3EUUA

Crystal structure of the fgfr2 d2 domain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
100
structure length
100
Chain Sequence
NKRAPYWTNTEKMEKRLHAVPAANTVKFRCPAGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHTYHLDVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Fibroblast growth factor receptor 2
publication title Crystal structure of the D2 domain of hFGFR2
rcsb
source organism Homo sapiens
total genus 22
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2008-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3euuA01
3MOQA 3OPZL 4UI2A 3C8DA 1NCCL 1UJ3B 4OLYL 3ULSA 4MA7L 1LO2H 4UAOC 5CGMA 1RJLA 4R2GB 5C8JB 4XCEA 4AZ8A 3ILQD 3PDGA 1LD9B 1CGUA 1KIPB 4J3TA 4WHTB 4KH2A 2X4TA 2B0SL 2DIBA 3W81A 2HT3C 5CEYA 2FEDD 1JPSL 4H26A 1WT5A 4IOIA 5DEFB 2Q86A 4OLUH 5F7KC 1KTLB 1U3HB 3C5JB 5D2LB 3EFDH 4LSSH 3ZHLA 1CIUA 2JJUA 4PJHA 4IRSD 4L8BB 4ZFZA 3FQWB 4K55A 2XZQH 3HS0A 1TTGA 3I3EA 1F58H 1KJVB 1Q9KB 3FHAA 2QJDA 2X4SB 1RZIB 3MV8A 3S36H 1QRNA 2F54A 4X4XA 4D9LL 5HHMD 3ILQC 4IMLB 1H3XA 2CLZA 1H5BA 4RBPH 4ODWB 4AK1A 3VG0L 2GJJA 2BXZA 1MCIA 3LKPA 4R97B 2FEDC 2FCBA 1FN4B 4HWEL 4FABH 4HX1A 5FYJH 3Q0HA 5C6TL 5TQ0H 2BOBB 4OD3H 2XG4A 3LPGA 3QUMB 1AGEA 3KYOA 3MLZL 2VC2H 4IRSC 1UA6H 4X5WB 5HGBB 2OSLA 4PJGE 1OLZA 4PREB 1W72A 4IDJH 4GKZA 4PR5A 4WU7A 1E4XH 1KELL 3MLWH 4P5KA 1X6NA 3L3JB 4HMDA 4IRZH 3EGSA 2VXUH 4BZ2H 4PG2A 3MGAA 1J1OL 4QRSA 4UU9A 4WRLA 4XHQA 4DAGH 1OWRM 1DE4B 4J3SA 4QY8B 1MHHB 1JNLH 5HYFA 3CZFA 2IF7A 3SGEI 3OKOB 5JORB 2EE9A 2ITCA 1P84J 5GS3A 5D1XA 4ETYA 2XA3A 1D5BA 4POYA 4AENB 1S7WA 3FRPG 2A1WH 3BSZL 3P4OA 3KS0J 4WEBH 3UJIL 3ROOA 4B5EA 4D9RE 4YNYA 3A67H 5FO8A 4TUOA 4BYHA 1SBSL 4PTUB 4ZFOB 2F8VA 1V3LA 4Y5XA 3LS5H 5EU5B 2LU7A 4M6OL 2AEIT 4U6XA 5KZCB 4WHDA 2G2RB 5DJZA 4E42A 5CUSH 1PSKH 4D94A 1Q38A 4M7JL 3MRLA 4PRBB 4PS4H 4X98A 4OBSA 3QCUL 3OKMA 4JFDE 4G3YL 3FB6A 1CFVL 5EU6A 1UVQA 2EH7L 4QOKE 3UTPD 3X12B 3ZYIA 5BJTB 4HS8H 4MAYD 3C5SB 1G9NL 5BRZB 3IDGB 5CZVL 3TIEB 1ZTXL 2QEJA 3QUKA 3QWRA 4HMEA 4K9EC 1CDIA 4PJFE 3VXSA 3MLUH 1J1XH 3QPXH 5I66B 1T7VA 5I8OH 2B4CH 4JFOA 5KVGH 2Z93B 5DA4A 4DW2H 1YEDA 2AK4A 3L3DB 5BOPA 3EYUH 3KPQB 3DHMA 4FP8H 3NBNA 1O7SA 4RZCB 5K59E 4LDLB 5FHBL 2XOTA 4UDUA 3FT4B 5HHOB 3O45B 1R6VA 3PWUB 4FXGB 1WITA 1YEGL 3JTTB 2ZCLH 3MGOA 3BHBA 3QDHA 4XPGL 5T1KA 1BD2B 5C2BH 4JM2A 4MAYC 3T77B 3B2VL 2NW2A 4P2CG 1JGUL 1FLRH 2GTWB 2NNAA 3QZWG 2JB5L 1J8HA 2IPTL 2NMSA 4X6DF 2VLRE 3LKOA 4U1HB 1BLNB 5T1LA 1HYSD 5BQ7B 5C07E 1ZLWH 4YAQB 2FB4L 3FB7B 3MA9H 4A6YL 1JGEB 5HJ3A 1YPZB 1FL3B 3V4UL 1N5YL 2WWKT 1JPTL 2IAMD 1PLGL 4MB5A 1QFWI 4PJEF 3EJYD 3HE7D 4HF5L 4GLRI 1MCOL 2G5BA 2MSPA 3H3BC 4ZTOH 4LPCA 2YBRA 5IESL 1NCBL 3VU2A 1FFNB 1CICB 5E2UL 4LVOC 1OLLA 4JRXD 3H7BA 3OAYH 4Y4FA 1J0YA 5D7KD 1C08B 1T5WB 1HYSC 3QUXB 4MDJB 5HYSG 1CVRA 2GJ6B 4MZ2A 2NLJB 2JK5A 5EUOE 4U1GB 4X5XA 3RDTA 3DV6B 3L3HA 2IAMC 1UWXK 5FUZH 1OP3K 3O2VL 4MQ7B 2WBWB 2X1WL 2XZAL 3D18B 3L3OA 3P4LA 1CS6A 4GG8B 4FG6D 1GGBL 3CFIC 4M5YH 1X6LA 3HE7C 4Q6IC 3DX6B 5J1AA 4X4YB 1PY9A 5FYKU 5DZNA 3U46A 1INEH 2VRAA 1FGVL 1Y6NR 2LAGB 4P46D 3NFPB 4NKMA 2G60L 4O51B 4WI4A 3WFHA 1RJYA 3I6LD 3MFGB 4Z7OE 1WWCA 2OX5A 1LEKB 2XNAB 3QEGH 3FAXA 5GS0L 1M6OA 3O6FB 2L7JA 4OFVA 3V8CA 4FG6C 2AXGB 4U05A 1EO8H 4DEPC 3UZVB 4FQ2L 2H6PA 4M5ZL 5DR5H 1OWWA 5F7YC 4R26L 4GXVL 3MLYH 3VXRE 4NOFA 1YQVL 5CBEA 1YEKH 3TNMB 3L3KB 4P46C 1WFOA 2X4OA 4I8DA 3WIIH 3FN0L 1IKNC 1A1MB 4M7LT 2EICA 1JCKA 3X3GL 1PG7W 1A6AA 4YZFF 1T21A 3RNQB 3V7AE 4ZFFA 4NQCB 5IM7A 3BXNB 4U1LA 4Q74A 1YMHB 5DHXB 2FHFA 2FSEA 4MNGE 2G9HA 1FZOA 2VDOH 3CFBA 3MNZA 5HHQB 3MXVH 4KRMB 4MD5A 5D7SL 2YPLA 5DWUH 2JIXA 1OVZA 4LSPL 2EEBA 4QO1A 1LNUB 3MBEA 4AEFA 1KFAL 5JXAH 5EDXA 2IG2H 3IF1A 5I1IL 1HINL 1KGCE 1NC4D 2AJSH 4G80B 1KPUB 4TSCL 1KIRB 3JV0A 4OKDA 4OZ4A 4TPRH 1UENA 5EWIH 1EA9C 5J7CC 3WFEL 2GUOB 2AGJL 1AFVL 2VQTA 1CDCA 2E6JA 1DN0B 5GS1B 3MJ7B 3PWNB 1DBAL 5TE4H 4K71C 1GPOH 3HPJA 2XQYG 4RIRA 5BW7A 1DBKL 3CH1A 4O2FB 3RJQB 4PD4J 3ZE1E 5TDNB 3RL2A 4L4TB 1YMME 3WUZA 3P0VH 3P77A 4YHZH 3O11B 4PJBB 3DVGB 3MROB 3HMXL 5E6ZA 4HPYL 1MLBA 1NANH 5IJVA 5DZLA 4PJ9B 1NMCC 1JWUB 4EDWH 1IM3A 1JUFA 1CLCA 3G6DH 3UMTA 1U2HA 3UDWC 4RRPG 5FYJU 5JW4N 1F6AB 1ZKAA 2DQUL 4GRMA 1NGYB 1QACA 4FTVA 3QG6A 1F90H 5K59F 4XVSH 4I77H 3B5GA 4YK4C 4TVPD 1Q94A 2X41A 4WWKB 1P7QA 1ZLSL 1QRND 2F54D 3QH3B 2F53A 3VFRB 2PXYA 4PJDB 4KZEL 4IHOB 1F4XL 1MRDH 4LLQB 5CKGA 4UOJA 1MH5A 1NSNH 4YXLL 4LSQL 2H3NA 5C0CE 4JFEB 3QO1B 5BZDA 1WT5C 1MAMH 4H20L 1A3RH 1IC4H 1IBGL 2PTTA 3BDYH 1QQDA 5DK0A 5KN5B 3SDCA 2LQRA 5LXGL 2ZG3A 3MGTB 3PHSA 4Y1AD 3SOBL 5LJYH 2UVEA 1RUQL 4ACPA 5CJQH 4QHKJ 4IIQB 1T0MB 1ADQL 5E8OB 3NCYP 4OLZL 2OBGA 5A40E 3VD9A 4JG1H 4S2SA 4X9BA 5J57B 1H5BC 3TO4A 3HI6L 5HYIA 2C5DC 5F70A 3CLFL 5I75C 1QSEE 5KS9B 4F2MA 3ARFB 2DWDA 5HYQB 1PKQE 2J5LC 3PWVB 5CHNA 2ATPA 4XPTH 3VWJA 3LEYH 3JWDL 2V7NA 2XZCH 5D1XD 3NTCH 4P0DA 5KSBA 1LDPH 4PRHA 5IFHH 1E27A 1DLHA 1I1YA 1EERB 4HGWA 4OFIA 5GGUB 1F4YH 2A6DB 4HIXH 1TDQA 3NABH 5F3HB 1A47A 3RIFK 1KB5L 1G9ML 2BVPA 1P4LB 4GS7B 4PG2C 3UTTB 3W9DB 5HPMA 4ZTPH 4R8WL 4CVXA 4NBZB 