3EUUA

Crystal structure of the fgfr2 d2 domain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
100
structure length
100
Chain Sequence
b'NKRAPYWTNTEKMEKRLHAVPAANTVKFRCPAGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHTYHLDVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fibroblast growth factor receptor 2
publication title Crystal structure of the D2 domain of hFGFR2
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 22
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2008-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3euuA01
5KAQF 4OKVA 3QIUD 5IV2B 3BX7C 4D2NA 3FB7A 5TQ0L 2ADGA 1Y0LB 4XVTL 4X7TB 3GSQA 4WCYH 3OB8A 1Q9OB 2AQ1A 5DVKA 4G3YH 3BWUC 4WI6A 3W9EA 2XQYK 4EDXB 5IFHH 4XRCB 3MRNA 5F7FA 1YPZE 2NX5B 3SKJH 2YWZA 2Q8AH 1CYGA 4JHWL 4LRIA 4MVBC 3SDCD 2M8XA 3DO7B 5H2BB 3TYFA 5JW4Q 5LGHL 5LBSH 1S9YA 4HC1L 5CD3A 1BQHG 2C7UB 1WLHA 1X5ZA 3ZTJG 1GC1C 2ZSWB 3ETBF 2JE8A 5I1GH 1YYLH 5GJTH 1WV7T 1QQDB 3B8SA 2DLHA 1HILA 1XIWD 1IQDB 2QV2A 4GXUN 4RNRA 4DKEL 1UJTA 2EC9T 2ICCA 2OZ4L 3IS0X 4NSKA 2WAHA 1KTKE 2A0LC 1RIUL 1RHHB 1ZV5A 3LS5L 4LOUC 3VJ6A 4RISL 1AGCB 3O9WA 3RWCB 4NC0B 1KC5L 1FFPB 5IKCB 4HK0A 5C86A 3L5JA 1R3IH 2VXVH 3OV6A 2RFXA 1WTGT 2FGWL 1FO0L 3RQ3A 4M6NH 1RUMH 3KGRA 2W0FB 3Q5TA 3GI9H 5GS2D 2VDML 3BP4B 1EO7A 3U4BL 1FCCA 4UV7H 2HVJA 5JDSB 5IP4A 2D7TL 3DTXA 5BQ7A 1I85A 5JIHA 4BQCA 5CGYC 2J5LB 4QRRD 3ARGC 4F9LC 4HEME 3BISA 3IDGA 2D4FA 4N0UE 1VGKB 3KPOA 1IAKB 4ORGA 5EIVA 1RAMA 3V7AE 5E4IA 5F7UA 3QXDA 4H8WH 5IB5A 3RVXC 1U8LA 1S9XA 1D9KB 1IAOB 2ITDB 2JB5H 3FT3A 1WISA 3IAPA 4PB0L 4HIHB 3QUXD 4Z7WA 3VGFA 4UQ2A 4Z7VB 1F8TH 3PIQA 4YXLL 4OZGB 1AGDB 1AHWB 1H5BA 4MZ3A 1KJMA 3O8XD 1VADB 5IW1A 4XC1L 5GISL 4MD4B 3HUJB 4KJQC 3VWJB 4YFEA 4LMQI 5JPMA 3ULUH 1TJIL 2NQCA 4PJDA 4MNGE 4XXDB 2C3XA 5I1EL 3EYFB 2MOVA 3TP4A 3MRQA 4EOWL 3D39E 4QNPE 3E1F1 1XF3B 4RX4D 2VZ3A 4PJDF 3REVA 1Q1JL 4U1GB 1FZMA 4OCXH 1DUZB 2VXTL 1IFHH 3ZE1E 3OKDA 2HVKA 2H1PH 3KR3L 2DI9A 1DEDA 4ODHH 1CXLA 4G8FB 1XF4A 4G5ZL 3DETD 1A6PA 5F88B 1B6UA 4N1EA 4W70A 1P4IL 1GOFA 1T2JA 3SDDA 1T0MA 1JGEA 1IC5L 1HINH 4PBVC 1WWCA 1BZ7B 1X4ZA 1H8OA 3QIWD 2HG5B 5ESVA 4FQCL 2GKIA 3DX7B 4QWWC 4H0GA 1X4XA 2V5MA 5ALCH 4BZ1H 4X80L 3RY5A 4R97B 2C3VA 1AQKH 1WZ1L 4C83B 4DJMA 1BLNA 1FNLA 2OJEA 1FVDB 3QEQD 2NNAA 4OTXH 3V0VA 3OAZH 3QSKB 1MSPA 3QNZA 5B22A 5D72L 1TVBA 1VGEL 2NR6C 5B39A 5D1QB 3VRJB 1BMGA 5C6PB 4R2GD 3OKEA 3RIFK 1SMOA 3QG7H 4HS6B 3HTLX 4WWKD 3MO1A 4OFVA 1Z0MA 4Y0GA 3RPKA 2DQTL 1JPST 3LB6D 1ED3B 2E27L 1N4XH 3MYJB 1SJHB 1DBBL 4PS4H 5K59E 3ISWA 4ZS6C 3P9LA 2HT3D 4Y19E 5E5MB 5TF1H 2HFFB 1ZOXA 2WWKT 2OP4L 1HN1A 4EEEA 5HHVH 5EOQH 3TNNA 3LIZL 2OXHA 4FQIL 3QCVH 3CFCH 4M1GL 4RAUA 4X7DC 3R8BB 35C8H 3C60B 3OSKA 3MZGB 1U8OB 4NRYA 2VQTA 4TVSa 3MRFB 3N1QC 4Y4FD 3FO9A 2R1YA 2FX8H 1UEYA 5HI4D 2WWKO 4LIQH 4OFYD 4JKPH 5I15H 3QFDA 1PW3A 1P4LB 1I8MA 5IESL 3O0RL 3O3BA 2WK2A 5ILTH 2VUOA 1JNNL 5E9DB 1Z3GL 3WN5A 2WM0A 4MB3A 1MIML 5HVWA 3TBTA 4OKDA 2DAVA 2ICEB 5H35A 1NQBA 3DUSA 3UROR 1A4JA 1MAML 4R26H 1GVIA 2BSSB 4JFPB 1AGFB 2NY3B 3D5OF 3HNVH 4O2CA 5GGUA 3GSOA 1NMCB 1XGQA 3OHXB 4QY8B 3UTPD 4OV5A 3QA3A 1G9MH 1AJ7H 3MMEB 3EIFA 1YDPA 2FIKA 3I50H 4P3CH 1ZLWK 2HH0L 3OXSB 3UYPA 3SE8H 2Q76A 1NGWA 1AD0A 3GSNH 5EO0A 4OIIL 5ADOL 2XG4A 3T0XA 4D3CL 1R3KA 4NZDA 2VKXA 4L4VE 5EZLA 2QSQA 3BPNB 1B88A 5D7LE 3V6OA 3RWGA 1JF1A 4KQ3H 1B4RA 1G7IB 1V5JA 4ZFFB 4QF1B 3AVEA 4MXWL 2MPAL 1MCDA 3P0GB 1QRNA 1Q9KB 2RQ8A 4CAGA 4NKOB 1DQDH 1MJJA 1X5LA 2NXYB 3PJSB 2J8UE 2XNAA 1NFDF 2DLIA 2CKBA 5C09E 3HR5A 1LO4L 3HMXA 4HJJL 1CFSA 2IMMA 4N0CC 1S7WA 2DOCA 4WFED 4LSTH 3TESA 1B0RA 2QEJA 3IETB 4ONGH 4LQFH 1F90H 2R2HA 4HV8A 3NTCH 5TFSH 3WS6C 4FHBD 3UTZA 4XPHL 3TBSA 2W60B 2C26A 1QEWB 2NY5H 1HKLH 1UM6H 2AJXL 3CXHK 3LKQB 1Q38A 1BECA 5KOVC 4NNYB 3D3VD 1I8LA 5B8CA 4L3CA 5ESQB 2RR3A 1U95A 2VAJA 5D7JB 1DVFB 1FNHA 1JRHI 2YA2A 4LEXH 4OQTL 4KZEL 3FOMA 4HBCL 1S7QB 1H3PL 4PP1C 2VSCA 4ZQKA 3HMWL 4JKKA 3WIFB 3DPBA 5I1KL 4U6XB 5EU6E 5C0EB 1Y6KR 1J05A 1OAXH 1KB9K 4MZ2A 4AYFA 5GGVH 5GSVB 4RIRB 1A3LL 1IILE 5IJVA 4Q9RL 3AY4A 4P4RA 4PG2C 5M94B 5C7XL 4P4KC 5I9QC 1FAIH 5D7SH 2Z35A 3SOBH 2X40A 4H26A 4M1DL 1FBIH 4I0PA 3VW3H 3OX8A 4NQDE 1AGEB 4LCWB 3KJ4C 4OGYL 5KAQG 1T1YA 1JTPA 1F00I 5KOMC 4DN4L 5HHQA 1FL3A 5C0BE 4TOYL 3W9DB 4NNXA 2IQ9H 4LHQB 3U7YH 1GZQA 4LCUA 5DTFB 4L4VA 3KYKL 1EZVX 1BZ9B 5ALBH 3BEVB 3R1GH 3BP7B 4F3FA 5DMIH 3MJ7B 3CK0L 4JRYE 3O9WD 3OAUL 5HHNB 5I75C 3S4SB 3P77A 2R2BB 5GS1C 4OZIB 1NUDA 4L3EE 3FFDA 4PJ5E 4GW1B 1ONQB 2X42A 2ZG3A 2J8UA 1CGSH 2EYTA 4YHYB 3DHJA 4PREB 1PG7L 4RWYL 4LKXB 4KDVA 1MCHA 5L7XL 5EZIL 5DK2B 2V6HA 1NCWH 4MJIE 1BM3L 1UB6A 2B39A 3MLSH 2DQDH 5DUBA 2XZCH 3P4OA 1QTYT 4BH7B 3FMGH 3ZKNC 3W11C 1T83C 4MNQB 5DSCA 1P1ZA 4TPRL 4JY5L 1XGTA 1CXFA 4XPFH 5F7MC 1TJHH 4Z0XA 2YWYA 3MFGB 1KEML 3EYSH 2IQAA 1I1AC 5IB1B 4Y4HB 1MHEA 3SY0B 3EYQC 3WE6B 4JZJB 4GRLB 4U1KB 1K9TA 1KULA 3UBXB 3WNNA 2XPGA 2Y07L 5GZNC 4DKDC 1FL5B 2ILLA 2VDRL 3K2UL 4N90E 2AXFB 2R56L 4ESKA 3H9HA 1CF8H 3ROOB 3FCTA 4LHUB 1TPXC 4LSRL 1YMHA 4OGAC 1I1FB 2BXZA 4NM4H 3QJFB 2WWMC 3GUTB 3S35L 