4ZMYA

Crystal structure of human p-cadherin (monomer 1)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
214
structure length
214
Chain Sequence
MDWVVAPISVPENGEGPFPQRLNQLKSNKDRDTKIFYSITGPGADSPPEGVFAVEKETGWLLLNKPLDREEIAKYELFGHAVSENGASVEDPMNISIIVTDQNDHKPKFTQDTFRGSVLEGVLPGTSVMQVTATDEDDAIYTYNGVVAYSIHSQEPKDPHDLMFTIHRSTGTISVISSGLDREKVPEYTLTIQATDMDGDGSTTTAVAVVEILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Cadherin-3
publication title Adhesive Dimerization of Human P-Cadherin Catalyzed by a Chaperone-like Mechanism
pubmed doi rcsb
source organism Homo sapiens
total genus 53
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4zmyA01
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4zmyA02
4NUMA 1O6SB 2OMZB 4ZMOA 3LNHA 4AQEB 4ZMZA 3UBFA 3LNEA 2O72A 4ZMWA 4ZMTA 2OMVB 4AXWA 4XXWA 1NCJA 1WUZA 5CZRA 2YSTA 2WD0A 3UBHA 2A4CA 5CO1A 4ZMQA 4ZMLA 4NUQA 4ZMVA 3FF7A 4AQAA 3Q2VA 4NQQA 1ZXKA 2WHVA 3LNIA 1L3WA 1OP4A 5KJ4A 2OMTB 4NUPA 4ZT1A 2YQGA 4ZMNA 4ZTEA 4AQEA 2OMXB 1WYJA 4AQ8C 1NCIA 1ZVNA 3K6DA 5JYMA 2QVIA 2OMYB 3K5SA 2WCPA 4APXB 3UBGA 1Q1PA 4ZI8A 4AXWB 3QRBA 3K6IA 3K5RA 3Q2NA 3K6FA 4ZMXA 3MVSA 5DZVA 2WBXA 2OMUB 1NCHA 4XXWC 2QVFB 4ZMYA 4QD2E 4APXA 3PPEA 3Q2LA 2OMWB 3LNGA 5JYLA 2X2UA 4AK1A 1EDHA 1NCGA 3LNFA 3Q2WA 3LNDA 2A4EA 3FF8A 4ZMPA 1SUHA 4AQAB 4AQ8A 2EE0A 2V37A 1FF5A 4OY9A
chains in the Genus database with same CATH superfamily
4JFEE 1BQ5A 1ERNA 4R8WH 4RGOH 5IBUB 4JL1A 5IQ9A 2AEPH 3S6CA 3KAAA 3IGFA 5T5FA 4PJ8B 1DQJA 5KSBA 2IJ0C 3MRJA 3K7UA 5DFTA 4J3OH 1XGRA 4QRQB 4MJ5B 5LG1A 2DQJL 3HI5L 1WWCA 2DQUH 2TAAA 4OLEA 4QT5B 3DX8A 5D6CB 4AQ1B 3BE1H 5C0AB 4A7QA 3ETTA 4PJBF 1CDGA 4UF7C 1Y0LB 1X9UA 3EH4B 2OMWA 4MMZC 3U4BH 3GJEB 4D0CA 4Z3TA 5A40E 1S9VA 2P5EE 1YPZE 5DS2A 5JW4Q 1AP2A 5LBGA 1RUML 5F93C 2AQSA 2C9PA 3KPRE 1KGUA 4NQQA 5I28A 3U7YH 4KDVA 5LAPA 5IROD 2PW1A 2X6VA 1NUFA 1RUQL 3HAEB 1V7NL 5J13C 2IDQA 3JYCA 4D3CL 2RMNA 1KULA 2DYPB 4Z78B 5BV7H 4LHUD 4E41D 5L2KE 2HTLD 2KDGA 4PJ5B 5EPMA 4FLQA 4TULL 2ICES 4OGAD 4I18C 2BVQB 5C0BB 2VDQB 2WQ8A 3MUY1 2CDGA 3ESNA 3L7EB 2FIKB 5D2LE 1CFTB 5IVXF 3PAVA 1XL4A 4M7JL 4BFBD 1CFSB 3RVXC 4X9IA 3OLEA 1NFIA 4KHTH 1F6FB 4BH7A 2QEJA 3WTTA 4LPVA 4O02H 2X4QB 3OKMB 3CVIH 4AT6B 3US9A 3HFFA 1XX9C 2W65A 3HS0B 4DN4H 2BOBB 4P46D 4N0YL 2ZTBA 3QNZA 5KVFH 1IGJB 1CGVA 3VI4B 2JNZA 5KVEL 3ULUD 3PGCA 1D5BA 1IB5A 1NM4A 1YNLL 4JO3H 4H8VA 1T20A 1JXGA 3JV4B 4G7RB 2O5YL 1KPVA 1WVZA 4QTHB 2ZP8A 3U1PA 2HLAA 5FA3A 4Z7WE 1BVNP 1P4LB 4UINH 3VD5A 2W0LA 3VFVB 3BYTA 3FRPB 1NCAH 5C09B 3IJEB 4X9YA 1P4IH 4E68A 2CMRL 3GGWB 3ARDC 5HDRA 2ALWA 4X7FC 4P5SA 4F15C 1ONQA 3E6FA 1KJMB 1AQKH 4YZFE 4M48L 1EZUA 3AT9A 4PBDA 1EAPA 2CCWA 4R8WL 2CIKB 4RGOL 2HFFA 1ZA6A 3KBFA 2AEPL 4PGDA 4JKKA 5C6PB 1AGBB 3FDWA 1O7VA 1T89A 3U0PB 4I3SL 3DURA 4N0UA 3V0GA 5I0YA 2DQUL 4S0SD 3O9WA 3BE1L 3SJVE 4BH8A 1XMWA 1KB3A 4ICWA 4KFMA 5CN2A 5DJYB 1Q1JH 4N87A 5EH1A 1NH6A 2GC4C 2LHAA 4HJSA 4OB5H 2B59B 4U1NA 3KYMB 3ATDA 3AS2A 4LVNC 3Q5OA 3U4BL 2YUXA 4BINA 2XXGA 4DP4X 1I4FA 4J6RH 4JZOB 4TQIA 4JGMA 2PWHA 5TDPA 5IHZA 1RZ8A 5L4IA 3FB5A 3UPCA 1Q94A 1VB9A 4L3CB 3U7YL 3GSNA 4WFEE 1WFOA 1G7PA 3OLIA 5ADOL 4NI3A 5KAQF 2YRBA 4BFKA 3KPPA 1FL6A 2X4TB 3D85D 4YHLH 3K6OA 1ETZB 1LO3H 5F7WC 5BV7L 1DJXA 5GGRA 5IUCA 1DQLH 1NGXA 3MCLH 3RTLA 5LBSA 3DRQB 1NL0H 5EIIG 4WGKA 2FLBT 1OP3H 3DGDA 2VR3A 2CBQA 4JFUA 4GXFA 4WVRA 3MV8D 5I82A 3CFNA 2NW2A 4U7KA 4HUWB 2CA3A 5B39B 2JH2A 1N10A 4RLDA 1MH5B 4YSOA 1V7MH 4HKBA 4F9PA 3ULVH 1IAII 1KLFB 1G1KA 1S9XB 4XN1A 1BEXA 1M1XA 1QQDB 4KHTL 1GYUA 4O02L 4H5SA 5F2FA 3SIKA 3E7JA 4UOZA 1M56B 4DN4L 1VGKB 3O41B 2G2RB 5DA4A 1S7QA 5J06A 3PFQA 4FDWA 5KVFL 3NPSB 4WNQA 3RVWD 3QEQE 1WCBA 3NN8B 2HFEA 2ZUSA 2KYIA 5HTSA 3OM3B 3N55A 1P7KB 1OTTD 4JO3L 3EBGA 5E8NB 3ALPA 3L08A 5DMGC 2YWZA 3AXLB 1VA9A 3BMVA 2UXFA 3T2QA 1EHXA 1REIA 2XWTB 3BFOA 4G8GB 3KCPA 1UOWA 4FG4A 1UGNA 4UINL 2ZYSA 5DD6A 1NCAL 1P4IL 2D2CC 2E75C 4POUB 5KYWA 5E51A 1OF2B 4PCKA 3MUGA 4OH2A 5F3HB 1AXSA 1AQKL 1JF6A 3ZLQC 3LEXB 5I30H 4GKZA 5B4MC 2K6ZA 2XX1A 5C0IA 1CFVH 4LLVA 5JW5B 3AT8A 2DWDB 2IADA 3DMMB 3L1EA 4LCIH 1JAEA 3HNTH 3S98A 5I5MA 4YHIB 3L4XA 1FSKC 1WFTA 5L0QC 3OMZA 3BSGA 4HWNA 1MW3A 4HPOH 1PS3A 5AVXB 2PYFA 2IF7A 1Z9MA 3TO2A 4G9DA 1OCWL 2IH9A 3QPQC 3QUXD 2OI9B 4OZIA 5HI3D 3V4UH 4UT7H 4WFFE 1Q1JL 4I0KA 4PJBB 3OB8A 3X11A 4X6DF 1MCRA 4OB5L 4DEPB 1U6AH 2ED6A 1WQVT 3MLUH 5HBBA 3KZ8A 4ZSOA 1N67A 3O6FB 4JRXD 2PTUA 4J6RL 1G0YR 4MYWB 5GJSH 1NANH 1BYNA 3UTSA 2VSMB 3P4MA 3PL6C 5F44A 3P54A 1YNKH 2BCKA 4NYLA 4TXVB 1AXIB 1H8NA 4H0IA 3K8LA 5JQIB 1E7VA 4L8DA 1MFMA 1WZMA 5HHVH 4JLRA 4YHLL 5K59E 5J3HC 1LO3L 4X2UA 3VYOA 4OV5B 2NUTB 3REVA 3JWDH 2KT6A 1DQLL 1MQ8A 3MCLL 1QFWH 1B0RB 4V33A 1NL0L 5E6SB 5FIEA 4BXVA 4WY7H 3ZSTA 5FXCH 5JPNC 1ILSA 5FYJE 3R8QA 4DZBA 1LO4H 4PJ8A 1LP9E 1P1ZA 3FHEA 2NY3D 4QRQA 3V4VH 5IVXB 4Z3JA 3UL4A 1V7ML 3M7OA 3ULVL 4QT5A 4IKNA 4AVIA 3MR9B 1XL6A 2YAEA 5D6CA 2PO6C 1K6QL 3OHXC 4OLYH 5C0AA 1NWPA 4HJIA 4AQ1A 3G3LA 3L3JB 4Z3GA 5HI4C 1Y0LA 5F7YC 3VQ2C 4IOFD 4Y1AD 4UM8B 1W0YT 3V6FB 3GJEA 3V0EA 2J73A 1OTUC 3L9EA 2P8LA 4M7ZC 1BJ8A 3RLSA 1UD5A 