3UTSE 1MNUH 5ADPH 4UIKL 3DO7B 2ATKA 1B9ZA 5EU6D 2VSDA 4PRNB 2R2HA 5D1XC 4MCYB 4UINL 5SX5H 1NAML 1MFDL 1JI2A 2E9IA 5H94A 1HHIA 4K2UH 1TJIH 1T1ZB 4MYWB 4MNQA 1T3FB 3IDIA 1WF5A 3VXSD 5FYJD 3OKNA 3SE9L 2AAVA 1REIA 4JRYE 2R4RH 3AVEA 2AK4D 2GIYA 4WO4B 1UM6H 5E03A 5EZIL 5MEPA 4JFPA 5MEOA 1Y6KR 3MLVH 1K4CB 5LKNA 1XGQB 5T1KD 1A4KA 3LKNB 4ESKA 3TWCL 3RWEA 3P9LA 1I7UA 4PJCE 4YHLH 4JKWA 2YC1A 2CLVA 3ULVD 4O58H 5GZOD 2VXQH 2X7LA 4ZAKA 4G6KH 1J8HD 2IGFL 3ZE2F 3CFCL 32C2B 2NY4B 2EYSA 2YPKA 1EEZB 1TNMA 5SWZE 5CJOL 1LK3L 4F7EB 1KENL 2V2TA 5E1AB 3JV5A 5T1LD 1ZHLA 4OCSH 2X4UB 4GSDH 1XGTA 2AXJA 3T08A 5GGRB 2VDNH 4TUKH 4PJ5A 5D7IB 2AJUH 4AM0B 1KN2H 1HWGB 3WD5H 4HUXB 1P7KA 4X7TA 3EYFB 4ZXBA 1JBJA 3G9AB 5DMKB 2Z91A 1F2XK 2FRGP 4LHUG 3ULVC 3V5DA 5GZOC 4HKJA 1WBZB 4OD1L 2WMPA 3MNVB 4BM7A 3MRNA 1B0WA 2BFVL 2CK0L 4NRYB 4U33A 1J0KA 1P4IH 1Z0NA 2KUTA 1IKFH 2HP4A 4ZUWB 3MRQA 4Y4FD 1VFBA 1NMBH 2RGSA 3L5WA 3SY0B 3D85A 5INCA 1ZA3A 3P3YA 4WY7L 3BGFB 3RDTD 2OCFD 1RMFH 4U2YA 4HV8B 2PW1A 2CK2A 1NCAL 5EBLB 5EFIB 3SJVE 1N4XL 4NJ9L 4XCNA 1WWWX 4L3CA 2AV1A 2ED8A 5B3JF 3VI3E 3MJ9L 1ZHKA 4HUVB 5T3ZH 2R23B 5FUOL 4UUJB 2WBJA 3TT3L 4NDMB 3U2SA 5C7XH 12E8H 3T0XA 1OSZB 4Y4FC 1IEBB 3CFEA 1GGUA 3HRZB 5EU4A 2ZUQC 3BP6A 3MBXL 2VYRE 3TIDA 4HFUL 4NZDA 5HHVL 3DX9B 3RDTC 5CLWA 5L9DH 4QHMB 2OJZH 2J4WH 4HT1L 1VFOA 2B4CC 2VQ1B 2ZSVB 1UM4L 3NGBC 4U31A 4ZOEA 1QLRB 1D5IL 1YEIL 3ZKQD 1QBBA 5JW5A 1AGCB 2PW2B 1A21A 2BMKB 4WVRA 3F7YB 4L29B 4NT6B 1CD0A 1TCRB 1PFCA 1YEEH 4CMMB 1AD0B 3C8KB 1MPAL 3HAEG 2XWTB 3T2PA 2J8UB 3VJ6A 5F7HA 4D0CB 3H2WA 2NY5C 2J6EL 1MVFA 5JMOC 3B4NA 4W6XB 1ZA6A 3PNWA 1FORL 3OTTA 2F74B 1EDQA 2IFFH 1OPGL 2A6KB 2GJZA 3HNVL 3BZ4A 5I8KL 5HGGS 1RULL 2YPLD 2JIXD 1OAUL 2UZYB 5IHUH 4Y8DC 5KSVB 1KXQE 1UKQA 2JJVA 1BGXH 3KJ4C 5LGHL 4OV5A 3MBED 4Y2DA 4P3CH 1SY6L 2AEPH 1ZANL 4JFDB 3BZEA 4PUBH 4MD0A 2RFXB 3O3DA 1A6UL 5TPWL 5ACZB 4P48A 3E3QC 2VAAB 1IEHA 1DCLA 4AQ1B 3TJEL 2YD3A 2BZDA 2D0HA 3SEPA 3GJFH 3BIBX 4PJFB 3GMLB 4AEEA 2VDPL 2I60H 3GBML 5GJTL 3TJHD 3MBEC 3LMJL 3OXSA 3BAEH 4NQSA 4U6HA 5ENWB 3UPCA 4H0GA 4LLVB 3MRFA 2DQCH 2DLEA 1NC2A 4UQ3B 5IFJA 1A02N 1WICA 1FIEA 3FB8B 2DJ4A 5JR1H 3UP1A 2GAZB 1LO4L 5DYOB 1AXSA 1U91A 5BW7C 3ULUE 4FTVD 1TIUA 1ROWA 1C5CL 2APWA 4EUPH 3M1BA 1ND0B 3BP5A 5E9DA 3OGOE 5B39G 3U6RA 3W39B 3TJHC 2VDRH 1P7QD 3V6FA 1F3JA 3EO1A 1G1CA 2F53D 2VLRB 2ZJSL 1MIEH 4JHZA 5FOJA 5DT1L 4F37K 3JUYA 3MC0A 3BZDA 4GW5A 4Y4KB 3VFVB 4NNYA 3LH2H 3CXHJ 3HI1B 3L5XL 3O9WA 4HIHA 5F8QC 3VGAB 3BP4A 1M7IA 3FFDB 2B5IB 5IEHB 1A5FL 4U1IB 3SDCD 3PIQB 3U9UB 4ELMF 5E00A 2QHLA 2BSTA 3K7UA 2ICCA 4NCC2 1N2RA 3ZDXE 5L7XH 4QCIB 1PG7L 2GK0B 4YR6A 3B8YA 5JMRA 1S7XB 4ZO7A 5EZOL 3BEVB 1XF4A 5JDSA 4HC1L 2VB5A 2F5BL 2DL2A 5HGHA 3HLAA 4OT1L 5EUOB 3T8XA 2X89A 4JY4A 3A6BH 1BQUA 5CSZB 2G75B 4MJIE 5HDBF 4OIAA 3GJFA 4PLJD 2R1XA 4JFFE 2FO1A 2C3XA 3L9RB 5DJAA 3UTQA 1J5OH 4HS6A 1WBYB 3EW3B 1EFXA 5GRYA 3SDCC 3MV11 3VGHA 4XPAL 1EO7A 1DANU 1J12A 3G5ZA 2CJUL 2PYEA 4I2XE 3UJJH 2A73A 1KXVC 5CILH 5F6HJ 4LF3B 2IANE 4Y5VA 1OT1A 3LY6A 3TO4C 1HQ4B 3QT2A 3DX7A 4LSVH 5ACLA 4EDXB 2E7HA 3O6LL 4QXTA 1ORQA 4PLJC 5TFSL 1J1PH 4H5SA 1M7DB 3P0YL 2R56H 2ADGA 2VWEE 3I85A 2CIIB 2DQJH 4HLZH 4YBLB 5DVLA 2YZ1A 2DTMH 5ISZE 5JO5A 5IQ9B 2W9DL 3VXRB 1P84K 1VESA 2C1OB 2WWKO 4MQXD 1B88A 2FX8L 2WUBH 1RJCA 3GI8L 4MNQD 1KBGH 4TULL 3FO2A 5LGJB 5JNYA 2AJVL 1G9EA 2YD5A 1T7XA 5IR1B 3QFJB 1UXWB 4JEGB 1X5IA 4KMTL 4XB8A 4PB9H 5I1JL 3V6ZB 4OD2A 3AU1A 5LWYH 5C0GA 4MNGB 3ILPA 1PY4A 4G7YH 4HMCA 4JM4L 1JNJA 3W2DH 3EO0B 3MZGB 3STZB 5E2TH 3V5KA 1IILE 4LLWB 2W60B 4CN4A 3CFDA 3NIGE 2R2BA 5EU7C 4OUUB 4G7VL 1UWGH 1QSFA 2E27L 1QHOA 4C4KT 3IYLW 2CDEA 5GXBB 5C3TA 4MQXC 4R96B 4XBEL 3MLRL 5FM5M 1RZ7H 3KLAB 2IALA 4ZAKD 3QQ3B 4PGZA 4JO1L 5EO0A 1QO3B 2VLLA 3QNZA 4P49A 4PJ7E 1BWMA 1LP9E 4N90D 3DARA 5IB5A 5DQ9A 3S97C 2EYRA 1PYWB 2VERN 4LDEB 5FB8A 3QXAA 1G7QA 1KPVB 1MHCB 4NN7B 5L8KB 5DD5L 4K3DH 4XC3L 5I17B 1V05A 2W65A 4ALAH 3F58L 4U1JB 3GSRB 5CEXB 3BRDA 2VDQH 3DURA 2CXKA 4OLXL 2XG5A 4PJ5D 3WDJA 1RAMA 3QUMH 2DQFA 1WAAE 1A0QL 1YMMB 2KQMA 4IOFD 4MHHG 2L4OA 3OKKB 3K8LA 4OZHF 1BFSA 4ZAKC 2B7DT 1H3TA 1V3JA 2OXGA 1CGSH 1KCUH 1JGLH 2ICWA 2R2EA 3SGJA 4I18B 1XF3A 4KPHL 1GC1L 1OF2B 5MP6H 3D85D 3DLQR 4BKLB 1UJ3A 1BIIA 1FYTD 1CGVA 1NGWB 2F58H 4OQTL 4WFHD 2E9WA 5C8JA 4IOFC 4YX2L 4WENB 5TE6L 4XCFL 5JA8B 2XKNB 2VLKE 3R8BB 1KIPA 2R1WB 4WHTA 3ARGB 2EE3A 4EBQH 3MCG1 4N0RA 3GSNH 4JVPA 2DDQH 1MCHA 2J3SA 3IXTB 1AXTL 5DEFA 1K6QH 3RGHA 1X44A 4PRIE 2R0LL 3DRQB 5C0CB 4R0LC 1KTLA 1U3HA 3C5JA 4XBPB 5D2LA 1F13A 4KMLB 5E94B 3BE1L 3ZKXB 1MFNA 4PJAE 5I71C 4ZUVB 3FQWA 1WFNA 1S7VB 5E8DL 1KJVA 1Q9KA 1AGFB 1RUPH 4WI7A 3TVMB 1YEFH 2X4SA 1RZIA 3T0WA 1NAKH 5IB2B 3PGDA 4RGMC 3U30B 5F7NC 2JJWA 3MCLH 3S3PA 2UV3A 4ODWA 1R3LB 3BT2L 2ADFH 3BOVA 2DQHH 4HEME 4GRWB 2X4PA 2CRYA 2DL9A 1EGJH 4X83A 5SX4H 3TT1H 2BOBA 3Q5YA 3QUMA 1OCWH 4WDIA 3W11D 3S34L 1B4JL 4Y8AA 1I7TB 5E99L 5HGBA 4ORZC 4RCAA 1FO0B 5C08E 4PREA 5GRUL 2ID5A 2H1PH 4E9LA 2Z8VC 1IZKA 4BSWB 3L3JA 5F89B 1KEMH 4X4ZA 3ZKND 2QQKH 5D7JB 5HHME 1DE4A 4QY8A 1MHHA 1E6OH 2QV2A 1HXMB 2VOTA 