4ZMYA

Crystal structure of human p-cadherin (monomer 1)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
214
structure length
214
Chain Sequence
b'MDWVVAPISVPENGEGPFPQRLNQLKSNKDRDTKIFYSITGPGADSPPEGVFAVEKETGWLLLNKPLDREEIAKYELFGHAVSENGASVEDPMNISIIVTDQNDHKPKFTQDTFRGSVLEGVLPGTSVMQVTATDEDDAIYTYNGVVAYSIHSQEPKDPHDLMFTIHRSTGTISVISSGLDREKVPEYTLTIQATDMDGDGSTTTAVAVVEILD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cadherin-3
publication title Adhesive Dimerization of Human P-Cadherin Catalyzed by a Chaperone-like Mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 53
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4zmyA01
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4zmyA02
4NUPA 4AXWB 2OMZB 1NCGA 2OMXB 2A4EA 1WUZA 3LNDA 4ZMXA 4OY9A 4ZMZA 1Q1PA 1OP4A 4ZMWA 3K5SA 4ZMNA 4ZMVA 4ZMTA 1WYJA 3Q2NA 3FF8A 1FF5A 2YQGA 5JYMA 1ZVNA 4APXB 3Q2WA 1L3WA 2OMWB 3PPEA 3LNHA 2OMYB 3LNGA 2OMUB 3UBGA 5JYLA 5CZRA 5DZVA 5KJ4A 3K6FA 4AXWA 1EDHA 4AQAB 4NQQA 4ZMQA 2WBXA 4NUMA 4ZMLA 4ZTEA 2X2UA 3K6IA 2QVIA 4ZMYA 2O72A 4AQAA 2EE0A 4AK1A 3K6DA 2WD0A 3LNEA 4APXA 2QVFB 3QRBA 3LNFA 1O6SB 4ZMOA 2YSTA 3Q2VA 2WCPA 3UBFA 2OMVB 2V37A 1ZXKA 4ZI8A 1NCIA 3K5RA 4AQ8C 3LNIA 4ZMPA 2A4CA 3MVSA 3FF7A 5CO1A 1NCJA 4XXWC 4AQ8A 1SUHA 2WHVA 2OMTB 4AQEB 3Q2LA 1NCHA 4ZT1A 3UBHA 4XXWA 4NUQA 4AQEA 4QD2E
chains in the Genus database with same CATH superfamily
4NQDD 1E7UA 1I8KA 2WP3T 3IJHB 3RL2A 1YYLH 5ESQA 4BH8A 3ZW3A 4O2CA 1BVKB 4JHBA 2FUQA 2I25N 4IW4C 1GC1L 1PG7W 1HEZB 3SQOL 4IRJD 5C07D 4CJ0A 3U2SB 5I5MA 2JV6A 3FAXA 2ICEB 5DR5L 3SBQA 3T3ME 5HHMB 1EXGA 2B9AA 2CHZA 4XN7A 2YD3A 2Y2WA 2PO6A 5DHDA 5I30H 4B9JA 4OV6F 1KB5B 2B8OT 5I26A 4F7CA 3CLFH 3LN5B 3OAYH 5BVJA 3BGMB 1JRHI 4LZKA 3MLRL 4MLSA 5GGSY 2DLFH 2HH0L 3L5WA 5HDRA 1T2QH 1ZGLP 4ZAKA 2WINA 3F84A 1MHPH 2XACC 3KPRB 1FZKB 5C0IA 1QFUH 1XV8A 4JRXE 3VDBA 2X28A 1R9FA 4OSUL 4AM0B 2IIJA 3QJSB 3F5WA 4W81A 4JFDB 3GBNH 4LCYB 4AXWA 5FGCB 2J72A 3MNWB 5F2FA 2JKNA 2HFGL 2VQUA 3VQLA 1MVYA 2EO7A 1HTYA 2Q7NA 5ADOH 3MYJB 1QLEH 4YUEH 2E4FA 2IEPA 3HNSH 5EO1B 1KCSH 3GHBL 1XVSA 4QHKJ 5DK0A 4MJID 3U4BH 4N8CL 4Y4KA 3MLTA 1ZK5A 3F7YB 1UD8A 4PJHE 1H3TA 3LB6C 4QDGA 3ARUA 3FHQA 4F8NA 5D4QA 3FOLA 5CLTA 3VRIB 1IGML 3E2HC 1I8KB 3TN0C 5ESQB 2R2BA 3A4AA 1D7DA 1TQSA 4IGBA 1NOFA 5T3XL 2OL3A 2VTFA 2VLME 3D4ZA 3ARGB 2NR6C 3WGVB 4BE6A 4ZX4A 4BSJA 3K1KC 3QZLA 1BW8A 3GPSA 2H47C 3FRUB 4NGHL 4O9HL 2GJZA 3SGDI 2KPWA 3V0FA 2EH8L 4X6EA 1ZA6A 5BVJB 2CXGA 1G6RL 2VQ4A 4YMPA 5GS0L 5FKPB 3L5WB 1MIML 1VFUA 1ZHKA 2EAEA 2WINB 4WI5A 2FGZA 2MPAL 4HJ1A 1DBKL 5KAQF 3PJLA 1U6AH 1BV8A 4QYOA 3GT6A 3PAVA 2OM5A 2F0CA 4FQLL 4R90H 3S37H 5F3BA 4PVMA 4AXWB 3KS0J 2EDBA 5DD0L 1WBZA 4G3YH 4LNRB 4ONGH 3ULAB 4UNUA 4WFFE 1ED3B 1IKFH 1UCBH 1XSOA 1ZLSL 2IBZX 3JWOL 3Q43A 4PW9A 1ZEAH 1HWWA 4LARH 1Q94A 3KXFA 4HGKC 2D8KA 5BV7L 3SDDA 5DK0B 2OYPA 4JFOB 1BAFH 3F04A 3HZYA 4L37A 4ZW5A 2M26A 5J7CC 2ADGB 4W4OA 4Y4KB 2H4EA 2BY0A 3KYKL 5JHDE 4M8UA 4P57A 4ZX6A 1OAKH 2RA1A 2EDOA 3FOLB 1HHKA 3B9VA 4RA0C 5F93C 3SEPA 3AY4A 5I1KL 4MKTA 1N19A 4DUWA 1DLFH 1IEAA 1KBBA 3CD4A 2A77L 2WQWA 3F64A 1S78C 2F54E 2UZIH 2F1EA 2F53E 3AT9A 1AXTH 1EMTL 4LDLB 1G7MB 4TOYL 5D1ZI 2NY0D 4FQJL 3SGKA 1PKQA 4JO8A 3U6RA 1SZNA 5E4AA 5DO8A 5E99H 4LIQL 5IB5A 3WDJA 2K4WA 5BQDA 4HH8A 3NFSL 1BWMA 5K9KB 5SX5K 5EFIA 4NCC1 3UAFA 1EHNA 2ATPB 1W15A 4DK3A 4FHJA 4CA4A 2ZYRA 4HT1L 5EU6A 5TQ0H 3TS8A 3WHE1 5FDYA 5J6HB 3GUFA 1MFBL 4K07A 1BQLL 1EA9C 3WL9A 3ZOAA 4Z76A 4X0KA 1E42A 4R0LC 4ELMA 3DVGA 4QYOB 1K2DA 2JKTM 5GHWH 3Q2VA 5LGYA 5IESL 1DFBL 1S7SA 5SX4I 1ZXKA 3WO4C 1I7RA 5EOCJ 1MG2C 4DZBA 5IHLB 3MHZA 5D2LA 4D9LH 2HJKA 3D2UB 1S5IH 3KG5A 3LPPA 4XBPB 1BBDL 2HWZH 1BQHA 4ADGA 1W8EA 4L37B 4JO4L 4NZRL 5ACZA 2GEQA 1L7TH 2KPNA 4FEIA 3AC0A 3VD3A 4G8IA 3PLYA 3O9WA 1XF4A 3FBQA 2EKSA 4FQCL 1KEGL 2BSEA 1TJMA 3R18A 2M2DA 3NFNA 3X3FH 3HMXH 3Q2LA 1DVFD 2E9BA 3GMLA 4Y89A 4R4FH 4NQXA 2G0LA 1B4JL 4P04A 1U30A 2FHBA 2GJ6A 4HIIA 2B4CC 3HG1E 5JXEC 4G8EB 2C1PA 2FGWH 4JO3L 1UA6L 4MQXC 3VQMA 2P80A 4H26A 4LDOB 3GMMA 4D9RD 1AZBA 5ADPH 5TTRA 3CVHA 2FBJH 3OKMB 1PKQB 2PF6A 3U6RB 3QEGL 5EEWA 3BVWA 5LQBL 3QDME 3NABL 3K46A 3APNA 5HD8C 4JFEB 5HYIA 3FQTA 4KX9A 1RHFA 5DUBB 5GGTL 3QA3A 1DBAH 2VN3A 5C6WH 3C5ZB 3NACH 4RMQA 3DURA 1N59A 3V6ZA 4M93C 1KOAA 2XG5B 1WZLA 1E4XH 1XIWA 4XP6H 3EUDA 2E27L 3SDXE 1ZK9A 2VW4A 3MBWB 4LU5L 4BHUI 4JFQB 1ID2A 3BCFA 4FFWD 5ABDE 4Z76B 4X0KB 2PO6D 2VMJA 3N44F 4ELMB 5C09E 3EFDH 3AG2B 1HS6A 3B9KA 2G3NA 2WWNA 2EIKB 4LLYA 3RWCA 3MJ7B 4KXCA 1CU4L 4UIKL 4I9WE 1UATA 3BAWA 3HI6L 1I7RB 1NAKH 1SOKA 3MLSH 1F11A 3H9YA 4DZBB 2ED9A 4ZAKD 3ZPDA 3A3YB 2X4UA 3BVNB 1LQSR 3FSVA 2NY5C 4ZO8A 1V7ML 2IQAA 2ZXAA 4M6OL 4DGUA 3FO9B 2JI1A 3S34L 5GRVK 2QVIA 1NGXA 2XC8A 4G8IB 1R17A 4RMTA 4EQ3A 4IJ3B 3U4KA 1JZEA 3L9BA 1U3HC 4Q52A 5T3ZH 3NFNB 3K6DA 2WD0A 2PN5A 3GMLB 1NEUA 4NQXB 4PM1A 3QIBC 5AOJA 2ESVD 2I7OA 2NSMA 4NAMA 2GJ6B 1N4XL 3LTVA 2YUWA 3VFUA 5C9JA 1SDDA 5KVGL 3GXDA 4GSUA 5FYLH 5INDA 3VWKB 4QHMB 4EF3A 3GMMB 5D5MA 3HBPA 2WWOA 1QUNA 3A47A 3M1CA 4MMYA 2KLRA 4XC1L 3UBFA 2KHAA 2ARJB 1I1YA 3V2AR 1OVZA 3PIQA 