1T5WB

Hla-dr1 in complex with a synthetic peptide (aaysdqatplllspr)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
190
structure length
190
Chain Sequence
GDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Polymorphic Pocket at the P10 Position Contributes to Peptide Binding Specificity in Class II MHC Proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
total genus 41
structure length 190
sequence length 190
chains with identical sequence E
ec nomenclature
pdb deposition date 2004-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t5wB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1t5wB01
4KK8C 5F3BB 1U8NB 5F6IC 3S37L 3DUSA 1H0DA 3EW3B 5MP6L 4MA1B 4XGZA 2V17L 1DUYB 1RZGB 5E6ZA 1OGTA 1H8SA 1EFXA 4JFXA 4XP4L 1UZ8A 3S96A 4ODHL 4NZRH 1LDPL 2FZ3A 2G2RB 5FKAB 5I8CA 4NQDB 2P7TA 2DJ4A 1D3CA 3B9KB 2DYPA 3CFJA 1QSFE 5T33H 1I1RA 2P1YA 2M8XA 25C8H 3QEGL 4YHOL 4L4TD 3MRLB 4POUB 1F42A 4QYOA 5EUOA 5E4EB 2Q86B 4L4TE 1K3IA 2IBZX 3RWJA 2QQKH 5HHNB 1A14L 2VAAB 4DKEL 1MREL 2A2QT 3FQXB 5CEXA 2CSPA 3KYOB 4WHTB 3B9AA 1TNMA 1T1ZB 5IB5A 5J4MA 3WUWB 1ZT7B 5CEZD 2EDHA 1TENA 2GJZB 4ZUUA 4U6VH 1EAJA 4ZNEA 5I8OH 4XRCA 2BX5A 5C09A 3LV3A 5C0CA 3RL2B 4UI2A 1LILA 2HLAB 4JR9L 2CDGB 5D1ZD 3VCLA 3BPLB 4H5SA 1I75A 2EDRA 2X5PA 4PGJA 5T3ZH 4Q6IB 5TJWK 4F7TB 3OPZH 3G6JF 1NEZB 2X42A 2EDBA 3G6AB 3MJGX 2ZCKL 3O3UN 2E27H 1U36A 2DWDB 4LL9A 4R2GD 1AXIB 1NLDL 2BVYA 3VH8B 5J3HC 5D93C 3FRUA 5BQ7B 4MMXC 4TUJA 2CD0A 4HXBH 4JFXB 4DN4H 5HVFB 4WDIB 2WBJC 4HKBA 4JVUA 2JF1A 3L5XH 5DJ0B 1WZ1H 3DMMC 4OFKA 4OF0A 2F5BH 4AEIH 2AJUH 1OF2A 1QLRB 4JFQB 4X6BA 1QFOA 5I1IL 4U2ZA 2ADFL 2VLRB 3MA9L 1IKFL 2NY3D 3KNBA 3JWOC 2A77H 1F3JA 1IILE 4MJID 3HMWH 3L95B 5I76B 1BD2E 5ILTH 1J9CT 4WTZA 3BZ4A 1UQSA 5L88L 5C0GB 4X6CB 4ZS6D 4I77H 3FRUB 1J0YA 2J7LA 1LO3L 2C3XA 2R4SL 4WFGE 3RGHA 1V3JA 3IVKA 5EA0L 3AREC 1T7WA 3D3VE 4WFEE 5T5FL 2YBRA 3NACL 5EOQH 1FNSH 3CNKA 3NTCH 1VEMA 2ZUUA 3PHQA 4M5YL 2F5BL 4AEIL 4GS7C 4ZS7H 4DVRH 4CGTA 5HGBB 1HILB 3MUHL 1B9ZA 4ODUA 5F9JA 5CUSH 1AQKL 2XTJD 4OLWL 4OB5H 5KS9B 1PG7W 4EOWH 4O2FB 5EU7E 1NKRA 4FS0A 1NCNA 1CS6A 2WP3T 3QG6B 2YK1L 5FUZH 2NX5B 1CI5A 4ZFFA 3FJTA 1UYWH 2FATL 2F58H 4DUVA 4PRHD 1Z3GL 4IIQC 3GMMB 1YNKH 1E4JA 4ODWA 2EEAA 4OFYD 2ADIB 2DQDH 3RZCC 1I9EA 4HF5H 2X41A 4AZ8A 4OQTA 3OX8B 2R2BB 2VXQH 3CGTA 3OKOA 5C0AB 4M5ZL 3VFSA 4WUUE 2ED7A 4EN3C 3TBSA 3QH3B 4L8SC 3MRCA 1EH9A 2B5IB 2CXKA 5A3IC 3LV3B 4JPIA 2RFXB 1J5OL 3FB7A 3L3JA 4Y2OA 1AO7D 1N6QL 1B0RA 5TQ2H 5BO1H 5F96L 2VIRA 4YX2L 4OLZL 4YC2B 1EO5A 3SDYL 3DO7B 4NPYB 3HNSH 2P8MB 5AYUL 3M17A 3DUSB 4L8BA 3IFPA 3WFZA 3RGVA 1JPSL 1OARL 2W9EH 1ZVSB 3G9VA 1MWAL 3BD3A 4K94C 3BESR 3KJ4B 4F57H 5J11B 1FL3A 3MYJB 3MRLA 5C08D 3P73A 5GSVB 1A7NL 4QGYA 3EYFB 3PGDB 4JGJA 3MBXH 5DC4B 4ZOEA 1W0WB 2QR0B 2ZUSA 3MSPA 1TPXC 3BDBA 4LBEA 4NJAL 4PGBB 3TVMD 5EO0A 1FG2A 2NY2D 2WLZA 4LLUB 4HMDA 1F58H 4M4RA 1KJ2A 1YEFL 4U1IB 4ZO6A 1QSED 3MA7A 4UNTA 4GRWH 5BXFA 2PXYD 4U6HB 1UT9A 5E8DH 2XA8L 3TBSB 2DYPD 4PJDE 2VNCA 4KZEL 4LIQE 3IS1X 3PABA 3X12B 5FYLL 5B3NA 2DLGA 3D9AL 1IRAY 1FO0H 1K9TA 3HUJE 4DFHA 2XKNA 3K8KA 4G7YH 5INDB 2FDBP 3NFSL 1DFBH 6FABL 2X4NB 1DVFB 4Q6IA 4F7TA 3HAEB 5DI8B 5EO9B 2LFGA 1F4WL 1W0VB 2BVPA 2Z8RA 2V6HA 4BELD 4P2QA 3MRMB 4XAKD 3QRGL 2X40A 1CFVL 4M9OA 4XVUC 1H3PL 3IRZA 4I13B 4H8WL 4GRLC 4YFEA 2YK1H 1F8TL 3T1FB 3HAEH 3T8XA 5JIPA 4Z7WA 2AK4E 4X7FC 5FYLH 3QI9C 3MOAH 4Q97A 1X5XA 1ZLUK 5BOPA 2BOBB 3AY4C 1HDMB 4JDVB 3TO2A 1FE8H 1QSFD 4LCIH 1YEEH 4PJAE 5L2KE 5D1ZB 1WWWX 4PRPB 1DJSA 4JO2L 5BS0A 4JFFA 3U0TA 4OFPA 4CMMA 1QEWA 1OW0A 4QOKE 1JRHH 2H2PD 3HLAB 1J10A 1S7VA 3RKPA 1WWBX 3DRQA 2BNQE 3QIWB 4TUOA 1FZKA 4U6YA 5D2LB 3UAJC 2DLEA 1U0QA 1AIFA 5CUSL 1IFHH 2Y5EA 1OAQH 4C59B 1ED3A 2F9BT 5EOCL 5F7KC 5DD1H 4LCWB 2Q8AL 4DQOL 1QLFB 2Y07L 3J7HA 4OGZA 5JZ7C 4KQ4H 4Z8FH 1TJHL 3P0GB 3KYAA 1F45A 2B1HL 2H1PL 4MX7B 1ORQA 1K5NB 3MUGB 1PVHA 5DMJB 3Q2CA 4D94A 5FO9A 2OBGA 4JFED 4XMKL 1IAOB 5AG8A 2X4RA 4PJ8C 4KUZH 2YA1A 4M48L 2CKBB 3DGGB 3KDMA 2VR4A 4F7CB 1DSFH 1TITA 1OAXH 5DJ6A 5DMGD 1T2QL 3QXVA 5B38G 4LDLB 3TA3B 3BRFA 4RNRA 5BZWA 1CICD 1RZIB 3VXOA 5GS1A 1A7BA 3TYGH 1I3GL 2E7MA 4N8PA 3RAJH 5CAYB 4NQCB 3LIZL 4G8GA 3EOTH 2Y6SD 4XBPB 4OCRL 3GRWA 5KSVA 1NL0L 3T09A 1BJ1J 1QFWL 2AI0H 1RUPL 1KEML 5D4QA 1YYLH 1I85C 4Y4FA 5I17A 4NQSB 5E6YA 4R97B 4ZDHA 4WTXA 4UU9B 4PJBB 3OTTA 1MFEL 2F74A 1XZ0B 5F9WC 2KKQA 4KK8D 3WKMH 1VCAA 4OBSA 5FYLE 3RVVC 1I8KB 3LH2H 2X9WA 3BRGC 3VFPB 1ZSDA 4LLMA 3BQUD 4LHQB 4HMEA 2FD6H 4CW1A 1MPAL 3VI4E 3U0TB 4OM1H 4EIZC 3LOWA 2V5TA 5D7KE 2NXZB 1NFKA 4Z76B 4JKLA 3BEVB 5CINH 5CKAA 1FSKC 1G7JB 4KKBC 3ARDD 1F3DJ 5JXAL 4OCWL 4HK3J 1VPOL 3ZDZE 5DGQA 1JF6A 4OJFL 4XNYH 4K7PY 2UYLA 3ET9F 5FK9B 4QO1A 2MOVA 2DQEL 4NT6A 3NIDE 3KPQA 3VXOB 1RZJH 4LVNB 3DX6A 3VXTA 4I0KA 2HT4D 1RZFL 2V5MA 4XP6H 1YNTA 5DDHA 1KTLB 5K9KA 4TNWF 3AU1A 5I1DA 3FOLA 4M62L 3VFUB 1CWVA 5DD3L 3AB0C 5K9OB 1GAFL 1MIMH 3U30C 1XZ0A 1QSFB 3IRPX 4C4KT 3GMNB 1MCPL 2ENSA 5DUBA 2H26B 5FXCH 1V5JA 1JNLL 1IC7L 4QRRE 3NIGE 4EKXA 2W59A 1FL6B 4JE4B 2B4CC 1WEJL 3BIAX 1AIFB 3FONA 3PL6A 