4Y2DD 1FNFA 4P23B 3IFPB 2KZWA 1WC7B 3OKOA 5JORA 4F15B 4Q9QH 3UPAA 3DUSB 3W11C 1MFBH 2YN5A 3BO8B 2DM4A 3I75B 4XP5H 3F7VB 3RY4A 4HJGA 4H0IA 2FLRT 2EC9U 4JO4L 4QGYA 35C8H 3T2NL 5M95B 4LSRL 3F62A 3HTLX 3Q6GL 4PTUA 4ZFOA 3ZTNL 3QSKB 3ZKNC 2YKLL 5DFVD 5EU5A 3BWAB 4JRYB 2G2RA 1RIUL 4Y2DC 5KAQG 3RNKB 4PRBA 2HLFD 2XN9B 4NUGH 2WUCH 5DJ0B 4RBPK 4XCCL 5AZ2H 1NC2D 5BJTA 3X12A 5DRNB 3SDYH 3C5SA 4JKKA 4P9MH 5BRZA 3IDGA 3TIEA 4BH8B 1WCBB 6FABH 3M07A 4P99A 4PJCB 3RWGA 5K9KB 3S5LG 1EGJA 2DIAA 3VFGL 5I66A 2EIZB 4UT6L 4O2EB 2X4NB 2W9EH 5DFVC 1IC1A 2Z93A 5E9DD 1KV3A 3L3DA 3KPQA 4I3RL 3DBXB 5SWZB 4PD4K 3BJ91 1QA9B 4RZCA 4JY6B 1FRGH 2HLFC 4WW2B 4DGIH 1JYXA 4HIIB 5BMFH 3FT4A 5HHOA 3O45A 3PWUA 4FXGA 3JTTA 4FQ1H 1UACL 4NUJB 2F15A 1CU4L 3O9WD 1BD2A 4X9FA 3T77A 3P2TA 1BIHA 3ARSA 2ICWJ 1CE1L 4NGHL 5TDOB 2DAVA 4ZNEE 4EVNB 1J0ZA 3GMQB 2GTWA 4BZ1H 4GW4B 3VGBA 4MXQD 3C2AH 1QBML 3MOBL 3MYZA 3DHJA 5F9AC 3RVXD 4F7PB 1BLNA 5BQ7A 3T4AB 4YAQA 3FB7A 1JGEA 4PTTB 1FFPB 3TYFB 5IWLA 5I8CB 1ZOXA 2X89D 2H8PB 3O9WC 1LE9B 1NEZG 5BO1L 3TYGH 1I3VA 3TBTB 3PGFL 3SJVB 5DK3A 4JDTH 1FFNA 1CICA 4NZTL 3NPSC 3RA7H 4MXQC 1Q9OB 3GSOB 2QR0B 1UZ8B 2VN4A 4HUUB 2KZ1B 3QCVL 2PYED 5JW4M 3RVXC 1C08A 1MEXH 4OV6F 3QUXA 4MDJA 2GJ6A 1TQCB 2NLJA 4LIQL 2R0WH 2QSTA 4BFGA 3DV6A 4MQ7A 3D18A 4GG8A 3MRMB 1T0NB 4O5LH 5B38G 3DX6A 2PN5A 3LOWA 4X4YA 2BOCB 4QNPF 1XR9B 2FL5B 1BFOB 3U9PL 4JANB 4PJAF 3RJDA 1ORSB 4ZO8A 3NFPA 4IJ3C 4O51A 2X1XR 1HIMH 2A6IB 2OL3H 2ZUSA 3EO9L 1H8OA 3QYCA 3CLEH 4FQLH 3VXMD 4DZ8A 2XNAA 1LEKA 2HVKB 4Y5VC 1G7MB 1ZLUH 2R8SL 2N56A 4EQ2A 4X7CC 3O6FA 5CMAB 5LQBH 4KK6D 1F6LL 2AXGA 1YUHB 2AW2A 5CIPB 3MOAH 4M1DH 5I73B 3IJSB 4XI5D 5LVEA 1ZLWK 4LCYB 4LSUH 1T0PB 3OZ9L 1IJ9A 3IU4H 5IMLB 1OT2A 3T4YB 3TNMA 3L3KA 1QSFD 3LEVH 3IKCB 1IFHL 2KDGA 4Z7VE 4XWGH 4NQDE 2X70B 1A1MA 4YHMH 1LMKA 1DR9A 2CLRB 1I8KB 3RNQA 2YUWA 4OIBA 3WUWB 2NX5A 4NQCA 3BXNA 3I6LE 4YO0B 4XVJL 1A9BB 1YMHA 3WKMH 5I15L 2BVQB 4R4BB 4DGVH 3OAYK 5HHQA 4KK6C 5KVFH 2YHGA 4XMKH 4XI5C 3LN4B 4DQOH 2EDEA 2XV6B 1U8LA 5DD3H 3VXUE 2DQTL 2D03H 1LNUA 3H9YA 4RMUA 1JZ4A 1TZIB 2M8XA 3C6LB 4G80A 1KPUA 4K07A 4PJXB 1HWHB 1TZGL 4O02L 2AKRB 5DHYB 4KUCD 4JR9L 2GUOA 3QISA 1DN0A 5GS1A 2VJXA 3MJ7A 2Q76B 1AE6H 2GSGB 3H3PH 1I1AB 3D5OF 3PWNA 3LIZH 4KY1L 3FOMB 4FNLH 4FQHB 5EZLA 3EYQD 1BQLL 4O2FA 3HZVB 3LKRB 4JZOB 1NLDH 5TDNA 5JA9A 3LN5B 4L4TA 4J3VA 1EMTH 1Q9WB 5DD0L 3L95B 4J3OC 4R2GD 1MJ7L 4PJBA 3DVGA 5T33H 2FJFB 2NY3B 4FFWD 5FCUL 1KLUB 3DUHA 4LVHB 1GIGH 4F3FB 3C08H 4RDQG 1QNZH 3NH7H 4O9HL 1JWUA 3I9GH 1JGVH 1YYLL 2D31B 3O0RH 2GSIB 3SGJC 1ZEAL 4HWBA 1SJXA 3DUUA 1U3HD 3D9AL 4WI9A 1F6AA 4GG6B 3OKEB 5EH1A 1NGYA 3EYQC 1U0QA 1KJ2H 5K9OB 3ZYOA 3IDUA 3G5VB 2CUMA 1UJ3C 3S36X 4YWGL 1F6FB 4WWKA 1RZGB 4R2GC 4JFHD 3QH3A 4M48L 3VFRA 1FNSH 4PJDA 4FFWC 4OSUL 4DKEH 4IHOA 4KTYA 4LLQA 2HVJB 5DEZA 5LBSL 1KB9J 2BNRD 3D3VE 5JOEA 2Z4QB 5B8CB 4JFEA 3RZCB 4KZDL 4MJIB 4P3DB 2BSSB 2NTFB 1U3HC 5LG1A 5FYKE 1RHHB 5KN5A 4JFFB 4KUZL 3KJ6L 3GHEL 4FMKA 1NMAL 3MGTA 1U3ZA 3LKSA 2AQ1A 4IIQA 1T0MA 4K8RD 5E8OA 4S1QH 4I2XB 3TPUB 1IT9H 3QHFH 3WXVL 3MV8E 3MUHL 2CIKB 2IANB 4PBXA 4K3JL 4XP6L 1LQSR 1PX3A 4R97C 3HUJB 5KS9A 4JFQB 3ARFA 3DNKA 5HYQA 2HRLA 3PWVA 1N7ML 2BNQE 2A9NH 1XH3B 3ARTA 3BRFA 5E8EB 1JPST 2D7MA 3VFNB 4CL7A 4M7ZB 4QTIH 1RURH 4S1RH 3FKUS 3ECBA 2GHWB 5FGCE 2D0GA 4APQB 3L3IB 4TTDD 1FZMA 4UT9L 4K8RC 4XH2B 4ERSL 5GGUA 1C5BH 2A6DA 3V5HA 3PE9A 5F3HA 15C8L 1QSVA 4I9WE 1TETL 1P4LA 4M6AA 3UTTA 4X7EC 3RZWA 3W9DA 5L88L 1LGVA 1U8OA 2HFGH 1HCVA 3FQNB 2DD8L 1MJUL 1OGTB 3IETB 4M6MH 4U6VL 3DO7A 3ARQA 1YECL 2E8YA 5IMMB 4PRNA 4MCYA 5K33A 1SHMA 1A7QL 4WGVB 4F8TA 5BRZD 4K9EL 2IPKB 2JJTA 4RA0C 1T1ZA 4TTDC 4UMGA 2VL5B 3NA4A 5JZ7D 5ESQB 1T3FA 2VLJD 5IHZB 3EHBD 3RWIA 1IAIM 5I74B 4HBCL 4OCWL 4M7KH 1DBBL 1IGMH 3MV7A 5CD5D 4G5ZL 4PJ7B 4U49A 2GK2A 4PV8B 1LP9B 1YNTB 3QPQD 1GOHA 2EDKA 4BQ8A 4Z7VF 1A6VH 1K4CA 3OBAA 1K3ZA 5HHOD 4XGZB 3AMLA 5IGXL 1XGQA 5DMJB 2HTKD 2BHUA 1BD2D 3LKNA 5EOCH 3EYVB 3GJEB 2OP4H 4AL8H 4OZGA 5A1AA 1A4JB 2OLDA 3AAZA 3AREA 5EOQH 3SKOB 4UNUA 4DN3H 5JZ7C 1GHFH 2BVTA 3UTZB 3CSYB 3HNTL 3EHBC 5E5RB 4NFDA 32C2A 2QQNL 1A2YB 2ORBH 3U0PB 3GSVB 4Q9CA 1N6UA 1EEZA 5CD5C 1MF2L 4OCXL 5D6CB 4H1LG 5JTWA 1JV5B 4F7EA 1CDHA 2CO6B 1T2XA 2DB8A 3PQYE 5E1AA 3QPQC 2FDBP 3DX8B 2XRAL 2X4UA 1CL7I 2XY1A 1YYML 4DK6A 1X4XA 3ALWA 2D3VA 3ZT7A 4PFEA 5GGRA 4MCZB 3EJZD 4O4YL 5D7IA 2HTKC 4AM0A 3VE0B 1FVDB 4HUXA 3CXHK 3EYFA 4HCRH 5DMKA 5HVHB 4JRWA 1OM3L 7FABL 2VLKB 1WCQA 1I1RA 1FC2D 3IS1X 1WBZA 1CICD 3MNVA 1NUFA 5DDHB 3LQAH 4XPBL 3GSXB 3C60B 1TFHA 3SKJH 4NRYA 5SX5K 1J8HE 2VXTH 4ZUWA 4WCYL 5IB1B 2DLFH 3QDME 3SY0A 5BV7H 1G6RL 3AS2A 3QUXD 4Q9RH 5F8RC 1QFWH 4C4KO 4C55A 4N5UA 4GLRH 4OFDA 5IWLC 2MTPA 3EJZC 5EBMB 1P5VA 3WMSA 4HV8A 5FGBC 2D7PA 4RDQF 5EBLA 3V7MA 5EFIA 2V17L 3FO0L 4EI5A 5DUPL 1UWEH 4QGTA 4EKXA 1EEQA 4YHKH 3TO2B 1VFAB 2EYTB 1CICC 4HUVA 2R23A 4N0YH 4UUJA 1CWVA 4F58L 4JCMA 1CLOL 1VGKB 2GCYB 4NDMA 3VD3A 1OSZA 1IEBA 5DO2D 4K3HA 3HRZA 3QUXC 3BFOA 5DJ6B 4Y16B 1X9QA 3RWFB 4FN0A 3OR7B 4U1GC 3UBXB 3D39B 5I1EL 3RX8A 4DWHA 3DX9A 4JB9H 4V2CB 4HXBL 1T4KB 