3QYNA 3PWUA 4JEGB 2C5DC 1CFQB 3HAEA 2BZCA 2OSXA 4NCC1 2Y6SC 3QIUC 3QJOA 1BXXA 4OCRH 2DYPA 2BINA 2XRAH 5FDYA 4Z78A 1JERA 3RHWK 4KUCD 5EDSA 3OKNB 2XPYA 5SWZD 3D85B 1UACH 2B4CH 4ISVB 3IKKA 3EKCA 3SHSA 3KLHD 3D0LB 2ED8A 5C0BA 2NTFB 4BFFA 2ZCZA 3DUSB 1DVSA 3HN8A 3RKPA 3L7EA 2FIKA 3SO3B 4UCFA 2YC1B 5HYEA 1CFSA 4W4NA 1CFVL 3QEUB 2XZQH 4LCIL 3VVVA 4BSJA 3WJMB 1XGYH 1FZJB 5DHXB 3HJEA 2WYIA 2X4QA 3NJKA 4Q8BA 2WLKA 1G94A 1FWXA 3B43A 4F8PA 1SDYA 3VA2C 4F8TA 5L4MA 4HPOL 1I8KB 3HS0A 1THAA 2BY0A 4MA7H 3C08H 5KOVC 2A6DB 4Y88A 3E9TA 3V4UL 4UT7L 4UOJA 5B3JE 4G5AA 3UMNA 2Z7UA 5HDOA 2CRIA 1U6AL 1LYQA 3MLUL 4U3XA 2BS8A 2AQTA 4NQXB 3JV4A 4LCWE 1HI6B 2CDFB 2ATKB 2E7CA 3GSXB 3QEGH 4HKZB 5GJSL 4QTHA 4F7CA 1HL8A 4Y16D 1YNKL 2XY2A 3UO8B 1GC1C 1P4LA 3VFPB 3VFVA 3FRPA 3IJEA 1LL1A 3KLDA 3GGWA 1BD2D 4UAOB 3ZW3A 1N4XH 5HHVL 3WY4A 2ZZUT 1E6OH 3Q5YA 5BRPA 4EDXB 1KJMA 2HG5B 5GSVB 3NIGF 1JIBA 1QFWL 5DJ2B 5F6IB 1KYAA 1E5ZA 3KD4A 4HOXA 2EZ0D 4WY7L 2FCBA 4N24A 4HLJA 1R47A 5CEZL 5E4EC 1AGBA 3T77B 3W1ZA 2JIXD 1LO4L 2P45B 3V4VL 2VGLM 4PVMA 4FEIA 1RCYA 4JPVH 4OLYL 4YBQC 2J56A 3QI9C 3QWRA 4JFDA 3TZVD 1SHWA 3UEQA 3CDCA 2I25N 4HZ1A 3NK3A 3FU9A 3VE0B 5K5YA 5I9QB 2CD0A 2VJ8A 1H6FA 2VM9A 2B59A 4AV4A 4KRPC 4Y19E 5GZNA 2P3YA 4JZOA 1O5DT 2J5LB 3BVXA 4FQ2H 2R0WH 2QSQA 1J5OL 4P23C 4L3CA 4F8NA 3MVSA 3CSGA 2WBJD 2ID5A 3EDKA 5JA8B 1CLVA 2Q0ZX 3HC4H 5BO0D 3MLSH 1JD9A 3B1UA 3FU8A 4HZAA 2X4TA 2VNCA 1ETZA 4OCRL 4CILA 1E3XA 2VE6B 2XRAL 4PRIE 2NQDA 4FYRA 5CWSB 2W0KA 3WXWH 2CGRH 3DRQA 1UACL 4FXKC 2B4CL 1RKRA 5KBPA 5F70A 1A25A 1HHIB 3CFQA 4ZW8A 4HUWA 5AW6B 5B39A 4PW3A 4X4MA 4QXTB 2EIZB 4BGDA 4PJAE 4IKKA 1S9XA 1KLFA 2XZQL 1T66C 4HU8A 3B2UD 5JW4M 4JFFD 5A6MA 3HG3A 2CO6B 4LEEA 4WKZA 5GXBB 4N9GB 1TTBA 1VGKA 4Q6YA 2EXSA 1WCQA 1U95B 2G2RA 1SLWA 2VTFA 1MVYA 3C08L 3O41A 4MA7L 2R1YB 3HBZA 4KKLD 2WVTA 4PV1C 1L7IH 5FCUH 2A74C 5D96C 5IBUG 5DC2A 1JCKA 1P7KA 3L1OH 3ZE0F 2R83A 4Y9CA 2B5IB 2EVHA 1QW8A 4X6DB 5INDB 1GCFA 3AXLA 5DMIH 3QDHA 1EBAA 2YQ2A 3KLLA 3NZ8B 1JZFA 2YPLB 2GBUA 3QEGL 3BO8A 2XFXB 1PD0A 4AM0Q 3W11C 4NNXB 5MEND 3AG1B 4G8GA 4G9FE 3TEYA 2DBLL 3AREB 2V5SA 3I6LE 3QUKA 4TV3A 1G43A 4J6IA 4JVPA 1N4XL 1MCBA 4PJDE 4YGVB 2ARJA 1OF2A 2VRQA 1E6OL 3K2IA 2AK4D 4K7PH 4WW2C 5F3HA 3NSDA 2DJMA 5CCHE 4NO0B 5DUBB 3NCMA 5ETUB 5DO8A 1NLDH 1OP4A 2ZX7A 3LXBA 4O2FB 3TIEA 2ADIA 1IL1B 4TVPD 5JW5A 2DWDA 5DMKB 4BFOA 4U3CA 1YVLA 1M71B 4YHIA 5TF1L 1HOCB 5FUCE 1QHOA 1A1OB 4V2BA 1JDDA 4JPVL 4NQCB 1KTKE 3DTUB 3ZHDA 3I9GH 1TEYA 3Q6FA 3D12B 3TVMD 4DW2H 4P9MH 5DA0B 2MCG1 2ICWB 5IR1A 1R4XA 4MBRA 4F33B 3PUCA 3MBXH 4RBPH 1S5IH 1U3HD 1JHTB 5ANHA 4EN3D 5C0JB 1S7SB 5IHBA 2GIMA 4LKXA 5HHNB 2CDEB 4DP1X 2B20A 2ZPKH 4FQ2L 2DQFA 1NC4D 2R0WL 3WNNA 4PLNC 2NXYD 4CL7A 1TFHA 3MTRA 4KQ3L 1M9SA 1LEIB 4UIKH 1KIUB 1Q9OB 3ROOB 2OSWA 3OQ3B 2R2HB 1HEZB 3HC4L 2X89A 4M8QA 1UUSA 3MLSL 5DFAA 3E2HC 3F7RA 4X7DC 3P4OB 1BJ1H 4OV5A 2NUTA 2D3LA 2FLRT 3QUYA 3EADA 1P84J 1EEZB 2CGRL 4OSUH 3DTXB 3D0VB 4PBXA 1CDYA 1QWUA 4U1IB 5HHOD 4PJIE 3QZNA 3R0MA 1G6RH 3FF8A 4J2QA 2FHBA 4JJOA 1T0NB 4GYBA 5GS0D 5GGQH 5IVXA 1J0KA 3MLVH 3MR9A 1JK9A 3HN5A 2ADGB 3EGXB 3LRHA 4AVKA 3J07A 4YDNA 3L3JA 5CEYA 3K1DA 1S9KC 4KKQA 3W56A 1WE5A 3ATFA 2Y36H 4U1JA 4Z3HA 1OSZB 2NX5D 4CVWA 2Q7NA 4UM8A 3QFJB 3Q13A 1DUYB 1J8HD 3S3JA 2V2WA 3MJ8B 1L7IL 5FCUL 1D3CA 1VFOA 2PN5A 3LS5H 5DGRA 3TO4D 2OR8A 1U93B 1JPST 2PABA 3L1OL 4OZHA 2EYRA 3JQOB 4NUGH 4Z77B 5DMIL 1HXMA 5IB5B 1XD0A 1LDPH 5K93A 1CFQA 1TIUA 2VL4A 4PI2A 4DP6X 2HN7B 5KYXB 2IOOA 4XWOD 4P9HH 5F7HA 4OF0A 4UT9A 1IKNA 2C3VB 5IBLC 1BFSA 2Y69B 4ZUWA 2CU9A 3EFOB 4XNMB 1V27A 4ANVA 1NMCB 3QR2A 2OYMA 3AY2A 1A9VA 3VX0A 3MRRB 2Z65C 4ISVA 4K7PL 5C0ND 3S35H 3D0LA 3F3HA 3IN0A 2NTFA 2VZUA 2VZSA 1T5WB 5CS7A 3WJJA 3QNXA 3DUSA 1MAJA 5CGTA 1NLDL 3NIGB 3EYVB 3TLRA 4GIOA 2VR7A 2YC1A 2UY7B 3QEUA 1OY3B 1U8JA 2WXHA 1BJMA 1NCUA 2YD3A 3WJMA 1LHZA 1FZJA 5DD3H 2YZ8A 4M1GH 5B38B 2H6UA 2YSSB 3PAYA 4YJZL 1U2YA 5F0MB 1I8KA 3ARBC 3I6SA 2HKHH 1BVZA 1TZGH 2YAMA 4TTDC 2A6DA 3I9GL 2IAND 1CG9B 4QWWD 1AG0A 4DW2L 3QIWD 4P9ML 4BWTA 2X1PA 4K55A 4I1RA 4LVOB 3MBXL 1DP0A 2F54D 1HH6B 3KHOA 1F42A 1K5NB 1S5IL 4NQXA 1CIUA 1HI6A 2CDFA 2ATKA 3GSXA 4HKZA 4QJ3B 4UTBH 5B39G 2ZPKL 5IT2H 5EEWA 5CP7B 1KBPA 4MCMA 2WXIA 3VFPA 3UZQB 2CXGA 2LFGA 3BIBX 3AB0C 3WLWC 3BN3B 4EDXA 3K3QA 3FQ4A 1NAKH 1BLNB 2HG5A 5GRVL 1T0PB 2WZ0A 4OSUL 3CLWA 5IHWA 4ENZA 4L8SB 1U8IB 2R15A 3CPUA 4NFBA 2C4FT 1G6RL 2NW3B 4Y2OB 4BFJA 1UWEH 3ARGC 5ADPH 2FNBA 3AJ7A 2VW4A 1LXMA 4RFNB 4CJ1A 4J3OC 5GGQL 5BRQA 3MLVL 5E9AA 3GSQB 2TSAA 2VQ4A 2BMKB 1OWRM 2QPUA 2CK0H 4JK0D 1IARB 3VE0A 1N59B 4BK5C 2AV7B 2Y36L 4X8JB 2VR4A 4LHUG 2E8ZA 3KJ4C 4HBCH 4JY5H 2VW6A 2EC8A 3AROA 3NRFA 1R1CA 3BZ5A 3FFCE 3LS5L 1FYHB 5G4OA 2X3BA 2FECL 3F84A 3ZE0B 3TX4A 2D3JA 1C5DB 3DVFA 2ZQKA 4NUGL 1Q0XH 1YAIA 1JUFB 2MNUA 3R19A 3W9DB 4OGZA 1LDPL 4F7TA 1Y1UA 4Y4KD 3ARFC 4GG6F 4DVRH 4FA8A 1DVTA 4P9HL 2JWYA 3EYQC 5BV7C 1MUJA 1SBBA 3LB6C 5EU4A 4WF7A 5T3XD 3BX7C 5EO0B 5BXFB 1ET8A 2HKFH 5CD5C 2NMSA 3CXFA 1U21A 3E0GA 4HUMB 2EE2A 2KHAA 5G4MA 1ZXKA 5EU7C 5E7FA 4LP4A 2C9AA 3A3YB 1N3NB 1MG2C 5CJXA 4R5TA 5D7IE 