5EULV 2C1OA 2FEDD 1GHFL 1IGCL 4TVPD 2IH1A 4R7DA 4XMKL 3ARDC 4PG9B 4ZUVB 5KVMC 3TIDA 2DTSA 1E4XL 5GRWA 4PJBF 5L2KA 2HWZL 3BQUA 4OF8A 1RIHH 4HIXH 4HKBA 2FJHB 1QLFB 1NAKH 4HH8A 3KPPA 4JANA 4JE4B 1U8QB 3D48R 3V4PH 4ZOAA 3NCCB 2XKNA 4DAGL 1QKZH 3IDYC 3C5ZA 5J57B 4YBLB 4YXHL 2VDOL 2D9QB 2PF6A 2ARJB 5K9JL 1ACZA 5F7LB 3LQAH 4XT1C 4N1CA 2HP4A 4GQ9H 5F1OB 5MEOA 3SDDD 5L2JB 4NKDB 4NM8H 1IGTA 1YC7A 1KXTB 1IM3A 1N3NA 2EIBA 5DJXA 4F7CB 2FX7H 5CJOL 1F58H 4L3EA 4M1CD 4X4MA 4HJ0D 1DQQA 2CIIA 2BJML 5L6YH 4YDJA 1TNNA 3B2UD 1SJEA 4OLYH 2IADB 2VUYA 5D6CA 2NW3A 1W0VB 2R0ZL 4NN6B 4DGVL 1HKFA 3VXPA 5C08A 4MQXD 5DEFA 4C55A 4HXBL 4DGYH 4U1SA 1T89C 2A2QT 1ETZB 5F3HA 1C16B 3MLVH 1OTUC 3N9GL 2GT9A 3HI6H 1S9WA 4Q6IA 1KIPA 5K59F 1MRFL 4RQQA 1CD8A 3O2WL 4KVCL 4ODSL 5KS9A 1IJ9A 2AERT 1CDYA 3CSBA 4Z95H 1S8DA 4LLQA 1P9MC 2Z91A 5KS9F 4J6RL 1HH9A 1QSEB 2X4TA 3KYMB 1HXYA 4PRHA 4UTBL 4JFHD 2OL3A 2EIZA 3NFNB 2XQBL 4QHNA 4Z0BL 3V6BR 1OWWA 1N26A 4HPOH 1FLTX 4LCCB 2C9AA 5D5MF 4ZPVB 3X14A 2OBGA 1FRGH 1NCAL 1FNSL 3F7VB 5F6HJ 1OWRM 4Z7VE 2ZKHH 2NZ9D 5F7WC 2VLRA 4WTXA 4WTWA 3OZ9H 1EEUA 3MLXL 4ETYA 1JRHL 4OZGE 1BVLB 5E2WL 4U2YA 3CUPB 3VXRA 2OTUB 4BSVB 1YC8A 1CDCA 2B0SH 2C4XA 3MUGB 1A6AA 1UWXH 2QQKH 5IV2A 3B9DA 2NY7H 1Y0LA 3L7EB 4X7TA 5BVJB 1W8OA 1FIEA 3MGTB 3GBML 1Q9OA 2CDGB 4LU5L 1YJDC 4Y16B 4Q7DA 3S88L 1S7SB 5EDXA 3T65B 2G2RB 4EDXA 2F19L 4IMLB 4XRCA 5DD0L 1F11B 2NX5A 4LARH 3C6LC 3S9DB 2ZSWA 3I3DA 4ZNEE 1YEEL 4KRPB 2DB8A 4IOFD 1QQDA 1MRDH 1PKOA 3X11B 3O45B 1NBVL 3MV7B 3VD7A 3FZUD 4HS3B 1PY9A 2FJFB 1RHHA 2KBGA 1MCCA 1AGCA 3O4OC 3KLHD 2EDDA 5JO5B 5AYUH 1OAYH 4ZFOB 4MB4A 1FE8L 4LPCA 2H6PB 4A2LA 1FFPA 4MA8L 4JN1H 1Z9MA 5HYSB 1QRND 5EFIB 3WJJA 1ZHLB 2KZWA 3MRGB 3EDEA 4GW5B 1NBZB 2X4QA 4RDQG 4Y4KC 2D0FA 5T5FH 1A7QH 5I66B 2EDRA 3LMJH 2IG2L 1CLYL 3ARZA 4LP5A 3BP4A 3HAEH 4N68A 4TNWK 1PX3A 5JDSA 1A0QH 1YEGH 3BXNB 4NBXB 3CXDL 1CN4A 3NPSC 2HJKA 3VFPB 5GRJH 1JV5A 2QSCL 4UNUA 2XG5A 3P11H 3ZKQD 4YGAB 1W72A 2CKNA 1YEFH 3EO9L 2MCG1 2VL5A 3GM0A 4PRNB 4KQ4H 1MAKA 2Y1VA 2G9HB 2ITCA 1C1EL 5IGXH 3JXAA 4AMKH 2KQNA 2NY2C 5IG7B 4JFEE 1D9KA 1DFBL 4L8SB 1IAOA 3Q2CA 1KLUB 1AR1C 2BHZA 1HQRB 2VAAB 3ULVD 4HIHA 1YEHL 2GTZB 4JHAH 5F9AC 4FQ2L 2AJUH 1C12B 4Z7VA 4AL8H 3CU7A 3UCRA 3M07A 3WO4B 2QBWA 1YN7B 3JWDL 3QDGA 5CCKH 2GJ6E 2FGZA 4HJGB 4JRXA 5L8LB 1U8MB 4MD4A 3HUJA 3G04B 5K9OA 2EO9A 5EOCL 1F4XH 4XXDA 1ZT4B 2HFTA 5F97E 3EYFA 4ZXBC 3PP3H 3BZEB 1ZE3C 4L8CB 4GSDL 1VFOA 2PXYB 1ROWA 2HFEB 1UKSA 2P48B 1MI5B 3HMXL 3NA9H 4TUOA 4YHKH 3ZKMD 5KSAB 4I0PD 4W4OA 3STBA 3QUML 3BSZL 4NQCB 3LDBC 1CI5A 1ULVA 1JPTH 1OD7A 1CL7H 4ZNEA 2PO6B 3ZHDA 3FN0H 4G8FA 5IVXA 4BFGA 2W07A 3L3IB 4JREC 5F88A 5CEYA 3O6ML 4XI5D 1A02N 4MX7B 1I9RH 4MXVE 4L4VD 5IVXF 1OSPL 5D7LD 1CBVL 2BHUA 2X4PB 1P69B 2HG5A 5IWLC 4BQ8A 5I1HL 3D69B 3NAAH 3UPRB 4OIAA 3WDJA 1P6AB 2K7PA 4C83A 3PWVB 7FABL 3OKOB 3R0MA 1FVDA 2WINA 4ELKB 1QFOA 3OPZH 2ZG2A 3QDMB 3QEHB 3V0WH 1RZKL 4H20H 1CR9H 3OL2A 1CE6B 2ARWA 5D1QA 3HE6B 2NY1B 2JJSC 2NW2B 3A6CH 3B43A 4PJ7E 4OD3L 1WWBX 5DFTA 2YD6A 4K9EH 3L3JA 5A2FA 3RL2B 4HS6A 1TTUA 3G9VA 5D93C 3DUUB 1KN2H 2APXA 4FQLH 3WNKA 5C6TH 5F9JB 4LP4A 2JIXA 4N8VB 1ED3A 4NCDA 4K94C 2Z31A 1RD6A 1SJHA 1N7ML 2W92A 3MROB 4NHUB 5DZNA 4PJAA 4F7TB 4JEGB 2ZOLB 3CFIC 2HFFA 4XXCC 3NCEB 3H0TB 5IVOA 3U30C 3NPZB 2CLVB 2VYRE 5IBLD 4M5YL 4D0BB 4Y88A 3C60A 1LHZA 4RMUA 2FLBT 1U8OA 5DD6B 1BF8A 1I9JL 3MRFA 4FFVD 1NCNA 3RGVC 1P4LA 4S1DC 1PDKA 3ZZ1A 5E9DA 4PJGB 2FH6A 3NCFB 3UJTH 2F5BL 4O2FB 1RUPH 4Z77B 3TBYB 4U1IB 3RJDA 1N8ZB 3S98A 3P4NA 3WFZA 5L2KD 1VACB 2K3TA 2BSSA 4JFPA 1AGFA 4WHTB 2VDQH 4L5FL 4EXPX 4QY8A 3AU1A 5B38B 3ARUA 3C5ZD 2XN9A 1K4CB 3MMEA 9CGTA 5EH1A 2MKLC 5ACLA 3O6FB 3TA3B 5GRZA 5IB4B 4LIQE 5CAYB 4CMHC 2IC2A 5HHME 3OXSA 6FABH 5I1LB 2Y25A 1HI6B 3O4LB 1DQLL 4L29B 2DIJA 3NN8B 4HLJA 2VDPH 1NDMB 4U6VL 2WNGA 4JKMA 1LK3L 3N85H 4JRYD 1OAZL 4HF5L 1G7IA 3RP1A 4ZFFA 4QF1A 3WIHA 3KWWB 1RUKL 2YRPA 2DLTA 4L3ED 2JB6A 1Q9KA 3B83A 4NKOA 2H26B 1A5FH 4OZIE 4OFKA 3PJSA 4ZOCA 1QHOA 3Q5OA 1ZGLP 1KOAA 4NOBA 2D7PA 2IANB 4HIEA 4KGLA 4NQXB 4WI2A 1MFDH 4LRNL 5C08D 5FO7A 4XC3L 4MHHI 2FIRT 1HHHB 2P4AB 5C8JB 1CT8B 3KYNB 2BVOB 4M7JL 4PPTA 4JFDB 4Y5YC 3IETA 4NQVB 3RL1B 3JUZA 1EHLL 3U9PH 3FO1B 5GS0L 5KSVB 4JPWH 1N6UA 2V2TB 4JDTL 1QEWA 4CDGC 3B6SA 3VCLA 1K6QL 4KZDL 4NNYA 1VERA 5CEZE 4JLRB 5D71H 4FQHB 1ZHBB 4PRHD 1RVFL 4NGHH 1JNHB 5ESQA 1ZLVH 4OCWL 3VFOB 1DN0A 2F15A 4G6ML 3BGFB 4WV1C 2OX5A 5L9DL 1TXKA 1S7QA 2VE6A 5E4EB 1L7IL 2Y9RT 1NGQL 1OQXA 4UB0L 5FHBL 3WIFA 3INUH 5C07B 4U6XA 5C0EA 1TQBB 1TCMA 2YD2A 5IK3B 2VLRD 1RZJL 5DR5L 1FPTL 5EIQA 3CFJB 2IFFL 3VXRD 5FECB 5GSVA 3A6BH 3G6DL 4JFFE 1YNLH 3ARRA 4U3HA 4RIRA 4U3CA 3RUGF 2M2DA 1QLEL 2CQVA 2DJ4A 1N0XH 4FG6D 4XWGH 2ICWA 3OAYK 2XV6B 2YOCA 3FQRB 3MLZL 1IMHC 3EOBB 3B5GA 5E24E 3F8UB 1UACL 3BGAA 1CDHA 3SEPA 4OD1L 5GSRA 5FO9B 2RGSA 2E8YA 1AGEA 2NX5D 1HIML 4LCWA 1EEZB 1NAML 1IGMH 4F57L 4W81A 5H37G 1BQLH 1MCPH 3O3AA 3W9DA 4YHPB 1YQVL 1HHJB 3DV6A 3EJZC 4UIKL 3NH7L 3QWQB 4KJWD 1LWRA 4HFUL 3BP7A 1PG7X 3HZMA 2OL3L 3MJ7A 3D85B 1M71B 3T0EB 2HKFL 5HHNA 3S4SA 1CDUA 5DT1H 5JHDB 