3RBSA 2Q8AH 2J3SA 3IF1A 4HDIB 1G9EA 2H26B 4PJ9A 3ZSSA 1V7ML 5KSAB 4DKDC 1AC6A 2EDWA 3ARDA 4PJ9B 5I1CH 5GPRA 4TNVF 1RJZB 1HXMA 1KC5H 1F4WH 4FQQB 2W9DH 5FK9B 4G7VH 4U1GB 1VADA 4OLYH 1AJ7L 4M1CD 1RJZA 3EFFB 5GS1A 1AKJD 1BIHA 3QUZC 1YMMD 1QBLL 1CTNA 4XPFH 1NAMA 5F9OH 5GRWA 4MDJB 1EHLH 2YD6A 3RGVD 2PO6A 5JOPD 1QG3A 1NLBL 5IHUH 3O2WH 4AEFA 5E9DE 3MRMB 3QG7H 4KRNA 3RWCB 1KCUH 3SBWC 4N0YL 3DMMD 1T7VA 3B9DA 1K4DA 4H0GA 4JFEA 1A6ZA 1W72A 3WBDA 5D4QA 3JWDL 3DXAD 2GYSA 1E4JA 5AZEL 4IMLA 2YSSB 4PG2A 5MEQA 2YHGA 1MLBB 4XZUA 3WKML 4G9FE 1NEZA 5E6YA 4F7MB 5DS8A 5FXCH 3RGHA 5A3ID 2X70A 4D3CH 2FECI 3HRPA 1ZLSL 1K6QH 4JFFB 4KQ4H 5DQJB 3C8KA 4QOKD 2Z93A 5DVLA 3ARBD 3CLFH 5TQ0H 1NCDL 3KYMB 4DZ8A 2FL5B 1FDLL 2I26N 3DX6B 1YJDC 2X4OA 2A6IB 1YUHA 4FRWA 1D6VL 2BOBB 5FV1L 3SQBA 3W82A 2ZKHH 3VW3H 1PVHA 2DBJA 1A8JH 4ONGH 4NCC2 2ATPA 1T20B 2WNGA 3MNZA 2C4FU 4KTEH 1MPAH 3C09C 3OXRA 1N2RA 4KQ3L 4XMKH 2HLFC 5I8CA 1XGPB 5ITBH 5IJKC 3BVNA 1BVLA 1XR8B 3PWUB 4WCYH 3OKEA 1FQ9C 2V9TA 3KPSB 3WNMA 1U8OB 4LSQH 5BZDB 3JSSA 2IQAB 3NIGE 3CXDH 4OQTL 1VGEL 2ZUVA 4NFCA 5EOTA 4U6YB 4OLZH 3ARDC 1XF2A 1NBYB 1QFWI 1KENL 3QUXB 1G9NL 2I5YH 1I4FB 3LIZH 3OJVC 4PJFF 1RUPL 4V1DB 5AZ2L 1DLHB 3BP7A 1HSBB 1N64L 3QUXA 2WMPA 4GQ9H 2WWKT 4V1DA 4P5KB 4K8RL 4R0LC 3RHWK 1KV3A 3RVVC 1CGSL 1G6VK 3C5ZD 1RURH 4JY5L 4L8SB 4HKBB 5DJ8A 4P2RB 3FONA 4Y0GA 3DV6B 4TTGA 1JTOA 3GSRB 5DJ8B 1IKNC 3QO0B 2ED9A 2Z91B 4N1CA 1T0NB 3EYQC 5EA0H 3SBWA 4EXPX 2FO1A 1CG9A 2DKSA 3SDAC 3BP5A 3U1SH 3QEQE 43C9B 5CEZD 1CD9B 2YZ1A 4H5SB 4MA8H 5FM5M 1EBAA 4J12A 1MCOH 1H5BC 1F2QA 1G9NC 2CSPA 3OJDA 1LO3L 3DRQB 4JFDB 5IQ7H 1IGJB 3NAAH 1I7RB 5ESVA 2GFBA 1AGEB 5D7LB 1IQDA 4HPYH 3CU7A 5AYQA 3ULVC 3FOLB 1LO2L 3RI5K 3C5SA 4D8PA 3NCJL 4OKVA 5E56A 3KLAA 5HHME 3EO9H 2YZ8A 4XCYA 5KW9L 4EI6B 2E7MA 2FO4B 1OAXH 1XGTB 2EE3A 2O5XH 3O2VH 1P1ZB 4DGYH 1A6AA 5DR5L 5DT1L 1S8DB 4YE4H 5FV2A 2ESVE 1BOGA 1U0QA 3RIAK 1VKXA 1A9BA 4PJIA 5I18H 5BV7L 3MQIA 1JL8A 4B50A 2CDFA 4YIQA 5EN2A 2CLZB 