3EUUA

Crystal structure of the fgfr2 d2 domain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
100
structure length
100
Chain Sequence
NKRAPYWTNTEKMEKRLHAVPAANTVKFRCPAGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHTYHLDVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fibroblast growth factor receptor 2
publication title Crystal structure of the D2 domain of hFGFR2
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 22
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2008-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3euuA01
4OSUL 3KYNB 5D7JA 5KN5B 5I8EA 4MXQD 4N1EA 5FYKL 1MREH 1TNMA 3P73A 3TZVA 3MRGA 2QR0B 3OKMB 3O6ML 2BNQA 4LSQL 2X40A 1D5XB 4DAGH 5CP7B 5IQ9A 1MHPH 2A0LC 1MJ7L 1WWCA 4L3CB 4L8SB 4LFHD 4UUJB 1JGUH 2H8PB 4NQCE 2BMKB 2NXYB 3L7EA 3GIZH 1W72A 4YX2H 1ZWIA 2CK0H 1Q0YH 3GNMH 1IGYA 1KC5H 1VFAB 3O3DA 4JPIB 3IFNH 3D2UB 3QFJB 5H94B 4ZDHB 2XTLA 4M62H 2FYYA 2XTJB 1G7IB 2ZUVA 4ZS7H 4G43A 4PRHD 1MF2H 4ZAKC 2C1PB 3QCUL 3HPLA 4PJCB 2VLLA 4YDLC 1JPFA 3LOWA 4H0GA 3D18B 4MD0B 1NGXA 4X6BA 3HHRB 1MJ8L 3VGBA 4H8WL 2A6JB 3E2HB 1IL1A 3IXAB 3NOIA 2YUVA 4LBEA 4JY6A 3O2WH 1CD1A 2V2TA 5F71A 5JOFB 4LCIH 4QRRE 3U7WL 4RFEB 3T0XA 1MJJA 5IW6A 2OJEB 3UBXA 3DO7A 4KTDH 1NJ9A 1NFDB 3QIBC 4RAVB 4OD2B 4JFEA 2PUQT 1XIWA 1L6ZA 4QTHA 3U0WL 2YD3A 5GJTH 4EKXA 1EZVY 1ND0A 4U1LB 3ROLB 3U4BH 4JE4B 2NY1D 2UZIH 1FFNB 3MRPA 1XEDA 3MNVA 3TA3B 3FB8B 2NW2A 1IEAB 5GGQL 3HE6D 4I5BB 5F1NA 2AV7B 3TYFB 3VGEA 4PS4L 4DUWA 4EZMA 5MHSE 1N3NB 2W65B 5LWYH 1X6NA 2VUYA 4NZRH 1OQXA 2IALB 1I7RB 5I1IH 3T4YA 4JQXC 3QPQD 1UXWA 2V5RA 4UILH 5E8EB 4HKJB 4R6UA 4U6HA 1AQDB 5EU6E 5GGSB 3OKOA 4HIIB 1F4WL 3AY4A 1Q1JH 3PWUB 2Z0BA 5GRWA 3HMXA 5EA0H 4YLQT 3HAEB 4LPXA 1AQKH 3QZWA 1QFWM 1XFPA 1YDPA 3KJ4C 4PV9A 3NAAH 3DVFA 1PYWA 1RULH 5D71H 5JXEC 4TUJA 1U8LA 3EZJB 5FYJE 3VGHA 4TQEL 1WT5C 4E9LA 1D6EB 4HMDA 2XFXB 1FYTB 2OR8A 2W0FB 4OCNC 2YRPA 3VD5A 4MXWL 3QUKB 2BVQA 3K4DA 2CDEB 1CGYA 5H37G 3AAZB 1TZIB 4NT6B 2C9AA 1QTYT 2YEZB 3BVNA 3RKDC 2MCPH 5D7IB 5K9OA 3TH4T 2A6DA 3W9DA 5I1GL 4Q6YA 4NWTH 5K33A 2GAZA 4RISL 4RFNB 3VA6A 4CKVX 3HNTL 4WJ5A 1MAJA 1EV2E 3B9KB 3L95A 3RIFF 2X4SA 5J8OA 2B1HL 4NO0A 1F3DH 2DQEH 4JFYB 1MOEA 1NLDL 3DGCR 1JHLL 2P44B 1UM6H 5I1CH 4HWNA 3X3FL 2BVYA 1D5IH 4PGEB 5HI3D 1C16A 3BYYA 2VQUA 2XG5A 3OF6A 5DZOA 4LCUA 1FO0A 5DVMA 1GGBH 4ELKB 4LIQH 1CGVA 3KYOB 4PJHF 2MSPA 1FLRL 3WXVL 4OZFB 5CZVH 3TIDA 3G6AB 4UDTA 5GRVK 1XF5B 4ODUA 3PIQA 3QWQB 3MV7E 4D9QE 1Z5LB 4XRCA 3MUGA 1Q0XH 2YSSB 5IBUG 2VL5A 1T2QL 1IGML 4MZ3A 4EUPG 1MIML 2I07A 4FFWD 4KROD 1RJLA 3W2DH 4OGAC 1HSBA 3MGTB 5EU4B 4ZMAT 3P0VH 5C86A 3KDMA 5JLZA 3FHQA 3KXFD 4RGNC 3RIAK 1WC7B 3QO0A 3TNNA 3PHSA 4UU9A 3HE7C 4AM0A 1AGCA 3D5OF 5LCVL 2LTQC 3QUYD 2DN7A 1HOCB 1I9EA 4OFIA 4WFEE 2GTWA 1WTLA 2KL6A 4LLQB 3VFSA 4WI8A 2APBA 1CXHA 1YEGH 2PKDA 1KB5A 1FNHA 5IVZA 1N5YH 2OTWA 1S5IL 1QO3B 3NA4A 2XZAL 2R8SH 4JRXB 3PGDA 4XI5D 5FUCE 4NQCA 4OGYH 3UTSA 4JFQB 1F42A 4O58H 2DQHL 3KPRD 1LNUB 4OZ4A 3HG1A 2CK2A 4YEFA 3AREB 5HGHB 1F2QA 1G6RL 5FO9A 1TXKA 5GGVH 3GSXB 5DMJB 5TE6L 2Z31A 4LP5A 4PGZA 3JVGC 3R4DA 4L9LB 1J0ZA 2Q7YA 4CJ0A 5ACMA 5JPNA 5DJXA 4CU8A 4K3GA 4QRRA 4GS7B 5AAWA 3QIWA 2A6IA 1FVCB 3DYPA 2E6QA 4WCYH 5IROC 3GMQB 5DZLA 4NQVB 1BVKA 1S5HB 1TVHB 4GOSA 4EDXA 3QI9A 5CJ8A 3FZUD 4E0RB 4MCYA 2H3NB 1TETL 1HXYB 4E5XA 2J6EH 3K2UL 1RZJC 5MERA 1UH4A 1X5IA 4MSWB 4CUCA 4NN7B 1WFUA 1P4IL 2QHRL 2WK2A 3MRIB 2DDQL 3SKOA 2H2SD 3GJEB 3KPSE 1JTOA 1MI5A 5GZOC 4KI5C 1U3HD 5I76A 5MP6L 5DVLA 1T66C 4ZFZA 5EU6A 2VXUH 3RUGF 3O9WD 1ROWA 1YQVL 5IFHH 4FTVD 2NY0B 4Q9QH 1A9BA 3OV6A 5CSBA 5FKPA 2ZCKL 5FOBA 4XC3L 3S5LA 3QQ4B 5IMMB 1T1YB 1VCAA 3IT8D 2NXZC 4Y1AE 3HUJF 3EZ8A 3HPJB 1E4XI 4S1QL 5EULV 4S1DD 1FG9C 1CL7L 1IGFL 3BPLB 5H2BB 2ED8A 1NL0L 1YN7A 4PLNC 2J3SA 3WIHL 3MXWL 1JIBA 1RAMA 3BEVA 5T33H 5EUOB 2Z92B 3FT4A 4H26B 2BCKB 2FL5B 3MLTB 2D9CA 3KLDA 3PNWB 3D87B 1HINL 2XQBL 5JTWA 1HQ4B 4M5ZL 1FHGA 1XF3B 2J1KA 1QBLH 3ZKSD 1IFHL 2D9QB 1ITBB 3DUSA 5FGBC 1KCSL 2CLZA 5I8KH 5IB1A 2VNCA 4JFPA 5HI4C 5ENWB 4D8PB 5C0ND 3P4LA 3MRFA 4BKLA 2YPLE 4HFUH 4KY1L 4G9FD 4Z7VF 2YR3A 3OJVC 2BMKA 2KQNA 3LSOB 1F58L 2DQCL 2DYPD 3BN3B 3G6JF 2HLFC 1U9KA 1T6WA 5E8DL 3VXOB 1TJHH 4MJID 3RY4A 2GHWB 1LILA 4WFGE 2A9ML 3O6MH 4OJFL 5H94A 4ZDHA 5FF6A 3V0AC 3KWWB 4BZ1L 3K8KA 1FORH 2IBBA 4WU5B 1B2WL 4Z95L 4FN0A 3LS5L 3MV7A 1NGPL 3IXAA 3MUJA 1ZHKA 3RA7L 3IJSA 1RHHB 2LQRA 5GHWH 3LN4B 2BNRD 3AB0C 4RMTA 3NCFB 3QCUH 2BVOB 2ZSVB 3OJ2C 2DBLH 2XN9D 3QHZH 4KKNA 4LSTL 2IG2L 4IIQB 1MJ8H 1EZVX 2NX5E 3NFNB 3QWRA 3TH2T 3Q6FB 3FMGL 2V5MA 2B2XL 4Z76A 1PW3A 1F4AA 4LK4A 3T0AA 4NUJA 1HH6A 2EXWC 1BOGA 2DD8L 2PO6B 3QUXB 2YD4A 4RGMC 5ANMB 3ECBB 1VFOA 3RWJB 5KSUB 1DLHB 5E8OA 4IMKA 2D7NA 1P9MA 2VDMH 4NKOA 2Q3ZA 1PG7W 1AGBB 5D6DC 4G8IB 3V7AG 4R97B 3EO0B 4LMQI 3C8KA 1IEBA 4PS4H 2H32H 5DS8A 1D5ZA 4I18A 2I5YH 2AEIT 4YK4C 3SJVD 3SY0B 3MZTA 2FX7H 2YUZA 3L5XH 1IGCL 1LP9F 2JB5L 5SWZE 3D39D 4MAYA 3L3HB 3H9SA 2EH8L 3VFUA 3C09B 1NDGA 5I6XC 4F7PA 3X12A 2HRPL 1EX0A 2C3XA 2X70B 5J13C 3CH1A 4JM2A 2Y7QB 4L4VE 4HIEA 4FZEH 5J6GB 2VAAA 1T7YA 4GRWF 