1T5WB

Hla-dr1 in complex with a synthetic peptide (aaysdqatplllspr)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
190
structure length
190
Chain Sequence
GDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title A Polymorphic Pocket at the P10 Position Contributes to Peptide Binding Specificity in Class II MHC Proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 41
structure length 190
sequence length 190
chains with identical sequence E
ec nomenclature
pdb deposition date 2004-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t5wB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1t5wB01
5ESQB 3RNQA 4O5LH 4KROC 2HMIC 1QO3A 1U6AL 3FFCB 1YA5A 5I1KL 1T7ZA 4MS8C 1A3RH 4X5WA 1JF1A 5DD3H 5EU4A 4CAGA 4PJBB 3TT3L 1NCDH 1W8OA 3VA6A 1JPGA 3KPSD 5CINH 4NN6B 1HQ4B 4F7MA 4MQ7A 2EZ0C 5HHPB 4EJ1C 4J6RL 5EUOA 5K9JL 1BIIA 2BVEA 4PYHA 3DMMB 5LWYL 1VGEL 3K80A 4LIQH 3Q5YA 3GMPA 2DJSA 2YEZA 4R7DA 2HTKC 1H9VA 2BXYA 4LP5A 1JRHH 3SKJL 2VH5H 3WFEH 4OIIH 2FEDD 3TPKA 4EBQH 1ZVYA 2BVUA 3VFTA 3L5HA 4LRNL 5EOTA 1C16B 5TDPB 3P0VH 3CNKA 4NCC1 4RWYH 3D48R 1MEXH 1FN4B 4NWUL 1CCZA 5IB4A 5HHXH 4WU5A 5JZ7D 4F3FB 1JGUL 5CD3B 3PQYA 5KVDL 1BP3B 2GSIA 2IF7A 1JWSA 1UEYA 5F9WC 1YMHB 5AYQA 2ADIA 1RPQA 2FO4A 2P42B 4P3DB 1OTSC 3PUCA 1YEJH 3H0TA 3MNVA 1XR9A 1MJ7H 2D7NA 1HKFA 4GAFB 1XF3B 4NQTA 1NCCH 1Z3GH 1YEIL 3QEGH 4WTWA 1GPOH 3HR5A 1KBGL 4ODUA 2K7QA 1FYTB 2YN3A 4OM1L 5I73C 2VL5B 3N50A 4TUJA 5GGRA 3CH8A 1I8MA 4JFQB 4MAUH 3AGVA 4P2RD 4YHIA 3LKPA 1UJ3B 2K3TA 4LQFL 3BPLC 5FCUL 3BKMH 2VYRE 5GGSA 1Q9KB 1XZ0A 5I16A 1QQDB 2YD3A 4LCWD 2XA8L 1WBZB 5E4EC 1F4YH 3MPCA 3V5KB 1T3FA 2PO6C 2EIZA 3PF2A 3U4EA 5I1LB 1SEBA 1NEZG 1S7XA 2VISB 3MUZ1 3B9KA 1YEFL 4PJFF 2G9HA 1BGXL 1BZQK 4OGAC 5DHVB 4UOW0 5DJ2B 1I7UA 3QUYA 1X9QA 3N9GL 1JGLL 5B8CB 2AEIT 1DVFC 4O9HL 3ULVH 2V6HA 3QIUD 3PV6B 1LEIB 3FT3A 2NY3C 3D3VD 5IB3A 2R0KH 3RKPA 3Q48A 1RJLB 1J5OL 1RFDH 1HWHB 1FNGB 4NDMA 4PG2A 1DBBH 5I75B 1IKNC 2VLRE 5DJYA 4UAOC 3X3GH 2PW1B 3SGJA 1CXKA 4M03A 1KXVC 3JV6A 2AK1H 2DRUA 2EIEA 5IB1B 3OKMB 2E7LA 4R3SA 3MRRB 5FGBC 3WCYA 4S2SB 3NFSH 4M6AA 4LEOB 1ITCA 4KC3B 4JKPL 1NFIA 2F53D 3OMZA 5KW9H 1EMTL 1NMCB 4IOSD 4PD4J 3IDIB 4H88H 3T1FB 2R0ZL 2H2PD 5GZNC 3K74B 1KIQB 1QFWI 4PJGE 2HJLA 5J4MA 4C56D 1SBSH 2PF6A 3WJLA 3HZKA 1F4HA 3OJ2C 2RFXA 4Y89A 2X4TA 4MB5A 3LVEA 1SJVA 4RA3A 3SE8L 3FCTB 4Y19A 4ZODA 4WDIB 3KYNB 1LO2H 4P3DA 5DK0B 2QL1A 4G9FA 1R0AH 1IGFL 4UB0H 2BX5A 2NYYD 4OCWH 1E4JA 1IAII 1U3JA 1BQLL 4P2QD 5EZOH 1J1XH 2A38A 4YHKL 1U3YA 1H0DA 5D7LA 2WUCH 4N0FA 4HV8A 1UM6H 2XZQH 3H3BC 5A2IH 2P47B 5DFTA 1J0IA 3NGBC 1JK8A 4WI7A 2Y25A 3AMLA 4ZXBB 3VFOB 2VXUH 4Z7OE 2R9HC 1Y6NR 3VXRA 2F54E 4JO4H 4HUXB 1CBVH 4NQSA 5KJRL 5C3LD 3BD4A 3ARBD 1IAMA 3REWB 3C5SA 2GJZA 2JB6B 1QSVA 3RL2A 1LO0L 2FGWL 1CXEA 1RIUL 3O3DB 4OQ1A 5F9OH 4K3DH 5GRJH 3U7YL 1WT5A 5GSRA 3SCMC 3V95A 5MEPA 4BSVB 1EFXD 3QUMB 4EDXB 1D5XA 4G6FD 3SDAA 3V8OA 5E6IC 3MRMA 4RMWA 5MEQA 2QSCL 3RY5A 4NRYB 3FO0H 5GGTA 3MRQA 4C54A 3MJ9H 1A0QL 4MX7A 3DX9A 5B3JE 3MOAL 3CZFA 2Q6WB 4PGBA 4Y16C 3H7LA 3L6FA 4YJZL 2W0FB 3I6GB 2ATPA 3RBSA 3QNYA 4UQ2B 3W11C 2OM5A 4GH7B 4QWWD 3O6FB 2HJKA 4XBPB 3WIFB 4S2SA 3GHBL 3HI1A 4FQHB 1UM5H 1MLBB 5HI4C 4POZD 2XZZA 4UIKH 5IW1B 3BKYL 1A3LL 4LU5H 5IBLC 5T5NF 3S96B 1JE6A 1N26A 1MAML 2EDBA 3IJHB 5EZJA 2EC9T 1IKFH 4KKBC 5IVXF 2OBGA 3DGCR 4PJDB 3JTTA 5JIIA 2YPLE 4G6AD 5KTEH 1T2QH 4G9DB 4Y2DD 5ELIA 3QCTH 2G5BA 4OCLC 3NCJL 3ES6B 3NVQA 3RGVD 4ELMB 3WXWL 4ELKA 3KWWA 3EDDA 4U7SA 4WDIA 1U41A 3QT2A 4JM2B 1CLYL 2Z4QB 3VFUB 5CEZL 3QXUA 5TPWL 3PL6D 4YBLB 4N9GB 4LAQL 2ED8A 3CXDL 4RGND 2G75B 2DQGL 2AXGB 1LO3H 2Q76A 1BM3L 1QEWB 4XC3H 5CILL 4JREC 4ETQB 4MDIA 3D87B 1QA9B 2E5EA 4NUJB 4XP4H 3ZO0A 3RGHA 3DHMA 4HPOH 4K23H 3UZVB 1ZV5A 1VFBA 2HFGH 4KRMB 5HYFA 2OI9B 3IFOA 4WW1A 4X80L 4OV6F 5GIRB 4CDHA 1AKJA 4JZNA 3UJJL 4KI1A 5BRZA 3S6CA 3QQ9D 3QDGD 4KGLA 1OM3L 4R0LB 2FHCA 1HWGB 4CADA 1U58A 4NUGL 4XMPL 1MHHB 1GAFL 4WGVB 1I1AB 1HINH 5IM7A 4XBGA 1AHWB 5J06A 1G7LA 3BO8B 3CH1B 3TVMD 1GGUA 1DTUA 4X7SL 4HS8H 2MCPL 3RDTA 1YJDL 4L8SA 1S7VA 1MCNA 4NRYA 3FB5B 2I25N 5D7JA 3ILQC 3UJIH 1HH6B 2GEEA 2YRLA 3TA3A 4F7TB 1IGCH 3RNKB 4PJEA 5FYKH 5ISZB 4Z7VB 5IEKA 4DN3L 2XYCA 2VO5A 3FOMA 1I3RB 2EDDA 4M7KL 4X98A 3AVEA 2I07A 5E8PA 1LWRA 3LRHA 4YGVB 1ZT1B 3HC3H 3HG1D 1YMMA 1UYWH 4PY7A 1H8OA 2F5AL 4IOIA 2BSRB 4HKJA 1CS6A 1SY6H 4KJPD 1QFHA 3TJHC 3LQAH 3ZE0F 1ZLSL 3IFPA 1H15A 3ZTJG 1UZ6E 5IW1A 2VDOL 2ZPKH 1T89A 4K9EL 5FYJL 4PS4L 3SDCB 2CR3A 3E3QE 1EBPA 1L7IL 4AEIH 3RVVD 5E2JA 3MGTB 1D5ZA 4FQ2L 2VXQL 4JRYA 3EFFB 4NHUA 3WNKA 5C0ND 4YO0B 5H35A 3UYPA 3QIBA 5E2WL 5HI5D 4XI5D 1YZZA 3REVB 1D3CA 4TOYH 3CFDA 3HMWH 1DQDL 3PHQA 3VFUA 3BJLA 1ZVSA 2HFFB 5CJ5A 1PBYA 2PTTA 3NACH 5DJ0A 3S7GA 1NCBL 4Z7NF 1NCAL 3D25B 1U3HA 5T1KA 4IHOB 4PJCA 2NXZC 3VI3F 5F3BB 3CXHK 3QJFB 1EEQA 1TJGL 4G43A 5EUKA 3H3PH 4TUKH 5JOPD 1HYSC 5D93C 4KKCC 3F7QA 2G2RB 1KACB 3P2TA 4U1SB 1UB6B 2YD4A 4PGCA 4TN9A 3JV4A 4Y88A 1QZ1A 3GHEL 5EWIL 3IDGB 4WGWB 1KUMA 2JE8A 4YAQA 5AD0B 1UH3A 4AENB 2E7HA 4PRDA 2C4XA 5D70L 1UKSA 2FJHB 1XGTA 5C0BE 