1B0GB 1A6PA 2G5RA 5DD3L 4M1GL 1AANA 1G1OA 5FYLD 2VKWA 1G7LB 4LLUB 1YUHA 1SM3H 2D4DA 1IAIH 3BQUB 2HKHL 4GW5A 5IW6A 2NYKA 1TZGL 2E4TA 4FNLL 2R1YA 4J39A 1QSFA 3I6KB 4I88A 4BEIA 3RHWF 3PABB 3QJQB 4EUPH 3BIKB 1I9IH 4UU9B 2A9BA 1N8ZB 3CN0A 4X6DA 3HG5A 3DI2B 3DUUB 4HIEA 5INDA 4WW1A 3I3BA 2CHDA 4Z7VA 2GYSA 2YPLA 5I6LA 2EJ1A 1FNLA 4UTBL 2XFXA 1S9YB 5IT2L 2EEXA 4NNXA 5INCB 2G3ZA 4W9CC 1J88A 4GUPA 4XN4A 4UBDD 3HI1B 5AW9B 3AREA 4M61B 4O00A 4I13B 3VWJB 1I85A 2ZSWA 4A68A 4RZCB 5HDWA 4TNVK 2VLME 1PLGH 1ZLWK 1BZ7B 3QFGA 5ANMB 1NAKL 4S10A 5DJXB 3IMBA 4XWGH 5DUBA 1TQVA 1A7QH 1SXCA 2FGWH 3D39B 4JFQB 3LKQB 4O2FA 1R75A 3DX0A 1BYPA 2C3XA 5DMKA 4QRPE 2PR9A 1UWEL 2FBOJ 3FK3A 5ADPL 4HCFA 3N50A 1DQKA 1NGYB 1HOCA 4FFYA 1G5GA 4RAUB 4RMVA 1A1OA 2D7PA 1TZAA 1NZRA 4NQCA 2JI3A 3OD3A 4CDHA 2MPVA 3CDZB 2QGBA 3Q3GB 3U9PL 2CK0L 1YY9C 1KXHA 3ALWA 1HSAA 1YDPB 4HBCL 3R4DA 4JY5L 5IEHA 3W9EA 4F33A 3BD3A 5IIEB 4FTVB 3LDBB 1JHTA 2K8MA 4KXDA 3HMWH 3ZQWA 3DETD 5HHNA 1VHPA 3IK2A 4R97C 3PWNA 3VFNA 1Q0XL 3PAZA 4HCIA 5LNDA 2XTJC 3UYPB 4OCYH 1LEIA 4M1DH 1KIUA 3ROOA 4QRRE 3QXDA 4EBQH 2R2HA 2V5TA 4DVRL 2XLLA 1UH2A 2XXMB 2OL3H 2YLHA 3P4OA 2BJMH 2N4IA 1QRND 4AJWA 2YHGA 1IVTA 3NIDE 4J2XA 1NPJA 3WTSA 5KVDH 3D0VA 4NKDB 3UZEC 2CUAA 4KOCA 4GAAA 4U1IA 5J57B 2HKFL 4DSYA 2F15A 4TLSA 1CD9B 1T0NA 2XY1A 4MQSB 3K1KC 1HILB 4U49A 3MYJB 5FA4B 2H4EA 3OV6A 4JN1H 1XSIA 3TC9A 3ULVC 5DYOB 5B7EA 3PUUA 2N7AA 4LXFA 4QLRA 3ZU8A 4EOWL 2VDOB 4NUPA 1SM3L 4YDLC 1DANT 1HC1A 1IAIL 4KNUA 1OSZA 5T3ZE 1VF5C 3S37H 3QFJA 1DUYA 2DEWX 3QXTA 3IMVA 2DPKA 4XX1E 3MJ8A 5C0GA 1EO5A 5ITFB 1OB0A 1S7WB 2ENPA 3W57A 4OTXH 3O3AB 2CR6A 4Z77A 3NJJA 1YY8A 2YMOA 5IB5A 2WZPA 1B6UA 5F0JB 4MS8C 2R0ZH 4K07A 4KVPA 1HWWA 2HN7A 5T5FH 5KYXA 3H85A 3L9BA 2C3VA 4MNQE 2XQYG 3MREA 4XNMA 4N2DA 4LGPB 4J3BA 4X9FA 4BK8A 1UXWB 3MRRA 1OLLA 1CD1B 5AG9A 3PWLB 1E5AA 5GIRA 1DBMH 1T5WA 4XWGL 4FNUA 5LBVA 3ZHKA 1A7QL 2FGWL 5J11C 3EYVA 4EI0A 4BELD 4A2GA 2UY7A 2XVGA 3KS0H 5CKAA 4OUUA 4JGUA 2KLSA 5IMOB 1T5KA 5B38A 2GBTA 5K9KA 2YSSA 2AQ2A 4D0BB 4GBXB 3VGHA 3EJJX 4KJPC 1SHSA 3TN0A 1KIRB 3CN1A 4MCNA 3VXSE 2Z4QB 1PJ9A 4HV8A 1WT5A 1AO7B 1CG9A 1MCSA 4ENED 1K4DB 4NBXB 3QXWA 4OLWH 3VD2A 1ACZA 1I7RB 2W9LA 4HSAC 1HH6A 2V9QA 4LPYA 1K5NA 2F9BT 3HMWL 4QPEA 5D8JH 2AXFB 4I0PC 5I23A 1F45A 3FO9B 2XACC 4HHAB 4ZUVB 2EC9T 3BPLC 5C7XH 4OCYL 1NUGA 4M1DL 2ZXEB 3UZQA 5DUPL 3K6SA 1GYAA 1HK6A 2HAZA 2X7LB 2W07B 3TJHC 2OL3L 1I7ZB 1XAUA 2BJML 1BG9A 3CX2A 2A4CA 3JWDC 3VTMA 5KVDL 1U8IA 4M93B 4JHZA 1RULH 4NFCA 5FB8A 4A6YB 2LLGA 5KUMA 2Q2LA 4JN1L 3SE3C 3HRZC 5I6MA 3VG9B 3M1BB 3PLYA 4OLXH 7TAAA 1JD7A 4HK0B 5GRUH 4G6MH 4YK4B 2XV6B 4IK7A 4EF3A 5I16B 5H4ZA 3ME0B 4CBPA 1D5MB 1N59A 4N8PA 2AV7A 4X8JA 4J4PD 2WNWA 3EJRA 3S37L 5MEOB 3W0WE 3N1FC 1A22B 5I74B 5ID1A 3EJYC 4BQBA 4X4YA 1L9TA 2IAMC 2HX9A 1C5DA 4P4KD 4R7VA 3RVVC 3ZOAA 4D9QD 3FJTA 1FA4A 3BXNB 1JUFA 3W9DA 1JZ4A 3TEZA 2R0ZL 4O58H 4YXHH 2V5MA 3IDYC 3JWOL 2HT4C 2Q8AH 5T5FL 3AG2B 1N6UA 3VB8A 5F9DC 5LHDA 2X4OB 4KI1A 35C8H 1LO5B 4PRDB 2F5BL 1MI5E 1WZAA 2P46B 1AJ7H 3OKOB 4L1SA 4KI5F 5CMAB 2OZ4H 2B4CC 1QRNB 1O0VA 1P7BA 1VLXA 2FUTA 2NY2B 4MGXA 2X4RB 1PPIA 3QR1A 4IOIB 4S1DC 2VERN 4UYPA 3MRCB 3TONA 3U2JA 3H9SA 4WENB 4KY2A 3A22A 1JWMA 1N3NA 4FJZA 1TZHB 5CBEA 3NUKA 1B0GA 1N2RB 3DVNB 3W39A 1UZGA 2ILLA 1G7LA 3S5LG 5ICUA 4LLUA 2XPZA 3KPOA 2A4EA 1K9TA 3GSNH 4ACPA 3BQUA 2EXWD 1JRHH 3T0ED 3FCUB 3F83A 3I6KA 3LH2H 2EADA 3PABA 4HULB 3VXMB 1OW0A 4XMTA 3L6FA 4OLWL 3BIKA 1N8ZA 5D2NB 2VN4A 3DUUA 3L9RB 4GS7B 2VC2H 3HS9A 5LBSH 5ACLA 5HD8C 4ZMOA 4BA8A 5D8JL 4LAJH 5IHUH 2OXGB 1S9YA 2PP9A 4C4BA 1SEQH 5INCA 2GHZA 3HC0B 3HI1A 5C7XL 2OMVB 1A21A 2JMRA 4M61A 1NGWB 1DVUA 3RGVB 3RQ3A 4OF6A 3MRNB 4RZCA 4A2DA 2J6EH 5LAXB 1CFBA 1BF8A 5AW1B 1GH7A 1BZEA 5ANMA 2PYED 1X5YA 4Q52A 5A43C 3B7TA 5H37G 4Y5XA 4DN3H 2DQTH 3LKQA 3WNOA 4MJID 4HX1B 3B5GA 1RULL 1YRKA 4LSRH 5D5ME 1JVOA 1NGYA 1UOKA 2JKXA 4JO1H 4RAUA 5BS0D 1XH2A 5DEGB 2QV4A 2VLKE 4OLXL 4GRMB 5GRUL 2CPUA 2EDHA 3BOVA 4G6ML 2ADFL 3CDZA 3HE7B 4YOKA 3QW9A 3Q3GA 2Z7ZA 3WDJA 4QUOA 2W9EH 2MQGA 1N12A 4PVBA 5K9OA 5IIEA 1WRFA 1CDUA 5HPMB 4OI9A 5AVTB 4FTVA 1W0WB 4WWKA 3PG2A 3WKPA 4CC4C 1Q9KB 4H13C 2BM3A 2X4UB 1DJYA 1D5XA 4I9WE 4YUEH 4A67A 4TNGA 1C12A 2XKNA 3CH1A 1LWHA 5TFSL 3UYPA 1JXKA 1UH4A 5IQMA 4O58L 4YXHL 3WCYA 4M62H 4GNKB 3WS6A 4IYKA 2Q8AL 4C4KO 5HI5D 2DH2A 2XVLA 3II3A 1DE4A 5JNYB 5E0FA 4Z1PA 8PAZA 3X13A 5B7FA 1L9QA 1T04B 3OMAB 4RA0C 4X5XA 5DUMH 4C56E 2ENYA 3DUHA 4G7QB 1AJ7L 4B95C 2ICWI 1T2XA 2JF1A 3D9AH 1E9OB 2OZ4L 4NKDA 1FLRH 2YPKA 3VYPA 4W9JC 4TUOB 1WH0A 5KEZA 5F9OH 2F8IA 1MRCH 1SYSB 1HILA 5E99H 3DJZA 1JGDB 3MYJA 5FK9B 4Z5RB 4R7NA 4APXA 5DYOA 3ZTJG 4YSAA 2XWXA 3D3VA 3ESUF 3K2UH 1QBAA 5D7LD 4KO5A 1PZUB 3GSNL 1WD8A 3B6SA 1JRHL 4PR5A 3WIHA 1FZOB 4AQ8A 2JTYA 3LH2L 1VPOH 2L7EA 3ASNB 1DEEB 5GGUB 4D9RE 1FDLH 5D4QA 4F7KA 5ITFA 1ZCRA 2JJVA 4OJDH 4ZAKC 1IBYA 3G6JF 4N1CA 1S78C 3O3AA 4N90E 1IBZA 2EAEA 1I1AC 2VC2L 5LBSL 4BBWA 1KN4H 4GKOA 4NKOB 3RWHB 3FCGA 2QL1A 2RTTA 4N2FA 4AQZA 5IHUL 4R0LC 2O5NA 4PHXA 4P4KB 3WAJA 3BH9B 1SEQL 4PQXA 5AL0A 4NRZB 4FD0A 1BGXH 2JCCE 4BSVB 4LBAA 3MPCA 