4RMWA 4TQEH 4TUOA 1EBAA 2XZCH 1DR9A 4KKAC 1FSKC 3TN0D 3GSVB 4G3YL 2FIKA 5A2FA 4FFYL 2ICEA 1LEIB 4W68A 4QRQA 3RNQB 4L29B 4NQEE 2Z4QB 4BSWB 5EBLB 2C26A 3KPLA 1UFUA 5FGCE 4DN4H 3SBWA 3ZTNL 2C4XA 5LBSH 1GCFA 4H1LA 3QDJB 5HGAB 5B21A 5TH2B 5J0BA 2MKLC 3HNTH 4P5TA 4U3XA 1P1ZA 5B39A 1U91B 3CSGA 4P9MH 1DTUA 3KPSA 4LSPL 2JJUA 2VE6B 1FRGL 1Y0LA 1YEKL 2B1HH 1JYXA 1MCBA 4QGTA 1NLDH 2NY3B 1I8MB 3NPSC 2RB8A 4Q6IA 1AGEA 1NSNH 4N1CA 3X3FH 3HNSL 4DKFH 1F2XK 1HDMA 3MRNA 4OCLC 5CLWA 2Z9TA 4XBPA 5A2LH 1U3YA 3DROB 1OB1B 3F5WB 5BS0B 2K3TA 2J8UE 1QNZL 5BRZB 4Y1AA 3RVWD 3KGRA 1MFCH 1U3JA 1I3RB 1SQ2N 1FLRH 2ARJB 3WXVH 4NPYA 4GBXB 1CDGA 1ZGLM 3WS6A 4YWGH 1N26A 4NGHL 1BJ1J 1QRKA 5CD5C 5GJSL 5KSAD 1T2QH 3RVTD 1YYLL 4HDIA 2JJTA 1BEYH 4I0CC 4JQIL 4JKWA 4XPAL 2EDJA 3QEUA 4BZ2H 1INEL 3TVMB 4RA3A 3NGBB 3MRBA 2AJSL 4F9PA 5KVGL 5MHSD 1A7QL 4KDTA 4EQ2A 5I2IB 3QRGH 4KVCL 2KQMA 3RWHA 4KPHL 1JWMB 4XP5L 8CGTA 2HJFA 1A6TA 1OQOA 2AEPL 1N8ZA 3QUML 5M94B 2NY5C 1OW0C 2OL3L 4LVEA 2BNUB 4IOFD 4ONOA 2HG5B 4HLZH 4LHUB 2DF3A 2GK0A 1HYRC 1LDPL 1GC1C 12E8H 8FABB 5E00B 5FYJD 5K9KB 4UINL 1HHJB 4U1KB 4K7PL 3AREA 4HEPG 2PR4L 5C2BH 1S5IH 2XI9A 5I18H 2BJMH 1Y6NR 4RIRB 2XZAH 3ZYOA 4CADB 1AIFB 4LVHC 5GGTL 4PJDF 3I6LE 3RDTA 3BKJH 3E3QE 1OF2B 4MJ4A 1A6WL 3SDCC 2DLGA 3IETB 5I1AB 2DQHH 4KK9D 1II4E 3RJQB 4I48A 3GSNL 3DVGA 1N64H 1JPSL 3CX5J 3NFSH 1G6RH 1QSZA 4JGJA 1JFQL 5TE6H 1FVCA 1F97A 2M2DA 1VFBA 3S97C 3V4VL 5E6ZA 3FCTA 3WKML 1NGQL 3KLAA 3DMMC 5EOTB 3MUZ1 4LVNB 2NX5A 3MJ9L 4FXKA 5H8DA 2AJZB 5CZKA 3KNBB 4NSKA 4MYWB 4NHUB 4XPGL 3ZMRA 2GI7A 5E8NB 1M6OB 3BZ4A 2CPCA 5C6TL 3L3DB 3MCG1 5E2TL 4QTIL 4P57A 4LKCA 3BE1L 2ICCA 2OMNA 4P4KB 4TTDD 1EDQA 3V6ZB 3BZDA 1XGTA 2AKRB 4DK3A 1MWAB 3RPIA 2EE6A 1OAQL 5T1MA 5KSBA 5B8CB 4M7ZB 5I1LB 4PJFB 2F5AH 2YHGA 1EJ6A 2R2BA 1EEYB 1P4IH 2QHRH 2R23B 4OQTL 2DDQH 4D9QD 4L3EE 1IBGL 3U0TB 5I73B 5EORL 3QQ4A 3DECA 3BEWB 5I71C 4OFYD 2EIEA 5C09B 2NY4B 3P4MB 4G5ZL 5SWZA 4EN3C 4Y4KD 2X1WL 5IFAL 3LQAH 4YHOL 2YOCA 5SWQA 1TJIH 1YQVH 2P48B 4WI6A 1TVDA 1U2CA 4NC1C 3T2QA 3REVA 4NQDE 4ETQA 1SJHB 1Q9KB 1ITCA 4IM8A 1FNAA 3HC0A 3RTQC 2ED7A 4FMFA 4X8JA 2ZKHH 4P2QD 3QNZB 1B0GA 1JMZA 2ATKA 2Z92A 3UTTE 35C8L 4ZG1A 4U6XB 2AS5M 3RL2B 4Y4FC 3I84A 3BP7B 4FQXB 5T5FL 1P5VA 2XWTB 4WFED 1IGFH 3GO1L 4FQQA 2Q86A 2EDLA 5GS2H 4QHNA 3QQ3A 3WIHH 2E6JA 3MXWH 3VXUE 1BAFL 5AEAA 3LH2L 4Z0XA 3ZE0F 3VXME 2EE9A 3KPMB 2F74B 4D0CA 1UQSB 5CMAB 4WUUE 5FK9A 2XA8L 2P5WB 4M5ZH 1IAMA 4YC2B 2CKBB 4ZTPL 3RGVC 3VFPB 2V5SA 4PJEE 4ZD3H 4LLMA 1QVOB 1IGIL 1IILE 1PVHA 4DK6A 4NYLB 1KCSH 5CINL 1NANH 1YJDC 3ARQA 3QUZB 3KWWA 2DMCA 3CDFA 4UV7L 4P2RB 4M1CD 5LGHL 4KY1H 2JJVA 3N1PC 2JJSC 5EFIA 2QSTA 1HHIA 3SQOL 4U2YA 4EI5B 5KS9E 3QDAA 3T4AA 2V5TA 2A9MH 5HDQL 1FQ9C 1ZLVK 4JDVB 2J8UA 3O6KL 3W11D 1CL7I 4BZ1H 2R1YB 1MUJB 2EDWA 5F89B 5HVHB 1DBKL 2GEEA 3RVXC 4ZOEA 1H15A 4K3EL 2W0PA 4HK3J 3TO4A 2G60H 4Q0XH 1B2WH 4IBLT 1TLKA 4QYOB 3WCYA 3KPPB 1NGPH 3SDYL 3NFNA 3RA7H 1S7TB 4E41B 1E28B 3BDXA 1YZZA 4PJ9D 1RK0A 2VXQL 1MHEB 2ICWI 1FL3A 2W0LA 3DXAE 3GMPA 4KH2A 1FBIH 3SKNA 1P7HL 3Q48A 5CEZD 4W6YB 3TBTA 1CXLA 4PFEA 4Q97A 4JREB 3LKOA 1A6ZB 2EZ0D 1J1PL 3JV4A 3OMZA 5F7LB 1HYSC 3QQ9C 3C60C 2GTZA 3FMGH 1K3IA 4GAGH 2B2XH 1DQQB 1LO2H 3RZCB 4XP1H 3KVQA 3CX5K 4U1NB 4DKDC 5DJAA 4GW5B 4N9GA 4PP2A 4J3TA 2FATL 2LU4A 1QA9B 1V7NL 4ERSL 4N5UA 1MLBB 1BZ7B 4HGWA 2UWEB 1BX2A 3A6BL 1YEEL 5C07D 4UB0L 2A2QT 3DIFB 4UNUA 4OT1L 3RI5F 3BQUB 4D9LH 4V1DB 2C4FT 4OUUB 4KRNA 4PLJC 4XPFL 5D7LB 1T2JA 1RQ5A 4TSAL 1IM3A 1C5BL 3NTCH 4X6EA 3LDBC 4C83A 5E0QA 5IJVB 2R1WA 2W60B 4PRBB 4NQUA 1UWXH 3D9AL 3VWKC 2EH8H 1ZEAL 4K94L 1OP5H 3PL6D 1K4CB 1QLFA 1O7SA 1MPAH 1QRNB 2BXZA 2X2YA 2HRPH 4L1HA 5A16A 1IARB 2V9RA 3O3BA 5HGDB 1XF4B 4N8CH 4BUHA 1RJZA 3GMMB 4XNYL 3VE0A 1JRHL 1T7VA 2YPLD 4CL7A 4JM4L 4JVWA 1RZIB 4Y7MA 1OT2A 1UT9A 2PW2A 4G3YH 4D0DB 1OSPL 5HDBE 4FFYH 4X4ZA 4NKMA 1MCDA 2ATPB 3IDNB 4Y5VA 5C0JA 1VPOL 3MFFB 4P2OD 5DHVB 4AMKH 2YK1L 5DD6B 3OKKA 3CFDB 4XNZB 4BM7A 3ZTNH 4C56E 2VXTH 3ZHLA 4HWZA 4WHTB 1TQBB 2HVJB 3ALPA 5EIIB 1MRDL 5HYSB 3B5HA 1IE5A 5D2NC 4L3EA 3N9GL 4LSPH 4Z7WA 5AD0A 1FRGH 3WDJA 1YEKH 3VFRB 2AERT 3BGMA 1QSFE 3MGOB 4NRYA 4PY8I 4QT5A 3QB7C 1K8DB 4NN6C 2VIRB 3CJJA 1YECL 3EOYG 4JJHA 1S8DA 1WZ1H 3HNSH 3FQXB 4NQDA 2H2PD 3MV9B 2E7LA 1DN2A 4QHKJ 1JMXA 1M7XA 3I3EA 2R2HA 4YHPB 2XZZA 3OXRB 1I1AB 3BSZH 4QHUA 5KANG 3UTTA 4Z77B 1KN4L 4LGSB 3TJHD 5BMFL 2EO1A 2F19L 1QNZH 1NCCL 5C8JA 3ZYZA 4PJAF 3QA3A 5ADOL 4KV5F 3TVMA 5IJKC 2FGWH 2O26U 5C0AE 4JDZA 1KPVA 3RVUD 3OKNB 3C5ZA 3CK0H 3MCKB 2LAGB 5BZWB 3VXMA 1J8HA 5FKAB 4F37F 5K59E 5L88L 1QZ1A 4XPAH 4WUUA 4MCZA 1SY6L 2Z91B 1INEH 2XWBA 4HC1A 4V2CB 2AJSH 4OUOA 5KVGH 1A7QH 1FPTL 2IPUK 2AGJH 5F88B 2VYRE 2J88H 1UM4H 3EOBB 3GIVB 2CRMA 4P59L 4OLUL 4YHYC 1VKXB 2AEPH 5D1ZD 1INQA 4PJ7B 1E27A 1NCAL 5IB2A 3OXSB 1MCCA 1T2XA 3EKCA 4MJ6A 3VXSA 3UTZA 1RK1B 3JWDH 5DSCB 1MH5B 5L2KE 2OZ4A 5FA4A 5KS9A 4ETYA 4L4VD 4UINH 4K7PH 3MUHL 5CKAA 2PR4H 2R9HD 3WNNA 1KV3A 2CR6A 2CXKA 1WFOA 4GG6F 2H32B 4PJ8C 4Z8FH 3WEXB 2EKSA 2N1KA 4S11A 5IHZA 5DHYB 1W0YT 4LPCA 2ZZUT 4NQED 1O7VA 4GUPA 3KPNB 