4KTEH 4X7TA 4X83A 4A6YA 1ZANL 3SOBL 2IWGA 4NNPL 1GHFH 1RMFH 2CDFA 1U95A 3G9VA 1DJSA 1WJ3A 3EFDH 5J3HC 2AJUL 1YJDC 1ZGLB 4QCIA 1NAMH 2R2CA 1FZMB 3QCUL 4ZS7H 3TZVD 2Z92A 5FO8B 2F58L 5DVMA 1MQ8A 2HRLA 3NTCL 5IIEA 2DMKA 3VWKC 4HIHB 1ZSDA 1ORSB 4HDIB 3WXVH 4JN2B 2IG2H 4XCFH 1UFUA 5GS0H 2NW3B 3IDJA 4CMMA 4XT1C 1WC7B 4HH8A 1B2WL 5IVZB 1N59B 2GITA 2QHRL 5D6DA 4BSJA 5ISZA 5D1QA 4NJ9H 2R29H 2Z35B 5MHSE 3VJ6B 5F7YC 2Q3AA 2Z8VC 3BESR 4KPHL 4XVUD 2NY0C 5DQDH 5IWLA 1T6VN 4K9EC 1N5YH 5F44A 1KC5L 4AYFA 3QIWA 3ARSA 5FEBA 2BVOA 2BY1A 3PGFL 1RULH 1MFAL 3EYFA 4G8GA 1S7WA 4L3AA 2OTPA 4XVJL 5A43C 4G6MH 3TC9A 5I76A 1YNLL 2SEBA 3MUJA 5E6YA 4J4PD 1FZJA 1ZHNB 5DHYA 3UPRB 1CGSH 1X5ZA 3ARED 2VDRL 5F89A 3EO0A 3PDOA 1MCOL 1KCKA 2AJZB 1F2XK 4H26B 4JO2H 3ROLA 5HD8C 3NFNA 4EKXA 3MBEC 1G9NL 4V1DB 4L8DB 2VJXA 4M48L 4JFFE 5L2JB 1AGDA 1DQTA 4Y4KC 1SBBA 4PJ7B 3DRTB 3FFCE 5AZEH 1RHHB 3ULUE 2ZSVB 4KMLB 1IC7H 1EXUA 4P0DA 2G60L 1NBVH 1OAXL 4D9RE 4KVNH 3VFRB 5FYLE 4PJBE 5M94B 5FUCE 3KPMA 4QTIL 3CX2A 3RY6A 1KCUL 1KEML 4PLJD 4MAYB 2WUBH 4GW1A 4DUXA 1FFOB 5HYSA 3HNSL 4JGJA 5D5MF 1EA9C 1F58H 3VRIB 3TT3H 2MTPA 3IDNB 2HT4D 4ZAKC 1P5UA 1I7ZA 5F7FA 4R8WL 4HMDA 1HQRB 5KVMC 1F6AB 1IEBB 3V9FA 2E9WA 3IAPA 1R3IH 1E4KC 4J6RH 5K9JH 5F72S 1ORSA 2FGZA 1FORL 2J8OA 3DIFA 5LWYH 2JJUA 2ZOKA 4HWBA 5C09D 3SGDI 4KFZC 3OXRA 5TQ2H 4XTRD 3TBVB 1KJ2A 1QRND 3VXNA 4LCCB 1DLHB 2XQBL 1ZLWH 1C8PA 5CHNB 3LPWA 1T5XB 4DFIA 3CVHL 3MJ9A 2BHZA 4L9LB 2XPGA 3LRSB 4ZFOB 5BOZG 2VZTA 4NYLA 1IGTB 3EO1A 5DLML 2Z35A 2OX5A 3GSVB 4LRNH 4DOHB 4LVHC 5IHZA 4JM2C 4OFYD 3F65A 2IBZY 2K1MA 4LKCB 4X5XA 1A6VL 4UV7H 5CZKA 5C08D 4G7VL 1JGUH 4JAMB 4AIZA 4CVXB 5KVDH 4PRAB 1RURL 4KI5E 5CD5D 3EOAB 3G08B 3NZ8B 4K7FA 2X4UA 3K4ZA 3U36B 1FYTE 4HUNB 1GC1L 1CFVL 4OBSA 1KB9J 3RX8A 5TDOA 4EI6B 3THML 4KY1L 1BJ8A 4KTDH 1QLEL 1G9NC 2ICWI 1RUML 1KLGA 5JHDB 1AR2A 3SBWA 1YEIH 3DVGB 2AK4A 3WUWA 1WIUA 3FQRB 5DURB 4TYUA 3NH7L 2D31B 1N3NA 2H8PB 2GJJA 2H1PH 1T04B 4U1IA 4NFBA 5FKPB 4JDZA 4X6FA 4OZFG 4L8DA 4LQFH 1TCMA 3QAZB 4Q74A 5DA4A 5F1NA 1MRFH 3OKOA 5HGGS 1S9VB 2V7NB 3BN9D 2VAJA 4GKZA 2OTWB 2NZ9C 1YN6A 1Q9WA 3DRTA 4OLWH 1P4LA 4FQXD 1T2JA 2FL5A 3KPOB 4HHAA 1YEFH 4XWOD 1I4FA 1BGXH 1XGPB 5SWZB 4K55A 3PWJB 1BD2A 15C8H 5A2JH 4JFYA 3VXUD 4WI8A 2J2ZA 4G3YH 3MV7A 3N9GH 1JGLH 2XWJB 3OHXB 5DMKA 3H42H 4OF8A 1D6VL 2WBJC 4U6YA 4EN3D 4U05A 4KK8D 1PD6A 1RZGB 5IVXB 1J5OH 3IDNA 4A2LA 5F71A 3C8KB 5E9DD 3X13B 3GEWB 5E4IA 1NAMB 2EXYD 1U8NA 4GRLB 4Y2OA 4U1GC 3PP3K 1IE5A 1G6RA 4RX4D 4Y1AB 4YBHA 1JGDA 1T22B 3B3IB 3Q2CA 4OLUL 5HPMA 4JFDB 3B8SA 5E2UH 5FOJA 3IB4A 4X4ZA 5FA3A 1W72A 2EICA 5INDA 4IDLA 5HYSG 3E8UH 5BO1L 4PJXB 2XKNB 4XB8A 3QWOA 1C5DA 4P2YA 2ESVD 1T5XA 4QY8A 2DL2A 4JFED 4JKPH 3PWLB 4FQCH 1EMTH 2NY2C 4XP5L 5A1AA 4KRPB 1CLZL 4LSVL 3ALWA 4N0UB 5FUZL 3VXTB 1H3XA 2R0ZH 1GC1C 2YZ1A 4NM4L 3RWEB 1SY6A 2YMXH 4MJ5A 1K3IA 1DN0B 3SE8H 3C5ZD 3B5GA 2HVJA 5TH2A 1JPTL 4DGYH 1NCUA 4AIOA 3ARGD 3K7UA 4JEGB 1NUGA 2RHEA 3HI5L 3O4LD 1FL6A 1PZUB 1S9WA 4O00A 1DUYB 3IJSB 1D9KB 1RK1B 4CU6A 4GAYA 4PV9B 3U1SL 4RIRB 3KPNB 2Z93A 5I1GH 1M05A 1SYSA 1BQLH 3GSXA 1IQWL 4M6OL 4MZ3A 3O2DH 1LP9E 2EYTB 4R4ND 1KF9B 5I8CA 5I1HL 3ZDXE 2P8LA 1T04A 4FQIL 4IRSA 1T4KA 4U1HB 4JZOA 3VXMB 3W2DH 2ADGA 2KUTA 1U2CA 4IMLA 2IGFL 3MV9B 1FBIL 1T20B 3KXFA 4LAJH 4X6CB 3DXAA 2LFGA 5LGJB 2DQFB 3MRKB 4NGHL 2NX5A 3MLRL 5DVKA 2Y06H 3TF7C 1LO0H 5D7SL 5C0DB 2FGWH 3LDBC 1XIWB 3VRJB 3U7YH 1GGCL 3C5JB 3TO2B 1HHJB 4M5YH 5C0AA 2HKFH 1GZQB 5EC2A 2A6DB 4F15B 4JRXD 1JV5A 5FDWB 1I9RL 4J3OC 4QRQB 1QVOA 4LSQH 1A0QH 1X5JA 1NQBA 4GG8A 3MFFB 1A6UH 4LNRB 1Q72L 5D6CA 4EI5B 4R26H 4AEHL 3G04B 1N0LA 5SWSA 3KNBA 3VFGH 4JPIB 4GKSB 1KCRL 3Q5OA 1FNEA 4LPVA 4X6EA 3U0TA 4PJDE 1ZAGA 4GXVH 3GHBH 4AL8H 2ZJSL 4IIQB 3IVKA 1F13A 5ICZB 2GUOA 3UTSA 3BKYH 1A3LH 3NBNA 4ZDHA 3PQYD 2L7UA 4ELME 1ZLVH 3QPQD 4HX1B 1ETZB 3O8XB 3DUSB 4U3CA 4H1LG 4DW2L 4DVRL 2QLVB 2AEQL 2OQJA 3RWEA 3G5YA 1M6OA 2IQAB 1ROWA 3NCJH 5DJDB 1S5HB 1RU9L 2X4NB 5T3XH 4LGSB 2GJ6A 2X1QA 3LPFA 2X1XR 5IHUL 1P84J 1D9KA 5TPWH 1F4AA 4N0YL 2GI7A 2MCG1 5GRXG 4LAQH 1S7UB 5C0GB 1OVZA 2I5YL 5LCVH 4YWGL 3RY4A 3T77B 1AI1H 2HH0L 3QBTB 4P9MH 1FFNB 5I2IA 5CILH 3UBXB 3U9UA 1P2CB 3OBAA 1KFAH 1U8QA 4RAUB 2IANA 3QG6A 3OB0H 3BGAA 1CDIA 4YHNA 3RVTD 4HGKC 5HDQL 4LASH 1EUUA 4K71B 3QUYD 2C1OA 3UJJH 3OKNA 3U6RA 2BCKB 2B5IB 3QB7C 3LEVL 3EJZD 3ULVE 2DM2A 1UM4H 1ZA3A 1XF4A 1CFNB 4NUGH 1G1CA 4I5BA 1F5WA 1GAFH 4QXUH 1MCCA 3WNLA 3VFSB 3QISA 3OGCB 1A1NB 4YDLB 4Z7VE 3F7RA 3TLRA 1A1OA 1WBYB 1KTRL 1SHMA 2A2QT 2MCPH 3QO1B 4JY6A 1YJDH 3BPCA 1BQHB 1P4IH 4MXQD 1NJ9B 4ZOEA 5KANI 2DWDA 3EGSB 2JTDA 1DVFA 3DGGA 1N4XH 4DN3H 3MFFA 5KVGH 4QHUB 4M7KH 3WFCL 1QSED 3QR2A 3N85L 3BZFA 4M02A 4MJIA 2F5AH 2J88H 3MRHB 3U0WL 3E1F1 2AV1A 5DJ8A 5I8KL 1QR1A 1AGFB 3LKNB 1IKNA 4IIQA 1EHAA 3IETA 4HS3A 4PRNA 5EOQL 2VDOH 4K9EH 3UTQA 5FYJH 3F12B 4UDUB 4ODXB 4ZUTB 1J88A 4Y19D 3ME0A 4QHMB 3FZUC 4PGZA 3CLEL 3HPLA 5FGBA 1V8HA 1RZ8A 2EIDA 1YDPB 2VXQH 5HHMD 1LEKB 4X4ME 3L3KB 3QJHA 3HA0A 1OGTB 1KIPB 1DFBH 3MBXL 2EDRA 5AWNL 3QUXB 1YYLL 5J11C 5D7LD 3C09B 3K8LA 2XG4A 4JANA 