3TYGH 2P5EA 4KI5D 4AMWA 2HUEA 1N5AA 4L0PB 1W0VA 3QEQD 2JJWA 1LP9E 4OIIH 5GISL 1YEFL 5CP7B 4IGBD 3HBQA 4OZGE 4YE0A 3V6ZB 3DUSB 3T0XA 3JUYA 1G94A 4JFVA 5F6IC 1HT6A 2VLRA 4TSBL 3U0TB 5DRXA 2WLKA 4GKNA 3OKNA 2MOGA 4X7SH 5JA9A 4K0OA 1SHMA 4XMPL 4N0FB 5C8JB 4UZSA 4AC4A 3STZB 5C3IA 1X7QB 1OSZA 3B9KB 4A2FA 4IMKC 4RISL 4LAQH 4ZUVB 3WN6A 3S37X 1OAZH 5I23A 4XPHL 5EOTA 5F21B 5D7IE 1TFHA 4XRCA 4APQC 3EO9H 2K9FB 2X4UB 5AALA 1NGWA 4WHYH 5KYYB 1G6RB 2IQAB 3PQYB 1FZJA 3NRFA 2Z0UA 1RSYA 2FEDD 2YJQA 1OLLA 5ECGA 2JQMA 5DZOA 1R5WB 1YMME 4MHHG 3P4OA 3HG3A 1TQVA 4PRDA 3CFBA 1OGAE 4WGWB 1FV1B 2Q1EA 4PJAB 4PJBF 4AT6B 5J57B 2FJUB 5TJWK 1IEBA 3W39A 4DGWC 2VL5A 4DKTA 1NIBA 2IQ9H 4PJ7B 2UXVA 3KXFD 1YEGH 4Q0XL 1HE7A 6PCYA 3DMMA 3SDDD 3VFUB 3UP1A 1TU2B 4TUOB 2WNKA 3H9HA 3FQUB 3PL6A 3UBXA 5D5MB 5KS9F 5MERB 2EVFA 4S0SD 1SQMA 5BV7B 1MW0A 2YWYA 2FO4B 4ZXBB 3LEVH 2CCVA 1OB1B 1WO2A 3IMSA 1PFOA 4H8UA 4LPUA 1N5AB 4PJCE 1EFXA 4NX0A 3O6ML 2FNBA 3BISA 4QR7A 1UZ8B 3N1GC 1EO8L 1NFDE 2AJYL 4UAOB 3BDBA 2AEQH 4D8OA 2VLRB 3T4AA 3KPLB 2BDNL 3ORJA 3SO5A 2WN3A 2HTKC 4NZJA 4NO0D 1G4RA 2ICWA 2ZICA 5BUPA 2NY3B 3PGDB 3KPNA 1R0AH 2HJLB 4N8VA 4H1LH 1TR7A 3QP3A 4PJEB 2R1YB 1P5VA 5EOTB 5GGTA 5EU6D 1RU9H 4UV7H 3CC1A 5A2AA 1RV6X 4ZW7A 1AE6L 2EDTA 3OPZL 3RWFA 3ZXAC 5GS1A 2WB1A 3QRGL 2CZNA 3MA9H 1NGWB 4HCGA 4QF1A 3OD3A 1G84A 4DKFH 3IPEA 3VG9C 1IZKA 2XKNB 1Z7JA 5LGHH 5HI5D 4HZ1A 4JJ5A 3MACH 2IANE 3CFBB 3RVTD 4QRRA 3MJ9L 4L4TA 3P9LA 4I18C 1HEJC 1DCEA 1JDCA 1PNCA 3TJEL 1CLOL 1GOHA 4EAEA 4CW1A 2VL5B 3N04A 3ALPA 3B3IA 2FLBT 2UUDH 3EGXA 4KO5A 1ACCA 5ICYB 4DJMA 4BK5A 1GW0A 3ERXA 4LSRL 4V1DA 2GW5A 3LHAA 2B4CH 2EEDA 5KSAB 5KAQG 3QJFA 1YY9D 3O9WD 4XTRC 2BSED 2FX7L 1NMAL 5LCVL 2EXWC 2G2PA 2EYSA 4AQEA 5I8CA 1AC6A 1F1GA 1P0SE 1HYSD 4Z0BL 1Q72H 2CMRH 3AACA 4JCMA 2ZUTA 1CVRA 1KTLA 2OMZB 3ECUA 1P5UA 3EGSA 5D1ZC 4HKBB 5JOPE 3ZDWA 3VNZA 1DVYA 5TPWL 4NIYE 1C08B 2AFNA 1QLRB 3LN4A 2AK4A 3HC2A 2BJML 4AMKL 3SPGA 1XF5A 2NY1D 5L2KA 4P5MA 2ICWB 2YD9A 1G0XA 4LVOB 4WWKD 3SDAC 5E1AA 1FF5A 5CXPA 1LDSA 1QX1A 4AQ1C 5F70A 4ZFFB 2NLJB 4RGOH 4NENA 4X8XA 3Q2WA 5DDHA 4JY5H 2B3IA 3ARBC 3TBYA 1XIWD 3BIBX 3L9YA 3RWFB 4XP5L 5T3XD 2XFXA 4IKNA 4GOSA 1OO2A 2H3KA 2YN5A 4QCIB 4QF1B 3MCG1 5E2WL 3FOMA 4F1SA 1OEZW 1Q0YL 4JB9H 2NY5H 5CIPH 3FS9A 3FO0L 2VRQA 2YR3A 4J3OD 3DJZA 4M29A 5A1AA 3QK0A 1AI1H 5IB2A 1HHJB 3O4LE 3GSWA 5KJ7E 4CW1B 2VRKA 1QOKA 1U91B 1KXQE 3MLXH 3H9SE 5G55A 3B3IB 4AEIH 4D3CL 1MNNA 2PR9A 1KJ2B 3BP7A 4L48A 3TU6A 4V1DB 3F7PC 4P9HC 2LGNA 3BUQA 4L4VA 2CJTA 3QJFB 2Y2TA 4AITA 3QPKA 3BI9X 3DIVA 5DRNA 3UTSE 5JO5A 5I8CB 2P28B 1EEQA 5C0GA 4EOWL 4U1GB 5JXAL 4G83A 3VXPA 3LZFH 5D7JA 2ZOLA 1P5UB 2DQJH 3P0VL 3HNTH 3TFBA 4EIBA 1J86A 2DMKA 1HINH 4ABWA 4A37A 4X6CA 2P5ED 1QP1A 1TZAA 2BSDA 1X9QA 2N1KA 1RCYA 5K9OA 1ZGLA 1NC2B 5E1AB 1XF3B 4U0QB 3CHSA 1P84J 2KL6A 1KJMB 3F00A 1IGIL 4HIEA 4P4KC 2WIIB 2OMTB 2ZOWA 2VITA 3SCMC 3IFLH 3N1PC 5DDHB 1CFBA 5CZXC 3TBYB 1JRHH 2WQ8A 3TO4B 1BQRA 1D3CA 1TEGA 2NXYC 1CF8L 2YD2A 2LLGA 4KROB 3T6XA 4UT9A 2QL1A 3UACA 3O2VH 1T66D 5DLLA 2VSDA 1KXHA 1O6SA 3FOMB 3NPZB 2NZIA 5IMLA 1PCSA 4X7TB 2CGRL 4ABQA 2CLRA 3ZE0E 3VRLE 3WLWD 1YNLH 4U4BA 1XB3A 4XZ4A 3ZSSA 3FCTA 2OS7A 4BDVA 4EI5B 5IB2B 3TBTA 3L4VA 5FYJL 1T03L 3BDYL 4WI6A 2PCPA 1AQDA 1PEZA 3O2DH 3QULB 3BP7B 4LCWB 1JSYA 1E4WH 1DJZA 2DDQL 3GSVA 3HNVL 5EWIH 3Q5TA 3TT3H 3MV9D 4OCNC 1BVOA 2O1AA 1X9RA 4S2SA 3VXPB 1WZ1L 4KKAD 5D7LB 4ZDHB 5HGGS 2J8UF 5H37H 3PL6D 2CKBH 2VB5A 4LVNB 1JWSB 3FMGH 2X05A 1RZKC 2YK1H 3WY4A 4ZFGH 4IOIA 2X6BA 2AXFA 3QH3B 1EHKB 3HE6C 2YAPA 4QAMB 4ZPTB 1E3FA 3O6FC 3MC0A 4WFGE 1EFXD 2V33A 5DRWA 2EKJA 5LCVA 4FRWA 4NOFA 2OKMA 2K9UA 3KCPB 1ZDQA 3WTUA 3SGDH 4D9QD 4TSAH 4KKPA 4AEHH 5CN3A 5I8OH 4AL8C 2XQYA 1NZRA 1A4BA 4HUWA 3MPCA 1UWGH 2AV1B 1R46A 2NY6D 5DTFA 1A9VA 2IALA 5AOKA 2ZKMX 3UEQA 5E94B 3N3EA 1O6SB 2NSQA 2XI9A 4GMTH 3DYOA 5AZEH 1TITA 1F56A 1UH4A 4R5TA 1ORSA 1KFAL 1UEMA 2OSLB 5E6ID 5T5FH 4KI5F 3FCTB 1RK0A 4BELD 2WUCL 4BDVB 3TBTB 1Q38A 4M61A 3D39E 3QI9C 5L0QB 5A7BA 3T0BA 2PCPB 3LNIA 2QLVB 1AQDB 4XP4H 1E43A 1AD9A 4JZNB 5D7KD 1MQKH 4O2EA 1EJOH 3BKYH 4KDTA 4QRRD 3NIFE 32C2B 3I2CL 1G7QB 3G3LA 5EZLA 1P6FA 4PCKA 3WKML 5CLYA 4GUQA 4W9GC 4Y0GA 4UUJA 5FOBA 3BVUA 3EG9B 1U8NB 1FNAA 5L6YH 2D4FA 5BOPA 3CVCA 2VDNH 5JZ7C 4ZOBA 1ERNA 1TEFA 1BHGA 4XBMA 2APSA 5AVUB 3D69A 3WFZA 5IMOB 5CAYB 4P23B 4DP0X 2CIKA 3I9PA 4PWJA 1OPGL 3HUJE 1X7TA 2AAVA 4OLXH 4XCFL 1BGXL 3KH3A 1T7XA 2DWDA 2CDFA 2PW1A 5D1XA 4ZX5A 5CEXA 2JXMA 5JIQA 2LU3A 1ITCA 1WYJA 2DM4A 1MVUA 1KY7A 2R7EA 4QKXB 2AK4D 1WIOA 2GB2A 4FJYA 4W9DC 4WSKA 4X8JA 5EZPA 5L2KD 3QRFM 2EEFA 3CK0L 3O81A 5DQJB 5IM7A 1YYCA 3LRHA 3A6CH 2LFEA 4JRLA 3VGGA 2DWEA 4YXHL 2ZX8A 5HY9A 5D71L 5C9KA 1K8IA 5C92A 4DOHB 1JHKL 1T1WB 4LESA 1SVBA 2GJRA 4ETQA 1RK0B 3V4VL 1KGCD 4UT6L 3V4PH 1FFPB 1WZKA 3QUYA 1RIHH 4C56A 3C60D 4M61B 5ETUA 3BD3A 4ODXB 5E4OA 3I6GA 4P07A 1SJEA 2YD6A 4YXLH 1A8ZA 2VLJE 3DGGB 4KY1H 5JW3L 1OCRB 1AD9B 2H41A 4OD3H 3AABA 4YDIL 5BVPL 3F05A 3GZPA 1RK1A 1MFEH 3O3UN 2GBTA 2W60B 3AM8C 4FERA 4P9HH 2GFBB 2ZKWA 5EZLB 3UO1H 2AK1H 5DS2A 3KLLA 4F5CA 1PAMA 4FXGB 1ZIAA 