4G7YL 4QRUA 4YFLF 3BKCL 2WZPD 3UO1L 4DCQB 5JHDE 4CVZB 1LO3L 3GSNH 3WO4C 5HGBB 3PWJB 4U2ZA 4WO4B 1JPSH 1NCWH 4C4KT 3EYFB 4OM1L 3DXAA 3N1FC 1B4RA 1FNSL 1YY9D 1L0QA 3E6HA 3G08B 3IFOB 5SX5H 3WKMH 1E6OH 4JZNB 1UXSB 1NGQH 4KU1A 3CSYA 4NM8H 5EDXA 3MJ9H 5DEGB 1P7QA 1WICA 1CLOL 1G7HA 2BVPA 5B8CA 2VXSL 1MELA 5I1LA 5IR1A 4CRPA 3IDUA 1QQDA 1Y18B 1EEYA 3MJGX 1VERA 4R96A 5IEHA 2WP3T 2X6MA 1ZLWK 2DQJL 5EB9A 3VXRE 1T3FB 1KGCE 5IBUB 1OAQH 3EHBD 1CFSA 3VXNB 3HS0A 4UAOB 3ARBD 3IFPB 3PP3K 3DVNA 3O11A 2GSIB 1KF9B 3SEPA 5DK3A 1IBGH 4X80H 4EVNB 2YN5A 3HR5B 1C08B 4MAUH 1T0NB 4M3KB 1MVUB 2WIIB 4H88H 2DB8A 4WNQB 3IJHA 3BPCA 1KN2H 3DURA 3ILPA 2BHZA 2IAMD 3CFIC 4JHAH 1OD7A 4YIQA 5JIIA 3ULUL 3PQYA 4RNRA 3FAWA 5DXWA 4J1UA 4FP8H 1S7UB 3GMLB 2ZUQB 5DD3H 4L4TD 1AR2A 35C8H 5DFWH 1S9WA 2BOBA 1UQSA 5ICZB 4QRTB 4HIHB 4K23L 3OB0K 1F6FB 1RV6X 1VADA 5T5FH 1XH3B 2GITA 3C8HA 1RZ7L 1CK0H 4XCYA 4MD5B 3SDDA 5D72H 5HSFA 3D69A 3MRKA 3MA7A 4X7CC 3VRJB 3T08A 3VJ6A 2GJ6D 1BAFH 3DBXB 2F53E 1BFOB 4C56A 4LASH 1H8NA 2DL9A 2XA8H 1KENL 4KJQD 3HE6C 3CUPB 4PTTB 4ZTPH 5AUMB 3OX8B 2D4DA 1EMTL 5KSVA 4NQXB 1XGQB 2AP2A 2YD5A 3NFPB 1P4LA 1FH5L 1JVKA 1N5AB 5CINH 3MJ8B 5L8KB 3ZTJH 4XH2A 1YNTA 2JCCF 1J10A 1IT9H 4LLWB 3L5WA 1IQDB 1I7ZA 1QSFA 2HAZA 2UUDK 3ARWA 4X6DF 1MUJA 1MLCA 5JW5B 4G6FB 5HHQA 1J0HA 1WWWX 1UA6H 2HJLB 3MBXL 4AG4L 1ZANL 1OWRM 3V6FB 4P4RB 3CC5A 4YDLB 5DRWB 4XAWL 5HDQH 5JR1H 4GSDL 4U6YA 4U1JB 1DBKH 1MCWM 4K3EH 3SPVB 5C0AA 4G8GD 3IRPX 2EH7H 1BZQK 4MLIA 5HYJD 4Y19E 1F6LL 3SE8H 1OGTA 2X1XR 3WHXB 2EIZB 2VXQH 3T1WA 1K3ZA 4ZUTA 4OLYL 2YA2A 2CRIA 4NNYB 3FRUA 3UX9B 1J1PH 1FFOA 1WFNA 2AK4E 4RWYL 4LAQL 5JW4N 3EDEA 2WMPA 2AI0L 2IFFH 4XMPH 2G75A 4K8RD 2D7PA 4FRWA 3NA9L 2DTMH 4F7CA 3Q3GA 3LKQA 4P2CG 5LQBH 4JO2L 1K2DA 3ESVF 5DD1L 5DQJA 4BFIB 5L2KA 2FATH 5IFJB 1QLRB 4XVTH 4ERSH 1IQWL 5I19H 3K2MC 1FZJA 1WJ3A 3A6BH 4A2MA 3KJ4B 1AO7B 1YEEH 5T3ZL 3S36X 3WLBA 3LQAC 5BV7C 4OT1H 2P5EA 4F7TA 3F12B 2O61A 1MCPH 2EE2A 1J8KA 4TSAH 3VXUD 4EOWH 5JHDA 4Y4HA 4I2XB 1F5WA 4UDUB 4Q7DA 1UZ6F 3V5HA 4KROC 1G1YA 1CFQB 3IGAB 4XXDA 1T22A 1ZEAH 3ZT7A 4K94H 1KTDB 2DQIL 1QFHA 3IFLL 3BMWA 1HHKB 1U8IB 2PXYA 4OAWB 5FO7A 1U8JA 2A74B 3BHBA 3OB8A 3IAPA 1PLGL 4OLWH 3IU4L 5TFSL 3T3PE 4PG2A 4L9DA 3O8XD 1UYWH 1R0AL 3VFNB 4KMLB 4XHQA 4XNYH 5FDWA 5HDLA 2X9WA 3TBSB 3OR6B 4MNQD 4WHTA 3QUYC 2VDOL 3FN3A 4X99B 2DI7A 1U8MB 2MNUA 3CVHH 5IM7B 3D85D 1OSPH 3JWOC 4GAJL 5DJYB 1S7QB 4POZD 1CLCA 3VXRA 1K5NB 3VD9A 3IF1B 4M61A 4YQXH 2ICWB 2YS4A 4HV8B 1TITA 3BRGC 3H9HA 3IDYB 3GSWA 4NCDA 4XI5C 5CFHA 4GRLD 3V5KA 1J1XH 4M7KL 4B5EA 1YEDB 1MRDH 1BD2A 4K3DL 1FGNL 5FB8B 3QIUA 1LE5B 3DRTB 1I9RL 1A64A 5BXFA 2GK2A 3P0YL 2HLAA 1LEKA 2BOCB 5C08B 3HI1A 1FG2B 1VESA 1D6VL 2PYFB 5DGQA 1UWEL 1INDH 1YECH 5FECA 2OYPA 4ZO9A 3K4AA 1AGFA 4GKSB 3IDIA 4LFHG 2P1YA 4K7FB 3BWAA 4NKDA 1VENA 3RPKA 3IAGC 1NC2A 1NGZB 3MJ7B 1JRHI 1A5FL 1DBML 3WNLA 1MHHB 5BZWA 1KN4H 4P23A 5BMFH 1QOKA 4XCNA 2F19H 3IJYA 1F3DJ 1MCJA 3QG7L 4RGNB 3P0GB 5CEZH 3ROOB 1G7PB 3VGAC 4JAMA 3FFCE 5FGRA 5JW4R 5IHBA 3HE7B 1B0WA 2I9LB 5F88A 1FGVL 5EU7E 4HW6A 1U8OB 1PZ5B 2H41A 4DVBA 4TVPE 4WDIB 5INCB 1YUHB 2F53A 3SKUD 4NCC1 1HILA 4WWKD 5L88H 3STZA 1SY6H 1RK1A 1KT2A 2VQ1A 3B6SA 4GXVH 4MQXD 1FPTH 2H2SC 3FB5A 3I6KB 3PXJA 4YO0A 4K55A 4WFHD 3SGDH 2B20A 1FYTE 1SEBB 1JHKL 1J88A 3WFBH 5C0FB 1RJYA 3U36A 3O9WC 3TBVB 1S7XB 5J1SC 1HI6A 4OCRL 4YDVA 3SGKA 1JL8A 4OKVB 2X41A 4HLZG 4JPKH 1CU4L 1MSPA 3HUJE 1D5MB 4XP6H 25C8L 3C9NB 3HNVL 1GYAA 4M02A 3NCYS 1RMFH 4LEOB 3Q6GL 2EYRB 3MR9A 4KJYA 1CT8B 1QFUL 4BH8B 1KYOJ 2DOCA 2M26A 4OZHF 2D0FA 2VLRD 4G7YH 3HCVB 3DGGA 3BKCH 5KVEH 1RZGA 3G9VA 5D1XB 3ULSB 2J12B 2X7LB 4G7VL 2EXYD 5T1KB 4K07A 3OGCB 5JZ7C 4OM1H 5BJTA 1FNSH 4ONHB 2OCFD 5J12B 1GJIA 1A3RL 5HHPA 2ZUYA 5D7SL 1MIEH 3GGWA 3SDAA 4N0YH 2AK4A 2G5RA 4XNQB 3U7YL 4ZPVA 5D70L 4WHYG 1CZ8L 4M3JA 5A1AA 3ES6A 5BV7L 3MBEB 4LVOB 2VXSH 4MD4A 3LHPL 3G6JE 4QHMA 4EUPA 2GSIA 2GSGB 4YFLI 5C9JA 1Q94B 3F6IA 2AXHA 3MMEA 2ZP0T 1CDYA 4EVNA 5FYLE 3BT2H 1EXUA 5HD8C 4PJHA 1Q72L 3MRCA 3MRRA 4ORZC 3ARDD 1T1WB 1G7LA 5FM5M 4F7EB 5DK2A 3FQRB 1HEZB 1T04B 4URTB 4N0UE 3SGEH 5GS1C 1A3LL 4CN4A 4L8CB 1NGYA 1KLUB 4NDMA 1G7JA 4IRSD 1NAMH 5F7MC 3ZKND 3NIFF 1GAFL 3ULUH 1A4JB 3LKRB 4PB0L 5I1DB 1NC4B 3JWOL 5TPWL 4DKAA 4PRPE 1ZTXL 3LPFA 1IRAY 5IK3B 4RMVA 3UP1A 1OL0A 2CUHA 3BPNB 1CE1L 1OAXH 2EO9A 4M8QA 2VDQL 4K23H 4EBQH 1U93A 1T21B 1P6AB 5D5MF 1RZ7H 5TDOB 4HPOL 2YMXL 4TPRL 3WFDH 3CU7A 1JYWA 2CLVA 4LLUB 2NW3A 1IQDA 1ADQL 1OP9A 4AT6B 4PY7B 5K9JH 3W39B 4W70A 1KENH 4ZXBB 1DP0A 3PGFL 1EMTH 4ZAKA 3FT3A 3JWDC 4QOKD 1LP9E 3QUMB 5J3HD 5IGXL 4K71C 5DRWA 3RWDB 5F6HI 4CW1A 1AXSB 2OL3B 2VC2H 4Y0GA 2NY6D 2XG4A 4S1RH 1KCKA 4X9IA 3KYMA 4XMKH 4FXGB 4QXGL 3MBXH 2QBWA 4AG4H 4XCEA 3FFDB 4IRJD 4HUMB 2BSTB 5D7KE 2YC1A 3FRPG 1CDBA 3QIBA 4LCCB 4NBZB 4I0PD 4OF6A 1UJ3C 1W72L 1LO0L 1OGAB 4AIZA 4XB7A 1F6AA 4NO5A 2AJXL 4GSDH 3TN0C 1NFIB 2Z35B 4ZOAA 4XAKE 1P53A 1A6UL 3QULB 4U33A 2WUBL 4UOW1 3FN0L 4APQA 3GSNB 4PJGB 3BN9D 4JFZL 1KGCD 3I3DA 3R8QA 2A77L 4HIXH 5E56A 1HKLH 1DVFD 3OHXA 4EQ3A 1ZLUK 2ZG1A 4PD4K 2E5EA 2DI8A 1KNOA 