3LH2L 2V5RA 3C8DA 1NCAH 1N64L 3DURA 4ISVB 2W65A 4F7EA 3A6CL 1JZ5A 4ODBD 1VDGA 2APVA 2LAAA 5C0GA 1ORQB 3BI9X 1FFNA 1TJGH 2N7AA 4FFVC 3JTSA 1IT9H 3VXRD 1R3HA 1LGVA 2HRPH 2AJVL 3SY0A 1T03L 3PIQB 3Q6FB 2WNGA 3IGAB 1YEDB 2AVGA 2YD8A 4ONFL 5EWIH 3GSNB 4BZ1L 1U36A 1QNZL 4NNYB 2X4QA 3HHRB 1I1YB 3TN0C 2NNAA 3FB8A 4PRPD 1ZLUK 1ZANH 3UROR 1JMXA 3SOBH 5FB8A 4NNPH 1EVUA 1ZGLM 3HFML 2FLBT 1P7QB 5JZ7C 2AJUH 3VDBA 1RAMA 2FO1A 3SDAD 4ORGB 4BFGA 1N7ML 1IGYB 4Z0BH 4JFHD 3E0GA 3CDYA 1DL7L 5HVHB 5HHQA 3DX6B 5JO5A 1A1NA 3WL9A 1JNNH 1FSKC 1HHGA 3HUJB 5DK2A 1KLUA 4MVBD 4H20L 4H25B 3KVQA 1CL7L 1H5BC 2AJXL 4LPUA 3QNXA 4YE4H 4NRXB 3SN6N 2YXMA 1CFQA 1TZHB 3A0OA 1NGZA 3BZEA 1BREA 2X70B 3RA7L 5D8JH 3QHZH 2OMBA 4M7JH 3V0AC 2DI9A 4E41B 2OS7A 1G0DA 5F6HJ 3GBMH 5LG1A 4KPHH 3QDJB 4LARL 4UBDD 3O6KL 4PG9B 4NQUA 3TO4B 4WIQA 3EJYD 1TNMA 1ES0B 4Y4FC 5EZLB 1Z6JT 3PGFH 1H3TA 3LS4L 1MFAH 1LO5A 4CW1A 4W4OA 1D5MB 5DUBB 3L7EA 4NNXA 5GS1C 4XNQA 4XVJH 4FTVB 4Y16A 1BFVL 5IMMB 3DOSA 2C1PA 2BSTB 3HZVB 1Z5LA 3MJ6A 1D5IL 3VE0B 1EFQA 2DMBA 4V1DE 4HQQL 3TBSB 3MGOB 4C57C 1NFKA 1OWRM 3CFEA 2R2HB 3HNVL 2XNAA 5INCA 1U8JA 2VDRH 5A2FA 4RQQB 2E7MA 4PJ7E 4EVNB 5J57B 2WV3A 1CQYA 1MVUB 2ZNWA 3VRLE 4OAWB 4ZSOB 2NY1C 3TCXA 2ORBL 3OR6A 3DI2B 3UTTA 4KJYB 5IBUG 2E6JA 5C0JA 5C8JB 1PW3A 2CH8A 2DQIL 5JPMB 1T0NA 1F3DJ 4NQVA 2BNQA 4KQ3L 3BGMB 4WEBH 1I7RA 3V6OC 3QFDA 2EYSB 1OAXH 2YD1A 3QQ4A 5C0EA 4WTZA 4QRUA 1QBAA 4RGOL 4DZ8A 5L9DH 1KCUH 4XZUA 1AXSA 4ZNCD 1CDGA 2M2DA 3LN4A 4PBXA 5ECJE 1H3WM 5JORA 5DD1L 3CFBB 5MEOA 2A6JA 4P57A 5SX5K 4BA8A 1CU4L 1IGJB 4HMCA 4K07A 1A21A 4AK1A 4JDVB 1AQDB 4QOKB 4YHPA 4R8WH 1XF2B 2EDYA 1E28B 3RDTD 3RWCA 1RIHL 3I85A 4LK4A 4NQXA 2LVCA 4XMKL 4G8EA 3TA3D 4HEME 2J3SA 3P9LA 5FYKE 4JRWA 2YPVL 1MWAB 4LLYA 3ZT7A 4CL7A 2C3GA 2AJSL 4WRLA 4DOHE 2XQBH 3ZHDA 4OCMC 3IDMA 3O8XC 1YMMD 3CVHH 1JRHI 5LQBL 3GM0A 1MI5A 3NIDE 1QHPA 4OM0L 4JO3L 4XVTL 1G1YA 1CD1B 2PR4L 1UC6A 2ZG3A 1MPAL 2GT9A 1A6VH 4NKOB 5CIPH 1N8ZA 1PJ9A 5JHDE 5F1IB 5F7NC 5DUBA 2OJEB 1RURH 5JXED 5B39A 5MENA 1OLLA 4TNWK 4GT7A 4D0DB 2X4RB 1FH5H 2ARJQ 2VKXA 5CP7A 3BRGC 5C71A 4U0RB 1GC1H 1CFVH 3ECBA 3L1OL 3K0WA 2KL6A 3UP1A 3FRUA 3ZKXC 3WJJC 4KY1H 5KSVA 1QLEH 2BNRA 3Q5TA 3W81A 4K3JH 2P7TB 4G6KL 5LAXB 1S5IL 4JGUA 3HE6C 1V3LA 4S1DC 4X7FC 1U3HD 4JG1H 4WW2C 2AI0L 2P49B 4YFLI 5T1KD 2IH3B 3S36L 1CFTB 1T1WA 4K3EH 3U30B 1TPXB 4LDOB 1SQ2N 1NH6A 3B4NA 1SMOA 1C1EL 1NCTA 4DTGL 3MLSL 5KOVC 4MLIA 4NPYA 4UDTA 1YQVL 1PEZA 1OQOA 1G9EA 2ZKHL 2I27N 4QWWC 1D5BA 4W6YB 1P7HL 3W0WD 3WKML 2EYSA 5E95B 5IVXE 2Q8AL 4KQ4L 4R2GD 1JBJA 5EBWA 5HY9B 1WAAA 4RFEA 4FQJL 3V7MA 3L7FB 5FHAL 1AGCB 4LBEA 1CDYA 3BRFA 3W39B 2LTQB 4Y1AE 3D0VB 5D96B 2A73A 4MD5A 3S34H 4JZJC 4PJ5D 4JFDE 3OPZH 3HCVA 3PGCA 4HLZH 3BP6A 3HAEB 4PJXE 1DLFL 3EUUA 4HJJH 3G5ZA 5CS7A 4WTZG 3V4VH 4OLUH 2MOVA 3E6FB 1NUFA 1VA9A 4N0UE 3RUGF 3PWPB 1MELA 2R1XA 2HLAB 5D1ZB 5T3ZL 1J9CT 4O58H 1M7DA 4UILL 4U1LA 3QIWD 4WI6A 5I1IH 3QI9D 1V3MA 4G5ZH 2YA2A 3VWKA 3GSOA 4YR6B 1CLZH 4LSVH 1AIFA 2VXTH 4N90D 2ARJA 3QUXC 3QFJA 4MB4A 5ABDE 4YK4B 4TVPL 3T4AB 1JNJA 1FG2A 4DZBB 4S11A 3TIDA 4NM4H 4HKBB 1MCSA 4NKIL 3V5HB 2BVPA 2R1YA 3QQ9C 5JDSB 4U6XB 1JPTH 4CJ1A 3D18B 1TMCB 5BQ7B 3UDWC 5KANG 5C07A 4I2XB 5ICXA 1A4KA 1OTTD 3I75B 2OZ4H 3IU3B 5E03A 3U1SH 3P4NB 1KPRA 5HYJA 1JMZA 4EIGB 3BEWB 4NSKB 2A9NH 2VSDA 3VXME 3ARDC 4GJTB 5IKCB 4M6ML 4P23B 3MV9E 1IQWH 3L3IB 4M6OH 4PLNC 4BZYA 4X6CE 1TLKA 5I1HH 4FQIH 4RCAA 4XPFL 3EBAA 5E5UB 3P4OA 4XH2A 3GMOB 1FBIH 1KXQE 1AD0A 2VC2H 4FQPA 5FA4B 1KTLB 3ZE0E 1IL1B 5HGBB 5C0FB 1T6WA 2DKUA 1Q9OB 2N4IA 3MLRH 1IC1A 3GI8L 3GB7A 1YPZB 3MBEA 1KGCD 1RVFL 2NR6D 3MCKA 4XX1E 3T3PE 5EA0L 2EE9A 1KPVB 1GCFA 2VXVL 3U2SA 5DTFA 1NMBL 4Y4KA 5ETUA 1VSCA 4HUUB 1CE6B 4ESKA 1WISA 4M1DL 3W39A 3X14A 4LL9A 1NGXA 3RVVC 1I9RH 1A1MA 4JPVL 1N6UA 1MOEA 3AS2A 4IS6A 1NANH 4QF1A 4D9QD 3HZMA 4G42B 5HI5C 3VI3E 4OZ4A 4LVOB 4AEHH 3RKDD 3MACL 3MRLA 2NLJB 2ERJB 4HPYH 3PGDB 2RJMA 3ULSB 3UMTA 4MJ6A 3MREB 1KCRH 2B20A 4ZAKA 1WIOA 1ZHKA 2ZJSH 4ZPTA 3IF1B 3RTQC 4HGWB 2IMMA 2J8HA 1DUZB 3VW3L 1E4KA 5I8EB 1MAKA 2JJWA 3AAZB 4HUMB 2BSED 4P48A 3O45A 4GBXB 4HF5L 3RU8L 1EAJA 3CJJA 1S78C 4PPTA 3T4AA 4KK9C 3T4YA 4JR9L 4DW2H 4DVRH 5TF1L 2AEQH 2VIRA 3OR7A 4JDTH 1J0JA 5E08L 5TGBA 1TJIH 3CU7A 3VG9B 1RU9H 2X4SA 3VGAB 1BBJA 2AK4D 3QEHB 2J1KA 1KTDA 3RJDA 5IHUH 4LHUA 4GG6A 3I6LD 5B38A 4N0YH 3DYOA 4APQB 3WFHB 3CCHA 3R06A 2UZIH 3P11H 1U8IA 1CICD 3E6HB 5E7BA 2HH0H 5H37H 2VE6B 2VWEE 1U3ZA 4AMKH 4LCYA 4MA1C 4L8CB 1XGYL 2XY2A 3IAQA 2NXYC 4S10A 3LS5L 3P77A 4FZ8L 4YHLL 4P46B 4QO1A 3BDBA 5HDQH 4HG4K 4F33A 5HYQB 1NFDF 4XVUC 2E6QA 3LEYL 3AFLA 3KPRB 5D7IF 1FNSH 4HZAA 4WUKH 3MV7D 2YWZA 5ID0B 1R3JA 1K8DB 3WIHH 2IBGA 4DKAA 4PYGA 1YPZA 5F1KC 1NGPL 5CZXC 1YEHL 2Y5EA 1ZS8B 3JWNC 1ZT7A 1X6NA 5T1LB 2BXZA 4QRPA 2AABL 3C2SA 3LD8C 3WFBL 4YDJA 5EU7E 1S9YB 3UZQA 2OL3H 2N1KA 4NP4L 1J05A 4J4PC 5F7LB 3CXHJ 4ODHL 4H0IA 4L5FL 4EQ3A 5IMOB 2FJGB 1FFPA 1A2YB 1EBAA 4Q9RL 2AXFA 3AXLA 4X8JB 5IP4A 5H94B 1OP3K 1VADB 3AM8C 2B7DT 2WBJA 1IM9A 3WFCH 5D2LB 3N85H 4OFDA 2GTWA 4OCRH 2Z31B 1Z9MA 4Z77B 2HFEB 4K94H 