5FECA 1S9WB 1CLYL 3WO3B 3OKDA 4CN4A 2EYTB 4J4PD 2FJGB 2R0LH 4X5WA 5IMMA 2FL5A 3G6JA 1BGXL 3UZVB 3DUUB 5L0QC 3E6FA 4XAKE 1BVKA 1F11B 4GG8B 4UV4H 2OJZL 3K4DA 3FFCB 1RZKC 5GGSB 2DQHH 1JRHI 2HWZL 4IMKC 3EZJB 3GB7B 5FYJH 1NBYA 3E3QE 3T2QA 3TNNB 2FYYA 1TZGL 4Z8FL 1QSEB 4GRLA 4OCNC 2VL4A 2ZG3A 2F15A 4TVPD 3T8XB 1KELH 3LAFA 5CZXD 2NX5D 5CZXC 1MWAB 5T33L 5E2TH 1A5FL 4JHBA 2GJ6A 4JJ5A 4Z7QF 3CMOH 4LNRB 1U8PB 3RA7L 4ZXBA 1XGQA 2P24B 1WT5A 4J8RA 4M5YH 1OHQA 5D9SB 4H88H 2BVPB 4X7EC 4G6KH 1YYLL 4P2QD 3SDXB 1QSFA 5CJOL 5DJXA 4ZUVB 4UBDC 4KK9D 2VMFA 5DRNA 1FZKB 5D2LA 2FECL 1PKQB 1BGXH 3WUWG 5DDHB 2OP4H 3D85A 3C60C 1N8ZA 4Y5XC 2C3VA 4NUJB 2B1AL 2EXYD 4JRXA 25C8L 2HLAA 3QEGH 4LP4A 4E5XB 1KACB 5I2IB 4YFLI 4CRPA 3L9RA 4YWGL 4KVCL 2QKIA 2YD7A 3HE7C 4LMQE 1QOKA 4Y16C 5D1QB 2WWMC 3OJDB 1CGVA 5TFSL 5FF6B 4IDJH 4LBEB 5DJYA 5ERWA 3IDYB 2QADD 4I3SH 5KS9A 4V1DD 3LN4B 1YUHB 1HYSC 3UYOD 1KJ3H 2FECI 4LARH 3BXNA 1FIGH 4L3AA 4PJ9B 3BP5B 1RK1B 3N85H 4PV8B 4JFDA 1D5IH 4RGOL 3O45A 4PJXF 4LMQI 2APWA 1J05A 3TV3L 3JSSA 2I60L 2R2CA 2AVGA 4XC1H 4UIMA 1K2DA 5DK2B 2WP3O 1LP9A 2X7LB 5GGVL 5I1CH 2VISA 4LDOB 3ZKNC 3GSWB 3MODH 1U8QB 4F15B 4EI5D 3CFKB 4OGYL 4EVNB 3FRPA 2DRUA 4FG6D 1QFWH 5T1LB 1Y18B 4MVBD 4Y4HD 4IRSA 1VPOH 1J7VR 1GZQA 5HHMB 1Q8MA 3LS5L 2YXMA 3MRCB 3HC0B 1S9KC 2VAJA 5LGKA 3B9DA 1UQSB 1ZTXH 3GMOB 4LSSL 1D6EB 1J05B 4D9LH 2EC8A 1CDIA 3TBVA 1QFUL 4NN5B 3RWGA 4MQXD 4LLVA 1IEAB 4R26L 1BD2B 4YEEA 3WD5H 1FNLA 4LVHC 1NGWB 3BIKB 2EDJA 3DIFB 3ILPA 3PWPA 4HKZB 2E5EA 3DECA 4ZFZB 5JW3L 5DD0H 3H42L 3TA3C 1X7QA 4UINL 1BQUA 5ESQB 3B9VA 1MI5D 3TA3D 3O9WA 5AD0A 2XXMB 5J13B 4GKOA 5F9OH 3P9WB 2H9GB 4BSWA 3DX7B 4MJ5B 2MQCA 1QKZL 3QB7C 3TZVB 3WLWD 3IDGB 4LAQL 4IRSD 5EU6E 3ESVF 1DBJH 2HJKA 3NIGF 3WKML 3SDDB 2NY6D 5LCVH 1NGYB 4MDJA 4JO4H 3E2HC 5CSZA 3ARWA 5DQJA 1OAKH 5DQJB 4EN3D 4JFDB 3CD4A 5FYJD 4GLRI 4JO1H 3AMLA 2DIBA 3O4LE 3OKYA 3W2DH 1HIML 1S9VA 3NIFF 4RFEA 4CMHB 1JIBA 2EIDA 4Z7UB 5J06A 1KCUL 2DBJA 1CL7L 4OD2B 1G7QB 3K3QA 4UT6H 4EOWL 3MRRB 5C09D 1K8DB 5EBMB 4NBZB 3H6JA 4FABL 4OT1H 4F7EB 4U6XA 3MXWH 5FM4A 1B4JL 3HFML 4I8DA 4KXZH 4PIRF 1KCRL 3NVQA 5DURB 4JRXD 4HIEB 1V7MH 4K3DL 5T3ZD 1LO0H 4XPAL 4J3SA 1RHFA 1D6EA 4N8VA 4WUUA 3V6FA 4ZUVA 2MPAL 2W0LA 3WFEH 5C1MB 4M6OH 2IEPA 4HIHB 4U0RC 5FKAA 1RIVH 3A67H 2ZSVB 3GIVB 3F7VA 4R3SB 5GGUB 1ND0A 5CEYB 3OMZA 1CDHA 2GY5A 4I3GA 1IGCL 4Z7OE 2R69L 5DJZA 4KJQC 1CLOL 2NYYC 4XCNA 2OXGA 2IADA 4KJPD 3PGCA 2NXYD 4HFWB 5D7LB 2OTUA 3QJFA 4XVSH 5FHBH 2VISB 1MCJA 1FVEA 2HTKD 4Y4FD 1Q9KA 4AIZB 2OR7A 3IXTB 5L6YL 3ZL4L 1JFQL 4HG4J 5F3BA 1YPZF 4C83B 1XF5A 3ES6A 3RWFB 3VFMB 3ARBB 3D0VA 1ZLUH 2ITDA 5IGXL 3DYPA 3KS0H 3O8XA 1QQDB 3W9EA 3MNVA 1YECL 1KBGH 4PV8A 3BYYA 4I48B 4D0DB 4ZSOB 1V3MA 1QP1A 1N2RA 3CDCA 3T2NH 2J8HA 1VACA 2R0KH 3QEQE 5C08B 2AS5M 4PJ5B 4MCYB 4MNGA 5T1DL 3MXVL 5JQ6L 4NO5A 3HKFA 1KN2L 1JNHB 4MAYC 5D1XB 2X1XR 3CFDA 4NM4L 3TN0B 4P5KA 5GGRA 1EZVX 3VXUE 3BO8B 5C07D 4QRPB 3KPSA 4UNUA 3T3ME 4FQHA 4L3EE 5K9JH 3QUYB 4W6YB 5K9QI 1EXUB 3VFUA 3K2UL 3ZMRA 1MRFH 3F5WB 3O41B 1J0IA 3AU1B 1FNHA 1NFDF 3RUGF 1FFOA 1J8HB 4EN3B 4NC1C 3VCLB 5C9JA 3B43A 4HJGB 5GGQH 3MXVH 5JQ6H 4LASH 2KDGA 3SE9L 3RKDC 4Z5RB 4FP8H 1KJ2H 5DWUL 3V4VH 4P46C 2D7NA 1U2HA 4FQQA 4X0KB 1K8IA 3V5HA 1F6AB 3DVGB 4YFDB 1T4KB 4FFWC 4MB3A 5J6GA 2FIKB 5IR1B 1R6VA 4NKIL 5IKCA 3I02B 4JN1H 3S35L 3G5ZB 4ZUSA 4QOKB 4DKFH 5K59E 4YHKL 3UTSB 1TLKA 3BKML 3FO2A 5L9DL 1BIHA 1QR4A 3LIZH 2D0GA 2JIXD 4OLWH 2FO4A 2FJGA 1WIUA 5DJ8A 3ARSA 5F21B 1IARB 4LFHG 4S0TD 5JPMB 4ETYA 5FO9B 2YPVH 2OMNA 4UIKL 3MO1B 3Q0HA 4FA8A 4JHWL 1S7QB 3ZKMD 2ZKHL 3CDYA 3QJHB 2PW2A 4TULH 2I27N 3B2VH 3DXAA 4QRUB 1XGUB 4JG0H 3SHSA 1OQOA 4U1LB 1E6JH 4PPTA 3NZHL 5KSBF 5FUOH 5GJSH 4NHCH 2EH7H 2XA8H 3SDXF 5JDJA 3DV4A 1BIIB 2B1HH 2CGRH 2EZ0C 4GBXC 5EULV 2XWBA 1NAMB 3BP6B 4D3CL 5K59F 4FG6C 3QAZB 4WTWA 4DKFL 2E7HA 4XI5D 1ZANH 4HKJB 3DLQR 2VC2H 3CUPA 3GSNH 5FYLD 4CVXA 4XCCH 4LAJH 2EDTA 5IKCB 1NPUA 2BXZA 5MENA 5IR1A 1G84A 1IQDB 1TQBC 2DBLH 3BX7C 3VDBA 3RDTB 3WDIA 4MS8D 2IQ9H 1QBLL 2ZSWB 4HPOL 5JUEH 2ZOKB 1CICC 3S4SG 3ARFC 1VEPA 2BJMH 1TTGA 5I66A 3G5VB 2WBJB 4F37F 2W0KA 1EEUA 3D6GA 3IAQA 4UQ2B 5IIEA 2P47B 3D18B 3SJVE 3RVWC 4U3HA 4XPAH 4CVXB 3OB0K 3TNMB 4GRWF 2EYRB 4MNQA 2KBGA 5FYJE 3AB0B 3TH3T 3VA2C 1EHAA 1CXFA 1UKQA 3OPZL 4Y89A 2X1WL 3BP6A 3FT2A 3RPKA 1U8PA 4ZXBB 2J8UB 5HGDB 1CGYA 5MEQB 4EEEA 5E7BA 4M7LL 1UCTA 5GS0H 3MCKA 5GJTL 1WUNT 3I9GL 4KHTL 4K3EL 4JM2A 1FG2B 1LP9E 1GRWA 3BQUB 5I66B 4DN4L 2HT4C 3D69A 5IHUH 4M6ML 4DUWA 4P2CG 1ODAA 3QPXH 1YY9D 2DQFB 1JI2A 2QBWA 3BPCA 3P0VL 1CZ8H 4LSRH 3U2SB 2NY0B 4ZQKA 4MXWH 4HAFA 4AG4L 1TZHB 1ES0A 3MV9D 5IMMB 5HYJD 5I1IH 3LS4L 3PV6A 1JZ5A 4HKZA 5BZWB 5E0QA 2DKUA 3KG5A 3V8OA 2P5ED 1EEZA 3V7MA 2IAND 1FLTX 1PLGH 3BIKA 2DQGH 4GRWB 3RZWA 1NKOA 1TQCB 1CGWA 1I1FA 3H3KA 4UDTB 3FO0L 3O8XC 5IFHH 4XH2B 3KPOB 1B4RA 2A6JA 3O11B 2P5WB 2WBKA 4YDIH 1AGFA 3OXSB 4YHPA 3WIHL 2EDEA 1NLDH 1MJ8L 4L8CA 3K81A 4QRRB 4D0CB 1LQSR 2BC4B 5DEZA 4OI7A 1R3JB 4PREA 3W0WD 2YPLE 2AV1A 4PP2A 3ZKXB 2VXUH 1FPTL 3BKCL 1UYWL 5D5MF 1JZ3A 4PJBF 4RMQA 1R5IB 4CN1A 