4PLKC

Hepatitis e virus e2s domain (genotype i) in complex with a neutralizing antibody 8g12
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
211
structure length
198
Chain Sequence
DIQMTQSPASLSVSVGETVTITCRASENIYSNLVWYQQKQGKSPQVLVYAATNLPDGVPSRFSGSGSGTQYSLKINSLQSEDSGSYYCQHFWETPFTFGSGTKLEIKRADAAPTVSIFPPSSEKVLSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTSPINR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords Capsid protein
publication title Structural basis for the neutralization of hepatitis E virus by a cross-genotype antibody
pubmed doi rcsb
source organism Hepatitis e virus
total genus 33
structure length 198
sequence length 211
chains with identical sequence G, K, L
ec nomenclature
pdb deposition date 2014-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4plkC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4plkC01
3TT1L 4UAOC 3W0WB 4G9FD 4PJEB 2F54D 4UIMB 5F9JA 4TTGA 5LWYH 1MVUA 2FR4B 1QNZH 3O11B 4QXTB 1AP2B 1Q72L 2PW1B 1A9BB 4Y2DD 1ORSA 2XZZA 1N8ZA 1FJ1B 1U8HA 4KPHH 2OK0L 3P11L 3PQYA 4FZ8L 4OZGF 5DD6B 4PG2C 3EO9L 1I1AD 3CFBA 4DZBB 5L0QC 5B4MD 1V05A 1ZA3A 4GLRI 2X4QA 5HBBA 1A3QA 2R4SL 1A6PA 4MD5A 1YDPB 4HWZA 2I60L 4QRPB 3SY0B 4PS4L 1E6JL 1F4XH 2XQBH 4HWEL 2KQMA 1B4RA 4PJXB 4QHKJ 4FS0A 4MCYB 5I74C 3MV8B 4H1LG 1KIPB 2WWMC 3BN3B 1L4IA 4BH7A 3NIGE 4XNXL 1FE8H 4UTAL 4YX2L 4QRRE 3GM8A 4XP4L 3ZYJA 2YPKA 3VFNA 4JKKA 4ZDHB 4YK4B 3S8WA 3P4MA 4P23C 3SE3A 1JJUA 4NJAH 5I0ZA 2D9CA 3NA4A 4M61B 5JPNA 3EJYC 4KKAC 1YNKH 3DUSB 3PQYD 3AS0A 2NY6B 3WHE0 1T5WB 4HK3J 3QQ4A 4LLDB 4X80L 2L7JA 1JGLL 4POYA 4YXHH 1BVZA 1UACH 4N8VA 1F4AA 3SGJC 1A0QL 1SEBB 4LP5A 2WV3A 3QIBA 1NGWA 1Q1JL 1ZHBA 3GHBL 2C26A 3DO7A 1JK8B 1N5AA 5HGHA 4QOKD 3ALXA 1CD1A 2FZ3B 4OFIA 3G6AB 2HT3C 5ISZA 4GAJH 3VFVB 5IMLB 3QWOA 2Y72A 4YC2B 3ILQD 4XVTL 4RZCB 2X44D 1D5ZA 5D96B 4BH8A 4C57C 1CFSA 4F2MA 5BRZE 4P9HC 4XX1E 