5C08B 4QHMA 2Q3ZA 3G5XB 2ARWA 4X80L 3O6FD 5FO9B 1CLYH 1WIPA 2VQ1A 2ZSVA 1FVEB 3Q1SL 4JHAH 4YUEH 5C2UB 1AJ7H 2DLGA 1QLRA 3VFMB 5KVEH 2CKBB 2DTSA 3S37L 2LTQB 3N1QC 4M61B 1KC5H 4CADB 1AGCA 2PW2A 4NYLA 2BMKA 4C54A 3F7YA 4L29A 4NT6A 2AABL 3H9SE 3CC5B 1R3HB 1QD0A 1I9IH 4LAQL 4CMMA 1AD0A 1JZ2A 3C8KA 1E4XI 4PJHF 4U1SB 5DO2C 2XWTA 4KI1A 4OCLC 2J8UA 4D0CA 4HCRA 4X7SH 4NQCD 4RGNE 1DQDL 3KPLB 4X8JB 3WNPA 3O6FC 4WTZA 1LEIB 2F74A 2A6KA 4JO2L 5KSVA 4HQQH 2DLIA 3RKPA 4KROB 5GRZA 1IE5A 1X5JA 2C3WA 2FH6A 1HH9B 4D2NA 4JFZL 4JFDA 1TPXB 1HHKB 2RFXA 2K3TA 4OLVH 3QWQB 5DTFB 2YSSB 2HJFB 5ACZA 4HHAB 2VAAA 1UJTA 1RFDH 5BCAA 1AR1D 1S8DB 5KANG 1NCDL 5FEBA 5F9JB 3OB0H 3P73B 4BH7B 5IVXE 3GMLA 1IGIL 4KRPB 1XT5A 1DQLH 4LLMB 4L4TD 4U7KA 2XYCA 3MX0A 4KJQD 2QKIB 2YPLE 5KSAB 5ENWA 5IEKB 4JQXA 4QHKI 4PJ9D 3V0WL 1ITBB 4UQ3A 4G42B 4TUJB 5CINH 1HKLH 2ESVA 1MJ8L 2ILLA 4HK3J 3H0TB 1BJMA 3FB8A 1OGAE 5GS1C 1AR1C 4NWTL 2GAZA 1B2WH 5DYOA 5I1GH 4NN6B 5C3LD 3MLTB 2CMRL 1ND0A 1KN4L 3W39A 4WWKD 3FAWA 5BS0E 3ZKMD 3RKDD 1KACB 4KJQC 3RL1A 4HD9A 2VLRA 3WXWH 4MB4A 3S35H 3OKLB 5E4EB 3MO1B 2YEZB 3VFVA 4Y4KA 4PJ9C 1H8NA 3HI1A 3QJFB 3QRFM 3NA9L 4I3SH 4JFED 3MA7B 4HFWB 5FOBB 4KAQH 4ODTH 3VMPA 2P48B 1P69B 3FFDA 2A38A 4HULB 5IEHA 4LEXL 2M2DA 5SWSE 4U1IA 3RX7A 5IMKB 2VAJA 4TVPL 3PIQA 3U9UA 3W0WA 4UNTA 1JNNH 4Z7QE 4QCIA 3ZE0F 4WWKC 3F12B 3VRJB 5DLML 2GK0A 3ZKMC 3RKDC 5ADOH 1S7XA 1CT8B 3BEVA 3WHE1 2MKLC 4R4FH 1Y0LB 2IQ9H 3VW3L 1GOGA 3GJFK 5EUOA 4X6CB 5CSZA 1CDYA 3MXWL 5JUEH 4NQUA 4YBHA 4ONHB 3T2OA 4Z77A 3ARFD 3ULVF 4NRZB 5CJ5A 2BXYA 2DYPD 1WBYA 4R7NB 4FFZH 3ZYJA 3KG5A 1W72L 3BUYB 5EOCJ 5GGSY 3OQ3B 5L0QB 1A6WH 3QCTH 5ANME 1ZS8B 1K2DB 4M7LL 3ZT5A 4IIQC 1QR1B 1TCMA 2LU4A 4ODVH 4LF3A 3RWDB 4U6TA 5DJYB 4KGJA 4WHCA 1Z9SA 4BUGA 4TNVK 5KBNC 3UTTD 1H15B 3NCBB 3B5TA 4EDXA 1SYVB 1S7UA 1Z2KA 4F7CB 1GZQB 3ARFC 1M7DA 3OL2A 4UV7H 5EO1B 1MCWW 4MJ4A 4PBWD 4HJJH 3MCKB 4YDLB 5IQ9A 3VXRA 3IDNB 2C1OA 4B0MM 1MFEH 1FSKB 5KSBE 4NQDB 1FGNH 2Y7QA 3EFDL 3CU1A 1FIGL 4PRHE 5LGJA 3BKYH 4LSSL 2YRZA 4LPTA 3QFJA 5IR1A 3T3MF 2ENYA 3QXDB 1HHHB 2WP3T 2XZQL 4GS7C 1F58L 2D7TH 4WO4D 3V6ZA 3S36L 2Q87A 3STZA 1A7RL 5FO7B 4LLWA 2W60A 2AQ2A 2DIJA 3VXUB 2X6MA 4L5FH 1ZHBB 5J12B 4RNRB 2Q8AH 4FABL 2JJTC 2B2XL 4R96A 1U8KB 5F1IB 5FYJL 1DSFH 5TQ0L 4OD3L 5KVDH 4ZNCD 3IFOB 3QQ3A 1JPFB 4KI5D 4JGMA 1QO3A 2VC2L 2NY4D 4UQ2B 4HIEB 5IMOB 1L7IH 1DVFB 5AUMB 1PYWA 4J3WA 4WO4C 4XC1H 1E4XL 2WIIB 3Q48A 1KPVA 1MHCA 3IKKA 4GRWH 3MLWL 5ESVB 2FATH 5I17A 4U1JA 5CEXA 5AWNH 3B3IB 4BZ2L 1NGQH 1KEGL 1YMMA 3ULVL 1X5KA 1BOGA 3OKKA 1JNLL 1X5FA 3WJLA 2HMID 1FO0H 3QZWB 2KPNA 5I0ZA 2HFEB 3HC3L 4KI5C 3ZDZE 4LKCB 4LP5A 4I18A 3TV3L 2NY4C 3QP3A 1NDMB 1FZKB 2A1WL 4F80A 2O93L 2V5TA 1YEJH 1OF2A 3V95A 3H7LA 3MLSH 3A67L 1NANI 4I4WB 4XVUD 4BKLA 4JPVH 4M3KB 1S7SA 2EDNA 1NGWA 3LS5L 4P2OB 2EDWA 3O8XB 4Q58C 5T1MA 5GRJH 2XKNA 5CUSL 2HMIC 1H3WM 1PSKL 1UCBH 4PB0H 4PJ5E 2R1WA 3OMZA 3ARGA 3WNLA 1LHZA 2VITB 3SE4C 3V0AC 3IXTA 4XMPH 3D3VB 5JW3H 3DRQA 4HS8L 5C0CA 3SQBA 4AIZA 2O5XH 1FH5H 4XBPA 1ULVA 1XCQB 3CMOL 2X4TB 2XQBH 4M1GH 1TITA 2KL6A 5CEYB 4TQEH 4ZUVA 1P53A 1S7VA 3BGFC 1LO3H 4XVUC 5EOTB 3MLUL 1J1XL 1AGFA 3QPXL 5I8OL 2B4CL 3TVMA 5KVGL 3Q3GB 5IB2A 3ZT6A 4DW2L 5MHSE 3CDGB 2R9HD 3O3AB 3FHQA 4OF5A 3ARUA 4Q6YA 4P2QE 1R3LA 1JHLH 3MV8B 2ZCLL 2NY6B 4HAGA 3N50A 5C2BL 2B1HH 1SEQH 1QZ1A 4GMTL 3E0GA 5C0DA 3OV6A 1VEMA 2NY5L 1F8TH 1FLRL 3KPMA 1NLBH 2BNQB 2VZ3A 3WFCH 4JAMA 5KG9A 1I7TA 3KR3H 5L2JB 1UCTA 3GM8A 1FO0A 4OCMC 1HCFX 1T1WB 3U7WL 2CUIA 3KYOB 2YK1H 5FGCB 5K9JH 4BSWA 2R9HC 5CWSB 5F89A 1IEAB 1PD6A 4D9RD 4CJ1A 2OSLB 3FCTB 1U8QB 4MA3A 4CVZB 3U4BH 1BVLB 1HXMA 1QKZH 4M62L 1G7IB 4P23A 3IFPA 4YDKH 1WC7A 2PETA 5IBUG 4OCYH 2VZOA 4OF0A 5E70A 4QRSB 3DUSA 4ZTOL 4JFDD 1IC7L 5I0DA 3MV9A 4QOKD 3BO8A 3I75A 3K4DA 5CP3H 4Y2OA 4GQ9L 3LQAC 3RHWK 2D4FA 3JWDC 1MWAB 4JN1H 4K7FB 2AJXH 3BWAA 3P4OB 5HHNB 1MFAH 5FUZL 1FNGB 3QULA 3CDFA 4YNYB 2FO4B 1BQSA 1RK0A 2XXCB 3IT8D 3RNKA 2XN9A 1J18A 4M5YL 4Y5XB 5DJ0A 4HGMA 4Z7WF 1CLZH 5HDQH 1QG3A 1INEL 5DRNA 1QYGH 1GYAA 4X98B 4JLRB 4PLOB 4BH8A 1WCBA 2EEAA 3VRIB 1NH6A 1K8DA 4PJCA 1ZGLB 3ISWA 5HTSA 5K9KA 1TENA 1UXSB 1BFVH 2EIZA 1KTRL 4O2EA 2X4NA 5T3ZE 3PWPE 1TLKA 3DBXA 5SWZA 1EEYB 1ZT4B 1QA9A 2VLRD 4L9DA 3PQYB 4JY6A 1UWXH 4JFOB 1EO8L 4HIIA 4JQXC 2I9TB 4Y4KD 4NUJA 5DR5L 1IQWH 1RK1A 5F6HI 3MLYL 3T09A 2E6PA 2DI7A 1YEKL 5TDOA 4EVNA 3GMQA 4GW4A 1JVKA 3WIIL 4DOHE 3PV6B 3BKJH 4JM2B 3QAZB 5CIPH 4KHXH 1ZVYA 5E08L 2EDOA 3AGVA 4PJIE 4XP1H 3PG2A 4F7PA 1KNOB 3QHZL 3RTQB 1UADC 1D5ZB 4XX1G 3T4AA 2VDOL 3QDMB 3BIKB 3G6JE 4PTTA 1FFPA 5CP3A 3VXNB 3TYFA 3MXVL 5I8CA 3HC0B 2C7UB 1EEUA 4BA8A 2X5PA 4Y4KC 5F93C 2H8PA 1OQXA 4CDHA 5DWUL 1V5JA 3LDBB 3H3KA 3ZDZF 1LE9A 1KB9K 3VGAC 3QNXB 4J6RH 3QFDB 3TBTA 2DLHA 2IG2L 3SJVA 1BX2B 2B5IC 4ZDHB 3LN9A 4D0BB 1FFQA 5D1ZD 3GSOA 5EWIL 1B90A 2QR0A 1UZ8A 4ZQKB 3M17A 5F72S 5I19H 2X1QA 2ERJC 4K94H 2K7PA 3RUGB 3FQUB 1GPOL 2OR9L 4NBXB 2K7QA 4JN2A 4JZJB 2R0ZH 4TSAH 1F97A 1IAII 3I6GB 3MRMA 1T0NA 4MHHI 4YHZL 1U8HA 4YBQD 2JK5B 4NO5B 1QTYT 5ERWB 1RUKH 2BOCA 4X5XB 1XR9A 1AO7B 1HEZB 2FL5A 1BFOA 