3UJIL 1A6TB 4EI6A 3MR9A 3TPKA 1VGKB 3L1OL 2ATKA 2HTLD 1FYTB 2V9TA 3KPLA 4ZNCD 4CU8A 2RGSA 3MQIA 3WV0A 4RMUA 4J3VA 5KG9B 5E2VH 4TPRL 1P1ZA 2I5YL 4YDIL 4K7FA 1N0XH 4U6XB 5E4IA 1O0VA 3RVUD 1GJIA 4I4WA 1MI5E 4K8RL 4L4VA 3P2TA 4HSQA 4PJ8B 2BOBA 1I1AC 1SY6L 3FFDA 1N5AB 3TO2B 3S8WA 4ODHH 1FIGL 5SX4H 5FF6A 5J6GB 1N5AA 3WUWA 3CXHJ 4X6DB 2AEPL 2AQ3A 4WHTA 1XIWD 2IBGA 1V3LA 3R1GH 3W81A 4CNIA 2W0PA 5MHSE 5IJVA 1YJDL 5IT2L 3CFCH 3UJIH 2X2YA 1D9KA 4JZNB 2C1PA 1PKQE 5FO8A 1WFOA 4RFOH 3FQWA 4ODVH 5JR1L 2BOCA 4OAWA 3I3EA 5EO9A 3EYVB 3BPLC 1IKNA 2ZNWA 1L9MA 1CFNB 4Y19A 1MCBA 5CJBA 4GG6F 3E6HA 4NQXB 4NKQB 5HHOA 3NOIA 4LPVA 3QNYB 4CADB 3GK8H 1CGSH 4XPTH 4XXDB 2VDLL 3GSQB 2CLZB 1XR8B 4R3SA 5GGUA 1NEUA 1AC6A 3NPSB 4X9FA 4MNHA 4NO3A 3WN5B 3EFFB 3ZSSA 3RGVC 3VG9B 4XNUH 2B7DT 3ARFB 4OCYL 4PJEA 5T3XH 4AIOA 4FFYH 2CIKB 3L5WB 1NGWA 4O51B 1U8NA 1CLYH 2HN7A 3RUGB 1QLRA 1BD2D 3AVEA 3E8UH 4JFQA 5JPNB 3D48R 4NUGH 1F13A 3ARBA 3P73B 5DMIH 2PYFB 5E08L 4MJ6A 5CEZL 3ARDB 1FL3B 2D4DA 4JN2B 5D2NB 3KWWA 2G9HA 3H9SB 4QHKJ 3BPCB 1J0JA 3I3BA 4HWEH 4PB0L 3U36B 1MELA 3C2AH 1N64L 3GSUB 1CGSL 4XPTL 2QQQA 4WFHD 1T22B 3RVWD 4PJCA 4JRWA 3BDYH 5CP7B 2WWKO 1U8LA 1T22A 3QDGD 3VXMD 1XF3B 4P2OD 3QH3A 2XZAH 2N56A 4TUOB 4MAUL 1INEL 5L2JA 1ORSA 2PN5A 3V6ZA 3IF1A 4ELMB 4M3JA 1JZ4A 3ARDA 4KVNH 3UBXB 5FDWB 2G5BA 5KVGL 4JKMA 1A7PH 3I75A 5E1HB 1RZKL 5TH2B 2XRAL 2H41A 3DVIA 4TVPE 3NCEB 3T0EC 1AKJA 1XGPB 3T04D 4OIBA 4R6UA 12E8H 3G5VA 3B2UC 2OL3H 2Z8WC 3ARFA 4PJEB 5GS0D 4S0SD 35C8H 5I18L 4ODSH 3SBWA 2C4FU 4YC2C 3TYGL 4U1SB 3NPZB 1SY6H 1U8OB 2X09A 1Y0LA 3AY4A 3C5SA 4LSUH 1DBBH 3MJ8B 4UUJA 3IDJA 4OLYL 2VR9A 1BVZA 5LAXA 1QUNA 4KRPC 4JRXB 1K8IB 3BDYL 2OM5A 2B4CL 5BVJB 2PYEB 2KL6A 2VERN 2DQIL 1WQVT 3QZWA 1QR1A 3DRTB 2ZZUT 1YEDB 2NXZD 3K8MA 5EBLA 1BFOA 1LWRA 1OAYL 2WINA 3BIBX 5F9OL 4X8XA 4PLNC 1KCSH 1T04B 2XICA 4WW2C 5HD8C 4P46B 3LEYL 1ZK9A 1JRHL 1WTGT 1HHHB 2YKLH 1UWEH 4KROC 3F7YA 3F7QA 1CE6B 5CSZB 3FO9A 3O4LB 5EO1A 3WIHH 4O02H 2XG5A 3HZMA 4L29A 2ATPB 3RL2A 2HTLC 3U7WH 3NAAH 1TMCB 2Y7QA 3F58L 1CDBA 1ONQB 3DXAB 1FZMA 4UOW1 4HUVA 3ECBA 1B6UA 1BFTA 1FFPA 4MCYA 1SBSL 3QFDB 4OM0H 5IB5B 1MCWW 1S7TB 1C5DB 5IB2B 1JGDB 1UFUA 2CPCA 3D2UD 3QIUA 1X7QB 2NY6C 4WEBH 4OLVH 4K7FB 4MA8L 3HMXH 3KYKH 4QT5B 1HI6A 4R96B 3T2NL 5TF1H 4YK4C 5DQ9A 4AM0A 5BV7C 3LVEA 4XX1G 1IGJB 3DURA 4XP5H 3RWGB 3OJMB 1AQKH 4FTVA 3JUZA 4PS4H 3MGTA 2JCCE 3P9LB 3L7EA 3OKEA 2F5AL 2IAMC 2YPLD 4HIXH 1IAKB 3CK0H 4JY5L 4JREC 4F7PB 2A83B 1MFAL 2D0HA 5DUBB 3Q3GB 2HFFA 3HZKA 1I8IA 4EUPH 1F00I 4Y4FC 4UV7H 1Z6JT 5IUSA 1SBSH 5BVPL 5A2FA 4NRYB 4NN6C 2FLBT 3STZA 2XI9A 3BKYH 3VH8A 1RZ8A 4HKXB 4OUUB 2IPTH 5HDLA 2ADGB 5BW7C 3SDAD 5D8JH 3RX7A 5JR1H 1NSNL 1DUYA 3BKMH 4TTDD 5EZLB 3GSNL 2D03L 4FQLH 3W82A 1OAXL 3VXNB 1MWAH 4LKCB 4OZIA 4Y4KC 1UADC 4NO2B 3NGBC 5D9SA 4G3YH 1B88A 4N0YL 2BSTB 4MDIB 5ID0A 4PRPA 3UYRL 2ENYA 5C08E 3SKNA 1JP5A 2KQNA 1W72H 4NJAH 4CKVX 1QBLH 2EC9U 3W9DA 1YUHA 1NCAL 1ZT7A 3UTOA 3GUTA 1MCFA 3NPSC 3RY6A 5C0JB 2AXFA 1ZA6A 3SPVA 2Y07H 4QHUA 3FN3A 3T1FA 2VDKH 3T3PF 1MHEB 1BVLA 1R5WA 1ZSDB 4LLMB 5T3XD 1HHGA 1ZANL 3D9AH 4NNXA 1JWUB 3V4PH 4OF6A 4N90E 1ITBB 2OK0H 4RQQA 2ZCLH 5F89A 2ZCKH 4G9FB 1IGTA 5LWYL 5E94B 1T1XB 4XCYB 3BEWA 5IQ7H 5BRZD 4JPWH 4E9LA 5EORH 4LLYB 3GSOB 2VDPH 4Z0XA 2GSGB 4RGNE 3T77B 4WW2F 4JFFD 2H26A 1U58B 3HZYB 4QWWD 3ABZA 3SE9H 2ZSVA 2ID5A 3TO4D 3AC0A 1CLOH 1IM9B 1KELL 4R0LA 3GZKA 2DLFH 3QDGE 1N4XH 3VWKA 5FHBL 2I9LB 1I9IL 4Y5YA 3O9WC 3RGVD 3LD8B 1PSKH 5KANI 1R24B 2A6KA 3UPCA 3QUXB 1KXVC 1UM6L 2ORBH 2PW1B 4PJXE 1LK3L 4NT6B 4PYHA 5DURD 1LO3H 3NFPA 5E6IC 3VXMA 3DV4B 2MTPA 5JA8B 3IFPB 2BNUA 1OSZA 4PJDF 2F5AH 3M17B 2BVUA 5C3LD 3TJHC 3MODL 1JV5B 1T0NA 5BV7H 3KHQA 3WJJC 1E4KA 3QR2A 4P9ML 4O9HL 3FCTB 4IS6A 4FFWD 4GKNA 5HI4D 4IRJB 3U7AA 1FNFA 4RMWA 5TE6H 1WK0A 3RVTC 3WNMA 2WV3A 4HGMA 5F1OB 4F3FB 3TBYA 1RPQA 3GMNA 3MRGB 4PJ7B 1LP9B 2X7LA 4UT9L 3VGEA 1FNSL 1DTUA 2VLKA 4JO2H 4M1DL 2GTWB 5K9JL 1JGUL 4LQFL 5GSRB 1WZMA 3PWLB 3TYFA 3U79A 4XP9H 5C0AA 3ZE0F 2OMBA 3DX8A 1DBML 1INQB 3KPSD 1FNEA 3PL6D 4BFIA 1BF2A 3MLRL 4NNYB 1YN6B 3N06B 1EVUA 4XC1L 1S7RA 3GJFK 4JPKL 4K94L 4E41E 1LK2B 4G5ZL 3T0EE 4LVOB 4PGCA 4DK6A 4WW1A 4H20H 2OJEA 2FO1A 1QSVA 1XF2B 1CDUA 3P4LA 3OGCA 4HCRH 3HE7B 3LKPB 1JUFA 5IJKA 3C6SB 1UH2A 4YGVB 1NDGB 4B0MM 5IFAH 4UT9H 2AXGA 1HKLH 1DCLA 2P5WD 4PUBL 4YHNB 5FM5M 1JMZA 3L7FB 4R7DB 1FNEB 1FYTA 3KPLB 5DHVH 1A2YB 2GAZB 5IVNA 5F7YC 4HX1B 1YEGH 1OLZA 5GS0C 5EFIA 2E8YA 1Q72H 1NC4A 4J3TA 4ZOAA 1U8IB 5FCUL 1A8JH 4I0PC 2C9AA 3WL9A 2BC4A 2Z8SA 2IAMA 3Q3GA 2VDOL 1AGEB 1JJUA 4N9OB 2GTZA 5D7SH 5C70A 4EVNA 4M7ZC 2Z0BA 1C12A 1NL0H 4KJYA 1HYSD 2A0LD 3GRWL 4FZ8L 4YE4L 4YXHL 3GB7A 3GHEH 4PBXA 1KNOB 1P2CA 4MHHI 3L3HB 3GSVA 4PJHE 3LPGA 3SDXE 2F53D 3HTLX 2NPLX 1CXEA 5MI0B 3WNNA 4RNRB 1FV1A 2PXYA 3ARPA 3IDYC 3QCUL 3TA3A 4S1DD 1NCDH 3O2VL 4M7KH 4GG6A 1KGCE 5SWSB 4ZPTB 3CH1A 3AS3A 5L0QB 2ZPKL 4LCUB 1L6ZA 5MI0C 3KYMB 4IM8A 4OGYH 2V9QA 3C5ZA 5J1AA 1FQ9C 3SGJC 5A1AA 4UBDD 5ETUA 3HNVL 4GAYA 4QHMB 4RIRA 4LPUA 4AY0A 4B53A 1OB1B 3CC5A 4X99B 4NDMB 3SY0B 4U05A 1T1WB 3GNMH 