1KC5L 3QHFH 4PJ7E 3QNXA 1ETZA 2AEQL 2VERN 2CDEA 4OGXL 2EDTA 4LK4A 4DKFL 4G8GA 2IPTL 3ZKSD 2HFGL 3WFBL 4KFZC 2J12B 3OZ9H 3KJ6H 5I16B 2X6MA 4NQEB 4PRHA 3UJJH 1JVKA 3P73B 5E7BA 4NO3B 4NQUA 3BGFC 2XACC 4HUNB 2JB5H 4KROD 1JPFB 3LKRA 3A0OA 4XBGB 3X3GL 3O41B 3UX9B 5FHAL 3QI9B 3WKNA 1MCDA 4DCQB 3OKLA 2PO6B 1U93A 2X9XA 1BD2B 2X4SB 1NAKL 1FYTB 4ZPTB 5FYLH 4M93B 1T03H 1I3GH 3HC0B 5C6PB 2J8UB 3BD5A 5J9PB 3W39B 4ERSH 3CUPA 4TSAH 2FH8A 4HPYH 5EZOH 1BX2B 4K07A 3R4DA 4QRQB 1BOGB 5I19L 4U1MA 5IVXA 1OAZH 3X12B 5T1KB 2D9QB 2CLZA 3NTCH 1NBZB 2P47B 2UZXB 2VQ1B 5EO1B 3SKMA 4JDTH 3NFPB 3ZTNL 4HH8A 1CE6A 5TDPA 3KPRA 4NM4H 4J1UB 5EU3B 3BVNA 3GMLB 1MSPA 5DJDA 2B4CC 4ZOAA 3CMOH 2PW2B 4GKZA 5LGHL 3PWJB 5D70H 2Z0BA 3IJSA 2ESVB 1U8PA 3RWGA 1UJ3B 1QSEB 3I6GB 1NC2A 3MLRH 2VDQH 1CDHA 3P9MA 4WHCA 2F53E 2YPVL 1IBGL 1JRHL 4LPTA 25C8H 4DK6A 5MP6L 3ZKXC 5C0FA 2IFGA 3GGWA 4M1DH 2IH1B 2NY5L 4HC1L 1KENL 5CBEA 1C7TA 3ILQC 2ADJA 3AY4A 3VW3L 4HX1A 4PJIE 4OLEA 4UOW1 4AEHL 2R0LH 5EO9B 1FAIH 4OCXL 5I8OH 2DQJL 2XN9A 3KNBB 4OLVL 1F4HA 3GI8L 4FQXD 4YHOH 3MV9B 3L3DA 1TTUA 5ICZB 1BGXL 2D0GA 2FEEI 4FXGA 3RVVD 3X17A 2G9HA 2VDLH 3SE3C 4PJ5E 3CVHB 3RVTC 4MJ2A 3CD4A 5AZEL 3L3IB 4YFDB 1G7JA 1XF2B 3Q1SH 5HDQL 1R24A 3MLZH 4FFZL 3WEXA 1E27B 1DN2A 5D7SL 2HA1A 3LDBC 4PLOB 5ESQA 2BY3A 1UZ8B 2OL3B 1T22A 1H8SA 3IGAA 1F6AB 3EYSH 4PJHB 5BQ7A 5E95B 2OJEA 2WMPA 3ROLA 3DIFB 2P24A 1MRFH 5KN5A 1BIHA 1MCPL 2VE6A 1UC6A 1ZSDA 1DL7H 3SJVA 4YPGA 4GT7A 3GHEL 3IT8D 1TZHA 1KGCE 4MSWA 1DQLL 3AS1A 4MZ3A 4N0CC 4IHOB 2B5IB 4ORZC 5IGXL 3AB0C 3OPZH 4HK0B 3TZVB 4PV8B 4I48A 3MYZA 32C2A 2R2BB 3UBXA 4NSKB 4W4OA 5EFIB 5LGJA 4R4BA 3NZHH 2YK1H 4OT1H 3WDIA 3WFCH 3RWJA 4CU7A 4HJJL 1F6LL 4PJGA 3JUYA 1F90H 4MQ7B 3D0LA 2C4FU 4FNLL 3LVEA 1KN2H 5EOQL 3SGDH 4X9HA 5FF6B 1G7PA 1FNLA 5FYKH 3M8OL 2MQCA 4FN0A 3O2DL 5SX4I 3SKJL 4IRSD 2X1PA 3S98A 5FXCH 1A6TA 1ZLUK 1XIWA 4ODVH 4KDTA 4F9PC 1RHFA 3NCYP 