1DTUA 1DSFL 3OJ2C 3EJJX 4IDLA 3S9DB 3ZKMC 4MJ4A 4MSWA 5AG8A 2LVEA 3WLBB 2ATKB 1RJZA 2F74B 5HYEA 1QI5A 3PXJA 4P2OA 3T4YB 4GXVH 5JPMC 5IB4A 3BRFA 1Q9WA 3FTUA 3KWWB 4RNRB 4I0KA 2IAMC 2VIRA 4KHTH 5D7JD 2D31A 3CXDH 3MX0A 2CDFB 2PW1B 1RZGB 3C8KB 2CBPA 5D1XB 5CEXB 2JJSC 4ECNA 4XHJD 3BPLB 3DGDA 5D2LF 5CKAA 2E7CA 3ZTNH 3BKJH 2R7EB 3SPCA 2EIDA 1L6PA 5I1AB 5DEGA 3RFZC 3ZN6A 4ZD3H 4KO7A 2PPEA 4YPJA 3MDJA 4ONFL 2O5XH 5HDQL 2ZNWA 3QUZC 4XMXA 3KL0A 1U2HA 1QHPA 4L5FL 1IAOB 3R7RA 1CB4A 1E2WA 1KPVB 5FR3A 1KTRL 4EBQL 5KN5B 4GG6A 4ODHL 2LU5A 3NMEA 2ED7A 4WTZA 2I85A 4HK3N 2ARWA 3QUYB 3P3UA 5AVVB 4G72B 3M7FB 2JCCA 4XNQA 3RB5A 1U36A 1DBBH 1MCWM 3BZFA 2XBZA 3GDCA 5TF1H 3SYAA 2V3FA 5E56A 2XYCA 1RJLB 4I4WA 5BQ7A 4M5TA 1ETZA 4XVTH 3WN5A 1NDMA 3EGDA 3LZLA 1ASQA 2EC9T 4JFTA 5T1MB 3ABKB 5DSCB 3RZCC 3LPOA 1T7VA 2CR0A 5LHDA 4M62L 5F9OH 4LLDA 4H8HA 1BF2A 3JTBA 4YHNA 4DGVL 4IKLA 5DD6B 4OB5H 2D03H 3FONA 4KRPD 1FL6A 3ZTJG 2F5BH 4UBDD 1R3JB 3AREA 4U3CA 1RZKH 4OLEA 2IGLA 3EJYD 2FAUA 5IB4B 4PW3A 1BM3L 1I1AA 4LQFH 4YLCA 1E9PA 2VIRB 1NGYA 1YY8A 2GIMA 3C08L 3MX0B 1FN4B 3HIZA 4Z7UE 4J3OF 5E6ZA 2XUWA 3UABA 4H8WL 3TNMA 2XV0A 2EUZA 1XR9B 5HYQB 2BCKB 2L7QA 3K6IA 2WLNA 2Y36H 5CR8A 2GYSA 1T4WA 1W80A 1YC8A 2GITA 4RMWA 1NC4D 4OFVA 4RGNB 4NAJA 5EB9A 1WT5C 3WFHB 1EAJA 1WH0A 5ID1B 4XPFH 1GTFA 4W6WB 3QDGA 1U8JA 4M5ZH 3UIZA 1YPZF 5JOEA 1XWVA 3T2NL 3ZE1E 2L7UA 1L0YA 2XA8L 3DYPA 1HWHB 2R0WL 3ALWA 2D0HA 3LMJL 3MLZL 3AS3A 1WGVA 4V11A 3P54A 1NBCA 4HX1A 5IVOA 1S9WA 1RZQA 3R19A 4FTDA 5ANHA 4KKQA 3ML8A 5B7EA 4XNQB 2EEXA 2A9NH 4K7PX 4EXPX 1L0XA 3BZFB 5EC2B 1X5FA 5J13B 2FR4A 4PJGB 4MZIA 4Z7QF 4JM2D 2EH7L 4I4WB 2OK0L 4LLQA 3VWJC 1ETZB 1X5ZA 4B3EA 3TGXA 1F2QA 2C3GA 4JDEB 5D2NA 2WYIA 1FNLA 2WSPA 1X5XA 4QMEA 5D72H 2OZ4H 4LRIA 1AZRA 3L3HB 4LLDB 4UT6A 5E9DE 4YHNB 1A7RL 4NPYA 2M1KA 3EOTL 3EYOA 4KKCD 4ORGB 3WHXA 3QDJE 3B56A 3TA4D 3NCFB 4TM9A 3DBXA 5GZOA 1A2YA 1TZGL 4W9EC 5C0CA 4QWWD 1P4LA 1SFHA 5I0YA 2PXYC 1TQCB 2X89A 4XVOA 1P69B 3H2WA 4DGIH 1M3IA 4L9LA 3MRLB 2MNUA 2AZUA 4DIXA 1NGYB 3AFLA 3I3DA 1UQSB 5CD5D 3PDOA 5IW3A 2FHCA 3UTPD 3LNDA 2YA2A 4WFED 3EDKA 4O51B 2GITB 2K45A 2X9WA 2X1PA 3F6IA 4UIMB 5KOVC 1U8OA 4NKMB 4JZOA 4TVPE 5PAZA 4D7BA 4ONHA 3WY3A 5HHOE 2W94A 3GSQA 5JYMA 2J6EH 2MQ0A 4P2QA 3UXFA 3QFDA 2BVUA 3O6LH 4P2RE 3G5XA 1U8LA 3DROA 2VMEA 4YEFA 1UOLA 4X98B 4U1SA 4H0GA 3ATDA 5CJOH 3EW3B 3WNPA 3SKJH 5CNHA 2QPEB 2RQ8A 2W80C 3T0WA 3QSKB 3AXLA 5DJ8A 1E28B 2ALAA 3QIUD 1YAZA 5AVZB 5IBLD 5EU3B 3IBOA 1XCTA 3B2UC 1IM3A 1TLMA 1JV2B 4LLQB 5C0AA 4IU2B 5BOZG 4PU2A 4C56D 4KFZC 2Y06H 2VKXA 4DFHA 5CZVH 5D2NB 5A16A 5SWZA 1JHTA 4QHPA 3JQOB 2J1KA 3F58H 4HETA 4XVUC 4BZ1H 1G7PB 5CGTA 3V4VB 3WKPA 4DGYH 2KERA 4E9RA 3ILQC 4NPYB 5GGRA 2R29H 5AENA 3VXSE 1IFHL 1QZ1A 1BYNA 3CBKB 2XIDA 2KLTA 5C0CB 5F7EL 4KK8D 4PLKD 4QXGL 4YLQT 5IMMA 4L9LB 4MS8C 2AW2A 4J6IA 1ZIBA 4YL4A 5I76B 4PPTA 4WUUA 3H7LA 4P59H 3GLEA 1QA9A 4WNJA 1L0PA 4O58H 2B39A 4W6YB 4URKA 1CFSA 3LQAL 2O5ZH 5F9WC 4F8LA 3U2JA 1OAJA 4L8DA 1D5ZB 4JAMB 4RFOH 5KW9H 3BUYA 1P6WA 5LJYH 5E8EA 3OX8A 4AV5A 4U2ZA 1HK6A 4JZOB 4Q7DA 2YPLE 4ERSH 1DVQA 1T1XB 2X6MA 1J1XL 1Q0XH 2LHAA 3BEWA 4AE1A 4DT2A 1DJXA 4PRBA 4PS8A 4JCWA 1RZJH 4UB0H 4Z7WB 2AGJH 3DROB 5IIEA 2YQ2A 4JHAL 3RTLA 1I9RH 4A66A 4Y1AD 1N6UA 3DI2B 4F1ZA 3V0HA 1IBBA 1BQSA 4WU5A 4WF7A 3QISA 2Y5EA 5EIIA 4OZHE 4UOZA 1AHWC 4DHLA 3QARA 1UXSA 3W2DL 4NKDA 1OE3A 2O4EA 3PWNB 2VDLL 4GW4B 3E6HB 3OV6A 4FQHB 4DPBX 4MNHB 5F7FA 3ISWA 5LG6A 2R8SL 1DEEB 3NJFA 3SE4C 2DI9A 4EUPH 5K39B 2VUKA 3NEOA 4XHQA 2XQYK 3MRHA 4YZFF 3P4MB 1E4KC 1PZUB 4WO4C 5KVFL 1AGEA 1MHEA 3PNRB 3L3IA 4L3AA 1KYOJ 5I18H 1VERA 3K5SA 3X12A 5C0JB 5IUSA 1BLNB 4WK2B 1QTYT 3S6CA 3O8XC 1FBIL 1FIGH 3LHPL 2OJZH 5CUSL 2VABA 3KLKA 5F97E 3ARSA 4V33A 3B7RL 4XZUA 3VG0L 3WEBA 5GS3A 1ZVSA 3EO0A 1C5BH 3KVQA 5HGHA 4YSAA 2YSSA 4FADA 2A9DA 2BVYA 1G7IA 2WXKA 4GRWF 2WN2A 1WCQA 2DQUH 5KBNC 1XCQB 1A1MA 1CFSB 1YEDA 2X7LA 3APDA 3N85H 3VFVB 4CDHA 1JYXA 1S7QB 3TT1L 5KS9B 5JOFB 4YHLL 4KVNH 1AO7E 4NSKB 3M1BB 1F3DH 2JK5A 3BHBB 3MJ6A 2AERT 3BUYB 3PWPE 1TVHB 2XTJD 2PP9A 1AYRA 1UWXK 5E8EB 1HHHA 5K1JA 4KUZH 4P3CH 3CFCL 4KXZI 4JX0A 1UXLA 2NNFA 3BEWB 2ISDA 5DK3A 4PGEA 3VD4A 4PRBB 2DM2A 4BKLB 5IIEB 4ODBD 5I1EL 2H1PH 1WD9A 1UKSA 4KQ0A 1A6VL 1N2RA 3LZQA 4GRLC 5ALBH 5I6XB 5LWYL 1JWUB 2JJTA 2ZUXA 4BWTA 1IIIA 1CBVL 1UXSB 3SPJA 2UWEF 1RULH 1AAJA 4LCIL 3R4RA 4UDTB 1DP0A 2C9VA 4WHTB 5DEZA 4B97A 5L8JB 4PBDA 4HWUA 3ZY7A 1WZMA 3O3EA 3QNFA 2B59A 4L3EE 3H56A 1J5CA 1AGEB 4KK5C 5I8EB 1MFVA 3AS0A 3X12B 1CT8B 3N2JA 2IH3B 2Q76B 1BQHG 4QY8A 1GHFH 5I5RA 1Z1WA 2AQ1A 1HILA 5MEQB 3GNML 2EACA 1R19A 3KWUA 3F7VA 1N0XL 5HGHB 2P5WD 2JIXD 4RLDA 4CU7A 1CN4A 1G7IB 2DMCA 2L7EA 3P2TA 4UTBA 1R5IA 4HFWA 3P4NA 4K5NA 5KVEL 4Q9RH 2C7UA 3MGTA 4FABL 5B1AB 1A1MB 3IU3B 2MNWA 2CPCA 5JMOC 5K59F 5GZOD 2R9HD 4JQVC 1ZHBA 4DN4L 4KI1A 1TZIB 3ZDXB 2NZ9D 4YX2H 1JHLH 1RMFH 1RJYB 2R69A 5FHAL 1RUPL 1XL4A 3TBWA 4CU6A 3VFMA 4XMKH 1MHCA 1HL4A 4JKNA 2A9ML 4P49A 2XX1A 1WAAF 2HUHA 4S1DC 4LSDA 4R6UA 3DX9B 4ABVA 3T0EB 1THAA 1PJWA 4W9CC 3WV0A 3DC0A 4ETYA 4OGYH 1OW0A 2OW6A 4MA7H 4ATTA 5A2IH 3IKKA 5D1QA 