4ZMYA

Crystal structure of human p-cadherin (monomer 1)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
214
structure length
214
Chain Sequence
MDWVVAPISVPENGEGPFPQRLNQLKSNKDRDTKIFYSITGPGADSPPEGVFAVEKETGWLLLNKPLDREEIAKYELFGHAVSENGASVEDPMNISIIVTDQNDHKPKFTQDTFRGSVLEGVLPGTSVMQVTATDEDDAIYTYNGVVAYSIHSQEPKDPHDLMFTIHRSTGTISVISSGLDREKVPEYTLTIQATDMDGDGSTTTAVAVVEILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Adhesive Dimerization of Human P-Cadherin Catalyzed by a Chaperone-like Mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Cadherin-3
total genus 53
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4zmyA01
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4zmyA02
2QVIA 1NCJA 1NCIA 3FF7A 4ZMXA 5CZRA 4ZMZA 1L3WA 3LNGA 3K5SA 1NCHA 5DZVA 4AQ8C 3UBHA 3Q2VA 4NUQA 4XXWA 4APXB 2OMUB 1ZVNA 2A4EA 2OMVB 4ZT1A 4AQEA 4ZMLA 1FF5A 4NUMA 4AQAA 1O6SB 4OY9A 4AXWA 1WYJA 3Q2NA 4AK1A 3LNFA 4XXWC 4ZTEA 3LNEA 5JYLA 2OMYB 4AQ8A 2OMXB 3K6DA 4ZMPA 4ZI8A 3FF8A 4AQAB 2A4CA 2WHVA 2YSTA 2WBXA 2WD0A 2OMZB 1EDHA 2YQGA 4QD2E 2EE0A 3Q2LA 1OP4A 3QRBA 1ZXKA 1Q1PA 4NQQA 2X2UA 3UBGA 4ZMYA 3K5RA 3K6IA 4NUPA 4ZMNA 5CO1A 3LNHA 2QVFB 4ZMVA 2O72A 4ZMWA 2WCPA 4ZMQA 4AXWB 1SUHA 3LNIA 3UBFA 3PPEA 4AQEB 5JYMA 2OMWB 4APXA 2V37A 1NCGA 3MVSA 3K6FA 4ZMTA 5KJ4A 4ZMOA 1WUZA 3LNDA 3Q2WA 2OMTB
chains in the Genus database with same CATH superfamily
3L5XL 4HOZA 2AABH 4PJEE 1WV7T 3NAAH 2A3TA 3B9KD 2P8MA 3I74A 5G4MA 1U8PB 2VDRH 1KXVA 2ZKWA 3EFOB 3TIEB 4RZCB 4L5FL 4DZBB 1JF1B 1OSYA 4G1MA 4Z78B 4XWOC 1M6OA 2HVKA 4LF3B 5DUPL 4G59C 3WY1A 1R3JA 4YHKH 2V9TA 2D3VA 4YSSA 2XTLA 1OO2A 4RX4D 5K59F 3O4LB 4YVNA 3OAUL 3II2A 3MRKB 1KJVA 1P7KA 3LKRB 4U1KA 5E6YA 2NY6D 1X5LA 2FBRA 2XNAB 5E2TL 2NUPB 1IO4C 4ZJ9A 2ZYRA 2ZUSA 5F9DC 2AJ3B 4I4WA 4IMLA 1HOCA 4HBCH 4JRXB 3DMMC 4FL4C 2CRZA 4DQOL 2JB6B 4WZ9A 5DI8B 1J0HA 4N2FA 1ZVSB 4U1IA 4WI0A 1CLZH 4KZDL 2IJ0C 5D93C 2B4CH 4F2MB 1F1GA 2BX5A 4F7EA 2Z8VC 5B8CB 1HQRA 3HZMB 4LOUC 3BZEA 3THML 5I2IA 2XVGA 3SDDB 3VVWA 1ASQA 4EI6A 3EJCA 3R7QA 4M7KL 3D18B 4OLZH 4PJXA 2DLFL 3K2IA 3AMLA 2NDFA 2PPCA 3BH8B 4J4PD 3IWVA 3DDGA 3L5XH 1MFEH 1N7MH 2DLFH 4N8UA 4CILA 4QF1A 2XXFA 1AD0B 1XZ0B 3ETSA 5GJSH 2VUKA 1OGPA 1A1MA 3ZIMA 1FSKC 3BZ5A 1HL9A 3WKPA 4GUQA 4NQUA 4QXGH 3DC0A 1CE6A 1YMMD 1WBZA 1TR7A 2Y4SA 1MI5D 3P2DA 1GGYA 5GS0C 1M05B 1WVZA 1S5HB 2UVFA 3DBSA 1NBZB 1NFDE 1F4HA 4QRPE 4AVIA 2DH2A 4F57H 2ICCA 2MPAL 4HLZH 4LPWA 3SJVB 3OF6A 1R1CA 5IW6B 5IHZA 3L4CA 4K9EL 4UQ2A 3CVCA 1PG7X 2ADIA 1DANT 4TRPH 1UJTA 2VE6B 4G6FD 4PJGF 3VJ6B 4UOW0 3O4OB 3LEVH 2D0HA 1U8IB 4X5QA 2FX7L 4ZS7H 3I02B 1E8WA 1LK2A 1HH9B 2R27A 3WDHA 4HLJA 1MG2C 5IBTL 1HOCB 1FN4A 3GI9L 1WAEA 3B7RL 3GIVB 3MYJB 3DXAB 4NN5C 9CGTA 2IANE 3DHUA 4Z8FL 2WLNA 3O4LA 2BIQA 2CR3A 4FTVE 2NY5L 4KI5D 4E41B 4NENB 2GI7A 4PGEA 1AACA 1HIMH 5EZLA 5I17A 5JO5A 4JHUA 3DUUA 4UDUA 4G1MB 1E4WH 2F9BT 3B7TA 3L5IA 1I85C 2EKSB 4HD5A 2PCYA 3L2MA 3QQDA 2OXGA 4QWWD 1K2DB 5DCCA 1L0XA 2ADGB 3LXCA 4FFYL 4JGMA 4X7TA 3TIDB 1ID5I 4PJHF 4PJFE 4PV1C 2OJEA 2AJYL 2WO2B 3Q2VA 4OCRL 4I0PA 3GDCA 3K71A 1MF2H 4CRPA 4MJIB 2Z31B 3QPQC 5DJ0A 1Q90A 1NCBL 3D08A 3EJYC 3LZOA 1C5BH 1M4KA 4J3OD 4D8PA 1NSNH 3T0DA 4QRFA 3D2UD 2BVQA 5DHEA 1WQVT 3R8QA 2ZE0A 4HDIB 2CIKB 3QISA 2B15A 3PAUA 4X8JA 5DC0A 1IBGL 2FLBT 3UGUA 3MNVA 2AEWA 5HI3D 3CZJA 4N0UB 5LJYH 1GY1A 3EOBB 3EJPA 3MX0B 5TFSL 4CW1B 3BXNA 3DX7A 5H4ZA 3K4DA 2X89D 3MMEB 2L0DA 3DRQA 4S0SD 3KW7A 4W9CC 5F88B 4XPTH 3EYVB 5DRWB 2E75C 4X7EC 5E0FA 1F0LA 1OK0A 5C6TH 2OCFD 4OM0H 5C0JA 4BQ8A 4WKZA 4R97B 4P8QA 5LGYA 3LN9A 2B0SH 4LCCC 5K59E 2QQKH 4F7MA 3WD5H 2DQIL 4GW1B 3MLVH 4BDVA 5EU3A 3F6JA 5KVEH 4P2OC 4DK5A 2V33A 2FBJH 4ELMA 5BW7A 3GFUA 5EO9A 5DZJA 3DX8B 2VWEE 3ULUC 2RA1A 3FOMB 5BS0D 5KYWB 4Z7WB 1G9NH 3RNQA 4XNQA 6TAAA 2E47A 3OSVA 5F7KC 5IVXA 1CE1L 5T1LB 2IAMB 1I7TA 3MSPA 4XODA 3UBXA 4FOMA 2BSSA 3QPXL 3RAJH 3APDA 2FQGA 1HFUA 5AENA 1CDJA 2BH0A 2DWXA 3B6SA 4LP8A 5BUPA 3TEXA 4KRNA 2W59A 1P4IH 1EEZB 1FFOB 2XKSA 3LH8A 2IDCA 5FLVA 3LNIA 4OKVB 4TQ8A 1A7RL 5JYMA 3U7YL 3CU1A 3WIIH 5LO7A 2P5PA 3JUZA 3MVSA 3TV3H 1HYSC 2ZWZA 4WV1A 5IMLB 5AQ0A 3QUZC 1LXMA 2WQVA 2BJML 2KERA 2E7LC 3L7FB 1NCCH 2KUTA 4N6RB 1X7SA 1O9VA 5LCVL 1HDMB 2VYRE 3IDIB 1W0WB 3OAZK 4H5SB 4EI5D 3MCLH 3PHOA 5ESVA 2FR4A 1PEZA 1UJ3C 3ATFA 4PH8A 2XZQH 4PSPA 5E94B 4XBMA 5AB1A 1MIEL 4R83A 3LZNA 2Z64C 1FRGH 3MRRB 3WNLA 4GSUA 3SGJC 5LNDA 1F4XH 2GITB 3ARUA 2VJXA 3CSYB 1JDDA 1S7SA 4MD4B 5E8DH 5IEKA 1KXTB 3SPVA 3MLSH 2W0FA 5J1SC 5F7LB 2BNUA 1NUNB 2QSCH 2CRMA 1F3RB 1JF5A 4S1DC 4UINH 2JMRA 2B5IC 2MOVA 4WTWA 1NC2B 2AQRA 3DBXA 4HHWA 1IEAB 4GAAA 4ZFOL 2NY4D 1BD2A 3KXFE 3WJLA 4CVWA 4P2RE 3L3JB 4RRPG 4V11A 3GSQB 5AYUL 5BMFH 3RDTC 3PUUA 1R5IB 1MHCA 2PLTA 1HE8A 5MEND 1PYWB 4ZAKB 2K45A 1TZGL 4OLYH 1AO7B 3WHXB 1XD1A 4YK4B 3D1MC 4G6JH 3SBPA 1U8CB 4L8BA 1G6RB 4M62H 5DUJA 4K3JL 1H0DB 2LAGB 1MAMH 4U6XA 1UM5H 5DLMH 1FYHB 2P8MB 4M6AA 4KNTA 2X9ZA 4AZUA 2V8MA 3UAEA 3RDTA 4G71B 3ZTJH 5KAQF 4R3SB 3NPSB 1HIML 3QZWB 3U7YH 3TBVA 3BSHA 3R0NA 4JQIA 3OLIA 1MPAH 1S3KL 1MFVA 2FD6L 2P7TB 3JV6A 3MBWA 4G9DA 5ICXB 2WLLB 4AWJC 5JUEH 