5A16A 3U0WH 3RZCD 3S5LB 2H3NA 4ZO7A 4FFWD 1CWVA 1B3JA 3ZE2F 2UWEA 5I8EA 5EOQH 3CVHA 5J1AB 3JBG7 5J6HA 5LGHH 3WLWC 5BZDB 3F7VA 4OZHB 1MCJA 4I0PA 3CLEH 1QR4A 2XI9A 5DJAA 1K6QL 1U8LA 4PLJC 5FYKU 5I1CL 3BZ4A 5CIPA 4ZNEA 4J3UA 1FL3A 2E9JA 3SDDC 3MBXH 5AWNH 1GGBH 4ONHA 4D8PA 1CIDA 3VFMA 1GYAA 1YYLH 2CO6B 4OI9A 3TCLA 3MODH 4K8RD 5IB2B 4J8RA 4TRPL 1CGTA 2R23B 1UG9A 3BWAB 1NBZB 1N64H 4BH7A 2NY7H 4IRSD 3A6CH 5F6IB 2IQ9L 4U1MA 4GAGH 4O4YL 4U0QB 1OHQA 3P73A 4X9GA 3TV3L 3KXFD 3DXAD 1CN4A 3HR6A 1IZKA 3NAAL 1A9BB 2NX5D 1T03H 5DJZA 4BZ1H 3GUTA 4ONFH 2EH7H 1QNZH 3GMMA 4QT5B 4LHUG 5FGSA 4JO1H 5HYQA 1RUPL 4YUEL 5HTSA 3L3DA 4J23A 5B38G 4LLMB 1NGQL 5ID0A 2ZOLB 4Z6AT 2AKRA 1BWWA 3HUJE 3MLXH 1UXWA 3MRFA 4OD3H 2IPUG 2HWZH 3G6DH 3ZHKA 2MSPA 3FFDB 2RQ8A 4F80A 2FYYB 2JCCF 1CFBA 2EDEA 2VQUA 4AM0B 1DL7H 4PJIB 2ZCHL 1X5IA 1R3LA 5AZ2H 3Q1SL 4BJLA 1K2DB 1AO7A 1X4YA 4JY5L 5GHWL 4KROD 3O0RL 5AUMA 4E41E 2HMID 3P9MB 5C92A 4IRJC 3X12A 2XWBB 3CFCL 4XVSL 3QDJE 4MS8D 2LV4A 3MRBB 4P5TC 4R4FL 2F74A 4QGYA 5CSZB 3D2UA 3EYQD 5H94A 5ADPH 1WZ1L 1A4JB 5E2VL 2HG5A 1N5AA 4LARH 4OF7A 2D2OA 3C6LB 3ZL4L 1OF2A 4Q97A 2EZ0D 1PLGL 4FTVE 1CDUA 2CJUL 2YPKB 3VD5A 3BN9C 1LO4L 2J4WL 3DV6A 5EDXA 4PLKC 4F7PB 4QHNA 3WDJA 1BFOB 4FQXC 2PYFB 3CK0L 4OV5A 2HTKD 4PJ9B 4GQPH 1RJYA 4CN1A 1BFVH 1RIVL 4XWOC 3RWDB 5J1AA 3AS0A 5TE4L 3T0EC 4PJFA 2PXYB 4LNVA 1Q9LA 5T3XE 1G0XA 4P2OB 4OKDA 5DJXA 1EGJL 4ZSOE 4YXHH 1FP5A 3OJDA 2MQCA 5I9QB 1WZKA 3K4DA 3GSUB 3BPOC 2R1WA 4Y5XC 5CJQL 4N5UA 4NO0D 3QUKA 4PRIB 2NY6D 3SDXA 2EXYC 1I8KB 4GKNB 1AGBA 3D39E 3IDXL 3MXVL 5I1DB 5IW6B 3PNWB 4BUGA 4Y5VC 1OTSD 1MLCB 4P4KB 1MIML 4O2FB 2IAND 2DQIH 4Q58C 4MNQA 4PD4K 4D0CB 1VGKB 3FQWB 4KQ3H 1IM3A 2A74B 4ZFFA 4YDVA 1VEPA 3MOBH 3KPSB 2PKDA 1ZEAL 5I71B 2X10A 3O6LL 2WIIB 1L9NA 5EU6A 1B4JH 2IEPA 4PTTA 4QOKE 2CLZA 2Q1EA 4M1CC 4RGOH 4UOW1 1Z9SA 5F9AC 4U1KA 4U4BA 1L4IA 2CKNA 2GFBB 1H8NA 3DUUB 3X11A 3BGFB 3V6ZA 2CUMA 5E99L 1BVKB 1CU4H 3FO9A 3RWIB 1SEQL 2PO6D 3SO3B 4TTGA 5EIIA 4MNHB 4Z78A 4WJ5A 1A14H 4OGAD 1CGUA 1EAPA 3DTXB 3HMXL 4PJIA 3FQXA 2NY4C 2W60B 4XCNA 2D7TL 4DEPB 4GW4B 3SGKC 2FZ3B 4KUCF 3PHOA 4GW5A 3RVXD 1DVFD 4XXDA 5E00B 3AU1B 2OL3B 2XN9A 1S7RA 4DGIH 2NY3D 5F7MC 2EO1A 3I84A 3OSKA 3RAJL 1L7TL 3QA3A 4R4NC 4OBRA 5E8NB 3VXQB 1I1CA 3BFOA 2FECL 1A4JA 3SPVA 4HIXH 1DSFH 4JO3H 4UUJB 4XVTH 5FIEA 1TQBC 1P4BL 2PR4H 3WS6A 5DD6B 2IBZX 2YC1B 1MPAH 1CYGA 4HUVB 5E5MB 1RY7B 3KPQB 1Q0XL 2H32B 2X42A 3PHSA 2MWCA 5HVWA 4FOMA 2IPTL 1V7ML 5DD5L 4I77H 4QTHA 5JHLL 4NN5C 1AP2B 4TSBL 4NWTH 3GJFA 1KLFA 5FOBA 5IF0A 1PSKH 3FTGB 3L1OH 5HHVH 5EBGA 3HC0A 5J13B 2EDKA 4H0GA 1K9TA 4MWFB 2EDFA 3EYOA 3D9AL 1D6EB 1XGQB 2R2BB 4LCWB 5KSAD 3TNMB 4G6KH 5F8QC 2FB4L 5ACZB 2IAMC 2NZIA 1PYWB 3WNOA 5GZOD 2AW2A 4KHXH 4M62L 1AXIB 1KCVL 1OD7A 3UBXI 5EB9A 3TGXA 4PUBH 5JQ6H 4BQ6A 4BK5A 2VN7A 4PJGF 1BVLB 3T1WA 5IW6A 3QIUB 4CUCA 2NTFB 3MLZH 3MUY1 4ZUSB 4BFEA 3L5WA 1YQVH 2XTJC 3VXSB 4D0CA 4JVUA 3VFVB 4EQ2A 2XG5A 4JFPA 3MRPB 1A7NL 1RZIB 5HHOB 4HUWA 3WKMH 1G7MB 3V7AG 4CVUA 4Z5RB 1RV6X 1AQKL 2P48B 4X6BB 1B0GB 3BH8B 4KQ4H 5C9JB 2VLKA 5BZWA 2O5ZL 3PWNA 3DHJA 5FHAH 4MLSA 5BS0A 4JPKL 2C3WA 2YHGA 4GSDH 3WE6B 1GL4B 3IKCA 1QKZL 5BCAA 5KN5A 1OAUL 1ED3A 5DYOB 1FPTL 1MREL 1IFHL 2F53B 3WHE0 3PWPE 2R15A 1U8OA 1IC5H 1QD0A 1MJJB 5EBMA 5BMFL 4HKZA 1GOGA 3RWHB 2I9LA 3TN0A 1TETL 4GW4A 1QLFB 4JFZL 3SCMD 2ICEB 2VZ3A 3OX8B 3IDYB 1FDLH 4C56B 4L29A 2UUDH 5E6ID 5T3ZH 1KJMB 4UILH 2XFXB 1MFBH 1TVHA 3FT2B 3FONA 1IAKA 3C08H 4OGYL 3S35X 1WUNT 1V5JA 2EKSA 3VXQA 1VPOL 4MA7H 3MRCB 1FZOA 2R56L 4MHHI 4Q7DA 4OTXH 1HHHB 3SKNB 2UV3A 5I6XC 3RVTC 1H5BA 1U91B 1ND0A 3PABB 1DCLA 4BELD 1BJ1H 4Y16D 4I2XE 2PYEB 4E0RA 5IW3A 3MNZB 1VERA 3RRQA 1C7TA 4L4TA 4NKIH 4W81A 3HRZA 5L0QB 1NFDB 4OUUB 4NT6B 2D03H 4MXWH 5D7IB 1KPUA 4R7NB 1L0YA 4WU7B 2CDGB 5D2NC 1T0PB 5IT2L 4P2RA 1YECL 1IC4L 3C60C 5IBLD 4Y4FA 2BVQB 2F9BT 4YLQT 1FHGA 1BEYL 5K93A 1HSBB 2QQNH 3CVIL 4NO2A 3OAYH 3GIVA 4ERSH 4PRHA 4KKBD 4M6MH 3ARBB 4ONOA 3HC4H 3P40A 2A6IB 2V5YA 4NQEA 4OZIA 1FNLA 5GS1A 1HXMB 1LNUB 3O2VH 5GGVH 4X9IA 5B22A 2W9DL 1UGNA 1MCEA 4P5KB 5CGYC 2DTSA 1J8HA 2EIBA 2Q7NA 1LK3L 2MMXA 5FF6A 2IBBA 1EFXB 3BP4A 4XAKE 3KG5A 4XP9L 1NGWA 3D0LB 1UT9A 4TNWF 4EDWL 2CGRL 5EBLA 4ZTOL 2NTFA 4UTBH 4ZUSA 3T3MF 1F8TL 3D3VA 5J1TC 4HJ0C 1UJTA 1UQSA 2V9RA 3ZKND 2VDKL 2BMKB 3GI8H 2CLRA 5GS2H 3UTPE 3V6FA 3DBXB 3ZSSA 5CEXA 1CTNA 5EU5B 5EA0H 2VXVH 2YBRB 4NOFA 2I9TA 5DRZB 5HGHB 3LPGA 5FYLD 1HYRC 4HFWB 1R5WB 3HZYA 2QKIA 3ZDYF 3LV3B 4R97C 1A7OH 3KR3L 3V6OA 4KGJA 4I1NB 3PWUA 2OR9L 1K85A 3G5VB 5H37G 1N6QL 4WFGE 4M8QB 1A6PA 1R3KA 1JGEA 3CMGA 3P30L 4XPGH 2HFTA 2V2XB 4I4WB 3MACH 1MCFA 2A1WH 2ENYA 2FCBA 3BQUC 1MI5D 1U42A 5HGAB 5T5NG 4HAGA 3FJTA 3MNWB 2WWMC 3FB6A 4Y2DB 4OCSL 1JZ7A 3RGVB 5EO1B 4NQCB 3ILQD 3OKEB 3VCLB 3OJVC 4RMQA 2VXSL 3PL6B 4P5MB 3T0XA 5F96L 1WVZA 4HF5H 3CDFA 5MEND 1UH4A 1WTLA 3UPAA 2ZSWA 4RAHA 4RGNB 4ZPVB 3S37X 3TEUA 4P2QA 3MNZA 2V2WA 4YGAB 3NFPA 5C2BL 2BNRD 2R0WL 5E08H 3L5XL 3RPIB 3GMQA 1G7PA 2A77H 3VDCA 4U7KA 4L9DA 3O3BB 3CC5A 5DMGC 3X3FL 1FYTD 3M45A 4Z7UA 3LIZL 4EUPA 1HSBA 2OMNA 