1I9RL 1I3RB 3MR9B 4KZEH 5FYJH 4XC3L 1S7WB 4JFDE 3IDYC 5HPMA 1DQML 4CRPA 2AEPH 3L7EB 1BVLA 5C09A 5FO9B 1X5XA 3IDXL 2E7BA 1KB9J 5GXBB 4YWGH 1AE6H 1X44A 1A7OH 3BESR 5CUSL 4OCYL 5C07B 3VI4F 4ONGL 4LCUA 2X4TB 2CMRH 1MHHA 2VZUA 1VB9A 3UTPD 3HI1B 5I15H 3KPMA 3OB0K 3KLHC 1YEIH 3MRLA 1AGFB 2FATL 3X13B 1OM3L 1QRKA 3AXLA 1MQ8A 5KVDH 1OSPL 1KJVA 2FIKA 4U6YB 5DQDH 2NXYD 1NGQH 3PGFH 1C08B 5KOMC 3SOBL 5F7KC 1I9IH 5DK2B 1WQVT 3CZJA 3NCYS 3TT1H 1FL6A 5ANME 4D9RE 3PV7A 2G60H 1IKFL 3AY4C 5HI4D 2Y6SD 4BK4A 1BVKA 1F11B 1P4LA 4GG6A 2GJ6B 1SYSB 5EA0H 1G9NC 1KJ2B 5J1TC 3VXMB 1QPXA 4KI5C 2Z4QA 4ZS7L 2OK0H 2MFNA 3P11H 2XKSA 4FZ8H 1GGTA 3NCFB 3OJMB 5GZNC 2OQJB 3O9WA 1S7VA 2WLZA 3EO9H 3FQRA 2V2XB 4YIQB 2HKFL 2O26U 3C6SB 5DUMH 3BD4A 4MA1B 1XGPB 3T3PF 4D8PB 2HRLA 1R3IL 3WIFB 2R4SH 1HKLL 1X7QA 2XWJA 4WEBL 4AG4L 4LHQB 3SN6N 4PV9B 1NBYA 3LD8B 5C08A 1E6JH 4F37K 4HUXB 3VGFA 2Y4SA 4RFNC 1JHTA 3V4VL 1FVCB 1QEWB 4Z76A 4XNXH 4UTAH 2CUHA 4Y8DC 4YX2H 4ELKA 3LEVL 4NCC2 2AK1L 1Z2KA 2CKBB 3D2UB 5T3ZL 3P4OB 3SDXA 3SDDA 2AV7A 3IDNB 4JPWL 3NFSH 4Z5RB 4RGOL 4QRRB 2A6JA 5IQ7H 5CAYB 1X5JA 3OAZH 1XGTB 5DJYB 3RTQB 4R9HA 4X80H 3RNQB 4DEPC 1I7TA 4MA8L 5DMIL 4ALAL 4K3GA 3JXAA 5I73C 4UT9L 4XNYH 4EN3D 1FZJB 1A0QH 5L9DH 1BFTA 5L8LB 3GHBH 1QSFA 5M94B 1MCLA 3VXRA 5JORA 4P99A 5DMJB 5C08D 1OLLA 2DM3A 3TCXA 4W68A 2DQIL 3O4LD 4X0KB 4RRPA 3NCJL 2P8MB 4XVTH 4NWUL 3QUYA 2VWEC 5KZCB 1PFCA 1XIWC 5CGYD 4YHPB 3I3DA 3VI3F 5KSVA 4KDTC 1EZVX 1H5BB 1KC5H 2B1HL 3RA7L 2GCYA 1FGNL 1YEFL 4QWWD 2AEQH 5CZVH 2Y6SC 1R5VB 5BVPL 4DKFH 3HE6A 2IPTH 3GUTA 5BVJA 5BRZB 3MLPA 4X9GA 4EBQL 2M1KA 3WFBH 3MRGA 2XXMB 4PJ7B 4W6YB 3VFTB 4ZOBA 5D2NB 5DRXA 1FDLL 3TO2A 5A1AA 3D87B 4YHLH 1YEEL 4MJ6A 4RMUA 1MELA 1CFTB 1UCTA 1XZ0A 3X3GH 1UQSA 5FHAH 4RIRB 4TN9A 1KIUA 5HHOE 1A4KA 4N9OB 1T6VN 5KAQF 1RK0B 5EUOE 1S7QB 3QIWB 1WZ1L 2DAVA 4Y5XB 4MAUL 3QUYD 4L4VA 2WBJD 4KKNA 4KRPB 5JQ6L 1AQDB 2W9LA 