2VDKH 1WZ1H 4PRPB 4H0LC 5GZNC 3H2WA 3S37L 4OCNC 1XR9B 2FDBP 2X6CA 4F9LC 1QR4A 1YMHA 1P9MC 1ZEAL 2EC9U 3HJEA 4NM4H 2EECA 4KX9A 2A6IB 2A9BA 1FYTB 3L1GA 3A47A 3FFCA 4JJ5B 1VFMA 1Z3RA 4HZLB 4NKOA 1UXMA 1PSKH 2FJGB 4NSKB 5GS1B 3NJIA 5DD3H 4MRBA 3G08A 3RGVD 3UJTH 3GMNA 4F8LA 1P9MA 1UWEL 4A55A 4PPTA 4CN1A 5L8KB 1QO3A 3RJDA 2CPCA 1XT5A 3G6JA 4GUCA 1B0WA 1K8IB 1NDGA 1ZA6B 3T6XA 2F58L 2VN4A 3GEFA 4JFEB 4X8CA 5ETUA 4ZMOA 2AK4A 4DUWA 5I8CB 1OCOB 4Y8DC 3UJIH 2AQQA 3G04A 4I1NB 4JHBA 1G7QA 4Y16D 2PF6A 2O4EA 2B0SL 3JWNE 4PBDA 3RIFK 4EI5B 3L3HA 3Q6FB 3AU0A 5BRZD 3U30B 3K4AA 4AIXA 4IDLA 4X4ZA 2J4WL 4W6WB 1EEYB 1HXKA 1XF1A 3IDYB 4RA3A 4X0KA 3UC0H 4ESKA 4WRLA 5BRPA 4OD1L 1E9OA 1U58B 2VLKE 3GSNB 2JKWA 2ZAHA 3FCTA 1GW0A 4TLSA 4LDEB 4FI6A 4BGDA 3SKUD 4JRYD 1D5XB 4KO9A 1Y6MR 5JA9A 3R06A 1J18A 1MHEB 4QRTB 1HXMB 2P5EB 1E4XI 2ZPKH 4X6DE 5FIEA 3CPLA 4FULA 1FE8H 1BZ8A 3OVUB 4Y9BA 3BYTA 2F5BH 2G0LA 2PCPA 3NSCA 2DI8A 3MNZA 3OSKA 5BQ7B 4G8EB 1Z9NA 3GMQA 1AZBA 1K8DA 2PUQT 4I18C 4V1DA 2QVTA 1P7QB 4JDZA 4F3FB 2HLFC 1KEGH 1CT8A 5EF2A 3GZKA 1EZVX 3RY4A 2LU4A 4L3EA 3GNMH 2GTWB 3LKNA 1FNGB 3TWCH 4E5XG 4LKXB 5IF0B 4A7QA 3FOLB 1JNJA 1HE7A 2CWRA 3QWRA 1IFHH 2LU5A 2Y2TA 3FF8A 5DMIH 5FW7A 4GW5A 3KLHD 5ANMB 2D03L 1JOIA 4XTRD 4AW4A 3APCA 5G2NA 3TO2A 5B38G 5DHYB 1DR9A 2EUVA 2AK4E 2WVVA 4H8WH 2YSSA 2FWUA 1IM9B 4TS6A 3LEYH 3UEZA 5A2JH 1JPEA 4UM8A 5J4MA 3CC5A 3OKDB 4KXBA 3W9EA 3HN5A 1UXWB 4DVRL 3MA7B 5IB5B 4GY4A 3UX9B 4OZHB 5HJ3B 2VLLB 3HE6D 4YXKH 3HNSH 1K4CB 2NW3A 1ET5A 4Y9GA 25C8L 1NKOA 1RCYA 1MFAL 3BPOB 4HF5H 3N3EA 1FBIH 2X38A 3L3KA 5DJYB 1L4IA 5B1JC 4PJ8A 4WK2B 4G82A 3DETD 4BFGA 3DGGB 4PY8J 4U4BA 2UZIL 4N0UA 4D0DA 5DJDB 3ZSSA 3CZKA 3MUJA 3T5WA 2WO4A 2OMBA 1KB5B 4Y5VB 3WNPA 1J5IA 2ZD0A 4GH7B 4PBXA 2CALA 1VACA 2OSLA 2P49B 3GSXA 4N0FB 2Q8AH 1PAMA 1KF9B 2GIYA 4AGNA 2R23B 1CK0H 2E3VA 3P4MA 2TSAA 5B39A 1WAAE 4IS6B 4X9BA 4OZHF 5HHOB 2YXWA 2CO4A 2GJJA 4AMKH 3HNTL 3QJOA 3VM5A 2X88A 3T8MA 2WP3O 4FAAB 2E7DA 4R4BB 4YSTA 4P2OA 1WS8A 4TSBH 4ZD3L 3GSNA 3ZHDA 1AIFB 1JVOA 1PZBA 2DMCA 2PCXA 4H88L 4P23C 1CICC 4Q9CA 3CFCL 2IANA 3C8KB 1BF5A 5DK2A 3SDXB 2LVEA 3QQ9C 2ZYIA 4WK4B 3DV6A 4JHWH 2FO8A 5F0MB 3RKDC 1YPZB 3CE1A 2E6QA 1NCWL 3PXHA 2YD5A 4JO2L 4DH2A 4F2FA 2ITCB 3GLDA 4FYQA 1DVFA 4PLJD 4PJ6A 4F15B 5TGBA 3TFBA 3LD8B 5KVGH 3UXFA 5JPNB 1TEGA 2X4NA 3EO1B 2Z92B 4OY9A 4L48A 3WY4A 2FNBA 3CXDH 3W5MA 3MXWL 1FH2A 1X6LA 4Y9FA 3NPSC 3VNYA 1KBGL 2VCOA 1S7UA 3OKKB 1S7SB 1CVRA 2CCVA 3L4XA 3ES6B 1A3RL 5DEGA 1PZ2A 1H6FA 1FLRH 4Z7WF 1Q9KB 1JHLL 3AY4C 4M7ZB 3RWJB 1IBBA 3FO0H 1OWWA 1NCDH 1SYVB 5E6RB 1A14H 4Z7QE 2VC2B 4UTAA 4PRPA 1RLWA 2D31A 1A9VA 3AROA 1IGYA 2VXTH 4Y19A 1T1WA 4LEXL 2VTFA 5DMKB 4KK8C 4QRQB 4I87A 5I16A 4HIPA 1LE5B 3KNBA 3KPSA 4M7LL 4KJWD 1TMCB 2Q7YA 3K2UL 3L7FA 4JY6A 4LPUA 3U0PA 5DJ2B 3MV9D 2ADJA 2GQHA 2OL3B 4O9HL 5DFVC 1NANI 2VQ1B 1M3JA 2HT2C 4XBGA 4XP6L 4YBHA 1JVLA 2G0KA 1KFAH 3ULUF 1HH6A 1MJ8L 1VENA 2Q86A 3BH8A 2EDEA 4J3XA 4NJAL 1ZLEA 3O2VH 2BVUA 3H6JA 3UCRA 4MB4A 2B1HL 2Y1ZA 1ZEAH 5E2JA 2WWMC 4YSPA 3ZT7A 4EI6B 5C0IB 1CD1B 2OMVA 3GD1C 4ELMF 1OL0A 3HAEA 2W0FB 4XNXL 4AYFA 3QZNA 3PGFL 2IAMC 3E6HA 2OZ4L 3KLHC 2AI0H 5IQMA 3VXMB 3IK2A 3IJ9A 4G9FA 1NOFA 1GW6A 32C2B 5A7BA 3SGDH 4ABVA 4LASL 4X9YA 4ZO9A 2QSVA 1YA5A 2EVFA 1EHXA 3U0WL 5DZPA 1ZHKA 3AACA 2CBPA 5AW4B 3L1OL 1P6WA 3BQVA 3EFOA 4YHNB 1SYSB 1YYLH 4LCIH 4P07A 4A6YL 5HI5C 1KY6A 4LF3A 2R2EA 3EGDA 1PZUB 1ACXA 2ZYHA 2E4TA 2KL6A 4BK5A 4UBDC 2EE3A 3KPMA 1JMZA 1XGUA 2XIIA 5I6MA 4UU9B 5F6IC 3BFOA 4LU5H 4PBVC 2R0KH 2CE6A 2YRBA 1O7VA 2GBAA 3H9SA 5FUOL 5DWUL 2J6EH 3VXOA 2WXLA 1G0DA 4NCDA 5HHME 3IN0A 4NUMA 1NCNA 1OAKH 1WCBA 2HKFH 3Q8AA 3T2PA 2YD8A 2AV7A 4BFOA 2MQGA 1U3HA 4XP4H 4JANB 5ITBH 4OCWL 4XXWC 1NBQA 1QFUH 5EOQH 1ZV9A 2ED6A 5FGCB 3ZX1A 3PDOB 4B50A 3WUWB 1KB9J 3EH1A 3FC8A 3BLBA 1MJ7H 1NA8A 1ODAA 1OK8A 2DWDB 1HINL 2LABA 4LSTH 5TFSH 4N90E 3RL1A 3ZL4H 3EO1A 2I85A 3CGTA 1JERA 1NANH 2FZ3A 3HMWH 2A4CA 1QZ1A 3KH3A 4PP2A 1E42A 1V05A 4NKQB 1RJZA 3O41B 5BPPA 2O5ZH 3LY6A 3ZTCC 2KH2B 1NJ9B 2G5UA 2WBXA 1AG6A 1B4JL 1FP5A 4XOBA 5TQ0H 4UTBA 4HPYH 1BIIA 2HJFB 3QIWA 4HWBL 1AKJA 2XWJA 1DQTA 4N68A 4TUUA 4XP1H 2ZXCA 3ZDZE 4FNLH 5CN1A 4NJAH 4R7XA 3MMEA 4PIBA 1UVQA 4PEEA 3D9AH 4PJ9A 2VQUA 1F42A 1MVUB 1EZVY 4WY7L 5KSVA 5T3XH 4GYBA 1JK8B 5D6DA 3C60B 1T0NB 3ARGD 3O4OC 1E27B 4GKLA 4IQHA 4RMQA 7TAAA 2MPAH 5FM5O 3EBGA 1HHGA 1YAIA 4IRZL 5B39B 5AOIA 4PRIB 3V8OA 1GZQB 4LDOB 5LWYL 4QHMB 3GDBA 2KBGA 3VI4A 2ZXAA 1U41A 4PJAE 3B2DC 4KBPA 4QXUL 1DE4B 3K6FA 3NCJL 4CA4A 5CEZD 4B6ZA 2I9TA 3EYFA 1IZJA 1UKQA 1E7VA 4IM8A 3WY3A 1G1KA 3E8UH 2V9RA 1RURH 4TVPE 1KIPB 1JHLH 4NFBA 3FFOA 4L23A 3VGAB 2GW5A 2VZ3A 5B3JE 2ZX6A 1XO8A 3N44B 4K9EH 4PJXE 1FC2D 4XXDB 4FN0A 5INCA 4N8PA 2A9NH 3TYGH 1AI1H 1FZMA 1GZPB 3WGVB 1ZS8A 3CUPB 3RWCA 1U8NB 4DPBX 2N3JA 2YC1A 4TUKL 3C75A 3QUXD 5DJ6A 1QA9B 2A6DB 4XO8A 4NI6A 4DCQB 3FSZA 4QHPA 1KCVH 2BRQA 2LR4A 3BVWA 4BWUA 4CC1A 3M17A 2EEXA 3DSNA 1RJZB 3O41A 2FQEA 1RZGB 5IG7B 1GGBH 2VZVA 1E67A 1NFDB 1LK2B 3JTTA 3WYRA 2I5YH 2VUOA 4GRLD 4PMFA 4KAQL 4FMVA 4YR6B 3LXAA 5HHOD 4DKFL 4TNVF 1FH5H 2J1KA 4PS3A 