4WTZA 1JZ7A 2R2BA 4JM2F 2WBJB 4FP8L 3ARBB 4OZIA 2R8SH 2P8PB 1U8KB 4GW1A 1ONQA 4O51A 5E5UB 2O5YH 1ZA3A 4OCSL 3UYRL 4BK4A 1J0ZA 1WJ3A 2BCKB 3PDOA 1NFIB 3TJHD 4WRLA 5DK2A 4XP5H 3KYOB 4KH2A 1NBQA 3CVHA 5F9DC 4KK5D 3N1PC 2YZ8A 4RSVA 2YUZA 4IJ3B 5JORB 5DDHB 1MY5A 3V5KB 1M7XA 1N2RB 4L3AA 3KPRB 4MNQA 3STZB 3SDAC 1GOGA 5FYLE 5BW7C 3CFKB 1DJSA 4P9MH 3QCTL 5IB1A 1D9KD 4IRJC 1FFRA 3GJEA 2XZZA 3SY0A 3QUYA 3WE6A 4JZJA 3RIFF 4GRLA 4U1KA 5ICZB 1EZVY 2GUOB 3MFFB 1FL5A 1CVSC 2AXFA 4M48L 4G7YH 2CO6B 12E8L 5DYOA 2YXMA 4LHUA 1U3HB 1KCSH 1L6XA 2ZCHH 4WEMB 3QJFA 4S1SH 4FOMA 3GUTA 4DFHA 4JRXD 4O9HH 5D2NB 1MCOL 5DMGD 4ZUVA 3QAZC 1P84J 5ADPH 1MJ7L 3OJDB 5BV7C 2PETA 5F44A 5ENWB 5F70A 4LLDB 2H2PC 4JO2H 1H3WM 3X17A 4TRPH 4YHML 2FJHA 1QLFA 4WEBL 2D31B 5HGGS 3OKMB 4IOIB 4P59L 3RZCB 3GSXB 2VLJA 2LVEA 4N5UA 3SBWA 5T1LA 1OAUH 1AXTH 3U9UB 5IJKA 2ARJA 4EN3B 1INEH 2QR0B 3C5SB 3TJEL 3GJFK 2UZIH 5T33L 4MQTB 5C0DB 1TTFA 3OR7B 3BHBB 5IM7B 5L2JA 4UINH 4POZD 3WFEH 5DMKB 1ITBB 2ZNWA 1T1XB 4M8VA 5DHYB 5J4MA 4KVNL 4JZNA 4X6DA 5C0FB 4AT6A 4MHHG 4F7CA 1WFOA 4LASH 2E7LC 4ODTL 1YY8B 1VESA 1T2QH 4IRSB 5T3ZH 2XI9A 4MQSB 3OAZK 3EJYD 4YGVB 4X6CB 1PSKL 2QKIB 2IADA 4OBRA 4Z78B 1FYTE 2ICWI 3L5HA 4KRNA 1U3YA 1OAQH 4QT5A 4TULL 2X7LB 4WI9A 5D1QD 4TSAH 1LE9B 1BJ1H 2V9RA 3RY4A 3GNMH 2L7JA 3G6JF 4M9PA 5EBLB 3SPVB 4JKWA 2Q86B 5IMKB 1ETZA 3IDNB 3HLAB 1C16A 7CGTA 3TO4C 1LO0H 5FUOH 5IBTH 1U8HB 2JIXD 4XX1G 4YDIL 5C9JB 5HD8C 3BKJH 2OQJB 5KVDL 4G9DB 5J12C 4KKLC 2IH3A 1D5MA 4R4FH 1JFQH 1LMKA 4FZ8H 2B8OT 2NY0B 3VG9B 1QSEA 3KYMA 2O5ZH 4HIJB 1PGRB 2YPVL 3OKLB 4LLWA 2OMNA 2Y36L 2J7LA 2BSED 5DWUH 1RZGA 3C60D 4LCCA 5D1ZB 5HXMA 4F37F 5DD5H 4R90L 4KUZH 4ZPVA 4PTUB 1I8KA 2LAAA 4G3YL 3F7VA 2E6PA 1GGIH 3RJQB 5IFHL 2FEEI 1BVLA 2OTUA 3SKJL 2Q8AL 4BSVA 1U6AH 1PG7W 2FHCA 5E9DD 5LBSL 1WCQA 4X6FA 2O61B 4K3DH 1YPZF 5BVJA 1YYLL 3MGTA 5I1GL 5L8KB 5GJTL 3GDBA 3CLEH 2IPKB 2CDGA 1N6VA 2VB5A 4Y16A 3G5ZB 4LQ1A 3W5NA 1S7SA 5EPMA 4KFZC 1FNEB 2G2RA 3FAXA 2NY3D 1MI5E 3BN9C 5KZCB 1DQTA 5J8OA 4YAQB 3D6GA 4NQCE 5D8JH 2P49B 3VRIB 2CD0A 4LLVB 1U3JA 2B20A 1Z6JT 3DLQR 1R3IL 4OLVL 4HK3J 3WV0A 4YHNB 4GKSB 3O45A 4PY8J 3MV7A 4M6NL 1RUML 3IVKB 3MRCB 2ATPB 3GI9L 1OCWH 2FJFA 5C2BH 2D7OA 3NIGE 5JO5A 2P1YA 2VZSA 2Y7QA 3DSFL 5EFIA 5J6HA 1ZHLA 4H5SB 1INQB 3MRGA 4R4NC 5CIPB 4GKOA 1NBZA 5BZWA 4OLWH 2NXYD 2XQYG 5I66A 4P23C 3IJYB 3QDME 4JO4H 5EU5B 1A7PL 3HPLB 1F4AA 3MZTA 5TF0A 3BXNA 1D5BB 2I24N 2B4CH 3CPLB 4G9FA 2XKUA 2JB5L 3VFPA 4BM7A 4LLMB 1B2WH 3V9FA 5HHPB 4ONFH 1R24B 4J7RA 3P9WB 2EXWD 1DE4B 3PGFH 4OCYH 1BFOB 5F7KC 1Y18B 4PRNA 3RVVC 3WDIA 2DICA 2G9HA 3T0DA 3IDXH 1F8TL 3B5HA 4HEPG 5IG7A 2JF1A 4L8SA 1KLUA 2EH8L 2VAAA 1FVCB 5D7JD 2P5WB 2GTZA 3NZ8B 4MXQD 4P3WA 3GRWH 4B53A 4AEIH 5B4MC 1PX4A 2DMKA 1C12A 4TTDC 32C2B 3U4EB 1YN7A 4OCXL 4F9PA 1IFHL 4QNPF 4Y2OA 3TWCL 4HJGA 3MUY1 4ZFGH 1MVUB 2WSKA 1RJZB 3G04A 4PJXB 3BVNB 1U8NB 1ZT4A 4ODHL 3ZE1F 4HKZB 2XA8H 4KUCF 4G43A 1JWMB 3NACL 4C54A 2PXYA 2Z92B 3SGEI 3TH3T 4RMRA 2HFEA 2VR5A 3IDUA 2M26A 1MI5A 1RI8A 1GPOH 2X44D 2D0HA 3ZMRA 5KSAA 4QXTB 1NCDL 4NQCA 4DZ8B 4NC2B 4DKAA 4LCWD 5DVOA 4FQ1H 1VDGA 3CLFL 4M3JA 1EXUB 1AH1A 3L3IA 4LPXA 5GGTA 1H0DB 5EN2B 3O4LE 43CAB 2HT2D 4WHYH 2X4PA 5F96L 2P8MB 3D69A 2YK1H 3DIFB 4ZFZB 3WKMH 1OTSC 4NYLA 3GB7B 4Q9BA 4Z7UB 5BS0E 2EDYA 3PWVA 3QDAA 1NMAH 4L8DB 4ELKA 1JGLL 5DEGB 3CDYA 3MLPA 3QEHA 4HAFA 5EZJB 1IC7H 4JAMB 1N4XL 1CE6A 3BI9X 1X4YA 4PD4K 3HE6A 4P2RB 3F62A 3T3ME 5L88L 1JZ3A 5TF1L 1V3MA 4JO3H 2R2EB 3NIFF 4OZHF 5HHVL 4H25B 3RL2A 3MUJA 1MUJB 3DUUA 3QHFH 4UOW0 5EOQL 5J06A 5IF0B 1Q8MA 3UZQA 4WTZG 4PJIB 5F9JA 1T4KB 3QCVL 2BY3A 4S1RL 4N8VA 4JFDE 3CU1A 2UVFA 1BD2B 4ELME 2DQEH 3PWLB 4MNQD 3MROA 4NHUA 1TCRA 5JIKA 1B90A 4LIQL 4F7TA 2ZOLA 5I15L 5CEZD 3SO3B 3MXWH 3H0TA 2X1XR 3QUYD 4OIBA 5ILTL 3WJLC 2CLVA 4GRLD 2AJZB 1AC6A 4UTAL 4LVOB 4FMFA 4D0BA 4M6AA 5DD6A 1G7LA 4L9LC 1CGVA 2BERA 2HKHH 4R26L 2ZUTA 3AREB 4LHUD 3X3FH 5IHUL 1R3LB 3C8DA 1F45A 1WFUA 3FHQA 5IEKB 1J0JA 4JVPA 4N1HB 1G9ML 1KPRA 2YXFA 4PJGA 1QFWI 4O2FA 3FONB 5FA3B 4Z77A 1AD9B 1G7QA 2R2CA 1O7VA 1RIVH 2FEEL 4GAFB 5E70A 4F2MB 4UNTA 1KGCD 3MOQA 5JLZB 3TBYA 4MA1C 1N8ZA 5DURB 2J6EA 3UZEA 3RWHB 2GYSA 3QPQC 2BVQA 4KQ3L 2XTLA 3SKMB 5B38A 1I9EA 3EO0B 3KG5A 4QTIH 1K4CA 2VLJD 5HI5C 3E3QC 3TA3A 2JJTC 1A9EB 1ES0B 5IB4A 1EBAA 4OZFH 4J3OC 4NO5A 1ZVHA 5I1LA 4RGOH 4MAYB 4DKFL 1A6UH 3O4LA 1Z9LA 4L29A 3HE7C 5CEZL 3RI5K 3PGDB 1NDMA 5DQDL 3MA7B 4PTTA 4GMSH 1VFAA 1S78C 1SMAA 3KWWA 1FV1B 5DVNA 5IB2A 3AAZB 1K2DB 1B9ZA 2H26A 5IFJB 2JJWA 1B4JL 4E41B 4LQFL 1F90L 3NTCL 4GBXC 5J7CC 2NY5L 1HKLL 1UM6L 2IANA 4UAOC 2UWEF 4NQXA 1CGTA 4J3WA 3R06B 5JOPE 3FFCE 3HG1A 3KYNA 4KROC 3ZLQC 2BVOA 2R0LL 5JXEC 4NQVA 3RL1A 4FTVA 1UADC 1A7NL 5TQ0H 3FO1A 4W6YB 4LEXL 4MJ4A 2HT3C 2CK0L 5FYLD 5IMOB 2V2TA 1FZOB 1Q0YH 4QXWA 4TNWF 4NWTL 4EQ3A 1OAXL 3DX9B 1CFVH 4JLRA 3MRLB 5DJAB 1QSED 4LGSB 1ZHBA 3VGGA 2CJUH 3EBAA 5K9QI 2HT4D 1JNHA 4W6XB 3VFOA 1KJ2A 2VNCA 3GHBH 4CVZA 1T80A 1CGWA 3F12B 2CLRB 3D0VA 1ZVSB 5FB8A 4CUCA 3IDIB 5T1MB 1G6RB 2EDKA 5CBAA 1FAIL 5C07A 3SOBL 3U7AA 5F89B 1J86A 5IK3A 2OZ4H 1NGYB 