4JANA 3CSBA 1ORSA 5DJCB 2YD2A 3K81A 5TE7H 2VSCA 5D1ZC 3R0NA 4EDWL 1IGCL 4PGEB 3VXRD 2I25N 3VMNA 5E8NB 3H9SB 1A6TA 1X5HA 4I3GA 4YFEA 2XTLA 1RZJH 2HVKA 1IZJA 5IW1B 3QFJD 1F90L 2P5EE 3BVNB 5F71A 4I77L 4Q2ZB 1RJYB 4RGNB 5CMAA 2A0LD 1DFBH 5CIPA 4YBQC 2IMMA 2R0KH 3IJSA 4LCYA 1MRCH 1MRDL 2RAMA 1NSNL 4YBLC 5IMLA 5CJ8A 1Z9MA 3IKCA 4WEUD 2H6PB 1S7QB 3TH4T 1MAML 2FEEI 3KPOB 1A3RL 1IC4L 3V4PL 1NJ9B 3OPZH 3GMMB 5FECB 4LAJH 3BDYL 1PZ5B 1KGCD 5CBEB 1I8KA 2DS4A 4OIIH 3WUWA 4Z7NE 4UV4L 4FQCH 1A9BA 2BVQA 4R4BA 5C92A 5CJQL 2Y6SD 2A0LC 1QHPA 2HKFH 1T21B 43C9B 4QRRE 4HS3B 4XAWH 2B0SH 3BIAX 2MNUA 3LN4A 4Y88A 3NOIA 4JG1L 4U1LB 4NHCL 5IVXB 5CP7B 1YMMD 3O6KH 1TZIA 3C6LA 5E5MB 4EN3B 4L4VE 4PJXA 2F8OA 3LEYL 2AKRA 5DHYA 3U7AA 1I9EA 3NTCL 4FXKB 3H8NA 3PL6B 3CFKB 1LDPL 1NUGA 4UDTB 4HZAA 2Q76A 4QRPE 1I1AA 1QFUL 1OGAB 1RIHH 2Y6SC 3EKCA 3FOMA 4FQHA 4NN7C 1F4YL 3HZVA 4HIXL 3LKRA 4JZOA 3VG0H 1XIWB 3NABL 3ZLQC 1CCZA 3LN5A 5GSRA 1K9TA 2PTVA 2OI9B 4DTGH 1MCPL 4HWEH 1Q9WA 3L95A 4FQQB 1ZLUK 3BPCB 2AI0H 2QSQA 2FJFA 5BS0B 1KLUA 3WJLC 3UJTH 4F3FA 3MLZH 3RL2B 5D71L 3ARGD 1DL7H 4S0TD 1MNUL 2C4FU 4LPUA 2D31A 2GSIA 3KHQA 1FC1A 5C0CD 5IJVB 3CXDL 4AMKH 4GG6A 1MCLA 1TJIL 2J8HA 3BEWB 3OKEA 4K2UL 2YWZA 5SWSB 4XMLH 5K9OA 1AGDB 3VH8G 3G5VA 5IP4A 4YLQT 1RV6X 3TVMD 1K8IA 3UO1H 4WUKH 1EIBA 2NY2B 4NZUH 2HVJA 1I7RA 4P2YA 5I30H 3HCVA 3RWJA 4C83B 3SDDA 3ARGC 4LNVA 5KOMC 2Z4QA 2PXYB 5B8CA 2V5YA 3BSZH 4MJIA 2A77H 4P3DA 4ZO6A 2BSSA 2NTFA 1U8MB 1NPUA 1KT2B 1T7ZA 4JFFA 3ZKXC 2R4SL 4HZLB 4O58L 5B3NA 4FFYH 2VXQL 4UT7L 5HBBA 4G6KL 5DC4B 3MODH 3EDDA 1I4FB 5DRXB 5ANMB 3TVMC 1CXHA 2P46B 2BX5A 2UY7A 3TPUA 4G3YH 3U30C 4JHBA 4OCSL 4LFHD 4ETQB 2CIKA 2IANA 4GSDL 1F5WA 5D7JD 1G9NH 2VDNL 4TUKL 3HUJA 4JFQA 2AJUL 1KN2L 2CDGB 4P23D 3WD5L 3V52H 4LEOB 1XH3A 1G1YA 3HAEB 4PY8J 3VFNA 2F8XC 3C6SB 4APQA 1OW0A 1P4IL 2W0KA 2HN7B 1IKFL 4XH2A 2FBJH 4PBVC 1NMBL 1X5YA 5KSBB 2ICWI 2VABB 4LQFH 1YEGH 4GKNB 4PRHB 4XPGH 4YXKH 2FJGB 1VFMA 4JRYD 5D7JC 4DVRL 4PG9B 4HGWB 1XZ0B 4BQ6A 3FQNA 1RMFL 4F9PA 1OGTA 4P23C 2JB5H 3IETA 4AEIH 3CVHB 4F15C 2Q20A 5DD1L 3RGVB 5IMMA 1JRHI 2ZKHH 2IPKA 5T3ZL 2XI9A 3KLSA 3VD4A 1CE6B 5C7XL 5ESQA 2OTWB 5IHZA 3QRGH 4XZUB 1LK2B 4M6NH 4XVTH 1FNAA 1LDSA 1N26A 3S8WA 2OQJB 1PLGH 4PJ7A 4PV8A 4TNVF 1LP9A 5HVGB 4MA1B 1YNTA 1MCOH 5SWZD 1PBYA 3CNKA 5L9DL 3WLWD 2OJZL 4GAYB 2VMFA 2M1KA 3WLBB 2CQVA 4H0HB 4XGZA 4KJPD 5TF0A 4HKBB 3EYVA 3GJEA 1E6JH 4KVCL 2FGZA 1A4JA 1VERA 1D9KB 5EBWA 3SKOA 1WZMA 1D5XB 1YEEL 3UTZA 3CSYA 5D93B 1QOKA 3U0PA 3GSVA 1J87A 1ZAGA 1QBLL 1AXIB 5D6CA 3UTOA 3AROA 4YGVB 2XZAH 1JV5A 3N1PC 2X7LB 4L8SB 4TTGA 1MY5A 3DX8A 3WLWC 4QTHB 3A6OA 3ZTJH 2JE8A 4WW2C 1FGVH 2AS5M 1U36A 4KJPC 4MCZA 4R6UA 3RIAK 3GGWB 4XTRD 5IHUL 3VE0A 4IOSD 1FVDA 3AB0B 1JTTA 4BSJA 1BGXL 1I3GH 3QUZB 1FE8L 4P3CL 3SJVD 2VLKA 4DKAA 4E41E 2AEPL 4GXUN 1EX0A 3Q5TA 4NP4L 3GSXA 3PABA 3C60A 4ZXBB 2RQ8A 2Z31B 1QSZA 2UWEE 5IB1A 3V5DB 1ONQB 5DA0B 4KK8D 3HNSH 1CD1B 2AJ3A 2JLLA 4NOBA 4GXVH 2MMXA 3ME0A 4MX7B 1YQVH 1YY9D 4KFZC 5EBMA 4XTRC 1FQ9C 2I60L 4L3EE 4DUWA 3FN0H 2FLBT 1CZ8H 1M71B 4ZPTB 5IV2A 3BAEL 4KUCF 3TO2A 1Z6JT 2EYTA 4P2QB 4NC2B 2DQCL 1SJHB 2VISB 2HJLB 1VGKA 2GCYA 4WI3A 2SEBA 1KG0B 1E4KA 5JR1L 4KK8C 1OD7A 5DJ6A 4Y16A 1TQCC 2CPCA 3RWFA 3OR7A 3UBXA 3D39A 3O6MH 3B9EA 4X6FB 4FQIH 1YY9C 1T4KA 1KFAH 5C08A 2GJ6E 3G5XA 2YWYA 4YPGA 4RFEB 5FO9A 5C9JB 3BP6B 1HINH 1FVEA 2O5ZL 5SX4I 1G7LB 4TSCH 3U36B 3BMVA 3SQOL 2MKWA 3VFMA 2CKBA 3WFEH 3ZDYF 3A6CL 4M61A 3LH2L 2X1OA 3CC5A 3JV4B 3JV6B 5D2LF 5GHWH 3OAUH 3SDAA 4U1SA 4D8PB 3VFTB 1JWSB 2QBWA 3ALXA 4P5TB 3KPLA 2IADA 2YA2A 2C26A 4X8JA 4HAFA 4WFFE 3DMMA 2FIKB 2OTUB 4HPYH 1LEIA 4LSDA 2P4AB 1P6FA 5I73C 1CXEA 5HVWA 4KK5D 4J2XA 3DJ9A 1H3GA 5I1DB 2DF3A 1HH9A 3C6LD 4U1KB 5FF6B 5FDWB 1J5OL 1HHKA 1S9WB 3MJ8B 2OK0H 4LGPB 5DTFA 2NR6D 2R29L 2YSSA 2HJFA 5LCVH 3ARWA 4LVEA 2K9UA 1S8DA 4FS0A 1I1AD 2NX5E 5F9JA 3AS3A 3UJJL 3P73A 5IOPB 1G7PB 2FNBA 1IGJB 4YXLH 4BH7A 3DPBA 1FHGA 4LVNB 5CILL 3ULUD 5CJBA 4KK5C 4LLMA 4K94C 1N3NB 4UBDD 4KTDL 3FQXB 5JLZA 3PWPB 4LSVL 2NY3D 2QKIA 5KSAA 1JE6A 4PJEA 5IEKA 3NAAH 3C6LC 3RBGA 1F4AA 3WIHA 1EAPB 4G42A 4TUJA 3SOBH 3Q6FB 2NR6C 3H0TA 3QB7C 3GIVB 2E5EA 2Q1EA 1SM3H 3J8F7 1I1AC 4PYGA 5F96H 1F3DH 2XWBB 4HXAL 1KBGL 3V6BR 4DOHB 1PZUB 3MLTA 4G8GB 3ULUC 5F7DB 2V5MA 3K8KA 3U7YH 4UBDC 1R3KB 1UEYA 4PJIB 1SMAA 2NY3C 4PB9L 5LWYL 4N8PA 5HI5D 3OKLA 4LVHC 4G7YL 1EO5A 3MO1A 2YEZA 3G6JB 2BVUA 1GAFH 5E2TL 5F9DC 5HD8D 1W2KT 1SJVA 3RVUD 1F3JB 1MCCA 3QJFA 3RZCD 4LLAA 3MA7A 4HFWA 5FOBA 5HYJB 4MJID 3UYRL 2VE6A 4MLSA 4JFFD 2WINB 4HIHB 5DQDH 5IMKA 1ZGLP 5EULV 1OAXH 3P40A 3BKCH 3F12A 3L7EB 3VRJA 3EOTL 1MCSA 1CT8A 1OARL 3WV0A 5HI5C 2VR5A 2UZIL 1Y0LA 3ZO0A 3OB0K 1HOCA 4JO3H 4K3DL 2IAND 1WQVT 3O4LE 4ALAL 4X6CA 5EA0H 3MRPB 5HD8C 2PTUA 1MFDH 1JGDB 2VDQL 3RVUC 3PXHA 2D2OA 3RZCC 1JJUA 3K2UH 3QUML 5TH2B 2CRMA 1TTFA 4NRZA 4MJ6B 4JFEE 4R7NA 2HYMA 3HG1E 3DGGB 3GJFB 4IRSB 3BUYA 5D5ME 4K8RL 1F00I 3IAQA 1ZS8A 1KCUL 1JGLL 1K2DA 3BMWA 5E95B 2KH2B 4MDIB 5ID0B 1BF2A 4APQD 1QR1A 3T3PF 3UROR 3OX8B 1EFXB 1YPZF 2NW3B 3BGMB 3RWDA 5MP6L 5DJYA 4MQTB 2FX9L 