1PG7W 3C2AL 5A2IH 1Z9LA 2AGJH 3FQWA 4EE2A 3T2NL 2VDNB 1XMEB 4YJZL 3NJNA 1RKRA 1EJOH 4ZTEA 2FNWA 3WENA 2APFA 4K7PX 2J71A 3N44F 3U7WH 3O2WH 4KV5E 15C8L 3SDAA 1J9RA 1T5KA 3AABA 4W9FC 3WFCH 2E46A 2XTJD 3EOTH 3D39E 1X5KA 3MNMA 1X9RA 2FQFA 5I5JA 4I77L 1K8DB 1TTRA 5CEYB 4IRSA 3SDXE 1BFTA 3FZUD 2VRKA 4K71C 3CVHH 4AT6A 4DSYA 2QSQA 1CGXA 1D5ZA 2HJKB 3BIBX 4HIIA 4Q52A 4K3DH 3SKOA 2H3KA 3DRTB 1GZHA 3GQFA 3GXFA 4POZD 5F9WC 1IC5H 2N0MA 2JJTA 4HH9B 1C8QA 1JE6A 4D0BA 4C4KO 1HS6A 3HUJE 3IDJA 1TO5A 1X5ZA 3WN5C 3K0YA 1P5VB 1WHOA 2NQCA 1PGRB 4ZAKC 4ZUSA 4LL1A 3DO7A 2B39A 5BVPH 4PJ5E 4J2XA 3C6LB 3FAWA 4I3RL 3FUKA 4KXZI 2LAAA 4RAVA 5FO7A 4F7CB 2XZQL 5D2LF 5E5RB 5I6LA 3HE6A 1Q0XH 5I82A 3N85H 5D6DC 3PWVA 4GUPB 2K70A 1I3UA 3MRDB 1QHQA 3QXAA 1Q4NX 5I76B 1BZDA 4WFHD 1T22A 5FUZH 4Z5RB 3K72B 4KTEL 5J1TC 4LPVA 2EEBA 5DJZA 4NO3A 5DI8A 5IFJA 3PQYB 4XVUD 2QQLL 2YS4A 2PPDA 3G5XB 5LXGL 4POYA 2VOTA 1SDDB 3FB8B 3BKYH 5BQDA 1UT9A 1I9RH 1HKLH 5BZXA 2BDNL 4JO4H 2VDLH 1R3JB 5CGTA 5FCUL 3QNZB 4DQOH 3TOPA 3EXLA 3ECVA 3VDCA 4DO4A 3TASA 4Z3FA 1HZHL 1DVYA 1AR1D 4P5SA 5DHVB 2G5BA 2SODB 3FXIC 4OB5H 3FKUS 4NHUB 1ZS8B 3CUPA 3MJWA 2QQNH 3KPSB 4JRYB 1XF4B 3RQ3A 1ZGLM 5LKNA 1DVFD 2Y22A 2ZOLA 4LZKA 5TDOA 1UEMA 1VGKA 2IOOA 4KKLD 3BGMA 2ENQA 1S9XA 1TZ8A 3C5ZA 5GS0D 4FA6A 1V7NL 4L9LA 3SGKA 5GGTA 3U6RA 2UY7B 3PJNA 5IV2B 1HHGB 1ZXQA 4PGCB 3AY4A 1E5UI 4IBQA 1FVCA 1E3FA 5FGRA 4CVXA 4W9GC 3ARDD 1I8LA 5B1AB 1O75A 5LBVA 1DFXA 3IFLL 3HPLB 2DYPB 3EOYG 2IPUG 3WLBB 2P52A 4APQC 4W9IC 1YYMH 5DRXA 2EDQA 1BD2B 2HX9A 2JELL 4F9PA 1DLHB 1QNZH 2ZXDA 4JFXA 1LO3H 4L4TB 1I9IL 1XVSA 3QQ9D 3ESNA 3IS1X 2C7UB 4PJ8B 2H9GA 5IHUH 4KH2A 1AGBB 1FVEA 4MMZB 3AQZA 1RERA 4R7NA 4IBSA 5TF0A 4AYSA 4P9MH 3DI2B 2VC2L 2RHEA 1QVOA 2X1OA 3MCLL 1FVDB 1FZKA 3MRQA 4OLEA 3MAWA 4OLXL 1QASA 4HXAL 2R2CA 3TBYB 4KROD 2BLFA 5C3IA 3F04A 3VRLE 1HWGB 1P7BA 1GMIA 3AJ7A 4JFDB 2X2YA 2XYCA 3BKCL 1DBKL 4G5ZL 3VCLA 2YRLA 3QP3A 4EOWL 5F70A 1UENA 3WE1A 2O5YL 5EEUA 4PJAA 5J6HA 4J6IA 2CBOA 1F41A 4HX1A 4MNHB 5CEZL 1XGRB 3LKPB 2HKFL 4IGBA 1B90A 4AQZA 4EJ1C 2YAFA 3PWNB 4JG0H 4XMZA 5JOFB 3V0HA 4ZMWA 4TNEA 1HAUA 2I25N 2R69H 3H0TB 3CFDB 3KPMB 3QPXH 1J10A 2CK0L 4P2YA 4RMSA 5IQLA 1AIZA 3BWAA 3V95A 3T04D 3MRIA 2BRRH 4N25A 5C0BD 2VO5A 3DX4A 3N42F 2YR3A 1EEZA 1FFOA 4UDTB 2VH5H 2E76C 3IF1B 4ZUTB 4NZTH 5DEJA 3CPLB 3U46A 2G3MA 5CF3A 4YXLH 5GRYA 2PCPB 1QBBA 2CKBH 3HG1A 4LSPL 4X42A 3H9HB 4OLUL 1OGAA 4POZC 3UGEA 2O5ZL 4L5FE 1QSEA 4JFQB 4DIXA 5IWLA 3LH9A 4YSQA 4I48B 3T77A 2WTRB 5DHVH 3KW8A 2DBJA 4M48L 4JL1A 1E9OB 2FT7A 2VDMB 3OR7B 4K94C 3FTZA 4FC3E 1S78D 1PY0A 3STBA 4WENB 4G7QB 5DEFB 3FO1B 4U6VH 5F96L 3S35X 3C5ZC 3TZVA 3NFPA 5SWQA 4M61A 2IXQA 3W37A 1IEBB 1QVOB 2EIJB 3LMJH 3MRQB 1I8MA 4NQXB 5I74C 1MHHA 2XBZA 3MLZH 1KGYE 3D50A 1L9NA 1PIFA 1W72B 3CN2A 4OBRA 2X6AA 1H9DA 1WC7B 4FXKB 1L9OA 3GMMB 5CGYC 4IOIA 2XU9A 3UTOA 1Z3GH 1ZT4B 1U95A 4LU5L 3D3VA 1QNZL 1ZHBA 1WDAA 2AJXH 5E95B 4Z7NE 8PAZA 5AB9A 3TEUA 3B2VH 3MFFB 4DERA 1GY2A 4LPXA 5I26A 1MW0A 2H32H 4N8CH 3QZMA 4FQ2L 2NY3D 4WJG3 5I8EA 3ZDZF 5EPMA 4YEFA 4QEGA 1CMOA 2UWEE 1JV5A 2EYTA 3I84A 3KDPB 3TIEA 1KCWA 3LIZH 5K9QG 3NJJA 1T7XA 4PJDB 4MASA 5I24A 1A1NA 5T1LD 4E9TA 4OVVA 1KBVA 2IG2H 2EDMA 3E9TA 1R24A 3DYOA 5EZOH 3EYFB 4OCXL 2WLMA 3SB3A 5AW1B 5IM7A 4UT9H 1R3KA 4YX2L 1JZ8A 2HXAA 1HVXA 2OP4L 3EDEA 5E6IA 5EEXA 4OQ1A 5E56A 1R5VB 4PJBB 4NIYE 4HIEB 1RHHB 3P77A 2EIZB 5IZ7A 1GJWA 2RMNA 2YN5A 1XSIA 1T0NA 2F54D 3VI3E 1H0DA 3ZRCC 1M2OA 5C0FA 3T0EE 5MERB 4L5FH 5JHDD 1AYRA 3RY5A 1QRNB 2XX1A 4PLOB 4JE0A 3UYOD 2BZCA 1KJ2A 1GGTA 1RIHL 1Z5YD 3UTPD 5HHQB 5BXFB 4E9XA 3VXME 2ZG2A 2PYEE 4KZCA 2IGFL 3BWZA 1NGPL 5IMOA 5IIEB 4XN8A 1SQ2N 2NYZA 2X1WL 2WLYA 4AK2A 1FDLL 5D72L 5D9SB 4HKXB 3ZUCA 2VM3A 2Z8RA 4GP4B 3D2UB 5FFOA 5ESQA 4F37K 5KWYC 2PO6A 3ZDYF 2Z31D 2AK1L 5GGRY 4YE4H 1KPVA 3IDUA 1CFTB 3IGKA 3KBEA 4B9GA 2J8UE 1I8AA 1RZ7L 2Q3XA 4AI7A 3HUJA 1NLDL 4LMQE 2F5AL 1QYGH 2BS8A 1PY9A 1T89C 5FA4A 1RUAL 5D1XA 4U49A 3E38A 4AQ8C 2UVEA 3B9VA 5JORA 3CFBA 5IUSA 3O6KL 4E41D 2CMRH 2N1TE 4OLVL 2H0EA 3QDMB 3JZYA 4N0FA 3KLAB 2LW3A 2Q8BH 2VXUL 4WI5A 5D4QA 1A3QA 5TF1L 1F3DJ 4BYHA 4ZFFB 2HUHA 2Q76A 5F3HA 2GUOA 3K0WA 4B5ZA 2OYMA 1ACCA 2O6CA 3DBXB 3KD4A 4LNVA 2DQGH 5DSCA 3W9DA 1UZ6F 1UH2A 4MNQB 4AIEA 3ZYIA 2FE0A 4NM8L 4XN1A 1MH5B 3EO0B 4QRSB 5FKPA 3MV9A 1PZSA 2FHFA 1NIEA 1D5BB 2IV8A 4LARL 3RWHA 3HHSA 5DVMA 5BZDA 2NW3B 3QI9C 5D4HA 1DN0B 4LSQH 4QRPD 5I9QB 4ECNA 5KVFL 1CQYA 4DTGH 2DYSB 4P2CG 3FOMA 2NYYC 3BZFA 1EGJA 1NAKL 3NRQA 3IMVA 3L17A 1P4BH 3WEAA 1FZJB 2HRPL 3T1WA 5DVKA 4NEHB 5D7SL 3QORC 1CXEA 1TJGL 2DL9A 3ZJAA 2XI9A 3D39D 3UYRL 4JK0D 2WBKA 5FYKH 2N7SA 1TFPA 2WOBA 5LBSL 4RGOL 2GY7B 4S11A 5B1KA 1GGIL 1TSHA 1RUPL 2GSGA 4LKXA 4NO5A 1L6XA 4ZRGA 5IF0A 1YNKL 4NAMA 3RWFB 4BCZA 1QG3A 2WANA 2BP0A 3QORA 2YRPA 5E7BA 5B1CA 4UV4L 2X87A 3ZE1B 3PGDA 4WI2A 4AMXA 4YAQA 4KRPB 3LHPH 2IMNA 3BWAB 1JMXA 3AG1B 4MNGA 2PMZA 4G8AC 3AQXA 1D2OA 5DRWA 5EOCJ 2D4DA 1MFAH 3MI6A 3V5HA 2X4RB 3SDDD 5TDNB 4B0MB 1DVSA 3AB0C 5JQIB 5H8DA 1LO5A 43CAA 4K5OA 1G7HA 3UROR 2JKSA 2WLZA 3C09C 3P0VL 4P59H 4Y4FA 3GSOA 1YG9A 4UTAH 4LE8A 