1H6TA 3VFNB 3IGKA 3P1VA 1H3PH 4CAGA 1D6EB 4G6ML 4HGMA 1CXEA 1GJWA 3GMPA 2OXHB 4P2QD 1IUZA 1J18A 3DRQA 4MA3A 2DI7A 4HJTA 4L29A 5D96B 1UUNA 3PPSA 1OWRM 3EDDA 4HS8L 4NJAL 1DHKA 3P11H 4DVBB 3L3OA 5B8CB 3MRPA 1J9CT 2DQDH 4XOBA 3F7RA 4KQ4L 3S35L 4J3OG 4AYBA 2B59B 5F7UA 5HYSB 2I5YH 3MYZA 4ANWA 1YZZA 1QFWH 3QJUB 3SZ6A 5I17A 1CICD 2NY0B 5C0AD 2C7FA 3WGUB 2VDML 3OWEA 1E2ZA 1OTUD 5LBSH 1JXFA 2BCMA 1IVTA 3O3AB 3I74A 1PMYA 5SWZD 1DL7H 3CBJB 5HHXL 1U95A 4HA1A 4GRMB 4XNYL 1G1OA 1E8ZA 1VSCA 4M1CD 5GGQL 3B9AA 4HFWB 2XSKA 2EE9A 4HIPA 4TNVK 4W9JC 4Y4FA 2C7UB 2DQIL 3D18A 5GJTH 5AVYB 5E00B 4L0ZA 1JF1B 1NJ9B 3QG7L 5LVEA 5CGBA 4OGZA 4DKEH 1JGUL 1I8MA 1ZT7A 4A55A 4FFVD 3VFMB 2X6VA 3PYCA 1BJMA 2Z31A 3RGVB 3EH2A 5ENWA 2NQDA 3GK8H 3HAEB 3NQIA 2YLKA 2Z7WA 3S0PA 2A99A 2OMBA 5FS5A 3TJHD 5LLIC 5HYJB 1D9KD 1MLCA 4JM2F 1EZUA 5IQNA 4CMMA 2R56L 3BAYA 4JHZA 2EVHA 4J3XA 1MCJA 2BNUA 3MNZA 4NQUA 4X5PA 2W38A 4Z3EA 1KXTA 4XMVA 1ECYA 1MF2L 5D1QB 5J12C 3X11A 2BSBA 5BRQA 2YD0A 2FZ3A 1WF5A 3T6VA 3WI9A 1EZVY 5F9DC 2VLLB 1CWVA 2FATH 5GGVY 4PJFE 1BXVA 3NVQA 4F27A 4H5SB 1O75A 3EYQC 2DKSA 3RDTB 1RP9A 4LKCB 1RXLA 3VXNA 4HCRL 1CTOA 5AKRA 4U1HA 3WNIA 4NNXB 4RFEA 2EVGA 4YH6A 1B9KA 3Q8BA 2JKXA 3TA3C 1EAQA 4Z7NE 1KCRH 1Q1PA 1VENA 1QBML 3N42B 2R2CA 1D2PA 2HG5A 3U25A 1I85C 1MNUL 3RWIA 5I1GH 1F1DA 1CXFA 5E1IA 2K1MA 3LIZL 4Y9BA 3TZVA 2VDLB 2UXGA 3UC0H 3S5LA 3T65A 2WXOA 3EYSH 2WXHA 1N6VA 1U95B 3IU4H 5ECJE 1B6DA 2V5TA 5L88L 3BGAA 2I27N 3D18B 4HKJA 5C08B 3FN3A 2Q6WA 5H4ZA 5M94B 2NY2D 4NUGH 4HZAA 3J7HA 4YDNA 2XN2A 3SDCA 2CRYA 2GK0B 3MU3A 4FHBD 3QO0B 4RQQA 3UBXG 5E51A 2DIBA 5KYUB 1WFOA 2BOBA 2H7WA 1MHHB 2KT6A 2V2XA 2YJLA 3IJEB 3CSPA 2AXGA 2QHRL 3BWZA 1R3KB 4HKXB 4HBCL 5I0ZA 5I0VA 1NWOA 5I0WA 2BNUB 3BOVA 4OQTL 1JGIA 2MCMA 3LYRA 1KXTB 1OSPH 1AD0A 3KPPA 2NX5B 1PY4A 2X0WA 5C6PB 4JDZB 1MRFL 2DEWX 4G43B 4WCYL 1SEQH 5B38B 3D34A 1XGRA 3LAFA 5IVXA 3OTTA 4JE0A 1G7JA 4PJ8B 2CH8A 3MV7A 2XTLA 3VSQA 3LEYL 3BN9C 4LASL 3G6DH 1RUQH 4HPYH 3UYPA 4N8VG 2VL4A 1UACL 3ZJAA 1E9OB 4TUKH 5TH2A 3FT2B 3MRKA 4WW2A 4FCAA 4X7DC 2I26N 2NW2A 4U1HB 2CWRA 4X6DE 4E41E 4QRSA 5EBWA 3FO1A 3BAJA 2O93L 4YK4C 4Z3IA 1BQKA 4PJDF 1T5WB 3OKDA 1D7BA 1BD2A 3DOHA 1QSED 4UILH 3BPCA 3RWIB 4KRMB 3S5YA 4P5TA 3VE0A 1MW1A 4XCCH 3OMNB 2EDFA 2QMJA 1IM9B 1TCRA 5ESAB 3TZVB 3DXAA 2AJVL 1OP9A 4NZUH 4W1TA 3U30B 3D87B 5CILL 1MJ7L 1J9QA 4DEWA 3DHJA 4M43L 3R06A 2XCMC 3NTCH 2WQRA 4JPKH 2K6ZA 4Z95L 1O7DC 1F45A 2HKHH 3IPBA 2ED8A 5C0BA 5I74C 3OSVA 1JERA 3QZWB 2BOBB 1Y18A 4TTDD 3WTVA 2YPKB 1QPPA 3BW9B 1KZYA 4MYPA 4MNGB 4GG6F 5EEUA 3O3BB 3CZKA 5TE7L 3B2VL 1E90A 3NK3A 4Y2DD 1K4DA 2OCJA 4FFYH 5TE6L 3KPPB 4JPWH 2AEWA 3N50A 2ZG2A 2JCCF 3RWEA 4U1IA 4OFKA 5IW1B 2ZCLH 4S1SL 4Y4HC 1PDKB 1PLGL 3DKHA 3IWVA 3BP4B 1G7JB 2UVFA 3MV7B 4RWYL 3LKPB 1M6OB 1WGOA 4N2IA 3UYPB 1JFHA 4XAWL 3UX9B 3WIFA 1OTSD 4F7PA 1UURA 1TXKA 2OQJA 2ITDB 3CDCA 3P3YA 4Q9BA 5TH2B 3T2PA 4Z1PA 3L3KB 3VI4E 3MRKB 4HK0B 3K6OA 1U3ZA 35C8L 1SXCA 1QSFA 1CE1H 2ZUYA 3KL3A 3LRMA 4LPCA 3RPIA 5EBWB 5J1AA 3O2WL 4DP1X 3FO1B 3K2UL 4GBXB 4I3GA 4NZTL 1A1OA 3EIFA 4KMTL 4XBGA 4YDJB 1YEEL 3RIFK 3VA6A 5K1NA 1IE5A 1BD2B 4NQQA 3BPCB 4N2NA 5DO2D 1FE8L 1U3YA 1DQKA 3IDGB 2XKUA 2AEIT 4KKBD 1BOGB 1S7UA 1J8SA 1E5AA 5LAPA 5AB1A 5DJDA 3GJFB 1N5YL 3ARVA 2O61B 4J2QA 2FL5A 3FUKA 4HQQH 2P1YA 5IROA 5DD3L 1OM3H 3L9EA 3BZEB 1UZ6F 3BXNA 1XGZA 3P0YH 4HCRA 3V5KA 2QDVA 3H42L 2GUYA 3VMPA 4R97C 2W07A 1GYCA 1MI5E 4KK9C 4WW1A 3ESPA 4NM4H 3RL1A 1PD6A 1SJHA 2X4RA 25C8L 3DA0A 4HC1H 2VN4A 5F3HA 1C9SA 3HMWL 1BZ9B 1W8OA 3Q5OA 1L7IH 4Y4FD 4OFYD 2CO7A 4RSYA 4PY8I 4KTGA 1KBPA 3CUPB 5T1JA 1RH8A 3N0PB 5H4YA 3ZVVA 4YHIB 1K4DB 4TVPH 1BSIA 3LX9A 5KBKA 2YGVA 3DECA 5E8DL 3HZKB 4WWOA 5F1IA 2Z31D 3RWEB 1CFVL 4U1IB 5IHUL 1FSKB 3MRIA 3S48A 3MR9A 7PAZA 1MREH 5T1KA 2FIKB 2D0FA 4WDIA 3GSNH 3TV3L 4N85A 2YQBA 2WHVA 3BEVB 5K93A 5L4IA 4QHLA 3V0AC 1KPRA 1IBGH 1F4YH 2CSPA 1ZCRA 2NT0A 4F2MB 5IG7B 4KITB 4K2UH 1J7VR 4OQTA 4WKZA 3NAAH 2DIEA 5FGBC 1YEJL 4XPTH 3EJQA 3ZDZF 4FA8A 1GIGH 3R0NA 4F58H 4Z7OF 4XBGB 2K3TA 1T6VN 4RMBA 4Y5XB 2Z7UA 3LCYA 4ZODA 5DK2A 1BCIA 2PWFA 5LBGA 1FGVH 2ENQA 4AEEA 4UV4H 4OCRL 1GAFL 5FGCE 4DSYA 2E7LA 5JR1H 3L3DA 4QHNB 3ZL4L 3CDGA 1S7UB 2VWEE 1KB9J 2C9AA 1UOVA 2VH5H 1NCAL 1VEMA 2GAZB 2FL5B 3KAAA 2B1HL 1T89C 3IS0X 4GS7C 1J10A 4B5EA 3NQKA 1HIMH 1UFUA 1K5NA 2FX8L 2FH8A 2NY1B 2W07B 1LD9A 2ZCKL 4C8XA 3FQXA 4ANVA 2BRQA 2UVEA 4WW1B 4TL5A 5H2BB 4BCXA 4TUJB 2XOTA 3I9IA 3RL1B 2J5LB 5L9DL 2HX7A 4WO0A 1IQWL 3KPSE 4M3HA 3UPAA 1LXMA 2R51A 3PNWB 3QUMH 2CO7B 4RAUA 5EF1A 4P8QA 4FXKC 4M4PA 4DERA 4LCCC 5AAMC 3AGWA 4XB8A 3SDCD 3T77A 2KLSA 4F3FB 1J0KA 2WBXA 3FSWA 4MMZB 5IV2B 2NCEA 4XP9L 1MCIA 3MRIB 4NS0A 3WJJA 1DFXA 3HB3C 4JM4L 3WFEH 4WDIB 2GI0A 3PUCA 2XICA 5EBLA 5BZXA 3LPFA 1QRNA 1KPRB 1HEHC 1U9KA 1J9TA 2AQRA 2YRZA 3NCYS 4HPOH 4JKMA 5FYLD 2C3WA 3VGEA 4I13B 5LDSA 3FUEA 4R26L 2XQYG 2RBLA 3WAKA 1IC0A 2QVFB 3LQZB 3QORA 1A5FL 3JWDL 1QKZL 1ZLDA 3WIIH 2X44D 4PV9A 2OMUA 4KVCH 2NR6D 5JA8B 4ZI8A 1S5HA 3DVNB 5DK2B 1KELL 4HSQA 4N90E 2VLKD 3L3DB 1JZ2A 2YFNA 1FFQA 5CGYC 4N6QA 3CX5K 4HOZA 3UDWC 1XSKA 1GZQA 1V54B 