2OYPA 1RIUH 1ZA6B 3P4LA 3VW3L 5E2VL 3CFJA 3Q6GH 5FECA 1JI1A 1SEBA 5DQ9A 4UUJB 3UX9B 3BJ91 1UWXK 1WBXB 1DZBA 5DQJB 1JWSB 3RHWK 3LRGA 1JZ2A 1MH5B 3U7YL 4P2YA 5CEXB 3FQRA 3GMNB 1BWWA 1X5GA 1YY9D 3EOBA 1ZLUH 4Y16D 2EEBA 1LEIB 1FO0H 1WVZA 5CKGA 5DRXA 4X7EC 5ALBL 4KDWA 2EYSA 5BZDB 1U0QA 5EZOL 2NLJB 2VDMH 5T1KB 1EEZA 1X9QA 4JQIH 1BX2B 1FVEB 2D7TH 4GRWH 4DWHA 4YHPA 2HMID 1HHJA 3DVNB 5FYLL 4KRPD 1AP2B 5FV1L 1CQYA 1C8PA 2JCCA 3HHRB 1CGSL 4GFTB 3MV7D 4HT1H 5FO8A 1JJUA 1JF5A 5IUSA 2JCCF 3D85A 1M71A 1RQ5A 4GKNA 3T0EA 5KTEH 5JHDA 1H3XA 5I17A 4XNMB 2YPLE 3WUZA 3QYCA 3IJSB 3MLSL 1CIUA 2DQDL 5AEAA 4KI5E 2P8PA 1JP5A 3WL9B 1U8KA 4JM2C 4NP4L 5HDLA 2ATKB 3FMGL 4PYGA 3S7GA 4X6CE 1T0PB 3LSOB 2BCKA 3MLTB 5HPMB 4XPFL 3H9YA 2FD6H 1A1MA 2BNRB 1TJHL 1IAIH 5E8PB 4U49A 3EYSL 5DK3A 1HEZB 3KYOA 4XC1H 5GISH 1T04B 3EYUH 3UP1A 4Y2DC 2MCPH 1S7VB 3IDMB 5I1EH 5JORA 3V5KA 1N2RA 3TVMC 5GS2H 3KPRA 3D25B 3STZA 2H32H 3GSWB 3C8HA 4GG6E 2QSVA 4NM4L 3CFKA 2V5SA 5JMRA 4Q58C 5KSUA 2IAMC 5EA0H 3NCBB 1DLFH 4XAWL 3KR3H 4KXZI 3UC0H 5ICZA 3MFFA 4M4RA 3BH9A 5HYEA 3TYGH 3C8KB 4X4ZA 2PTTB 3BIKB 3VFRB 1RIHL 2YR3A 4ZFOL 1U3HA 1EEYA 5HYQA 1NAKL 1UYWH 3VI3F 3VFGH 3V4PL 4FQCH 3CX5J 1QKZL 5D2NA 3O2DH 4X80H 1JIBA 5CZKA 5EU7E 4QRTB 5C71A 3PP3K 3BWAB 1JNLH 1LO2H 3OJDA 2PN5A 1EA9C 5HGBB 4LLDA 2PXYD 1QFWL 5SWSE 1MI5D 5D72H 4NM8L 2D31A 1F02I 1VGEH 4Q0XL 4IOIA 5KSAD 3T4AB 4NQCD 4WENB 3X3GH 3RZCA 3GSXA 1SY6A 4PGBB 5ITBH 3HNTL 1D5XA 2ICES 3QO1B 5DLMH 2OR9H 4M7LT 2FX7L 3VXQB 3U9UA 3C5SA 1H3TA 4MWFB 5C0DA 4LNRB 5A3ID 3OR7A 1XFPA 3BHBA 4Y8AA 5IM7A 4PJ8C 5DMKA 4M8QB 1T1XA 5DHYA 4HSQA 3AM8C 1Y6NR 5DS8A 5C0FA 5DZLA 4JFZL 4GXVH 4B5EA 1ZSDB 1YY8A 4R6UA 1I1YB 4IRSA 1KNOB 3H3PH 5CD5D 4BUHA 3FO2B 4CVXB 5FDWA 4FQIH 3ZKXC 3KPSB 3HI6L 4GRWB 5HYJB 4M1GH 4UBDD 4YGVA 4X6CA 1ZGLB 2ZWLT 1QOKA 2QKIA 3ILQD 4NT6A 4Z78A 5TPWH 4U0QB 5EC2B 4Z95L 4IOSD 3REWA 3AUVA 3HE6D 3LOWA 2NY1D 1LE9A 2GSGB 4PLOB 4JRWA 2WQ8A 3SPVA 5IESH 2Q86A 1QSFB 3GMQB 3HLAA 1P6FA 2EE3A 3ARYA 3OGCB 4FN0A 1JTOA 1KXQE 3QHTC 2CGRH 3QULB 2OQJA 4G9DA 5F9OL 2XTJD 1FRGL 3EAKA 4YFLI 1TETH 5T3ZE 1P53A 2ZKHL 3LV3B 3PQYB 1SYVA 5CGMA 1HXMB 1JTTA 4QYOB 4HIJA 1L7TH 4GJTB 3MOBH 3OKLA 5E08H 2E7CA 4RCAA 3S96A 1U8PB 2AKRB 2FZ3B 1TDQA 1CG9B 1CICC 2NY7L 5CFHA 5D1ZA 1MFBL 3WS3B 2P5WE 3QEUB 2PW2B 3I9GL 4N8VG 4OIIH 3H2WA 1S3KH 4MJ2A 3N50A 5DJYA 4ERSH 1EUTA 5E8EB 4H0IA 4Y1AB 4PJXE 4MXWH 2IPUK 2MPAH 2O61A 2VXQL 4X4YA 1H8SA 1QUNA 5AD0B 3ZL4H 3DECA 2IPKA 1MRDL 4NKIH 5E8NB 4H1LA 3G5ZA 1R5VB 1FNEA 4L8BB 1JN6B 1R6VA 3UAJD 4YAQA 5AYUL 3QIBC 1OAYL 4HKXB 1OGTB 4LLVA 4P0DA 3VA2C 2AEQH 4JN1L 3TA3D 1QBMH 2GHWB 1KPVB 2HTKD 5HVFB 3V8OA 4YHNA 4YLQT 4GKSA 4NJAH 3O4LD 1BBDL 4DOHB 1KXVC 1KTLA 3QUXB 5T5FL 3V8CA 4GAJH 3IVKA 2CMRH 3MBEC 3MRCA 4NZUH 4XPHH 3VD9A 4M93C 1TTGA 1MCSA 1A0QL 2AJXH 3BZFB 3LZFH 3ZSSA 2VITB 3O8XB 1T6VN 3MJ9A 2R9HC 5I9QB 5B38G 1JZ4A 4H5SA 3P11L 5CIPA 3QO0B 2IBZY 1YEFL 1T7WA 5D6DA 1JI2A 3ZDZE 5EU5A 3HPLA 4KQ4L 4DK6A 1UZ6E 2VSDA 4MQXC 5IGXL 2RIKA 4AMKL 2IAND 3E6FB 1SBBA 4N5EC 5ELIA 3LPWA 1D5BA 4CADB 5I1JL 1GRWA 2B2XL 3CPLA 3TO2B 3VFUB 1HNGA 4LLMA 5E1AB 1VEOA 2PCPA 1JMZA 2HLAB 1A3LH 1R24A 5JZ7D 4JFDD 3IKCB 5FYKD 1DE4A 4FTVD 4N0YH 1BFOA 4PJIE 1Y18A 4BYHA 5I75B 4JHAL 4MD5B 1BD2E 2UZXB 3M8OH 4DCQB 2AJUL 5C7XH 4AL8L 4LVEA 3K1DA 1I7TB 5I73C 5CCKL 1N59A 2LV4A 4UV4H 1ZLVK 1MRCL 1SVZA 1ADQA 1F4XL 2DN7A 3ZDXE 4RFNC 5KBNC 1FVCA 3U0TB 1L6ZA 2P5WA 3GKWH 3NZ8A 5JW4N 1PKQE 1FHGA 3KYKH 3U4EA 1ZTXL 5C07D 3VGAB 4IDJH 3NA9L 1K85A 4YHKL 4WWID 3SE4A 2E7HA 1MVUA 1KEGH 1RJZA 1JPTL 1SVCP 3BVNA 3CD4A 4PGEB 5D1XA 4UT7H 1A6VH 1U8NA 1Q9WB 3RDTC 3PXHA 4HKZA 3UTQB 2Z92A 1OB1B 4JQVA 1I9RL 8FABB 1GXEA 1EVTC 4LHJB 1PG7H 1NH6A 3DSNA 5D70L 2F53A 4QXTA 1JGDB 4DZ8A 1I3RB 4RAHA 4MXVF 3ULUF 5EZIH 4FXKB 5CSGA 3QZWB 5FF6A 1TPXB 1T7YA 4E42B 5HJ3A 1OW0C 2FBOJ 3OPZL 5EN2A 3G9AB 3NFSH 3DXAE 5CMAB 3V0WL 43CAA 3ARDB 2ZJSH 1CR9L 1DSFH 1EERB 3CNKA 2P44B 1VFUA 1X5JA 4JY5H 2P8MA 3DIFA 2R15A 3D85D 3JWDC 1WICA 3T0ED 1P7KB 3GJFA 5E6ZA 3GB7A 3I6LD 4R7NB 5JHDD 5HHOE 4K9EL 4Z7UA 4L8DA 3IYLW 5SWZB 4PJ7F 5C6TL 3H7BB 5DEGA 1LE5B 2VDRH 4E41E 4QRSB 3IDYB 5EZJA 4HZAA 2QQNH 2VN7A 1YEKH 4P2RA 5EORH 4E9LA 1CU4H 3V5DA 1TVHA 1XGYH 5A2JH 2A6JB 2NXZD 2R2EA 3TCLB 3GMPB 4H25A 1IGCH 1MUJA 1WK0A 5IHLB 2X4RB 1ND0B 5IF0A 1X5YA 1T4KA 2MWCA 1J87A 2O5XL 1BD2A 3KPRD 3PWLA 3T8XB 3QXWA 2HWZH 4PJHF 4POUB 1QFWM 3RX5A 4JY4A 3SGJA 3KLAB 1U41A 1IGIH 4XVUD 2AJZA 4M00A 3L3KA 2F54B 4ZODA 1RUPL 1YNTA 4EJ1C 1F3RB 2AI0H 5J3HC 4JR9H 3QNXB 4JB9H 5I6XC 3AREA 4LK4A 1U3HD 4KV5F 3VMOA 3TT3H 2VDQL 1QZ1A 1R3LA 4GS7C 1FFNA 3UTSE 4LLAA 2G5BA 4RMVA 4ZOEA 4GO6B 5HGDB 5EBWB 1LEGB 5FA3A 4Q2ZB 4X99B 2Z8SA 1W8NA 1XCQB 4M61B 2LTQC 4F2MA 1R0AL 5JLZA 1MLBB 3LH2L 2VDPL 3RWHA 4QRQB 4TVPH 4NN5C 3U83A 3N85L 4HFWB 1MQ8A 2WUBL 1OP9A 3RVTC 3C09C 3RZCD 3RWIB 5EO9B 3D3VB 4MJ6A 4YQXH 1A9EA 1ES0A 4WHCA 4APQC 4EN3D 4LL9A 4MAYA 3N9GH 4C56E 2J3SA 4ZUWA 1KB5A 2ESVA 3PGDA 3O2WH 4Z7QE 3FT2B 4K7FA 3F58L 3CSGA 3VFVA 4ZUUB 3WHXA 3GSNA 3K46A 5E94A 2ZUQC 1KJVA 3BRDA 1FV1A 1OGAE 4YDLC 4E5XB 4RRPA 1K2DA 4J3VA 3LN4A 