4OLEA 1H15A 3QQ9D 2P5EB 1SYVA 1VACB 2LFGA 3MRJB 3QWOA 4Z9KB 4F7CA 3TCLA 5ABDE 3I02B 5EO1A 4ODXB 4HDIA 2VWEC 3MCKA 5L2KE 2WNGA 5FYLH 2O26U 1IM9D 4FZ8L 5FM5O 1ORQB 2DDQL 5CSBA 3FRPA 4M7ZC 3IDNA 3QXVA 4EUPB 1K6QL 4APQC 4K3GA 3HKFA 4ZFOL 4NQDA 1RZ8B 4M9PA 2VL4A 2HFFB 5F7LB 5MENE 3H9ZA 3IFNH 4NKOA 1NEUA 3QXDA 3TBSB 3QQ9C 1YEFL 2GQHA 5JIPA 1NAKL 1A7NL 5JNYB 2OJEB 1GL4B 4F9PC 5FO7A 1R24B 4QRRB 3MCLL 2XKUA 4NO2B 3Q5OA 3AU1B 3VXUA 1ZHBA 2ADFL 2DQHL 1FL5B 1S78D 4RNRA 5GISH 3OGCB 4F33B 5BVPL 1EGJL 1U8KA 5F1IA 4UIMB 3TT1L 1V7MH 2R2BB 4WY7H 3IFOA 1JPFA 1OCWL 5I74C 1NGPH 4L4VB 2AQ3A 4XP9L 3G6AB 4PRPE 4HIEA 5IMOA 1OAKH 5AUMA 4ZOBA 3HZYB 1NCAH 2N7AA 2H1PL 4NC0B 2WIIA 4QRPB 5ESVA 4NJ9H 4UILL 3MV7E 1A7PL 1KEML 2XPGA 3B3IA 1WZ1H 2XY2A 2QQKL 2H41A 2Q3AA 2Z8SA 4PY7A 1E6OL 5JOFB 4HLJA 1AC6A 1S78C 4C56E 2FGWH 3QZWA 3BN3B 3DURB 2VLKD 2HFEA 1P4BH 4Q9QL 2DQFB 3IVKB 4OZGE 4LKCA 1MFBL 1CL7H 3C60D 5DMIH 4ELKB 4QWWD 4JKMA 1NDMA 2VDLH 1FZKA 3RQ3A 4BFBD 4KTEH 3U0WH 1UM4H 2Z9TA 2ICWB 2HH0L 4JY5L 35C8L 4OF3A 2DMCA 4I4WA 1D5IH 4OF8A 1V3MA 1YEIH 1PEWA 4HUMB 1IGTB 2NPLX 1SBBA 1RUAL 4P2OA 3O8XA 1NEZB 2QLVB 4MMXC 1MPAH 4HEPG 5GGTA 3GNMH 5D7IE 3ESUF 3LRHA 4NUGL 1BIIB 2WUCL 2J6EH 4N68A 2VITA 4N8VG 5AZ2L 3D3VA 5ICZB 3C60C 3SDYL 4QWWC 1MWAH 1XCQA 3W9EB 2BY0A 6FABL 5HYSA 2EDTA 3FO1B 4Y16D 4QXGL 1OAUH 3O3UN 5EOTA 1U93B 3D39D 1DUYB 3IB4A 4LDOB 4PJBF 2Y5EA 2W9EL 3Q3GA 5C08D 1JN6B 3CDGA 1R3IH 2IBGA 5B38B 3O3AA 3QIWB 3AY4C 2NY1B 1BJ8A 4DGIL 3OG6B 1A6UH 3RVTD 4FQ1L 2DQDH 3PGDB 5GQBA 2EIDA 2I24N 3LZFH 4EOWH 4PRAB 5A2LH 3QIBD 3RU8H 1E4KC 2BNQA 1YN7A 3DYOA 2X4PB 3AM8A 1S5HB 4Y16C 1VB9A 1UC6A 3GBMH 5L2JA 4RFOH 3C2AL 3VMOA 3QG7L 1T1WA 2Z8RA 4JGJA 4YGAB 1PX4A 4PJDF 3LMJH 3OJDB 1F3DJ 4WDIB 3S4SB 2HTLD 5CWSA 4ODHL 3M45A 4B53A 1IEAA 2FHCA 4KHTL 3FCTA 1U8QA 2LTQC 3RVTC 4CVZA 1BVLA 4LRIA 3AC0A 3REWB 1JF1B 4KROD 1G7IA 4NHUB 2QL1A 3IJHB 4ZSOA 3QIBC 3TYGL 4EQ3A 1WIOA 3P9MA 3GKZA 3RA7L 5D2NE 1FG2B 2APXA 2PO6B 2J8UE 4H25B 4EI6B 1F02I 3U82B 2HTLC 1MEXL 2YA0A 4MXVF 4CNIB 1MWAA 1MHPH 1P2CB 4K7FA 2R0WL 4KRPD 2E7MA 5KS9F 3GSNB 4HJGB 5HHNA 1T2JA 2IFGA 1FNGA 4DVBB 2FO4A 4KROC 5KSAD 4YHOH 1A5FH 4XPFH 2WAHA 5T5NF 3KXFE 1CGWA 1II4E 1TPXC 1UZ6F 1N6VA 1LE5B 1KJMB 1B3JA 4FQJH 3WHE0 2E7CA 4JLRA 4PJ8A 3MFFA 2EKSB 3OJVC 3VRIA 5EZOH 1E4WH 1AI1H 4P4KB 1HIML 1ZGLA 1VDGA 2GKIA 1T83C 1UXSA 2F5BH 5HDOA 4FQLL 4OT1H 2ZNXA 3VGEA 1CXKA 4KRPC 3GSWB 5TDPB 3SDXE 3RWGB 1EEYA 3OWEA 1ZT4A 3B9KB 3PQYA 5KSAC 1BAFH 3MOAL 4M1DL 4OM0H 2I9TA 1NMCB 4HWBL 3DXAE 1IC5H 3IU4L 2IQAB 2OXHA 2CJUH 3CK0H 2MHAB 1NBQA 4RRPA 1UG9A 3PV6A 2XIDA 2ESVE 3VFUB 1UGNA 4E41B 4U1NB 1A64A 4NN6C 1KYOJ 5A2JH 5J1TC 3MREB 4G6FB 2FJHA 1KNOA 3RTQA 5TFSH 3WKML 2UWEB 5D9SB 5FGRA 4DGVL 1D5ZA 4CAGA 3QDMA 3BIKA 4HW6A 3VXNA 3N85L 5KVFL 5E4EC 3BKMH 4XMKL 3HC0A 2C7UA 4DQOL 2VZTA 4OZIE 2B1AH 4FZEL 2PYFA 5E6YA 3QNXA 4L3EB 3QFDA 3GI8H 4NO3B 1BX2A 4KI5F 4ZDHA 3SKUD 2VDMH 4D0BA 3U1SH 1YEHH 4KMTH 4KKNA 3SHSA 1G0XA 4ONOA 2P8LB 4ZQKA 4IMKA 4YQXH 1ZSDB 4XNQA 3RUGA 3W0WE 1AE6L 3H3PL 3FQUA 5TQ2H 4QYOB 3LIZL 1TTUA 4FNLL 1T20B 5BXFB 3U83A 3DRTB 2R2CA 4G7VH 1FZJB 3GO1H 4JZJA 1NLDL 1BZQK 3I6GA 3F8UB 5GZNC 4WNQB 4CRPA 2VDKH 3WJJA 5T33L 2FR4B 2MCPH 3F65A 4NO5A 5ERWA 1I1CA 5EPMB 1AO7A 1HEZA 2PCPA 1GIGL 3C08L 4A2MA 1QNZL 1NFIB 3NH7L 5DJCA 3VXPB 3I9GL 3QXUA 1JGVL 5DJXB 5L0QC 4PGEA 5E8NA 3O0RL 2W0LA 4U1MB 1FDLL 4X0KB 3M8OL 3H9SA 3DI3B 4ODUB 4NQDD 3IFLL 3F58H 1QLEH 5IHBA 3RI5K 5IW1A 3KWWB 3BVNA 1J9CT 3ABZA 1A0QH 4K3EH 4Q2ZA 1JL8A 4LRNH 4DZ8B 4PGJA 1QPPA 1FNSL 3DVNB 4GOSA 4W6WB 2DQGH 3PF2A 3S7GA 2I5YH 4YDLC 2X9WA 3VXUD 3CAFA 5DRZA 1Q0XH 1S7QA 3KPOA 1S7RB 1NJ9A 3GMMA 5FECA 1PZ5A 2GYSA 3E8UL 2ZZUT 1PQZB 4PJGF 4OQTH 1DVFD 4HWUA 3V7AG 4U4BA 1OAYL 3DYPA 2YRPA 4P2RE 3QFJE 4POZD 4S1QL 43C9A 1BVZA 1PG7X 2NX5B 4HS3A 5AYUH 3TBWB 1IT9L 3QHFL 4P5MB 1RY7B 4LP4A 3IAGC 5IVXA 2X4RB 4I48B 3SO3B 5CP7A 4OCRH 5J12C 1MQ8A 3AXLA 3C09B 4PLKD 1JZ6A 1U8LB 2J8UF 5E5MA 5EUKB 4EN3A 4ZYKB 2A9NL 1BECA 5E8DH 1HN1A 1ODAA 2CD0A 1H3UA 4FXKA 3PL6A 3CFKA 4H1LB 1DVFC 4UDTA 4ELMA 3VGGA 4S1RL 1RURL 1OGAA 5FYLD 1ZT1B 4POZC 1SJEB 1C5BL 2O61B 2CUHA 2EDHA 3BT2H 1XIWA 2IPUG 4XXCA 2P5WE 3KDMB 5AG8A 1AD9B 3R8QA 1U92B 4FQQA 3HAEH 4P2OD 3BPCA 3O8XD 2HFGL 5EZLB 5BS0A 4LARH 4LKXB 2JKXA 2JTDA 1U6AL 4PLKC 2OL3B 3KPNA 3O3BB 4O2CB 2P8MB 4QEGA 5IG7B 4YFLI 4HUNB 2KBGA 4XBGB 2F5AL 7CGTA 2PF6A 3GUTB 3D3VD 3GK8H 5F9OH 2BY1A 3C5ZB 2EDRA 3BEWA 4C58B 4PJFF 5SWSA 5FYKD 1MCQA 1AGDA 5FDYA 5T1DH 4WFGE 4OM1H 1NFDE 3DUUB 2F19H 3CVHH 1IGML 4P2OC 3TPKA 3O8XC 2D7NA 1VA9A 4LGSB 1J86A 4C83A 3O4OB 5FHAL 3MV8D 3KGRA 3O4LB 3NCFB 2NY6D 5EOCL 2OP4L 4AL8L 1U8MA 1KT2A 4YDIL 2BNQD 1C8PA 3E2HB 4GXUM 4HZLA 4DN3L 3QEUB 5HHXL 3HG1B 1I4FA 5ESAB 5D5MB 5DRXA 4CMHB 1J05B 1I9RH 5ANMA 4MD4B 5FKPB 3LHPH 1I7ZB 4G8EB 3NGBB 3LCYA 5HGAB 1AGBB 4JVWA 43CAB 4XCCH 3QUYB 4ETQA 4DFHA 1ZK9A 3LKSB 3SKMA 4I9WD 2NY6C 5JIKA 3WNMA 2CDGA 4MZ3A 3JZ7A 4LEOA 3U0TA 2BVOB 4GRWE 4HCRL 3TN0B 3HAEA 4JQVA 5ALBH 4PGCB 4Q0XH 4UT6H 5L2KB 3LQAL 3S6CA 3C6SA 1T66D 4GKSB 3SKJL 5JXEA 2VXTL 2HN7A 1VGEH 2DLFL 4BK4A 5DZOA 