4QRSB 1PDKA 2R4SL 4CNIB 2BY3A 2PN5A 4MCZB 2JCCB 3ZDZF 4WWKC 1J0ZA 5IB5A 2EEBA 4JM4L 4HLJA 1UZ6F 2Z9TA 4MVBC 5CEZD 4LLUB 4L8BB 3EYSH 3OKDA 5HHNB 2VMFA 5DWUL 4DVBA 5K9KA 3KPRE 5F6HI 1XGYH 2ITDB 3LZFL 2CLVB 3LKOA 2CKBL 3WJJA 5DMIH 4HZLA 3H6JA 4FZ8H 3SO3C 4KMQA 4YHLH 2MFNA 3BDYH 3RVUC 3GKWL 4I3RL 3D0LA 5C6WH 1MFEH 3QPXH 1HIML 2J6EL 3HE6A 3PV7A 3C6SB 4H8WL 1A6AB 4GMTL 4WW2A 1O7SA 4P59L 5F7EL 3GSQA 1BJ1J 1NGPH 1PY9A 3I50H 1YEHH 3RWGB 1OP5H 1HYSD 2O5YH 3FQNB 1JGVL 4MCYA 4LMQE 5E94B 4HK0B 5CZVH 3BHBB 5ICYA 3G5XA 3WFBH 3RQ3A 3MUHL 1G7HB 4RAVA 1U8KA 2EDQA 4WV1B 4PTUB 4OCYL 5IV2B 4NP4H 5D2LE 4L5FH 4RBPH 4S1SH 2R2EB 4E5XA 1QFWL 4Z9KB 2H26B 4M8QA 1LEGB 1AY1L 3B6SB 5J3HD 1HHKB 4WFHE 4XC1L 2BRRL 3LB6C 5B21A 5KS9A 4NQDA 4YHZL 3QULA 3F6IA 1DQJA 3K2UL 1EHLL 4ZTPL 3VWKD 4JZJA 1K5NB 2XRAH 5GRUL 2FATL 2BP3A 5J13C 4Q9QL 4F7CA 2GK0A 2IALA 4L3CA 5DT1L 1FVDA 4OZHE 5F9JB 3W9EA 1GZPA 1KEGH 1AFVL 1IAIL 2Z0BA 5JMRA 4Q0XL 1PFCA 4XCCH 3B5TA 5GPRA 1MRDL 4YQXL 5L8KB 3G6AA 4AIXA 4HSQA 4HIEB 5ANMB 1A6TA 1DDHA 4NZTL 5I15H 3MJ8A 2KPNA 2ZWLT 2CK0H 2NY0D 3CUPA 5DC0A 2DQUL 5I18H 2GIYA 5JW3L 3MTRA 1WWBX 4LKXA 4FG6C 2EDHA 2VZOA 4NC1C 2FSEA 1A8JH 3DWTA 3WD5L 5D5MA 4GLRH 1HCVA 4GQ9H 3NABL 3DRQB 3L3GB 3PJSA 1KENL 4QHKJ 4TRPH 2FD6H 3VH8G 3L3JB 1EJOH 3O3EB 1VFAA 2QSQA 5JW4R 2IQ9H 4ZXBD 3QDGA 3MROB 1X5GA 4O4YH 3TV3H 3VGEA 5FYJU 4H8WC 3UDWA 1AGEA 3GBNL 2V5MA 4WHCA 4X99B 1I85A 3U0PA 4AEFA 1U93B 5F9DC 2D4DA 5HD8D 3MBED 3MYZA 3TVMA 4EUPG 3HS0B 1LE5B 2FR4B 4URTB 1NDMA 2YD7A 4Y4KD 4LF3A 3VG0L 5E8EA 1GGTA 4QRRB 5IK3A 2FJFB 4LLVA 3CFJA 4XNZB 3MUGB 2R69L 3I2CH 5D9SB 1S7QA 5J7CC 3EOBB 1GXEA 5E94A 1W0VB 4JY5H 3HG1A 4Q9BA 2IFFH 3ULUF 4I3GA 4XVSH 3CFCH 4PTUA 4PJBF 4R4FH 1SJHA 3TP4A 2WMPA 1J0YA 2Q20A 1FVCB 4ZAKD 1WZ1H 1Q1JH 2R4RL 5E2VH 5D7KD 1V3KA 1BFTA 1RJZB 4EOWH 3Q6GL 4J3SA 3FN9A 1LO4H 1MIEH 1RI8A 1X5LA 1G7QA 3OXSB 3QEQB 5MI0B 1RZKH 2BDNL 1QFUL 3DVNB 3UX9B 5DEZA 1NC2B 3JVGC 5JOFA 1BQHG 2GSGA 2MNUA 4F2MB 2VDMH 1RZ7L 3CFKA 2P43B 2EDWA 1BF2A 5BV7L 4HIEA 4NKDB 4HXAL 5DQ9A 4PRIE 2VR9A 3GSRA 1EGJH 1OW0C 1QOKA 5IR1B 3ARFB 2AERT 1MH5B 1P7KA 4FS0A 4JM2D 4I18B 4LHUD 5J6GA 4GRWH 4J3TA 1ODAA 1E4WH 3HE7C 2DQHL 5I8OL 5CJQH 1R5IB 1F3JA 1YNKH 4Y4HC 3KPSE 2HLFD 4LVNB 3MXVH 5ESVB 1T7VA 1CD8A 3IJYA 4JLRB 4MA3B 1MIMH 2BFVL 4HH9B 4PJHA 1TZIA 2OTUB 4H5SA 4WI4A 2ZUQC 4C59B 1QUNA 1HI6A 1JNHB 1CXLA 1R24A 3O6LH 3TZVA 4WO4B 4MD4B 3SGEH 4G7YL 2ICWJ 4HUKB 4Z7WA 3QI9C 3WFDL 4BH8A 1MCLA 3MR9B 1XMWA 1DEEB 3FQUB 4LCIL 4KDWA 5C09B 4GMSH 1N0XL 1XF5A 1QRNB 2NZ9D 1I1AD 5E99H 4QRPD 3QNZB 1DQML 4XMLL 3QYCA 1SEQH 2EYRB 2FJFA 4CVZA 1OSZB 4XWGL 2GQHA 1AE6L 7FABL 2AV7B 3WN5B 4MSWB 3IS0X 3H9SB 5CBEA 2D7TH 3BEVA 5D9SA 3TWCL 3S88H 2M8XA 1YEKL 1ZLWK 1GIGH 4UINH 4HIIA 5BJTB 4BSWB 1P1ZA 1CG9B 5C08B 1IM9D 1ZA6A 1UXSB 2VLJA 4M93C 4UTAH 2IPKB 3RAJH 3WIIH 5IJVB 3EYVA 3H9ZA 4L4JA 1U2HA 1FVCA 5AG9A 2A83A 3GSWA 1PQZB 1DQQA 1J1PH 3GMRB 1JYXA 5T33L 1OARH 5HGDB 3MV8B 4XP6H 1P4BH 1P9MC 4EXPX 4WUUA 2ICES 4J4PA 3CGTA 5BV7C 4G8IB 1X7QB 1CTOA 3AREA 3BP7B 4R4BA 1Q0XH 3V5DA 2Y5TB 4LCWE 2IPTH 3UTZA 1EEYB 4OLXL 5DD5H 3AM8A 4MJ4A 5JHLH 1Y18B 3W5NA 4TSBH 1PX3A 4L3EB 1TJHL 2DWEA 3HNTL 3NA9L 4OI8A 5IFJA 3KLSA 4YIQB 1MJUH 3QRFM 2NY2D 3L9RB 3U46B 3D9AH 1INDL 2R0LL 3I02B 4LGPB 1W0WA 4P4RA 4N8CL 3D85D 5D1XC 3WEXB 1FAIL 5JLZB 4ZUWA 4AH2B 1P6AB 1F11B 5E8OB 1R5VA 3TYGL 5IG7B 1JFQL 3VXSE 4NC1E 3PG2A 2E7CA 5HVGB 3VXUB 3ISWA 1LK2A 5DR5H 2DLHA 4D2NA 1ZTXH 2W1NA 1VKXB 2ZNXA 2DQDH 32C2B 5HHOE 4ODSL 3B2UD 3O2WH 3GK8L 1HSAB 3B9VA 3TBWA 3MRIB 3ALPA 5SWQB 4EN3B 2UVFA 4Q6IC 4LLQA 1MY5A 1INQA 3LN5B 4LGRB 4M61B 3SDDA 1A7NH 2YSSA 3BH9A 3LQZA 1A7PH 4MNGB 2NTSP 43CAB 1VFUA 1HXYB 4LCUB 5CWSB 3NN8B 3MA9L 1QBML 4MGXA 1G7IA 4ORZC 3QUZC 2F53E 5E8DL 2P4AB 4JPKH 1BOGA 2BY2A 1JPST 5CJBA 4PGEA 4AT6B 2ESVB 3ZZ1A 2P5EB 1FPTH 1MREH 2XOTA 4C56E 4LMQI 5IFAL 4NRZB 3WN5A 5BMFH 4I48B 1FZKA 5DSCB 1TETH 4LLWA 5IEHB 2APWA 4JFZH 3BISA 4XGZA 3NCFB 3AMKA 3GMNB 3D2UD 5M95B 2IH1A 3VDAA 2XZAH 2W59A 5I74C 1MFDL 3PWVB 1G84A 1B88A 1X3DA 3CLFL 5GRVL 3C5ZB 4BYHA 1OAKL 2PYEE 4POYA 2IPKA 4FFYL 5F7DB 1NEZB 1IEAA 3ARGB 4K8RL 1IGIL 3O4LB 1NFDE 5DRXB 1WITA 5D7IE 2Q86B 4IRJA 3QXVA 5TFSH 4OQTL 2BNUA 4P5TA 5ERWB 4NO3B 4G8IA 1V05A 2BOBA 1RZFL 4YPGA 3IXAA 1SVCP 2YK1H 2MHAA 5JUEL 4JJ5A 1Y6MR 5EO0A 4PGJA 1BX2B 3BPNB 1EEYA 4NC0B 1QRKA 5IT2H 1IQDB 4YXKL 1IC4H 3OGOE 5L2KB 2GCYA 1EVTC 4YBQC 2UYLA 3G6JB 4W68A 5ESAA 2FLRT 3FQTA 2P5WB 4PJDF 3MRNB 3FOLB 1FO0B 3RNQB 4FQXA 4V1DD 1QO3B 4AH2A 3NCCB 4GRWB 2W9DH 4X5WB 1JF1B 3CMOH 3STBA 4ODVL 3TBTA 4ELMF 5EU4B 4RFOL 5GGTH 3FAXA 1M7IA 3T0EA 3ZTJH 2DI8A 1G7JA 1I7TA 1JPGB 1OPGH 1F4XL 4EDWH 4F7MB 2CGRH 4ZTOH 4MQ7B 2J5LB 4PJCF 2QV2A 5EUOB 5EU6D 4Y5XA 5T1DL 3ZE2E 3VWJC 1BIIB 2DQTH 1XR8A 3RZCC 5E9DA 4YFLF 2DQJL 4OLVL 3GMPB 2YEZB 4R7DB 4XRCA 4PB0H 4B7LA 4RX4A 4Y5VA 2VITA 4CMHB 4OB5H 4OUOA 3RWFA 1JTOA 1FC2D 4L4VE 3WLBA 3WHXA 3VFTB 1EEZA 1T1ZA 2C3VA 2ICCA 5EOTB 1S7SA 4XB7A 2OR9H 2D3VA 3MXWL 3AROA 4CRPA 4XBEL 4JFEA 5C0RH 5I1AA 1N6QH 5KAQF 3MJ7A 1F97A 5IB4B 4RGMB 4WU5B 1NANI 2XN9D 3PQYB 3UC0L 2GSIB 