4OV5A 5F7MC 1FAKT 1AJ7L 1NCWH 4RAVB 4YZFE 4EN3A 4M61A 4QTIL 1ZS8B 5I8EB 5ITBL 4DGVH 2Y72A 4G80A 2RCSH 4FMFA 1A3RL 3IKCB 3QUMA 1YMHB 4R26H 1RIHH 3WD5L 2GHWB 1L7IH 4Y19B 1FAIL 3INUH 2H32A 3LQMA 5E9DD 4YHZH 3IU3B 5DUPL 2MWCA 1YQVL 3KPSB 3CFBA 2Q87A 4DGYH 1KJMA 3SGDH 2OZ4H 3AM8A 3MJ9L 2HRLA 1BOGB 1WZKA 2B8OT 3OAZH 5TE4H 2ERJC 1H3VA 4LSPH 5C0NC 3P40A 1FGVH 5KVMC 4KI1A 3G5YB 1UACL 4PRID 3NCYS 3BHBA 2Z93A 3UAJD 5EWIL 4JAMA 1OTSD 3OBAA 1U8MA 1XGPA 4WFFD 5LQBL 1A7OL 3TCXA 4QRSA 5EZOL 5B39G 4AL8L 5IEKB 2W91A 1NEZG 4G9DA 4DFIA 2XQYK 1XIWC 5HSFA 5C0BE 4PB0H 4ELMA 4NRZB 3SQOL 2Q86A 3FT3B 4P9HH 5JHDE 3RDTD 1AQDB 1MUJA 4HWUA 3RWDA 1RI8A 2ARJA 3SGJA 4PJ7A 3TT1H 5ANMB 1L7TL 5CCKH 2XKNB 4I0CC 4LKXA 5JQHC 1DQJA 4NIKB 2VIRB 2E9JA 1A7OH 4JFZH 3STZB 3WIIL 4LPWA 5CILL 5IVZA 5TE6L 3MRHB 3BD5A 2E8ZA 1UACH 1IM9D 1FVCA 3HZKB 3O6FB 4IRJC 4PJAA 3WFDL 3IDXH 4LFHD 3P77A 3PP4L 4MD5B 4PJEE 1PG7X 1KCSL 1DSFL 2XKUA 4LARL 4DVBA 4XTRD 5EU6B 4LVEA 5J12B 1RZGA 5E5UB 5ICZA 1AGDA 1IGIH 3EYUL 2WWKT 4NOFA 2YD3A 2O5XL 4GBXD 4KKBD 1IEBB 2OL3B 2ORBL 3MCLH 3L5HA 1HWHB 3ME0A 5HDQL 2LAGB 3V0WH 2W07A 5IV2B 1U9KA 4PLJC 2VH5H 5AZ2L 1BFVL 3DYMA 2AK1H 3DOSA 3I6GA 1P5VA 3ALWA 1FCGA 4J1UB 2UV3A 1KB5L 2NXZC 1VKXB 3GSXB 1CLCA 7FABL 1ZVHA 4AQOA 3R06A 2VITB 1MHHB 4X7TB 1BM3L 4NNPL 5H94A 4RFNB 4HWEL 5T1KB 4H25B 1CQKA 1X5LA 4EDXB 4S2SB 1FFNB 1ZWIA 4U1KB 5EIIA 2ZUQB 1DQJB 1T2XA 2CLRA 3RZCD 5ANMA 4G6FB 3GKWL 4R9HA 3OG6B 1IGTB 5HGDA 5EO1B 1FH5H 5IBTH 3UTZA 1MAML 3QUYA 3ZT6A 4PFEA 2QSCL 4MDJB 5F89B 3PJSB 3VI4F 2UUDK 1AGBB 1S78D 3LKSB 4GW4A 1JGLH 4YO0A 4PJFF 4G42B 4JB9L 3X3FH 3PV7A 5GZOD 3F12B 2EC9T 3O3DB 1MIEL 1A6PA 1MVUB 1L4IA 4L1DA 2PR4H 3X3GL 2WUBH 2VE6B 4JDVA 5FA3B 1NBVL 3OJDA 3TWCH 2YEZB 1MFNA 3RJQB 4FQJL 2NY5L 3RPIB 3FQTB 4IMKA 4NQCA 3GNML 2AK4D 1U91B 4JY4B 2ITDB 5E9DA 5DSCA 1AHWA 4HXAH 4F2MA 4XAWH 4M1CC 5I73B 1PDKA 1X5ZA 4NOBA 3ULVC 1RJLA 1RURH 4KI5E 4YPGB 5H2BA 1A6VL 4WGWB 2FBJL 3MRKA 4I18B 4NYLB 4URTB 5SWZB 2CXGA 1G6RB 2ZCHH 3EO1B 3W0WA 3QUMB 5HHQB 4G80B 1FNGA 1NC4D 5I1HL 4NZRL 4JHZA 1KFAL 4L1HA 5KOVC 2DDQL 2VUOA 4PY7A 1T1WA 1G9NH 4NC2B 4RMSA 1G7IB 1DBAH 2Z91A 1XGUA 4K7PH 1D9KC 2F53E 2HKFH 4RFOL 4XCYA 4C56D 3O4OB 3CPLA 4M6MH 4JZJC 4U1HB 5JHDD 5M95B 1HHJA 4XBGB 1NFIA 2F53B 1RJLB 4HIEA 1BLNB 1CE1H 2J6EH 3V6OC 1QVOB 3WJLA 4PS4L 2BSSA 4H5SB 2NXYC 4P4KA 1NBQA 1XH3A 2GSIA 1TJIH 3Q5OA 3MNWA 2EYSA 3MACH 5IEKA 1S5HB 1G9NL 4U1MB 5D7JA 4DEPC 4APQD 5KBNC 1K6QH 5CINL 1MJJB 1LGVA 1UVQA 1J8HE 4X9GA 1MF2H 2ERJB 3G5ZA 4ZUSB 3SPVB 3N9GL 4PRDA 2ZG2A 4OCWH 1J0ZA 5E99H 2VLJB 3IB4A 3QDGA 5SX5H 3X14B 3BD4A 1DL7L 3PG2A 1E4KC 4K9EL 4QLRA 4M8QA 2EKSB 1EEQA 4PJGA 3ALXA 4IOFC 1A4KA 1DFBL 5IG7A 2RCSL 3MLZL 1ZGLA 4M9PA 5IHZB 3T0EB 2EDDA 4D3CH 1DQLL 3Q1SH 2IBBA 3QCVH 4HJJH 4NQXA 4Q2ZB 3KPPB 5IQ7L 2C1OA 4LCYB 3KLAB 1SMOA 1XIWA 5HYSA 1AKJD 5DQDH 1HOCB 1OT2A 4R7DA 2APBA 3V79C 1GPOL 2BY1A 3SKMA 3KPMB 4HMCA 3GM0A 5M94B 2NY3B 4QRTB 4DCQB 2IMMA 3IDGA 4HUWA 2BNRD 3B8SA 3DWTA 3G08A 5I8CB 5DRXA 1F6LL 2J4WH 4GMSL 2UYLB 1IGYB 4ZAKB 2VN7A 2HFEB 1LE5B 1MCOL 3HS0A 2NTFA 1P84K 5C0DA 5C0AE 4POYA 3ZTJH 3RWEB 4ZSOA 1GPOH 2P8LA 3ARDC 3JWDL 3WIFA 5F88B 2R0LL 3VWJA 1HI6B 4R96A 4UAOC 3WS3A 1KLUB 2VUYA 5HHVL 4E0RB 4F33B 3NZ8B 1SJHA 4M7JL 1SJVA 1DP0A 3JTSA 1FC1A 4PLKC 1HINH 1NCBH 1LDSA 1TVHA 4X8JA 5GRWA 5DO2C 1CT8A 1LEKA 2X1OA 4JQXA 5FCUH 1A1NA 1F90L 4ZTOH 4HV8B 4LOUD 2C4XA 5EIVA 4ETQA 5KW9L 2IGFL 4I0PA 1N7ML 1D6VL 4Z77A 1KPRB 5DYOB 5IP4A 3EHBD 4AT6A 3HI6H 5DJZB 1XGRB 1CL7H 2DBLL 3ZKSD 1WGOA 2Y4SA 4B7IA 5BRZB 4MZ2A 3O3BA 1P9MA 3QCTH 3AREB 4UIMB 1A7RL 5DT1L 3VXMB 4JO3L 2VXVL 4DZBB 5KTEL 5CEZE 3OKOB 2R2BA 3HG1D 3KR3H 3K0WA 3HE6A 2AXGB 5JPNA 5E6IB 3IGAB 4P4RB 4UINH 2B2XH 3H7BA 1C08B 4GMTH 1D5ZB 2IFFL 4N8CH 1PBYA 1RHHB 4R4BA 1PSKL 4HKBB 4QRPE 3UTTD 1Z9OA 4NQTA 3EGSB 1HXYB 4Y5VA 5D7IE 3RPIA 2AV7A 3C2AL 2VLLA 4KI5C 2YWZA 1MY5A 1KTKE 3I50L 4KZDH 4Z95L 4N9GB 3TIDA 2DWDA 3SJVD 3EYQC 5DF0A 4POZD 4JVPA 4MQTB 4DW2L 4KZEH 4G7VH 2CGRL 3MLWL 3QEHA 3D39B 4WU7A 5GRUL 2VQ1A 3CSGA 3M07A 1M71A 1QBBA 2UZIH 1CGUA 4XHJC 4NNXB 4LNRA 4N5UA 4Q6IC 1P7QB 3MLTB 1A4KB 1JGUH 4JM4L 1JYNA 2E9WA 3KXFA 3RWCA 1ERNA 3SE3A 3TJEH 5JTWA 3BH8A 1Q38A 1QBMH 3V6BR 4HUKB 4YIQB 5L2KA 4D0DA 4XCFL 2R1XB 3LRSA 2P49B 3ULVL 4APQC 1BX2B 3QNZA 5HTSA 4QY8A 3W11D 1QLEL 2AJXH 2HVJA 4J6RH 5HHNA 1UXWB 1G7PA 1L0YA 2UZXB 3WJLC 3TT3L 1QBAA 3ALPA 4M1CD 1ZAGA 5DI8A 5BCAA 1CL7I 2E7LC 1CIDA 2NY5C 4XP1H 2YKLL 1PG7H 4BKLB 3ELAT 5LGJB 3IFNH 3MR9B 3CFJB 4MLSA 5JDSA 3V4UH 4JM4H 4P2OA 2HH0H 2VR5A 2CRMA 1B90A 3X13B 1TJHH 3WS6C 1CVRA 3WL9B 3QRFM 1K3ZA 5DRWB 2BY0A 5ADPH 1I8MA 4Z7OF 4TSBL 3RA7H 5EU5A 1T5WA 5EZJB 4WWKD 3MO1A 4WI8A 5SV4A 3UTQB 4PJGF 4NQEE 3GRWH 4HULB 4KH2A 4PJGE 1OD7A 4NRZA 3U9PL 4G8EA 3CLEL 5D7LD 4X6EB 4PLOB 2XY1A 5IJVB 3LRSB 1RUAH 3QWQB 1NCCH 3VWJB 2AXJA 3QNZB 2YD6A 1C5DA 3CLFH 1KBGL 3K8LA 3L3DA 3WLBA 5MEPA 5CILH 1RD6A 3QUZD 1GHFH 2DTMH 1ZT4A 1T4KA 4MSWA 1IGML 3KJ6L 4ZFGL 5I1JH 5IHUL 3S6CA 5ID0B 4Y4KB 2C26A 4X6CE 1Q9WB 3U4EA 4PRBA 5KVDL 4F9PA 1FVDA 4KMLB 4IMLA 5ILTL 1JZ7A 4LSSH 1X5HA 1BOGA 1ZLSL 