4IRSD 5IFJA 1M7IB 4E41A 2NYYD 4OKVB 1E4KC 4J3SA 1VKXA 4XP9L 2H2SC 3FB7B 3C6LB 3KXFB 3U9PL 4EI5C 4BFBD 3GSQB 4JPWL 2H41A 1BBJB 3FT4B 4ZO8A 2EDOA 1FNSH 1HH6A 4YDKL 3UMTA 4YFDB 4LDEB 3MLXH 1JRHH 2WQRA 5E2WH 5D71L 5E8DH 1U2CA 3R06A 1PY4A 2H9GA 2WP3T 4NGHL 2V17H 1OQOA 5B3JE 4F33B 4JJHA 2X70B 4NRXA 4YR6A 1RPQA 4LSSH 1TZHB 3T2PA 4LAJH 1JHTB 5DHXB 3HKFA 1FZOA 5BRZB 1SY6L 4RNRB 1BAFH 2Y06H 3DX9A 3BAEH 2RHEA 2F19H 4NSKB 4WUKL 3MRLA 5DJAA 2NY0D 2WP3O 3VXSE 4Y4KB 2ADIB 3A6BL 1YNLL 3GSVB 4IRZH 4WFHE 3NABH 4HK0B 3F12A 3FRPA 4XWGL 5D1ZD 4GAGH 4DFIA 3NPSB 1G6RA 1WUNT 1UWEL 3ARGA 4F9LA 4J2XA 4AIOA 4J3UA 1ZA6A 4XPTH 3ZTNH 3MV9A 3SDYH 3SE3C 1IGML 3B9VA 4UUJA 4PJCF 3DTXB 1WBXA 2ZCKL 3BESR 2AABH 3ET9F 3GMRA 5BQ7B 3MBXL 4MA8H 1B0WA 1MH5A 4O00A 3HZKA 4JPKH 1Q94B 5C9KA 3CSPA 5DFVC 2NY2B 5CEXA 1X5FA 3GMNA 4M7ZC 1CTNA 5GS0C 4G6AC 3KPOB 5BZDA 5KZCD 2NLJA 5T1KA 4XCYA 4WGWB 3OTTA 1FQ9C 4X0KB 5DT1L 4CU8A 1S9XB 3DVNA 5C70A 2R8SL 3V95A 1AP2A 1S7TB 2QSCH 3M1BB 5T1DH 5FCUH 3JV6B 4PJ9C 5J1TC 4Z18A 2O5YL 4H1LG 5CLWA 3LEYL 3KVQA 3PIQB 1RZJC 3CH8A 1KJMB 4K3GA 4XNMA 4P99A 5IW1B 3IJSA 2GEEA 3S97C 4PJDB 1A4KB 2NPLX 3F7RA 3LDBB 2ATKA 4GRWE 5HYJE 2D2OA 3LSOA 4K8RD 2QQLL 3EGSB 3REVB 5HPMA 4JREB 4IBLT 3WXWL 2BNRA 4YPGB 1RK1B 5E8PA 4P9ML 1J18A 5F6IC 1HEZA 3QFJB 1T04A 2VKWA 5DEZA 5D2LA 3ALWA 2HVKB 4ZAKC 1KCVH 3IDMA 3NMEA 1EHAA 1J0IA 4G7YL 3D25A 1KLGB 3BKYL 5D2LF 1WT5C 3GSWA 2CKBH 4JJ5A 3ORJA 2ZCHL 3HMXH 4S1SL 2XXCB 1OOAA 1K3ZA 3BSZH 4O9HL 5J13C 1BGXH 3G08B 5IOPB 2C3VB 2Y6SD 2P5WD 5LG1A 3UEZA 3C8KA 3O6MH 4GW4A 3VFRA 4JO2L 1LP9E 2FATL 5D93B 1OSPH 4CU7A 1YNKL 3N1MC 3MJ9L 3I6KB 4BH8B 1UH4A 4A6YA 1LILA 3T0VA 5JW4R 2CH8A 1CGYA 3ULVH 2CR6A 5D1XD 4QRTA 3S8WA 4Y1AE 1OAUL 1AXTL 2AEIT 7FABH 5ESAB 2EO1A 3TPKA 4KJYA 2V9QA 1WGOA 4DN3H 3LEXB 5MERA 2W1NA 1H3GA 5MEQB 4Z7NF 3U30B 1KIUA 2DKMA 4AEEA 1RZKH 2VXUH 3T4AA 2F53D 3MV8A 1J1XH 3P9LB 3QO1A 3VXQA 4LASL 3CFDB 4NC1C 4JGUA 4U7MA 3K2MC 1LQSR 5T3ZL 3RVUC 2X10A 1EFQA 2DLFH 4LNRA 4U1NB 3U1SL 2NZIA 1N7MH 4I2XE 1U2HA 2OI9C 1OAQL 4TSAL 5E03A 4LLYB 1WIPA 3LN5A 4KK9D 5HDQL 4HCRA 1I8MB 1I1YA 1EX0A 2ICWJ 1KNOA 4CVXA 1LO0L 5CJXC 5FUOL 3KPSA 2HRPH 2EC9U 1YA5A 1ZGLA 3RBGA 3CH1B 4WVRA 3RI5F 5DD1H 1I9JH 4PB9H 1G0XA 1YYML 3JUYA 1A4JB 4XB7A 4R4FL 4P2RD 1JFQL 4CMHB 4K71B 3KDMB 2GSGA 4PV8A 4FZ8L 3WIIH 2HRLA 4U6HB 4O2CB 5GGUB 1LO5B 3GSOB 4ENED 2O5ZL 5IW6A 5JW3H 4OV5B 3QA3B 1QSFA 3GMQA 2OTPA 2F5BH 5I76B 3OGCA 3S36X 2Z8VC 5DWUL 3IFNL 3VXMB 1BD2D 3QULA 5DD5L 1AIFB 1NGWB 1JYVA 3OB0H 2AP2A 1GGIL 4WDIB 1LO3H 3LV3A 3PQYA 3BKML 1HXMA 3CFEB 3WD5H 3RWGB 4QYOA 1JF1B 2GSIA 3TZVC 1U6AL 3FQUB 2OR7A 2AKRA 2FZ3A 1CG9A 5LCVH 3QEUA 1NFDB 2PW2A 1JL8A 3CLEL 3NZHL 3SJVB 1AHWC 3DX8B 3WNPA 2VDNH 3QEQE 3ARED 3V6ZB 1GYAA 3VWJC 2XNAB 4RGND 2EDTA 4ZSOE 5A40E 4OLUH 3WS6A 1OAZH 5E8EA 5J11C 1UGNA 1CFSB 4G8IA 5CLTA 5AD0A 4RBPH 4JHZA 1ACYH 2Z93B 3FO0H 1B0RB 1YMMB 5E8NA 3K1KC 5DURD 1O7SA 2G60H 1EHXA 1R5VA 3QNYB 4G42B 4L8BA 4K23H 5MI0C 1JN6A 1EGJA 1OCWL 3DURB 4OZ4B 3VXUB 1OGTA 4PLKD 2D03H 3DMMC 4PJFA 3T1WA 4L3CB 4NBZB 3RHWF 3NIGF 4NQTA 3PHQB 4DW2L 3BUYB 4MAYD 2LU3A 1BP3B 4MDJB 2NTFA 4PJFF 1Q9LA 4OLZL 4OLWL 3PWNA 5CSBA 4JO4L 5INDB 4JG0L 3WDHA 4R97C 2FDBP 3QH3B 3G5XA 3L95B 4PG2A 2FO4B 3BZFA 4DVBB 2VITA 3ARXA 2B4CL 4P4KA 5ISZB 1R3HB 3QT2A 1B2WL 1E0OB 3LQMA 4ONFL 3MRJB 3ABZA 2CRMA 3QO0A 2EDWA 4E41D 4LFHD 4OCYL 4HWZB 4K3EL 2XY1A 4MVBD 4WI8A 5L9DH 3U6RA 3DYPA 4OSUH 1L7IH 1YEJL 3GO1H 1NGQH 2X4OB 1YZZA 2XZAL 5I8OH 1H8NA 3FJTA 3V5HB 3E6FA 2QHLA 1FGNH 4CADA 2A1WH 3IXAB 1RZJH 4WI5A 4I0PB 1MQKH 3MLRH 4J4PC 2XFXB 3TO2A 3VFUA 5DJ8A 4LDOB 3L3GB 4BKLA 5E1AA 3RX8A 2HLAA 3IKCA 1FL3B 2A0LD 3TGXA 4RRPG 3ILPB 4P2OC 4WY7H 4MCYB 3GRWL 4LKCB 4MD5A 4WI3A 4LCUB 3MRHB 5GS1A 1C5DA 1UACH 1I7TA 3B2VH 4NKMA 3E8UH 4KTDL 2V2XB 4OD1H 5FIEA 1NPUA 4ZD3H 2YUXA 4I3SH 4HUWA 1L0YA 5MENA 1KPUB 3G6AB 1JUFB 3U0TA 4HUMB 1DTUA 4JVUA 5IHBA 2XA8L 4QXUH 1D5ZB 4B50A 3BE1H 3NH7H 5CGYD 5IFAH 1GPOL 4OUOA 3ARGD 4X6EB 1IGFH 5LGJB 1MOEA 3HRPA 2P43B 2OL3H 4EIZC 1TZIB 2R0KH 4PGEA 1T83A 4FQ1L 3TPUB 1OLLA 1FSKC 4LMQE 5EWIL 1Q9WA 3MUZ1 2OCFD 4JZOA 5E95B 2HTLC 5DUBB 2ZPKH 1FNGB 4JFYA 1QFPA 3RVXD 1OB1A 4WFEE 1OSZB 2FH8A 5SX5H 3LAFA 4NWUH 5H37H 2E8ZA 4HAGA 4R4BB 2F5AH 4OCSH 3O11A 2XZQH 1JGDA 2YK1L 3OXRB 4XNUH 5T1KD 4CW1B 1ZWIB 4FXKA 3QZWA 3QDJB 1E28A 1MHEB 3D3VE 3CXHJ 3PF2A 1IZKA 1NMAL 3PHOA 1MCWM 4WGVB 4E42A 1J0YA 3QXAA 3NA4A 5DVLA 1YN6A 1UJ3C 2XPGB 1LK2B 2ZCLL 5CMAA 3GHEH 4KJQD 4F7PB 5C6WH 3ARDA 1VHPA 3H9HB 3P2TA 2PYFB 3QAZB 4CGTA 3RVWC 3H6JA 1U58B 1P7KA 4R7NA 3B8YA 3F6IA 4JO3L 3QCTH 2MQCA 3QUZB 3QHFL 4M4PA 2IH1B 2KZ1B 4PJBB 1KB9J 5AG8A 3T3MF 4KJPC 5SWZA 1G0DA 3F7QA 4K7PY 4QRSA 1I3UA 2R0WH 2DQEL 3BP6B 4MCZB 5L2KB 3BQUB 1CLOH 1CGXA 3KPPB 1GH7A 4ELMF 2BNRD 4JANB 1P2CB 2A6JA 1IEBA 3MXWL 3TCLA 3OR6B 1BREA 3C5ZB 2FHFA 2X4RA 1ND0A 1MCOH 2DM4A 4QWWD 3TF7C 4PRPB 3T8XA 5GPRA 2HKHL 4TSCH 2BDNH 2HJFB 3JV4B 5J9PB 5C0NC 5MEOB 2AK1H 3X3FL 2I60L 5KSBA 1IGTB 3QHZH 1WAAA 4LCIL 2LFGA 2C3HA 1N3NB 5D7JC 2G75B 1DVFC 1W72H 5DJXB 2F54A 2NR6D 4AIZA 5KSBF 1RIVL 2EZ0C 4J3TA 1DQQB 1MVFA 2APFA 