5FWQA 4Y9GA 3BRGC 3RUGB 2OTUA 4P5TD 1JPSL 1M1SA 3FQXB 2MCPH 3DXAD 3BO8B 3LXAA 4LSVH 3L4WA 4NRZA 4IRJC 1T22A 3F8UB 2A4ZA 5B3JF 4XPBH 1CDHA 1QNZL 3C5XA 3L17A 4KMQA 3GD1C 1B2WL 2L8AA 4G8AC 4HUXA 4RAUB 1CURA 3KDMA 4DAGH 3DJSA 2YD7A 3T77B 3UTZA 4KKLD 4D7PA 1TNNA 2IFGA 5FO7B 4G9FA 1FO0A 5I15L 4XXDB 1RUAH 1I53A 4KXZH 4XCNA 4QXWA 2W81C 3FPYA 5CGMA 4TRPL 3N6YA 3FT3B 4JKPH 1ZLVH 4F9PA 4GSDH 5I1CH 1VACA 2ORBH 3IDUA 5MENA 5EU4A 2WZ6A 5IMKB 4RAHA 4N4YB 3NIDB 3MBXH 3SE3A 1XXFC 2QFPA 2OMYB 4PV9B 2OMUB 2LW3A 4F57L 4JHVA 4FL4C 2BVPB 4BFRA 1BFOA 4BWWA 3QNXB 1S5HB 1AY1H 2OXGA 3EOBA 4YLBA 2OULB 3MV9B 1JZ5A 2YEQA 3D85A 1JZJA 2DIJA 4JDVA 4XC3L 1XGTB 1AQMA 1A3ZA 1NTDA 1NUNB 1QSFD 1S7XA 1W9XA 1VB9A 2FO8A 3PRZA 4KNTA 1A6UH 1X44A 4HH9B 3PWUA 2IDCA 1B6UA 5F89A 4PV1C 2WLHA 2OTUB 4A2GA 1Q90A 2HKFH 3QZBA 4FXLA 3UMNA 1H15A 3T8VA 4LRNH 1JGEA 2WBJD 1TJIH 2DAVA 4HJ0D 4JBSA 4S10A 4J3WA 1BMGA 4MCYA 3NCJL 5I6MA 1CYGA 2ICCA 2GIXA 5IROD 2WXQA 1O0VA 3QCTH 2Q0ZX 3QRBA 4HUXB 2Q3AA 4ILDA 4D0DA 4JFHD 5DVLA 2H3XC 1CUOA 1L5GB 5ILTH 1HU8A 1N0LB 2MQGA 2JKWA 4MQTB 5DS8A 4NFDA 2H32H 1MCFA 3BSHA 2GUOB 1PKQE 3QQ4A 4G9FB 1KCVH 2BP3A 2HZHA 3KYMA 3M7OA 4JFEE 4U4IA 3P02A 4LEOA 4XCNB 5I76A 2OMVA 3H54A 5A2KH 2J1XA 3GGWA 4N25A 4TQPA 1FVEB 1LNUA 2YBRB 3GUTB 2P8PB 3C8DA 5JHLL 5EU4B 4B60A 4ODTL 3FQWA 4FS0A 1F97A 3U1QA 3GPEA 5C0DA 5T1KD 2IXQB 1TG8A 2CO4A 3RY6A 2P43B 1A14L 4ELME 4TPRH 4OLUL 5F6HJ 4E5XA 2NQCA 3W37A 1H5BC 1EZLA 5HD8D 3VYOA 4ABUA 1NBZA 4MX7A 1LEIB 4K3EH 1INQA 2YQ3A 5DHVB 1AKJA 4WTZG 1G9MC 4JDVB 1JGLL 1NEZA 3D25B 3FDWA 5T1LD 1DVXA 1UJTA 5DLML 2IF7A 4XX1E 4IMLB 4HXBH 3PWUB 2ZOKA 2X3AA 3IN2A 3MI6A 4XAKE 5E5RB 5C6TH 4FI8A 4EO5A 4CBPA 1T0NA 5IEKA 1JGEB 4PB0H 3US9A 1J0YA 4DUVA 2HX9A 4LFHG 1CPUA 1AACA 3WNJA 2GIYA 2GJ6E 4PIBA 1M3JA 5CEZL 4UCFA 1USQA 4FLHA 5EF3A 1E50A 2QV2A 5FYKD 3KR3L 3LRLA 4ISVB 4Y5VA 3L7FB 1MFCH 1MWAL 1JGDB 3V10A 5DS8B 4CC4C 5AFAA 5HDBE 3MLYH 3SYOA 1MAML 3QQ4B 4A39A 3Q9PA 1UB6A 1J1PL 3HG1A 2Q8BH 2YMOA 1THCA 3EYUL 2MHAB 1IO4C 1K72A 4EI0A 4WEBL 1DQLH 4N1CA 4FYQA 3KW7A 4W93A 3FT1A 4J7RA 3D7PA 2AQSA 5I24A 2HTLD 3RJOA 1BFSA 3QDMA 4AENA 4OUOA 2VQTA 4NC1E 5T3XE 1EPFA 1OQOA 3AAZA 3QHZL 1C5DA 2Q9OA 3X1BA 1M7UA 1YQVL 1YRKA 1PLCA 2YMXL 1FLRH 4UNTA 5F7NC 5C0FA 1YMHA 4H8PA 3AZUA 3T3PB 5HVHC 2WGXA 5CJXC 5DC0A 1NBYA 3QAQA 1NBZB 2QSCH 4JZJC 4MX7B 1INQB 3MRMA 4CJ1A 1AKJB 1A8JH 3U9PL 3DX6A 3QORD 1TTAA 4ZSOA 3V0WL 2JB5L 3NG5A 2PPAA 1CGWA 1DVFC 4BHUA 2ZOTA 4HAKA 2ZOKB 3PQYE 4WI0A 4ADIA 5AW8B 2L7JA 3WD5L 1C16B 3SY6A 2Z93B 1DBMH 2VMFA 3W5MA 5JLZA 5F7LB 1JBJA 1T0NB 5SX5H 3QQDB 3M8OH 4IRZA 2J7LA 3ML9A 3C5SB 3VTTA 1RIUL 4CSZA 4JFPB 4QTIL 1DEDA 4QRPA 4H2CA 1I7ZA 4OUUA 5J56B 4Z8FL 3IJSB 4JRXD 4R4BA 4PJ7E 2FK9A 3HC4H 3IFOB 1NBVH 1PVHA 1LO2H 2X2IA 2DTML 3BFQG 3T1FA 1AR1B 1CLZL 1HQRA 4GW5A 4APQD 4Y5VB 2QJDA 5IW6B 1U2CA 4KY2A 5D5ME 1G7LA 1LILA 2J1WA 3WIHL 5B7FA 2AJSH 2UZYA 4LOUC 2C3XA 1VJSA 1UB6B 2P5EE 2YGQA 1AHMA 4A7GF 3SE6A 3GXTA 3MOBL 4AIOA 2E56A 4MJ5A 3ZO9A 1IT9L 2E4TA 1WVZA 2Z92B 3E8UL 1LO4H 4FFWC 4I0PB 1Y0LA 1DN0A 2D9QB 1KGXA 2PO6C 3KE0A 3OAZK 5DUMH 4RRPA 2WXIA 2H6OA 5IBTL 4AJWA 5IKCA 2H6PB 1MDAA 4BH7B 2VXSH 3GJEA 4LVHB 2VLRE 3OKLB 4AENB 3O0LA 1CTNA 4OBSA 2WWKT 4IBZA 4GW1B 3UTQA 5LN8A 5MEPA 1C5DB 1TUPA 1OALA 1HAWA 2G0KA 1LP9A 2NRDA 2YUZA 4NOBA 1YYMH 5CCKL 4ODWA 4ZAKC 2J57A 4OZGA 2CAKA 5GZND 4BRJA 1I8AA 4FJ6A 4JFFB 4DQOL 1YMHB 2VLMD 4LIQE 4PJEE 2DOCA 4DF9A 4I7ZC 1C1EH 2X40A 1NBYB 4L1BA 2X0UA 2V5SA 3L6FB 4MA1B 3HJ0A 1NLBH 5FO8A 4ZSOB 2MRYA 4AVJA 4U3XA 2XHNA 1OAUL 1N7ML 4NEHB 5JHLA 3OR6A 3OB0H 3R0MA 1IV8A 4BFEA 4CGTA 3CSBA 5D7IA 4OM1L 4A1RA 3W3BA 1L6XA 3ZZSA 4YSRA 5I9QC 5JLZB 3D85D 2R1WA 4JREC 4FP8L 1TIUA 2Q10A 3S88L 4QRPB 3D4GA 4BKSC 1YEIH 1ZANH 4QJ5B 4EIUA 3FTZA 3N9GH 3KLHC 1HQRB 4N2CA 5HI3D 5I16B 4WFFD 4WJG3 2CO3A 1ZS8A 3BKML 4H13C 3VQ1C 5FV1L 1BAGA 1LYQA 1UEYA 2X1OA 4IGBC 2QSVA 2X4OA 4ZUSA 5IVXF 3FB7B 4FQXA 2BHFA 2R2EB 3FRPA 4K7FA 5DS1A 4CSTA 1E5UI 1TPXC 4Y2OA 3HC3L 5CN1A 3VTAA 1GZHA 4X4XA 2B16A 2ICWI 1S7WB 1FCGA 1KENL 2J20A 4KH9A 4Z23A 2BC4A 2M8XA 4WW2F 1CDBA 3OG4B 3S2CA 2L04A 4FYRA 4IK6A 6FABL 3UTQB 3IXTA 5MEPB 4O02L 1MWAA 2B1AH 3IFPA 4ODWB 4XTRD 4PR5B 3VI3A 1HH6B 2Y72A 3NH7H 4KZCA 2F54D 2EXWD 2F53D 5BS0A 3PAUA 5AVXB 2FEDC 3MUGA 2ZYHA 4HCIA 2VC2L 3B6SB 1A6ZB 5GIRB 1AGFA 1JTPA 4IU3B 2PABA 5D1ZD 5FO2A 1TQBB 5GGUA 3UFIA 3RG1C 1QEWB 1NMCB 1P4BH 1TMCB 1G9MH 5EIIG 3OR6B 2QEJA 1JZ4A 3CVBA 5D7KE 5C2BL 4KPHH 2KS0A 4XMUA 3SDDC 4Y2LA 2PWDA 4NHCH 4N5EC 1IQDB 1TKWB 2QKIA 3MOAL 2WYZA 3CSFA 4L4TE 4QRRE 5KSBA 1N10A 1UWEL 4NKIL 2MCG1 1V10A 3BKCL 3ZTJH 3RBGA 1NAMB 2FJHA 3QCUL 1CFMA 3ARBD 2BERA 3ARFB 3TYFB 4RCAA 4IBVA 4G6JL 3AY4C 4N1EA 1XSIA 4V1DE 1S7TB 1KN2L 1LGVA 1MJ8H 4ATWA 1CVSC 3MRRB 1CDCA 1Z0NA 4E36A 2X4OB 3R1GH 1L3WA 1KGWA 2G2RA 4ZUSB 2ITCA 3E0GA 5F7DB 3M45A 2XV2A 4MAYA 3SGKC 1RSFA 3KCWA 3NJJA 3NIGF 4XVSH 5EOCL 3FRPB 3LKQA 1T1YA 5F7MC 3TVMA 3D12B 1QPXA 2G3XA 4H88L 1WFUA 3TH4T 1FZOB 4FLQA 1EDHA 4Y16B 2HG0A 1H9VA 5KVGE 3MCKB 1BEYH 3CC5A 2AK4E 5E08H 1J05A 1JF6A 2YKLL 3DV4A 1IIKA 3HG1D 1MWAB 3WIHA 1CLYL 4OF5A 1KWKA 1XDTT 