1CQYA 1A7RH 5DT1H 1W8OA 4ZS7L 4I2XE 4P46D 3LN5B 1V7ML 4K3DH 5CGYD 3HB3D 5FGBA 3RUGE 5HVWA 3FO1A 5TDPB 3FQUA 3OX8A 1G1YA 3FTGB 4OZ4A 2QSVA 3EYSH 5I1CL 2B2XL 1EK3A 1MHCB 3OAYK 4NQDA 5EWIH 3BN9D 3ZKQD 2PYEA 4LLWA 1INEH 3EJJX 2HRPH 4M4PA 4MA1C 4WNQA 3HPJB 3R8QA 4A6YA 4NWTL 2E27L 2VKWA 1F4HA 4CUCA 1QSEA 2X89A 3QIUC 4GRLB 5D7IF 4XNYL 1URLA 1UZ6F 2A77L 1P4IH 1R3IL 1ADQH 4PRIE 3D2UB 3QIBA 1B3JA 1A3LH 2R2HA 5JHDB 4PJ8D 5HDOA 4HT1H 4M03A 4ELME 3PWLA 2OR8A 4PGEB 1JGDA 1T80A 3P77B 4YHIB 5I74C 2GCYA 4OCXL 4OD3H 3OAUH 1A7PL 3VG0L 2HT2D 2ZOLB 4K71C 5I16B 3QDMB 3T0ED 2GT9A 3ILQD 5TGBA 2D7OA 1K4DA 3QDMA 1NLBH 4RBPK 3ARBD 1PFCA 2ESVD 3A6CL 2R9HC 3NABL 4NQVB 3NFNB 3JBG7 3HLAA 2DQCL 4MJIE 4DZ8A 3VGFA 3BYTA 3V6OA 1QEWB 4XBEL 1MPAH 4MJ6B 3QEHB 3PXJA 5KS9E 2PTUA 3INUL 4HGWB 2CIIA 4PP1C 4WWID 5D2NC 3ARXA 3K46A 4WV1B 5F88A 5F7EL 2HJFA 4JAMB 2ICWI 3ARGA 4JFDE 3SO3C 3U0WH 3GO1L 4EQ2A 1NCAH 3MNZA 2FSEB 5TE4L 1PY4A 1IL1A 3W9DB 5J6HB 4U1SA 4GUPB 5A40E 5L2KD 3VG9C 4LQ1A 3BGMB 1F4YL 2YPLA 1JWSB 3PWVA 3ULSB 1D5XA 3UTTB 1DBBL 4KI5D 4QHNA 5DHYB 4XPBL 3TFKD 5F97E 1HXMA 1WVZA 5JLZA 1J8HA 3MYZA 4JANB 2JB5H 3MZGB 2IAMD 3CVHH 5KSAD 4KKCC 1UB5A 5CD5D 2OR9H 1BIIA 1ZHLA 1L9NA 4ACPA 2HH0L 4JG1H 4KY1L 1N6VA 3S4SA 1MCWM 1SM3H 5FUCE 5JXED 4W4NA 4UMGA 3WNKA 2SEBB 4DKAA 1DE4B 5C8JA 1AGCB 2E6JA 1HWGB 3LEXB 3CVHB 5C0FA 2Y9RT 4QHUB 1H5BA 4MS8C 4OLEA 3W39A 3U4BL 4AT6B 3I6LE 2VZ1A 3IFOB 1JWMA 4Q6YA 3X14A 4PJ5A 3BZFA 1DEEA 3WLBB 3FFDB 5AD0B 1W0WA 5I19L 4L3CA 2AJXL 5I1LB 3QWOA 1RULH 1F4YH 1SHMA 1DUZA 1S9YA 3DMMA 4MDIA 1S7WA 2AJVH 5DTFB 4YPJA 4Y1AB 1PX4A 4GXUM 4HS8H 3D0VB 4RISL 1KEMH 2LTQC 5CD3A 2H8PB 3RGVB 5I0ZA 5FECB 2PO6C 4LK4A 2L7UA 4MB4A 1OOAA 4HZLB 5D6CA 2PTTB 5AEAA 1FCCA 2AEIT 4ZTPL 2NX5E 2WSKA 1I1AD 1GHFL 4UOJA 1ZA3B 3NAAL 2J6EA 4FHBD 4ZSOE 4JQIH 5JW5A 1U3HB 1IGYA 4ZAKA 4O58L 5FOBA 4MNQD 4OLXL 3TF7C 2JJSA 2A83A 3O4LA 3HUJB 4NKOB 3CFKA 2DS4A 3A6CH 3O2DH 5CSGA 4HX1A 3F62A 2VTFA 1J5OH 3HR5A 1FPTH 4PJIF 4UDTA 4HLZG 4XPHL 5INCA 4XP9L 1QRND 3LMJH 2GK0B 2DLTA 4JM2C 1A0QL 4AENA 1ZE3C 4IRJD 4WIQA 3O6LH 4L4VD 1J8KA 4C4KO 1CXHA 2FLRT 1TZHA 3NCYP 2IFFH 4JZOB 3PDDA 4RGNC 5D1ZA 2YD8A 3PWNA 5DSCB 3TJHD 5T1MA 1U8OA 1ADQA 4Q74A 4F9PC 3JV4B 4M48H 4BK5A 5EORL 4ONHA 2EH8H 4A6YL 3CX2A 2CO7B 5DD6A 1KENH 2IANA 2PETA 1G6RL 3RWJB 2DM3A 2NZ9C 3G08B 3TYFB 1G0YR 5E2UL 4LIQH 3H2WA 3HFMH 4FQCL 5B4MC 3B5HA 3S37H 4PJFE 2EECA 1BFVH 3F8UB 1UB6A 4QF1A 3KLAA 4W4OC 2BSRB 3RVTD 4IRJA 4FXKA 4NO0A 1JMXA 5CBAB 3QXTA 2E6PA 2OL3L 3EFDH 2J5LC 2ZOLA 3GSUA 4NBYB 5DMGC 4NQCD 1TQCC 2UWEF 5EU3B 4MJ5A 1NGQH 2YZ8A 4FXGA 1S7XA 3KAAA 1N6QH 3NZHH 1BMGA 2EDNA 3C5JA 1H8OA 2CDEA 4UV7L 1DQML 5GS1B 2YSSA 2EH8L 1Z9MA 3MRIB 3MJ7A 2VWEC 2FX8H 5FV2A 1HCFX 3QNXA 1OAKL 4JFHE 1MJJA 4TOYH 4OZGA 5EZOH 3ZHDA 2QV2A 5FB8A 5E4EC 3VFTB 3P30L 5T3XL 4FQLL 3HI1B 3QIUD 1F02I 2YN5A 4DVBB 4BJLA 2Q1EA 3QEUA 3MRBB 4NC1E 4EXPX 1AGDB 4O4YH 3OR7B 3QFJD 2CKBH 4NQVA 4BZYA 4KU1A 5E00A 3TPUB 4KFZC 3QUML 1G9MH 1X6NA 2Q3AA 3BH8B 1EO8H 4YHLH 2V2TA 4NO0B 4X80L 1I7RB 3SDAA 1DE4A 4TNWK 1EMTH 1MHCA 5DYOA 3K1KC 2R69H 4Z78A 5JOEA 2PW2B 2R1YA 3F6IA 4JCLA 1H5BB 1YA5A 5E94A 3VXRE 4Y5XB 4OF3A 2NY3C 4QF1B 4XHJD 3VRJA 4P9MH 4HH9B 4S11A 5D2NA 2VQ1B 3N1MC 1UB5B 1C7TA 4U1GC 1KTDB 2YRZA 5T3XE 1AC0A 1I4FA 3LKNB 4AH2B 1U8HB 3SDDA 2R23A 2XFXB 5J1SC 3IFNL 1UM6H 3L5WA 2CIKA 1RK1A 2AK4A 4PTTA 1S3KH 2C3GA 3GK8L 4RWYL 5CJXA 5AUMA 2A9NL 2GFBA 1KLFA 5E9DB 4N0UB 4LU5L 1LE9B 3LDBC 4RCAA 3SKOA 5I8KH 4YQXH 4GXVL 3SKOB 4L4VB 1GGYA 3MXWL 1NCWL 2E7BA 3ZDYF 4DEPB 2DMBA 3DHJA 1MQKL 4Y88A 4I3RH 3ZE1F 3QHZL 4WEUD 1RQ5A 5EIQA 4M6NL 1GGTA 4Y8AA 4MAYD 3TJEL 4M7JH 5F6HI 1QFWM 3C60B 1XT5A 1T03L 1JPFA 3UC0L 1T0MA 4PB9L 4NCDA 1OM3L 1WAAF 1BQHA 2GKIA 2V7HA 4JHWH 5DRWA 2H32H 3VXPB 1QPXA 1ZVYA 3QXWA 3ZDXE 5TPWH 5I17B 5JW5B 3EOTL 4W6XB 1I7UA 2AK1L 1A6ZB 2DTSA 2VLME 1U95A 2GY7B 2PR4L 4P4KC 3DSFH 4FMKA 5TGBB 3IVKB 5SWZD 1B0GA 3MUY1 4RMRA 2R8SL 2XY2A 5E8PB 4OLVL 4S1SL 5D7SL 3IETA 3QDME 1M6OB 5DQDL 1IGIL 3EYUH 5IMLA 1A0QH 1CFQA 3VFNA 1S5HA 1KJVA 4KUZL 3KWWB 4FQ1H 2IQAB 4M93C 3WFHB 5I73C 4KTEH 1JTOA 3O8XD 4NZDA 4DKEH 1M1SA 1ZLVK 4LCWD 1IT9H 3QFDA 3FHAA 1RK0A 5E2TL 4ZAKC 1QSEE 4X5LA 4YH6A 1FN4B 1DZBA 1T6VN 1OP3H 3T0DA 4JB9H 1FRGH 2D7TL 4V1DE 4Z7VE 3OGOE 4IEFB 4JGMA 4R8WL 3SEPA 1E28B 2Y1VA 4Z7VF 4D9QD 3VD3A 1UWXK 3V0AC 3BW9A 4WO4D 5D8JL 3IFLH 1KG0A 2C3VB 3MTRA 4EI5A 4RZCA 2HTKC 5D71L 4LCCC 1KUMA 3BKJL 3FQUB 3ULUD 1IZJA 1SVCP 4O5LH 1IBGH 1ZEAH 3T3PE 3NH7H 1U3ZA 5DFVD 3TN0C 1ZLWH 1JPSH 3KLHD 2IGFH 4CMMB 2BMKA 4PRBB 3HG1B 4AMKL 2W9DH 3DHMA 1BX2A 4XI5C 5GJTH 3FB5B 2GITA 2IANB 3R8BB 3MRNA 2FX7L 3D0LB 1CFVH 5IT2H 1FL5A 4OZHA 1KFAH 3L3DB 1ZA6B 2YD2A 3MLSH 1KXTB 1RUMH 2KUTA 4I2XB 1BVKB 4G6AC 3P4MA 1BPVA 4P5TC 1FZJA 4GW5B 4OM1L 2F54D 4K3JL 2EYTA 1HH9A 4RA3A 3QFJE 3WEXA 3BP4A 4LHUA 4P57A 3TNMA 1FYTD 3V2AR 1OW0C 2HG5A 5IVOA 4DK3A 4NCC2 2IQ9L 1D9KD 4CU7A 5D2LF 5CP7A 2GT9B 2DDQH 4PJCB 4U0RB 4OZGE 1JPTL 1NBVH 3ARZA 2IG2H 2GTZB 1ZTXL 1FFRA 2Z31D 2G2RA 4BH7B 3ROOB 4ZYKB 4BZ2H 1B2WL 3X13A 3R0MA 4U6VL 4WI3A 4XWOD 1X5FA 2R2EA 3CMOL 3MRBA 