3UJIL 3KJ6L 4CVZA 4MS8C 1L0QA 2WP3T 3GFUA 4Z7WB 2CRIA 4GW1B 2OR8A 1RZIB 4YHZL 4WEBL 1AHWA 5CEYB 1D5BB 3Q1SL 3SCMD 3P2TA 1FO0L 2NY1B 4Y5VB 3Q2CA 1B9ZA 3TBTB 3QAZB 4KK6C 4QHMA 5DC9B 2CO6B 3FFCD 2E5EA 4A2MA 1VEPA 3QFJB 4ZS6D 3TBTA 4XI5C 4L1DA 1U8LA 1UZ6F 4M7KH 1H15A 4P9HH 1JV5B 5GGVY 3H0TB 5F7WC 3IU4H 3B3IB 1P7QD 3WMSA 2QEJA 4ELMB 1TVHB 3MFGB 4KUZH 4U3CA 3KPSE 2KH2B 3PGFL 5FGCB 2R0WH 2Q7YB 3EYVB 3U7YL 1YMME 4K7FB 4X7DC 1KPVA 2LU3A 1SM3L 1IL1A 2ATKA 1NFDE 4L9LC 4MB5A 4O02L 3FZUC 1E4WL 2AJUH 2V2WA 1IM3B 4NDMA 3MRBB 2ICCA 2ATKB 5DHVB 2OYPA 5BRZD 2FZ3A 1GIGH 2V5TA 4PJHB 1WAAA 4NJAH 1J7VR 1I1CA 5CSBA 1EFQA 2PYED 5J13B 2Y7QA 3L3JA 4MLIA 2PXYA 4WHYH 3OR7B 2C4FT 3O6FB 4G6ML 3DBXB 2AABL 2J7LA 3SDCD 4HJ0C 4JB9H 4MNGB 2UZIL 2FB4H 3LZFH 5E6ZA 2CQVA 5SWZB 4JDVB 3O6ML 4IRJC 3WFEH 4H8WH 5IF0A 3GJEB 4UUJA 1I1YA 3GSQA 5TE6H 4XMLL 1VGKA 4XNZC 4L9LB 5FGBC 1CL7H 2PTTA 3UYRL 4WTZA 4OB5L 4EOWH 3U4AA 1KTRL 1WCBB 1N5AA 3ZKQD 3S35H 3FQRA 4B0MM 3HC0B 1S5IL 3L1OH 4MNHA 1QBBA 2XG5A 1A1NA 1U8JA 2IGFL 1AI1L 3G08B 5C0IA 4P5TA 2JK5B 4N90E 3UZEA 5EFIB 4KWUA 3SO3C 3WHE0 4YDLB 3LCYA 5DJCA 3GRWH 2P1YA 1BJ8A 4LVOC 2E9JA 4N5ED 5TPWH 1YY8B 1YEKH 1G9ML 1RFDH 4GQPH 3S9DB 1RZKH 3MR9B 1WVZA 2DJSA 4LLWA 3VXMA 1ZGLB 3V7AG 1WT5A 3GKZA 4WFHD 3SGKA 3B9AA 4XNXH 3MYJB 1F4WL 4U31A 2YPKB 3G5XA 4HV8A 1IAII 4Y5YA 3MYJA 3EJJX 3T65A 2F53A 4JKPH 2F58H 4V2BA 2ZUUA 5E8NB 4GBXD 3EGSB 4Q6IA 2AK4B 4ODBD 2CKBB 4K8RC 3LQAH 4PRIE 2F53B 5DFVD 3ZKXC 2R39A 5D7IB 2M8XA 1JBJA 3HPLA 4L1HA 4ZOBA 5K93A 2X4RB 3MXWH 1DQML 4LNRB 1FV1A 2P8LB 3WFHA 3HPLB 1S7RB 1OTSD 3HB3D 5IB4A 3EOBB 2XPGB 3VFTA 1A3RL 2IMNA 4AL8L 3BGFB 1F3DJ 4OQ1A 1SJEA 3KYOB 2OLDA 4D9LL 3EOBA 1QNZL 4PP1C 1T1WA 5CAYB 4YDIL 1QRNA 3WUZA 3FB6A 4HZAA 5BXFB 3QUYC 3VI3E 4OFYA 5DJ0A 4WWKB 3U9PL 4TYUA 3HAEH 1AE6L 4LLYB 4DCQA 4ELME 3FB6B 3REVB 3QO1A 3OKMA 3OV6A 3U9UA 3NCMA 5C0FB 1T2QL 3CSYA 2NY2D 4LKXA 5JIIA 1YYMH 3QG6B 4DW2L 2K7QA 4H88H 4IDJH 2F9BT 4AEEA 5C0BB 1RZFH 5EBLA 4ERSL 