1YJDH 3EDEA 4KAQL 3WS6A 4JRXE 5I19H 1GAFH 1BAFL 4GAGL 1ZE3C 3U0TA 4NUJB 5F1SA 4LLQB 3QG7H 3QIUA 2DQCH 2EC9T 4K7PX 3DOSA 2MQ3A 5ACMA 2HKHL 4P2RA 4PGCB 1BQHG 2P5EA 1H3WM 2D4DA 1OB1B 4LLUA 5LGHH 1LEGB 1N0LA 4IMLB 3U2SB 1LD9A 1BQLL 1ZS8B 5B22A 4EN3C 1JPGB 2VDKL 2YPVH 5JW5A 1IBGH 1JRHH 5C0DA 2FEEL 3GSQB 5MP6H 4G8IA 2WINB 2H9GB 2YUVA 4ZUWB 3I84A 1DBKL 4X4YA 1DFBH 3VW3H 1EJOH 2F53B 2UY7A 5IF0B 4AEHH 2Y5TA 1JTPA 4OCXH 4C83B 2DQJH 3OAUH 2XWTB 2EXYD 5IK3A 4ZFZA 4Z77B 4OLVH 1SJHB 5F7DB 1S9WB 3DETD 2FX8L 4F58L 1MNUH 2UV3A 5HYSA 5BCAA 5DJ6B 2H32A 4K71C 4RFEB 1BGXH 3DVIA 4N0UE 3U79A 1KEGL 2C5DC 5GGRA 4YBQD 4X5XB 3RL2A 1KFAL 2BRRL 4X8JB 5MENB 1R5WB 3CCHB 2Q76A 3GMOA 1KT2A 2YKLL 1AIFB 4R2GB 3QNYA 4PD4K 2F19H 4FFZH 1H8NA 2JCCE 1MJ8H 5LXGH 5TQ2L 4KKLC 5DJ8A 3BEWA 1WBZB 4X6FB 1PG7L 3NACH 4XP9H 4O2CA 2NXZC 4I77L 2HLAA 2EDNA 1MCPH 4JFFE 4HKZB 4OFYA 5C0IB 2KH2B 3FN9A 2CKNA 3QUYC 2CIIB 3GHEH 3RUGB 3PF2A 4L3EA 5GRVL 5FUOL 3O6FD 3SPVB 1S3KL 1BJMA 3VWJA 2AXGB 3QDGE 2WWKT 3ZE2E 4U6HA 3MODL 5KS9A 4M7JL 5ESVA 4YFLF 2NZ9C 3HE6C 2DIBA 2NY0D 3FO0L 4HJJH 4JFQA 3O3EA 3RWDA 3TF7C 3NIFF 4UI2A 2NY2D 5JHDA 4LDEB 1X3DA 5EOQH 3JV6A 1B3JA 4KHXH 4N1EA 4QY8B 5IVXF 1YY8B 4LCWA 4OGAD 3M8OH 3D48R 4LVNC 1MF2L 3SKJH 1JUFB 4CL7A 3KHQA 5IBUB 4AZ8A 3T0XA 1HHJB 1JZ4A 3U7YL 4CN6A 1NDGB 5IESL 1IM9A 4JVWA 1NMAH 4YO0A 3B4NA 2XRAL 3T3MF 2Q86B 3B5TA 1I9RH 2GAZB 4S2SA 4FTVE 3R1GL 5ESAA 3BRFA 3WLWD 1W72A 1F4YL 4PJAE 5C71A 1LP9B 4MDIB 3WS6C 2EXYC 4OI9A 1CK0L 1JNJA 1INQB 3IDXH 4JE4B 2OI9B 4JFDB 5E9DD 4EI5D 4MJIA 4YBQC 5IM7A 4EDWL 5CUSH 3N06B 4OCYH 5FB8A 2OTPA 3E0GA 4ONGH 3E6HB 4J4PA 2GJZB 4MMXC 3HUJA 1B0GA 1FN4A 1AO7E 1XF5A 1TNMA 3WSQL 2EDXA 1HSBB 5I1EL 1MQKL 1OM3H 4RMSA 4U1JB 4XCFL 4LF3A 2ZOLA 2J2ZA 3OBAA 1Z3GL 3EKCA 1G9MC 4FQLL 2V17L 5AUMA 1AKJA 4WGWB 5DWUH 3TBSB 2R1YB 3WIHA 5JXEA 4HWBL 3UJIH 4YBLB 3GSVA 1IKFH 4W81A 4HV8B 2EIZB 5I66A 3OKDB 5CIPA 1YN7A 