3VDCA 2WBJD 3VFOA 1AP2B 2P4AB 4RISH 1EJOL 5MENB 4XH2A 3ZYZA 4ENED 1YJDC 3U6RA 4QTHA 3DURB 5GIRA 1XCQA 1S7UA 4P3CH 4YXLL 2ZWLT 5SWSA 3QIBB 3BT2H 3C6LB 4DTGH 1BD2A 1RJYA 1J87A 3UTTE 1T2QH 1T03H 3SE3C 2QL1A 1GL4B 2AQ1A 1NCUA 4D0BB 2OZ4L 3EHBC 1KNOA 3RL1B 3O6ML 1TZIB 1FDLL 4K8RC 4D2NA 5C71A 4ZYKA 1FVCB 1EHLH 3S5LA 2X4QA 3GSNA 5IVXE 5GGVH 1XCTB 1G7JA 3D3VA 1JYXA 3L3KA 5E7FA 5EOTB 3UBXG 1I7UB 4XC3L 4Z0XB 1KB5H 1OGAE 3PWPD 4HIIA 3NCCB 3MRJB 3CZJA 4U1NB 1J1PH 4LHJB 1BBJB 3FQRA 3WLWC 2BHUA 3BI9X 1CE6A 2FX9L 1NDMB 2G75A 3SKJH 4K8RD 4P9HL 3TBTB 1FDLH 4F7MB 1CF8H 1GC1C 1HZHH 2WIMA 1YN7A 5A2KH 4WO4A 2P5EE 3CK0L 2YA2A 5E5RB 2AXFB 4M8QB 4Y2DB 2R0KL 1GVIA 4ODTH 2Z93B 5D1QA 1MAKA 3G5YA 1CD8A 1CD0A 3VFRA 3BKYL 4HJ0D 2MCPH 5E1AA 5DRXB 4PJEF 1Z9LA 1BQSA 1UEMA 2VLKE 4OJFH 5IESL 2OR9L 1ADQL 3O3EB 4XPHH 1YN6A 4ZS6C 4L9LB 5IOPB 3KPMA 1I1CA 1PLGL 5GGSY 5A43C 3P9MB 4N0FB 4TQEH 1EXUA 1UC6A 4ERSL 3UJJL 4Y4HB 1QO3B 5D6DA 1VFAA 2AEQH 3IKCA 4W4OA 3O6KH 1RIUH 1DVFC 1MLBA 4HWBA 3NFNA 4NN7B 3BPOC 2WUCL 1WWCA 2F19H 3MRPB 2XXCB 1BAFH 1P9MC 2EKJA 1OTUD 3S3SA 5FGCB 3QBTB 4MA3B 1NLBL 3HZVB 5HJ3B 1JFQH 1P53A 5FEBA 5FO7A 4I48A 1U3JA 3RWDB 1K2DB 3S3PA 4X6CA 1CXIA 4OTXH 5EZIL 3JTSB 1N26A 4JRYA 3LKOA 1EJOH 2AJUL 4Z7VA 5HYQB 2HMID 5MHSD 4JHAH 1CD1B 3KYNA 4XBEH 4GOSA 4KKCD 3ZSTA 1M05A 1T21B 5EN2B 3O6FD 5F7DB 3GBML 3RUGA 1I3GH 3C09B 1F4XL 4O51A 4PJ7F 1IC4H 4HUNB 3QEQB 3QNXB 3RWEA 4BFGA 1N5YH 2BY3A 3CVIL 1HQRA 4KK6C 2C3WA 1LEGA 1FZMB 4JG0L 1HIMH 1U93A 4KQ3L 3JWDC 4M7LH 2FIKA 2UVEA 3IJHA 2C4FT 5D2LE 2PCPA 4KKAD 3FZUD 3NIDF 4NO3B 2VB5A 4HUMB 3UPAA 2COQA 2R0WH 4KK9C 2Q8BH 3SDAC 3TCLB 5F96H 2Y7QB 3L3IA 3VI3E 2NY5H 1CDCA 3JVGC 4YZFF 4IOSD 2XPGA 1JNNH 3F65A 3EO9H 5L7XL 4R2GC 3ZTNL 4XPBH 1JPFB 4J3UA 5DRNB 4GG6E 4DGVL 4U1GB 4G9FA 1N7MH 3KPPA 4MQSB 3IU4L 1XMWA 5I15L 2N7BA 2MKWA 3MCLL 1XIWB 4G8IB 4UAOB 4Z7NE 4L9LA 5I0DA 4MD4A 4OUUA 3DO3A 4XP4H 1AXTL 2GJ6B 4PV9B 2VLLB 5JXAH 4UV4L 3P11L 4MD0B 1N6UA 4P5KB 1VB9A 3IXAA 1IAIL 1MRDL 4WCYH 1NBZA 1LP9F 1X4ZA 3QFJA 4FP8L 1YNKL 2BHZA 1A6AB 3JV4A 3IAGC 4LSDA 2EDXA 3MBEA 1MQKH 4M6AA 5C9KA 1S7RB 4JO4L 4MA7H 4Z76A 1PAMA 2Q3ZA 3MLWH 5HHXL 4K3JH 4Q9QL 3VXME 4Q7DA 4PJBE 4HH8A 1KJVB 1FIEA 1HILA 1WF5A 5DTFA 3RY5A 3I6KA 3L3OB 3JV0A 3OHXA 2P42B 3VXNA 4JFEB 3T65B 1MCPH 4RMTA 1A1MB 2R4RL 5HHPA 2W1NA 1CGXA 1DQQB 3K4ZA 4J2XA 4BZ1H 3DV6A 4W6WB 5ALBL 4JPVH 1W2KT 4OZFB 3UZEA 4XX1E 3PIQA 3JVGA 2Z91B 5F1NB 3GSNB 2Q6WA 3PP4H 2QHLA 1P7HL 2J8UE 3T0XA 3P0VH 4O58H 2ATPA 2FJFA 5D5ME 2UUDH 1ZHNB 3KXFD 1RUPH 5DWUH 3EAKA 3MOQA 1VFAB 2NZIA 1KIQA 2P8PB 2WQ8A 4AIXA 4BH8A 4E0RA 3MV11 2N4IA 2VXTH 4KZDL 1R3IH 4OF5A 1E27B 3WFEL 1YNTB 3EJZC 1YDPB 3OR6B 4YDLB 4XP1L 4JO3H 1P6FA 3SGDI 4YR6B 5C0DB 4LRNH 4ZFOA 1A6AA 1CDJA 1V7NL 3W0WE 3L5JA 4MNHB 4ZUTA 4WJ5A 2W9LA 4Y2DC 3BGAA 1GYAA 3MCG1 2APFA 4KQ4L 2CUIA 5IB1A 5I19H 2BCKB 2X6MA 5F93C 2Z31C 4J3OC 1JWMB 1FFPB 2H2PC 2VXSL 3T0WA 4L3EA 2CK2A 3ARGB 5J56B 3PWJA 1MHPH 4RFEB 3QQ9D 4KKNA 3VGGA 1HSAB 2QLVB 3L1OH 4F7MA 3MCKB 1ZKAA 1NFDB 1NGXA 2EE3A 2O5YH 5CFHA 3VFPA 1U8JA 4P57B 3F7RA 4LCWE 2ADJA 3NCMA 1UB6B 3DRQB 1S3KL 1WC7B 4YEFA 1J1OH 1S7SB 3O2VH 1AGBA 1T20A 4J8RB 3W11C 2NQCA 4JANA 4I9WD 3CFDB 4H1LG 5HGHB 5H94B 1F90H 2VLJD 4ZTOL 4GT7A 2IPUG 2ICCA 3QUXD 2CRYA 4EDXA 1IGFH 3B6SA 5B39A 1OQXA 1TETH 3C5ZB 2JIXB 4WWKB 4N68A 3TVMB 2RJMA 4FQ1L 5J57B 1MI5B 5CP3A 2A6IB 3WCYA 1H3GA 3JXAA 3QIBC 5B3JF 5DS8A 2YS4A 1WCBB 3RI5F 5CS7A 1D5MB 2EZ0D 5KG9A 4KDVA 1KYOK 4UTAL 1QTYT 1AKJB 5DJ6B 4HGKC 4MAUH 3UJTH 4N0YH 4QTHB 1AR1C 4RGNB 3I75B 4HFWA 3QT2A 3MROB 2ZCLL 3CFIC 1BZ7B 1Z2KA 2JJSC 5EZJA 3QPQD 2X4TA 5SWSE 2QEJA 4EI6B 2NYYD 1PYWA 2A73A 4LSQH 2IG2L 4OBRA 3ROLA 1FO0B 4PY7B 5CEYA 4V2CB 2OJZH 1UJ3C 4YHPB 4U1LA 3ZYIA 5I18H 4JN1L 1XGRA 1NC4B 4U33A 4QRRA 3I6LD 4FQ2L 4BQ8A 1JZ8A 1IGCH 4CL7A 1RK0B 2EDQA 1MCIA 1BZ9B 2XA3A 5D1ZC 1A1NB 2OYPA 3GBLA 2ARWA 5BOZG 4GJTB 1KCKA 1FP5A 4MNGE 3N1QC 3QI9D 4ODBD 3G6JE 4N5ED 1F3RB 4WW2B 2IQAA 4EUPB 5DC0A 3L3HA 1T7YA 4H8WH 3QEQD 4Q0XH 2DAVA 1LNUA 2A6IA 3QXDB 4RGND 3KPSE 4S10A 3MLVH 4X6DE 2EE6A 1U8MB 1ZXQA 2A9NH 3MFFB 5H37G 4OGAD 4YBHA 1S9VB 3MRFB 3QFJB 5MEPB 1G7LA 4LEXH 1ACYL 3KYOA 3PWNB 4IDJL 1Q1JL 3ZO0A 4JM2B 1ZGLP 4FQQB 4X0KA 3L5XL 1KB9K 2C3HA 2D7TH 3GMLB 1JGEA 2EE9A 2LVEA 5DO2D 3WXWH 2L7JA 5E8EA 4M1GL 1C7SA 3FT4B 3REWA 3CIQA 3MRQB 2W60A 1NMCB 2BERA 3F5WA 3O41A 4LSVL 4NQSA 1HZHL 1HHHA 1G7HA 4PJ5D 3CSPA 3SDXA 3FQNB 2ITCA 4O2CB 3O81A 1JV5A 1T0NB 3ZZ1A 5GGTH 4XBPA 3MREA 5AWNL 3CDGB 5GZNC 2QADB 5E8DL 3ZKND 5J1AB 2P5WA 1QPPA 3PL6C 5FIEA 2KQMA 3RRQA 4XTRC 3VRIA 3ZE1E 4QHMA 4RIRB 1T6WA 5ADPL 3OF6D 5DR5H 1AR2A 3QUXA 1NANH 32C2A 3C9NB 2YPKA 2XN9A 4NM8L 2LVCA 8CGTA 1IEBA 2OL3A 3N0PB 5EH1A 4GAGH 4KROD 3GGWA 1NCBL 5TH2A 5CD3B 3E6FB 5D2NE 3SO3B 5EN2A 2F8OA 2XWBB 4WI5A 1M6OA 1GOHA 4HWBH 4JFPB 5SWQB 3MV7A 4BYHA 1I3VA 1ULVA 2P8MA 2B4CH 1AE6L 5KN5B 4LSQL 4ZD3H 8FABB 3KXFE 2EDWA 1I8MB 3BZDA 1SYSB 3QDJD 5KSAC 5I16A 3KXFB 2XNAB 1ED3B 1EV2E 3RWCB 4X5XB 3OKLA 5J7CC 5JW4Q 5MENE 1IKFH 2IAMB 1F2QA 3F7YB 4A6YH 3N85L 2YWYA 1GOGA 2BNRA 1W8NA 4U49A 2R1WA 5CHNA 