1F4YH 1HEZB 1KJ2H 3SE3A 5C0CA 1OSZA 4HCRA 2YEZB 4PJ5E 1IGIL 3RP1A 3BDXA 1OAUL 5JR1L 1NANH 2AJXH 4NRXA 2Z0BA 3VE0A 5AAWA 1E28B 4PJEA 3GSOA 2APFA 4QTHB 2CR3A 4M1GL 3WHE1 4J1UB 1NC4A 1FFOA 4PP2A 4XT1C 2FIKB 5HVGB 5J6GA 5IB5A 4WW1A 4X99A 4Z7OF 4I18C 1DDHB 1S7WB 1CU4L 1EGJA 3BUTA 5LCVL 3CFBB 3MRHA 4X9GA 3KPPA 3V6FB 4NUJB 4RGMB 1KPUB 1LK3L 2A73B 2ADJB 1T1XB 3WSQH 1K2DA 4RGOL 3DX8A 5E24E 4E41B 1ZHKA 4P46B 4UT9H 1FL6B 3W0WD 5JLZA 5D5MA 3NFPA 2BVOA 1WTLA 3REWB 3RL1A 3TNNB 1MVFA 3IU3A 2RJMA 3MBEC 2P5WA 3JWOL 5GGTL 1CLOH 1OWWA 4I3GA 4IIQC 3RX5A 3VFMB 5DTFB 1GHFL 1S3KH 5IV2A 4N8VA 1YQ2A 1VFAA 3I02A 5I71C 4KJWD 1G7QA 1L4IA 1VPOL 1FFPB 3P73A 3C2AL 1G6RH 4JRXE 1EO8L 3I3BA 4Y16B 3GMRB 4F37K 3PWJA 1ZEAH 1QEWA 1C7SA 2NY5H 4F7TB 4KPHL 2JCCA 1UZ8A 1P5UA 3TH3T 2FHFA 4X6BB 1K4DB 1NUGA 2XTJD 1HWGB 3NH7L 1CGWA 3TV3H 4HGWB 5GGUB 3L6FB 3CZJA 2QR0A 3F7YA 5ITBL 5E5UB 3F12B 4P2OD 4NP4H 4GRWE 4C56B 1B6DA 3NA9L 5LGJA 4FQ1H 3IDXL 2QQLH 5HI4C 2MCPH 1KB5A 4N9GB 1H5BA 1MFNA 2VSCA 3LPWA 4Z7UF 3G6AB 2YD9A 2GSGB 3MA7A 4PB9L 1CGVA 3C8DA 4FQHA 4LCUA 4U6VH 1XMWA 3MSPA 2OR7A 2AXJA 5HY9A 5DT1H 4NZJA 2G75B 2CLRB 4HHAB 5KSVA 3P11L 4RFOH 4LSPH 3KVQA 3WJLC 3QIBA 5GGSY 1RZ8A 3MLVL 1JK8A 3PWPD 1A7PH 5D8JH 3VFWB 2QL1A 4DK6A 1MRCL 4ZS7H 2A38A 2R1YB 2WP3O 3UPRA 4G5ZL 1FNHA 1G7JB 1AH1A 3E2HC 3K4AA 1FL3A 1JI1A 3UTTA 4JGMA 2Y36H 4FNLH 1KN4L 4HK3J 1H0DB 4YBLB 1ZVYA 2QBWA 3Q5YA 5GGQH 5KTEH 4NSKA 5D7IF 5SWQB 1L6ZA 3AREC 1CE6B 2X44D 5MEPA 3W0WE 5BRZE 3DVGB 1MFBH 3TNMB 5J12B 4X7CC 3OAZK 4X98A 4I0CC 4Y2OA 4APQA 3MRQB 1YC8A 5EZIH 3JBG7 2UZYB 3UBXA 1MRDL 2VXTL 2VXVH 4X4XB 1UXSA 1LWRA 3S36X 1V5JA 4P5KA 1G7LA 5IIEA 5BJTA 1JI2A 5DD6B 2BRRH 2V7NA 2JF1A 4Z7WF 5DFVC 5KZCD 1WFTA 1N3NB 2A74B 3O3AB 3MV9A 2J8UF 4YBLC 3O3AA 3ECBB 3QO0A 2NTFB 4I5BB 5CEXB 1T0NA 2H2SC 5AWNH 2PO6D 3ZTNL 1HWHB 2IF7A 2XKSA 3C8KB 4BSJA 3VWJB 5DJXB 3PE9A 5C0EA 4UB0H 3GSXB 4ZAKB 2IMMA 3MV8A 5J06A 4FQ2H 1DCLA 1HQRB 4UOW1 2AQ3A 2EH8H 4WEBH 4WFHE 1U8HB 4MXVE 3VXUE 