2PW2B 5E9NA 4P57B 1HNGA 2GT9A 3N5AA 1UXWA 2J6EL 2E27H 4LCUB 4D8PB 1CD1A 4KDWA 3QIBA 5C08A 1IGMH 3QWRD 4YHNA 1LE5B 3G5YB 3VXTA 3VSQA 1GZHC 3PP4H 1ZIBA 1WFMA 1OGPA 1DVFD 4DN3L 2V3EA 2DQTL 3QRGH 4IEFA 1PD1A 1G1CA 1W9XA 5E2WH 1ULVA 4XOAA 3UAAA 5CAYB 1FFNB 2D31B 1SJHA 4G80A 2DAVA 2WWKO 4LSRL 5E6ID 1P7HL 5IMOA 15C8H 4L5FE 3WFZA 4JO1L 3M1OA 4D0BA 5IM7B 1RHFA 2YWYA 1GGUA 4GBXA 2NDFA 3L4WA 4GRWF 4NC2B 1KIRA 3HAEH 1AO7A 3F04A 4FS0A 5A2IH 3DIFB 4YHMH 4EI5B 1UM5H 1UM6H 2W9EL 5T1KA 3VGBA 1I7RA 3BHBB 2NXZB 4TNVF 3VFWB 4OJCA 5FYKD 1CICC 1S8DB 1Y18B 3PQYD 4RGMB 4IJ3B 4BA0A 4HEPG 3BESR 4HGMA 3VX1A 3FO9A 1NCTA 2AANA 2E6PA 2VDQH 5IW6B 2WPGA 1GJWA 4HHAA 4ZUVA 3ZKQD 3LIUA 3UTTD 3REWB 3CUPB 4K3HA 5KSVB 4JQVA 5AYTA 4M62L 3DHMA 1VEMA 4NHCH 4QHPA 1QD0A 2X7LA 5JW4N 1MEXH 2W07A 1I7ZA 1WA2X 3D8MA 4XPHH 2C7FA 1EJ6A 2NQCA 3RNQA 1FHGA 3P73B 5DJ8A 4HUCA 4LLDB 3VFUB 3D9AL 1V54B 2GG1A 3T0BA 3UPRB 2R2BB 1FLRL 1DBBH 3G08B 3RTQA 4L4VB 1AQDB 1H9DA 1OARH 4M7LT 1QRKA 3AM8A 5J5EA 5F9OL 4ZW6A 1MRCL 4NC1C 5E99L 4MJIB 4Z7QF 3PDOB 5SX5H 1M05B 4XXWC 4POYA 2A4ZA 1S7VB 4HK0A 2HJKB 3HKZA 1W8EA 3K2UL 3ME0A 2CH8A 5E5RB 4KTDH 3MV9D 1HDMA 5DD0H 5MEOA 3CVDA 3LNDA 4Y5VC 4HH9B 2FX7H 3DSNA 1VPOL 3CZNA 4KK5D 1FDLL 4LQFH 2WTPA 4FXGA 2DQ6A 4P2OD 3PNWA 3S35X 1UJ3B 3BXNA 3CFEB 1KN4L 4IKJA 3RZCC 1PLBA 2ZYHA 1VADB 5J6HB 4B7IA 5C6WH 4P9HC 1BGXL 2QELA 5EO1B 4AYMC 4C8XA 1RVFH 3FQ2A 3MNMA 4QRUB 4PRDA 2GTQA 3OR7B 1CXEA 3OSVA 1WZLA 3TBTA 1A3QA 1TQBB 2E27L 4HQQH 5GRYA 4JFXB 5A2CA 4MMZB 4FA7B 1IGML 3V8OA 2QKIB 2WTRB 5K39A 3ULUE 1XCQB 3PP4L 3NG5A 4IOIA 1A6VH 3MRCA 3NZHH 4ZQTA 5AAWC 3QRGL 3FH7A 4H2AA 3MZGB 5E2WL 2RH0A 3DBSA 2Y5TB 1TZHA 2D7TH 3IEAA 3DVNA 4KH2A 3C5XA 15C8L 2PPFA 5J13B 2PPDA 4WJG3 3HE6A 2BW4A 3CSTA 1W16A 3KYKH 2QT6A 4FQLH 1AACA 3FU0A 3P11H 1B0WA 1F97A 3VXMA 1T83A 1TJXA 2YD7A 4PBVC 3SODB 1UM5L 1UM6L 2IMNA 3L4VA 3V8CA 4P49A 3UO1H 4NB7A 3C6LC 3V4PB 1BBJB 3L9RA 3QUYD 4DTGH 1IEHA 3S2AA 2OXGA 2VDQL 3EIFA 3OF6D 5D1XC 3ZHLA 1GGTA 3CFUA 5EV7A 3HC0A 4HS6A 2OMVA 1E65A 1EJ8A 2IAAC 5E23A 1NGWA 1HYSC 3BAKA 1SOSA 1RIVH 3KLAA 4PG9B 3BDYH 3MRNA 4NHCL 5LAXA 1MEXL 1OSEA 2Y7NA 4XPHL 2NYYD 4JX0A 1KCWA 1EUTA 4KK8D 1E6JH 4ANUA 1OHQA 4G7VH 8FABA 1GJIA 3UTZB 4UMGA 1DBBL 3FXIC 3DSFH 5FFGA 1OARL 3MBED 1HHJA 2OP4L 4NRXB 5C7ZA 4Q9RH 1A9BB 3GBDA 3L4CA 4QRBA 4A38A 5K69A 4XNXH 3H9HB 3GFUA 3QXVA 5DEGA 5DZVA 1D5RA 3S4SB 5JIDA 4FNRA 1NUDA 4NN6C 5D1QC 3HE7A 4QXUH 2XWRA 4RMTA 2JCWA 3ARDB 5JXEA 4JE4B 4KTDL 3FUEA 4L37B 1R3HA 4K5OA 3SPVB 3SYQA 5DD0L 4Y9BA 1W0WA 2FX7L 4RCAA 3T2LA 3VTAA 4HWEH 1Q9KA 4LQFL 3UC0H 3MRHB 1QLFA 2EDRA 2X4UA 1U2HA 4IRJC 4BHUI 1FI8C 3DKHA 3P9WB 2XBZA 1A6ZB 3G6JB 3PQYB 5CEZE 7PAZA 4JG5A 4X5QA 2LT9A 3Q8BA 3ATBA 2AVGA 1J11A 2VB5A 3KNBB 4K9EH 1GMEA 4HIHA 1R3JB 5JNYA 2CQVA 5KS9B 1RVFL 3IDIB 4XMKH 4KPHH 4KQ0A 2W38A 2J43A 3HB3C 2AKRB 4HQQL 4PSRA 1JXFA 2E9WA 4YSTA 5D6DC 3O3DB 4FG6C 3UAJC 1LGVA 2NSXA 2J8UF 4FFVD 4XP4H 2Y22A 3WS3B 4KITB 4YDJB 1A6VL 3NZHL 4G6AD 1SXAA 5DUJA 5FK9A 1JGDA 4Z5RA 4ZO8A 4NI6A 3ZDXE 1NC2B 3HCVB 5JOEA 4Y4FB 3WY2A 3QDAA 1PW3A 1FH5H 4KTYA 1KGCD 1MSPA 1OGAB 2X9WA 1UADC 2N0KA 3GBLA 1A8JH 3ARSA 3KYKL 3N0AA 5E9DD 4FQLL 4GRWB 4YHZH 4I2XE 1ZVHA 3P11L 1DEEA 4GQPH 1YEEH 3ZY7A 5M7QA 3GEWB 1MW2A 1L3WA 3FOMB 3UO1L 3FAWA 2C34A 4AIXA 4DTGL 1MCDA 1MCIA 2K3HA 2P42B 4NKOA 5B1JA 2GTZA 4GRLC 4QOKB 3N40P 1T7VA 1MNNA 2E7LA 1DR9A 3BH9A 4ZUUB 3TFKC 2R9HC 4NRZA 3V0DA 2YA1A 3O81A 1BG1A 4PJGF 2AF2A 4ODTH 5BNXD 1IFHH 2PW2A 1RIVL 1OP3K 3BDYL 4U1MB 4I9XA 3C5JA 1HE7A 4OU3A 3VXQB 3FUHA 3AABA 1NM9A 4KZDH 5AZUA 1LE5A 5KYYB 4XO4A 3G5YA 1E6JL 4K3JH 1JZIA 3OGOE 4X9BA 4XCEA 4G7VL 5GZOA 4P3CH 3DSFL 1BQHB 4DP0X 1EGJH 1FFNA 2D31A 4UOW1 4N3TA 1AAJA 3CSYB 1T1WA 4Q9RL 2K6WA 2A1WL 4XNXL 3GMRB 3QDJB 2WKLA 3IJHB 4N5ED 2OR9H 5MEPB 3UYOD 5IM7A 3VXRE 2GITB 4U1HB 3FOLB 3JV6B 4QXUL 5B21A 3DIFA 3VO0A 2ENJA 3PWPE 3BHBA 3IMSA 3VFWA 1XVSA 2N3JA 2X4SA 4HUNB 4OLZL 4Y8DC 2B1HH 4EI6B 1S8DA 1Y18A 4HWEL 3S3BB 3SCMC 4MJHA 3GPSA 3UC0L 1AQMA 5F3BB 1N6VA 3GF8A 5AUMB 3BIAX 1BPVA 1WBZA 2LGNA 4JO4H 3REWA 3CUPA 5KSVA 2WY3B 1FSKB 2PLTA 1W6WA 4IIQC 5L0QB 2NY1B 2A5UA 1QZNA 4K9EL 1KIQA 1XEUA 2Z8VC 4PJ7A 4UNVA 2GTWB 3FQWA 5FHBL 3BPNB 4XMKL 5IESH 1FVCB 1NEPA 1NICA 3P73A 4KPHL 2BHFA 1LILA 1TITA 2KI6A 5EU5A 4F5CA 5LDSA 4LLDA 3VFUA 3EH3B 3PFUA 4Y1AE 3A4FA 5TGBB 4L8CA 3UPRA 1I3UA 2R2BA 3G08A 1Z7JA 5LVEA 4L4VA 1AQDA 3S37X 4XP4L 5L8JB 3OWEA 1QSFD 4G70B 5HVHC 4HSQA 4PV9B 3HUJA 4B96A 3POHA 1NCBL 4L8BB 4YPJA 3PDOA 4HLZG 5FW8A 5ACZB 3PL6B 5TH2B 1KBGL 1FH5L 3B4NA 2HJKA 4AI7A 4MXQD 3HRPA 2WLIB 5D71H 4ZX6A 1HL4A 2FEJA 4AMKH 1C8PA 3CFJB 4WW2F 3GINA 3QWNA 2ZWYA 4RSYA 4YHZL 4HH9A 5A6IA 2MOGA 2WXNA 2CO1A 4M6NH 5EBLB 1YEEL 3RWDA 3D4YA 1AD0A 4Y2DC 5HXMA 4AC2A 3T8XB 3UBXB 5E6RB 3UAFA 5L4FA 1A2YA 4L3ED 4GW1B 1MCLA 1UJ3A 2DWSA 1F56A 4MMYB 4NO5A 3B7YA 2VXVH 2BIPA 4P2QE 2O4EA 2PCPB 5C97A 3T2NH 4ZMNA 1JNJA 1XAKA 1OQOA 3L95A 4LFHD 1BAGA 5AW8B 4QRUA 4ODTL 3WTWA 1IFHL 4PP1D 3OR7A 5KW9H 4E5XB 1NEZB 1G7HB 1UB5B 4YDVB 1MQKH 1DJSA 1QASA 2WWMC 4FMKA 4MMZA 3BKMH 4KUZH 4KZDL 2FT8A 1TEFA 3FKUS 1KYDA 2QKIA 3IFNH 3MRFB 