4HC1A 3ILPB 5ANMB 2H8PA 4JFYB 4ZS7H 43CAB 4H25A 3TT3L 4FFWD 1GIGL 3AU1A 4MJID 2GK0A 2XFXB 2GKIA 3CJJA 1JYNA 4L4TA 2PR4H 4R90L 2VXSL 1MWAB 1N2RB 5EU7E 2X4RB 1FC1A 4J4PD 3GBLA 3JTSA 3MLXH 1R3IH 3G08B 3GSXA 1HKLH 2YWZA 3HPJA 4AG4H 5EU5B 4BFIA 1JGUL 2X7LA 4F3FB 5CGMA 4Q9CA 1FO0B 4OGAC 1VHPA 5HYJB 5I8CA 2MHAB 4HIEA 5EBLA 1BFOA 1NUFA 3Q6FA 1CL7I 1Y6MR 4PJGF 4GO6B 4PJ8B 4DGYL 5D7JD 2YRPA 2HFTA 2AK1H 3MYJA 4QO1A 1VPOL 5T3ZH 1MJUL 3MV01 5J56B 3W0WA 3QXDA 4PJEA 1OTSC 4UIMA 5HVFB 3QDMD 1QHPA 1WJ3A 5GJSL 3WLWC 3C5JB 4ESKA 3WD5L 3G6DL 4ZTOL 4P4KB 4JPWH 4M1CC 3VWJC 1QLEH 1UCBL 2VRAA 1AP2A 2PW1A 1MJ7L 1FJ1A 2PYFB 4PGEB 5DD6A 2EH7L 3QNZA 4JFED 4MA8H 4WFED 3QJFB 5DMIH 1RZGA 4X7EC 1F00I 1IM3B 2PNDA 4IIQB 1RIUH 4QLRA 1PAMA 4UT9H 5KSUB 1DBML 3L5WA 4OM1H 1RUAH 1KPRB 1A47A 1GGYA 4IOFC 4G6FD 4DOHB 3ZHKA 3HHRB 3H42L 2XNAB 4JGMA 4M9OA 2NMSA 1R5IB 4PD4J 2DQIH 5ITBH 3NCJH 5GRYA 1HINL 4PJXA 2A6KB 3MLWL 4NHUB 3V7AE 1PY9A 3RZCD 5FGBC 4S1QL 4XP5L 3UAJD 3MV8A 1KIPA 1E28B 4ODUB 4P9HH 1PQZB 2B1HH 3RA7H 3O8XB 1EJ6A 4Q6YA 1FGNH 5ALCL 4ZUVB 1VGEL 3E6FA 4MB4A 4UT6L 4ZDHA 3IFPA 5BXFB 2R2EB 1Z9LA 2O5YL 2P7TA 4R4ND 1J8KA 4EBQH 4HUKB 3KPNB 4HCRA 3FTGB 1NANI 4MS8D 4M61A 4XH2B 2BNQD 1QRND 3DGGB 5E8EB 5J1AA 2BSSB 1FDLH 1YEEH 3OJVC 4YNYB 1NCWL 4J4PC 2RHEA 3V52H 4HLZG 2FDBP 1RJZB 1SEBA 3TJHD 4AQ1B 1MHPH 1J0YA 3SDCB 1JK8A 1WZ1H 2VLKE 4QRPD 4HEPG 3WXVL 5FO7B 2FZ3A 4MAUH 5CKGA 3RX7A 5IMLA 4BFEA 5JQ6H 4RZCA 3MV8D 4LAQL 5EUOB 2ZPKL 3QFDB 4KAQH 5F1IB 4GAGH 3WFEL 2NTSP 4KTEL 5C0BE 1P6FA 3LMJL 3KPQB 2F5AL 5F70A 1OD7A 5HDOA 1TFHA 1QFUL 3C9NB 3WS3B 4X83A 1U3HD 3NOIA 2VLJE 4TNWK 1KB5A 2AVGA 3T65B 1ZT7A 4OCRL 3MRMB 4WVRA 1P7QD 3ZO0A 2NY6D 3DRTB 3VRJB 5I16A 4XCNB 2CRMA 1FNFA 3P73A 5F7HA 1EERB 1BQLH 2ED8A 4R97B 2UYLB 1KJMB 3D39E 4JN2B 3TV3L 1IAIL 2QHLA 2VDKH 1JPFA 3L7FB 1IAIM 4XBGA 4NRZB 1LDSA 2J5LC 4YDVB 3AREB 5LVEA 5F89A 4DCQA 2PO6A 3B2VL 1RAMA 