5C0CE 1WGOA 3Q5TA 4FNSA 4QRQA 1W72H 1NIDA 4JRXD 3OWRA 4PS4H 1SY6L 3HN8A 2PR9A 1ZSDA 4XN7A 1E28A 2Y69B 5A2AA 1MRDH 1NM9A 1OQXA 2A99A 2MHAB 1JWSB 3ORJA 3ARFB 2DM7A 3P4OB 4FG2A 4IJ3C 3T0EC 3UACA 1H5BC 1INQA 4X0KB 4MZ3A 2VR7A 4TL4A 5SX4H 3ZYJA 1TPXB 1BW8A 1D2PA 3BKMH 3U0TB 3CDYA 3C6SB 4XCYA 5HHNA 3D2UA 4OJFH 4AL8H 1U8MA 3L9BA 1QPKA 2Z4TA 3ZE0E 1I82A 3OTTA 4RGNC 3U9UB 4HA1A 1G7LA 4E41A 4HFUH 1NBCA 3UBHA 1ZIAA 4DJMA 4XMLL 2CKBB 2BIOA 2W38A 3HLAB 5HY9A 3WJJC 1HEJC 3QI9D 5C92A 2IBZX 4MXWH 3UBXI 5C09D 4XAWH 4O02A 4RRPM 2KQNA 3UZQB 2VIRA 4KO7A 4WU5A 1NOLA 6PAZA 1I1CA 4LLQB 2DQDL 1J8HB 1ETZA 2A7BA 5IOKA 4AH2B 3CBKB 2Z35B 2DYPA 1FN4B 5HD8C 1JCVA 3EOBA 3RBGA 1OZTG 1P1VA 4AIOA 1LWHA 1KNOB 4N2HA 5E8PB 5IMKB 5T33H 3SKJL 2JJSA 1WD8A 3AG4B 1A5FL 3D39B 3EJSA 1MUJB 5B22A 2P24A 3D06A 3I6GB 4K7PH 4QRPA 4HK0B 1OAKL 1YECH 2C7FA 1OGAE 2UY7A 1COBA 4PJCB 7PCYA 2AC0A 3ULVD 1BG1A 4J8RA 1WRFA 4P23B 3SE4A 5FECB 3LQZA 4WIQA 1I8KA 3V6BR 3MLPA 3KM1A 2ZAGA 3FCSB 1N0LB 4GXUM 4HUXA 1E3ZA 2F5AH 3ALWA 3PWLB 3AS0A 4GSDH 3LIZL 1OE1A 4P4RB 1I1AD 2F58H 4HGKC 2DWTA 4J2QA 4JPKL 3QRGL 3ABGA 1RZKL 2A38A 3PCYA 1RJCA 5CIPB 2IH8A 2N4IA 2Z7YA 4PY7B 4AKPA 3QYMA 3BMWA 1TZIA 3K6SA 3T0VA 5F7WC 3QBTB 5AB2A 4IOIB 5JR1L 2RCSL 2APVA 1XB8A 2CU9A 2CGRH 3DETC 5I0YA 2B1AL 1K4DB 2VR8A 4GKSB 3BSGA 1AGFA 3KYNA 5CCKL 2WZ5A 4L8SB 5SV4A 1CF8L 5FUCC 1OT4A 2F19L 2IFFL 4HIJA 4NFCA 2YRZA 4XZ4A 1QZNA 3RP1A 1CDIA 1VEPA 1P4IL 4IBLT 2BPBA 4YZWA 2BO0A 4ZUSB 3U9PH 3UAFA 4DZ8B 4K8RL 4NQEA 1CG9A 5I0XA 2RD0A 2V7NB 3MCKA 4N22A 1EVTC 4FHKA 4ENEC 5DJAB 3WHE1 4WI8A 5T3ZL 5DUBA 4GW5B 4QCIA 1U3NA 5IFHH 2IDFA 1DLFH 4YZFE 2CKBL 3LDBB 5CNHA 2QTEA 4DGVH 4GSDL 3LNGA 1SXSA 4OIBA 4Z7UA 3SCMC 2FX8H 4MHHG 3BVUA 3U2JA 1LE5A 1MFBL 1T0PB 4JFDD 2CG9X 4Y2LA 4XRCB 4W9LC 1PZ3A 4BRJA 1IM9D 4U3HA 2ZAIA 1UM6L 3EH2A 1Z5LA 3F84A 3TH3T 4GIOA 2OFQA 1PZCA 2M8XA 3N5AA 1QLFA 5F93C 2WVTA 4ORGB 1HWWA 3V0WH 3B7SA 4FABH 2QJDA 3VCLB 3IU3B 1RPQA 1Z3GL 3QK0A 3T1FB 2X4UB 4YUEH 3RB5A 4PJAB 4JM4H 1A9BB 5LAPA 3MRHB 4IMLB 1OSPH 4L0PB 5HYIA 1SM3H 2JQZA 5LDSA 1HNGA 2J1YA 4GBXB 4RRPA 2AQ2A 5FS5A 1EXUA 3FQRA 3M17B 5AKRA 1QSFD 3R4DA 5FKAA 5A2LH 3BWUC 3GB7A 4PRBB 4OGYH 2WUBH 3S3DB 2PYFB 3PQYE 2ZWKA 4FD0A 2WNGA 4JN2B 2YMXH 4JFDE 5FWRA 5ETUB 5B1JA 1CFBA 4EEEA 3TS8A 4HLZG 4AL8L 2H1PH 5GRJH 3QH3A 2D2CC 2VLRB 5CJQH 3ML8A 4HOXA 1CLCA 2E9JA 1J12A 3UG4A 2QELA 3RY6A 2R0ZH 5A1AA 3X3FL 2CJ3A 4OF0A 4ZMYA 4BA8A 3FTSA 2FSDA 1MCHA 2Y5EA 3B2UD 3BW9A 5A2KH 2WZ6A 5C07B 2OSYA 3BO8B 3GI8L 1MCPL 2VISB 3MJ9A 4X8JB 3GMPB 2J5LC 2HPTA 1IBGH 5L0QB 5J1AB 1U91B 4HMDA 4I89A 5GGRA 3ZPDA 3MR9A 1CDGA 1Y0LA 4PV9B 3FONA 4Z8FH 3VG0H 1WF5A 1H5BB 1ZDQA 2Z31A 5HHOE 3ULUL 1R19A 1H8NA 1HOEA 2WQ8A 1DBBH 4M4RB 4F58H 4N0UE 4I1RA 2A74A 2ESVE 3CN3A 2EXYC 3O6FB 2GBTA 4N0YH 3ZR6A 5K93A 2ATPA 1UH4A 2X6BA 1S7QA 2HH0H 4GBXD 4U1JB 3DIFA 1JGUL 3LH2H 1GJUA 4KHXH 4TF4A 2JQAA 3CSBA 3EFDH 1IB5A 2XIBA 1OAUH 5IHHA 4KUCD 4YBQC 4TOYH 1X9UA 3V6OA 3MOBH 4X7DC 2F74A 3IJHA 1FYTD 1PL3A 5D7IA 2V6HA 3EKCA 4XPHL 1W72L 4C56D 1TQCB 3IGFA 3N2JA 3VACA 3GXTA 5C0BB 4OFKA 3LRGA 2KI6A 1QQDA 2DS4A 2DIEA 4MS6A 3UYRH 3P3SA 3WELA 1OCZB 32C2A 4X4ME 1NEZG 3S98A 5HDLA 1NWPA 1BQ5A 3VGHA 5L4JA 2HG5B 2W0PA 5EIIG 3EF4A 1IM9A 5TE4L 4B3EA 1A65A 2Q10A 4LLMA 2VZTA 4KNSA 3AM8C 2NY1C 3ZT6A 3CDGB 3LHPL 2J55A 2QT6A 4E2OA 5JDSA 4OU3A 1ZA3A 1JYNA 3O3EB 2WXFA 1IGIH 4FF9A 5TK4A 3N85L 5C0GB 4V33A 1W15A 2VE6A 4M1GH 4PJHA 4QTHB 3BUPA 2DQEH 5HGDA 1FLTX 3KPOA 3EO0A 1BXXA 4QRSA 3L9RA 5FKPB 4D0CA 4JO8A 1FQ9C 4HUVA 4LQ1A 1BOGB 2CIIB 3AT8A 4AGPA 5I66A 3MDJA 1SMAA 2EC8A 2CXGA 4YSRA 2NX5E 2C3GA 1XTLA 4MJ6A 5L4IA 3BT0A 5JW4R 2W65B 2XN9B 2WXPA 1AS7A 2XQYG 2CH8A 3IDIA 1BGXL 1PQZA 3FTUA 2VR5A 4XCEB 2GAZA 2Q7YB 3SJVE 15C8H 4WLCA 5AUMA 2LE9A 3PHSA 4ODUA 1JPTL 2YA1A 1ORQA 1S7TB 1M7IA 3K8KA 5J3HD 4JG1H 2VLJB 2ZKXA 5AW2B 4LVNB 3GMRB 4PJBE 5I6XC 5EN2A 4HKBA 4F9LA 2CDEA 2FWLB 3MBEA 4AEIL 5C6WH 4FGMA 1F58H 1RZFH 4ZX6A 3GM8A 1F4WH 5F0PB 4K9EC 3BGFC 3O6FD 2P9RA 2V9UA 2L4OA 3A67L 1NPJA 3VO0A 1TZHA 4AVKA 3TEWA 4FXGC 5F9JA 5H94A 1NPUA 3PWJB 2BNQE 5FAAA 2HFFA 3CVHB 1KC5H 2NRDA 4WWOA 2ORBL 2HG5A 1T3FB 2KZKA 1J5DA 1D9KA 1DHKA 3O2DL 4IMKC 4UILL 3W2DL 5T3ZD 2K8QA 4EIBA 2ENJA 5K39B 1DVFB 2XWEA 3GSRB 1MFMA 1Q0XL 1QSEE 3GJFA 3F7RA 3KDMA 3BCFA 4NZUL 1RIUH 2XNAA 3V4UL 2YHGA 1UXLA 2YC1B 3D33A 2EIEA 3GC3A 3IGAA 5DJ6B 1JPST 3ZYZA 3SHSA 1CURA 3KWVA 3HKFA 4DCQA 4EZMA 5BVJA 2J8UB 1F4YL 3FO2A 3KWWB 1RMFL 3U0PB 3NRFA 3V55A 4JX0A 3GMOB 5IBUB 1I3GL 4QMEA 1F4AA 1NL0L 1Q9LA 2FJSA 4GEIA 1MQKH 1VGEL 4OZ4B 3S34H 5ILTH 4XVSH 2KS0A 4BZ1L 4N87A 3ROOA 4R7VA 3K5SA 4Z95L 1KIPA 1KGJA 4S1QL 5C9JB 1Y18B 5HHMB 1TCRA 2EDFA 2Y2YA 4IKLA 4PJHB 4QTHA 2ISDA 5BS0B 3EYOB 2QKIA 4HS8H 3NABL 4OD3L 4G42B 1PX3A 3FFDB 2LLLA 4P0DA 3Q1SH 5J11B 1Y0LB 2Y5TB 5I28A 4MX7B 1A1NB 1AVAA 4Y16A 3RUGF 2GK0B 3BWUF 4G6JL 2BC4A 2F53A 2WV3A 3PG2A 4Z7VE 1R3IL 2DJMA 4YE0A 2RACA 1R5IA 1DBBL 2XRAH 1NAML 3O3UN 4YDVA 2D9CA 4OTXH 2DIBA 2PPEA 5D1ZD 5DVLA 3PV7A 4QGYA 1KBBA 4Q58C 2C9XA 4HSQA 1MHPL 4XC3L 1CR9H 4U1GB 3ZKXB 1AJ7L 1M7UA 2BXZA 3CIAA 1IMHC 1MJUL 1W0VA 2ZSWB 4LOVA 