4ZQKA 4IRSC 1XCQA 4K3JL 4WTZG 5TK2A 3TNNA 5FV1L 3UOAB 1ZGLP 1GSMA 2Y5TA 4KJQC 1PX4A 1YECH 1E9QB 3UADA 2BNRD 3HG1E 3ROLB 4GSRA 4P5TC 2OR9L 1UZ6F 2X9YA 1BMZA 1OSPH 3K74B 2FVNA 1I3RB 1EFXD 3QIUB 4CW1B 5I24A 3PV6B 2YZ1A 3JTBA 4YSEA 1I8UA 3FNKA 4NT6B 1XCXA 2Y72A 2DJ4A 3CVBA 5C07D 1YEIH 4OQ1A 4EO5A 2P24B 4KGLA 3V4PA 2B1HL 1KENH 2G3MA 2Z31B 4N2HA 3HBQA 1CXKA 1UM4H 1EO7A 4MQTB 1RK0B 4PJHF 4AYGA 2X1XR 2N7SA 2WINB 4A39A 4BZ1H 4GLRI 1KACB 5DO2D 4JO4L 2UWEF 3ILQD 4MA1C 2F7IA 3ABGA 4R90H 2UY6B 3EHBB 1DQVA 1ZT4B 3ILEA 4NAMA 4PJEF 3Q06A 4N22A 3TBWB 2AAAA 1ASOA 3DOHA 3QQ4B 3BPOB 2IPTH 1MWAA 4CKQA 5IESL 4MB5A 1QEWB 2ADYA 1FFOB 1OB1A 3TH2T 3B9KD 3UTZA 1SJEB 3DWTA 3VH8A 2VMFA 1TETH 4R4ND 1EPFA 4JQXC 4KKPA 2J8UB 4NRXA 5I6PA 2EDJA 4OAWB 1SXBA 1VEPA 3H9HA 4HK3J 1QSVA 5I18H 2FAUA 1OTSC 4YLQT 5CJQL 2XVKA 2WZPD 3DGCR 3X1BA 2UVEA 2AEWA 5D71L 4TNWF 4AMKL 3WTYA 3ARDA 4FFZA 5KVGH 3GKWH 3PGDB 3S8FB 4L37A 2NY4C 4JM2D 3SPVA 3V52H 4GIAA 1BQKA 1SGKA 2HX7A 3C5ZB 2ATAA 1UG9A 4KHXL 4XE0A 4M6NL 2DTSA 5H2BB 1BHGA 5L6YH 3MRHA 4PRAA 4WEBH 1MRFH 5IWLC 5MEQA 5G5DB 2ROXA 3IM1A 1A6ZA 1RJCA 3G6JA 4FEMA 5E4EB 2BVTA 4F8LA 1GGYA 2VXVL 1HTYA 2Z7WA 3F12B 2VZTA 5T1JA 1CI3M 5KS9A 1R5IB 2NY6B 3IDIA 1CGXA 4JFFE 4AE0A 4PJGB 5KW9L 3GSUA 2AKRA 3ARXA 1MQKL 4UQ9A 3O9WC 3AXHA 3QDGE 1TYRA 3NDZE 3BKML 4KUZL 2J57A 1WUNT 3IFNL 2W8CA 4N0CC 3U1QA 3WS3A 3E38A 1LD9B 1UKTA 4YDJA 4A7TA 4GSXA 3C60B 4K5PA 1U36A 3VMPA 3SBRA 4A2LA 1F1GA 3FHQA 1NC2A 3WKQA 1Q1PA 4A37A 1YECL 2EUWA 2V17L 3T3PF 5MENE 4KWUA 3MV01 4RDBA 2FL5A 3IBEA 3O4LB 3GDBA 2XV3A 4TPRH 3SDDD 1O6VA 4LPTA 2ED9A 4X6CE 1SN5A 5TDNB 3V10A 4PFEA 4WTWA 3SGKC 4ADGA 3BGAA 3QBTB 1YEIL 4WWOA 2AK4E 3FQRB 5B3SB 5AVWB 2E76C 1A1MB 1KENL 1ZJAA 4FQJH 4FXLA 4OI7A 4GKSB 3TPKA 3O3EB 3WFEH 4J3OF 1UM4L 4QOKA 4W9ZA 2BZDA 3GJFK 3FUJA 1IGYB 4BZ1L 1KY6A 3L4ZA 4OW6A 4PCTA 2V2TA 2E5EA 3N42F 1VJSA 5T5NF 1YEJH 4R90L 3UABA 3CTTA 4F9PC 4U1MA 2H6OA 2Z7YA 2GJRA 3CDGB 3VXQA 2OTWB 2IPTL 5C2UB 2I85A 1CWVA 3MGOB 1QKZH 2A74B 5D96B 4XHJD 1T2JA 4YXKH 1BQHA 1TETL 4LSTH 3RUGF 4KROD 4U0QB 5H37H 1FLTX 3CSYA 5I0WA 3U30C 3GMRA 3QUHA 3ZUNC 5MEPA 3NJFA 5I18L 1FNSH 1AGDA 2DM2A 2GITA 4U1HA 1XSKA 3FOLA 4OGQC 3JV6A 2F53A 5JHAA 2CLRA 5AZ2H 2ED7A 1FYTB 1UA7A 5EZIH 5BUAA 4HT1H 3GKWL 4ZNEE 3FQTB 1IAOB 3JBG7 2D0HA 4WW2B 3V52L 3NP4A 4YHPB 4EI6A 4ZUSA 5C07B 4U7MA 1RZQA 1CE6B 4EPSA 5F3BA 4DWHA 2V7HB 4WEBL 5AUMA 3VRJA 5HHOE 1MRFL 1T7ZA 4OR1A 4QMEA 4QKTA 2APSA 1INDH 3RWEB 4GG8B 1N18A 3CU7A 5DD1H 4UQCA 3AQZA 3GMOB 3QYCA 5KOMC 4WGWB 3H4FA 3MO1B 4FNPA 2GTWA 4FFYL 1K72A 4WV1C 2Q6WB 3CZFA 1FVCA 2ZCLH 3TBBA 2C4XA 4N6RA 4ZO7A 3RX5A 1ZJBA 3CMGA 4NDMB 1VFMA 2H3NB 1IIIA 4QXVA 2CGZA 3OJDB 1BVOA 1KIPB 4DK5A 1PU0A 2DIBA 1COBA 2WQRA 4XT1C 1NLBH 4PV9A 3THMH 3SDAB 1A7PH 1CF1A 4AITA 4L8BA 2DJSA 3K8MA 4Y4HB 5F89B 3PL6A 4U6VL 5ACZA 2DS4A 4ZPVB 5TH2A 3D6GA 1HCFX 1AS7A 3VRLF 2DYSB 4L18A 1U58B 2WLIA 2XG4B 4P05A 4J1UB 3ZTJH 5JOPE 3CFJA 4AXWB 1DDTA 4GKNB 1RSFA 4TPRL 1EJOH 3MV7B 4G5ZH 4RBPK 2E7DA 3V55A 3UH8A 1H6EA 5EBLA 5TTRA 5CD3B 3D2UD 5F96H 1EBPA 4O51A 2YD1A 1ZV9A 4KKNA 3RX7A 3UFIA 4AIZB 4GW1A 3LZFH 1OT1A 1GSKA 4FQJL 4MMYA 5T1DH 2UZPA 3WFEL 1XF5B 4PJHB 5F88B 2PCPA 3UYRH 2MQCA 3S4SG 4KRLB 2XWDA 1LNUB 4KJWD 5LCVA 3OHXA 1SN2A 1YEJL 2UWEB 4R2GC 2MNWA 2WSKA 4TVPH 2W9DH 1LO0H 4ZX3A 3T6QC 2ZG3A 1NEZA 1G7HA 3F7QA 3O8XD 4PJEB 4AQ1C 3TTYA 1URIA 3FSVA 1MCJA 2ZJSH 2BIIA 4KKBD 3MRFA 2RR3A 4ACTA 5F7BA 1QKZL 4NKMB 3CIQA 3WHE1 1XF1A 5EU3B 4YXKL 2PNDA 5HHMB 4LSTL 5E2JA 4WWKD 1YPZF 4NQEE 1E9QA 2CIIB 1TTFA 2H2SD 4ZMTA 3ROLA 3RL1B 5GRJH 3OJMB 2A9CA 4JFOB 1FNSL 1MLBB 2EDKA 3QIUA 2VDRB 2W0FB 4RMRA 5I1KH 2WD0A 3BUPA 5AZ2L 4P59H 5CBAB 4HUXB 5EZIL 1IM3B 4HT1L 1XF3B 1NEUA 2JJSC 2P24A 1ZS2A 2W5PA 1R3LA 2DQGH 1OCRB 2M2DA 2IH8A 2WQUA 4XO5A 4ZMVA 1V5JA 2PF6A 2Z31A 4JFED 1RK0A 4OUOA 2WINA 3CHRA 1WICA 1INDL 4JRWA 1ACCA 4KY1L 1J05B 3QVAA 5EU6B 2UY6A 1NBZB 1ZT4A 2H45A 5BRZB 1FN4B 3TBWA 3ARBB 1CLCA 3I74A 2YFOA 5TDOB 1QEWA 1ZTXH 2ZCLL 4G59C 3D3VD 3RWGB 3OKDA 2W88A 1RZ7H 1SJEA 2JK5B 1CT8B 3QUZC 2J8UA 2X4NB 4J3WA 1NLBL 3KPLB 3THML 4OAWA 2J1ZA 1A7PL 1NGZB 3OKKB 5M95B 1AH1A 2EEFA 1AKJD 3GUFA 1ADQH 3VFSB 2H32A 2HFGH 1R3KB 1U30A 5I8KH 1DN0B 1WZ1H 3KPRD 2Q7YB 1LK2A 3LZLA 4K7PY 3D48R 3UZVA 1X4ZA 2F1EA 1X4XA 1H6UA 3BFWA 3A4DA 4Z7WF 4QXGH 1XDTT 3PGDA 1EJOL 4G5ZL 4RGNE 4BDVA 3SDXE 1IC0A 2X10A 3C5ZA 3E8UH 2J1KA 3A47A 5H2BA 2XQ0A 2V2XB 5C3IA 2Y25A 3DX7A 2PXYC 4YZFF 2X44D 4IU3A 5F96L 1CGTA 3QIBD 5G5DA 5SWSD 4PS8A 4TL4A 5C08D 1A6TB 4ZMYA 5ECGA 3MJ6A 3LZFL 1FZMB 2YOCA 5T1DL 2Y4SA 5IB3B 3ARGB 2F19H 2EO1A 5DEFB 5J0BA 4RIRB 3CAFA 3F12A 2A77H 3UYRL 1D9KB 3VW3H 3L4UA 1R5IA 3IDJB 3N42B 3AG4B 5FYLE 4TVPL 3EJUA 4PJGA 2W9DL 1LO0L 2UZXB 4BQCA 1CU4H 1UZ8B 2V37A 4JM0A 1HAUA 3DXAB 4M3HA 5GS2H 3KJ4B 2ZJSL 1NDTA 1YN7B 3SOBH 4Q2ZB 1LD9A 3ZKSD 2X0VA 1B4LA 3C60A 4QHKJ 4ABQA 5T1KD 1EUUA 5CEXA 2EO9A 4PLOB 1IC4H 2QADD 3RUGB 1YUKB 1ROCA 1VGEL 3MRBB 1UB6B 2EILB 5GRJL 1KCRH 2R69A 3ARFB 4ZFOL 3O4LA 1ZIAA 1NKOA 5KSBE 4ZZFA 5BV7B 5I1KL 2HTKC 2LU5A 4WWID 1XWVA 5JORA 3UTQB 4P59L 1HH9B 3PJNA 4B7LA 1Z9PA 2BC4B 3OL2A 3TESA 4FXKA 