2X4SA 2OCFD 1J0ZA 3RZCC 3F8UB 1DBKH 4ZPTA 4ZFOL 4AEEA 5DFWH 5DMGD 4OSUL 4X7FC 5F3HB 5J9PA 2BY1A 2OZ4A 5CJ5A 1BX2A 3Q2CA 1TTFA 4WY7H 3G9VA 4QRQA 1S9VB 1P7KB 2FX8H 2C1OA 3X12A 4HS6B 4CNIB 1KEGH 1GGUA 4YGVB 2VQ1A 3CDCA 2C3XA 3NFPA 5DK0B 1FSKB 1KFAH 5EU3A 5F9AC 3HCVB 4QRTA 4R4NC 1LHZA 3EOTL 1G7IB 3GI9L 1AD0A 5DJAB 4D9QD 3CFEB 2D7OA 1S9YA 3RWFB 4XP1L 2FJGB 1WFNA 3L3OA 4NQED 2VMFA 5EBMB 3PWJA 1KG0B 5FOBB 4BSWB 2GT9B 1BJ1J 5KANI 3LRSB 5TQ2H 1HNFA 1IC4L 2J6EL 3EUUA 1QSEA 1UJ3A 1EK3A 1PG7H 1XMWA 2BHZA 3QI9D 1JI1A 3AVEA 1AGEB 2QADD 1NUNB 2JCCB 1HK6A 1BD2D 2IH1A 1FYTD 4GKSB 5K9QI 4K8RC 1G7LB 5IEKB 4HQQH 5F96L 5FUOH 1LE5B 1T1ZB 4OQTL 1W0VA 2ZG3A 3MODH 4TUKL 1A64A 3KNBA 5DJ0B 5SX4H 5T1KD 3H9YA 2A9ML 5SWZE 1I8MB 3GKZA 5ICZA 1YC8A 2DL9A 4YK4C 4GQPH 2NY1B 5IVOA 1RZ7L 1YQ2A 2ZWLT 3QZWB 1AC6A 3CVHA 5INDA 4BKLA 5B38G 3GMMA 3QB7C 1CLZH 3L3IA 2NY6C 3LQZB 1XF2A 5TF1L 4J8RB 1UB6B 4BQ8A 1ZOXA 2ESVD 4PRDB 1MF2H 1MCOH 1F3RB 1UZ8A 3W2DH 3U7YH 2EE6A 4YLQT 3L5IA 1F6AA 3BWAB 2XRAH 5E56A 5DD1L 4C56D 3DIFA 1X5IA 5J06A 1NLDL 5EC2A 4PJCE 4YC2C 5F7YC 4OB5L 5DMGC 2XZAL 4LGSB 1JHLL 4N90E 5D96C 2AQ3A 4WI6A 3VA6A 1CK0H 1WK0A 5LJYH 3FOLB 3D3VE 4HK0A 5K33A 5EU6A 4PV8A 1QKZL 3MV9D 5DC9B 5TFSL 1A6WL 2R2BA 3VWKB 4EDWH 4UT7L 3CDYA 2XTJD 4S1SL 1ZVSB 1Q9KB 3KLAB 3M17B 1UXSB 5IR1B 2VR5A 1F58L 2DLEA 1NCDL 5DXWA 4RAUA 3WSQH 5EBWB 1DN0B 3PL6B 2VDNL 1MCNA 4MDJB 5I1EH 4F57L 1MQKH 3N1GC 4QF1B 2Q3AA 1OD9A 1ZAGA 1U36A 4XCFH 1CXKA 1MCCA 3BQUB 1FGVL 1Z3GH 5EIIA 4FQLH 4LHJB 1TZIB 4XCCL 3MROB 1QSVA 3QI9C 5F71A 2EYTB 4WTZG 4HEME 4E41E 3D69B 4HWBH 2PO6C 1M6OB 5D1ZB 4DQOH 4M02A 3KLSA 1I3RA 3MR9A 4JHAL 4M93C 1S7WA 1IAKB 5FIEA 1QTYT 5EULV 2LQRA 2YS4A 3CK0L 5E2WL 1BWWA 1G9NH 3L7EA 2I07B 3MJ8A 4JPKL 1Z5LA 3ZDZF 1PW3A 4U1LA 1GIGH 2UWEE 3TZVD 1NJ9B 2FL5A 4AEIL 2I9TA 2GEEA 4R90H 2VXSH 3VXTB 5C0EA 4PY8I 1LEIA 4MNQB 3P40A 2NTFA 4AL8L 2SEBA 4GRWE 1VA9A 2BVTA 5HVHB 