4I48A 4IDJL 1JWSB 3DVFA 4NQCE 4K8RC 5IHLB 1YYMH 1HNFA 1QBBA 4HG4J 2ADIB 4F37K 1A9EA 3ULVF 2FO4B 1ZHBA 2DAVA 2C3HA 4NN7B 2GAZA 2DBLL 3H0TB 3MNVB 1XR9B 4D0BA 3BIAX 4OCSH 4RGNE 4AEEA 2BY0A 3IXTA 5FO7A 3HR5B 1ZLVK 4ODUB 3UO1L 4TUJB 3HAEG 1CR9H 5GGRB 5DS8A 5F96H 1I8MB 5DDHA 4Q9CA 1DN2A 4YHIB 3LKPB 5I19H 3BUYA 2ED9A 5GGSB 1MFNA 1I9IH 2E3VA 2IADA 1XZ0B 3U83A 5I16B 2JCCE 1NGYA 2DQCL 5JHDD 3I3BA 3OAUL 3KJ4B 2BJML 3SKOA 2EIZB 3U4EB 4U31A 4OT1H 1SEBB 1S7XB 3X3FH 4KKNA 4Y7MA 2G9HB 3LIZH 4XPAL 3F7YA 2PCPA 2D9CA 1QHOA 1I7UB 3QUYB 1TVBA 1UCBH 1I9JH 1EGJA 3NZHL 4JM4H 1O5DT 3FZUD 3E2HB 1SYVA 5DWUH 3OB0K 4W6WB 3RPKA 4YNYA 3FT3B 5DGRA 2D0FA 3LZFH 3EOTH 3BXNA 5IB3B 2CKBH 1K3ZA 3DO7A 3HB3D 4NDMB 4D9LH 3EYQC 3GKWH 2BERA 4I3RH 1OAYL 4X4XA 4JPWL 5ILTH 1HIMH 5DJYB 2IAMA 4LFHG 1JHTB 4H8WH 2Q7YA 2VLKD 2AS5M 1XGUA 4JRXA 3O41A 3JWDL 4GMTH 4DKEL 1ULVA 3MA7A 2PNDA 4P59H 5F7EH 4OJFL 1OT1A 3PP4L 3JV6B 5BS0D 4FFVD 3QXDA 3KYMA 3OKKA 4YEEA 4JJHA 1HE7A 4OZGA 4R3SB 2RAMA 3L3HA 4PLOB 2AJYL 3ZYIA 3QQNA 4U7MA 2C4FU 4RZCA 1JGVH 2HT2C 3V4PL 4TPRL 2QHLA 3O9WC 1NFIB 4Z8FH 1CXIA 1GH7A 4OCYH 2Q3ZA 3TN0D 1OB1A 3GO1H 4Y1AD 3U4BL 1NBYA 1LDSA 1CDBA 4Z95L 3NCYS 1QFWH 2HJLB 3GI9L 4K3GA 1F00I 5CFHA 1H3GA 3HZKB 2RFXB 2X4TB 4XC1H 2BRRH 2JJSC 2H6PA 2NY6C 2HN7A 4YHZH 5JW5A 3HMXA 4Y19B 5ID1A 3TIEA 3QQ3A 1A6WL 2JK5A 3WYRA 3K2UH 4ZQKA 2WINA 1NCNA 5IMLA 5GRUH 4BFIA 4G9FB 5A2KH 4Q9QH 3BMWA 2ZUTA 1GOFA 1XGRB 5ANME 4W4NA 1AFVH 1IAIH 3DJ9A 3SQOH 4PJ8C 1IBGL 1WSST 5D7LB 1H0DB 4N0FB 1I3GL 4L4TD 5JOPE 4HV8B 4N8VA 5CMAB 2RCSL 1JK8B 3FO1A 1MCQA 3VFNB 4O2CA 3A6BL 3QP3A 3SJVA 1KIRA 5DEGA 3DLQR 2DQUH 4Y4FD 2DLFL 3VXRB 4KRLB 4A6YH 4ODTL 3FO2A 4NQSB 4AG4L 2MPAL 4PRHD 5GS3A 3RHWK 2VZSA 1EH9A 3WD5H 4NQED 1AH1A 3C5SB 2D4FA 2A9ML 2GJZB 3S8WA 3RL2B 3NABH 1VFMA 4QHLA 2FX9H 4LOUC 3NPSB 3W9DA 5GSRB 5C7XH 1J8HD 2A6KA 35C8L 4Q2ZA 2ZZUT 4NJAH 4JCMA 1BAFH 4JFXA 5MEPB 3GRWL 3RVXC 4MXVF 1CGVA 3MV9D 2BRQA 5D2NA 3RWJA 1D5XB 3GIZH 4LDEB 3SDAB 1KB5L 3GBNH 3P3YA 3MRMB 3JWDC 3C60A 4YDIL 2Y36H 1V7NH 4JQXC 5MEQB 1MQKH 5DFVD 4QRRE 5EOCH 2Y7QB 4FFZH 2X40A 3PXHA 3MRQB 3BKCL 3K2MC 2DYPA 4G6JH 4MX7B 3DX9B 5CCKH 2DLIA 1DEDA 3CZFB 2NY1D 4JFOA 1JHTA 5C0IA 4PJ7F 4PGBB 3VG0H 3L6FB 3MCLL 3VRLF 4PJAB 1ZWIA 2ATPB 3QNYB 1FGVH 2EO9A 1B6UA 1FIEA 2E7BA 4Y5YA 2HJKB 4M7LT 3ZHLA 3D6GA 1YQ2A 3O4OB 1QSEA 3HI1B 3MLUH 4RISL 4U6HA 5CUSL 1C08A 4ZUVA 2QR0A 4OZFH 3MX0A 2BSSA 3Q3GA 3E3QC 5EZJB 5KSAC 2WBWB 5EFIA 5IGXH 3JTTB 4DFHA 5C0CA 4PBWD 3U7WL 3QEQE 5GZOC 3K8KA 4DK6A 1JWMA 2G5BB 2OJZL 2VZVA 3SDYL 2P8PB 3FT4A 4ZD3L 3KWWB 4JHBA 4ELKB 4ZFGL 3V4UH 4OI7A 1F4WL 1DE4A 4HWEL 1XGRA 3MRJA 2BDNH 3R4DA 3O8XD 1MCBA 1FFRA 3EJJX 2Q76B 4O02L 1RZ7H 1JHKL 4P9HL 5CMAA 4MDIB 3VFNA 3V0VA 1VFBB 1RHFA 3KPLA 4I3SL 3IFOB 4WW1B 3ULUL 4LEXL 4OF6A 3ZMRA 1AKJB 2XICA 3NIDF 1TTGA 2LU3A 3M07A 4JZNB 5MERA 1E4XI 1Q0YH 3K81A 4M4RA 5BRZB 3KDMA 5C9KA 5FYLL 4FP8L 2BVYA 2YRPA 2ILLA 2CUHA 4YHYC 4QEGA 4N8VG 1PG7X 4CADB 5T1MA 1U58B 1JVKA 4PRPA 2BFVH 3M17A 4OD2A 5IM7B 4XBGB 1AC6A 4A2MA 1G7LB 3QDMA 5E1HB 5C09E 4HWBH 3HE6D 1I1FA 5HJ3A 4M7ZB 4WHTA 3RDTB 1QRNE 1KJ2H 4L8SB 1S7VB 4S1DD 4WFFD 3RUGA 3WFDH 1MF2H 2Y7QA 5D7JB 4DUWA 3DECA 4HWZB 3TA3B 5L88L 4WWKA 4PJEB 4LCIH 5IEKB 2GKIA 1N0XH 3H9SE 3FOMB 3GFUA 4X98B 2I07B 5E8PB 4M5ZL 4DKFH 4LPTA 3EO9H 4PJAA 1YMMB 1DQMH 4PY7B 4NN7C 3EYUH 1J11A 3R8QA 4IOIB 5F3HA 5C08E 4HKJB 1AE6H 1XCQA 7FABH 2X2YA 3VGDA 3IFPB 3MLPA 1H15B 4FQQA 5CLWA 3TWCH 3MYJA 1YEKH 1KN4H 4KH2A 4OFIA 4MZ2A 1FCGA 4UQ3A 5EPMA 3MV8E 4NQDD 5E1AA 3OTTA 1U92A 4U6VL 3KLAA 1FL5A 1HEZA 1TQCB 1D5ZB 5B3NA 3ARZA 4JRYB 5JPNA 5DO2D 4S0TD 4NHUB 4KJWC 1HOCA 3B83A 1PAMA 5T33H 3T3ME 5H35B 3QIBB 4YDKL 5FM5M 4E42A 2P8PA 3CIQA 2MKLC 3F58H 1EIBA 4L3EE 4P9HC 3CFDB 4IBLT 4M6NL 3B9KC 3ROOA 3PHQB 1ZVSB 2PTTB 5DJ0B 4GKOA 4PJXF 1U3HB 4XPBL 3ZKNC 5T1KB 4OLXH 4PJCB 1RZJH 1BVZA 3ULUC 4G43B 1WFOA 4RFNB 3J8F7 5EUKB 5TE7L 3ZDYE 2VB5A 2L4OA 4GRMA 1BZ7A 4RMVA 2EE3A 3VXUE 4XNMA 1INDH 2QSTA 2R0LH 5LXGL 5FUCC 5CJXC 4PGCB 4N8CH 3JV4B 3QUXD 1FAIH 1JF5A 2DLTA 4YAQB 1K4CA 5T5FL 1QLRA 4NN6C 4PRDB 3WDIA 1XGTB 3TYGH 4X7TB 3ZKQD 4NHCH 4A6YB 1QSFA 2NW2A 1SM3L 2CDFB 1U95B 3DMMC 1WZMA 2EDNA 4R2GB 4WI5A 8FABA 4KUZH 2YKLL 4MNGE 4QCIB 1C5BL 3BVNA 4ODSH 2WAHA 4YC2B 2I60H 4TQEL 2Z92B 4N5EC 3QEUA 1HZHL 1DBML 1G6RH 1FIGL 4DN4L 5IIEB 3ILPA 1ZSDB 1A5FL 3ARDD 4H1LH 1MCPL 5HYIA 4NZUL 1W72H 4MMXC 2APBA 3IDJB 3OB8A 4WY7H 2EECA 1J10A 4LSSH 4CMMB 3U9PL 1MHEA 1S7TA 2CKBA 2ESVE 2P5EE 4FQ1L 4HWZA 4KJQD 2GITB 4R96A 3MLVH 3MRGA 3N0PB 4X6CF 2B39A 3KLDA 4K7PY 3UEZA 5D1QB 2J6EA 3QCVL 4AJ0A 1FAKT 1ONQA 1IGML 4X5LA 3QIWB 2AQ3A 2BVOB 2AEPH 2ZG1A 4RNRA 4G8GB 3EYFB 1AC0A 1S7WB 3N1PC 3ZDZE 3LKRA 4KI5C 5CGTA 4GOSA 1XAUA 2YZ8A 2XWTA 1CGYA 2CRYA 3O4LE 5TJWK 1FGNL 5I76B 5JIKA 3T3PF 2SEBB 2CXGA 3GGWB 3QDJD 1EV2E 5DZOA 3GBLA 1UJ3C 5JXEA 3OKLA 3TO4D 1FZJB 5DHYB 1RK0A 4FFYH 5CEYA 4K8RH 1IGIH 3IU4H 2VN4A 2OK0L 2X41A 2H2SC 5F89B 3EO0B 3PDOB 5T3ZD 5CAYB 3ROLB 5KZCD 1PG7W 4KRNA 3NFNB 4OQTH 3DYMA 2NCMA 1OAZL 4FTVD 5L2KE 2J8UB 5EZIL 1UB5A 5CJOL 3MSPA 4QNPE 3CSYA 3G6JE 5JUEH 1AGDB 