5B8CC 3I50H 1UEMA 4R7DB 2CKBH 4Q7DA 3MV8B 3R0NA 3SDAD 3X12B 2BZDA 4HLZH 4MX7B 1J0HA 4NC1E 4PJGE 1DN2A 2YWYA 1QLEH 4R7DA 3MBXL 3ZKND 3U2SB 1CDIA 3AFLA 3BX7C 4MX7A 3QNYA 3KPQB 1T20A 2R29H 2HRLA 3MGTB 2DJ4A 4DKEH 4L3CB 5MEQB 3ZMRA 1UZ6E 4JO3H 3NFNB 1U8NA 4YHNA 3VFUB 1DN0A 3ARWA 1OAQL 2DI8A 4LSUL 35C8H 5FDWB 4HUXA 1F11A 5FA3B 1Q9KB 2X4NA 4OF0A 5FF6A 5FYKU 4AH2A 5DDHB 1W0VB 5FOJA 3V52L 4U6YA 1QFWM 4OCRL 2PYFB 5HHOB 3BZ4A 1DP0A 5JZ7D 3EKCA 1SM3H 4OZFA 4LF3B 3B6SB 4FQLH 3VFPA 4ISVA 4GXUM 2V9RA 5EU5A 2BOBA 4PJFA 2HLFD 1EEYB 3HMXL 1QQDB 1JNLH 3NFSL 1RULL 2VWEE 4JM2C 4NJAL 4KI5D 2H9GA 4NOFA 2AXFA 4EN3A 5JW4N 4WU7B 4LSQL 2PO6C 4H26B 3KDMA 3WO4C 4JQIL 5MEND 1A7RL 3KWWB 4L4VE 3ELAT 1Z5LB 1XIWA 5EPMB 4RGMC 2FB4L 3LZFL 1B4RA 3C60B 1ZT4A 3RVWC 5C6PB 4LAQH 1RK0A 3MLTA 3EOAB 4P5MB 3T77B 5EIIB 3CUPB 3N0PB 5GRJH 4MA1B 3ARTA 3UAJD 1N59A 2P5ED 3DJ9A 2OMNA 5MP6L 1QNZH 1CGSH 4P5MA 1DLFH 1MJJA 4NC0B 1DLHA 1OAKL 2QJDA 3U4EB 3C6LD 3LS5H 5EO0A 1IGJA 2MTPA 2JCCF 1S7SA 1UH2A 2YD1A 2D7PA 3U4EA 5TDPA 3ZYZA 4Z0BL 3GRWL 1JZ6A 2OSLB 5TGBA 4PJBB 5F6IB 1PQZA 1X7QB 5C0BE 5HXMA 2A6DB 2YA2A 1XGUA 2XOTA 2FGWH 4GLRI 2OSLA 5E4EB 3EO0B 5IR1A 3U1SL 5FYJE 1R5IA 2KBGA 5HYSB 4RBPH 1UADC 1INEH 4QT5B 4BSWB 4UOW0 2ERJC 4M7LL 5D2NE 5DEZA 1JFQL 1XCTA 4ZTPH 1MPAL 3ZSTA 4WWKC 1ORSA 1LHZA 3QUYB 3AB0C 2BCKB 4NKDA 2E27H 3JTSB 2AJ3B 1OT1A 4ZPVB 1N5AB 4NWUL 1ORSB 3WLBA 5HGBA 4QRTB 5H35A 1BF8A 1WBXB 3IXAB 5CHNB 2UZXB 5DRNA 3HCVA 2NY3B 4GUPB 1C1EL 1MREL 2VOTA 4KK5D 4LCIH 2Y6SD 4I48A 3DROA 2I5YL 1CDYA 4QWWD 4GUPA 5JPMA 1KLGA 1TZGL 4OKVB 3QDJD 4ENED 4JG1H 4K94C 3RIAF 2ZUQB 2Y1VA 1QFUH 1WLHA 2BJMH 2DQJH 1D5MA 1P9MA 2I27N 4ODUB 1XF5B 1YNKL 1UM4H 3D2UB 4L4VD 2HRPH 3S4SA 3SDCA 5KSAA 4Q9QL 4NNPH 4UDTA 2A9MH 3QIWB 3UYOD 4JRXB 3C5ZA 5J1AA 3NCJH 4TTDD 1FPTH 3PABB 5C0DA 5F7MC 5C6WH 1BX2B 4Z7WA 4DKFL 1OY3B 1T21B 3QIWC 1WBZA 3U0WL 1QR1B 3EO9L 2VDQH 4JFEE 4MA8L 4IOIB 4K3JL 1AY1H 2E9IA 4XCEB 4WFEE 5EIVA 4DVBA 3QB7C 4UBDD 3QEGH 4P9HL 