1KEMH 1PD1A 3ZQWA 1F6AA 1QEXA 4UM8A 4JN1H 3V4UL 3PABA 5FPIA 1N26A 2TSAA 5BS0B 1NCWL 3PWVB 1IC7L 4K8RL 4B9YA 2QDWA 4PEEA 4G8GA 1X5MA 5HI5C 2J5WA 3QDMD 1T83A 4M6ML 3IMBA 3C12A 5IBUG 3RVTC 4FX5A 1OAQL 3CN4A 3WS3B 4Y7OC 4JS7A 4WU7A 4QRBA 1NCTA 3H4HA 5J6SA 2P8LB 1W91A 2PW2A 3MN8A 5GRWA 5AZ2H 5KSBB 2A6JA 2XNAA 1CZ8H 1YY9C 3O9WC 1RIVH 4P4KD 5C09D 3I50L 1I1CA 2Z8SA 5CZXD 1HYSC 5JDJA 2R0LL 4YQXL 2NXYD 4V2BA 4I9WD 3QYNA 3EBAA 1LQBC 1E0OB 3OMZA 4JG0H 3QUXA 3AUWB 4L4JA 4LCWE 4LCVA 5I1IL 1N3NA 3D08A 3HHRB 3ASOB 4L4VE 1Q9KB 3RI5K 3LKRB 2COVD 3ZX1A 3MRFA 4TLSA 2OP4L 4AZUA 3KZ8A 3H9SA 1FFTB 3NA9H 3V8OA 3STLA 3IDJA 4OF0A 5D7LE 4WWKC 4H20L 1KCUH 4Z7VA 4N87A 5BZDB 2N7AA 3IE4A 2EDLA 3X3GL 2X3CA 1CIUA 4LPXA 5DUPL 3WE6B 4X6CE 1J05B 4X4ZA 1XIWC 2TRYA 3LH8A 3DV4B 3OKEB 1XH3B 3BFWA 1SBSL 3CVDA 1UJ3A 1KPUA 1F02I 4KAQH 3CZLA 3K3QA 3CLFL 4LP8A 1F6AB 4ZS6D 4YS4A 1OCWH 2AJ3B 4A2MA 2VZ3A 3PABB 4F24A 5I2IB 4DN3H 2ZUVA 4GKSB 2RALA 3QJVB 4G8GB 5TDPA 1M71A 2KQMA 4MDIB 4OZIA 1MHPL 4P9ML 1QFUL 4J3OC 5D93C 1OXYA 1INDL 2Q7AA 4GSQA 2ZNXA 3ROOA 4JY4B 5IZ7A 1FPTH 4GIAA 4LBEA 3EOAB 5J6GB 5HHQA 2QR0B 4MTMA 5GS2H 4OR1A 3L9RA 3ARDA 5G4MA 5ADOL 1QLEL 3WS6C 1JK8A 3O6FD 4GQQA 4PWHA 1W0WA 4XN5A 5HGDB 4R3SA 3REVA 2A6JB 2F8OA 2XNAB 3SKUD 4M1GL 3U4BL 1QFOA 5TGBA 3VFRA 1HHGA 3H8NA 2P7TA 3O0RL 3D9AH 3S4SA 1ZVYA 3P9WB 5ICZA 3MXWH 1N3NB 3L4UA 1QG3A 2Y25A 4OTXH 3FCGA 3DV6A 2OPCA 3JWOC 4HD5A 1M7IB 1U8MA 5DMIH 2FLRT 5BV7C 4PI2A 1Z32X 2OL3H 4B9IA 3STLB 2FJFB 1IBHA 2YAQA 3IDJB 5AVWB 5BZWB 3KYNA 1YMMD 2H2PD 1LO5A 1TZHA 5HHVL 5HJ3A 4Z7VB 5IVZA 3IN0A 5IGXH 1OGAD 3U1SL 3T3MF 1URIA 4JUTA 1BBJA 3OSKA 2DL2A 2X6AA 3MRGB 1J0HA 3B37A 2GC7C 5EF2A 3VGHA 1A0QH 3OGOE 4XCYB 4AYEC 2FO1A 1ZHNB 1QRKA 3ETSA 4HLZG 1T66C 2IWEA 4NQSA 5EN2B 1UB5B 3T04D 4HUKB 1YEKH 5AOZA 4PJ9A 2IGTA 5TDPB 3ZO0A 1M71B 1E4JA 3HI1A 3R8QA 3LS4H 4HIHA 1ZV2A 3BAXA 1U6AL 2OI9B 4K9JA 2DYRB 3P77B 3G5WA 4QIRA 2GTWB 5JZ7D 3S37L 5B1BB 5I1JH 4G3YL 4J1UA 1MFAL 4O02B 2PP8A 1CLCA 4DOHE 2YBGA 1GPOL 4UQEA 3EO1A 3IAGC 4JG1H 4MJ6A 2VM9A 2R2HB 4G6KL 2NZ1A 5EU7E 3CSYB 1GGIH 1NCUA 4X6FA 3IRPX 3IJYA 2J73A 1EZVX 5TGBB 4PJHF 1HHGB 1FNFA 4Y2NA 4M48L 3AG3B 2CM5A 4G5ZH 3S4SB 4G1MA 2WO2B 3DMMC 1OAKL 2ZSWA 1HQ4B 3PL6C 2WXPA 1H8NA 4EDWH 2PTTA 4M6NL 5KANI 3NSXA 2G4GA 3BMVA 3ZKND 2G5UA 3KJ6L 3P40A 5HXMA 3T1WA 3S5LG 2GPZA 1KGIA 4PRPB 2ENJA 1A6WH 1E8WA 2IAND 3IMUA 1NMBH 2UYLA 3VA2C 1KULA 1VFAB 2JKLA 3MCLL 1HCVA 3GXUB 3KLQA 5FCSH 1JPFA 4QOKA 4GH7B 5HPMA 3V9CA 4YSPA 4IBWA 5E9AA 1F4HA 3GTVA 2VXVH 2HLFD 4FG6D 2ERJC 4GKLA 4Q6IA 3T4AC 3NRQA 4MAYD 5LBSA 5KZCD 1M4KA 2NY6C 3KHOA 4EIGB 2F8XC 3IYLW 5FEBA 3S8FB 3SQBA 3JTTA 3K8KA 3TVMD 3RI5F 1BZEA 2CBMA 4W9HC 5D1XE 1GC1H 4U49A 3SQOH 2B5IB 3QCVL 2GJPA 2A6KB 4HIHB 2NDFA 3HUJA 3AG1B 3EJSA 3ZYZA 2VGLM 5DR5H 2HRPH 1PTZA 5GS1C 1KACB 3KEHA 1XBRA 1ORQA 2Q2LA 3LEXA 5AZUA 4AYDC 2IH1A 4YAQB 1ZV9A 3AU0A 3CIQA 4J1UB 5DA4A 2NNAB 1T1ZA 3Q6FA 3QFJB 4D9LL 4PY8J 4OAWB 1ILSA 2NQ3A 1IAKB 1SM3H 2B08A 3MLRH 2HH0H 2RCSL 2KYIA 2VDOB 3K0YA 2EDYA 4D0CB 3NN8A 4X6FB 1VZHA 4M8VA 4YSTA 3WEMA 4G8FB 3WFCL 3ULVL 2FWSA 2WAQA 3FULA 1FL5B 5F1SA 3UG3A 2NDGA 1MN4A 4OSUH 2W9EH 2X5PA 3HMXL 4BK5C 2E74C 4PRAB 2HFGH 4UI2A 4JRFA 5I73B 4FF9A 4FNUA 5IK3A 4PBVC 4TXVB 1KXVA 4L05A 3GHBH 1IAIH 2RQEA 3EH3B 5CBAA 3QUXD 4N8CH 2FBJL 4PP2A 3P4LA 1O9VA 5JW4Q 1AKPA 5ANMB 3GSOA 5CCHE 1JPFB 3W9EA 3O4LD 4QOKB 5HPMB 5IEHB 4QD2E 3H9SD 3CLEL 4Q6IB 1JK9B 5AD0A 5BRZA 1IGMH 2Z35A 4JUSA 4X99A 3CZFB 3GZQA 5TDNA 4M7ZC 5K9JL 3HS0B 3AWFA 1UVQB 4BKTC 1HL5A 5T3XH 4OT1L 3RILA 3ELAT 1SLWA 3RZCD 3CXHK 4YHPA 1GGUA 2W88A 3UTTA 4YVUA 2J3SA 1DANT 4ZMNA 3IF1B 3QRLA 4RGNE 4Z9KB 1VGEL 1PFCA 3LEXB 3QG6B 3HLAA 4J3OH 2IH1B 4F8TA 3MLPA 4O9HH 4HVBA 3VACA 3FT0A 2Y7MA 4HF5L 4OLWL 3KJ4C 3OB8A 5T5NF 3FB8A 4GG6E 3BQUA 1G6RH 5KJRH 2IADA 1HI6A 1MIMH 5IP4A 1F5WA 3HHSA 2MPAH 2PCYA 1DBKH 1QWUA 3O45B 3JXAA 4KX7A 2JCCE 1NGQL 4MB5A 4TNGA 4MD4A 4FQLH 4AQAB 2IV8A 5HHPA 5T3ZL 2MCAA 4LSTL 4DWHA 3UPCA 1J1OH 3AW5A 2A1WL 4QGYA 1ZLSH 4Q6YA 4HOMA 3KGTA 1QLEB 1G5GA 3CFUA 3JWOH 4E9XA 5D7SL 1JYWA 3II2A 4X2UA 1T7YA 4X8CA 2WO3B 3G6JB 5BV7H 2AVFA 4J8RB 1FI8C 4P46B 3UAAA 5D7JC 2J12B 4PP2B 3U9WA 1R3HB 3GSOB 4UINL 3KYKH 3W0WA 4OF3A 2X3BA 3SB3A 3W9EB 2JSFA 4HYTB 4XHJC 4KWUA 5FDWA 3DO7A 2Z35B 3AU1A 4IRSA 2XTJE 3BWUF 3C6EA 4R7NB 4X99B 5TDNB 3VWJD 1EJ8A 1MCRA 5CM1A 1NCIA 1QACA 2C4XA 3RKPA 4TOYH 4H7VA 4X7SL 1EMTH 2A6DB 4FQJH 2XWBB 1B0GA 5FUCE 2H2SC 1FFRA 3UTTB 5CCGE 1HJBC 2UY6A 4LIQH 3DPBB 1MJJB 4WLCA 4UNIA 1I4FA 1OAZL 3LRKA 4FFTA 4Z7UA 5IJVA 2P3YA 2QTVA 2G5RA 4FG2A 4NQVB 3QDGE 2BK8A 3HFFA 3KPOA 3BH9A 5EU5B 4HT1H 4IBUA 4JFYA 2WSDA 4PJ9D 3BSZL 2FD6L 2A74A 2F7QA 1HI6B 3SJVB 1FIEA 4WFGD 1MFBH 1BVLA 3GMNB 1U8KB 1BQLH 3HHSB 1M1XA 4FFYA 1BEXA 1IX2A 1PJ9A 2YFOA 4ZUUA 5F7BA 4F15C 4HUVA 1GGCL 3QO1A 4U1NA 4MD4B 1KLGB 1TTCA 5HHPB 4L8CB 3I02A 5CR1A 3AQDA 2GSGB 4ES9A 3M07A 1QQDA 3QXDA 4FQ2L 3K8LA 4B9GA 2BNQB 4AGLA 4PJXB 5D2NE 1CLVA 2DLHA 4UBDC 4ZTOL 4GMSH 3CCHA 1FVCB 2A73A 3MODL 3MRNB 4X6BB 4Y2DB 3EJYC 3NEEA 1KTDB 3ZKXC 1A6AB 2DQCH 5A40E 4JLRB 5DJAB 3MFFB 1DVTA 1KEGH 3D39D 2ODHA 