3NJHA 1UA3A 3FQRA 1E4XI 1HNFA 4UB0H 6CGTA 1RJLA 5EF3A 1A1NB 1WF5A 2DQGL 1JWSB 2DOCA 3N9GH 1A1MA 3CSPA 4NPJA 3WL9A 4QTFA 4XPTH 4GKSA 3RIAK 2QV2A 2EEDA 4RDQF 1XGPA 5GGSY 3WUWB 3RTQD 4YDZA 3Q8CA 5D7KE 2RA1A 4U31A 4L0PB 4H8WH 1H3TA 1XHHA 2XN0A 3CDGA 2CA4A 4H8QA 4ZXBD 5DS8B 3SJVD 1EWHA 2VDOH 1W2KT 1ZTXL 2GBVA 1OZTG 3MN8A 3QCTH 3MGOA 5DVPA 2A74A 3LY6A 3ZJAA 3ZKND 5C2BH 1RZ7L 4WTQA 3UBXG 2HLFD 5DRWB 2AGJH 4ZODA 2BY3A 4YH6A 2EE6A 2X53A 3RL2A 1ADQL 4YMPA 2HFGL 3WV0A 2BP8A 1WZ1L 4N28A 5I8KL 5ACMA 5C0DB 4WFED 2BNQB 5D9SB 2WO4A 3B7SA 4E5XG 1LO2H 1FYTA 1YHPA 4QXGL 5FM4A 5IROC 4AW4A 3FQTA 1IAOA 3BZ4A 4WW2A 4YHPA 3E8UL 4S2SB 4EIBA 1ZVSB 1NGQH 1F5WA 3RDTD 3HHSB 2V7HA 1QFWM 3NA4A 4PG2C 4PJ9B 2ZF9A 3RWEA 4GG8A 4OGAC 5T3XH 1J48A 2XTSA 2QGEA 4PCYA 3G7TA 4HOMA 2A77L 1PIGA 3DMMC 3PHOA 2CK2A 4K9EC 3MO1A 1DLFH 3VW3L 3JT2A 1A5FH 4UT6A 5JIQA 1IE5A 2Q6WA 1UWFA 4OKDA 4UOQA 1RZGB 4CKVX 1CU4L 3BLPX 3R06B 3BLBA 3CGTA 2H3NA 3HE6D 2VDMB 4AK2A 1KOAA 2F7RA 3OJDA 4M3JA 1E7UA 1TDQA 5F9WB 2OI9C 2DTMH 3FULA 3OXRA 3ZL1A 3SOBL 3FAXA 2VR5A 3QEQD 1WFJA 3SDAA 4DEPC 3S3CB 3SKOB 4R97B 2BOLA 5A2LH 2RD0A 1IC4L 4ZPVA 2GW5A 3O6FC 2P5EB 3RX8A 1YPZB 4YSCA 3TASA 1U58A 2XG4A 1KCRL 2ZOKB 3BEVB 3MROB 4J1UA 4AUJA 4AXWA 4JJHA 4GKNA 1F4WH 3MV7A 4XNQB 1KWGA 2BS9A 1AZUA 3OX8B 1MFCH 5CSBA 5K59F 1LVEA 2NZ9C 5CIPA 1L7TH 3WLBB 4UB0L 1TYJA 3UXFA 3N9GL 2V8LA 5D1ZD 2X28A 3E1F1 4AIZA 5B8CC 5L2KB 4WK0B 4FQXB 4XPTL 4YFLF 4ONOA 4HAFA 1XF5A 4EXKA 4PJHA 4MQXD 2IH3B 5F88A 1OEZW 4Y89A 3N44F 4A6YH 4Z7UF 4QHNB 1AYRA 3GBML 5G55A 2UWEA 5DJ6B 2XX0A 1KLGB 4H8WL 5DDHA 1F41A 5ICZB 1HZLA 4JHWH 1QSEB 4NZRH 4OZFA 4PJEA 5DJZB 4KZ0A 2HT3D 2VDOL 3EYSH 1EX0A 1JOIA 3O11B 3QCTL 1U91B 3EBIA 4WFFD 4NKMA 4APQB 5KJRH 3UBXI 5C2BL 2A0LD 3QJHB 3NCXA 3X1NA 2CJSA 3FU7A 1NDMB 3VGGA 1XR8B 1EDYA 2AGJL 3MBWA 4HWZB 1NIAA 2CIIA 4XP6H 3RL1A 2F61A 3OTTA 4GB9A 1EXGA 1FC1A 5ENWA 2QADB 4OCSH 3FTWA 5C1MB 5DYFA 3ZRCC 1ZDQA 2WAHA 5AOJA 1LO2L 4HUXA 5ILTH 2L3BA 2ZICA 1XF3A 2LU4A 3M88A 4NZUH 1PZSA 1RERA 3VXOB 2FSEA 3NP3A 1KV7A 1ZGLA 1NGQL 2GHWB 1TTRA 3DIVA 3EAKA 4X8GA 1H0DA 3OPUA 2EIJB 1SRDA 2BVEA 5T3XL 5GJTH 3SO3C 1J05A 3H42L 5EU6A 2JFCA 5E7BA 3T1WA 5BRZA 1FN4A 4GLRH 1DLFL 3ARBA 3KEHA 1A5FL 2DMGA 4KTEH 5TDOA 1ETA1 3RWGA 2FJHA 2NSQA 1Q9LB 5TD4A 2JK5A 5T1LB 2DTML 5B3JF 3IBOA 4A7UA 4HWUA 1SXSA 4OCNC 2X4NA 4H25A 4FC3E 4F7EB 4GKLA 3CZEA 2X4PB 3P30H 3OKKA 2VMEA 4I0PB 1CF8H 3EZJB 4CBZA 3VFSA 4FHJA 1DN0A 4DAGH 1OTTC 1J5DA 2E9GA 5EZPA 4G71B 3EOTH 4HLZH 4LNVA 4ZOAA 4J27A 3PWVB 5EUKB 4LFHG 1F4WL 1U8QA 1HCYA 5EC2B 4NM8H 3E3QC 1MFVA 1MFCL 2IFFH 3F7LA 4UAOC 4PD4K 1JTOA 2V2XA 4CGUB 1BZ8A 2AHIA 2QVTA 1L7TL 3ZHNA 4CN6A 4AZ8A 3IFPB 3O2DH 4XPBH 4OZIE 1DVQA 1FZMA 5F6IC 5IB3A 3ARGA 3IRZA 3MODH 4G8EA 4YAQB 5DEFA 1FNHA 4RIRA 4TVUA 4B60A 1QW9A 5I1HH 2K9UA 1D9KA 4A6YL 4C59B 3I85A 3IDJA 2ZSVB 1JXDA 3H3KA 4R4BB 4A63A 3UTSE 1AZZC 1PG7H 1DBKL 3GSOB 1UZ8A 3K2MC 3KR3H 4JHWL 4NZRL 1PLCA 3WENA 1ZSHA 2WHVA 3DXAA 4WDIA 2QR0B 2YXVA 5IW1B 5MI0B 4YX2H 3V79C 3EYSL 1YN7A 1E8XA 1CTMA 1MJUH 2H26B 3WFBH 1NGPH 4Q2ZA 5LKNA 1YJDH 5KJRL 2CHWA 3QUXC 1ZANH 1DQIA 2Y7SA 3P3TA 2DICA 5JW3H 2E7MA 4ZD3H 2C9RA 4WU7B 1F3DH 3RUGA 3T9WA 3V95A 1QR1B 4GPVA 4LCWD 4DVBB 4XP6L 3MRBA 4EE2A 3ARFA 2IFGA 1KY7A 4LE8A 4OCSL 3TCLB 5HGDB 2QMJA 4F91B 3PXLA 2VIRA 1HH9A 5ILTL 2BC4A 3S3SA 1F6LL 4UZUA 1UT1A 3RB7A 4NZUL 5E4IA 4E0RA 1A1NA 5T8IA 3BYYA 1HQRB 3GHBH 3FPYA 1AIZA 3MA9H 1BWMA 5CSGA 1FVEA 3WUWA 4PW4A 4LLQB 1A65A 3W3BA 2VSKB 4ABWA 5GJTL 3A4EA 4LPXA 3Q9PA 4PJAF 4YHYB 2NNXA 2XYBA 3MRGA 2NY3C 1JYXA 5GRWA 1B2YA 5J9PB 1I7TA 2DMKA 4LCCC 5GSRB 3EOBB 4NGHH 2GJZB 1VFBB 2L7UA 4TOYH 4HJ1A 4UTAH 3EO1B 5AVQB 3GXUB 5JUEH 4Q6KA 5DRWA 1QSZA 4Y19D 5BZXA 3BWSA 3WY1A 4Z95H 5E2UH 3P30L 1LDSA 3HR5B 2LFEA 3DV6A 2RQ8A 5C0BE 1RU9H 5E1AA 3VU2A 1GKOA 4DAGL 2X42A 5LWYH 3S2CA 5C0DA 3IMWA 1AQHA 2BNQA 2H9GB 1J0HA 3EOTL 3ECQA 4BKSC 1MXGA 2VL5B 2F8XC 3FUIA 2G4GA 4W9HC 4YXLL 1K4CB 2FH6A 3AREC 2IALB 1QA9B 4NM8L 3ESOA 1I85C 4PRID 4S2SA 2IFFL 1ZVSA 4PJDF 4YDIH 3WHXB 3X17A 1GA2A 3HHSA 3A6OA 3RZWA 1G4RA 3K81A 3O2DL 5SV3A 3FO2B 3KL5A 1Q0YH 2R23A 4XPBL 4FG2A 4FZEH 1WAPA 4YR6B 3OWRA 4PTTB 1WS8A 3MODL 2QQLH 2H0EA 1KXQA 3IDUA 5ES4B 5I1HL 1ZLEA 3A24A 2CRZA 4WEMB 4CAGA 2FK9A 3N44B 4Z7UB 3QZBA 2GEQA 4KO6A 1RZGA 2FEEL 3UGUA 4P04A 2XJKA 2DV6A 4LLYB 2KPNA 1PG7L 4R3SB 3R06A 2Z8RA 3QQXA 2I07B 4X5PA 1J5CA 1D7DA 2I24N 1MJUL 3WFBL 1NGPL 4MAZA 1YJDL 2NRDA 2WW8A 3SKOA 5GGTA 1ZANL 3CK0H 5CFHA 1ZLDA 1X5ZA 2R0LH 2R2CA 2YJLA 4ORGB 2JLPA 2Y1YA 3B5HA 5JW3L 4ZD3L 1WGOA 1OE3A 4M6MH 4WI7A 2P5EA 2R4SH 1OM3H 3ARYA 1UT9A 3P9LB 2H5UA 2YMXH 3E9UA 3BEVA 4U1SB 3RVXD 3OJ2C 4G9FD 2LLLA 3GJFB 1PZCA 4XNQA 4YDMA 2CXKA 3IS0X 2VWEC 3L3IA 5FW6A 3OX8A 2WXGA 3I6LD 4BXSV 2FWOB 5ISZA 2IG2H 1E3ZA 3L3KB 1S7RB 1NCIA 3N43F 2MJWA 3FT4A 1BVLB 2H0PA 2WXLA 4LVEA 3WLBA 2XHNA 2BVPB 4JFDE 4UUJB 2WCPA 4BQ8A 1PZ5B 3EFFB 3MA9L 1EAQA 2E0PA 4PJIF 5EN2A 3AQDA 1I3GH 1KN2H 2IH3A 1DZBA 3TT1H 1KELH 1RPQA 1MCWW 5ID0B 4QHNA 1AZNA 3J27A 1X5MA 4PMEA 4XBPA 5EC1A 4G83A 5DJ6A 3F00A 3P9MB 4N2LA 5ICZA 1VFUA 3X2QB 1QSEA 3GPEA 3Q2LA 1C8QA 5DJZA 