1HZHL 4BSVA 3GK8H 1KYOK 1I3UA 1GOFA 2NCMA 2HMID 3TWCL 1ZHBA 3UJTL 3EYUH 4F37K 3HZKB 5FUZL 1WWBX 1IKFL 1DUYA 3KLHD 2E9WA 3RUGA 4LLVB 2AI0H 4HSQA 1KPUB 2D7TL 3VU2A 5JXEA 2J5LB 1AFVL 4YK4B 3NA9H 1T5XB 1SYVB 1BMGA 1K9TA 3MX0A 2MPAL 1TVBB 4JO2H 4JRYB 4AIOA 2N4IA 5DD1H 5MI0B 3H7BA 3FO9B 5T3XE 4JFFB 3HUJA 1KIRA 3F58L 3ILQD 3B2UD 1IGTB 3C6LD 3FOLA 1IAII 3VFWA 1G1CA 2G9HA 3RVWC 2R39A 5J13B 3QXAB 1RURL 1BGXL 2B1AL 3VWJD 4B41A 1MRFH 4PJIF 4KZEH 2ED9A 1QSEB 1T89C 2ADFL 3QWOA 4CVUA 5DRNA 2X1QA 3QI9C 3BZEA 1YA5A 3NZ8B 1I1YB 1R3HB 3HMXL 5DMGD 5KSAC 3RVTC 4OGXH 3WS3A 3L3KB 3UTSD 4X5WB 4PJBF 3LN5A 2WBJD 5I1HL 2QHLA 4QXUL 5JIKA 5CLTA 5JO5B 1S9VA 3MLZL 3IU4H 5DJYA 3BIKA 5TFSH 2GFBB 2XRAL 2CDFA 3D6GA 2ICWA 4Z7VA 4KFZC 4O00A 3ULVL 5IKCA 4ZUVA 4IOFC 5DQDL 4CDHA 1YMHB 3KLSA 4G6JL 4LLDA 3CPLB 4FXLA 2I60H 1I7TA 2FJFA 4JG1L 3T0EB 4JHZA 2DJSA 2PTTB 4XB8A 3VRIA 3DTXB 2BOCA 4ORGA 1FG2A 3U9UA 1TENA 3GMOB 2GCYB 5HHVL 5CJQH 1IC4L 4NIKB 1CXFA 4M7KH 4X4XA 4N0UA 4K7FA 4L8DA 4K3DH 3WHE1 2A73A 4F80A 4NOBA 4L5FH 4Y19D 1EFXD 1I9RH 4IOIA 5BW7C 1D9KD 5IEKA 2FBOJ 2DQTL 4AEFA 4KXZH 4YE4L 3VFMA 5ANME 4PRPA 3HE7A 5MEPB 4GRMA 1FO0L 4MDJA 3B8YA 2DWEA 5J6HB 4PRIB 5DRZA 4MVBD 5HHMD 3B9VA 5DK0B 1KJ2B 3FB6A 1MCHA 3QG7H 3VA2C 3ISWA 3T8XB 5I9QC 2X4QA 1UKTA 3FT2B 1ZS8A 4TTDC 1UGNA 2VABB 4N0RA 4E42B 1KG0B 3FQNA 4LQFL 1EJOL 1I9IL 4NRXA 4QRSB 3U6RB 1S7XA 1FNFA 3E6FB 5DR5H 3WE6A 5SWSB 3BZFA 4X9BA 1ZA3B 5JXAH 3HLAA 2IJ0C 4UIKL 3IDJA 1WCQA 2XICA 3RBGA 3MOBH 3JVGA 1LP9A 3QDGE 3GSUB 5D2LF 4H0HB 2ADIB 4O2EB 4RMUA 5DD0L 4RCAA 1JHKH 3X3GL 1JZ3A 4Y4KC 3BI9X 5L0QC 2OLDA 5DJ6A 3GRWH 3BPOC 4OCRH 3UZVB 2VLME 1KB5L 2HJKB 4HX1A 3V9FA 1RZ8B 2E9IA 3N0PB 4ZTOL 4KQ3H 1IGJA 3L3JB 4HK0B 3HNVH 1L6XA 4ZFFB 5T1KA 2NXYD 5IVXF 1XGRB 2FECL 2GYSA 2PTVA 4MS8D 1XR9A 3Q6GH 2K9UA 3UPCA 3RWEA 3DV6B 5HBBA 1H3PL 3S9DB 2DKUA 3RHWK 3D2UD 2RJMA 3NIGE 5F96H 3QFJD 4G6ML 5DFTA 2XTJD 3ZDYF 4N0FB 2PYEB 1CG9B 2F15A 3SKMA 2VN4A 3CDYA 3VH8G 3DV4A 1KJMB 3AROA 2IGFH 2GJJA 3OKLB 3U2SB 1U95A 5FUCC 1FL6B 3ARFA 4POYA 1DFBL 5I0ZA 1JE6A 4AL8L 4HH9A 4JFXB 4H5SB 5BS0E 4A6YB 1P5UA 4DN3L 4Z5RB 3U7YH 4QRPB 2YD6A 2UV3A 4O5LH 2BDNH 3LHPH 4F7EA 4NM4H 5IHUL 3MLVL 4NO3A 4QWWD 3GJFH 1C5CH 1L4IA 4OBRA 1MJUL 2QLVB 1AR1D 5AAMA 2JELH 4IEFB 4OD3H 3TA3D 1FLTX 1IAKA 3RTQB 1Q72H 2NQCA 3MRLB 3D1MC 3W11C 4PGDA 1PQZB 4N0CC 3RVVC 2N7BA 4KKCD 3ETBF 4WTZG 4JEGB 3O2VL 1OVZA 2WINA 1E4JA 2R0KL 4JZJC 4TVPD 3AU1A 4RGOL 3V2AR 5EIQA 5FGBA 4FQ2L 3RWGA 5I17B 3HFML 4PB0H 3VXQB 3PWLA 3ZKMD 5TPWH 4F7MB 1ZTXH 5KTEL 4ZYKB 2EZ0C 2R4SL 4CNIB 1FYTD 4HS3B 4JPWH 5D6CB 1CE1H 3L1OL 2VDQH 1N0XL 4H25A 4MMXC 1JHTA 1FZMB 3A67L 1QP1A 5HPMA 2ESVB 2YMXH 4TPRH 2VDPL 4X98A 5GRUH 4OZGB 1DQDL 4YDIL 1AXSA 5E1AB 4EXPX 4JQVC 4F2MA 1QD0A 1CICB 2RQ8A 1ZHNA 4QHLB 1IM9B 4PJDA 1D7FA 3B9KD 3PGFH 2MHAB 3O4LA 4N1HB 3WS6C 3N1MC 3WKNA 4ZNCD 3DX9A 4P5MB 2QQQA 2BSTA 4DGIL 5IGXH 3S5LG 1A4KA 3MNZB 1PKQE 2QV2A 2FWOA 3GI8H 1TJGL 4FNLL 3MV11 5IMLB 1L7TL 2DM3A 5F3HB 1HWHB 1A6AB 3IRZA 3PL6C 4FQ1L 3X11B 4QXGH 2V2WB 1UH3A 4M4PA 5EO9A 3CFCL 3GDBA 1G9EA 3QJHB 1BJMA 1BQHG 1HNFA 4N68A 4PRDB 4PJFE 7CGTA 5GGRB 2B7DT 1W72H 3ARGB 3BDBA 3HZVB 1KTLA 2AJXH 4EI6A 2VZUA 3MRQB 2XQYK 2R4RH 2UZYB 1FZKA 2WUBH 2ICES 3D25B 3FN0H 5KZCB 4PJXB 1DE4A 2QL1A 1EEUA 3CNKA 4GJTB 4P2OC 4KC3B 4JFZH 5HHOA 5DA4A 1DEEB 3PJSB 2A77H 3NIDE 1N2RB 5C0CA 1A9EA 3CDGB 4YHMH 1T1ZA 2VOTA 1WWAX 3T77A 1RUKL 2LU3A 4LIQE 5DEFB 3UJTH 5FUZH 1IKFH 3QDGA 4ZUUA 3CFBB 4X7EC 3L7FA 3RL1A 2IPTL 3HRZB 1OAKH 2D7TH 1RZFL 1RD6A 1AFVH 3BH9B 2C3GA 4XNUL 3MQIA 1FIGL 2H2PC 4O2CB 2MPAH 1KJ3L 5EZJA 1S7SA 4IDLA 3TBWA 1RUPL 5FHBL 3QEQB 3KJ6L 4I9WE 2VLKB 2MJWA 2RR3A 3WN5C 4JRXD 4M9OA 5EZOL 3TJHC 4OZIB 5TDPB 1PY4A 2CGRL 5EOQL 1TDQA 5EBMA 1KTKE 1DJSA 3PWVB 1RURH 1BGXH 2B1AH 4PREB 4IDJL 1W0VB 3U30B 4K3JH 2ADFH 2GT9B 5GSVA 1ZLSL 4ODXB 5D1QB 1L7IH 2ARJQ 3EGSB 3RNKB 1UM5L 4AENA 2OR9L 2F5BL 1AXTL 1DUZB 4OTXH 5CIPH 5I1HH 4QXUH 1ES0A 3C5JB 3MLRH 3MLZH 3FKUS 3BFOA 2QQLL 4KK8D 2XRAH 3WFHB 4ZFOB 1U92A 4MDIB 3ULVH 2GCYA 1ZHLA 2MMXA 2FJHA 1ZV5A 3P9WB 2HKFL 4G6JH 1LEGB 3N85L 1YPZB 2FO1A 4AY0A 4NN6B 4E41E 5FM4A 3QDMB 5D7KD 2XKNA 5EO1A 1I7UA 4JG1H 4HUWA 4ENEC 4GG6E 2V7HB 2R9HC 2WWKO 3SOBH 4XHJD 4M7LH 4XAKD 5HHVH 1IC4H 3T2NL 4F33B 3PV6A 4WGWB 5ISZB 3LQZA 3H3KA 2CLRB 4P9HH 1T7XA 2VH5L 3FJTA 2XY2A 4U31A 2VDKL 4U6TA 2D3VA 2NY0D 3MCLH 1J5OH 1KJ2A 4Z7NE 5I16B 1FV1B 1YY9C 4YE4H 4MA3A 2E9JA 3NBNA 3JSSA 1FO0H 3UTPE 3EYQD 2UWEE 4Y2DA 2N56A 5EBWB 4HQQL 3VFOB 1XGYL 2H26B 4E42A 1CR9H 4X5XB 5CS7A 1KCRH 1JYNA 1JNLL 5F7EL 1U8HA 3U6RA 4H1LG 2DM7A 5I66B 2VWEE 3EYVB 3GHEL 1BQSA 3VI3F 4P3CL 1NMBH 5T3XD 1N59B 4C58B 2ZOKB 3V0VB 5EZLB 1NBZA 5ESVA 4LQFH 3VXPA 1EJOH 4NUGL 3SDCA 1DLFH 4U7SA 3EHBC 4HS6A 1A6VL 4GMSL 1UEYA 3DYOA 4UIMB 5EPMA 4BZYA 3CLFL 1GPOH 5HJ3A 4UIKH 3MLXL 4Y88A 1AHWC 3MSPA 3LEYL 5HYQA 1YMME 1PKQA 5IOPB 5DD0H 5F3BA 3LKSB 1BVLB 32C2B 3DMMA 5D9SA 3ESUF 3X3GH 2IAMC 5HHNB 1AGDB 1S9KC 3L5JA 4CMMA 4TSBL 1UADC 1KB5H 1YNLH 4ZQKB 2X89A 2YPKB 4L8BB 3TC9A 1JGVL 1A7RL 2NPLX 4ZTOH 3OKYA 3RWIA 3CFKA 4ELMF 3V6OC 4HFWB 5LGJB 4JN1L 5E9DE 