5T33L 5C0CE 1P7QB 2FECL 2LABA 5DHYA 1LP9F 4B9PA 1AQ8A 1GXEA 4OZGF 3L5XL 5E9DA 4IRSB 4ACTA 1B4JH 2J44A 2OFQA 2DLIA 3Q06A 1KBGH 1Q8MA 4JO3H 4KRLB 1UA6H 4PWIA 2AKRA 1R34A 4RZCB 4JKWA 3QJHA 2ZP9A 1JN6A 1TJGL 3DTDA 3KYOA 5DWPA 4JPQA 2OMXA 2HLAA 3QEGH 2BXZA 3GKWL 3ILQD 3BWAB 2UY6B 1R0AL 1F8TH 3NABH 4X9BA 3U7AA 5GGTH 1R3IL 3LPWA 5D7IF 4A63A 4QEGA 2HFEA 4P2QE 1YN7B 5C7ZA 5FXCH 2DZEA 1SBBA 3QZPA 2ZOUA 2VR8A 3MA7A 4MS8D 4ELKB 4Z7WE 5FF6A 3MA9L 2A74B 1GW6A 1JG9A 2E27H 3X14B 5CBEA 5CEYB 4LU5H 4G80A 1BVLB 1M1XB 2V6HA 5HHOA 2Y7QA 3G04A 3LDBB 4X4KA 4ZUUB 1J87A 2ZXEB 2BNRB 3G6AA 3MACL 5EU7C 4XNZC 1FFNA 2O6EA 3FQ4A 1B0RA 2LT9A 5BO1H 4I1RA 3PXLA 2E9JA 3I02B 4UIKH 3GSNA 3HI6H 1B90A 2GBVA 3K72A 4KKCC 5C0AE 3ASNB 4L5FE 5B39A 5DFWH 1GGBL 2VQ1A 4KDTC 3LH9A 3TPUA 5IB3A 4QHUB 1V7MH 2B4CL 2X2JA 4IEFB 1RZIA 4F8OA 2UY7A 1YSOA 4Y5YC 4RWHA 4QT5A 1NCJA 3S34H 4YBLB 5CD5C 5G5DB 5CSGA 2XQ0A 5A6IA 4F7MA 1BMWA 5CSBA 4R7DA 5DHYB 4U6VL 4EE2A 2VLJD 1RI8A 2VM3A 3WEXB 4YHYB 1KLUA 5DXWA 3VI3F 1NFDF 5AUMB 2DV6A 3T71A 4XXWA 1OZTG 1N4XH 4WUUE 2QPSA 1IE4A 5KVGH 1ONQA 3VXQA 1OSYA 3UC2A 4K5OA 4C47A 2P48B 2CJUH 1H0DA 3WTTA 5KEZA 4WO4D 4XC1H 3MUJA 2AQPA 1M05A 2OMXB 2HLAB 1DSYA 1JPTL 4WNQA 5BRZD 2X4NA 3O8XD 2ITFA 3L2NA 9CGTA 4BFIA 5EBGA 2HFEB 2MQCA 1YEFH 5GISH 5DJCB 3VXRB 3GHEH 2VAAB 3MA7B 1CFNB 2AJXL 5IBLC 3DIFA 3FZUD 5FF6B 4TSBH 2Y7SA 5DJ0B 2WLIB 4NB7A 2MTPA 2G3MA 4BIKA 2YPLA 4PYHA 1YEHH 2MOVA 5DC2A 3S96A 1Y07A 1OP3K 4XMPH 5E2TH 2NY5L 3GMRA 2OR9L 3NSFA 3SPVA 1K4CA 4XXCC 3QXWA 1FFNB 3DTXA 4RBPH 2FYYB 4KXDA 4U6YA 5F9JA 1VKXA 4RISH 4BJLA 4XPHH 2CJ3A 3FFCB 2CGYA 2Y2YA 5DZVA 3A21A 3BQUD 4HJGB 5HBBA 4NYLA 3DX0A 2E8ZA 2EIJB 3D0VA 4XMLL 5DZLA 4A7TA 1X4YA 1MCNA 3SOBL 1XGQB 2P4AB 4MA8L 1K85A 2PUQT 5DYFA 3QWRD 4PJ5A 3EDJA 3BSZA 4KK8C 4PLKC 4DK5A 3KH4A 3IDNA 5CJBA 4HS3A 3FK3A 1J5DA 1HAUA 1MDTA 1QO3A 4AM0Q 3MLUL 2QHLA 4TN9A 1DQJB 4OW6A 4QPEA 4LHQB 4ELDA 5LXVA 2JTYA 2FH6A 5JDSA 5DVMA 2QADD 1LEGB 4F7MB 4MMXC 3LZFL 1KG0A 3NT0A 2HVKB 4HCFA 1G9HA 3MUY1 3GM8A 3PP4H 3BH4A 4PBXA 4PREA 1P1ZA 4Q0XH 4P2OC 4HWBL 3VXQB 4CKQA 4HJIA 1TEYA 1JZ3A 1P4IL 2VDPH 3TN0B 5EUKA 3L2LA 2AQ3A 2XPGA 4KK5D 3DX2A 1HWGB 4AV0A 3MO1B 1AXIB 3NFPA 1Y6MR 1JVKA 3CN3A 2BVOA 3HS9A 4I88A 2DLGA 4FQIL 1JPGB 3O6MH 5DZ9A 4BFIB 4H44C 2F15A 1EO8H 1JVLA 2X53A 1NLDL 3E6FA 4H25B 3OHXA 1SEBB 2B1OA 2AJYH 2BZ7A 4UT9H 3QZOA 4Q2ZA 4W6XB 6PAZA 2FSEB 2YEZA 3FB5A 2YA0A 3PWPA 2DQTL 3QNYB 4CRPA 3S96B 1GH7A 3NJXA 3SPVB 4N86A 3DTXB 4JFWA 4ZT1A 1YNLL 1MY5A 4Z3GA 5F9JB 2BZCA 4U6YB 4YHKL 1VKXB 3FT9A 1FC1A 4TQEL 1U8CA 1U42A 3LH2L 1L6ZA 4PRIB 1AE6H 4L18A 1INEH 3D0VB 4E5XG 3DNKA 3QRGH 1H6FA 3FQNA 4S1DD 3WN5C 5DCCA 3T9WA 4AH2A 4YHOH 4AV4A 3IDNB 3H0TA 4PJIA 1NEZG 1FVDB 1E4WL 2YAFA 1QO3B 3GBEA 3CFDA 5KWYC 2YHGA 4C59B 1CL7H 1X5IA 4A2LA 2CE6A 3ASWA 4KJWD 2AHIA 3ARQA 3MJ9H 1RUKL 2X4QB 3S36X 3S5ZA 1KG0B 2X1QA 2GTZA 3TJEH 5HVWA 5LB1A 3VD1A 5LKNA 4PTUB 3DUHA 2IOOA 1TQCC 3AREC 4JQIL 4PREB 3FTYA 1P1ZB 2CKBL 1SXAA 2XTJC 5KBPA 3W38A 2XWDA 4RDBA 1I1AC 2YK1L 4LSRH 3RU8L 5FK9A 3H85A 1ZT1B 5FM4A 1H9DA 5TFSH 1KMGA 5FB8B 4K71C 3QXUA 5EUKB 3ARRA 2FX7H 1NMAH 3HI5H 1RHHB 3PHQA 5LCVH 3UMTA 2FJGB 5FO9A 1D5IL 5E9DD 1PZDA 4Z0BH 5FUCC 2OX5B 1MKFA 4OFIA 2EEAA 4NNPL 1OGTA 4TSAL 3QDJD 5I8OL 2R4SL 3ZR5A 3NJVA 3FTWA 2AJUL 5DRZB 3V0VA 1IL1B 3CHOA 4ANXA 3JTSA 5TPWH 2RFXA 3GIVB 1UH2A 2GT9B 1FNEB 2FBOJ 2WVVA 3JV6A 2BJMH 3OQ3B 4AMKH 1EEZB 4K5MA 5CLZA 5E4IA 5D1QE 4GMTL 3ZE0F 2X9XA 1RVFH 3VRLF 2XWZA 4KX8A 5LDUA 4YO0B 4X4MA 5DC9B 4MNQA 1OHQA 3CHQA 4FQ1L 1U8HA 2BHYA 1VF5C 4FKKA 3ABMB 5T5FL 1IILE 1NDGA 4H1LB 4R0LB 5FHBL 1ODUA 2WLJA 1SXNA 4XP4L 4TVPD 2OJEA 3IPFA 2EE2A 5HHOD 4OF7A 3HOGA 1N9PA 4AH2B 1UXWA 5E2WH 1JP5A 4N3UA 1A4JB 5D2NC 1Q0YH 4P2RD 3VFOA 1YJDC 3CFDB 4LRIC 1UWXH 4J28A 4KTEH 2CQVA 2D3VA 4PAZA 4UMSA 3V0GA 1NIAA 4I48A 2YLHA 2R9HC 2GTZB 5GZOC 2XWTA 4X4YB 2NZ9C 2AQQA 3P69A 1WLHA 4AVIA 4D3CH 2JQAA 4RGMC 3F83A 5FK9B 1HZKA 3QIBA 5C08E 5IHBA 5B21A 3HFML 2D4DA 3S3JA 1V3JA 5IF0A 1WRFA 5KVFE 2A9BA 3GO1H 1HNGA 1SXBA 3PHQB 2X2YA 4N2LA 4ZO6A 4S0HA 3QAZC 5FO9B 5GPRA 5I1DB 5K69A 3KL5A 2VDKL 4JMXA 4BQ9A 1PS3A 3VXSD 4NP4L 3P0VH 2E76C 3BGFC 3V0VB 3KLSA 3MV8B 3BP6B 5EN3A 3SKNA 4HWBA 1XL6A 2D3NA 2WVVB 3NJGA 1P7KA 4MAUL 4RRPG 2Q3ZA 1XQ4A 3HCVB 3IDMB 4M93B 3IM1A 1FFOA 1MH5A 1U58A 5AAPA 1S9YA 3B2XA 4MNQB 1SQ2N 1XBDA 3L54A 4Y88A 4Y1TA 3VGDA 3GEFA 3VGFA 1BVZA 1IGIH 4I2XB 1LEKA 1GOGA 3OG6B 5D7EA 5ITBL 1HSBA 4M3KB 4J3UA 1BF8A 1KJ3L 5BJTA 3RJQB 3OJDB 4IMKA 1I1RA 1CF8H 3GXIA 1CICC 2D7OA 2YPLD 2WQSA 3LPGA 3UO8B 1H3XA 5TE4L 1OTUC 4R96B 4X9GA 5CZRA 5FUOL 1USZA 3ULUL 4G6FD 4EDXB 3A67L 3VXMA 2G3ZA 1HXYB 4RMVA 2CGRH 3N40P 1WFTA 2AI0L 3NIFF 3FUJA 4P9HL 4M1CC 5DJYA 3CTTA 5CP3H 3S8WA 1LK3L 5DI8B 4MXVE 2C26A 2JWYA 2JLPA 2XWTB 4LMQI 1KTJA 4OJFL 3BDYH 4FAAB 1T03H 2ZSVA 3VDAA 1TTBA 4FFVC 3FUNA 2R0ZL 1U3HB 3CZJA 3OZ9H 4B50A 5ABAA 2DICA 4U7MA 1BQUA 4IOSD 4LMQE 3QIBB 4X9FA 3TJHC 3SKOA 2OYMA 3HUJF 3T6ZA 3AGVA 1SMDA 1SN5A 2V7NA 3OBAA 1KV7A 3T0AA 3QXAA 4LSQL 3WUWB 2C9XA 3C09C 4MB4A 1WZ1H 1I3VA 1J8HA 1IGYB 1JFQH 3IETB 4MNGE 4V2CB 4ZFZB 3FRPG 3ECVA 4TVUA 2YPVL 