4FZ8H 3BXNA 4LHUD 2EDNA 5KVEL 2P43B 1V3KA 5DJAB 2ZUQC 2B1HH 4POYA 5DMJB 1UM5H 4MD0A 3EDDA 3UTTD 1B0GB 1L9MA 5HYIA 4LARH 1I8IA 1BVKA 2XN9E 3I84A 5GS0L 4K07A 2OTUB 4QRRA 3SJVA 3DGGA 3JWDH 1X5LA 4YHLL 1M6OA 1ZA6A 5KOMC 5CGMA 3SJVB 3QEQA 4OIAA 4NQED 2C7UA 4TSCH 3HPJB 5E4IA 4EDWH 5B3NA 3IDGA 1QSFB 2AEPH 4M6NH 5JW4M 1NCDH 2CXKA 4PJCB 5C3TA 1OW0A 1QSEE 3IDGB 1HH6A 3OAUL 4M5YL 5E5RB 3L95A 5JZ7C 3CMOH 4P3DB 5D70L 1V3LA 5IFAL 1TDQA 3B9KC 2BSTA 3OPZL 4YQXH 1FZJB 4GRLA 4LSTH 1IQWH 2PKDA 3SDXF 5IQ9B 3GSOB 3G6JA 2J6EL 3BSZL 2VDLH 2QQNH 3G5XB 3VD5A 1OP5K 1E4WH 1A7OH 3EYFB 3SDXB 3CCHB 1M7DB 3ZHLA 5GS2H 2W0FA 2PYEB 5F9OL 3DPBA 3MO1B 1MRDH 2VXTH 3U0TB 2DIAA 1YEKL 4MMZC 3F5WB 2M26A 4PRIB 2BNRB 4U1MA 1U92A 5C07A 1NUDA 4AIZB 3N9GH 3U46B 4NRZB 1KENH 3TBYB 4LNRA 2OTWA 4XGZB 1RD6A 2HVKA 5EO9A 4DN4L 1YY8A 4P2QD 4GBXA 4PJXE 1N64H 4PRID 5TE6L 5D9SA 2GHWB 2VAJA 5DHVH 3FRPG 1RIUL 2EO1A 2O93L 2XT1B 1QACA 5EIQA 4A6YA 5L7XH 3SE9L 1QPXA 4D3CL 4XPHH 4CMHB 1RURL 1KXVC 4EI5B 2DQCH 2FBOJ 4Y5YB 4XHQA 3OB0H 2BX5A 1UA6H 4G6MH 2R1WB 1SEBA 3HNSL 3MREA 1J1XL 3PIQA 3PWJB 4YFLI 1TTUA 4NO0D 2EE6A 2JCCB 1UG9A 3EGSA 2EYSA 3RWFA 4XNUH 3KYKH 2AV1B 1TQCB 2Y36L 5HYEA 1DQTA 3LRSB 3T8XA 4HGWA 4P2QA 5GGUA 1D9KD 1G0YR 4P57A 4PRAA 2GKIA 3PQYA 4PJEF 1TETL 5F88B 1PG7W 2DQEH 5CP7A 1MCEA 5ECJE 1DQQB 2E8YA 3P0VH 4Z95L 3SDDB 4NZUH 4PG9B 5L2KB 4N5EC 4RGNB 1IGCL 1FHGA 2Z9TA 3DSFL 2X40A 4GSDH 4PG9A 35C8L 1NGXB 3VE0B 4R26H 4QWWC 2IADA 4KJQC 3NA4A 5B8CB 2P47B 4MJ5A 4L8BA 3C8HA 3QCVH 4BA8A 2V17L 4ODWB 5AG8A 2V5RA 5IVXA 2P49B 1WTGT 3SDAB 1A4KB 3U9UB 2JKXA 4F8QA 1KJ2L 5AAMA 2LU4A 2A73A 2ADJA 3W11D 3IJYA 2WINA 2X05A 4F3FA 4PD4J 1QKZL 4OFKA 2XN9A 5L88H 1MH5A 2ZJSH 5FYJU 4YWGL 3NGBB 4F58H 5IJKA 5T3XL 2D7TL 5BZWB 4OCMC 4PRBB 5JHDE 5KAQF 3KPRA 1WIUA 3G6JF 3F7QA 2R15A 4Y5XA 3ARPA 1OTUC 3GBLA 1CFSB 3UJJH 2NY2B 3C6LB 3BMVA 1UJ3A 4E5XA 2PUQT 1WAAF 4PJAA 3ILPA 4WFFE 5EC1B 1FFPA 4MWFB 4HXBH 5I9QB 1DSFL 2Q7NA 3VRJA 1XZ0B 4R96B 1YMHB 3VGBA 5HDBE 