1F4YH 4FS0A 4KDWA 3H8NA 5ESQB 3H0TB 4A6YA 1J18A 4Z5RA 1RU9L 4HKXA 2XPGA 3BWUC 1OAUL 2Z8RA 4O4YL 2H9GA 4OB5L 2KH2B 3SDXB 2O5XH 3WBDA 1T20A 2IANA 4KJQC 1UKQA 3TH3T 4F58H 4GLRH 1DFBH 4EN3A 4F15C 3E3QC 1VGEL 3U0PB 2JCCE 4DN3H 1W8NA 3PWPE 4LCWE 5GS0C 3CSPA 2ADGA 5ID0A 4P2YA 2MCG1 3S88L 4LP4A 2PO6D 3QUXD 1KELH 1NCDL 1CD8A 2OTUB 1UWGH 5IHUH 5IB4B 3UPRA 3MLVH 1DQLL 5BZDB 4Y4FA 1IAOA 1MJUH 3ARSA 3O3UN 1JGDB 4UT9H 1CFNA 3B43A 2HFGL 1H3WM 2FECI 2QSCL 4PJAA 4LSDA 1S9YA 3BUYB 2AJ3A 4J2XA 4WI3A 1AD0B 1UWXK 1P2CB 3G5VB 5HI5D 3G5ZA 5L7XH 4WI4A 4Y2OA 3RGVA 2IWGA 1ZLVH 4RGOH 1T0PB 5IESL 4M6ML 4JANB 1OP3H 2VO5A 1U8KB 2JLLA 5FYJU 2VKXA 5MENE 2FSEB 4PBVC 2PTUA 1N7ML 1WCBB 2NNAB 1PG7L 3C8DA 2JJSA 2NYYD 1IC5L 2J4WH 4Z7UB 3BH8A 3QH3B 4YHKH 1P7KA 4ODWB 4FQCL 5DYOA 4K8RC 1N0XH 4X7TA 2PW1B 1C12A 2VLMD 4YBQD 2P24A 4LSUL 3A67H 1TPXC 2EDDA 3IDGA 3O3AB 4ZO8A 3O6FB 3MRMA 2WQRA 1DQDH 3FTGB 4LSSH 1AKJA 1X7QB 3QDJD 4AQOA 5F7DA 2R2CA 1RI8A 5CD3B 5ILTH 1A0QL 1CFBA 5DJZA 3LKPB 3P9LB 4GKNA 1ORQA 1C1EL 5CEYA 4OFDA 2D7QA 1M4KA 1KTRL 2ZSWA 3C5ZC 2F58H 2NY3D 1S9XB 3P9MA 4DGIH 4HAFA 3V5DB 5E5MA 2A83A 4XCFL 4JFDE 4FNLH 1T1XB 3C60A 1XF2A 1FP5A 1BHGA 1NCNA 2ADJB 5ALCH 1JGEA 3IXTB 5BS0D 2G5BB 4KRLB 2R56L 4LDEB 4YAQA 1TMCB 4LDLB 4P46B 5BRZD 5ECJE 1A1MB 1H0DB 2X09A 5EC2B 2H6PB 3O8XC 4WW1A 4K2UH 1R3IH 3S96A 4UQ2A 4GBXD 3CFEA 5DI8B 4OFPA 3MC0A 3KPOB 4ONGL 5FCUH 3HZMB 4LDOB 1C5DA 3QO1A 1PFCA 5KVFL 4RAUB 1S7WB 1CF8H 4PV8B 5EC1A 3O4OC 5B3JF 2CJUL 5F9JA 2WIMA 3TVMD 4NP4L 5JDSB 3QDHA 4PJ5B 3I6GB 4GRLC 4LRIC 4O2CA 1QEWA 4PRHE 2VERN 3BMVA 3VWKA 1BM3L 4JR9L 4KWUA 3RWFB 3QEQA 5BV7B 1RUAH 4M7JL 1YMMA 1SBBA 3HI6L 1A1OB 3ME0A 1XR8A 5TDPA 4WI5A 3DUUA 3CZFB 2IPTH 4LHUD 4XVJL 4LNRB 4HS8H 3PWVA 2AXGA 1FNEB 1YC8A 4XNUH 2JIXB 5TF1L 5E6IA 3MV8B 4KROB 1KJ3H 1CWVA 2D7MA 4NN5C 5FHBH 3K80A 2OQJB 4HF5H 1JNHB 4YBLC 1VACB 3VCLA 3NCCB 1KEGL 4HUUB 3HAEH 3LPGA 2ZG2A 5EOQH 5FHAL 1SVZA 5E9DA 5C0BB 3S37X 3CDCA 4IDJH 3RAJL 1DQML 3LB6D 4GAYB 4ZSOB 2Q8BL 5GS0L 1UZ8A 5IV2B 4HWBL 5SX5K 2JB6B 4YGVB 4HZLB 2WUCL 5D2NA 2FHBA 1B4JL 2OR9H 4HULB 2F5BH 2FR4A 1AXTH 4F3FB 2C7UA 4Y16B 3O41B 2AQ2A 4DZ8B 1MHCB 4R0LB 4MQXC 3V4PL 1QR1A 1SVCP 3W0WB 5E03A 2EYTA 1EK3A 3D3VA 3PWPA 1LWRA 4X6DA 4P3DB 4LCWA 3ZDZF 3AS2A 4UOW0 3F7VB 4JFOA 5E70A 3MOAH 1OAZL 4P4KD 1JPST 3CXHJ 2MQCA 3N85H 3JV6A 2CLRA 3ZZ1A 4IS6B 4KJWD 4PTUB 4F9LA 5E99H 4J3OC 1WTGT 5IJKA 1QFWI 3H3PL 4ODVH 5I16A 1MAML 3OG4B 3T2NH 4U1IB 4PRNB 2XZQH 2ITDA 4LLYB 3RX5A 1GSMA 5B38G 5C09D 4R4BB 2NY4D 5D7JB 1FFQA 2Z93A 5I8EB 4KMTL 3P73B 1ZSDA 2EXYC 3TZVB 2BX5A 3MRGB 1MFNA 3BP5A 2BNQB 5J4MA 5E95B 1NCBL 3GMRA 1UVQA 2Y1VA 4HXAL 5IQ9B 3ZL4L 5KG9A 4Y5YA 4HBCL 2ZOKA 3L7EB 1W72B 1EO8L 1ZWIB 4FQXD 2IPKA 1I8IA 5CJOL 3H3BC 1IGYB 5F7EH 4MQSB 1OARL 2FYYB 4G43B 5T1LD 4PPTA 1I85A 2BFVL 3HPLB 4I2XE 4P3CH 2VLLB 4PJ8A 1JPFB 4FTVB 3R8BB 3U4AA 3QRFM 1NMCC 2DLIA 1NGXB 4X6BB 1EH9A 1WEJL 3VFTA 2P5WD 4TULL 4HC1L 4LBEB 1IL1B 3MXVL 3ARDC 2CDGA 4JY6B 5E5RB 1A6VH 1AGDA 1CD1B 3BD4A 3TV3L 4FABH 5F6IB 4MA1C 2LVEA 1MJJB 5IW6B 4JN2A 3UBXB 3MLXH 3QUZD 1NJ9B 3BKML 4P2RD 3LEYH 4ACPA 3LZFH 3NIFE 2HTKD 4JFEB 1S3KL 5IIEA 1XIWB 4X4ME 4IRSC 4QTHB 2Y36H 4PJEF 3G04A 4JFDA 1ND0B 4PGJA 5GISL 2OZ4L 5MEQA 4PG9A 4EI5D 2CO7B 2ZJSH 3MRPB 2AJVH 5IFAH 2WBKA 3MNVB 4R4ND 3GSOA 3OBAA 2NW2B 5F1NB 4JVPA 3UYPA 1A7RH 2CO6B 4K9EL 4X6CF 2W9DL 3T4YB 4G6KL 5D5ME 3T0VA 3QJFA 1UXWB 1K6QL 1FZOB 2ZOLA 5DURD 3S35H 3SDXA 4LGPB 3V7MA 4U6HB 2OI9B 1BVZA 2W91A 4KTEL 3OKOB 4E41D 3ZDXF 1D3CA 3U0PA 4BELD 4LCYA 4DW2H 3I50L 1JI2A 2DS4A 4N8VG 1CGTA 4H0IA 4KUZL 4PV9B 1YDPB 2BHUA 3VMOA 1PYWB 1AD9A 1OAUH 5KBNC 4TUJB 1U8LB 4M4RA 4M1GL 4OB5H 3KPRE 5EUKA 2XV6B 1A7NL 1GVIA 2Y06L 1ORSA 5DVNA 1O0VA 4BK5A 4RA0C 3EOAA 4PRHA 4HJ0D 3VFVA 5I1JL 1PBYA 2V7NA 4JKPL 5C0GA 4Y4HC 3NVQA 2BVQB 3RZCD 4UT7H 4DFIA 4I4WA 2NY6C 4RDQG 3BVNB 5C92A 2FB4H 5K9OB 1NCDH 2ITCA 4JPVL 3OGOE 1AD0A 1XZ0A 3W9DB 3TF7C 1DQLH 4NNPH 3FO0H 4U1HA 2GAZB 3UTPD 3AMLA 4P9HC 5DUBA 2P7TA 4WJ5B 2QSCH 3B83A 1FN4A 3BQUD 3L95B 4I0PC 4V1DD 4YHNA 5FA3A 3F7QA 5D7LD 2X4SB 4NO0B 5I1EL 5HPOA 4LEXL 3R0MA 3WIFB 3WFEL 3CXHK 1LO5A 1F90H 1WCBA 1LO4L 3THML 1ZVSA 3HE6A 3G5XA 2DLTA 3BN9C 1J12A 2YD9A 2HT3D 1C16B 2X42A 5IESH 2R2EA 3CX2A 4XTRD 3P77A 3L9RA 1QRND 4ZUWA 4P3WA 1S7VA 4X7SL 4LCUB 4PUBL 2IQAA 2AEWA 2ZCHH 4FQHA 4IRZL 4YHIA 4YJZL 2NZIA 4UDTB 3BUTA 4ODUB 1FVEA 3KLHC 3MUGB 3GI9L 1ERNA 4W4NA 2VR4A 1A3QA 4FQCH 5FOJA 3CXDL 3SJVB 4ODSL 4XZUA 3LKPA 4P5KB 2I07B 2BVUA 2FEDD 1HSBB 2CMRH 4YHLL 1N6QL 4LGRB 3KDMB 3BP6A 5JLZB 3ILQC 3B2UC 5HY9A 3V4UL 4OZHA 3QO0B 4FZ8H 3MODL 2BY2A 4R8WL 4UU9B 4HIJA 1Y6MR 2ADJA 1C1EH 2D0GA 1AGCB 3IXTA 2FX8L 1SYSA 1V05A 4LF3A 3FQTA 2GTWB 1KXTB 5HYEA 3RRQA 3VFSB 5DMGC 3QAZB 5FYKD 4PJBE 3MV9D 1KB5B 5IVZB 3KPQB 2HH0L 3HZMA 4OF7A 2VXVL 2WBJC 2OTWB 2WP3O 3CFJA 1I1AD 3BOVA 3PGDB 4NQCB 4PV8A 3BAEH 2Y25A 4MJIE 2MQ3A 5AYUL 3TCLA 2MFNA 4FFZL 3HN3A 4OZ4B 4P48A 3HG1B 3TYGH 4ONGH 1MFBL 5ALBH 5FO9B 5BO1H 2Z31B 5HYIA 2V2XA 4M48L 3NH7H 3RWFA 1PAMA 5CGMA 5KVFH 3UCRA 2Q7YB 3T3MF 5JPNB 1IEHA 1CN4A 1Q9OA 5CUSH 5DJXB 2DTSA 2QSVA 2BC4A 