5EUOF 2VABA 4Q9RL 5DMYA 4GKNA 1QFWL 2HG5B 4LFHG 1JYVA 3ECBB 4RMRA 2FJGA 2DKSA 5MENB 3ESVF 3DYMA 2I07B 1FZMB 1HZHH 4PG9A 4DFIA 1CE1H 1XZ0A 1FFOA 4LRIC 3V5HB 2DJSA 3WEXB 1L0XA 4ONFH 4W70A 3CVHA 3RGVA 1U8OB 1UWEL 4G9DB 4YHKL 1KJ2B 5T3XH 4N0YL 1T66C 1I9JH 1QLFB 1CE6A 1MIML 2HWZH 2OTWA 4XZUA 3MV9E 1LK2A 4Z7OF 2OQJA 5LGKA 1MI5B 5A2IH 4PRPB 4LASH 4CGTA 5A2FA 3QWRD 2RJMA 2IC2A 3RWIB 5HSFA 3PQYD 4GAYA 2GITB 3BPLB 3WLBA 4Y5XC 4NZTH 3MV7B 1MELA 1TJHH 4JHAL 4YUEL 4AY0A 1AJ7L 4Z95H 4HKBA 5KVEL 1QEWB 2XN9E 4DKFH 3WL9B 1OD9A 3L5JA 5BZWB 1IAKB 1SEBB 4L1DA 1D9KA 4C56B 1D5XA 1I9IL 4R3SB 4Z18A 1AP2B 5E1HB 4JM2D 1MRFL 3SE8L 1HILA 4OZGB 4YGVA 5EORH 1T22B 4X7SL 3AAZB 3AREB 3B9VA 3RTQD 3KPPB 4L8SA 1U2CA 1L9MA 5EC2B 4QTHA 3QDMD 4RSVA 1T03L 4F7MB 3O81A 3MRBB 2BP3A 3P11H 5KJRL 5AYQA 4IM8A 3GGWA 2EDDA 4HQQL 3CPLB 2EDBA 1N64H 1MAJA 3QUZA 2VXVH 4Z0XB 2Y06H 2WM0A 4A2LA 1S3KL 2R8SH 4JM2C 3QAZC 2Z31A 4OLVL 4OI8A 1NBYB 1CDJA 5C0FB 3BH8B 1T6VN 1LO0H 1ONQA 3IDXH 5C0AE 3RTQC 1EXUB 1RFDL 2DLTA 1CD1A 4URTB 5GGRY 1UH3A 5F44A 3ZE1F 1VFUA 4MX7A 4KDTA 4LCIH 4LL9A 4W4OA 3LDBC 1DQLL 4ZS7L 1UYWH 4P4RB 2XFXB 1M71A 4ZPTA 4BQCA 1FBIH 1AO7D 1MY7A 4P2QA 5FV2A 3B8SA 5IF0B 1SJHA 1I75A 2VISA 5CINL 2HJLA 5I9QC 4EI5B 4IMKC 5J13B 1KG0A 3H9SD 3IAPA 2Z92A 3KAAA 4JPKH 1IAIH 5I1GL 4HUWB 5EN2B 4OGZA 3OF6A 3JWOH 4X6FA 1DTUA 4JZJC 1OOAA 3CX2A 4RGND 4RFEA 3MRCB 1NUNB 5C9JA 1FJ1B 1KUMA 4Q9BA 3WJJC 3AUVA 1G7LA 3T65B 3WXWL 3U36A 2NQCA 3TA3B 4JZNB 3S35L 2QSVA 4GUPB 3D0LB 1OP9A 4O02H 4OLWL 1RD6A 3D2UB 4M9OA 3JV4A 3JV6A 4JHWL 3E1F1 3X3FH 4KAQL 4ODTL 2YD8A 1VENA 4Z7UE 3GRWH 2C3HA 5D8JH 4D8PA 3VFTA 3O3EB 1JWSA 4NYLB 1JPGB 3CU7A 2X44D 4P5TA 5DGRA 4F9LA 1JNNL 1DZBA 3VDCA 2O5YH 5D2NB 4RGNC 2FIKA 2OTUA 4L1HA 5ADOL 3WHXB 4GAJH 4O9HH 1NCNA 4GRWF 1HE7A 1G7JA 4WTXA 5D7LA 1YYLH 2BSED 2IQ9L 3T0BA 1ZEAH 4GRLB 5I1DA 1OL0A 3E6HB 2UVFA 5TJWK 4U1KA 2ZOKB 5BV7B 4EN3D 5FF6A 2ZCKH 5FDWA 3KXFB 4X4MA 1S9WA 3MJ8A 4CN6A 2LABA 4FFZL 3WUWG 1EHXA 3QQ4B 3PL6D 1A6WL 1HNFA 2FD6H 3QCTL 3SE3A 4NN5B 4OSUH 1OGAD 3PGCB 1B6DA 1KJ3L 1G7PA 2PKDA 5IOPA 1IGJA 3B83A 4ODVL 4ZD3L 1XIWD 5I1HL 2NCMA 1N3NA 1FNEB 3FQXA 3PWPA 3L5IA 1TZHB 5BS0D 1W8OA 3SDXB 3HE6B 3FRUB 1TQBB 4OBRA 3KJ6H 2ED9A 3GHEH 4EN3C 1EAPA 4LCWE 5KTEH 3Q6FA 3DXAB 4NFCA 4WV1B 3GIVA 3PL6C 1DEEB 4PJXE 1G0YR 3LD8B 2ED7A 1MFEL 2XWBA 1U8JB 4YEEA 3EYOB 5SWSD 1MFCL 1SYSB 2ESVB 3GMPB 3THML 4Z8FH 3LV3B 1FGNL 1VHPA 4G8GA 4DGYH 1XIWC 2NTSP 4XXCC 5F7DA 3GRWA 2BJML 3BPOB 2OI9C 1J0HA 4XNYL 1R3KA 2D7TL 4PJIA 4ZUUB 4PY8I 4LPXA 3VGDA 2NY2D 2RCSH 5C0RL 4HGKC 4OGYL 3G6JA 3SGDH 4OB5L 3RL1B 2PXYD 3OKDA 1KCRH 4OZIB 5HYJA 4LU5L 5DSCB 5ICYB 4L5FL 4PJCF 2X4QB 1FCGA 4ERSH 5F1KC 2Q8AL 1WLHA 5IROA 2WINA 15C8H 1DSFL 3ETBF 3NVQA 4LPVA 4GG6E 1CFBA 1L7IL 3L7EA 3VCLB 1CXIA 5DEGA 4WW2F 4XNZB 4XC1L 2NY2C 3W0WB 4U6VH 2FATL 4RAVB 2Q8BL 3MRPA 1A7QH 5JQ6H 1JGDA 2PXYC 4MQSB 5DD6B 4FHBD 5TH2A 1A6PA 4NM8H 4N9GB 1J0JA 3TO4D 4MJ6A 1KCVH 1FO0L 4HBCH 1HSAB 2XWJB 3DGGA 4RMVA 4IRSA 1NCWH 1DBBH 2P43B 4G5ZH 4Z77B 5A2KH 2APVA 1DANT 1ZXQA 4MDIA 5ID0A 3VWJD 4WUUE 2R15A 3OX8A 3L7FB 2IH3A 3BGMA 2NW3A 2P49B 2YZ8A 5F88B 5IGXH 3MLSL 4PRHD 5D1QB 1CK0L 2P5EA 4JPVL 5F7WC 1EBPA 1VACA 3K2MC 3MRJA 5IBUB 3VFOB 4WEMB 3WYRA 3IDMB 4GAFB 2V2XB 3I02A 2NY0B 5GRJL 4Z5RA 3ES6B 4JQVC 3HUJE 3VI3F 4PRDB 2QQNH 4ODXA 3RGVD 1S7UB 4OCXH 5E5UB 2DI8A 3WKNA 4KXZI 4EUPA 2R69L 3VFWB 5JW3L 4G6AD 3VWJC 3DSFL 5DVOA 3PHQB 5I1CL 2UZXB 3O41A 1RZ8A 4M1GL 5I1LB 2HFFA 4TQEL 2CR3A 1LO3L 3TBSA 5E24E 1Q1JL 4M00A 4R4ND 5ITBL 2Y7QB 3TFKD 1U8PB 2OJEA 1MREL 2H26B 2OZ4H 3MUJA 5I6XB 1ZMYA 4P2RB 1JRHH 7FABH 5INDB 3HC4L 1R24A 4QRRA 3GFUA 3DOSA 3JVGA 3RGVC 5C0EB 3DVFA 4NO2A 3PWLB 5H37G 1JHLL 5AAMA 4D3CH 1FL5A 4N0FB 4WCYH 3OGCA 4F33A 4AYFA 1G6RH 1SEQL 2B1HL 4G6AC 4UIMA 1D9KD 4U7SA 1F8TL 4P9HH 3ZZ1A 5J1SC 4L4VA 3LSOA 3G6AA 4HPOL 3WFCL 4GJTB 3KR3L 2HT2D 4U0RB 3HZYA 2ICES 3IDYB 4MA1C 4OGXL 1DQMH 2GT9B 4QRPA 4R4NC 3B9DA 3STBA 3TFKC 4Q97A 3OB8A 5DC9B 1D7FA 3HI5H 4NZRH 1IGFH 5CCKL 1AHWB 2P5WB 1S9YB 2Y36H 3BGAA 3U4BL 5JOFA 1QKZL 3S3JA 3QUZD 1XF1A 4KWUA 1D9KC 1NDGB 1HQRB 4LCUB 4YDKL 3WBDA 3WDIA 3IVKA 1BQHG 5D93C 1BOGB 4OI7A 1BFTA 4IDLA 4ELKA 4HXBH 4KJYB 4UNVA 4ZXBD 2Z31D 1CBVL 3EYSH 1BHGA 4X80H 3QA3B 2HT2C 1U8NB 3FTGB 1KYOK 4L8SC 5T3XD 1EFQA 3C8HA 2V9QA 3HR5B 1FLTX 3X17A 1IGTA 2QHRH 4JN1L 1NFDB 1TMCB 3MJ6A 1NEZA 1MFAL 3AB0C 3WFZA 3C9NB 3GDBA 9CGTA 5MHSD 1S9KC 1C12B 3QUZC 4PJXF 4QF1B 1S7SB 1XCTB 1W0WB 1BM3L 3NPSB 1GXEA 3HA0A 2YUXA 4XAKD 3K3QA 4P2QD 2DBJA 2OZ4A 4LSTH 1KCSH 4P57B 5FM4A 1DQDH 4S0SD 4K7PX 5T1MB 5ICZA 4ZXBC 1QYGL 2Z31C 3HN3A 3CDYA 2MFNA 1ETZB 3W9EA 4QHLB 5IVZB 2JCCB 3ULUF 3FO1A 5F1NB 1U93A 2WBJD 1DUYA 3WN5B 4AIZB 3OF6D 3BD5A 3UYPA 4KDTC 5FA4B 4NRXB 4W4OC 1JN6A 3VXTB 1DBMH 3ZHDA 5B38A 4JFZH 3RPIB 3QIWA 3OHXB 1XGUB 3WFDH 3VWKB 1W0VA 3CZJA 1V7NL 1R0AH 4YXHH 3ZL4L 5EBGA 4F57L 4PRAA 3T1FA 1U42A 1NKRA 1XR8B 1L7TH 5D6DA 3D69B 4YE4H 2WW8A 1S5HA 4IEFB 4PP2B 4UTBL 3BKJL 4P5TD 2WBJC 3ZDXF 3FFCB 5C0DB 2BY2A 4Z0BH 3KPMB 4KHXL 1YN6A 3OJDA 8FABA 2C3GA 3S4SA 4XP1L 2HJKB 3D39E 4JAMB 5KG9B 2A2QT 3WNOA 