3QNXA 5DUPH 4YDJB 4F15C 4U4BA 3THMH 1T89A 2WMPA 3FOLB 5D6CB 1RZ8B 1E27A 5I1AB 1I7RB 4QTIL 5EBWA 3VXPB 5SWQB 5C08B 2VDLH 4X99A 5J12B 5HHXH 3PL6C 1P9MA 1UH2A 4U1SB 4ZS6D 5F3HB 4RGOL 3CAFA 1MLBA 2A74B 4JQXC 4AEHH 4XWOC 1PSKH 5KS9B 1HWGB 4QRQA 5I8EA 3HB3C 4HFWA 3PUCA 4TULH 4YEFA 3ECBB 3RWIA 5EO9A 1QPPA 3ROLB 5A1AA 5LKNA 5IQ7H 2P24B 1HXYB 1X5HA 4FNLH 4U2ZA 2WIIB 2EDLA 5D5MB 5JUEH 4QHNB 4AZ8A 2L0DA 1CXIA 4GRMA 3BW9A 1HWHB 4JFQB 1BWMA 4XPAH 3FT2A 5EUOA 2J1KA 5KVDH 2P47B 3X14B 1J0HA 1LD9A 1NUFA 1WZMA 4ODBD 4Z7WE 5DC0A 4ZUUA 5LWYH 1MWAB 3MJ8B 3D87B 1DBKH 4E5XA 5EUOF 1WWWX 2DQGH 1G9MC 4Y5VC 3UO1H 4TVPE 1M7IA 4OCMC 1A6AB 2Y36H 3KPSD 4YWGH 5HYJD 3C6LA 3KXFA 4PJDE 2YEZA 3DWTA 3HCVA 3BZ4B 3KJ6H 1U93A 2YUVA 4R90H 1G7PB 1BBJA 3FT4A 1Q0YL 1ODAA 1OPGH 1RUAH 4D9QE 4P48A 5IHZB 1CFVL 1E4WH 2CJUL 1QSFD 4M9OA 3GHBL 5F1NB 2X70A 1IL1A 4F33A 1QFUH 4I4WA 4JM4H 4KDTC 1TZHA 3OG4B 3ARFC 1JHTA 2PKDA 1IKFH 2VH5H 4LVHB 2I9LB 5BRZA 4Y4HC 3VXTB 3UDWC 4UZGA 3PQYD 3Q6GL 3K7UA 4KC3B 2ADIA 4QXGH 4Y4KA 1BPVA 4I3RL 1BFVL 4ODUB 2D0GA 3GSVA 4P23B 4PY8I 5HYIA 4LCYA 3RU8H 3SKOA 3L9RB 5M7QA 5E8OB 4OLVH 3TBVB 4QRPA 3PWUA 2GTWB 4LVNB 2X4QB 2MTPA 1PZ5B 3QQ4B 4CMMB 2NY5C 1KENH 1EV2E 4AY0A 4JQIL 4NJ9H 3MRDB 4Y1AD 3DSFH 3U82B 3VGDA 2HJKB 1Q94A 1JV5B 2AXHA 5DGQA 4RA3A 1KUMA 1W72B 2WUCH 1PD6A 1GOHA 4HT1L 2VL5B 1J7VR 3NVQA 1A7PH 4NDMA 1XR9B 2ITCB 3ALXA 3SBWC 5KTEL 3WLWC 3G5YB 4X0KA 4PP1D 3VDAA 3BIAX 1S7TA 3W0WB 1FC1A 1VA9A 3M1BA 4JFHE 3CGTA 2J8OA 2IBBA 3JV6A 2A38A 5EIIA 4ZXBA 1PEZA 2R4RH 1VB9A 2FD6L 4OM0H 1IAIL 3QDGB 3CZFA 3ZO0A 2MFNA 4JRXB 2Q1EA 4P4KD 1YQ2A 4NIKB 1MJUH 3EYUL 5K9OB 1JPSH 1FP5A 2VDKL 2CXGA 1XCTB 2EH8H 1A4KA 2MCPL 1F3JA 3DV4B 4ODXB 3C08H 4I18C 4NN6C 4Q74A 4QLRA 1I4FB 5HSFA 2N1KA 2GITB 3AGVA 3EGSA 3WIHH 4YPGA 1U92B 1RK1A 4TUOB 1J11A 4YPJA 3TWCH 5AZ2H 5EA0L 4GG6F 3VXNB 3QFJA 3WLBA 1S9VA 1DLFL 3UC0L 5IWLA 4C4KT 1UFUA 5IVXB 5JR1H 5ICYB 1KLGA 2AXGB 4P46C 5FUZH 3TYGL 3NACH 5CEYB 1N5YL 4LPVA 4QEGA 3LKSB 2FL5A 1IGYB 1UYWL 1S7RA 3VFGL 1WC7B 5L8JB 4G6KH 4KKCC 4XBEH 1KG0A 1NCDH 3GMLB 4C4KO 2R69H 3V6OE 3PV6B 3O2DL 5MEND 3G08A 5IOPA 3CLFH 5IW3A 1JNLL 1LO2L 2JJSA 3C2AH 2DI8A 4WO4C 1F4HA 1MFAH 1QRNE 5SX4I 2WINB 4Q9QH 1NFDE 1CFBA 3SJVE 4JY6A 3I6KA 1ORQA 4BH8A 4HWEH 5F96H 4KPHH 3MNZA 3X3GL 1KBGH 3EOTL 5ITBL 4FQXC 5CZXC 3W11D 5DLML 2OR9L 5E6IC 3L3JB 2IGFH 5E99L 3T04D 5ESAA 2IPTL 4XH2A 2EDHA 5MEQA 3LEXA 2KDGA 3EZ8A 1JGLH 4XXCA 2JIXB 1G7MB 1YMME 3EYQD 4MMXC 2Z31B 4O4YH 4PJEF 3VG0L 1N0LA 4X7SH 1AC0A 5GZND 5I74C 3H8NA 4XNZB 1A2YB 4PJAB 1DQJB 5L88H 4L9LB 4GXVL 4HG4K 2DKUA 3CFDA 3H3PL 3RGVA 4OGAD 3V79C 4HUKB 4L9DA 2WWMD 1UG9A 3GBNL 4OCRL 4S1RH 3MODL 4R8WL 4U1NA 1DANT 4EVNA 3ULVE 2QADC 3LPFA 3ARDD 5TPWL 1AO7A 4U31A 4MA1B 3MRMA 1T0NB 4LLYA 2BNQB 4TTGA 5JMOC 2EC8A 3EKCA 4UTAH 1F97A 3QZWG 4HUXA 4EXKA 5SWZD 1G6VK 3BPOC 1T5XB 1CIDA 3CH1A 1ZHNB 2CGRL 3LQAC 3UTTA 3L3DB 3P4NB 4DQOH 2HLFC 1TETL 4ZG1A 3KDMA 2E6QA 5IHUH 4U6HA 3PWJA 1LO5A 1F3DJ 3AU1B 3HE7B 1L7TL 3W81A 3MOBL 3HN3A 4IHOB 5E08L 1OTTC 1FG9C 2XN9B 3IFLH 5I76A 1GCFA 3VXMA 1JYWA 3IJHA 2J2ZA 1SM3H 1AIFA 4YNYB 3T1FB 2JK5B 1S3KL 3MGAA 3LHPH 1KCLA 4WDIA 4ERSL 5HY9B 3CFEA 1CDJA 2X1WL 3CVHH 1T22B 4HZLB 2DQHL 3VI4E 1KT2A 1I7ZA 4GBXB 4IM8A 2F54D 3FQUA 3W82A 1QD0A 2JB6B 3AC0A 3ZL4L 1NFDA 4DKFH 4NKIL 3P0YH 3SJVA 3DX8A 5CEZH 4PR5B 3SE9H 3BO8A 3HI5H 3V6ZA 4KROB 4Y5YA 5DQDH 2ZUVA 1OTUD 4HIEB 3TEUA 4OB5L 4YBHA 4B41A 5C0AA 1GAFH 5FO7B 2AEQL 1NCTA 1QBML 1FFOB 1G9NH 2Z93A 4GKZA 1YMMA 1B4JH 4HWUA 4HWBA 4NJAL 1UENA 1QFHA 3IAGC 3D1MC 3QNYA 4G42A 4F37K 4GAJL 2CMRL 4NZUL 1MCWW 5ID0B 4UQ3A 1I3GH 1BIIB 3DURA 3EDKA 2PO6C 4OZ4A 3UJIH 4BK5A 3B6SB 4I0KA 1XR8B 3GK8H 3VXUA 3LZFL 4WV1A 3VCLB 2C4FU 2HJLA 4QOKB 1FL6B 2EDEA 4CNIA 2XT1B 3PHQA 3BUYA 3QQ9C 2R0LH 1DN0B 4MDJA 5FGCB 1A7NH 1DLHB 2BOBA 2J88L 4KK8C 1OARH 2CK0H 5FYJD 5INDA 1Q72L 2VE6B 3NCJL 3QH3A 2X41A 3L95A 2FO4A 4S1QH 4NWTH 4DVBA 3RUGB 1WFTA 5ISZA 1R3HA 2YKLL 3FQWA 1UZ6F 4KHXH 1OT2A 2VJXA 4MNHB 2DI7A 3MRJA 3WUWA 2A77H 3T2OA 4N0YL 1T7XA 4HWZA 3C6LD 3KXFD 3K8LA 4NO2B 5ID1B 4XTRC 2ICWB 4KK6C 2DQIH 3M8OL 2X4OA 4MQ7B 5L2KE 3V5HA 4D9RD 3IXAA 5GSRB 4QCIA 3GMMB 2XFXA 5E2VH 2D7NA 2DQUH 3L3GA 4UV4L 4YX2L 1MAJA 1UEMA 1ZGLM 3O3AB 2NCMA 3ILPA 3DV6B 3GKWL 3I6GB 4MCYA 4NBYB 4FFWD 4XP4L 5F1SA 4LKCA 1IT9H 4P3DA 3EYVA 3MRHA 3ZDXF 4WI7A 5BRZD 4I8DA 4IDJL 4HKJB 2V2XA 5JIIA 4KHTL 2VLLB 4JM2B 3HZMB 5EZOH 3MLWH 5GRYA 4Y4KD 1KEGL 3SGEH 1KPUA 3G6AA 4UT7L 1A6VL 1RJLB 1JUFA 3LRSB 5FYLH 1D5ZA 1D6VL 1INDH 2VTFA 2YD1A 3O3EB 4HMCA 3VDBA 4X4ME 5F93C 1JPFA 2AV1B 4QRPD 2FECI 2FHBA 3DVGB 4QHUB 1ZLSH 4UIMB 4O51B 5D9SB 2WIMA 1ZA3B 2CXKA 3PGCB 4X6EA 1X6LA 4X5XB 5LGJA 1TZIA 1UKQA 4TNVK 3PDOB 5C0RL 1IAIM 5GZOC 3TPUA 3SDAA 1Z2KA 1KYOK 3GIZH 1X7QB 5C08E 5BW7A 1KELH 3CVHB 3MLYH 3HZYB 1FNGA 2NY2D 3MRPB 4NP4H 1OSZA 4IRJA 2IAMB 3NFSL 4R4BA 5JXAH 2ZJSL 1DSFL 4KAQH 1AR1D 5KS9E 4G8EB 3T09A 2VWEE 3OXRA 3CZJA 2I07B 1XH3B 3O6FC 5FYKU 2R4SL 4KKAC 4CW1A 1ZWIA 3QDJA 3GJEB 3QUYB 4O2EB 4X8JA 4DTGH 4PRHE 1AR2A 5D5ME 5F8QC 5IB3B 1LK2A 3AB0C 4F7PA 2BRRH 4LSDA 2QQNL 2PYFA 4WW2F 1YEKL 