1AQDA 4EQ2A 4HVBA 2PW1B 1U36A 2HJFA 3QIWB 5L6YL 4EDXA 5C0CD 4U2ZA 1KBKA 2UXGA 5DJ8B 1OW0A 5TPWH 4B0MM 3QFGA 5J13B 4M5ZL 1X5HA 2IALB 2FECL 1KTDA 1MVYA 4AENA 5GZOD 2EH7H 2MPVA 5ITBL 5ALBH 3RUGB 1A9BA 4JM2A 4TLUA 3D09A 1N6UA 2DQJH 4RGND 4KKCC 3TLRA 5J6GA 3QEGH 2OTWB 5GGQL 3N1QC 1E28B 3WUWG 5IQ9A 3ZE1E 1BPVA 2X40A 1MCWM 3FUHA 4B27A 1UGNA 4Q9QL 1U8HB 3T65A 5CLYA 5AFAA 1BVOA 2AXGB 4UTBH 4HC1L 1OAYH 3MJ8A 2NTSP 2AQPA 2E9WA 5H35A 4K23H 4LT7A 1QNIA 4LSRL 3DXAD 2OL3H 4FABL 1D6EB 5F71A 1SBSL 3MRCA 4JG0L 4FEIA 1BLIA 2NMSA 1SXCA 1WUZA 4N4YB 4KKCD 3KPQB 4FTVA 2DI9A 4LCWB 5CP7B 3KLLA 4OUUA 3WKQA 2UX7A 2XOTA 4HYTB 3BRFA 1DJSA 3RGBA 4X4XB 4RMRA 5E99L 3FT3B 3MUY1 4FQIH 1VSCA 1GS8A 4IOSD 4XN5A 1KTLA 1BAFH 4B60A 3RFZA 4HJIA 3TEYA 2YPKB 3VFTA 1GAFL 1EBAA 3QJTB 3UZEC 4NZ8A 5FA3A 3QA3B 3HE6C 3GSNL 1PAZA 2KLTA 3MV9B 4FFTA 1BLNA 5LGKA 3M1CA 3IAPA 2WSKA 5DJ8A 2OK0L 2CBMA 3A24A 4G1EB 5JPMB 4AQ1A 4UOQA 1JFHA 5IMOB 1A7QL 4EXPX 4F7MB 1CD1A 2OMVB 3AREB 4LKCA 4R6UA 3S5ZA 3SYAA 3WFEH 3DHJA 2WB7A 1M71B 3PNWB 3X12B 1HK6A 5F7MC 1JXFA 2C7UA 1TF4A 1YEIL 1IGCH 2V8LA 3Q8CA 3QIUB 2DWEB 3WFHB 1A2YA 3DX6A 2Q76B 1QSFE 2YPVA 5C8JA 4Z7UB 4G5ZH 5KUMA 2ILLA 3CXHK 3BXNB 3DX7B 4UILH 1OALA 3TA4D 4HIQA 4ZMPA 1MDAA 1GSMA 1SBSH 3KR3H 3DTXA 3MGOB 3GRWH 4JQIL 3HZ3A 3P0GB 4HEPA 4QT5A 5B7FA 3OKMB 4BFIA 4X6BB 3AAZB 3FTGA 4IK6A 2BS9A 3NDYE 4BKLB 4X83A 1DQDL 4PV8A 4MJIA 1A6ZA 1DDHB 4PVBA 2K4WA 4WWKC 5BS0A 3RFZC 4HIJB 1A1OB 4FXGB 1L7IH 4GOSA 2XQBL 4NQVA 5DJCA 5K1NA 4OQTL 3UAJA 2JI2A 2VABA 1ADQL 4X7SL 2MKLC 4EDXB 4EI5A 1MWAL 3NEOA 3STLB 1A4AA 2A1WL 3WEBA 3CFIC 3UADA 3VGBA 4NUPA 5KYXA 1QKZL 1EUUA 4UIKH 4JAMA 2Y36L 2WMPB 3EH5B 4N3UA 2J3SA 4I77H 1KYDA 1FIEA 3EH4B 3ZKNC 4PRNA 5HP5A 3KPTA 3KBHE 3KDMB 4BUQA 1T7YA 3A67H 3FB8A 5GJTL 5D4IA 4UUJB 1OM3L 2P26A 4MMXC 2EUXA 1HX0A 2VB5A 4NNPL 1OAZH 5KSAA 3DJTA 4JHWL 1FYTE 5D7EA 4UT6A 1ZAGA 4ODWB 2VQ4A 1G7LB 3BAEL 3DUSA 4P9HC 4P48A 2FEEI 5DU7A 1WT5A 4NKIH 3QDGE 2Y5TA 1AHWA 1H3UA 1R4XA 3KPSE 3WXVH 5J06A 2D7MA 2LU3A 3SBQA 6PCYA 5SWSB 4BCYA 1JPTH 2X2JA 3E2HC 3ARFA 3P4OA 3MA9H 3H9SE 4O5LL 3T77B 3V4UH 2CGYA 3UO1L 1GGBL 1EZSA 2CO7B 4RAUB 5SWSA 3VI4E 4CJ1A 2SEBB 1EHKB 5KG9B 8FABB 4M6NH 1JJUA 2EUZA 3PAYA 3C8DA 4L1BA 4IS6A 1FCGA 2WIMA 3ASNB 1XWVA 3H2QA 1CVSC 3D7PA 3OKNA 4D3CH 5ITFA 1QP1A 5A7EA 3WFDH 3OG6B 2EDRA 3MXVL 1QSZA 3VXSB 3BH9A 4HQQL 2DEYX 2NR6A 5FYLH 5E00A 2PTVA 3JT0A 4H1LG 4WF7A 2IGLA 3V0JA 5I30L 2UXVA 2XN0A 1KXHA 1OOAA 3H8NA 5LGHH 2GK2A 2VT0A 3DGGA 2EINB 3QIWC 2G2RA 1WWBX 4RSYA 5CINL 5FX3A 1NC2A 4QTIL 2QV2A 4B9JA 3ZL1A 2QKIC 3OX8B 2NY3C 1UOLA 2NY0D 1I8MB 3ABKB 4K71B 4KUCF 3WFBH 2R2HA 4PVLA 3D6GA 1S7VB 3BVTA 4JMXA 3VFWB 4QHNB 3NA4A 1YMME 1B9KA 5I1IH 5DRNB 1NLBH 4NQVB 2E9IA 2EVIA 5F89A 5JDSB 3S2AA 3UTTD 1KTLB 3S9DB 4TNVK 1PZ5B 3S35L 2WXGA 4HS6A 2NT0A 2FATH 4WO0A 2QEJA 4PCKA 2XPGA 4S2SA 1ZANL 1DN0A 3CFCH 4XHJC 4HKBB 3QJVB 3VFGL 3D9AL 2IDUA 3QRLA 3VGAC 2I69A 2WUCH 5GGSY 1LEGA 1WEJL 3NCCB 4OT1L 4JQXA 4OAWB 1JNHA 1DUZA 1KT2B 4R2GB 1FHGA 5BUAA 1FNGA 2F8IA 3B9AA 2MQCA 3G9VA 5ERWA 4R4FH 2IDQA 4Z7VB 4LCWA 1CFSA 4PW3A 4BSJA 2HKHH 4DF9A 3ZW3A 2IMMA 4U6TA 5BV7L 5C9KA 4IKIA 4NFDA 3TA3C 3N1MC 4A67A 1WLHA 2C1OA 1D6EA 1MCFA 2GJPA 4QUOA 1FV1B 2DQMA 2AEQL 5E4EC 4LVNC 2XWBA 4KKZA 2FO4B 2O72A 4QKTA 1QYGL 4KROB 5JHDB 4HX1B 2MOQA 4MNHA 1YEGL 4G8GA 2G75B 1KJMA 5EU5B 1HZKA 3FO9B 2BFVL 4FQLL 3U48A 5HJBA 1HYSD 4LCUB 3BP6B 3BWSA 4KKAC 4X4YB 4WI9A 3MRBA 5L4FA 4TVPH 4QRRA 1SF5A 4BELD 5IJKC 2Y7QB 2Q8BL 1ED3A 2DMGA 3C5ZB 5IB2A 1FDLH 1KTRL 2B77A 3RGVB 5EO1B 1DUYA 2NXYC 3WIHA 1IKOP 5D7KD 3HMXH 1ESOA 4DO5A 1PCSA 2DQCL 2OSXA 3BFQG 2OAAA 3TURA 1VPOH 3N04A 3SE8H 1W0VB 1BQHA 4JO3H 4ONOA 3BPNB 4PWJA 3DOIA 2QFRA 1MIMH 2PW1A 1KB5H 4WNQA 3V0IA 2CDFB 3TBTB 1LO4L 5DS8B 3HRZA 3FB5A 3IFNL 1GYWA 1R46A 2XKNB 4NM4L 1AXTH 2AQ3A 1JV2A 1T6WA 2H32B 1PFOA 5DRXB 3ZMNA 1OPGL 1S9VA 3QHZL 5BV7H 3EYVA 3K3QA 1VCBC 4YSUA 1A4BA 2Y7MA 4Z0XA 3P54A 4WI6A 4YX2H 2LU7A 3VFPB 1WYJA 4HGWB 2FJGA 4UT9L 4ZUWA 1UADC 2NOYA 1KYOJ 1SJMA 1H6EA 1V27A 2HLFD 1J0ZA 1TQVA 2R0ZL 3L54A 3MJ7A 4FQ1L 4LVEA 3QZPA 3FUMA 5IV2A 4BFEA 2YEVB 1W2KT 3IDNB 2XN9E 3KL3A 1N2RB 2WWKT 2K8MA 3MCYA 4HKZA 3HUJB 2FX8L 3MV11 4HPYL 4WFFD 3GKWL 3HI1B 5DT1H 3TCTA 2WQRA 1ZWIA 3IDMA 2W95A 1Q9OB 1RVFL 1S3KH 3MRPA 3QO0B 1PF3A 3K2MC 1XDTT 4AM0Q 3WL9A 3N41B 2V7HB 1K5NA 3CPUA 1SN2A 2EJ1A 1KV3A 3IFOA 3O3BB 2RQEA 1EPFA 3LKSA 2R15A 4B97A 2F8OA 3NQKA 4OGZA 5JO5B 3ECBA 5I17B 1ZSHA 4NOBA 4M56A 1BWMA 5EDSA 4DAGH 3RL2B 2AZUA 1DQDH 3TF7C 1AO7A 1DVFC 4MJ2A 5EIIA 3OJDA 2N01B 5E8DL 3SQBB 3WKMH 4HUMB 4PREB 1KIQB 1O7DC 5IFJB 2IPKB 3F8UB 3EHBB 3IVKB 4Z23A 1E6JH 3F65A 3MLRL 1WGVA 4AJYV 4UTCA 2XETA 2QKSA 3FO0L 2OZ4H 3QW9A 1DQQB 2A1WH 1ORSB 1XGYH 3MRNB 4YHIB 4WUUA 5DJCB 4YXHH 4ORGA 4LLYB 5CU9A 4PJCF 1S7WA 4W9DC 2YJLA 4X6DF 2XY2A 4YDNA 4JRXA 1U8LB 4GIAA 1OY3B 2CPUA 4JM2F 3EAKA 1G7MA 3OLEA 2AZAA 3C5JB 5DFWH 3IXAA 5CS7A 3MRKA 4RVBA 3RWIB 2Y6SC 3ME0A 4MDRA 5B3NA 1I75A 2Y7LA 3ESMA 2MOGA 1W0WA 4LLWB 1KBWA 2DQTH 2HVKB 3FT2B 3O8XC 5JUEL 3V5KA 2HX8A 2NR6C 5AOMA 1XQ4A 5EPMB 3UAAA 3GXPA 1MPAL 2FD6H 3NIDE 3VXQA 5DT1L 