2DQIH 1GCFA 1MJ8H 1Z0MA 3REWA 1JF1A 4NHUA 3MNWB 3IJHA 1MQKH 4J6RL 4MA3B 3S98A 1FPTL 4P5TC 1MAKA 4F9LC 5GGVH 4DKDC 1FG2A 3O2WH 2PO6A 4H25A 5I19L 4EI6A 2EC9T 4HWZB 4GBXB 4NM4H 4K94L 3WO4B 1U8IB 2GEEA 4CNIA 3MV9B 2RBLA 1P2CA 4S1SL 4YC2B 3GSNA 4CU7A 2R0ZL 1AQDB 2Q6WB 4NZJA 5T3ZD 4DVBA 2MQCA 3MJGX 3PWPD 3MTRA 3MLPA 5F21B 4LOUD 2VH5L 1J10A 1KXTB 1N0LA 3SO5A 3D6GA 3QEHB 5ILTH 1RUKL 1RIVH 1D6VL 1CF8H 3QULB 2BVYA 2BC4B 2ZNWA 2ZWLT 3QEQB 1LE5A 1KJMA 1RK0B 5TE7L 1IGYB 2XQYK 2EKSA 1JFQH 5A16B 4P4KA 2JJSA 3ULUL 1S7TB 1HHGB 4LVNC 2A6JB 1N0XH 1RZJL 3MXWH 3D1MC 3GSWA 4X6DE 5TDPA 1K8DB 4AEHH 3BYYA 4JE4B 3B9KA 2ZG2A 4TSBH 5F7EL 1DFBL 3JWOC 4LOUC 3UBXI 3RIFF 1ES0B 4RMQA 3NIGF 1ACYH 2JB6B 5CAYB 3R0MA 4EXKA 2A9MH 1YNLH 1E4JA 3PP4H 2IQAA 4QHNB 4M7LH 4PJEE 2NY7L 3S37X 2MHAA 4FQXB 3VFUA 1RK1B 4E41A 5B21A 3VH8B 4U1NA 4PJ7F 1LP9F 4OIIL 5HXMA 3MREA 1T80A 2FX7H 4FQCL 4FMFA 1RSFA 2UWEA 5D9SA 1IAOB 5C0AB 5IB3B 1C1EH 2HKFL 1BP3B 3GHBL 4XAWL 1CQYA 1WAAF 4G6MH 4L3EA 3L6FB 3CCHB 3O6KL 4NO3A 3V4VH 5JQHC 5CZXD 1Q0YH 2GY7B 1FIGH 5IROC 4R90L 4MJ5B 2CO7B 1QFOA 4G43B 3B9AA 3WNNA 1X4YA 2N1KA 3OG4B 5E7FA 2P8LA 4CJ0A 1Z5LB 1BZ9B 1ZSDA 1LWRA 4H88H 2I27N 1EFXD 3MSPA 1A7RH 1OAQL 4QYOA 3ZSTA 1RIHL 1T20A 5BXFA 3DRTA 3M17B 1FZJA 2E9JA 2BNRB 2GFBB 4X7FC 2P5ED 2X1PA 4DTGL 2B2XH 3L1OL 4WNQA 2AI0L 1GRWA 3GI9H 5L6YH 2FR4A 1RUMH 4X6CE 1CFTB 4XNXL 4JN2B 5CZXC 4H1LH 5EPMA 2J1KA 3UJTL 5C0BE 3D48R 1QR4A 1NFIA 3VXPA 1DL7L 5DJXA 1U8HB 4Y1AA 4NKDB 3CVIL 4U1MA 2E3VA 4X0KA 1BBDH 5TF1H 4AMKL 1NBZA 4ODUA 2X9XA 4Z7UB 4YZFE 4AIXA 4XMLL 2R1YB 3KWWA 1KEGH 2YMXL 4XP4H 3LS4H 5DS8B 3ULVH 1K4DB 1A6TB 3CSPA 3GMOA 3UO1L 2VIRB 3QDJE 3DVNA 3OAZH 4WUKL 4NZUL 5I1KH 3WFBH 25C8H 4QRRD 3HC3H 5I30L 3KLDA 4GMSH 3TV3H 4RWYL 3W5MA 3T2QA 4YHNB 4WU5B 4OQ1A 4J23A 5LAXA 2FIRT 4WHYG 2A77L 5CGTA 2EO1A 1S7RA 1KLGB 4RISH 3W5NA 4FA8A 5ALCH 1RZKH 4L4VD 1PQZA 4FFYL 4JGUA 5JHLL 3KPSE 4NO0B 3MODL 2NZ9D 1U3YA 4J1UB 5F9WB 5KW9H 3PXJA 2BSRB 4QRPD 3K1DA 3WSQH 4L3AA 3TBWA 3BYTA 1VEPA 1HDMB 4P5MA 3JVGC 4YPJA 1MVUB 1NL0H 2X4RA 4I48A 5KSUB 3S96B 4G6JH 5EG6C 3UYOD 1O5DT 3CMOH 3WS6A 1RPQA 2AK1H 1RU9H 1CDUA 2LV4A 5EUKA 3V52L 2VLJB 4ZYKA 2BY3A 5J6HB 2BRRH 2J12B 5C09E 3SGKA 3I2CL 4KC3B 1MCNA 2WBKA 5DFTA 3HR6A 4LCWB 4W6YB 4H1LA 4P59H 2HRPH 1YJDH 2NZ9C 5GIRA 5IBTH 4B7IA 1ZT1A 3EDFA 1SJEA 2O61A 2FBJL 4X6EB 3D87B 2FBOJ 1JMXA 4LQFL 2C3VB 3KDMA 3P4MB 1AD9A 4OZFG 4E5XB 1U92A 4YXKL 1XAUA 2B8OT 4XPHH 2DMKA 4GMTH 2OTPA 1INDL 4LKXA 2NY5H 2J8OA 2OL3A 3LEXB 3O3BA 4O2CA 5J3HD 5GSRB 2P8MA 4WFEE 4CUCA 5IG7A 4AEIL 1QPXA 4JVUA 4EJ1C 4XBGA 2YRLA 4WJ5B 5DJ2B 3GUTA 4OJFH 2DM2A 4V1DB 3U7WH 2X40A 1O7VA 4QRQB 1YZZA 2ZKHL 4LMQE 3C5ZA 4DZBB 4Z76B 4X8XA 5C0ND 4WGWB 3QRGL 4M6NL 3N9GH 4XVTL 3PDDA 5L8JB 3IU3B 4JPIA 5FYLE 4M62H 3UC0H 5GJSH 3MRIB 5E7BA 2Y5TB 4KKLD 3FJTA 4EZMA 3QIWD 5J3HC 1IC7H 2NY1D 4PLNC 3V8OA 1K8IB 1OTTD 5B4MD 3MLXH 3O4LA 3S88L 2E7BA 1EH9A 3I50H 3PHOB 1I7RB 1G0DA 4GQ9H 3DO3A 1E6JL 3HCVB 3RWJB 1JF6A 3SDDB 4BFIB 3T0VA 1YDPB 5C0NC 3GBNL 3QEUA 1RI8A 3HG1A 5ESAA 5D5MA 3V6OE 5AD0B 2IWGA 1J05A 2C1PB 4HIJA 4MD4A 1DUZB 5FKPA 4P9HC 1I7ZA 5FUCC 2CKBL 5F7UA 3EJYC 1RHFA 3ARDB 4WUUB 2ZPKH 4G8EA 43CAA 4M43H 1AGBA 5HGAA 4KKLC 3QIWC 3QUYA 2NY1C 1J0IA 3O2DL 1OTTC 5B4MC 3HRPA 5D72H 3R1GH 5IVNA 4JJ5B 3BD4A 1GGCH 1WFTA 2P1YA 1EHLH 1WK0A 3IS0X 2BVOA 2DBLH 3GKWL 1AKJB 4F37F 5J9PB 3TN0A 1I3GL 1S5IH 1R5IB 5D6DC 4PGCA 3N1MC 5HHPB 5DUBB 5L2KA 2ZCHL 4GKSA 2PO6D 3CFJB 3H9HB 4LMQI 5DJDA 3HNSL 4X6CF 4WWID 2HG5A 5SV4A 1DBJH 5MENA 2I07A 4S11A 1CGTA 3KHOA 2AJYH 4ISVB 3WEXA 1NGZB 3B43A 1CZ8L 3ZHKA 4G9DA 5KZCD 2D9QB 1KJ2A 5FA3B 4ZSOE 5E08H 3SN6N 3T0EE 3WIFB 2QADB 4JQIH 4XXDB 1EBAA 3QHZH 4X5LA 3GMRB 1QLFA 2PO6C 2DWEB 4GQPH 4K7PL 4P4KD 4KVNH 3ZE2E 2AEWA 4KKCD 4LGRB 4ZUTB 4KK9D 1MI5A 4N8CL 3U79A 1CVSC 4PRPA 3O6ML 4FQIL 3QBTB 3WIHL 3B9KD 1SMOA 1GGIH 2GITA 4RAUB 5J89A 3TP4A 1QEWA 1D3CA 3WL9A 1F3RB 5D96B 5BZWA 1IAKA 1SEBA 5GHWL 3OAUL 4C56A 4R3SA 4C57C 2EDJA 4P4KC 1AP2A 2OR9H 2JJSC 1ZV5A 2WV3A 4E41D 4PGDB 5F1OB 4KKCC 3VG9B 4I0KA 4KK9C 1L0YA 1T22A 2GI7A 4G6FD 5EBWB 3KPPA 1B0GA 1T2QL 3B9KC 5EC2A 3BISA 4HH9B 4F7MA 3MRBA 1U95B 4NQXB 2XTJB 1IGCH 5DUML 2VXSL 3CPLA 4I1NB 2Z35B 4L3ED 2IBBA 5IFAH 5DQJB 2OR8A 1MUJB 2X9YA 3ELAT 4Z0XA 4GFTB 1A14H 5B3JE 2X05A 3DSNA 1RJZB 1HSBB 1I8MB 2Q7NA 1WEJH 2OMBA 2OK0L 5T5FH 5A43C 5LCVL 1NBYA 5C0FA 1XGPB 3BH8A 3HFML 4GAGL 1Q9LA 4M1CD 1EXUA 3C87A 2RHEA 4RFNB 3NZHH 4AT6B 1I85A 1N6QH 2APTA 3PABB 1EVTC 3FOLB 3TLRA 5GS2H 3QO0B 1EV2E 4L9LB 1TVHB 2J2ZA 3CX5J 3QDGB 1QBAA 2AJ3B 2GJ6D 4P4RA 2XFXA 3V4PH 4ZPVB 2FZ3B 4A6YB 4KQ3L 2ITDB 3NAAL 2EXWD 4UV4H 4DN4L 3NFSH 5IF0A 5AZEH 1KIQB 2AV7B 4NFBA 3VGFA 1VPOH 1CTNA 5E6IB 5IV2B 1YNKH 5DRWB 4RGOH 4Y19B 4M1CC 1SM3L 4D0DA 5C86A 1Q72H 1URLA 2OM5A 5F96L 3HMWH 1A7OH 3MR9B 4IRJB 4NHCH 4HUWA 5EN2A 3KYKH 3RWHB 2SEBB 3RUGE 4LNRB 1L9NA 1Z9OA 4F7TB 3MRCA 1FJ1A 3U7YL 4WFFD 3T65A 3TA3A 4JZNA 5MI0B 4GUPA 5ITFB 4QXUL 1FV1B 3D0LA 2DYPB 3TBVB 1R5VB 4Z7WA 5DC0A 2EXWC 4YPGB 1GAFL 3D2UA 1T7YA 3MUY1 4JCLA 4X9GA 5IT2L 1G84A 2DI9A 2CGRH 1CR9L 4LQ1A 5D4QA 1AO7E 1QFUH </