4JQIA 3U0WL 3U9UA 4W9ZA 5FM5M 5D6CB 3PWJB 3UG5A 5KVEE 5LGJA 3MRCA 1MCOL 3HHMA 4KGLA 3ZHLA 4CVXB 1MH5B 1KB5L 5CSZA 4EKJA 1SJXA 4HV8A 5JW4R 1A25A 2VR4A 4KGJA 1MQ8A 3I6KB 4OZFA 5AAWC 4NCC2 1XGUA 4NO3B 3NEXA 3ZLQC 3MV7E 1AO7D 2VOTA 4LCUB 2ZKYA 1XEUA 3AS2A 5CINH 3KM2A 3PWPD 2LU4A 3M17A 3RX5A 3UBHA 4IHOB 4FZEL 4EIZC 3TNNA 2Z34A 1IBDA 5TF1L 2CJSA 2E47A 4XO4A 1AR2A 3DX7A 2WXJA 2ZTBA 3I6SA 5I5JA 3VXMB 4OM0L 4YC2C 3ZKQD 4APQB 4KH2A 5AKTA 2SEBA 4DW2L 5F72S 1T4KA 2HFFB 2J21A 2WJ5A 1KFAH 3OR7A 1BD2E 4H8QA 4Y4HD 2WUCH 3MXVL 5F9OL 3TBSA 2NY2C 3QS3A 1IGJB 3ZHDA 5FUZL 1EAPA 1DQMH 3MNVB 2MPVA 3RNQA 2VCOA 5SWSA 3C6SA 3WSQL 4OB5L 3UERA 4P4RB 4PJHB 5L4FA 1FC2D 2QT6A 3LSOB 5H8DA 5AW1B 4OLVL 1Z9NA 1AOHA 3PFUA 1RZKL 3FTXA 3KYAA 4LQFL 4L3ED 5EZJB 1LWRA 3QYMA 5C0BE 3WKMH 1UH3A 3QXAB 5EZOH 2R23A 4PS4L 3RVVC 1O9WA 4JKKA 3T8XA 1OQXA 2CKBB 1E27B 5DJ6B 4XT1C 4AL8L 3G08A 1E3XA 3AJ7A 3QJZA 4NQEB 5LGJB 3MRCB 2EYRB 1Z9OA 3PV6A 4ZTEA 1OPGH 2E9IA 1J11A 43CAA 4HWEL 4XGZA 4ZOEA 5E4EC 5F7YC 2JJTC 4BUQA 3MREA 3DX8A 4GUPA 3NIGE 1VCBC 5D70L 3AS1A 3I84A 4F2ME 2D2CC 3ZTCC 4TUUA 1M56B 3RTQA 3HVDA 3TNNB 2MMXA 4FEMA 2DQ6A 3QHTC 2WXRA 3MQIA 3S2AA 3JT0A 4N2BA 5LBVA 2CHDA 3B2DC 4YXHH 2F58L 5I6OA 3TH3T 4NM8L 1OGSA 3FH5A 3C6LA 5J11C 2W0FB 4ZZKA 1JHKH 1JNHB 4M03A 4BSVA 2MFNA 3VG9B 4W9KC 4UT6H 2DKUA 3FU5A 1IGFL 5TF0A 3PGCA 3L4XA 3PXHA 2X4TB 1EAPB 1AJ7L 1WIUA 4HWZB 2A9CA 3RNQB 5JW3H 5SWSB 3CFIC 4HU2A 4I18B 5BVPH 5JHDB 4YDIH 4TTDC 3SY0A 3QIWA 2QZQA 1N12A 3WDIA 2IH9A 4JFUA 4K3JL 5GGSA 4NO5A 1N70A 4Z7UF 1PG7X 3DSFL 2P26A 2F53B 1PZ2A 2C9QA 1YCSA 5KVDL 3ZMEA 4EUPG 1DSFH 3SO3C 2H8PA 5DD5H 2VDNB 1MI5A 3B83A 2X4PA 4HHAB 3G08B 2NUTA 5D1ZB 3FU3A 2Y9RT 1OTSC 2J6EL 4PY7B 4PWEA 1JZFA 1OW0C 2XWJA 1A4KB 2QQQA 3I75B 4R8WL 5GRYA 2IPUG 5D1QC 1BREA 5DJZB 3PHOB 4GAJL 2DH2A 1BVKA 2H6UA 3MREB 3SDAB 4ZFOL 1PYWB 43C9B 1HEZA 2VDKB 1O5DT 2YQGA 4AQ1B 3U2SA 1A1NB 4XVJL 3F6LA 2YPVA 2ICEA 3FXIC 3RTQB 5DO2C 3L3OC 3ARBB 1E67A 2YGNA 4ONFH 3L48A 5HDQH 4KTDL 3G9VA 4L5FH 3EHBB 2EO9A 1OE2A 2YC1B 2AAAA 1KB5A 2P8MB 4XNMB 4EBQH 3LN5A 3OKYA 3BGMA 2KZKA 4MQ7B 1GVIA 3K6FA 3O11A 4CSSA 5LXGL 1JNJA 3V4PB 4H8VA 3RDJA 1L0QA 3SDYL 3DGCR 2ZAHA 1T7WA 3KPRA 1FZKA 2EDWA 3B34A 3VFTA 1Z5LB 5L8KB 3SY0B 3W82A 4JFDA 3FTGA 2IJ0C 4Y4FC 4KQ3L 4O4YH 3S4SG 1KGJA 5FYKE 1F13A 3BD5A 2AXHA 3PREA 3MYJA 4P59L 4PP1D 1PY9A 1ZLVK 4O58L 3OMAB 4M62H 2H0FA 2ZWYA 3GFUA 2RAMA 1S8DB 2Z31C 1R47A 2BW5A 4DGVH 2VO8A 2NY4D 1PKOA 1PLAA 3OJMB 3MJGX 2NUTB 1W72L 3GMOB 4ERSL 2E6QA 4PGBB 2BOCB 3BFOA 3VRIA 2XWJB 5MP6L 1PAZA 3KWVA 4YE4L 1BM3H 2ZJSL 4WY7L 3FC8A 4H0LC 3C08H 4N26A 2KQNA 1J8HD 1F00I 4AYSA 4WKXA 4LOFA 2BFVH 3ZE2B 2BIQA 3SDXB 4GAFB 1M2VB 2CG9X 4H8WH 1QRNE 4LL9A 4UOW1 3ARGA 5FECB 2WXGA 3AG4B 3SCMB 3BSGA 1UM5L 1CXKA 3NIDE 4J23A 3FRUA 3KVPA 1ASPA 2WKOF 3CSTA 3TBBA 1JV5B 3D8MA 3T2NH 4UT7L 1VAHA 1CDIA 4BQ8A 3DJTA 2XA8H 3L16A 5EUOA 3WJMB 2R0WH 3O11B 5E8PA 3LMJH 3UZEA 5JPNC 5D8JH 5FKPA 5IB1B 2YXFA 3VX1A 4K3DH 3D0LB 3TZVC 2A4EA 5L2JB 4YNYB 3VFTB 4CN6A 5AL0A 1GY2A 2OJZL 1SJVA 3RX7A 2CNZA 2N3JA 2IPKB 1CYXA 2FX9L 2EH7H 3FTGB 4R2GD 4LNRA 3RPKA 1IBYA 4BRVA 2OK0H 3UROR 1E40A 1ED3A 4N2FA 4RFNC 1BX2B 3CN2A 4HPHA 3SDCC 4E41D 2Y24A 1LO0L 4MASA 2DQUL 4LEBA 4CMHC 2WW8A 1OCCB 1Y1DA 5IJCC 1X5JA 4JFOA 1A7RH 1I9IL 3EOTH 15C8H 2FSDA 4KVNL 5I6PA 2ADGA 2E46A 5EDSA 3UBGA 1BZ7B 1GZPB 1J9SA 2G4EA 2MKWA 4QKTA 3OKKB 1UM4L 2BH0A 2MNJB 3VFWB 3KBHE 2BSTA 4ZFQA 4G9FE 4L3CB 4PRHA 5I1HH 3HE6B 3WNOA 4MYWB 5B1JC 2H1PL 4FN0A 5DUJA 3O6FB 2HCZX 4JN2A 4P5KB 4AIEA 1G7MA 2Z65C 3DPDA 4OZHF 1I8IB 4CADB 2X6UA 2PMZA 1JZDC 1HFUA 1YECH 4NT6B 2G5BA 5MENE 1RULL 4WIQA 1C7TA 4AYMC 5K9KA 4WW2C 2ATPA 3ZGIA 5HVFB 1X9LA 3PJSB 4D2NA 1Y1UA 5EUOB 2H3NB 1HH9A 1K3IA 1KTKE 3BYYA 1QLFB 4TULH 1M9SA 5E8PB 5AW5B 3V7AE 5J6HA 2VN7A 4BUHA 2GHWB 4P5TC 4AJYV 4ZFOA 2G2NA 4F8PA 1HL8A 1BPVA 3ME0B 1SY6L 3GXFA 4UQ2B 3K7UA 2UXFA 3C6LD 4RESB 1ZKAA 3NZHL 3QI9B 5CKGA 3B7YA 5F7KC 1KGUA 1KSRA 1XR8B 4UTBH 1QAWA 1XZWA 3NSYA 5CMAB 1P7BA 4FGMA 4XI5D 2DQFB 3FF7A 1QBBA 3NDYE 3D2UA 3GDBA 1OM9A 4UQDA 4AQ8A 4KKLC 1SMAA 3IDXH 4XBPA 4JMNA 4L2LA 3N06B 1IARB 4KDVA 4GI9A 1ZMYA 2R69H 3T0VA 4YX2L 4RETB 4ZRGA 1IFHH 1S3RA 1FYTA 1WAEA 1BA9A 4PJCB 5EO9B 5F7EH 4LAJH 3K6SB 3A23A 5IJKA 2Q87A 5KUKA 3ZZQA 4QXGH 5BUAA 2BSTB 5E8NB 1EWHA 3KM1A 3C75A 2DQMA 3II3A 1UUSA 4G8EA 1N64H 4PRHB 4BUGA 4AYGA 3OC8A 4FXTA 4JN2B 1MI5D 2A3TA 4DPCX 2IAMA 3VD2A 4POZC 4KHXL 4XN1A 3KPQB 3OKMA 5KYXB 2JJSA 3LQMA 3GF8A 2YKKA 2EVIA 4PJIF 4JFEA 2G5BB 1DJGA 1ZE3C 4MB1A 2CGZA 5DA0B 4RAVB 4PVBA 4HXAL 5DUBA 1W72A 1L9QA 2EYTB 1J1XH 1Y6KR 3D48R 3C5ZA 4UM9D 4DVRL 2V2TB 3P11L 1JPEA 2HT4C 4XBEL 4YSUA 4HLEA 4TV3A 2XG5A 5LUMA 3QVAA 3WEAA 5HVGB 4JHAH 1HH9B 3T3PE 3TTYA 5KSVB 4OLZL 4WGVB 1CJYA 1DQIA 3MBWA 4ZFOB 3BT2L 3BLKA 4JFQA 1FJ1A 5HHMD 1NOLA 2A6IB 2EECA 4GINA 2IANB 3O41B 2J43A 2WBJC 1DVZA 4HJ0C 2P42B 1UA3A 3MJ7A 2VDLH 3KVDD 1WEJL 4NERA 4AG4H 5IROC 2IWKA 5IQ7L 2R8SH 3OHMB 2ZWNA 1FH5H 1H3GA 2XLLA 3MBEA 3BVNA 4L1LA 3KPRD 4IBLT 5KVFH 4HSCX 2BVEA 3GS7A 3FO9A 1JZ8A 2ZPKL 4JFDD 3CPLB 1A7QH 4AE0A 5DF0A 1FBIH 1MCPL 3LHPH 1FYTB 4PG9B