1HEHC 1KYOK 2YLKA 2HMID 1D7CA 1QPXA 3O11A 1HAWA 1XB3A 3LNFA 4H40A 4NGHL 1JZJA 1UENA 4KVNH 4TOYL 4XMLH 4APQA 4UTAL 1MHHB 3TZVC 1G0XA 5FYKE 2BOCB 3QJHA 4ZAKB 3SKJH 3CLFL 1XR8A 4HWZA 1AGCB 3J7HA 3MLYL 4MD0B 3IDXH 4Z95L 1NPUA 3P4LA 5E2UL 1TQCC 4Y7OC 4NX0A 2AW2A 3RIAF 1XSOA 3UTTE 2J25A 2GBAA 4L1BA 2C9UA 3UROR 3WHE0 1RU9L 2QLYA 4AE1A 3TF7C 2JSFA 4MJ6A 4NUMA 5LWYL 4JW3A 4X4ME 3TH4T 4A1RA 4Q74A 1ZPUA 1IM9D 3SO5A 2X6MA 3VXOA 3BQVA 4FI7A 1NMCC 2AAVA 4LP5A 4YDIL 1WEJH 3UP1A 3W81A 1Q0YL 1Z9SB 4BWWA 4MX7B 2YXWA 3L16A 2KZWA 2QQLL 1K8IB 2XN9A 1HXYB 5IJBC 5KSAD 2RCSH 1R5VA 3KL3A 5JHLH 1OAXL 3ZN6A 1MCKA 5EN3A 2X87A 3T65B 2BSEA 3MV9E 4G8GE 5H35B 3R7RA 1Q9LA 3ZT5A 1YC8A 4FRWA 1CI5A 4I0PA 2X4PA 3CK0L 4Q6IB 2R0LL 3PU7A 5AWNH 5CNHA 3P0GB 1JV2B 4M6ML 5C0FB 2KQNA 2R4SL 2ZXQA 4PRHA 1QFOA 1OM3L 2YMXL 4XMXA 3PWVA 5EUKA 4KTGA 4W93A 3IMTA 1FAKT 3WNMA 3BZFB 4GW4B 2IG2L 4LZKA 4G2AA 4DGIH 2Y7LA 4NKQB 1Z5YD 3IFPA 4PRIB 3TH3T 3IJSB 5HYSB 4OD3H 1P5UC 2FH8A 5BOJA 4K5MA 4ERSH 4JDTH 4L8SC 3NGBC 4L0ZA 4A2HA 5GGVH 1UKQA 1I3GL 1KN2L 3SE3A 1KGWA 3TT1L 1KELL 3V4VA 5DMGD 1OPGL 2O6PA 2ZSVA 3BDXA 4RFNC 1OPOA 4R4BA 1SYVB 2IBBA 4PJAB 3SYOA 3MMEA 4U4IA 3PY9A 4JGNA 3FS9A 3LNGA 1YEHH 2F53D 4Y5VB 3EF7A 4NERA 1A3RH 1THCA 2H26A 4FFZH 4XMLL 3ZTDC 2EEAA 5SX5K 1JF1B 3SKJL 1KCUH 3VWKB 2MCPH 2VZVA 3IT8D 3T71A 1Q72H 3MLWH 4QKXB 4KXZI 2NY0B 3GIZH 4JBSA 4WU7A 4HXAH 5J1AB 1QR1A 2YK1L 3IDXL 4I4WB 4DVBA 3NCBB 3RZCB 5HYJD 3IGKA 3BUBA 5B4MD 1U3HC 2DM3A 4EN3C 4NAJA 3GSRB 1BJ1J 3GO1H 2WXRA 4HFWB 5HGDA 3TCLA 1SLUA 3F05A 3VSVA 3D05A 1WITA 1K8DB 5IVXE 4IS6B 1OVZA 4G9FB 4IW4C 4RWHA 1C5BH 3LXAA 3BPCB 1MNUH 3Q9QA 4W6WB 3HTLX 1X5AA 4X9GA 1M7DB 1ESOA 4YHOH 3U1SH 3UCQA 4F8QA 3KWWA 3QPQD 3B7UX 4PJDB 1WEJL 3MNVA 3Q6GH 5GISH 5E08H 4QNPE 1YEGH 3DX9B 1E4XH 3MNWB 4DESA 1WBYB 4FQCH 1YMMD 2AEIT 1E2WA 4WWPA 3RFZC 4FAAB 4XTRC 1IGTB 4I3RH 4OZHE 1XCTB 2AEOA 2RCSL 5JHLL 1OD7A 3NIFE 5ABDE 5J7CC 3TEWA 5F7MC 2HB0A 5D4JA 3EOBA 4CSZA 3CQFA 4DO5A 2GJZA 3GMLA 4XCNB 1VFBA 4AUYA 3FMGH 1T1YA 3BQUC 2ITDB 3EO1A 1JDCA 3NABH 4GRWH 3WKMH 1B4RA 5J3HD 3C6LB 1A7BA 1AVAA 1AFVH 1TG8A 3IJYB 3FFCD 1ETB1 2JV6A 3FN9A 5KYUB 1D7BA 4NWTH 3NEEA 4DUXA 3HR5A 3V4PL 5D1XB 3TO4C 1FCCA 2R1WB 4Z7NE 1L9SA 3R1GH 5AWNL 5T33H 4KMLB 4W70A 3ZE2F 2H9GA 5CKGA 1YAZA 3O2WH 3JWNE 2A99A 3LEYH 1K4CA 4AH2B 1CYGA 3OAWA 4XVUC 2IALA 1QA9A 2PO6D 4Q0XH 3VWJC 4P0DA 2WKOF 3WHXA 4DGIL 3N43B 1ML0A 1YYLH 4OD3L 3GBEA 4PTTA 4Q4IA 4YR6A 3S8WA 4ERSL 4JDTL 5C0NC 5GGVL 5HHXH 3DO7B 1BSIA 4PJIB 3AU1B 4OFIA 3RIFK 1CC3A 1DQDH 4Z7UA 3MUUA 1KGCE 2V6HA 1EHKB 4LLYA 5DURD 1II4E 4R3SA 2CBMA 2I07A 4OKVB 2Y6SD 1LLAA 1YEHL 5L8KB 3AACA 2QQNH 3GHEH 3NZSA 1A3RL 4CC4A 4FFZL 5I6OA 3K71B 2FWUA 1LEKA 2J4WH 4IRJB 4LIQE 1KCUL 2ERJB 3OXSB 2MCPL 1X6NA 1PMYA 4ORGA 3W5NA 1Q72L 3MLWL 2AJUH 3GIZL 4XXCC 4HXAL 2ZUXA 2RGSA 3P9LA 1JPTH 5LN8A 1SOQA 3IGAA 3PCYA 3QQDA 4U1SA 4WI9A 3AWGA 3GJFA 4U1GC 2WQSA 2OM5A 3HB3B 1FZKA 1S7RA 4XVOA 3PGFH 1C5BL 2VLMD 5I66A 1MNUL 2BVPA 2EINB 3NIDF 4PVNA 4YHOL 3U1SL 4B5ZA 5IQ7H 1PZ5A 4O5LL 5C0RH 5M94B 5H8DA 4OF5A 3EFFA 2FQGA 3Q6GL 2UV3A 5GISL 5I19H 5E08L 4OZ4B 4F7PB 1YEGL 1E4XL 2ICEB 2J1YA 2NZ1A 4FQCL 4QRPD 2P5WA 3GLDA 4BV1A 3UJTH 2D7OA 3QSKB 5CZVH 4I3RL 3P9MA 4H8WC 5AZEH 4I48B 1RUKH 4ZX5A 3V9EA 4ODXB 3WSQL 4G6FB 1X5HA 4NNYB 2VLJA 2MKLC 4U0RB 1JGUH 3FMGL 1XGZA 2Y07H 3C8DA 3NABL 4O9HH 4ZAKA 4U2ZA 3T4YB 3WKML 5F7EL 1PZDA 2B0SL 3QJTB 1CO1A 1AFVL 1I1AA 3M86A 4NUJA 4CU7A 1AGCA 2FTAA 4MD0A 3VGAC 3G04B 4NWTL 1AR1D 4AGMA 5IQOA 4YSRA 4RDQG 2CE6A 1XXFC 3R1GL 5BO1H 1TQTA 3OMIB 1PQZB 4P99A 5EOQH 2Z8SA 4QRRD 4N2EA 4AMWA 3GT6A 3LEYL 3BZEB 5LCVH 4Y4KC 3S9DB 4YBQD 2ZOOA 2WXPA 1BQLH 3QI9D 1HHKB 2WV3A 4EIGB 1GZHA 4AMXA 1F4YH 1IGCL 1QSFE 1Z9SA 1TEGA 4MX7A 1YYLL 3PREA 5JTWA 4P8QA 4F2EA 3OKLB 1K8IA 2XIDA 1MJJB 4EZJA 2GFBB 1HXYA 4QF1B 5HHXL 5HJBA 2H2PD 4Z7VE 1TKWB 4P23D 4KXBA 5DFVC 2YPLE 1DQDL 4L9LB 4V1DB 1Z9NA 2DL2A 3T65A 4GBXC 2VRAA 4FKEA 4AW7A 3PS6A 5EZOH 5H35A 3WTXA 5T3ZD 1QEXA 1ZSDA 3BVTA 1CICA 2QQNL 3C12A 3F2LA 3GHEL 3CBRA 5DRZB 5JA9A 2J4WL 4JAMA 2QHRH 4Q6IA 1I7UB 4L3EE 2AMUA 3FFCB 2AJUL 3ASWA 1T5XA 2Y5QA 1TVBA 4WHCA 1JV2A 5C0FA 3NRQA 1IAKA 3B2VH 1JPTL 1NOFA 2NLJB 1TMQA 2HRGA 1RQ5A 1FFRA 2YPVH 2MEJB 1T66D 5AD0B 3BZFA 4MA3B 1SY6H 4GW4A 5T1MA 4UBDC 2XXCB 3LQMA 1HWHB 3PGFL 4N2AA 4NQCE 3L5WB 5L8LB 3KL0A 4IBVA 4OBRA 5IQ7L 5HYSA 1T4WA 4B0MM 5EIIB 5C0RL 2FYYB 2UXVA 3SGDI 5I19L 1KEGH 4N2MA 5I1LB 4M93C 1MCHA 4GP4B 4XXWA 5IQNA 4DO6A 3AM8C 1AHWB 1TSHA 1V10A 5IEKA 3D2TA 3UJTL 2BNRE 5GGSA 2L0DA 1KTBA 5AZEL 1MELA 4QCIB 1MFNA 3DK0A 1RUKL 5CJ5A 5L7XH 3I02B 4LSVH 4UIMA 4OIAA 2C7UB 2BFGA 2LAAA 4Y5VA 4C83B 1JGUL 2YD2A 4H44C 2CM5A 4HCGA 4H26A 3LH8A 2Y07L 3T08A 1JF1A 4O9HL 5EEXA 3EH2A 5DZOA 5J1AA 5I74C 4R96A 5JO5B 3RZCA 2GIYA 5AALA 3QNYB 2CWRA 3OAUH 3GSRA 4PU2A 3DETC 3BVVA 5BO1L 2PCYA 2ADJB 3AWEA 4W9DC 4CJ0A 4MDJA 5FLUA 3VG0H 1BECA 4TKWA 1K8DA 1SDDA 4IS6A 3GI9H 3ZE2B 4WO4D 2R1XB 3MOBH 4ZDHB 2V7NB 5LCVL 3NRPA 4GAYB 3BPCA 2IC2A 4MASA 1WS7A 1Z1WA 4RRPA 1M7DA 1BQLL 2GC7C 5TQ0H 4IRSB 3G6AB 5J6GB 5IKCB 1KZQA 3TP4A 3MNWA 1F4YL 3DX9A 2NY2C 4CNIA 