4QRRB 2A6IB 4JR9H 5CJXC 1OTTD 1BBDL 1BVKB 5CSZA 2XN9E 3QPXH 4M7JH 1M7DB 2YPVL 3L5IA 3KXFA 4EDXB 3QI9B 1D9KC 5MEND 4MCYB 3QHFL 4E5XB 5TF1H 5DQ9A 5MERB 1XCTA 3MNWA 4OLVH 3SDAC 3QUYA 3UYRL 1YC7A 1H5BC 5IUSA 3SKOB 1FJ1A 1MI5B 3MROA 5I76B 5D5MA 5FHAH 4WUKH 4XPBL 1F4XL 3VDBA 4ZFZB 5EU6B 1DQMH 2RFXA 3NZHH 1SBSL 1I4FA 3B5TA 4TUKL 3BRFA 4WO4D 1A9BB 4HWBH 5FKPB 4NRZA 3UC0L 5FOBB 2NMSA 4Q9CA 2WUCH 2QQKH 3FRPA 3S5LB 2I27N 4HPYL 4KHXH 1G9MH 3KPRA 3FB7A 4J3XA 2IQ9L 4D9RD 4KRPB 5D2LE 3T04D 3V4PH 4PTUA 3DPBA 4LSVL 4D3CH 1LD9A 1YN7B 1JI1A 2KUTA 3BEVB 4Z78A 1MCKA 1FCCA 3FT4B 4GMTH 1OAZH 4U1IA 4MJ2A 4HXBL 5E7BA 1G9NL 4MB3A 3V95A 4MA8L 4R4BA 4MZ2A 3EUUA 1WZKA 2W9EH 5E08L 2XNAA 1F8TH 5IVXE 3WDIA 4L8SC 3DUSB 1CBVH 3H3PH 5EWIL 5JORA 1TCMA 2CLZB 1WZMA 3AS3A 4MS8C 5E1HB 5IB1B 4JFPB 5M95B 3ZDYE 2MOVA 3MRFB 4BKLB 5C0EA 2AV1A 3TCXA 1LE9B 2C3HA 3K81A 3SE9L 3MREA 5I9QB 5DJ0A 4KMTH 1CDCA 1K4DA 2LV4A 3SKJL 1GZPA 1U3HA 43CAA 1BLNA 5FF6B 4JRYE 1NCBH 4RWHA 4PP1D 3E2HC 1AE6L 4HXAH 3ZL4H 2Y5TA 3O9WA 4NZTL 4FTVA 4HBCH 1AC6A 2OXHA 3L3GA 4QEGA 2B0SL 3MV7B 4KZDL 1ZHKB 1HQRA 2Z8VC 3IJSB 1OARH 1JNNL 4TVSa 4JB9L 5I15H 4QWWC 1EGJA 3NN8A 3UDWC 3S34L 4MHHI 1HSAA 4FQIH 1J11A 3BPOB 3CVIL 4WHCA 3TA3C 1WEJH 5F7FA 4I3GA 3U46A 3VGDA 2OBGA 4PJIA 1BFVL 1HE7A 3TV3H 2MQ0A 4Z76B 1SM3H 3PGCA 2N7AA 2DQGH 4OLXH 2VLJE 4APQC 1DN0A 4HJGB 1S78D 2DQFA 4NUJB 1HH6B 5I1KL 2M8XA 5EU7C 5LAXB 3NPZB 1KCVL 1BOGB 4UV4L 4M1DL 5ACZA 4X9FA 5J1AA 5JQ6L 1S3KH 4G6FD 7FABL 4PJBA 1FZOA 4F57L 2OZ4H 5E8OB 3ZKMC 3AMKA 4NKOB 4IMLB 3T0EE 4GQ9L 1XGPA 4G9FA 3K7UA 4HUXA 1DL7L 1HXMA 3C8KB 1IEBB 5DS8B 2DYPA 1D5ZB 3MUY1 1KCUH 1T4KA 4MJIA 5EOCL 4CMHB 1FE8L 4I18B 4Z7QF 1K6QH 4I13B 1JUFB 4MAYB 3MACL 4HJJL 5LJYH 3H9SB 3VFUB 2ORBH 3F7RA 1YQ2A 2X10A 1RFDL 4U0RB 3I50H 1NDGB 4F7PB 3X12B 4KUZH 2ZCLH 4RFNC 5GS1A 4RFOH 2IH3A 3CH1B 4JM2B 4NJ9L 1AP2A 4HIEB 4M1GH 3WD5L 2VAAB 2EYSA 4TUOB 3B9KC 3EDDA 2W0KA 1JWUA 2BNRA 3WSQH 2OSLA 1MWAH 2Q3AA 2HT2D 1NPUA 4JKPH 2FIKB 4I77L 2ICEB 2XN9A 4QRQB 3AXLB 4R7NA 3KPLB 3OR7A 3FQWA 4OI9A 3WIFA 3LCYA 3TO2A 1XGUA 2DM4A 4MNHA 3FAXA 4H1LB 1A1NA 4YUEH 1VEOA 1F4HA 4P5TB 1AO7D 2E6PA 1WBYA 1P1ZB 1LK2A 5B39B 4EDWL 3KPSB 5CCKL 1Y0LB 3MLPA 4LEXH 3WFEH 4Q6IB 3T1FA 1AGEB 2E7BA 1LO4H 5CGYD 3THMH 1HDMB 3MRNB 4XBPB 3RKDD 1AI1H 4ONFL 2QTEA 2D7OA 5INDA 1PG7X 2BZDA 3SJVA 2ZNXA 4P5KA 2E27H 4X7SH 3HB3D 4Y1AB 3D39A 3C08L 4IRZH 4KKBD 5D2LA 4NPYB 1VDGA 1FVDA 4LARL 2EEDA 5BVJA 2CKBH 2F9BT 3VH8A 5GS2D 3X14A 1ZLUH 1Y6KR 4P2QE 4YPJA 2XKUA 3WXWL 3D0LA 2W07A 3CXDH 5IT2L 2FD6L 5F21B 4HDIB 3T3PF 1UJ3A 2EIBA 3WUWG 4R26L 3TN0A 3UAJD 3QEUB 3TT1L 2ERJB 3WNOA 1CIUA 3MRBB 1FL5A 4YHLH 5J9PA 1N6QH 5IVXA 1OAYL 3MYJB 3RWHB 1F3JA 4HCRH 4X6FA 2HJFB 1A6TB 4LRNH 3KPQA 3MODH 1N8ZB 3EYSL 4R8WH 1JN6A 4QCIA 2C1OA 4PJCF 2FZ3A 1BBJA 5C08D 4QRPE 1RUML 2GK0B 4UT6L 4KQ4H 2QADC 15C8L 3S98A 4L9LC 3W81A 2CIIA 5C0IA 4P2OB 3G9AB 2HH0H 4NZJA 4OGAD 1UB5A 2VXVH 1JTPA 3GSRA 1EEZA 2HA1A 4WTZA 4XXCA 1AJ7H 1NFDF 4KK8C 4RGND 4Q9RL 4RQQA 3RDTB 1V7ML 1I3VA 1A8JH 1PSKL 3B2VH 3HE7D 4I48B 3DVGB 3Q2CA 2DL2A 3STBA 2VDLH 5J56B 5I75B 1VFBB 1E4XH 4WY7L 4ZUSA 1KIPA 3IS0X 1WBXA 3FCTB 5HHXL 4N5ED 1T89A 5F44A 1MNUL 1M7DA 4NN7C 3KLAB 3B5GA 4U49A 3P30H 2NX5B 3ARZA 4OF3A 4FXKB 4XHJC 1KLFA 5KSAA 1YEHL 4NSKB 4PB9L 1F11A 3BZ4B 5GRZA 5CEZE 3PWNA 3S3JA 1BBDH 4P57B 4LKCB 4J12A 4Y5XA 5ERWA 3MLSL 2NY0C 5EO0A 1WSST 2YPVH 3MLYL 3TPUA 1NLBH 3EFDL 3VI4F 3ARFC 1XGTB 3UZQA 4CGTA 1D5BA 3RPIB 3QHFH 5T1MB 5KSBB 4OZGE 3UTQA 4BYHA 3NCBB 2R2BB 3UYRH 4DKEH 1H8OA 4LSRH 4X7FC 1R5VA 3S3SA 4WW2C 5FDYA 4MNGE 3BPLC 4XNMA 5D7IF 3VI3E 1F4XH 5SWZB 5D1XD 3VG0H 5C07E 1M71A 4WU7A 3W9EA 1EHAA 5SWQB 4YR6A 4TUKH 3REVB 4ETQB 4XPTL 3TJEH 2YRLA 3HC0B 3E8UH 1EVUA 4OIIH 3IKCA 4X8JB 4YEEA 1HIML 4O02H 1BQHA 1X4ZA 1MCNA 1B0GB 2ATKB 1OSZA 4HPYH 3P11L 5DLML 4F8QA 2AXFA 5DHVH 2CD0A 5BW7A 3QCVH 3GM8A 3WO3B 3MBED 4AZ8A 4KI5D 5DMIH 3GJFK 2WBWB 5J1TC 4FQQB 2Q86B 3QHTC 4G9DA 4QHNB 3QQ3B 1T66D 5ESAA 1YN6A 1AXIB 4Z0XB 5GXBB 4V2BA 4KVNL 1LK3L 5F7HA 2R1XA 5FYLL 4D0CB 4PJXE 1G9NH 1UACH 1HHHA 5FK9B 4MA8H 4OSUH 3CMOL 5D93B 2XKSA 3DRQB 1LE9A 2FLRT 4ELME 1H3UA 4X4YA 2DQUL 2IPUG 4LLMB 5FYKH 1IAIM 4W6WB 1I1FB 5EWIH 2HVKA 2B4CC 3GHBL 4LSQH 1PY9A 2UYLA 4F8TA 4JG0L 3SN6N 2NY2B 1R5IA 1QYGL 3BGFB 1MJ7H 5GPRA 3LKNA 1JYVA 4N9OB 4M5YL 4MWFA 4DOHB 4ISVA 5EFIB 1HHIB 3H9ZA 5ICXA 3T4AB 1NC4D 1G84A 5ADPL 4OZFG 4OFYA 4IIQC 2J8UB 5AG8A 2DJUA 4Y4KA 1AE6H 2WWKT 1H15B 4CDGC 1CLZL 1NEZA 3T0DA 3TO4B 4AH2A 4DZBA 2B0SH 4H8WH 5HI4D 5JA9A 1KFAL 4P2QA 1X5YA 2PO6C 5IWLC 2AXJA 2FHFA 1RK0B 3U7WH 1FL3B 3GMPB 3EYOA 1RZKC 2NZ9D 4HJGA 1ETZA 3SKNB 5LAXA 3TBTB 3ULUE 3EO1A 1EPFA 3EAKA 3LKOB 4J3SA 5J11B 1G6VK 3LS4L 4S1SL 1T80A 1FIEA 1X5ZA 3JV4B 4JY4A 3U0WH 3WDHA 4ZXBD 2I25N 1L0XA 1NUDA 3N50A 4R97C 2GTZB 2VZ3A 1A7BA 5H37H 3QEHA 4IMLA 4OV6F 1BQUA 3I2CL 5GGQH 4HUVB 3OKDA 4ZPTB 5DJAB 4UV4H 4M1DH 3CVHA 4N9GB 4PP2B 3S36L 5JQ6H 4JHWL 1G7MA 3C09C 7FABH 3CLEL 1ZT1A 4F57H 2DJ4A 4HGWB 1JUFA 1BX2B 2KKQA 1OD9A 4ZS6D 1F4WH 2Y9RT 4GQ9H 4XBGA 1YY8A 2I9TA 1OGAD 1DL7H 1SJXA 1RIHL 4F15B 2NYYC 1IM3B 5EOCH 