4HAGA 3KLSA 3ZHKA 2W9LA 4WNQB 1DLFL 4B7LA 3QQ9C 3LKNA 2R29L 3MOAL 5HHQB 4FFYH 1XCQA 1TJGL 5LGHH 5MENE 2VXSH 4NZDA 5BS0D 2MHAB 2J8OA 3L5JA 2C3HA 1T3FB 4M61A 4OJFH 3FO1B 4XXCA 2YPLA 3PHQB 2FX8L 3HE6B 4LP5A 3V52H 1RZJL 4IDJL 3VFMA 3UZQA 4P5TD 5K9JH 2OL3B 3S96B 4WY7L 4HWUA 1RJLB 5J6HA 4I9WE 1IT9H 2QSQA 2EKSB 4Y19B 5A2IH 3Q0HA 2L4OA 4OAWA 5KVGH 4AIXA 1DBKH 1I3UA 3DXAE 4YUEH 2UZIH 5IKCA 1U95A 1DBMH 1VFMA 1XF1A 1EO5A 2AVGA 5IMKB 3VXTA 3CFEB 5BO1L 3OJ2C 3K2UH 1I9IH 1B3JA 1KCKA 1C5BH 2XQYK 2HFFA 4XAWL 2P8PB 3QI9A 4K7PL 4HMDA 1VACA 3OG4B 3HC0A 1KIQB 5LCVH 32C2A 1F11B 3NN8B 2HFFB 5FA3A 2CJUL 1GZPB 4Y4HC 3RWIA 1N2RB 1J0IA 1JWMA 3NTCH 2IPUG 3DVGA 1OAZL 4PGEA 2B0SL 1JVKA 3NN8A 4CUCA 3PL6D 4M8VA 4ONFH 1ZLUH 1JWMB 5IBUG 4GMSL 3W39B 3OHXA 3UO1L 1UWEH 2NY5C 3DTXA 4HK3N 3MLXL 4P48A 1ZLWK 2ADFH 3HS0B 4TOYL 1G9MH 2HFGL 3MODH 4KVCH 5CP3A 1YZZA 4MA7L 4NQCB 5I71B 4I8DA 4IIQA 2R1YA 3AS1A 4OZ4B 2FJGA 4U1GC 2YPKA 4NQCA 4XP6L 4IIQB 4U1IB 3MRPA 5ADPL 3HUJB 1G6RL 3E3QE 4ESKA 2P48B 3G9VA 1L0YA 3T65B 1AY1L 5JHLH 1U91B 4PJ7B 3A67H 3QFJD 2GCYB 1DQDH 5CJ5A 1ACYL 1RU9H 1TJHL 2VZUA 3WFBH 2YKLH 3TGXA 2Z91A 1KIPA 2GCYA 2W65B 1YPZA 2ZCLH 3AREA 3C5ZC 3KR3L 5H2BA 5KVFL 3KYNA 5C0EB 2LQRA 5DZOA 4I18B 3MRQA 1BVZA 2XPGA 1WEJH 5GISL 1NAML 4PFEA 4H8WL 1U8HA 1CXFA 4G8GE 4PB9H 2ZSWB 4MXWL 1G7LB 5BJTB 5BV7B 4L29A 3FT2B 2PW2B 3L7FB 1MCCA 1Y6NR 3QQ9D 2BY2A 4RFOL 1AI1H 1Q9OB 5HI5C 2J8UB 2DDQL 1CD8A 2BDNH 4ZUTB 1CICC 5EWIH 1NCAL 2CDGA 4LCYB 1Q9LB 43CAB 4AENA 4NKMA 1IFHL 4Q58C 1EV2E 1HHHB 3KXFA 5LWYL 2HT2C 1OPGL 5DVNA 4JFFA 3GJFB 5CSZA 3OPZH 5GGQL 5KTEL 3IFNH 1QTYT 3QPQD 1RZFL 3BKML 4LSTL 1A9BB 3KYMA 4PJIB 4DZ8B 1IKNA 2VN4A 2EEDA 5HDQL 4ISVB 1H8OA 2VDNH 3I9GL 3V4VL 1YNLH 4HIEA 4G8IA 4JO3L 4Z9KB 5DD3L 3SKUD 2IBBA 2WQ8A 2A6IA 3BIKA 3I3DA 2GFBB 3LD8B 3DXAA 4GW1A 2IBZX 1BBJA 3VCLA 2NR6C 5DWUH 4UIKL 4NO3B 3IFLH 4ODHH 1VEOA 4LU5L 3MV7A 4M62H 4YFLF 4WW2B 3DXAB 5MERB 1EVTC 2GJJA 4D8PB 4JO2L 1TTGA 4FTVA 1Z5LA 4ODUA 5FUCC 4WW2A 