1JZ6A 1RIHH 5J8OA 1CI3M 2LT9A 1Z0NA 2FK9A 2UZXB 5DUBB 1NTDA 3U30C 5AVRB 1RIVL 4KNQA 2G3XA 1BD2E 1MG3C 5DZAA 2PWFA 4PQXA 1JPGB 4DW2L 1NCUA 1WC7A 5FHBL 2WQUA 4W9ZA 2WN3A 1MRDL 5SWZA 2OK0H 3VDBA 1HQRB 1BQUA 3HZMA 4NWUL 5E1GA 4Q56A 3OZ9H 3WOVA 1H8OA 2Y25A 4JPWL 2DMHA 2JKIS 3Q1EA 5CGYD 4X6CE 1NDMB 3PUCA 1G4RA 4LQFH 3DX3A 2DTML 3JWDL 4PREA 4R4NC 4P9ML 4JB9H 4NQCA 2NY6C 2DM4A 4JZNA 1XSOA 2IG2L 4KKNA 4QHUB 5HVHC 1NMAL 4OVUA 2HX7A 3CH1A 4W9HC 5EBGA 4Y19D 5C6TL 5CIPA 3GRWL 3UTQB 4BQBA 1A21A 1YPZA 2EP6A 4RQQB 3LPPA 3VU1A 1V7MH 4NP4L 5M94B 4WEBL 4XPFH 5AUMB 2QPDB 3AWGA 1C7TA 5D7IB 5EU3B 3WTYA 1FZMB 1DJYA 3ULSA 4OIIH 1X5JA 3B2VL 4NPKA 2J1ZA 2ICWB 4WQOA 5CSZA 1JBJA 1J0YA 1K5NB 5HDBE 5FECA 3WTVA 4I7ZC 3ETBF 2OI9C 1M6UA 5GIRA 3NK3A 4CU6A 4M3JA 4HUVB 3HRZC 1JHKH 2AEPH 5FF6A 5LGJB 2FYYB 2GCYB 2V2WB 4HW6A 1O9WA 4H8UA 4X50A 2BCKB 2RFXB 3VWKB 5LUMA 1EAPB 4TV3A 1CFNB 4AIZA 5C0GA 4BM7A 1SDYA 2ZUVA 4JN1H 5C07A 1J9CT 2QZ5A 4AENB 2EIBA 2Z35A 3DJRA 2ZX5A 5ALBL 2IF7A 4HAGA 3SO5A 2XKNA 1XEDA 3SPHA 4DPAX 4NHCL 4N3TA 2V5MA 1FG2A 1FPTH 1FUNA 2KZ1B 1UVQB 4PJ9B 3DURB 3QR1A 5BO0D 2I7SA 4MA7H 1Y6NR 5DD5H 1WSST 1BQHB 5D7LB 4DOHE 1LQBC 1HC1A 5EH1A 35C8H 3CVIH 4WNQB 3UP1A 3ULUD 4L4TA 1WAPA 1EXUB 3FQRB 4FYTA 1UJ3B 5I5IA 3NVQA 1UD6A 5GGVY 3ATAA 1CL7H 3PABA 3HMXL 2BINA 1MCBA 3SJVD 1ILSA 2IADB 3TVMC 1OPOA 3VW3H 5FW8A 3MA7A 5IB5A 3WTXA 1B0GA 3IXTB 1NGXB 4FYSA 4BBWA 4CSZA 2VITA 4I3RH 4IRSC 3TPKA 1N9PA 1VPOL 1HHKB 1U42A 3A0OA 1II4E 1I85A 4L1DA 2AXFA 3WG7B 4GQZA 4F5CE 4XWOD 1QSFB 2I9LA 3GSWB 4YNYA 4N2EA 2EILB 2GTQA 2AV7B 4F8TA 5K9OA 3MO1B 4QYOB 1WZMA 2N0KA 4KMQA 3BVNB 5IHBA 4LSVH 3LKNB 3SYCA 4HPHA 5ANHA 2D7QA 4DESA 4GRLB 4PB0L 3RURA 1KEGL 5EZIH 4GEJA 3V5DB 2ENPA 5BNXD 1AH1A 5GRWA 1BM3L 2PKDA 5T1KD 3VFSA 4ZFFA 4PJEA 2AQTA 5CJXC 2CHDA 2QPFA 2CDGA 2GJ6D 1HQ4B 5KTEH 1WBZB 2Y2WA 2YSTA 3LDBC 4ODTL 5BVJB 5K9JH 2R0LL 2G4EA 1VEOA 4Q8BA 4QOKE 4Y2DB 3V0AC 2F8VA 4GW4A 3EYQD 2A0LD 5IVOA 4HOWA 1I1RA 1IARB 5JORB 2MQ3A 2WPGA 1NEPA 4K73A 4UBDD 3VB8A 5ACLA 1KULA 1LO2H 4MLIA 1KB3A 2HRGA 1EFXB 5TDPB 1EHAA 4JJHA 4I18A 1UWXH 4X5LA 5LN4A 4Y4FC 4DEPB 5C7XL 5IGXH 4MWFB 3T3PE 3EG9B 5EUOE 2ZWSA 4JM2C 2PABA 4N9GA 1U8OA 1S3RA 2XV6B 5D2LA 2D3NA 3T1FA 4U6YB 1V55B 2F2HA 4FHBD 3QEQA 1CFTA 3V79C 2EO9A 4FQJH 3FBQA 3VGFA 4UIMA 1P4LA 1FSKB 2OMYA 2JJWA 5D2LB 1ZHNB 3GINA 4F2MA 5F7UA 3O45A 3OKOB 5GS0L 1N59A 2DM3A 2FJFB 4G80B 5D9SA 5J9PA 3VRJB 5GPRA 4OJCA 2XQ0A 5I73C 3BAJA 1FIGL 1L9SA 1YNTA 3BN3B 3HIZA 2DLIA 5J11C 5CSGA 3VGEA 4APXA 3GBMH 5KAQG 5EIIB 5AYUH 3LZQA 3C08H 1D6VL 1ZOXA 2YA2A 2PCFA 3F12B 3P2TA 4L37A 4Q9BA 4OB5L 5E00B 1HXYB 4MCYB 4NC1C 2OMTB 1WWCA 3ARED 3OB0K 1UZ8A 4FFYA 4KY1H 3ABMB 2EYRB 1KN2H 1M6OB 2ZOWA 4X9FA 5I6XB 3BVDB 4Z7UE 4LHUD 3WNOA 2VDOL 3IJSA 4HCFA 3IT8D 3UYPA 4QXGL 3TTYA 4Y4KD 4FLRA 4U3SB 1IGYB 2OI9B 2GSMB 5GRUL 1RULL 2YEQA 1MCQA 5KBLA 4R7DA 4S1SH 2R0WH 3QUYC 5I1CH 4QHMA 2V5RA 3NACL 3VNZA 4KK8D 3ZQXA 4TSCL 3WMQA 4F24A 1VCAA 5JLZA 4MQXC 3BQUD 5T3ZE 4WNSA 4YQXH 3BPCB 4FQHA 5FV2A 4XMVA 3ABLB 1OGSA 2X4NB 2YFNA 2CJUL 1B0GB 1UB5B 4KMTL 5HJDA 2XTSA 2BRRL 2YXVA 2EVJA 3D3VE 1CGSH 1V10A 1CLZL 1D7DA 1YMMB 3NCFB 4GG6A 4KZDH 4CMMA 4JKPH 1F2XK 3TBTA 1UB5A 3BN9C 2K7PA 1U8NA 2J20A 3CZEA 1T89A 2OMUA 1CGYA 5I1JH 3D0LB 3G6AA 4WJ5B 1ECZA 4Z3IA 4ZW5A 2BSTA 2X42A 2VKXA 4QY8A 2HLAB 4BWTA 5HHNB 4F2ME 3SKMA 1IAOA 1P1ZA 3DYMA 4HAFA 4POUB 5F44A 5IEHA 4HLEA 3P4NA 3PL6A 5HGAA 3I6SA 2QQQA 1BVKB 1DUYB 3QHFH 4F27A 1PJ9A 2FZ3B 2DRUA 5EF3A 1A8JH 5CN2A 4MYWB 1WS7A 2AVGA 4A2GA 1OARH 4P2OB 1TU2B 3PJSA 3TBCA 2XHNA 4PI2A 2IIJA 3EJRA 4YSDA 3MBEC 3NAAL 4LCCB 6CGTA 1CFNA 1BG9A 2QADC 1PLGH 2R0KL 2WYTA 1H15A 5C0CB 3GHBH 3T2QA 1XGPB 1FH5L 3B5TA 3BP4B 3IU4L 2AEOA 1KB5A 4Y5VA 4I0PC 5B21A 3O0LA 2ETWA 4KGJA 3ARFD 3JVFC 1SLXA 1WG3A 5IMLA 1U4EA 2D7NA 5D1ZB 1AOZA 4XPTL 5FUCE 1QSVA 2BIMA 3BD3A 4HGMA 4PUBH 4X6DA 1XXDC 2GBVA 4DVBB 3GUTB 1IJNA 1AI1L 3R0MA 1UYWL 1KJ3H 4IKJA 2F7OA 2WSDA 4YHNA 1B2WL 4LBEA 1UM6H 2DJUA 1WZKA 3G5VA 4X98B 2E7LA 4L4VB 3HZYA 5JHLL 2QLVB 4DUXA 1U8MB 5E0QA 5C08D 5T1KB 2YD0A 2ICWI 5KBKA 2NSXA 2VXVL 3V0VA 4QLWA 4QRUA 5DC2A 3BISA 1DQIA 5HHMD 2IO5A 5C0ND 4Y1AD 2ARWA 3DHPA 4X4XA 2PXYB 2Z9TA 5IVZA 1MHPH 4QRUB 2A6KA 3VG0L 3VE0A 2KZWA 3TGXA 1DJHA 2OTUA 4I9XA 1CTNA 4JANA 4NI3A 2JCCE 4BFFA 3CCHA 3DOSA 4OJYA 2CO1A 1CD0A 4DPRA 1G7IA 2A77H 2J12B 4ONFH 3TN0D 2XPZA 2VDPH 1MFNA 3QXUA 5F1NA 2GUOB 4DGYL 3BD5A 4F3FA 3WMSA 3WUZA 4UT6H 3ARDC 3NCWA 2JKLA 3BDYH 3VWJB 4LPCA 4ANWA 1SBBA 2J1XA 2BP0B 3VDAA 2ESVA 1QFPA 3GBDA 1YMHB 2G5RA 1WBXA 2LOEA 1B6UA 4OZGE 4C59B 1UATA 3RWEA 1Z9SB 3VAEA 5KG9A 2AXFB 3N41F 3IBEA 3MROB 5I71C 4RH4A 4AKQA 3OPZH 4F93B 2V2XB 2HTKD 2H3XC 2OTWA 4I9WD 5DZNA 1UUSA 4KX8A 5J0BA 1R3HB 2ZSVB 1ANUA 3Q2LA 2EDTA 2GJRA 3QJSB 4H40A 1VGKB 2WK2A 2HLAA 4KO6A 4ZW6A 2VDQB 4XNYL 4D2NA 1G87A 2EH8L 3RWHB 1P1ZB 1KBPA 3NIDF 4WU7A 3DOHA 1VESA 5BZWB 5EZLB 2BW4A 3ZO9A 2Y0SA 5C0BE 2X4OB 5DVOA 2H47C 3RVVD 3CZNA 3NJVA 1UOKA 1F8TL 1S78C 2R9HC 3G6JB 3SPCA 4GG6B 1KEMH 1Q1JL 3WO3B 43C9A 1TSRA 1TYJA 1RK0A 3IM1A 1P2CB 1CYGA 1USQA 1CDCA 2VR9A 5IHLB 3PY9A 2AJYH 3S5LG 2FEJA 3TXAA 