2P5WE 4KK6C 5K9QI 1S9XA 4KVCH 5B8CC 4PP2A 4TVPD 5KVEL 3RTQD 4XP1L 1TITA 4GRWE 3DV4A 2ZG2A 4YXKH 1EO5A 1CLOL 1EXUB 1FCCA 5KSUA 4M8VA 1YNTA 5ACMA 2C7UA 1PZ5A 4WNQA 3FB7A 1DBKL 3VXPA 4P3CH 4OGZA 5C2UB 3KPMB 2Z8WC 4I0CC 4O5LL 3HRPA 5I75C 1S78D 4KK9D 3QUML 1KYOK 3JVGA 3W0WA 3WSQL 5EN2A 4GW1B 5EUOE 4ODVH 1A3RL 5HYSB 1HDMA 5DD3L 4RFOH 3LEXA 1NCDL 3KYOA 4PRBA 1I7ZB 4NZRL 1OW0A 1OGAA 5EORL 4YFDB 3D39D 1F4XH 1UVQA 1FFQA 4TUOA 3DROA 2YUVA 5T1DH 4AY0A 4PJ5A 1B90A 4KDVA 3KLHC 3DIFB 1NMCC 3LMJL 1NKOA 2ZOKB 3WS3A 3OXRB 4Y4HA 2DQJH 4OLVH 2UVEA 1KJ2B 3VXNB 2KZ1B 3T65A 5GGQH 2NXYD 5J12B 5GS2D 1MHPL 1JRHL 2XPGB 4XNYL 2VH5L 3WFEL 4NYLB 4NFCA 3EO1B 2B1HL 4EBQL 5IHZB 4OGXH 3MXWH 1LD9A 3QI9A 4XBEH 5FO9A 3MLYL 3LHPL 1MEXL 4QHKI 4X5XB 4OLZH 1PKQA 5HHXL 5CZXD 1OLZA 4IJ3B 2E6PA 2VLJD 4AIZB 3LKSA 1Z9OA 4IDJH 4I8DA 4K7FB 3V6BR 2GW5A 1BZ9A 2X4UB 4OZFA 5IUSA 5H2BA 4HAFA 5DF0A 5TDOB 2C5DC 1UA6L 2DBLH 4U1NA 3FHQA 1YEJL 3GGWA 3IRPX 2EC9U 3PE9A 4ZXBC 1KLGB 4WUUD 3B5HA 2N7BA 1NCCL 3WUWB 2AK4B 2Q8BL 1Z3GL 3BJ91 5I1EL 4MQTB 5KSBA 4ONGL 1N3NB 2CO7B 3P4MA 3H9HA 3O3AA 1F90H 5BOPA 4U1IB 3DX7A 1KSRA 4JDZB 1CICB 4MAUL 1K8IA 4X6FB 2J8UA 2J7LA 5F1NB 2WBKA 3OKOB 1J1OH 1NEUA 5DUML 4GKZB 2Z8SA 4X6DA 1AJ7L 1S3KH 1YN6B 4HXBH 1Q9WB 2DQCH 5IOPB 1P4LB 2BJMH 4QXWA 1MFCH 2FL5B 1F4YL 1WWWX 4FA8A 5CBAA 1P9MA 4S1RH 4HHAB 1YUHA 1T1XA 4D3CL 4XPAH 4JVWA 1I4FB 2X44D 1BD2B 4JFYB 4MJ2A 1WBXA 3MV7B 3H3KA 5IQ9A 3WLWD 3S35L 3NZHH 1Q8MA 5DMKB 1U6AH 3INUL 5I1KH 3ULVL 4U6YB 4ZFZA 5FK9B 1KT2A 3MMEA 5HDBF 1BLNA 3SDDD 4KHTL 3STLB 1RFDL 3TH2T 5D1XA 1DBBL 3O6FC 1U8NB 4JPWH 4OCNC 1B0WA 1G6RB 4F58L 1JGDB 6CGTA 4OJFH 5HPMB 3PP4H 4H1LB 2F8VA 4LLAA 5FA3B 1NBQA 1VGEH 1W72B 2AK1L 3M1BA 5INDB 3F7PC 3HN3A 4OKVA 2AJYH 4XCYA 1CF8L 1C5DB 3QWOB 4HIJA 3SE4A 1LILA 4QY8B 4TPRH 2C26A 3SKJH 4Q6IA 1B0RA 1AXTL 1HH9A 1INEL 4HWNA 1JTTA 4Y19E 2X7LA 2EC8A 1EX0A 3DO3A 1PGRB 2QADB 4QXTA 4NWUH 3GI9H 4G9FE 4YBLC 1BOYA 3QUZA 4MJ5B 2LE9A 2ATKA 2B8OT 5D1ZD 1BQSA 3HPJA 2B1AL 1OTUC 3MLTA 4DCQA 2HVJB 5TH2B 2HLFC 3VFPA 5D7LE 3LRGA 3HUJF 1SVZA 1FL6B 1S9WB 3ARWA 1IAOB 4GAYB 4IRJD 4C83A 2Z93B 1M05B 4P5TD 1SYSB 3GSXB 3O81A 1JWUA 2OI9C 2HVKA 1IBGH 3BP5A 1KBGH 1UH2A 3VXRE 1NC4A 5EZOL 1J1XL 4PY8J 4F8QA 4OM1H 2FIKA 1UM6L 2XZQL 5I8CB 2OXHA 2RCSH 2P8LB 4IRSB 1T4KB 4N9OB 1F6FB 4R0LC 1CICA 2FRGP 2P46B 4JZOB 2ADGB 3MV11 4IMLB 5EIVA 4NC2B 5FCUH 4M9PA 2DLFH 3KXFB 2P44B 3DXAB 4LFHD 4ODTH 4PLKD 4F37F 1I1AC 1J87A 2XA8H 4JO4L 4AG4H 2MPAH 1CBVL 5IOPA 2NX5B 1AHWC 4AZ8A 4P2CG 4P23D 3ULVC 2A9MH 5EU3B 1TENA 4JFHE 1I8IA 2WWKO 5F9OL 1NSNL 3T8XA 1KV3A 4GUPA 4NIKB 3T0ED 3KPTA 3AB0B 5D6DC 1Z0NA 3GRWH 2DD8L 5C0AB 4O9HH 5EC2B 4PBVC 4IOFC 3SE9L 1KB5H 2HJFA 5FK9A 4YDIH 4HBCL 3H8NA 1JV5B 3I6KA 2OR7A 5ENWA 3IFLL 3BKCH 3S37L 3FO0L 1VACA 1QVOB 3STLA 5D4QA 3T0BA 3UTOA 4XAKD 3K3QA 3QO0A 4UIMA 2QSVA 4GG8B 1MNUL 3MCLH 5D6CB 3FL7A 2V7HA 4YEFA 4NOBA 4H1LA 5SWSB 3KNBB 3SDCC 1FJ1A 5GGUA 1FNEB 2VRAA 4X6EB 3U0TB 4JN1L 2VLRA 3IVKB 3CSPA 4RMSA 3RZWA 3CDGA 3C8HA 1UM5L 2GUOB 3UTSB 3VWJA 4LU5L 4M1CD 4ZDHB 1WCBA 3RZCA 2O61A 4G8FA 1SJEA 2YWYA 4B41A 3C9NA 2VDNL 2QTEA 2OQJB 1T2QL 3G5YB 1M6OB 3NIGF 2OJZH 2DLEA 2CR6A 2NY4D 2GJ6B 3B2UC 4ZFGH 3JV5A 1F4WH 1CT8A 2ZUXA 1IAOA 4PJGA 1IGFH 3M8OL 2WQ8A 4JKWA 1BFSA 4UT6L 3LQMA 2PW2A 1HILA 4OCXL 4TSCL 5GISL 4OFKA 4YHKH 2ED7A 5F9WB 3CPLA 5ITFA 4LPCA 3AY4C 5I2IB 2ITCA 1LO3L 4J1UA 4XC3L 4B7IA 1YY9C 3U9UB 5BRZE 5DEFA 1U8QB 1T21A 2IANB 3QG6B 3N1MC 4OQTA 3ZE1F 4K23L 5IMKA 4YHNB 2CDEA 5DJCA 5EG6C 2HFGL 4BKLB 1XCTA 4I3SH 4LEXH 5K9OA 1QTYT 2C1OB 5KJRH 3OKNB 3U6RB 5I73B 1HCFX 5FYLH 4FP8H 3STZA 2CK2A 3WO4B 5EU3A 2VLLA 5I17A 4FXGA 1RIUH 1ZA3B 1XF4B 4Z76A 1U8MA 4DGVL 2WSKA 3BPLB 3P0YL 4I5BB 2F54A 2H9GA 3VD4A 4NO5A 4PJEE 2V17L 5E4EB 5DMJB 3K1DA 3HTLX 1A1OB 2IAMD 2I26N 1I8LC 4JY6B 4HS8L 3BPCB 3KS0H 2QSCH 3KPRD 2C4FT 3SGEI 4XCEA 1YMME 4UU9A 5E24E 2DWDB 3EOYG 4LIQE 1IGCL 4FXKA 1MJ8L 3MOAH 3RHWF 1DVFB 3DGGB 5FYKL 4ZFOL 2WLYA 5BXFA 1OWWA 2NY3B 3BZFB 1NDGA 2XTJD 5T1LD 3HC3L 4PGDA 4MJIB 3VD9A 3SKMA 2AV1B 4KK5D 2GYSA 5DJ8B 1QR1B 3LQAL 4UAOB 4LRIC 3VXOA 3N1GC 3IETB 4HS3B 4JRYE 4PRNB 3WHE1 3GJEA 3BYTA 5JIHA 3UTQB 1MAMH 2ZPKL 3V52L 4UOJA 4U6VH 4NKQB 1U8HA 3HPLB 1RZ8B 1U8PA 4NBYB 3OZ9L 2F8OA 3QJHB 3OG6B 3DPBA 1URLA 2QBWA 4PJCE 4WFHD 3VMOA 4YDKH 3WXWH 3F5WA 43C9A 1CLYH 2XA3A 4M6NH 3TFKC 3P9WB 5CEZH 3JUZA 1TCRA 2YPLA 4TOYL 4RA0C 4U1JA 1EO7A 2GTZA 3RVWC 4JANB 1FVEA 3DURB 1IAIM 2CXKA 2W65B 2X4OA 4XPBH 1U9KA 4F7EB 3CXDH 4HKXA 4NO0A 3SJVD 1Z9LA 3VGFA 5EH1A 2DQGH 3JTSB 1BM3H 4MAYC 4PREA 1LE9A 1R3HB 1KJVB 1ACYL 3H3PL 4TUKL 4HC1L 3ESUF 5DHVH 3S9DB 3SY0B 1JPSL 3T0WA 2VDLL 3FHAA 4BKLA 5T5FH 2X4QB 3ZSTA 2G5RA 4X80H 1LVEA 3FN3A 2NNAB 3FB8B 4PJ8A 1UKQA 5FM5O 1CGXA 4Y0GA 4X4YA 5FB8B 2RGSA 3NGBB 1RMFL 1OM3H 2YKLH 4O51A 4GG6F 1C5BH 4J3XA 1NAML 4LCCC 3C60D 2XQYG 4XMPH 1DBMH 2C3XA 3GMLA 5E0QA 1FIGH 4DN4H 4WFED 1E6JL 5HHQB 4L9LC 5JO5B 2DYPD 3WL9B 2YD2A 3MO1A 5ISZE 2WANA 1HHGB 5DK2B 1KLUB 2PO6A 4X7SH 2IG2L 1XH3B 3QNXB 5GS0L 3U9PH 1CFQB 5CGYD 3TH3T 1NGZB 3BZEB 3SCMB 4G8GE 1BIHA 3QG7L 2JIXA 3LQAC 