5DYOB 5INCB 5EORL 4ZXBD 4DEPC 1CU4L 1U58A 1XGYL 5K93A 1E6OH 2VLRE 3QUZA 4PJBA 1ZAGA 3VXRE 4NN7C 1U8IA 4XAWH 4ZTPL 5C0JA 1QBAA 2Z9TA 4IS6A 3QWRA 1BVKB 1UA6H 4MCZA 3BP6A 2VC2L 1SJXA 5HDBE 4HLZG 4YUEH 5KN5B 2ZUWA 4HDIA 1CZ8H 4D9QD 1CXEA 1P2CA 4UT9L 4NZJA 4O58H 3S3SA 3OR6A 1IGIL 2WBKA 3QFJD 2NX5E 4PJ8B 1IKNC 2VLJB 4P5TC 2HYMA 4LSVL 4F7EA 1KCUH 5T1LB 5MHSE 5AUMB 1A14L 4PRPA 2AI0L 3IRZA 4JR9L 4CN4A 4JB9L 2YD5A 2HJFA 2MKWA 3JV4A 1QFWH 4CN6A 5J9PA 2E7LA 3TC9A 1M6OA 3KS0J 3RZWA 3TT3L 1V7NL 5I1DB 1HSBB 4Q0XH 1HQ4B 1DBJH 5KVEH 4JZNB 4M6OH 4X6DB 2G75A 3HNTH 4K9EC 2MHAB 3BGFC 4AT6B 2ORBH 4RZCB 2AV7B 4DGIH 2W65A 1TQBC 3K4ZA 1MFEL 1L0XA 3FOLA 1A6TB 3G6JB 3TO4A 4TVPL 3CDGA 5DMJB 4ZOBA 1RZ8A 4QT5B 1IE5A 3IU4H 5I1AA 1I7RA 5SWQA 4JFZH 2P42B 5C0IB 4YQXL 2Q7NA 1CK0L 5MEPB 3O2VH 5JQ6L 4YBQC 2PR4H 1XF2B 1WBYB 4XVSL 2A74A 4F8QA 2AK4B 2CO7B 3IXTB 3UXFA 2EEAA 1VSCA 5FKAB 3ZT5A 3JBG7 2IH3B 1D5MB 2DM7A 1CICB 3BPCB 3ECBA 4OFIA 4Z7QF 3ROLA 3K74B 3FQNB 4DUXA 2P24A 2WIIA 4NFBA 1ITCA 5D5MA 4LLWB 5TQ2H 3RGVD 3MCG1 1N64L 1MCFA 4S1DD 1UT9A 4JFQA 2DYPA 1RZGB 1SQ2N 2W59A 5F9OH 4BQ9A 1I8KB 2VZVA 5T3XD 1MWAA 1W0WB 2W91A 1AO7D 3MJ8A 2WBJC 3ARBC 3TN0C 5GIRB 5E8DL 4L4TB 1YPZB 2P5EA 4WJ5B 3QDGE 4OCLC 5GGTH 4JRXE 2YD7A 2V17L 3HUJE 4PY7B 3O41B 3S36H 4X6FB 2UYLB 3B9KC 4LSSL 2DM3A 1ZT7B 3QIBB 1MFBH 3BZ4A 1G7PA 3I9GH 1ZS8B 5B3JF 1TZGH 4I3GA 1QR4A 5EPMB 2DL2A 1BAFL 2Y06L 3BAEL 1QNZL 3J8F7 5IHZA 4RMWA 1AXIB 4OV6F 3IF1B 4M43H 3T2QA 5K33A 3MBEB 1E6JH 3NGBC 4M93B 5F1NA 4IRZL 2VXQH 5B3NA 3NABL 4R0LC 1A6WH 3VXMD 1MCEA 5IVXE 5BXFA 3D0LA 4GAGL 1DBML 1P4BH 1D6EB 2I9LA 3OB0K 5FGBC 3T3PF 3VXTA 4MYWB 4XMLH 4IDLA 3GGWB 4XPTL 3ZTNL 1DN2A 4ZTOH 5FK9A 3WKNA 3SDYL 4ODUA 4P23A 3T0BA 2AABL 3KPTA 4ZDHA 3BPLC 2BVYA 2Y7QB 5BOPA 3S37X 4JPKL 2ZUXA 3L9RA 4YH6A 3GFUA 5J6HB 2D7MA 3E6HB 5E8OA 4XX1E 3TBVA 3ZDYF 3JVGC 3SJVD 1BBDH 2GTWA 4Q9CA 5BZWB 1PZ5A 4HC1A 2UUDK 3QQ4A 4I1NB 4N0UB 2O26U 4CMMA 2AJYL 1EFXB 1FIGH 1SHMA 3L5XL 1UM4L 3TFKC 2VERN 3MRDA 4JN2B 4H88L 4XBPB 1J1OH 4RBPK 1TNMA 4G9FB 2OZ4A 4WU5B 1T66C 5I73B 5T1DL 4MDIA 1A1OA 1YMMD 5FCUL 4NNPH 1FH5L 3QWOA 4LEOB 5DD3H 3RRQA 4F7MB 3VRLF 1TFHA 1UXSB 2OLDA 4RFNB 3HRZB 2RJMA 3MV01 1XR9A 3VXUD 3G5YA 3BRGC 5I1JH 4EN3C 4PJAE 3IU3A 1FO0A 2B2XH 4QHLB 2BNUB 4G80B 3W0WA 3FN9A 2J6EH 4HHAB 3KPQA 4XZUB 4MNGB 5I2IB 3RAJL 4B7IA 3D39B 3VFSA 43C9B 4JFXB 3EHBC 3RDTB 3MRKB 2MQ3A 4KI5C 4ZS7H 2DM2A 5ISZD 4G6JH 3AS2A 1MRCH 3SDXF 2QJDA 1KCVL 1XCTA 5ERWB 4YXKH 5E9DE 1MIEL 3DV4A 4ODXA 2C4FT 3A67L 4U33A 1ZXQA 3H3BC 4G43B 1I4FA 5KG9B 3L3OB 2MNUA 2GITA 2Z8WC 2CKBL 1WZKA 1FDLH 1R5IA 4KXZH 4OD2A 1ZTXH 1U92A 5KVFL 1HYSC 1ZMYA 5JPNA 2YD8A 3MXVL 4JKLA 5EU3A 2YD9A 4M03A 1T20B 2NMSA 3VXNA 5IMLA 1BGXL 1NEZB 4BSJA 3QUKB 4IIQC 1RHFA 1FN4B 2XN9E 3P4MB 5ICYA 2AXGA 3CC5B 3WUWG 5I71C 3LKSA 2NY0C 3PDDA 1IGYA 2YS4A 1PLGH 1WC7A 3P0VH 1H9VA 5D70H 3A6OA 4BJLA 3TH2T 3GMLA 1M4KA 1LP9F 1UZ8B 3PV6A 5FYKH 2AEWA 1QSVA 1IC4L 3B4NA 4NYLB 3T0AA 3ULVL 2Q3ZA 5DMYA 2YN3A 5JTWA 5HGAB 4D94A 2Y23A 4DN3L 5DJ0B 3OWEA 2FSEB 2LABA 1Q0XL 4MGXA 5EU7C 2VXUL 2YC1B 4K3HA 4OZHB 3PWPA 1A47A 1J1XL 1KN4H 4XMPH 1LGVA 1KJ2H 4Y19B 4Y89A 4P2QA 2FR4B 1MJ8H 3SDAD 4U1JA 4HPYL 1NL0H 5DHVB 5TDPB 1UKTA 2DLFL 1IZJA 1G7MA 4XCCH 3AFLA 3WJLA 4C57C 2XWTA 5F1IB 1HZHH 5EUKB 1T3FB 2XTJB 4OAWB 1MHHA 3H9ZA 1QBBA 1TCRB 4J23A 5ABDE 1A2YA 1DQJA 4L9LA 4UMGA 4JGJA 3L6FB 1NDGB 2W0LA 5I6XB 3QDJD 4U1LB 2EKSB 5E5RB 4UILH 1OP5K 5BOZG 2HRPL 2O5XH 3O6LH 3R4DA 5FGCE 3VWKC 1G7LB 5DD1L 4PB9L 1AXSA 2GFBB 1NGPL 2HN7B 5J1AA 4CN1A 3WIIL 3MV11 1O0VA 1T0NA 2IFGA 2BNQA 3B9EA 2H2PD 3X12B 2QQQA 5JW3L 3QUZD 5C0GA 1KPRB 5HVHC 2ERJC 5E2JA 1JPGA 2OK0L 5H8DA 2J12B 1J8HB 1G7QB 1T5XA 3BT2L 3PNWA 3RWFB 1ZHNA 5EC1A 3QWRD 3C09B 3L3DA 4J12A 5DXWA 4YZFE 3BQUD 2JJTA 3BN3B 4APQB 2D9CA 5KW9H 1LO3L 2WANA 3LS4H 4XNXH 3WD5L 2BVQB 3HE7A 3S6CA 4IHOA 4LCWE 1ZVYA 1UCBL 4NO5B 5LCVL 1R0AH 4X7CC 4PRPD 4YNYA 3W5MA 3T1FA 2JK5A 4OF5A 4BFEA 3BIBX 1NCUA 1MHCB 2VDNL 3LH2H 4XHJC 5HY9A 4PTTB 3DRTA 1C5BL 1XGPA 1T22A 4OLUL 5GQBA 2WUBH 3T77B 4HZLA 5C09B 3HC0B 4EI5B 1VFAB 4GBXA 2X1OA 3LQZB 5DJ6A 5A2IH 5IB2B 3QI9C 1UXWB 1UWGH 4IMKC 1ACYL 3E2HB 4LPTA 3FO0L 2AEPH 3WSQL 1U8JB 3SCMB 2G60L 4PR5A 2UWEB 2ZSVB 4K23L 5JXEA 2A83A 2DJSA 4MLIA 1W0YT 2XRAL 3F58H 1BEYL 5HD8D 5J0BA 2D03L 4PD4J 1MLCB 1RJYA 3RKDC 3QQNA 4KKLD 2OMBA 4WNQB 4W4NA 2FWOB 4H0HB 1FFOA 3RA7L 3HG1B 4XNQA 4U0RC 4FTVB 4XP9H 2DQFB 5ID0A 3E0GA 3ARWA 1BIIA 4Z8FH 4MNQE 5EBGA 1XR8A 1E4JA 3D2UB 4YDKH 4EIGB 4OFYA 4QOKA 1FL6A 1BZQK 2H8PB 4K07A 3IS1X 4FQJH 1FAKT 4NQEA 3RNQB 5AG9A 1XZ0A 1KJ2B 3VH8B 4YHIB 1DLHA 4CVZB 1OVZA 2DYPD 3LY6A 3D0VB 4OSUL 3GO1L 5FB8B 4WI4A 3SKNB 1SY6H 4HWNA 4XAKD 2NY4C 4FABH 5CBAB 5I8OL 4QGTA 5GRVL 1FGNL 3U4AA 3RUGA 2A1WL 4WUKH 2CRYA 1MQKL 3MLRL 2P5ED 5DC9B 1SEBB 5DQ9B 4MNHA 2VL4A 1FZJB 5C0BB 4Y7MA 3BN9D 4WY7L 3LKRB 2VXSH 4NO2A 5ID1A 3MR9B 1KGCE 5BJTB 4HBQA 5E00A 4MQ7A 4U1MB 4G7VH 3B2VL 4ZO6A 2X4UA 1UWEH 5DRXB 3E8UL 5CWSA 4ZD3L 4K3JH 2EYSB 4I3SL 3GMMA 2MJWA 3ES6A 4OQTA 4PJ9B 2LE9A 1J1PH 3U79A 1R3JB 2ZCKH 5C1MB 1JHKH 2VLJE 5MHSD 3MBXH 3I6GA 4QXUL 