2BNQA 1SN0A 5AAPA 2YMOA 3QAQA 3RVVC 2OW6A 3LEVL 5JIMA 2W07A 3K72A 2OR8A 1QRKA 4U05A 4Y19B 4PJ8C 2EEFA 2ARJB 3FK3A 2DJSA 3QUMH 4OGXH 3W82A 1U8KA 2BY1A 1WFMA 5AZEL 2V2WA 4H8HA 2L7EA 3U6RB 1QRND 1T1ZA 3TWYA 1INDH 1TYEB 2VR4A 4LRNL 3ISYA 4KZ0A 1ETA1 3FQ4A 3GT6A 1RH8A 1U8KB 1UWGL 4MA1C 2WZ0A 1NUFA 5I1DA 2FUTA 5HHOA 4CNIB 5C86A 4HHGA 3FU3A 3O9WC 2J8OA 3GJFH 1ULVA 5HPOA 3WIHL 3ULSB 4JR9L 3W0WE 2XVBA 4LHJB 2R56H 4ZBJA 4B9PA 3AU1A 1AHKA 3WKNA 4DGUA 2Z8WC 3KLSA 4L4TD 2EYTB 3QB7C 1XF2B 1J1XL 3P4LA 1QD0A 3IJ8A 4PD4K 1RIUL 2F68X 3TPUB 2HTLD 1NAMA 1S7RB 2ZOOA 4RLDA 5C0EA 3F83A 1D9KB 3TV8A 4ZZKA 5I6NA 1MNNA 4UQAA 4FLQA 3GSRA 4ELKA 2EIMB 3L2LA 3OQ3B 3GM0A 4NO0A 3VRJA 1M7XA 2NY2C 2YZ8A 3DV6B 3GMMA 4FFZA 3IFNH 2Z6FA 1C12A 4P59L 4ODXA 1OTTD 4ETYA 1BCIA 1ZY9A 3DLQR 5C6PB 1UOVA 4D9LH 1T22B 12E8L 4YSOA 5I2IB 1VEMA 3E0GA 1SVBA 4NOFA 1BQLH 3P11L 4IHOB 3BLKA 4OJFL 5ABAA 4TN9A 5M95B 4MXQD 4ZI8A 4HIEA 3ZKQD 4LRIC 2YPKA 3KLDA 4PYHA 3VFTB 4HCIA 3MBEB 2ZKMX 3OAWA 4L9LC 1JPGA 2A9NL 3RIKA 3SGKC 3VH8G 4KVNH 4ZFGH 1I1YA 1AFVL 4HJJH 5FOJA 4PV8B 4UQEA 2BVOA 1B2YA 1F1DA 3L5WA 4P9HH 4H88H 3IMTA 1QPXA 1E4KA 5GS1C 1U92B 2YUZA 3H55A 1BZEA 1AO7E 4WEMB 4UTAL 2A9MH 2DH3A 4KUZL 3ESPA 1SHSA 1RJYB 5C71A 3GYRA 3OR6B 3FU8A 1RLBA 3EHBD 5E6SB 4IYKA 2CDGB 4CU8A 4JG1L 1XF3B 4OZGA 5EU6B 5FK9B 4LSQL 3ARBB 3RWIA 2A73A 2X1PA 3GBNH 3L9RB 1ODUA 3TBWA 4D0CB 5JIKA 3EFFA 3MX0A 3DECA 4JREB 2BZ7A 4PRPE 3DK0A 4NWTL 2C4XA 4U0QB 5F1KC 4ZMQA 5T3XL 1PZAA 1QSFA 2I9LB 3M46A 3TWCL 1K4CA 1RFDH 1DQVA 3POHA 4LCWE 5KJRH 4NRXA 4XMUA 2BHFA 1JNNL 3VFMB 2ZJSL 5GHWL 4E9YA 3LQAH 1HHKA 1TJGH 1BQSA 4XNUL 5E2VH 4YMPA 2JWYA 2OJZH 3HI6L 4YDJB 1SJVA 2WKLA 5C7ZA 3K81A 4RDQF 2JJTC 4M7JH 5IVXB 2ZOKA 3ROLB 5DHYA 1RU9H 1KTDB 2LQRA 3DX2A 4XVUC 2EDKA 2MIZA 4QO1B 4Q6KA 3PL6B 1NUGA 3AXHA 3NOIA 4WDIA 3B9KA 5DHDA 3MRJB 4ZOAA 4LVHB 2WINB 2XFXB 1XSJA 4F80A 35C8L 3CVIL 4TQPA 4ETQB 1GZPA 1GYAA 4NUQA 3D2TA 4XNYH 2MCMA 1E90A 2M1KA 2VLRE 3EO9H 4ZAKD 3VYNA 4NBYB 4HJGB 1ZLDA 5D2NB 2ZONA 3W56A 4ODHL 1H3PH 3KPPB 3HMXA 4FFWC 4U4IA 3FH7A 5F7AA 1Q9OA 4NC0B 3ZQ9A 3QJRB 2F53B 4V1DE 3ZOAA 3CHSA 1H5BA 2WGNB 2VDKL 2WXKA 3QG6A 2YPLA 4X0NA 2PO6C 5EF1A 4L4TE 4PBWD 1JFQL 5JPNC 2R39A 3BQUA 1VFBB 2WCGA 3L5HA 4XNXH 4MQXD 1J0JA 3C5SB 2EO1A 3JWDC 3L7EA 1GRWA 4N0YL 1MFCH 5I18L 4ZNEE 5DTFB 3C60A 3NN8B 2VDPB 3NSYA 1UCBL 3FDWA 3QUYD 4X7TB 1CJYA 1UWYA 4QOKB 1KN4L 1N6QL 1X4ZA 2FLMA 4MAYB 2LV4A 1SOKA 2FAUA 5J6SA 2LGNA 3QUXB 3U83A 1ZT1B 5HGBB 2B5IB 3DUUB 2JXMB 3BE1H 4FLHA 2EKSA 2EE0A 1JIBA 2BNQB 4FNUA 4ONHA 2ZSWA 5KEZA 2G5BB 2YQ3A 2NY1D 4CL7A 5BXFA 3H56A 1MY5A 4AEFA 2GBUA 3B3BA 3CAFA 3QS2A 4RMBA 3VFNB 3LKOA 4C4UA 2Z93A 2I27N 3J7HA 4GBXA 4XNMA 1XF5B 1TZAA 3QC5X 1WJ3A 3DTDA 3V7MA 2HT3D 2EEAA 1C8PA 1UC6A 4FXLA 5FB8A 5E2UH 2C8NA 1CL7I 1G7PA 2OMXA 3P73A 3WUWA 2JCCF 4K8RC 5SWZB 1A0QH 1SUHA 4F7CA 3QZWG 3Q5YA 4UQ2B 1JG9A 1T66D 2O6PA 4FKKA 3UBFA 3IYLW 4DKEL 3PWVB 5I76A 1CCZA 1PSKL 2O61B 4Y5YA 2IFGA 2WLLA 3E6FA 2UYLB 2EE6A 4NLAA 5FEBA 1G84A 4YHPA 2PXYD 1EFXA 2CM5A 1OCRB 1FV1A 3H9SB 3FU7B 2OR9L 3P30L 4XP5H 2B08A 4D0BB 6FABL 3EJQA 4WAFA 5F7DB 2VXTL 2GEEA 3FMGL 4P2QE 2FCBA 4IRJB 4CADB 1ONQB 1CBJA 2J25A 3KYMB 3S2CA 4DZBA 4Z78A 3MBXL 1RK1A 3L5JA 3OL2A 2ITFA 4ZDHB 1F6AB 2V9QA 3VQ1C 2O6FA 4CU7A 1MCNA 2C9VA 5AW7B 5BW7C 4C57C 2WNKA 3GBLA 4PJIB 4W6YB 3B5HA 3QPQD 4EDWL 4MJ4A 2QFPA 1T1WB 1G6VK 4YH6A 3UFIA 4HJTA 3TFKC 1DZ0A 3IXAB 3P9MA 1IGJB 4YC2C 1ZHNA 3PQYA 1CXLA 3QARA 1UOWA 2FL5B 4NZTL 1GL4B 1JRHH 4NN7C 5AAMA 3H4HA 4X6EA 1LQSR 2DZEA 3N9GH 2NW2A 1OTTC 1S7VA 2X09A 3LNEA 5FYLE 3OKKA 2F15A 3QUXC 4DGIL 2WWNA 1JDAA 2XTJB 2YJQA 3C6LA 4KI5C 2AI0L 2G3NA 5H37H 4MJID 4CAGA 4KFZC 1CGWA 1IBZA 5FYKU 2HFTA 2A9DA 3QUML 2G9KA 2Z34A 4KRPD 1TZIB 4ZQTA 1QWUA 3D12B 1OAQL 4XT1C 4AKOA 3B83A 5H4YA 4DAGL 4M43L 1CBVL 2WD0A 3U9WA 1RUKH 2BNRD 3BVXA 5KW9L 1N4XH 1IIIA 3NZHH 4KVPA 3EDJA 1SEBA 4RMTA 4W1TA 4NQTA 5ADOL 4NXSA 1URIA 3IWUA 3MRPB 4OLXH 5E2WH 5F88A 3ZTNH 2FBJL 2V7HA 4R90H 5AG9A 3K2UH 3VXMD 1N2RA 1NDTA 3MLSL 3D39A 4LNRA 3VI4B 2EH8H 1W91A 4IOFD 1K6QL 4QRPB 1GIGH 2HAZA 1PMYA 2ITDA 2IAMA 2NZ1A 4P4KA 1I1AB 1MCKA 2ZKYA 3BQUB 4ICWA 1AQMA 3BI9X 5KSUB 2FTAA 3QXVA 5DA4A 2XWXA 3HS0B 2X10A 1VZHA 1ETB1 3MV7B 4YN3A 1OCWL 2UWEA 5I74B 3A3YB 3H9YA 1SXAA 5CLWA 3VGDA 5KOVC 1KPRA 1U4FA 2R9HD 2W88A 1A5FH 5DD0L 1M1XB 4YXKL 4Z7UF 1OPGH 3K2KA 4M7ZC 2BNRE 4MXVE 2X41A 1LM8V 2CKBA 4OF3A 5D96B 1A6WL 5DMGC 3RX5A 1U3HD 4RMUA 1E8XA 1QA9A 2A6DA 3ARGA 5D7IF 1P4BL 2XACC 1E30A 9PCYA 3WU1A 1AS8A 1B88A 1FAKT 4N2MA 1OZUA 2EDHA 4G8IA 2ZCZA 4RNRB 3KYKH 1QFOA 4AMKL 4LXFA 4RX4A 5EV7A 5BV7C 2XV3A 3VI4F 1CTOA 2M26A 1I3RB 4HV8B 4GKOA 1INQB 2BW5A 3CFNA 4XTRC 4Y9EA 2NDGA 3HC3L 5C0RL 1TENA 2YARA 5KN5A 3D4YA 3L3OB 3S35H 1IVTA 5KSUA 2K6YA 2V2XA 3ZRSA 3AAZA 4TQIA 4I0KA 3T4AB 1U3HB 1A7BA 4A39A 1CFQB 1M9SA 5IWLC 1FORL 2Z0UA 1OOWA 3DTXB 3MGOA 1CZ8H 2Z4QB 5AKTA 3RE0A 4CSSA 3KVQA 1BX2B 3V0GA 1XD0A 3ARSA 4OZGB 5EU6A 4UOJA 3MV7D 3PP3H 1E8YA 3PPSA 3E80A 3CFQA 4XVSL 5L2JA 1CK0L 1MQKL 1VGEH 2CJTA 2JI3A 3IJSB 4G7VL 5ILTL 4GAYA 1U93B 1W9XA 1M3IA 2IV9A 3MXVH 5D1QE 2JNZA 2MCG1 4GPVA 