3MV9E 3KJ4C 5IIEB 3FOMA 3MV9B 1G7PB 3LDBB 3PWVB 5FGRA 4NGHL 2XN9B 1XF2A 3VWKC 1RSFA 3D85D 5IVXB 1O5DT 3EDKA 3L9RB 5E1AB 1U91A 3C6LD 4JY4A 4XPGH 1T7ZA 4WHCA 4ZG1A 5I1GH 4CJ1A 1I8LA 3MRMA 2WW8A 4HBCH 3PHSA 4PGCB 3X17A 1OSPL 1KIPB 2QSCH 3GSOA 4CVUA 1R3KB 5AG9A 1NGPL 4P4RA 4X9HA 5DRZB 4DAGL 4YDKH 3RHWF 5C7XH 1AD0A 3VXUD 1FFOB 4AQ1B 4YHMH 5MP6H 5TDPA 1MIEH 3ULVD 5EZLA 1X4XA 1P4BL 1M71B 2XZAL 4JY6A 4JLRB 4NUGL 1G9MC 4JQIL 4LSVH 3CDFA 3IJYB 2YRLA 3QUZA 1EFXD 5HI3C 3MLXL 4PJBA 5DVMA 4QRPA 1DVFD 4DVRL 2HLFD 5A2JH 5DJ2B 2B39A 3DTXB 3UTPE 4IS6B 3VXSD 2HFFB 4X99A 3OKNB 5CLTA 1T7VA 1RJZA 4ZUUB 5CKGA 1LEGB 2CKBL 1N2RB 3CU1A 3MJ6A 4YDKL 5JW4N 3WNLA 4C56E 4PRPD 1IGJA 1RZ7H 4G8FA 1L7IL 1R3LB 5HHXH 5IB4A 1EGJH 2BNQD 1HNGA 4WEMB 4JKWA 4XMPL 4I4WB 2VZUA 5DUPH 4N1CA 1RUKH 3QIUB 1C16A 1FJ1B 4P3DB 4OI9A 1YDPA 1C8PA 1BHGA 2MQ3A 3WN5C 4ODXA 1E27A 5E8PA 3UYPA 5HDQH 2J88L 2CMRL 1W72A 3HMWL 3BWAA 3DGGA 2O93L 4APQB 2J5LB 3HNVH 1GGBH 1MFDL 1J0KA 2NZ9D 3HR5B 1SM3L 5ALBH 4U7SA 2X89D 3EFDL 1P69B 5JUEL 2UVFA 3PQYA 3O3BB 2XTJE 1OCWH 1U2CA 3G04A 1MCNA 3GIZL 5KOMC 2PYEE 2BY2A 5C0CD 5KSBA 4HK0A 1KULA 2F54B 4ZXBC 1CFNA 1NEZA 3RFZC 4NSKB 3WDHA 1WT5C 2GAZA 5LGJA 1JYWA 2F54E 4JDZA 1UWGH 5ALCL 3RIAF 3MGOA 3SO5A 1S9XA 3QUZC 5K93A 4HDIB 3DVNB 2WWMD 1HNFA 2X1QA 2CDGA 5HYJB 4KQ3H 1NFDE 1DDHB 3CLFL 1HHKA 4R7NB 1INDL 4KTYA 1T83A 3DMMB 3NCJL 1R5WB 4G8FB 3BE1L 1K4CB 1FC2D 2ESVA 3QQ3A 3V4VL 1G7QA 4Q9RL 4UUJB 3EUUA 4KPHH 4NO5B 4OD1H 2JB6A 5KZCB 1QZ1A 5EBMA 3PWUB 3GBMH 3VG0H 1DQLH 3MRRA 5GGQL 2EO9A 2NY0C 4JFEE 4PTTB 1WEJH 4QKXB 4JPIB 1WITA 4OLUL 4X7CC 5HYIA 2DTML 3IDNB 3JWNC 2GITB 4JKPL 4WWKC 3WSQL 3L6FB 5J9PA 4Z5RA 1MFEH 5EUOB 4NZTL 1A6WH 3DUHA 4MB5A 4HWBL 2QTEA 2UY6A 3QRGH 1QFPA 1AO7B 5D96B 1NGZA 1A1OB 3JV5A 2F53A 3QO0A 1LO2L 1UXSA 1X9QA 1OM3H 2JCCB 1BREA 1AXSA 4NKOA 1CYGA 3IJSB 1YNLH 4NRYA 5DUMH 1SQ2N 1D5XB 3UTTA 2YUVA 4JPKH 4K94H 1JWSA 3GSXA 4RZCB 4NQCE 4JJ5B 4WI2A 3TZVA 1VFMA 5C0RL 3DX7A 5KJRL 1IAKA 4P2QE 4RAUA 4HWZB 4G6AD 5ADOL 1MJUH 3CFEB 3P4NB 3ARGC 2FSEA 2PW1A 4ONFL 5EO0B 5IQ9A 4XMLH 3C8KA 3V6FB 5IFAL 4NBXB 2O5XH 1CICB 4NKMB 2EE2A 4MXVE 5EZIH 1DR9A 3K80A 3VW3L 3RDTC 3OR6A 2H8PA 4YFLF 5C86A 5DQ9B 4AM0B 1NCTA 5CSBA 2AW2A 3BUYB 4MXQC 3WFHA 5EUOF 1A7NH 2D7PA 5BV7L 4G3YL 3U2SA 1A6UH 3VFNB 4DWHA 2VXSH 4H8WC 3A6BL 5JW4M 1PW3A 4Y16B 5D1QC 5EU3A 4MAYA 5DJAB 1B0GB 1KOAA 3SOBH 2BNQA 5C07B 1F5WA 4GBXB 1IAIM 1IFHL 3WFBH 4JDTL 5C07A 3GMQB 4LCCA 2IH3A 4LQFH 3DI2B 4PRIA 1YEHL 2BSRA 5C7XL 1GZPA 4HUUB 4AEHL 3RZCA 4YXKL 4JPVL 4POZC 4YO0B 3BSZL 3O3AA 2G9HB 3OZ9H 3WMSA 2K1MA 4YK4B 1DQTA 4AL8H 4N8VB 1YPZB 3FFCD 5CP3H 5DMKB 1T04A 4KDWA 4D8PA 5EBLB 2NNAB 1U8KA 1EEYA 3MLUL 4E41B 5H35B 4K55A 3GJEB 5F9DC 3GUTB 2V5RA 4Q9RH 1N3NA 1IJ9A 1Y6NR 3FB5A 3DVGA 3MREB 1AY1H 3RY6C 5TDOB 3RVUC 3BQUC 3NN8A 4DGIH 4WCYL 5ACMA 2VQTA 4MD0A 2FEDC 4LSTL 2DN7A 4E5XA 3C09C 1BJMA 3KS0J 4KTDH 4ZOCA 4HGWA 4HJGA 3C2SA 1LO0L 3DIFA 3ILPB 3SJVA 3K4AA 1DVFA 3U48A 5E8OB 4OZ4B 2WMPA 2JJVA 2NXYB 3CCHA 2Q20A 5C0IB 4KROB 3KLSA 3H0TA 1I7TA 1MRFL 3QG7H 2VDML 1D9KB 2FJFB 3LSOB 4FXLA 1G0DA 2D31A 2ZJSH 5CJQH 2Q6WB 4L5FL 3PQYB 1RVFH 3QUYC 4QRUA 1UZ8B 3S96B 4HJ0C 2VO5A 3VFGL 1MHHA 3BKCH 2JB6B 4I0PD 3QDJA 3QCUH 2J8UF 1KIUA 4HQQL 1KV3A 5D1XC 4ODXB 5AAMA 3NA9H 3WE6B 5KSUA 3QG7L 5DGRA 2DLIA 4Y5YC 1CFQB 4M1DH 4L9LC 3IETB 4QOKA 1JL8A 3BKJH 5JMOC 1XF4B 2WNGA 5DZOA 3WO4C 1AHWC 3GBNL 3PUCA 3QJFB 3BGFC 4LRNL 2VDRH 1UM5L 1JYVA 2F54A 5B22A 4HEPG 3EDJA 2V5SA 4NM4H 3NA9L 1MFBL 1ORQB 1FE8L 5KSAA 2AJSH 3R0NA 2RQ8A 3FN0H 5ISZD 1BAFL 1T0MB 1GXEA 5GRYA 3VMPA 5FUOL 5BJTA 1TXKA 4OLXH 2A6JB 5ICXA 3FO1B 3EO1A 3OQ3B 4MNQB 4IOFD 4NFBA 1ZHBB 3BPNC 1AD0B 5LKNA 3VW3H 4G6JL 1RUML 2QHRH 3FQWB 3U0PB 1I3RA 5FDYA 1A1OA 3C6SA 4FFVD 1RU9L 4UQ3B 4GQ9L 1UXWA 2VOTA 2HKHH 3C60D 4JZJA 5DVOA 2X05A 2X4SA 3CXDH 4BSJA 3ULVF 4X6DA 4RDQF 3PNWA 1QACA 4QXWA 4GO6B 1J11A 4OSUH 5C0JA 2HJFB 5FYKU 1R5VB 4ORZC 3MV9A 4WV1A 5L8JB 1NANI 3FFCA 4LSPL 4D8PB 2R23B 1INQA 4LIQL 1VFOA 5F7DA 3TLRA 5F9JB 4PJHB 1NMBL 2G60L 1UKTA 3MNWB 3RBSA 5L6YH 2WANA 2Y5TA 4FZEH 4S1RH 5C6TH 3TBWB 4ALAL 3IF1B 1Q9OB 3DBXA 3RAJL 2GIYA 3TN0D 2A1WH 3UTZB 5CGMA 1MSPA 4RRPG 2MHAA 3RI5K 1SJXA 1WISA 4CDHA 5F7WC 1RIHL 3MRJA 1K4DB 1A4JB 4NQDD 1KCUH 2UWEE 1FBIH 4HK0B 5DD5H 5DJAA 4D0CA 3SDDC 2V5YA 5BO1L 5TQ2L 5HPMB 2O26U 3VFWB 3NFPB 1KJ2B 4P3WA 4FQ2H 4HIHA 3R1GL 1A3QA 3I6GB 4WENB 2Q7YA 2CH8A 4J23A 4ZFOB 4ZOBA 4I3RL 4HHAB 4YR6A 4KMTH 4J6RL 5TFSH 4KVNL 3ZLQC 4R0LC 1XGYL 3RP1A 5ID1B 2CMRH 2ZCHL 3SCMB 1HQ4B 5F7UA 4QY8B 3TBVB 2DQJH 2R29L 2P8PA 4BH8B 2ADFH 3BFOA 4MX7A 3M1BA 1TCMA 3RVVD 5HPMA 2WBWB 4YDJB 4YHLL 5FKPB 3KPNB 5F7HA 2R4RH 4JPWL 2DQDL 3EO0A 5GRXG 1S5IH 5KVEH 2Q8BL 2R0WL 3UO1L 1QYGH 3Q48A 3IJSA 4FXKB 2BVOA 5I9QB 3F12A 5ESVA 5BS0E 1G7HB 3FB6B 1FO0L 3MOAL 4EIGB 4ISVA 2AERT 1NGZB 3V4PL 3OJVC 4JFEA 2W60B 3MV8D 5DD0L 1RIUL 4PLKD 5GSRA 5HDBF 3W5MA 1SJHB 2CJUH 1M7IA 1C1EL 3VRLE 5L8LB 2VABA 2V2WB 1MF2L 1UWEL 4Z7WF 1BFOB 2WINB 4H26B 4X7TA 1AO7E 2FWOA 3T4YB 3VXSB 1Y6KR 2AAVA 4G8GD 1T5XB 2DOCA 5IB1B 5BVJA 2VDQL 2XTJC 3WNPA 4KV5E 4OZHB 3B5TA 