2D03L 4MX7A 4N90D 5B22A 4X6EB 1RZJL 5ISZE 5C0RL 4PR5A 1G9MC 4C83B 4YBQC 2R1WB 2EEAA 2EXWD 4MXWH 3V52L 1RFDH 1QLFB 5I8OL 1KB9J 3HMWL 3OQ3B 3AXLA 5A16B 3O3BB 4NJAL 3QSKB 4JZJA 3S7GA 4D0BA 2BY0A 2X5PA 1RJZB 3VE0B 2IMNA 4PJ9A 2X4OA 5I1GH 2NY7L 5E6YA 4EEEA 4RISH 5DUPL 2PW2B 2EDFA 2NY3C 5F1SA 2C3VA 4I77H 1I8KA 4ZFGL 2BHYA 4NKMB 5CKGA 4Y5VB 3T65A 5C0JB 4Z7OF 4JRYD 3VGGA 1SEQL 2EKJA 3OKKB 3C5SB 3IVKA 1JHLH 3FL7A 4JFFD 4G80A 4S0SD 3IYLW 4HWZB 4WW2F 3LY6A 4MQ7A 5F9DC 2HFEA 4BQ6A 4FG6C 3QG6A 4L3EB 4EDWH 1LQSR 2EIDA 1HH9B 4Z7WB 5JOEA 5CCKH 4GBXC 4MNGA 1QSED 5AD0B 5EUOF 2C4FU 4KJPD 4KKAD 4OF8A 4JQVA 3BGMB 5IW1A 4NRYB 4QT5B 3JWNC 5C07A 1MCEA 1IC7L 5B3JE 1S8DB 2P4AB 4NQDB 2BY1A 2P8MA 1TPXB 2R2HB 1Q38A 5DFVD 4G42A 3NGBC 4QHUB 3UTTB 1IGMH 2FX9L 1MIMH 3MYZA 3DI2B 1U36A 2VLJD 3I9GL 5C8JB 4OF5A 3QA3B 4LNVA 1J05A 2WLZA 2B4CL 3PL6A 3VG9C 3LMJL 4WV1A 4JDZB 1ZOXA 1HKFA 1T0MA 3MYJA 4LARH 4XNXL 1KPVB 3C5ZB 2ENYA 4L4TE 1MCLA 3WXWH 2HFFB 2OJZL 4WWID 5IT2H 3VXMB 1J8HB 4KKLC 4EIGB 4M43L 3HC4L 3HI5L 3V6OE 3T0ED 5LCVH 1NUFA 2YPLA 3X13A 4R26H 5LVEA 3KS0H 4MCZB 4WUUB 4Y2DC 5BQ7A 1OM3L 2XWBB 3K74B 2E9BA 4DGYL 4ELMA 4YDJA 4LHJB 4RMQA 4P2OA 2GJ6E 3S8WA 5DGRA 3EYSH 5JNYA 3TFKD 1CGXA 1INQB 3LB6C 1E27B 3GKWL 5JMOC 5IB2B 1O5DT 4MJ6B 3R06A 2IADB 3VXSB 5GSRA 3UTZB 1RUMH 2BSRA 2A38A 4UT6H 2YXMA 4PLKD 5FA4B 5KS9B 3C6SA 1NUNB 2Y07L 1RZKL 4J7RA 5L9DL 4I0KA 3O4OB 4JGUA 2J8OA 1XCQA 5IG7A 4M7LT 4LVNC 4PRID 3Q1SL 1KIQA 2O5ZL 2EKSB 5IBTL 1T5WA 2BP3A 4GW4B 3ZDZE 5IHZB 2UY6A 4Q9RH 4GUPB 4QRUB 4RMRA 2Q1EA 4Z9KB 5HGGS 2PCPA 3IDMA 3L3IA 3WN5A 4P4KC 1CFTA 4MA7L 4X0KA 4BQ9A 1NAMA 3DXAB 1I9JL 4HKBA 3E6HB 2H1PL 4KJWC 5H35A 4OCWL 1JPGA 5C0DA 5EG6C 3MA9L 1M1SA 5HHXH 4J8RA 5SWSD 1MNUH 4G8GE 4NN5B 5KJRL 4KDVA 5GGSY 3CSYB 2FDBP 3K8LA 5HYJE 3UJIL 1P7QB 1G7HB 1TETH 2BVPB 1YEHH 3I75A 3DX7A 3K2UH 5IR1B 3Q5OA 1QQDB 2YBRA 1M05B 2BRRL 4R96B 1CTNA 4YPGA 3MLSH 5IEHB 1KB9K 5MP6H 1V3KA 4ZNEE 3NACL 4HKZA 4OQ1A 3LV3A 1H3VA 4UQ3A 5DDHA 1CFSB 1QKZL 3HS0B 3BX7C 3MRHA 3DVNB 3O11B 2WSKA 5L6YL 3U4EA 3F7PC 2LU7A 1WBZA 2ZCKH 4XC3H 2XWJA 1W0WA 1VEPA 1OCWL 4L4VA 5CILL 3MRJA 3BIBX 3IJHB 2PYED 3BPCB 3DURB 3ILPB 4YIQB 4S1QH 4UNVA 3PQYB 4RNRB 1CL7H 3SGJA 4J1UB 4XPTH 2AAVA 2AK1L 4CJ1A 4POUB 1NL0H 3HRPA 1ED3A 4NQEA 1HIMH 3NIGF 4YC2C 4XWOC 4BH7A 1S9WB 2BOBB 1JGUL 1HINH 1U58A 2FO4A 2Q87A 2XQBH 4YX2L 1OTSD 1T6VN 3DRQA 1VADB 4QRPD 1JK8A 2CK0L 3GNML 2GITB 4OCSL 1KC5L 1IFHH 4XCYB 5SV3A 3SDDB 2HTKC 1I1FA 3D69B 3MRKB 3MA7B 4M62L 2EDEA 3VJ6B 4EI5C 4KVNH 1LK3H 4D2NA 4R4NC 3S3PA 4C56B 4MNQE 5CBEA 4B7LA 3RTQD 1F58H 2DQCH 3D0VA 4X6CE 5KSVB 2DQUH 5E8DH 1FFPA 3SHSA 3UYOD 1R3KA 5HVHC 1P4LB 3O2WL 1X5XA 3GHBH 4OJFH 3T0BA 3VD4A 4XH2B 1Z9SA 1YNTB 3ZDXE 4GW1A 3L5WB 2ZUUA 1I7ZB 1QSFB 4KTDL 1GZQA 3LRSA 3S4SA 3WNPA 1OP3K 1MLCB 5HHQB 1KJ2L 4J4PD 1NBYA 4M5YH 4Z95H 5DMKA 3O2DA 1ZGLP 3LS5H 2DBJA 5C3TA 3T2OA 2NY5L 3CC5B 1AHWA 3FO1A 4JREC 3C2AL 5ADPH 3MV8E 4XGZA 3NMEA 5F9OL 1A21A 2X1PA 5I74C 2EDNA 4U6YB 2IAMA 1GC1L 3IU3A 2EDQA 4LKXA 5LWYL 5I1IL 1BWWA 3OJDA 3RZCC 5C0AB 2X4NA 4LSTH 2IG2H 4MA1B 1EIBA 2IC2A 4UILL 3AS1A 5D4QA 1IJ9A 1KFAH 3KHOA 4KK6C 4L4TA 2ESVD 3STLA 1OGTB 1Q1JL 4R3SA 1GHFL 3V6OA 4ZUTB 4HUVA 1CICD 1BP3B 4ZPTA 3CCHA 3FRUB 3H6JA 3NAAL 5D96C 1RULL 1IM9D 2DD8H 1FDLL 3LS4H 4S1SH 1FFOB 3HZYA 4G8EA 4OCMC 2GJ6A 4LHUG 4QXTA 2VWEC 3RVXD 2VN7A 2G75B 4PGCA 1RJCA 1CXIA 1PEZA 2Y6SD 3I2CH 3LKQB 3Q3GB 4F7CB 1K2DB 3ORJA 2C3WA 2HT3C 5DQJB 3TIEA 2X4RA 3O3EA 4JHWH 4JLRA 5ITBL 4PRAA 5IMOA 5L2KB 2XIDA 3W5NA 2UY7A 5HVGB 3P4NA 3ZE1F 4WFHE 1IGCH 2JB5H 4W4OC 1FZJB 4GRWH 4OV5A 3DX6A 3WLBB 5FAAA 2P5EB 4BQ8A 2CIKA 4F7TB 3ARGD 5B38A 1HYSD 2O61B 1I8LC 2F8XC 4Q2ZA 3L6FB 2DQEL 2F54E 2D03H 5JHDB 5IF0A 2XXMB 4Y4HB 4A6YL 5C0RH 5I1CL 1CXKA 5E6IC 3WJLC 5KZCD 2BERA 3PHOA 3V5HB 4IJ3B 3SCMD 4XXDB 2FEDC 4PJFF 1T22B 4XNZC 5FO7B 2PXYB 2SEBA 1ZT7A 1U8JB 3BHBB 5AYQA 1X5HA 4MLSA 1A02N 2VLRE 1TQBC 1IKNC 4G8GA 5E4EB 2ZUWA 4NJAH 1GGBL 1R3JA 1NBVL 3C5SA 5HYJA 4ZOBA 1YYML 2V5YA 5FDWB 3RP1A 5CZVL 5DO2D 3M17A 2D31A 1E4KC 2NY7H 3NIDF 5DUPH 3REWA 1U8PA 1Q0XL 5L2JA 1P69B 1HH9A 5DJ8A 5C2UB 4MJ5A 3O6LL 1CIDA 3VXRB 1SEQH 1A2YA 3ABZA 3W2DL 3NCYP 4QHKI 4M61B 4JJ5A 1JF6A 2NTSP 3H9HB 1I1AC 2VLKD 3P0VL 3GSWB 5DJ2B 1RVFL 4RBPH 3V5KB 1ZGLA 2DIJA 3GM0A 1WIPA 1BD2B 4X9GA 3QIUB 2BSSA 3MPCA 5F70A 4S2SA 5BXFB 5T5NF 2HLAB 1LEKB 5D1QD 4NZUL 4O51A 3HI1B 4HGMA 1REIA 4F9LC 3ULUD 5FECB 5JW4M 4YH6A 1PDKA 3T3ME 1AGFB 3GRWA 3IDIB 1YEGL 5SX4I 2QKIA 1YJDL 3BWAB 4NKDB 4NGHH 4QF1A 1DDHA 1NC2B 4H8WC 3VXUA 5GJSH 1SJEA 2HFFA 1YYLH 4P23B 5GGUA 2FX9H 4XCNB 4QNPE 2NR6D 3IJYB 4JQIH 1VB9A 4YNYA 4OGYL 1OTTC 1V5JA 4JAMB 4PJEA 1URLA 5T5NG 4O58L 2RIKA 3NCMA 4KVCH 3AGVA 1QG3A 2DWDA 4GXUN 4N8VA 4KPHH 3WFCL 5LKNA 4XP5H 2LE9A 4OD1L 2Q6WA 4DVBB 3O8XA 2OJZH 3IDXL 3QUMH 2F53B 3QDMD 4P0DA 4AK1A 1HILB 2OL3H 5CEXB 3HI5H 3I3BA 4Y5YC 5E2WL 3MFGB 3EFFA 4MNQA 3STZB 2IADA 5IMKB 2X4UB 3B6SB 1KT2B 2VQ1B 4X6CA 1OM3H 1LDPH 3D85A 1KSRA 3FB5B 3QT2A 1U41A 3ZSSA 5ISZD 4YO0B 1JPTL 1I85C 1RJYB 2VDRL 2Q76A 4NQSA 3U36B 1JWSA 3C87A 3GKWH 5DTFA 3ULVE 1HI6B 1H8SA 4GW4A 4YDVB 