4XXCA 2J88H 4RMVA 5ERWB 1S8DA 4UT7H 2Y72A 2F1EA 2VMDA 3QQ4B 1F97A 3T0AA 4AVJA 1WFTA 3LRMA 4P2RA 3DSFH 3QDGD 5DMIL 1HHHA 2ICES 4HMEA 2A6KB 4JQVA 5H2BA 1KELH 2XPYA 1UXWA 1I7RA 1NAKH 1VFUA 1JCKA 1KXVC 4N8VA 5EBMA 1Y1UA 3X1BA 2ZICA 3WS6C 2NY5H 3HG5A 1INDL 2JVUA 2ZCLL 3R19A 4HSCX 4PD4J 5L2KE 5MENA 4RFEA 4XMXA 5IJKA 8CGTA 1N8ZA 1EXHA 2X3AA 1T2JA 3HCVB 5CCHE 2CBTA 3L3HB 3Q6FA 4JZJC 4APQB 3BOVA 4QI3A 2OZ4A 5BVPL 4PTTA 3FFCD 3DA0A 1OLLA 1B3IA 1OGTB 3REVA 4YPJA 5CP3H 1KJ2H 2WLKA 4GNKB 4KJWC 2WUCL 2UZPA 3QDJB 3QFJE 4PJIA 1S46A 3W39A 2QDVA 1XF2A 2WTOA 3DX9B 3C6LC 3NIGE 4PRHE 5DZ9A 4A37A 5KS9A 1F1AA 5EC1B 2ZWLT 3KYMA 3M6DA 2JB5H 1U8HA 1NCJA 2DAVA 2L7JA 1WTLA 2P4AB 3LQMA 5E9DD 3AG3B 3BPNC 4PLKD 2ZX9A 1I8LC 4MCNA 3RPIA 2BDNH 4PJEB 4RMWA 3VX1A 1VHPA 4DP5X 4YDZA 1BBDL 2YD9A 5CEZE 4KU1A 4JDTH 3ZVVA 4M4PA 5GZOC 3DSFL 1L7IL 4WW2C 4BSWB 4P5RA 4YGVB 4BSVB 5KVDH 4AEHL 4F7EB 4G9DB 1IEHA 1J8HE 4FDWA 4IU2B 4UB0H 2BSBA 5F7FA 2PPAA 1Q9KA 2W07B 4HBQA 5E8PA 1YY9C 5HYQA 2JB6A 3S96A 2ARJA 2NY4C 2FH6A 5FB8B 4PSRA 3DKHA 4X6CB 1A6AA 1U8QA 2R4SL 4JPIA 5IK3A 1J5CA 1P2CA 3LXUX 4LSSH 1G6RA 4OCYL 5D5MF 4XGZA 5JPNA 5JW4Q 3RZCA 1W8NA 1OM3H 1NIAA 1T04A 3HE7D 5C0NC 3S5LA 1NKGA 2VIRB 3M1BA 3O0RL 3I3EA 1T4KB 2NQ3A 3HR5A 3K6NA 5HHXH 5ID0A 2EKJA 1YN7A 5FDWA 1MRFL 5GJSL 3KL5A 3MV01 1U8PA 4F7TB 4MNQE 5MI0B 1R5VA 4BA0A 4TULL 4Y0GA 1ZT1A 1ZT7A 1U6AH 3E1F1 1JVKA 1IAIM 5A16A 4P2RD 3EOTL 4KOCA 1IM3D 3LB6D 4OD2A 1AHWC 5HDBB 3S4SA 4N2BA 1OP4A 2XG4A 3MLXL 4WGVB 2H26A 2KQMA 3NCJH 4U1HA 3FN0L 2K78A 2ZKHL 4X6CF 5EG6C 4WHTB 2R1WB 3L7EB 1Q1PA 2BNQD 2Z7WA 3B9KC 3ARFC 4EDWH 4F7KA 3HHMA 3NH7L 4W6XB 4H0IA 3NN8A 5D1QD 5M7QA 4MA7L 5DD5L 3UBGA 1NGYB 4DKDC 2F54B 1XCXA 1RUQH 3GGWB 4LVOC 4MMYB 5AWNL 1EAPA 5TD4A 3SGEI 4YDLB 1B4RA 1OT2A 4EUPB 4HGWA 4ZUWB 1K3IA 2G75A 1WK0A 1UHVA 3LN5B 2J8UA 5F3BA 1KXQA 3NCXA 1PPIA 2PR4L 1QHPA 4NDMB 1N3NA 3WAKA 4JZJB 4O2CB 1YJDL 4NQED 2AJXL 3P02A 1A2YB 5EOQL 5EEYA 4OCMC 3ZKXC 4TNGA 3ETBJ 4ZFZB 3VXNA 3Q5OA 1IQWH 4FQ2H 3HRZB 1TIUA 4MJHA 2X7LB 1NIFA 1RZJL 3MU3A 3WGUB 2EE9A 1CIUA 1W72A 3VXPB 1NJ9A 2F53D 3IPBA 3VWJC 1HESA 2XN9D 4L4JA 4KK6D 2I60H 4JKMA 4NRYA 3H54A 2VC2H 2PYED 5C0AE 4M5SA 1E6JL 4L8DB 2VDML 3P0YL 3QORD 1E2VA 2QGCA 1FZOB 5G4NA 2AKRB 3UG5A 1T80A 5AL0A 4PB9L 3HNVH 1UA3A 5E94A 4JFUA 5E1QA 4D94A 5I15L 1A7RH 3V0VB 3NCBB 1LK3H 4I3GA 5IESH 4Q7DA 3U0WH 1LP9E 1EHLL 1DBJL 3H9HA 2B2XL 4XI5C 1CDBA 3H7LA 3PL6D 2AV1A 4B3VA 2XVLA 4MJIE 3SODB 3US1A 4UQCA 4X5XA 4WFGE 3HC3H 2XUWA 4N5ED 5C0RH 4LQFL 4RSVA 1P7QA 5EBWB 3DVNA 4RZKA 4Q14A 3V5DA 1MCJA 1RVFH 2NTFB 4NQDA 2NUTA 2HFEB 5TE6L 4U33A 2W0KA 4GSXA 1LNUA 1O7SA 3PQYD 4MVBD 4E42B 4EIZC 2CJUH 3TZVD 3IMBA 4JUSA 1DVTA 2DLGA 2BHZA 2YAOA 1YUHB 3B6SB 4GUOA 3MNVB 1A6WH 3FHAA 4LLWA 3CCHB 3T4AA 1I1FA 2VLLA 1IC0A 3O11B 2NY7L 1YJDH 4CSTA 4JKKA 3BFWA 3TP4A 5IFAH 2XA8H 3C6LD 5FOBB 2X6UA 4ZODA 3D3VD 5IVNA 1MJ7L 4OD2B 5BRQA 3S4SB 5IBLD 4OZIE 4NO2B 4KVCL 3GIZL 2NY7H 5HGAB 4I0PB 1JZIA 4PUBL 1G5AA 1T7ZA 4JY4A 2NX5B 3ZDXF 2EVHA 4XO3A 1AGDB 1INEL 3CMOL 3VM7A 1TJMA 1UCTA 4H20H 4L1HA 4MBOA 4LFHD 1IAOB 4UTBL 1MFDH 4LCYA 3P30H 4M6MH 1C12B 4OI7A 1IKFH 5C07D 5T5FH 2BHYA 3IE9A 4ZS7L 4FFZH 3ULVF 2GEQA 3UZVA 2XKUA 1IC4H 4ZW7A 4TMPA 5C0EB 4OJDH 2P45B 1F3JA 3F7KA 1IAIH 3UG3A 2CO2A 1CICB 1V54B 2XZAH 3DXAA 5ABZA 4PWFA 5I8KH 1CB4A 4NIKB 3D07A 1JRHI 3GMQB 4WEBH 4NKOB 3Q13A 1G1YA 4WW2F 3QT2A 2ZXEB 4OFYA 2HP4A 2VLMD 3LN5A 2BK8A 3ENEA 4AQOA 4BINA 1OAXH 4AIZB 5ICYB 2N56A 4X8GA 2BVQB 3VXUA 2ADIB 2H8PB 3NUKA 1UXSA 1X3DA 2X5PA 4Z3HA 4MZRA 5JIDA 4WWKB 3EUUA 1ZLWK 4U3SA 4ZSOB 1VKXA 2WY3B 3BW9B 1YDPB 5TE7H 2CLZB 2H8PA 3T4AC 4K55A 2KDGA 1EHNA 1DL7H 5BOPA 1EEYA 1NCBH 2EYRA 2YQBA 3VMPA 2IAAC 3H42H 1CGVA 1VDGA 2BVTA 1YVLA 4FADA 5IP4A 4KH9A 2AANA 2DQHH 3FN0H 5FDWB 3HB3D 1KG0A 5EC1A 2Y5QA 4JN2A 5DF0A 4N0RA 5KUKA 3GSQA 5K9JL 5LXVA 2HG0A 3CNKA 4JO4L 2BXYA 4ZAKA 4GQ9H 3QNZA 1ZLUK 1AYOA 1YNTB 1QMUA 3N1GC 1ZHBB 3M1BB 1C1EH 2XG5B 1Z6JT 4NO3B 4Q6YA 5T5NF 1ZPLA 3IMSA 4RFOL 1IEAA 3AQDA 3HI5L 3HLAA 3QVAA 1C08A 5HY9B 3KPSD 2ZCKH 1BYNA 2ZZUT 5CR8A 4FP8L 3SPVB 3VXSE 5EIQA 1TOXA 4WO4C 2AITA 4OUOA 1YEJH 5T1DL 4LEXH 1LDPH 4BQ9A 3EJJX 5LXGH 5LG6A 3RVTC 4EUPH 2O93L 2R29H 4JY4B 4AGLA 1BIHA 2YUXA 4P49A 2F1BA 3C60D 4FQCL 5HI4D 2BVYA 2CDEB 4KTEH 2FEDC 5I19L 1XZWA 2XVKA 1HJCA 1GS6X 3BEVA 5J89A 4X6BA 1F90H 1OAJA 1ADWA 3L48A 4ZK8A 1JZ4A 1MFCL 3UTTB 4KI1A 4YXHL 5FYLL 1IAKA 2YO3A 5B38B 3OHXB 2VLJA 4JKWA 3VTTA 4XNZB 5DD1H 4TSAL 3IF1A 3LAFA 4ZUTA 3I9AA 3FB7A 1IZKA 1J88A 2X4SB 4IMKA 3R18A 1QFWI 2GAZB 1TLMA 1JD9A 2VDQH 5TQ2H 1TDQA 1TKWB 3D85B 4MHHI 4ODHH 3SOBL 3C12A 3J8F7 3EYSH 5CZKA 4JVPA 1OLZA 1UACL 1QW8A 4XZUA 2E6PA 3CVHL 4ATWA 4N90D 1EV2E 1I7ZA 3K91A 4WY7H 4HEPG 4AZ8A 5GS2H 4HSAC 4WHDA 1AR1C 1Z2KA 1LEGB 5DMJB 4XMKH 5I71B 3IJEA 4J1UA 4OR1A 1RZGA 5IG7A 1N0XH 3CHPA 2IPTH 3X3GL 1XIWA 2BHUA 3TNNB 1URLA 3A6BL 1FORH 3BC9A 3TCLB 2JKNA 1CD8A 2HSIA 2H45A 2X1QA 3FRPG 3HI6H 5EO9B 3AZUA 5SWSD 3QYNA 1IILE 3FQXB 4PGBB 5JMOC 1G9EA 1D5BA 5FFLA 2JB5L 3P40A 5F9OH 4APQD 2RB8A 1MREL 1YEKH 1QBMH 4JFTA 5CILL 1AR2A 3QJUB 1EGJH 3LKQB 1HINH 5HVGB 2WXOA