5MERA 4I2XE 4QHMB 3P0YL 1WIPA 3V6FA 2BC4B 5KVDH 1IAIL 3O6KL 4O51B 1M7IB 1A6TB 1FYTE 4YK4B 1IEAB 1F5WA 3ZKXB 1RIUH 3VXPA 2FEDC 4N0FA 3OX8B 1A6TA 3NFPB 1T1YA 4WTWA 4OM1H 4NHUA 4EZMA 2WUBH 4LLQB 2DMBA 4X0KA 3T2NL 1FE8H 1I8LC 5FECB 3OX8A 2AK4D 5D71L 2MKLC 1NC2A 2DQCL 4LPWA 3WV0A 1A7RH 5M94B 1VEMA 5F1OB 3SKNB 2EXYC 3OKNB 3ZKMD 1KLUB 3CD4A 3QISA 5KSBE 5KANG 1F13A 5IMOA 2C3WA 2UYLB 1ZK9A 1NDMA 2V2TB 4TULH 2RAMA 2FEEI 1YPZF 3F7PC 5FO8B 4MD0B 3S36L 1A6VL 5I1IH 4X80H 1JWSB 3QJHB 4LOUD 1ZKAA 1AR1D 4XPTL 2VKXA 3LN4A 1A1MB 2NY0C 3Q5TA 4TUJA 3M07A 5HYJA 4JO4L 5I17A 3FQTB 4OF7A 4S1RH 1JHLH 1U42A 1NBZA 4XNZB 2MCPL 3P77B 4KXZI 2V2XB 3AAZB 4ZO8A 2DTML 4MGXA 2EYTA 4JZNB 4YC2B 5DQJA 5JOFB 2F19H 2AI0L 4LPVA 3NIDE 1A7QL 1ULVA 2OJEA 3FQXA 3UTOA 3M17B 1OARH 4GT7A 4YO0B 5D7LA 5I1GH 4TPRH 3P4OB 3VFRA 5F1KC 1KNOB 2VDKL 2EDQA 2NXZD 5CJOL 4XWOC 1R5VA 3HG1E 3LKOB 3FB8A 1BD2E 2DF3A 3AS3A 4PLJC 3D3VE 4M93B 1DFBH 4HJGA 1S9XB 4LLWB 5HI5D 3VXMB 4Z7NF 2ZPKH 3GMOA 2YXFA 3QDJE 1OQXA 1EHNA 1JYNA 4MXVF 5B22A 1KN4H 2OJZH 1AP2A 5KSBB 3QWQB 2W0FB 4JFQA 2XNAA 5C70A 5BMFH 1T21A 3ETBF 3VXSE 1BVLB 5BV7C 5GGRY 5E8NA 2DQJL 2E6QA 4YPGB 4Q6IB 4DVBB 4HH8A 1MFCH 4OZFG 4B41A 4UQ2B 4YDJA 4MA1C 1ORQA 3IVKA 3TWCL 4X4XA 1LE9B 4LVEA 2FJFB 3VXOB 1BBDL 4HH9A 1OCWL 5DJAA 4LLMB 3BP7B 1AD0B 5LGHL 2NR6D 4WFED 1CS6A 5I1JH 2EZ0C 2Z92B 3MR9A 3RWJA 4LLMA 4EBQH 1GZQA 2QHRH 1Q9WB 3ZO0A 4PV9B 3CC5B 3S37H 3ECBA 4U33A 3VWKB 1M6OB 5ISZD 2VL5B 5J1AB 2EXWC 2X41A 5GS2D 5FEBA 4C4KT 3G04A 4L4TE 2VISB 4PLOB 4NUGH 4FQQA 3EYVA 4XCEA 2JJUA 5L6YH 2VLLB 4XBGB 4WW2F 4UB0L 5GS1B 4NC1C 4DAGH 4NWUH 4QRPB 1KCVL 4Q6YA 2A1WL 2BVQB 5T3XE 2GAZB 4MNQE 1BMGA 1YNTB 2VLKB 4WJ5B 4OZHB 1AD9B 4Z76A 4J4PC 5F7DB 1RUAL 3O4LD 2HFEA 3H7LA 2BNUA 2PW1A 3QFJE 1R5WA 4K3JH 3WE6A 4JM4H 2DQIL 1F2XK 1JGUL 4NQEB 4HWEL 2NY0D 1QD0A 1ZS8B 1UM4L 2YSSA 4ONFL 5IVXB 3KPNB 4BFGA 5KVEH 4XB8A 5GHWH 3TFKC 1T0MA 1ZGLP 1LO0L 1AFVL 5D6DA 2VXSL 1UM5L 2XIDA 2GK2A 5C0ND 3IJYB 2FHCA 4Y4HA 