4GRLA 4WO4C 4LRIA 5GGTH 5ABDE 3MRDA 3GJFA 3QNYA 1A6WH 4FQLL 3F6LA 5FO8A 4QOKE 5AG9A 1ZVYA 2Y07H 2ZG3A 3UXFA 5IW3A 1MCQA 2OMBA 1JFQH 3DVIA 3MR9B 4KJYB 3Q1SH 4Z7NF 5IBTH 3V4VH 3O0RL 4WIQA 3DGGB 1RZGB 4XVSL 4Y19B 2UWEF 4RX4D 5IFHL 4R2GB 1NAKL 5MEOA 4NFDA 4XPGH 5F7YC 3VMNA 4Q9QL 5BJTB 4TOYL 1M05A 1HWGB 5C6TH 4MXQC 5E2TH 1B9ZA 4QTIH 3BE1H 3MA9H 5HHPB 3ZE2F 3GGWB 3SDAB 3H9YA 2AK4B 2VITA 5GQBA 4ZPVB 3UJIH 3ES6B 4FHBD 4MD4B 4QHMB 4X7DC 4EUPB 2OX5A 1TCRB 5C9JB 5JIPA 3W82A 4OQTH 4NNXA 5T33L 3MMEB 3QNXA 5CP3H 5EORH 4HT1L 3QXWA 5A3ID 1EXUB 4GKZA 4PJHB 3K8MA 4G5ZH 3MRCB 1EAPA 3MRRB 4PP1C 2ZUQC 3WJJA 4YHOH 1G7LB 4RMSA 1QBLL 5T3ZD 1AY1L 4PGBA 5DK2B 2BY3A 1ZT4A 5I8KL 1J1OL 4Q74A 1B0RA 1UENA 3D48R 1NGYB 1KLGA 4NDMB 1G7JB 3ZYIA 4XX1G 4ZFOL 1TJHL 3GO1H 2AK1H 1BIIA 2AQ3A 3B3IA 4UNTA 2VLRA 4KGJA 1WGOA 3OPZL 3LH2H 2NY1C 2GJZA 2L7JA 3MO1A 1FORL 3FONB 3JTSA 3F8UB 4M8QB 1BQLL 4I3SL 4NOFA 3UTSE 1S78C 1U93B 3TNMA 4OCSH 3BD5A 3PHQA 1IGIH 1E4WL 3HG1E 1TNNA 3QPQC 1U2HA 5GHWL 2XYCA 5F1IA 2CLVB 2P47B 2NW3B 4UV7H 5HYSG 3ARXA 3L3OA 5LGHH 2DBLL 3QHZL 3HKFA 2P8LB 4IHOA 4U1SA 4ZAKB 4Z7QE 3SQOH 3OZ9L 5TQ2L 3FT3B 1R24A 5C6PB 3RHWF 4CW1B 2HKHL 1ZA6A 1CCZA 3O6KH 4JHBA 3KYMB 3ARDA 1IAIL 1KJ2H 3DX8A 2YXFA 3EOTL 3CU1A 1P6FA 4QY8A 1HHGA 4GAFB 4XCEB 3EDFA 3SDYH 1TZGL 1TZHA 2NY5H 2GUOA 3FO2B 2YC1B 3C2AH 2UVFA 3QIBB 2VDML 2A6KA 4IRSA 5F9OH 4AIZB 3QXDA 4PJ7F 1F6AB 4NO5B 5DJCA 1GC1H 2HN7A 1JZ5A 2HT2C 3EJYD 3ZHKA 1MI5E 2EICA 3FFCB 2I5YL 4KTYA 4APQB 2W38A 2FX7L 3L5XL 2CR3A 5GIRA 3WL9A 3CIQA 5HHME 4XMLL 5E8PA 3O6FD 2DICA 3OHXB 2I26N 1GHFH 3S35X 1MCIA 2GQHA 1KNOB 4LPTA 3PABA 4G8FB 4BSVB 1CQYA 5DJDA 5HI3C 5CIPA 1ZHBB 1FDLH 4JY5L 4FZEL 4HHAA 1V7NH 1DUYB 4YGAB 2XZCL 4WGVB 3RUGB 2HP4A 3OL2A 5GZND 4UB0H 5F7UA 2X4TA 4NKQB 1PD6A 1X6LA 4YZFE 1FAKT 1JCKA 5CGYC 4XPFH 5I8CA 3L6FA 1UB6A 5ITBH 1C5BH 3H7BB 4QOKA 2O5YL 4DN4L 3HUJB 1KIRB 2X4PA 4ZOCA 5LBSL 4FFWC 3FOLB 4P46D 3HB3C 3VFWB 3A0OA 2G9HB 3D9AH 4KKBC 2ZPKL 4P9ML 1KPRA 3QWOB 5DRNB 4IRJA 3BZEB 4MXVE 1J0YA 4AEHL 2D2OA 4A6YH 1R5WA 5JPMA 1JRHH 1NSNL 3WS3B 4I0PA 4JM4H 4DKFL 3UAJC 4ALAL 5E2VL 3LN5B 1IMHC 1MCWW 1NGWA 1VGKA 1U8NA 3QFJE 4PJ5D 3IDYC 1S9VB 2EDYA 1BOYA 4XWGL 2XTJE 3BIKB 4OCYL 1VPOH 1NBVH 2YK1H 1MRCL 4YFDB 1MFCL 2CDFB 4XC1L 1YYMH 2EE3A 3VXTA 4Z7VB 4PJCE 43C9A 5JW4Q 4R7DA 3N06B 1DVFA 5IKCB 3G6JB 5DJ2A 4ZUVB 1F02I 1DBAL 4LLDB 5IB5A 4YWGL 4J3UA 1PZUB 1I7TB 2JIXD 3N9GH 3O6LH 2FJFB 1BPVA 3MV8D 3G5YA 1BEYL 3RWCA 3VRIB 4CBPA 4ORGB 3ZSTA 4L3AA 4BZ2L 1MVFA 3U9UB 1BZ9A 1NFDE 4O2FA 1RVFH 4OKDA 3QRGL 4Q9BA 4X4XB 4N0UB 5C0BD 4L8DB 3QFDA 1WQVT 2P45B 3BP4A 2A73B 5BCAA 1CS6A 1DQJA 2PN5A 4OLEA 4IOIB 3GMNB 4HD9A 5KANI 4NZUH 3C6LA 1NCCH 5IEKB 3BD3A 1IC1A 5ADOH 3VFMB 3VWJA 3GB7A 4PRPB 12E8L 5ETUA 4GRMB 4N5EC 2LTQB 1YJDH 5DT1L 4MDJB 4Y16D 2DWEB 3UMTA 5C2BL 5DRZB 5CBAA 5I18L 3FZUC 2BJML 3BW9A 3W0WD 3FB6B 3JTTA 5CEXA 4NO2A 5EU3A 2XQYG 5IMKA 1QUNA 2X4UA 3BKJL 2X4QB 2WBJA 2W92A 5ICYA 3I02A 3VI4E 4AEEA 1U3HC 1ZS8B 1KUMA 3NCJL 3WFCH 1N64L 4ZO7A 3NFSL 2FJGA 1VA9A 3H9SE 4OD1H 4P59H 4OLUH 2OS7A 3QP3A 3IKKA 2JK5A 3FQNB 3IDXH 3DNKA 4U0QB 2QADB 4NRXB 3BXNA 1NCAH 3WE6B 5E2WH 3BZFB 3HLAB 4KI1A 5GGVY 5IB3A 3IDJB 1MQKL 2F54D 5D7IE 1K8IA 3V8CA 1LP9B 1GGUA 3OAZH 2DMBA 1WZLA 1EA9C 1JPTH 3P4OA 1FNGA 5D7JD 3TBYA 1JJUA 2Z8SA 2VDRH 4PD4J 5D1XC 5KW9L 2H45A 5EN2A 4EXKA 4S1DC 5DJ6B 3TZVD 4GFTB 2BNQD 3CGTA 1BWMA 2Y23A 4HX1B 3SE4C 2C5DC 4B53A 4FQLH 3UO1H 3E0GA 4GRWB 5CJXA 5J12C 5B3NA 1IGJB 1EFXA 4Y19A 1LO3H 5DD5L 5TGBA 5CWSA 2F5AL 1R3LA 5TQ0L 1XR9B 4NBXB 1D9KA 3GSQA 1NCUA 3RWEB 4M93C 3MBEC 4LVOC 4RZCA 3O0RH 1FCGA 4GG8A 1X9QA 3ZT6A 2EDBA 4XVSH 3ARPA 3GFUA 3SKMB 3LQAL 1H5BA 3DV4B 1CLOH 4NBYB 1TJIL 5C0NC 1NAKH 1U95B 4TOYH 1TCRA 1YNKL 3ARFB 2ZKHL 2ENSA 1PX3A 4HH9B 2DQJH 4U1MA 1KJVA 1Q9WA 4HMCA 4WW2B 4OCXL 3DOSA 4JFED 1XIWD 4JZOB 1MCRA 4NO3B 2NXZB 3WUWA 5CHNA 3R0NA 2P42B 1CE6B 4HT1H 2EC9U 2OK0L 2JTDA 4DTGL 1IAKB 5JZ7D 3F7YA 1J0IA 1NUGA 3DETD 3KYNA 5KN5A 4PGDB 1WFTA 1EHNA 4ZD3L 1AY1H 1CXEA 2E7HA 3BPNC 1UCTA 1PX4A 2QR0A 3OKMA 4YXKL 1J1OH 1D5XA 2G2RB 5CP7A 2WINB 3AU1B 1B6DA 4L3CA 4L8SA 4JRXE 1DQTA 3FONA 4UUJA 2H8PA 3AUVA 3RWGB 2NZ9C 5FYKU 1MAKA 3PWLB 1VFAA 4JPIA 2AW2A 3D2UA 3LRGA 3QFJA 1TQCC 5HD8D 4ZXBC 5C3LD 1ZE3C 1G7IA 2K7PA 3OPZH 2C1PA 2WV3A 5EZIL 4PJCA 3ULVD 1BQLH 4I3SH 4MD0A 2G60L 3D18A 2VRAA 4H25B 4Q0XL 2P8LA 3ARYA 1JHTB 2A6JA 5HPMB 4B50A 1YEIL 4X98B 1E4WH 1FH5H 4YHZL 5JOFA 4RFEA 4F2MB 3QXTA 3IS1X 3LEXB 4C54A 1X5GA 1FBIL 2OJEA 1ZHNB 4ZS6C 2CUMA 3FQUB 1NFDA 4RAVA 4OD2A 1GL4B 1ACYL 4PJDB 4LCCC 1PEWA 2YWZA 3O4LB 3AB0B 4UOJA 4NO0D 1ZANH 3OZ9H 2YA1A 4U1LA 3DX9B 5TQ2H 5GS3A 1Z9OA 3ROLA 3UDWA 3FO2A 4GAGL 4QXWA 1A4KB 1FFNA 1LO2L 4XAWH 3TA3A 1VFUA 4XP1L 3FB8A 2FWOB 2HKHH 1ONQB 2DLEA 4NQTA 1ZVHA 5IP4A 1IEAA 4I5BA 1TTFA 2AV7A 3TYFA 1A22B 1IAIH 3P3YA 1N3NA 2F8OA 2W65A 2IALA 3EOTH 3FFCA 1I7RA 5F9WC 4Y89A 3OF6D 4JKMA 5E8EA 5EO9B 4HKJA 1AQDA 1TZGH 1GOGA 5GGSA 5KSBE 2L4OA 3TESA 2EDOA 4HIIA 3PWUA 4RGMB 4D9LL 1KTLB 3HAEA 4OLYH 4EI6B 4G8FA 5D8JL 3AM8C 4Z7OE 3NTCL 5BOZG 1FZKB 2J5LC 2E7CA 1DE4B 1EGJL 4RWYH 1IVLA</