1C12A 3QCVH 4NJ9L 1ZHLB 5E6IB 2E9IA 1W0YT 3DX8A 5DQDL 1O0VA 4JQXA 4HJ0D 4LPYA 1MUJA 1YPZF 2ARWA 5FGCB 1NKRA 5TDNA 2AJ3A 1K4DA 2WIMA 3HLAA 1LO5B 4O2EA 3ARYA 4Z0XA 4CW1B 1ZLSH 4HS6A 2VTFA 2F8XC 3L7EB 4NNXB 2UUDK 5C0CD 5DRWA 4XNQB 3TBYA 4Y16B 1CLCA 3BOVA 1FGNH 2C1PB 4PS4H 4XPHL 1Z5LB 4LSUL 4P99A 4I9WE 5E70A 1KCSL 1L7IH 5L7XL 5ITBL 3QAZC 4FQ2H 2DBJA 3CFEB 5F1SA 2XNAB 5EO9A 5INCB 1U8JB 4NM8L 3QXTA 2YD6A 5E2WH 3HB3C 5I66A 4JO2L 4PV8A 4QXGL 4UT9L 5KSAA 1KNOA 1OAZH 1FG9C 1DQDH 5F7HA 5CJOH 3OR6B 1NCBH 3BQUD 1KIUA 3UTTB 2VQ1A 5C0JB 2PXYD 2WWMD 4HCRL 4P2OD 1T0NB 4NQVB 5A3ID 4AQ1B 2BNQB 3QH3A 3OAYK 3BIKA 2VNCA 1JF6A 1VEOA 1I7RB 1UWGL 2X9WA 5CGMA 1KJVA 3QFDB 2CIIA 3QQ4B 1X5AA 3LSOA 5I30L 4R6UA 5TQ0L 4TTDC 2D7QA 5C0EB 3GHEH 4QRUB 4DZ8B 4GRLC 3QUMH 1KCLA 5D70H 3S4SA 1ZK9A 1AXSB 4XZUB 4EZMA 4ZS6D 3WSQH 3LN4B 5JORB 4P4KD 2M1KA 2WUBL 4JREB 5MEOB 2A6JB 4P57B 3GM8A 3VMPA 3DSFL 1TZGL 1F58L 5IHBA 1UZ8A 3QDMD 2V2TB 4H0HB 4KZEL 4NZRH 1T0MA 3QCUH 4YHPB 5GS0C 5EORH 4D9QE 3RWCB 4NKMA 5DMGD 3RL1A 2F58H 1MHCA 3NTCH 4NQXB 5C0BA 1R3IL 4G8EB 1CFSA 1X5HA 3GRWA 4ODWA 3L95A 3ESVF 4WWKD 3P9LB 1B6DA 1T5WA 3LMJH 4KRPC 1M71A 4LLYB 2VUOA 4ZOBA 1KB5A 5DC4B 1XH3A 5IROC 5TQ2L 3IDMB 3G9AB 5DQJA 1B2WH 1T7YA 1MHPH 2QHRH 3SCMA 4XNYH 1E27A 1MI5B 3RVUD 2B1HH 1ZHLA 5E6IA 1JZ8A 5J9PA 2Y1VA 1KC5H 3F6LA 2BC4B 3MLYH 1D9KC 2GT9B 5JDJA 3LHPH 1N8ZB 4UV7L 2EXWC 3B43A 3BE1L 2X4PA 1NLBL 5B39B 5MENB 2AK4E 4MXVE 1EEUA 5CP7B 1FLRL 1TFHA 5IESL 3ECBB 3I6LE 4TVSa 1UA6H 4YZFE 3FRUB 2VAAA 5KSVB 1YNLH 2HA1A 3KPPA 5ALCL 2BNRB 4KTDL 1SMAA 1AD9A 1A6ZA 2Q8BH 4HJGA 4G80A 5I1EH 3QXAA 1NL0L 3QZWA 4ONGH 5DFVC 4YHML 1MCOH 1JPFA 3DARA 3HKFA 4RWHA 5D2LF 3OAZH 2H1PL 3LB6D 1JN6B 3WO4C 1T1WB 1N6VA 1G9NH 2VKWA 1U0QA 1XIWC 3U48A 4M48H 1HHIA 1MRFL 1BD2E 5DUMH 4QYOA 1AJ7H 4MD0A 4BQBA 2RR3A 3MV7E 4NPYB 4UDTB 5JR1L 4OLWL 4KDTC 5DJ6A 4KTYA 4ZYKA 3VI4E 1D5BB 5HDLA 4F15C 3V8CA 5DRNA 2G60H 4D3CH 1QSFD 3SE3C 4JFFA 4OZHF 1JUFA 15C8L 3GNML 4MDJA 4G3YL 3T0AA 5EBWB 1BECA 3S35H 4X7EC 5ESQA 4QTIH 1MCRA 4RFEB 2NXZB 3INUH 3H42L 3VGBA 1KEMH 3FFCA 2COQA 2HYMA 4LBEB 4Q6YA 4EI5C 4FG6D 2A73B 3HNSH 4MD5B 5D93B 3VXSD 3SDXF 1ITBB 4PJBA 2V2TA 4KHTH 3HCVB 5CJXA 3PGCB 5HHOD 3T2QA 3BP6B 4IIQC 1HQ4A 3P4LA 3G5ZB 5HHPA 4F58H 1OP5K 4PP1D 1FORH 3DMMA 2GY5A 5E2UL 4U3XA 3S4SG 2VLME 3C2AL 2R1XB 1CF8H 3E8UL 1M7DB 4U1LB 1A7BA 3BD5A 3VWKB 1AXTH 4RBPK 1INEH 3GSOB 4UMGA 5DLMH 4FQCL 1AIFB 2ARJB 3QFJB 3IFNL 3W82A 3BKJL 1C16A 5TDPA 1MCKA 3UAJD 1FG2B 2BC4A 3TIDB 4LHJB 1FN4A 4G7VH 2BVPB 2R1YB 3TESA 2YMXL 4F3FA 1WV7T 5CD3A 4PJIF 2B1AH 3SHSA 1YMHA 4DGYL 2NY0B 2XKSA 5C07B 5ICXB 1A4KB 3THMH 5HYJB 1KPRB 1RUMH 2W9EL 1ZVHA 2EDJA 1MCHA 5SX4H 5I1GL 1XF3A 5CJ8A 2PYED 2VWEC 3KXFE 3DXAE 4K71C 3NH7H 3O2DL 3BN3B 1FYTA 1QFPA 2B5IC 1JP5A 2NX5E 2VL5A 2DTML 5DGQA 1JN6A 4JFQA 3P4OB 4XH2B 2WWKT 3GSNL 1UJ3A 3W2DL 1AD0B 5SWZE 3TT1L 2FX8L 1Q9KA 1LP9B 1NLDL 1FNHA 1J7VR 1NUDA 1QQDA 4M7LL 2F15A 4R90L 5C0AE 3S3PA 4YDLC 1WBZA 3V5KA 3GB7B 2Y06L 5I1LA 3MBEB 2VISA 2W38A 3QZWG 4KXZH 3MCKB 2DICA 4WCYL 3U2SB 1NSNH 5DHVA 1RUQL 5DTFB 5DJ2A 3T2PA 4Y4KB 2DD8H 4WHYG 5ETUB 5B8CA 4M5YL 1JIBA 3SE9H 2HKFL 1OGAD 1D6VH 3ZKMC 5EU7C 5GJTL 3PV6A 3X14B 1LEIA 1NGXB 3HE7D 4HBCH 4GO6B 1A1MB 1RJLA 3IFLH 5SWSE 3S37H 1S9KC 5F88B 5DO2C 1FNGA 4Y4HD 4IS6B 4JG0L 4LSQL 4QF1B 4W4OC 3OL2A 3HZMB 2F19L 2PW1A 2APFA 1Y6KR 3OJMB 1MNUH 2DOCA 5E56A 1A6UL 1E0OB 4OZ4B 3UTSE 3LKQB 4R26L 3MRLB 2Y9RT 3FN0L 1C5CL 3VFGL 4MJ6B 5IB1A 4ZAKB 3OKMA 1JHLL 5C1MB 5BO1H 4JN1H 2X6MA 3MRRA 1ZHKB 4ZPTB 4GXVL 4AL8L 3WNPA 4LEOA 1GVIA 3KHQA 4XP5H 4HT1L 3C87A 5DVOA 4L4VD 5FUZH 3O45B 3IDIA 2GJ6E 3C09C 3T1FA 3U82B 5FHBL 3T4YB 25C8L 2VDNH 1KIQA 2VIRB 3IS1X 3OR7B 1AR1C 2VOTA 5TGBB 3FCTA 2X4SB 1BBJB 4KMTL 5T3XL 3NA4A 1KTDB 4NQCD 3HI5H 4LVHB 4LHUB 4S0SD 4GG6B 2DIAA 3KYNA 5DK0A 5B38B 3M8OH 2IANE 4UT6H 2XACC 3CCHB 3R06B 1U8IB 4HMEA 4OCXH 4TSCH 1KJ3L 5F7UA 1X5YA 5GISH 5LCVL 1P53A 1AI1L 2HAZA 4P9ML 3R8BB 1UKTA 4XHJC 3QWRD 4LCYB 5GRWA 4KJQC 1KFAL 3P77B 4PR5B 2FX7L 4ZXBA 3VFOA 2IGFH 4TSAL 5F7KC 4F33B 4M3JA 4LASL 5HDOA 5L6YL 1LP9A 5HVHC 4NGHH 4HUXA 3QSKB 1R3JB 4YPJA 2X05A 2D0GA 3REWA 5SV3A 5D7SH 2JB6A 4QLRA 1UM4L 4CDGC 4DGVH 5C86A 3O3DA 1JZ3A 3P0YH 1GGCH 2CSPA 1ZT7B 4QXUL 4OZIF 4BSVA 1W2KT 5D1XD 2V17H 4QRPB 3QUMA 4YDJB 1MWAL 4EDXA 2WQRA 2VSCA 1J05B 3TO4C 1DP0A 4Z7QE 5F88A 4MJIE 1FFPB 3CSGA 1P4IL 2AXFB 3T08A 3AXLB 1MJ8H 4UNUA 2FEEI 4MYWB 1N4XL 2WBJB 1IM9B 1Q72H 5KVGL 3BRDA 2Q6WA 3BD3A 3LKQA 2EDXA 2GTWB 2W0FA 2C9AA 3I6GA 4YHOL 1EZVY 5A16B 3BZDA 3R1GL 4UQ2A 2J88L 3CU1A 2H3NB 3O6FA 5JIPA 4XBPA 3WIFA 4U1GB 2UWEB 3FKUS 4FQHA 2JB5L 1MLBA 3CVHB 3GJFH 5LBSL 3S96A 2D7MA 3QUZD 3V52H 1R6VA 5J6HB 3IJHA 3F7VB 4I0PB 4PJDA 5LKNA 2H41A 1WZLA 5DJAB 1ADQL 1U8LB 3OZ9H 3BZ4B 5CIPB 4G9DA 3NOIA 1FL3B 2NY2B 3KAAA 4ONHB 4D8PB 4JVPA 1DFBL 3ES6A 3VFMB 4ELMA 3D85B 3TCLB 1NC4D 4JM2A 4R9HA 2Z4QA 4J8RB 4BH7B 4N9GA 2I5YH 5TF0A 1RUKL 2G75A 4NZDA 4YWGH 4U1MB 2AXGA 3P73B 4RDQF 3P0GB 2YR3A 1IT9L 1QEWA 1ACYH 4DQOL 5HPOA 4HC1H 4ETQA 1QA9A 2HRPL 4NUJA 1JPSH 5DJZB 4PR5A 4DKDC 2VDLH 3GUTB 3OKYA 3GMMB <