3DSNA 3M1BB 3SDCA 4JZOA 3VXRD 3CH8A 4F57L 4MA7L 1VSCA 4UQ3A 5FA4B 1FAIH 4KUCD 5F8RC 1EERB 3WO4B 1MRCH 4OQTL 3HPLA 5ALCH 3IGAA 3ZTNH 2AGJH 1KPVB 4Y5VC 4NC0B 1ZMYA 4OLZH 4RGOH 4Y5YB 3QHFH 4RBPH 2CIIB 3CX5K 2AXHA 2E9BA 2C5DC 3KDMB 4O2EB 1UJ3A 2VDRL 3W2DL 4LCYA 5EU6A 2VRAA 4LNVA 4LLQA 1RZKH 4YGAB 5DLMH 1ZLWK 4IJ3B 5GRVL 3UP1A 4UU9A 1HN1A 3ARYA 5F3HA 1W0YT 1L7TH 5GRZA 5CCKL 3FB6A 1U3HA 4M7ZB 4NP4H 3TN0A 3MRHA 4FABH 5JO5A 2FGZA 4PRIB 4G43A 4I3SL 3OKLB 4F7PA 2AJVL 1BEYL 1F4XH 3OG4B 2HRPL 3FCTA 4Y8DC 4HQQH 5JDSB 2W0FA 3QISA 4FNLH 1WBYA 2A9MH 3KPNA 3MV8E 8FABA 4X6CF 2MHAB 5C0GA 3QIWA 1VDGA 5C07E 2W92A 1YJDH 2DQCH 1TCRA 1UJTA 2DF3A 3BJ91 4JVWA 4YDLC 1MFDH 1OVZA 4M6OL 3EOAB 5E8NA 1I9RH 3LQAH 1Q94B 2FO4B 3UJJH 1Q9KB 4AIZA 5E08H 3RU8L 4M8VA 5I1LA 1S7TA 2HN7B 1JCKA 1BZ9A 3IDUA 5JW3H 5GGTA 2FJHA 1KCRH 2BK8A 3D69B 3U0WL 2DJUA 4OCRH 1NUFA 1KXQE 3D0LA 1QRNB 4KRNA 3VE0A 4XPGL 1U6AH 4YBLB 4ZAKD 1U58A 2RFXA 1UA6H 3MUZ1 5GJSL 3V6OE 4DCQA 3QWRA 4DUXA 1TIUA 1QLFA 4YHKH 3GIZH 4YBQD 2X4TB 3H9YA 1AI1H 1WIPA 2VDNH 3P0YH 4FQPA 4DAGH 5HGGS 5LGHL 3H3BC 4JEGB 2ICES 3IDIA 3QHTC 1A2YA 3DBXB 4LLAA 3LQAL 1SEQH 3HHRB 3REWB 4C57C 2ZUVA 4UDUB 4PGDA 5JIKA 1X3DA 2CUMA 4E42B 1IC4L 2EIBA 4BQBA 3HC3H 3VE0B 5I30L 1VGEH 4S1DC 2NY1C 4YDVB 3VFRB 5ACZA 3C08H 3V5DA 3S7GA 3QG6A 1NJ9A 3I50H 3PE9A 4KDTC 1YEHH 4ORGB 4Z7UA 4BM7A 1EDQA 2NX5A 2A74B 1U8KB 1A3LL 3MNVB 3GJEA 2VJXA 3LEVH 3HE6B 3A6BH 2BVEA 3GSVB 5DD3H 3GMOA 1HEZB 1JN6A 3HC3L 1RURL 2V17H 3SGKA 2JKXA 1BBJA 1N0LA 2X4NA 1RMFL 5IM7A 4ONGL 3TIEB 4NPYA 5EBWB 2HAZA 4UILL 3FMGH 2ICWA 1FFNA 4U4BA 1C12B 4EI5C 3L5IA 4B7LA 4R4FH 1MCHA 2IH3B 2OTPA 3MRPA 3SDAB 3JTTB 1LK3H 1FORH 1KTRL 1EMTL 3F7VB 4I18C 2NY2B 3V52L 1H5BC 4JQVA 4P5MA 2V7HB 4KVCH 5D71H 2GUOB 5IK3A 5EFIB 1NC2B 1NMAL 3OKEB 3PP3H 3MLPA 5K9OA 2JE8A 3MGTB 3GSRA 4NQUA 4XNMB 5BZDB 2R39A 5ISZE 2ZG1A 1D5BA 4NM8H 1BP3B 1BOYA 2DQJL 2R29H 1WCQA 3O3EA 4N90D 5FFLA 2DQHL 2HWZH 4TVPL 1OPGH 5DVNA 5DJCA 3ZT5A 4KRPD 3EZ8A 1AP2A 2DKSA 4ORGA 3ULUF 5H8DA 3OKKA 4ODWB 4X80H 4QCIB 2VDQH 3HPJA 4A6YB 2VDLH 3NCJH 3NN8B 2XYCA 1INDH 1S5IL 1FFQA 4F7EA 3W5NA 4LLWB 3KVQA 3H8NA 2RHEA 2R1XA 1DEEB 3K7UA 1A5FH 5I8OL 3WYRA 5EC1A 3DROB 1A4JA 1EEYB 2CK0L 3FAXA 4BFIB 2YHGA 1A1MA 1M7IB 3EYVA 1MCLA 1IM3B 1CG9B 5EBWA 1DEDA 1AD9B 4XC3H 3MOBH 3QO1B 4RGMC 3QUZB 5EUKB 2I5YH 2VYRE 4OZHF 1GGUA 4WUUD 5J9PB 1I1YA 3VRJB 1I9RL 2GJJA 1JGEB 5ITFA 1SEQL 2ADJB 2DICA 2EYRA 1KB9J 3ESUF 4XRCB 3ZE0E 3LKQA 4HS6A 1UM5H 1MHEA 4H25A 2AJZA 3QPXL 1JHLL 3TO4B 2O5ZL 3AXLA 2V2TB 5DJYB 3OWEA 5ERWB 1EAPA 1U3HC 2UZYB 4PRAA 4I9WE 5I1AA 5JOFA 3QUXC 3QEQA 1H8NA 2WQRA 5LAXB 5BRZE 1RUQL 1N59A 4FTVD 1MRCL 4OQTH 1QSZA 5T1MB 4CMHC 4WI4A 3AFLA 3GI9L 4RAHA 4ZODA 2BRRH 5E03A 1EA9C 3S35H 4KJQD 3HC4H 3MGOB 4P2YA 4PP1D 1FYTE 3V4UL 3DVNA 1JHLH 4YXHH 4ODUB 3O6FC 2P5EA 5BZDA 2DYPB 4MNQE 1X5JA 1FRGL 2H6PA 4IRSB 2JLLA 5DD5L 5I9QC 1YMMB 5KSBB 4U1JB 3MLXH 3C87A 1XF3A 3A6OA 5GQBA 4G5ZH 4PJ7E 2I24N 5F71A 1YMMA 4LCCB 4J4PA 2IMNA 3MA7B 4GRLD 4PD4K 1PX3A 4UB0L 2PCPB 3O11A 5HYSG 1SYSA 2BDNH 3I3DA 4NN6B 1I9JH 4LKXB 5SWZA 1NC2D 4HCRL 3U9PH 2OI9B 4FTVB 3PQYD 3LMJL 1MJ7H 4KK6D 1TNNA 1OSPH 5J3HD 5SX4I 3MV7B 1UH3A 3U1SL 4QT5A 5BS0B 4GH7B 3LH2L 5DVKA 1WTLA 3U82B 3H42H 1UWXH 3IT8D 5J12C 5C09B 4J3XA 3MJ9A 1P4BH 5A2LH 2AJSL 4G6ML 3S5LG 5J11C 3I02A 3FMGL 3P4OA 3HZVA 4F58H 3VXRA 1JTPA 4OF7A 2VE6A 3BAEL 3TC9A 3MJ9H 3V5DB 1G9ML 5C3TA 5IJKC 3UZQA 1F58L 2P44B 3MLVL 3IAPA 1MLBB 3BPNB 4A2MA 2IPKA 5C0CE 5IBLC 4CADA 3M8OH 3S37X 2ITCB 1YEIH 4K23L 4PGDB 4WU7B 3FO9B 5J8OA 4P23D 1AXSB 4OT1L 4FQIL 5CJ5A 4XB8A 5LXGL 5KVDH 2YA0A 4AEFA 3V0VB 4LGPB 4UILH 1JGLL 1R3KA 1ZWIB 2YD9A 5I1HH 1TVBA 2BVOB 2V9RA 1IQWL 2YD4A 1R5IA 4LF3B 2ADIA 1U3YA 3LKPA 3GEWB 5TE7H 3OGCB 4KDTA 1ZGLB 1REIA 2MPAH 2EXWC 1P84J 4YDJA 4WY7L 2MSPA 3QA3B 4QCIA 4CBPA 1FN4A 2DI9A 3MJ8A 4XNXL 5IB3B 1F4AA 5JOPE 1PEZA 2RB8A 4PLJD 4Y2DA 3H7BB 4F8QA 4XGZB 3RIAK 2VC2L 2ED8A 3C6LA 3BN9C 3EYFA 3PGDA 4OSUL 1HHKB 1T3FA 4XNMA 5E8NB 3LKNA 2V2XA 1YPZA 3WXVH 5I6XB 1F2XK 3ES6B 1ES0B 1IC5L 3VFMA 3WFCH 4P4KB 4RWYH 2F74B 5IB2A 5L2JB 1D7FA 4RMVA 1FL6A 3PL6B 1AY1L 2FATH 3K2MC 1KPRA 3BQUA 3WS6A 1I7ZA 4QHKI 5KN5A 1UH4A 5A16A 4BUHA 3DSFL 4KGLA 1HKFA 3WXVL 4M7LT 2NY4B 3NMEA 2A73B 3BGFB 1QRNE 1WBXB 4OLUH 5C2BL 3ZL4H 3BWAB 2PYFA 4MLIA 1WLHA 5D7IA 1H0DB 3ZTJG 1HE7A 4YAQB 3O9WD 1F4WH 4XNUL 1EEZB 3BP5A 3AM8C 4CJ0A 3D18A 1H3UA 2QHRL 5ECJE 5K9KB 2R9HD 4IDLA 2JCCF 3C9NA 4Q58C 1KLGA 3JV6A 1PQZB 5IEHA 1DN2A 1FNAA 4ZQKB 2QKIB 5DEFB 3LHPH 4JKKA 1OCWL 3SDCB 1MCEA 1KN2H 1N59B 2HYMA 4HS8L 3Q5YA 5EA0H 3TVMA 1KEGL 1Z5LB 5C0BB 4YLQT 1QFWI 2B5IC 1MVUA 1E0OB 4ZO8A 3QDJE 4XVJL 4ZO7A 3MRDB 4MHHG 2G5BB 3HG1E 1JPGA 1HH6A 5HGBA 4O5LL 3U30B 3VJ6B 4DW2H 5HHOD 4WFFE 1NAKL 1KB5B 4H0IA 1OAZL 1ZS8A 5I8EA 2HT3C 1EGJL 4LLDB 1WSST 3CX5J 1QD0A 5GHWH 2GI7A 3UTPD 3VXSE 3ARFD 5D1XA 2CLRB 1I7RA 4Z78B 2HFTA 1MFAH 3CC5B 1S8DA 3MPCA 4U7KA 2XKSA 4GAYB 4QXTB 4GMTL 4NWUL 1C1EH 3D3VB 2D2OA 4FFVC 4J4PC 4CVWA 4HF5L 3U36A 3FN9A 4F9LC 4HLJA 1QQDA 3O9WB 3W9EB 3QUMH 2IH1B 3RDTA 5CJXC 4RX4A 3QQ9C 3SN6N 1PQZA 1M05B