1GL4B 2AGJL 4RMSA 2APBA 2JCCB 3BE1L 4PJ5B 5ANMA 3SO3C 1F6LL 5IFAL 4HKJA 5FO8B 2VLLA 4JM2A 4R4ND 1IGFL 2B1HH 4LVOC 1VPOH 4WFFD 4GKNB 2A6KB 4BSWA 2R0KL 4P23D 2B4CC 1RJLA 4X6DE 4QRUB 3QDHA 5F7YC 5I17B 3LRSA 4FZEH 1QA9A 3O3EA 2ZPKL 1U91B 3QEGH 1TQCC 2AV1A 5F6IB 5TGBB 1NAMB 1OLZA 3DVGA 4QHUA 4NWUL 4UIMA 5D9SA 3KHQA 2F5AL 3GZKA 4ZAKB 3PGCA 4Y2DA 4X5XA 2XZQL 3LEYH 2V7HB 3G6JE 4KMLB 1JWUA 3TVMA 1YEIL 4XNUL 1FLRH 4HXAH 5HYFA 4PRDA 4WU7B 1A1MB 4JDVB 2NXZB 1D5IH 4KMTH 1J12A 1I1RA 1X7QA 2UVEA 4MS8C 3HZYA 3MRPA 4Z7OF 2GW5A 1F4YL 2IAMA 1WBZB 4DVRH 3GHEL 4U3XA 5L0QB 2IJ0C 3OJMB 3TM6A 4G8EA 2QQLH 3HPJB 2I07A 1XH3A 25C8L 5TE6H 3WXWH 5B4MD 5KSUB 4MAYC 4TTDD 3RTQC 4O2EA 5CJ8A 1QSEE 3O3DB 4H1LH 3W0WD 4KKBC 5IB3A 5DVMA 5D7IF 2RCSH 3EZJB 2R0WL 3BH9B 2W38A 3BKYH 3QP3A 1CLOL 2LU7A 1L9MA 1RULL 4L1DA 5INCA 4ACPA 2R39A 3OAYH 4M62H 1EEYB 5HYQB 4WW2C 3QRFM 3ZYOA 3QDGD 3LKNB 2A6IB 5BVPH 5TE7H 4N8CH 3CVIL 4L4TE 2R1WB 1JHLH 2FYYA 1G7JA 1BVKA 5GJSH 2ADFH 4TSCL 2BDNL 5KN5A 4LSPL 4X4XB 2FATH 3ZE0F 2XWJB 2AK1L 3KS0H 1YNKH 1MELA 3MJ9H 3QHZL 4W6WB 2CUIA 3GMOB 2X9WA 4PJ8A 4GT7A 5CIPH 3UTOA 1W72L 4NCC2 1D5XB 2OI9B 5I8KH 1S9KC 3AM8A 5AUMA 4K8RH 1OTSD 3K80A 4GUPB 5DUPL 1NKOA 3THML 1IGJB 4LBEB 2GY7B 5I1DA 4X9GA 1HSBA 3MV7E 1HQ4A 1NGZA 2CUMA 2BZDA 1X5IA 5DS8B 2MHAA 2VDLL 5HHXL 5CJQH 4RZCA 2D7QA 3HNSH 2AV7A 3U0PB 3MLUH 5FDWB 1DR9A 5DFWH 4AEHL 3A0OA 5CILH 3BDYH 3U1SH 1A6TA 3G6JA 1OF2B 4NT6B 3REWB 1ADQH 3PWPD 5GGVY 3O3UN 1T03H 1QPXA 4OLXL 2WZPD 4P2QD 5DRWB 5C0IA 5I18H 3C9NA 3QXVA 1WSST 4P2CG 5HDQH 5MEPA 5IQ7L 4FNLL 3FQXB 5IROC 5JUEL 4G9FE 1XF2A 3H9SA 1WBYA 3HS0B 3MACH 4JFOA 2AK4A 4XPAL 1Z5LB 3TZVB 3IXTA 1S7UB 2Z31D 5FKAA 2Q87A 1YYMH 1F6AB 5LWYL 1CICA 3BPCA 1F4WH 4N8PA 4NFDA 4S2SB 1DBKL 1SYVB 4HD9A 1W2KT 3FQNA 4BQ6A 2DQGL 5DO2C 3UO1L 1KF9B 5BO1H 4Z7WF 3S96B 3I85A 4YWGL 2XOTA 3IFNH 2YMXH 3VGEA 3KJ6L 4UNVA 4BFIB 5J11B 2NY6C 4QHMB 4YHZH 1FJ1B 5I8CB 4KU1A 1W0WA 5DJYB 2IBZX 1OPGL 1RUAL 5GIRA 3BKMH 4L4TA 1YPZA 4WJ5A 2BNQD 2VLKB 1E4WL 3CFBB 5MI0B 5TDOB 4PY7A 3O41A 1RZFH 1QFUL 3QPQD 4X4YB 2UYLA 4JM4L 4ALAH 1ZT7A 3QIBA 3ESUF 1JGVH 1IKFL 2VH5L 3NZHH 2EE9A 5HI5D 1ZS8A 3DMMB 4H1LB 1A7RL 3GJFH 4JG1H 4ODWB 1G7HA 2B7DT 3K4DA 5KVGL 4U6YB 3IF1A 4QXGL 3HE7D 1WEJL 3MBEA 3MTRA 1HHKB 2XN9D 1F5WA 5HI3C 5JDJA 4FQQB 3RU8L 3HZVB 4Z9KB 3RNKB 1WQVT 5IT2L 1S78D 4Y5XC 4ZUSB 1D6EA 1LEKB 1REIA 1MFCH 1KTLB 3CX2A 3GGWA 5CJBA 1KENL 1YUHB 4NJ9L 3FQTB 3P9MA 2W9EL 3RY6C 4GBXD 3W2DH 1TMCB 4XPBH 4TQEH 1MCQA 4DW2H 3E6HA 2FB4H 2WUCL 3VXOB 2FX9L 3LKOA 4OLZH 1GZPB 4N0UA 4KROD 5JXED 5F21B 1EFXA 4JG0H 3QJHA 4P2OB 3NIFE 4OZHE 1DCLA 4JN2A 2EXYC 4JFEB 3KLSA 4XBPA 3EFFB 1OM3H 4WU5A 4JPVH 4ZO9A 2PCPB 2DBLH 4K3EH 2X05A 3H42H 4LEOA 4F7MA 1EO5A 3MRRB 4Z76B 1UXSA 3HRZA 4ISVB 4XGZB 1YEJH 1OL0A 2R4RL 4JO1H 4OCNC 2XZAH 3EJJX 2XTJE 4OM0L 4TNVF 3U2SB 1T7ZA 4QOKD 1N59B 2BK8A 1E4XI 2GJ6B 4QHLA 4O5LH 2BNUA 1FG2B 1HDMB 1WCBA 4G80A 1MJUL 2JELH 1JPSL 4HHAA 4NQED 4XZUA 4MNGA 5I2IA 1DUYB 4YC2C 3C08L 4UT6L 3D39A 4U1HA 1CE1H 4OM1H 43C9A 4JFXA 4HS8H 1FSKB 3OKNB 1F2QA 3RDTA 3DX6B 2ED7A 3MRKA 2QHRH 5CP7A 3WIHL 3CSYB 4KTDH 1T1WB 1AE6H 2YRLA 1KCKA 3NCMA 5AZ2L 3QIUC 5D1XB 5ERWA 1S7XB 4PJGE 1KB5H 5JR1L 4PLJD 1J8HE 5FUZL 4AENB 1JMXA 5KG9A 3L3OA 4YE4L 1IM9B 1AY1H 1I7UB 4K7PL 4WFGE 3SDCC 3TCXA 3C6SB 4G6KL 4XBEL 1OW0A 1UJ3B 2F53B 2J8HA 4RDQF 1IEHA 1T20A 4BUGA 1NEZA 2R69L 3ARVA 3QUKA 2AQ3A 3FB8B 5EWIH 1FN4A 3P4MA 1XIWC 3C2AL 5FF6B 1EIBA 1NLBH 5GRUH 3CC5A 1MFAL 1GC1H 2G5RA 4Q9QL 5HJ3B 4OJFL 1I8IB 4D0DA 2MSPA 1J8KA 2OS7A 2CRZA 2AJ3B 4HWEL 4JM2D 4KPHL 1EBPA 4LSQL 5FUCC 1KBGL 1IEAB 4GG8B 4FA8A 5DC4B 1UZ8A 4YO0A 4Q6YA 3GJFB 4PJ7B 4I48B 3CMGA 2EYRA 1EVUA 3ZE2E 2IGFL 5HGAA 5GGSY 1OY3B 1II4E 5DJ0A 2PNDA 3QUMA 4EDWH 2FSEA 2ZCLH 3LD8C 4O4YL 2UWEE 4Y2DD 2YC1A 4OZHA 4X7SL 4I9WE 3TVMD 3V5DB 4Y19A 1TVHB 2CPCA 5DRNA 4M6ML 2IANE 2FR4A 4JDZA 1AQDB 1LDPH 4BA8A 5DHVA 5TDPA 4I77H 2DWEB 4PJHB 1G6RH 1MCLA 3HG1E 2IAMD 5FYKE 4FTVE 4G6FD 4XCNA 2VZTA 5F1IA 3T4YB 5EUKA 1T3FA 1M1SA 3PABB 4OAWA 5FKPB 4XP6H 4NUJA 2ZUSA 5AWNH 2W9DH 4JY4B 3KPNA 3ULVF 2XWBB 4GXUM 5F7HA 3HC3L 3L6FA 4GMTL 1NDGA 4EBQH 4F15B 4PRAB 4U1LA 2EKSA 3QUXC 3L3KB 1YNTB 4PRBA 4TN9A 5C3LD 3NBNA 4RGMC 2A73A 3DYOA 2P46B 4DQOL 2GFBA 2HN7A 3O8XC 2R29L 3PL6B 2I60H 1A3RH 5GGQH 4RGNB 5C07E 2DBJA 1PYWB 2BFVL 1FFNB 4LCIH 3X12A 2G5BB 2IBGA 2EDBA 2PTUA 3V2AR 2E7MA 4EUPA 3IFLL 3TT1H 3IAQA 1J8HA 3RWDA 3RWFA 2F8XC 5HHMB 3X13A 1M05B 1SM3L 4NO0B 4HUNB 1QR1B 3MRIB 2FBJL 3LHPL 4APQA 3DHMA 1OP3H 2I27N 2VZOA 4QO1A 5D7LA 3CIQA 3CVHL 3DETC 4PJ8D 1A9BB 5AZEH 4ETQA 4MJ6B 5DI8A 5T1LD 4ZO7A 5HGHB 5SV4A 3VI4F 3P0YL 1X6NA 2BY2A 4ZUWB 4L1HA 3QIWC 1MHCA 5DJCB 4Y5VB 2JCCE 3SE9L 3HI5L 1KB5B 2ESVB 1BOGB 1CQKA 4K7FB 3QRGH 1E4KA 3JV5A 3V7MA 2KL6A 3VFVB 3MOAH 1GIGH 3T77A 5C09A 3WHXB 3HC0A 4EI5A 2VQUA 3GSNB 1CD0A 2OSLB 5E94B 5CBEA 3T0EE 2J8UF 1GAFL 1KJVB 3LQZA 4YHOH 1Y6MR 3SGDI 3I6LE 1PQZB 1UXWA 5JHDE 4WEUD 4F8TA 3U0WH 1X44A 2OJZH 1AGBB 1G9NL 3LN4B 3VGAC 1U8JA 3AMLA 3SCMA 2VZUA 3VMPA 1VKXB 2UWEA 5BMFH 2ZSVA 1S5HB 8CGTA 1I3GL 2E3VA 4R2GC 1LNUA 3UJIL 1ORSA 1V3KA 1HH