3UBXG 3TZVD 3H3PH 3MRHB 3ZYJA 4Q0XL 3U7WH 4RWHA 1G7PA 5C92A 5C0IB 4CMMB 4FFVD 5CS7A 3NVQA 3MGAA 4YHLH 1K3IA 2HN7B 2NY6C 1QUNA 1J05A 1KB5H 1WZMA 3IKCB 4F33A 3WO3B 2R1XB 1RU9L 4WUUD 2HN7A 4Y4KD 4AIOA 5DTFA 5FGSA 4EI5A 1QO3B 3C5JB 1QRND 3PWNB 5DQDH 2R1XA 4G6KL 2RBLA 4KI1A 3H8NA 1F8TL 4J1UA 4MNQB 2HMIC 5GISH 3IAQA 4XVUC 4DN4H 4ENEC 5BO1H 3JWOC 1B2WL 2IPUK 4LSVH 1FC2D 2BHZA 4MNQA 1N59B 3N50A 2J6EA 4Z7WE 1TTFA 3U46A 1HNGA 1HILA 3VXRA 2YK1L 3O41A 3OB0K 4Y4KC 3ET9F 3UTZB 1P4LB 2X6MA 3P4NA 4FXKA 4M3KB 3RKDC 1OWRM 4W81A 3T2QA 5F9JA 1I75A 3UTQB 1PQZB 1X7QA 5IGXL 2HJKA 1EERB 3BD5A 2BDNL 2P5WB 4JDTH 3OAUH 2MQCA 3TN0B 4JHWL 1QA9B 1AIFA 1GPOL 3VRIA 5IV2B 3A6CL 3C60D 1VFAB 2DQDH 5B8CA 3U79A 3IFPB 5L0QB 2EE2A 1KF9B 3NZHL 2XZCH 2BVUA 4GS7C 3SE3C 2MOVA 2APWA 2O61A 2P5EB 1ETZB 1MIMH 2V5MA 5F1IB 4OD1H 3QO1B 4I77H 5IEKB 3GMPB 4OLUL 4R4ND 3NFSH 3BKYL 1JYXA 5I16B 1AKJA 4H5SA 3UCRA 1D5IH 1M71A 1IRAY 2D7MA 3EYUH 1DQQA 3QNXA 4V1DD 3GMPA 1TNMA 1XGRA 1KJ3L 1EAJA 4Y7MA 1UA6L 1VA9A 1CIUA 2ZOLB 4WTZG 1JGVH 1XGRB 3ZL4H 3QWOA 1ED3A 4N0UE 3T0ED 3FOLA 1CT8B 3BESR 3RAJH 3G5VA 4TSBL 5DD0L 3C5SB 3O6KH 4PJ9D 2E9WA 1C08B 4C54A 4X98B 4F7PB 1BFTA 4MXWH 5CBAB 5E00B 5F7KC 1BM3L 4NRXB 4WUUE 3VRJB 4K9EC 2CDEB 1FNSH 3MV9D 1QKZH 4H1LG 3ARED 5E00A 2X1QA 2IBZY 4EVNA 5KG9B 1FO0B 1GOFA 4NZUL 3MRPB 4PBVC 4NNPL 1PG7L 4JHAH 1EPFA 3ZTJG 1OAYH 3WHXA 3MV9B 4W4OA 3RNQB 5JTWA 4YDKL 3HR5B 4LLVA 1HH9A 2XV6B 1W2KT 1JHKH 3BD4A 3BKCL 3RNQA 1NBVH 5I19H 4G6FD 2LVCA 4P4RB 2J4WL 1LD9A 5HHMB 1G7HA 2HJFB 4P46C 1ND0A 3QNZA 2DQFA 3L5IA 2H2SD 4NT6B 2P8LA 4KJQD 1DVFA 4WI8A 4PY8J 3TA3B 5ALCL 3R06B 1DUYA 1I3RB 3ALWA 1INQB 8FABB 1QBML 1J8HE 1I85A 3BWAA 3DGGB 1J86A 3V4PL 3SY0A 1ZT7A 2VE6B 4BH7A 1TPXC 4XBPA 1MEXL 1FVEA 4FZEL 2YBRA 4UT6L 2VDML 2XZZA 4HWBH 5FB8B 1A3QA 2F53E 3P0YH 3ULVE 4NRYA 3SQOL 2MSPA 2R56L 4AEIL 3GMMA 4TSCL 3RA7L 4DCQB 1IEHA 2DYPA 4C4KO 2FNBA 3QXDA 1Q0XL 1YA5A 4O2FA 4O4YH 5IFJA 4GAGH 4XPBH 3ZDZF 3ZE2F 3MA7B 4Y19D 3RKPA 3T0EA