4J3TA 4LNRA 4MAUL 1WBYA 4DUVA 3CZLA 3OGCB 1IGTA 4X0NA 4B9ZA 1XCTA 2XQYK 4P5TB 1PY0A 4L4TA 1L9PA 4P2RD 4I8DA 1QO3B 4LHQB 4IM8A 4XCNA 2JKNA 4MDIA 4XPFH 2GSGA 2ZONA 4MSWA 1ZAGA 3RVTC 5EZOL 4ELME 4MAYB 3C6LA 3W0WD 3LH9A 1CUOA 5D1ZI 5KYUA 4DPAX 5D2NC 2QHRL 1WDAA 5D1XA 4H88H 5CCJA 4GS7C 2HVKB 4PB9H 2E74C 3VFOB 1ZLVK 3IDMB 3ESMA 3IDNA 3TYGH 2NNAB 1PYWB 1YQVH 4WUUD 3B2VL 5EFIB 2Z8WC 4AH2A 2YPVL 4OQTH 5C0EB 2APTA 3RGVC 5MP6H 2NZIA 5HHPA 1JG9A 1SY6L 1MI5D 1PG7X 2YD8A 3JVGC 4QYAA 3VUAA 4I1NB 1TR7A 3KS0J 3D87B 1O7DE 5ICYA 2VSCA 3NIDB 4OD2B 2NPLX 5C6TH 4X5WB 2H0JA 3P3RA 1G7MB 1KEGL 1WWWX 4Y7MA 5D5MF 2AQPA 2LQRA 1DQQB 3V4LA 4FG0A 5D1QA 5DVMA 4HLEA 3TYFB 3EJZC 2V8MA 1E2ZA 1OK8A 2OPCA 2GUYA 5L7XL 4OKVA 1SF3A 1X5GA 2LVCA 2NY4B 4A7SA 3BUYB 4LSVL 2N59A 4YBHA 3K71A 3LKOB 1JBJA 5GPRA 4KXCA 4GAGH 1KBVA 4IRJA 4DJMA 5EOCH 4B53A 4UM9B 3OXSA 2DKUA 4MDRA 3CFKB 4G72B 4LOUC 4NFDA 4RFEB 2O61B 2I9LB 2QKSA 4OJEH 5BQ7B 4NOFA 2DLEA 2OS7A 3WJLC 1W8NA 3OAUL 1O7SA 2B08A 3I9IA 3HHMA 3CC1A 1S6NA 3OPZH 4UDUB 3VG0L 5DEJA 4L0YA 4J5VA 2WLHA 3GI9L 4NZFA 4PUBH 2ZWZA 3MOBL 1OD9A 5D6DA 2MTPA 3GK8H 1IBDA 4UT6H 1SQ2N 4IGBB 4MNQB 4YN3A 3UAJA 1J7VR 1L6XA 2Y23A 5TQ0L 4GT0A 4XP5H 3B83A 3TEUA 1NAMH 2ZNXA 1XF2B 4OZ4A 4F7PA 3DOIA 2ICEA 2F8VA 4ODWB 4JL2A 4HAGA 4FMFA 3QDMD 4HP5A 2IQ9H 1QUNB 4YS4A 2ESVA 4XVSH 3ZE0E 2O6EA 1FG2A 4I48A 1RJYB 2VLKD 5DI8A 4CSPA 1A6AB 4B97A 5D7JB 2R69L 1IC5H 4NNYA 4HJ0D 3UTPE 3AXIA 5E2TH 2DDQH 3EDJA 1TQWA 4LT7A 4NN5B 4XPFL 2X1WL 2FIRT 3VXSB 3HHRB 3L17A 1EMTH 3K2KA 3Q2NA 5HGAA 3T4YA 5C9JB 3VGEA 3CFIC 1PZ3A 2CRYA 2QSCH 3VXUA 2J7LA 3U46B 1EEUA 4K4KA 4JRYD 5EIQA 3QCVH 4H88L 5JIHA 4PB9L 1I9JH 1X7TA 5B1JC 3TYGL 1PQZA 1PD6A 2JE8A 3GLZA 3Q5TA 4WFGD 3DDFA 1YQVL 3H9SE 4O2EB 5BZWB 4P4KC 4HF5H 1GS8A 3KXFA 4Y1SA 2JCCF 3WO4B 1GZPB 5DFWH 4ZMPA 3IKCB 4OQTL 3MCYA 4HXBH 1QLEB 5MP6L 1MFAH 4AYFB 5DTFB 4Z18A 2DY2A 4X4ZA 1PX3A 1VSCA 3G9VA 1T22A 2BVUA 4LRNH 3CVHB 1RJZB 2Z93B 3V5DB 5C6TL 1ZEAH 4PWGA 3MOAH 3OKLA 3U30B 4H0GA 2GFBA 3DIDA 2WWOA 2BHYA 1HS6A 1EHLH 1EXUB 5JDSB 1SHXA 4V1DA 1KJ3H 2C9SA 3RDJA 4F24A 3ZKMC 2VDRH 2XSKA 3V7AE 2VUKA 3PHQA 1E5CA 1A8ZA 4NQSB 2MMXA 3U4AA 4NQDA 3LN5B 4EI5C 3BI9X 1EXHA 2EXWC 1VACA 4L2YA 3T0EC 3TM6A 4GAGL 3SKNB 3QJSB 1YEDB 2AV1B 4IMLB 5EOCL 3B1TA 4ELKB 5IJCC 1XTLA 4RGMC 1URLA 1Z3GL 1NMAH 3B7RL 3P2DA 1MCPH 2EYSB 2L7JA 2P26A 3OPZL 2R39A 4WV1B 3ZT7A 4JUSA 4MA3A 4PUBL 1TCRA 3QORB 4NPYB 5AW3B 4UT6L 3GK8L 3L5WA 1I53A 2WBKA 1TTUA 4ES8A 2CBPA 4PJXE 2WYHA 3BWAB 3IE4A 1HFUA 3SDCD 3CWGA 1GW0A 3T04D 5EIIA 2FYYA 3S97C 2RBLA 4XP5L 4HYTB 1C5CH 4Q56A 4KI5C 3CMOH 1E43A 1RZJH 2IQ9L 5C8JB 4XVSL 2VRKA 5CSZB 3GXTA 2GJ6A 2VDPH 4PMFA 4W9EC 3U7WH 4QCIA 3DV4A 3X3GH 2ZYRA 1E8ZA 5AB2A 1IC5L 2BSBA 5E2TL 4ZS7H 1J8RA 2DDQL 2B14A 2E6JA 4Y2DA 2F1BA 1TXKA 1XH0A 3SQBA 1EMTL 2VLRB 1JDAA 2BS71 1U4FA 2QSCL 2AJZB 1X5FA 3RJQB 1FNAA 1PAMA 4FHKA 5AAMA 2WYZA 4HOZA 5JPMC 3QCVL 5DC9B 5H94B 1UJ3C 1I9JL 2L8AA 3AW5A 1UD6A 3AMKA 3BEWB 4F3FB 2ADJA 4OF7A 4R2GB 2E9JA 4HF5L 1QUPA 3RFRA 3D4ZA 2CLVB 1KYOJ 1MN4A 4HXBL 3VFRB 4ABUA 1MFAL 1HKLH 3D3VE 4WI0B 1TQBC 4IRSA 2WKOA 3G6AA 5IKCA 1PCXA 3KE0A 4WLCA 3MRDA 3H3PH 5J6SA 4LRNL 3ULUF 2QKIC 5IVNA 2XQBH 3CXDH 5FLVA 4ANWA 2VXTH 3MUZ1 1ZEAL 5HYIA 1KUMA 3MOAL 2E4FA 2IDCA 1DL7H 2GCYB 1XIWB 4P5TA 4UANA 2J20A 1FFPB 2E6QA 5D5MB 5JHDA 2VH5H 2YARA 3F5WB 1LE9B 2XTJD 1QO3A 4CSSA 2P80D 1KJ3L 2BERA 5I2IB 1MCOH 2VDRL 2YAOA 3B3BA 2Q3ZA 5CGMA 2EKJA 4GQ9H 4PY7A 4OBSA 2F2HA 5JZ7C 5SWSE 3L4YA 2RALA 5C08E 2J12B 2HVKA 4EIZC 3VFOA 3IDMA 4ECNA 2PKDA 4KO9A 2APBA 2NNAA 1NMAL 1PYWA 5EFIA 4I89A 1MCPL 2MIZA 1N9PA 4TF4A 3GM8A 5EF2A 1B4JH 2YA2A 3ULVD 1CXLA 2FX9H 3R7QA 1BP3B 4ABVA 5C0EA 2XWJB 5AVSB 5IV2B 1U41A 3HC2A 3MX0B 4I7ZC 3AG3B 2WVSA 2X1QA 3UIZA 3SKMA 2OLDA 4JGJA 3VJ6B 4L1TA 4C56B 3DRTB 3MJWA 1AO7E 4JQXA 1RD6A 3QUZB 4OD2A 4X5WA 4PP2B 4BFIB 1C5CL 1G7MA 5E00B 1W80A 3CMOL 1P1VA 4DP9X 4MZRA 1DQQA 1DVFC 1RZJL 4GP5B 3S96B 4YBLC 3TYFA 4X6EA 1SBSH 3U7WL 2VDPL 4XNUH 3SZKC 1ET5A 2QQQA 4TLKA 3X3GL 1H6TA 2P7TB 4WIQA 2IWGA 4F1ZA 1J0YA 1JJUA 1NSNH 4JDZB 4ZS7L 4WNSA 4OD1H 2EIBA 4JCLA 2PXYB 5IWLA 2HYMA 3U48A 1KTDB 5D72H 3TJEH 2XTLA 2O61A 4QRFA 2I9LA 2NR6D 3O0RH 5BQ7A 3ZVVA 4F93B 3A0OA 3LRMA 3IJ8A 3M8OH 1W91A 1CPUA 2JKSA 3A4AA 1QI4A 1TCMA 1MW0A 1WK0A 3ZRSA 1P7QB 5CR1A 1E2VA 3G9AB 2BSRA 3QJRB 5A16A 4UILH 4AIOA 5C70A 4AEFA 2JCCB 5I17B 2OZ4A 4IGBA 4MNQA 1KGYE 1MZZA 4KJPD 4PSPA 1NIDA 4Y2LA 4B9FA 1HKLL 5B1KA 3B3IB 5HGHA 4HUUA 2VDMH 1NKGA 3H1ZA 4TUKH 3TBVB 3ILPB 1XF2A 1HOEA 1ORQB 3AUVA 3H3PL 2F7PA 3OZLA 2XICA 4N8CH 2XQBL 3CXDL 4ODWA 2G5UA 5ALCH 3ZDXF 4QJ5B 2QMKA 1QUNA 4LBEB 5GGTH 4A7GA 1LMKA 4DKAA 1H15B 4G6KH 1F13A 1DL7L 2FBRA 2HRPH 5DQ9A 3V7MA 4Y4FC 5BVJA 1RJYA 1TTCA 3CPLA 4PY8J 3GSWA 1HJCA 2VH5L 3FTUA 1X9RA 4KMTH 2BXZA 1MIMH 1L9NA 4PRHD 1AY1H 2BSTB 1NQBA 2C9XA 3SGKA 1MCOL 5DJCB 3TJHD 3VXSA 5DRXA 1RY7B 5CJ8A 5D55A 1ID5I 3NZUA 4BCXA 1KCLA 2PR4H 3BH8B 4TUJB 3SPIA 1J1OH 2Y2WA 4GQ9L 4ZW3A 3U46A 1JZ2A 4XP9H 5CCGE 4N8VB 1G5AA 4HMCA 1FE8H 4KK5C 5JLZA 2R4RH 3FUDA 5F3FA 5CEZD 5K33A 4AQOA 3GIVB 1RMFH 3U79A 4IMKC 4GQRA 5A2FA 1E28A 3DVIA 1GZPA