4N8CL 3HI1A 4OLXL 4JM4L 3P0YH 2ZG1A 2ZSWB 3FB5A 1RZJC 4S11A 3OF6A 1LK2B 4R96B 3CDGB 2C9AA 1K4DA 1UJ3C 3KAAA 1SBBA 1OQOA 3MV7E 4U6YA 3RFZC 3JWDL 2CUMA 4XWGL 4DGYH 1C08A 1V3KA 3ZE0E 4PJFE 5CEXB 2L7UA 4GKOA 5DK2A 4EUPH 4LVEA 3TN0B 1VPOH 5JW4R 4WEUD 3QUZA 1MJUH 1FNGA 5I17A 3BXNB 4ISVA 4FG6D 1SHMA 4I0PD 3WD5H 3G6DH 4ZTOH 4WENB 1UCBH 4PLKC 3WJJA 2OSLB 2GJ6A 1MJ7H 2DBLL 2ATPA 5JOPD 4P5KA 3UTQA 3EYUL 2IBZX 4RWYL 2EH7H 2Y9RT 4YIQA 4M4RA 2V2XA 3RGHA 1U8OB 3C6SA 4NN6B 4X98B 1DBMH 4HDIB 5C07D 3KPLB 4HJGB 1XGPA 3LPGA 4ZO6A 4JO4L 4L8SA 5DEGA 2D7MA 1MIEH 2WIIB 1HINH 1U8JB 1RUKL 5HYFA 1S7TB 3WKML 4S1QH 4XP5H 2V9QA 2EDHA 4CVXA 4H26B 3B6SB 4XPHL 1VERA 4BM7A 4Z7OF 2ZCKL 2PXYB 4OFDA 5BZWA 1PZUB 5ALCH 5SX5H 1VGEH 3D2UA 4UT6H 5FECB 3P4OA 1FC2D 3MRIA 4XMLL 2O5YH 3IDNA 5EB9A 5CD5C 5KSAB 2B5IC 3BI9X 3FQTB 1GZPB 4HKBB 5FK9B 4QRRA 4WWID 3VXMD 3H7BA 4NKOB 5DD3L 3TBVA 4MAYB 1FFQA 1XGTA 3MRFB 5J57B 3RTQA 1HIMH 4K9EC 3RNQA 5ACZB 4KJYA 5K9JL 2W92A 2EKSA 3R0MA 1DANT 5DJ2B 1P1ZB 1LK3L 2CH8A 1FZJA 1K6QH 4LGRB 5LQBL 2AABL 1A9EA 2BVUA 1T7XA 3WXVH 4X0KA 4F7MB 5DRWA 2R0KL 1WTGT 5F9WB 2P8MA 4KVCL 1A7NL 1LILA 3DURB 2GK2A 3PWPD 3S4SG 3F6IA 4LAQH 1CWVA 2ZPKH 2FNBA 4YHPA 1X5FA 3WFEH 3DVFA 1H5BA 4PREA 4U7SA 3LMJH 1JF1B 2F5AH 1MI5D 1R5VA 1QFUH 4WNQB 3S36L 2JKXA 5BRZA 4XNUL 2C3HA 4XAKE 4X9BA 4OCRH 1X6NA 5C0BB 2D7TH 3DI3B 1M05A 1EBAA 4PJ7A 3QA3B 5E94A 1L0XA 4S0SD 3G6JE 3IETB 4ETQA 4PJEF 1HXYB 4U1NB 2VLJB 1BZ9B 5JZ7C 1IAIH 1B0RB 1CFTA 3BO8A 1RSFA 3F7VB 4DUXA 5FV1L 3WXWL 2WP3T 1FP5A 4RIRA 4GH7B 3OTTA 1WCBA 3ARUA 1RK0A 2XQYG 1S7QA 2FEDD 3B2VH 3QIWA 1DLFL 5E8NB 4LHUG 2ICEB 3D39B 4Y5XA 1DLHB 2LTQB 4OSUH 5KZCD 1AQDA 5D2LE 1BMGA 2EYRB 1ROWA 3QUZC 1QYGL 2R23B 1CXFA 3HPLA 4NUJA 1RUPH 3D85B 1JZ6A 3MUZ1 3WJJC 4PJXF 3MRNB 3PG2A 3GI9H 4WO4B 4JY6B 4PGCA 2CSPA 4NN7C 1EHAA 2ZUSA 3U2SA 1UM5L 1NGXB 5CSBA 3DUUA 1WICA 2X4OB 1IC4H 2J6EH 3R0NA 1UENA 4MA1C 1MEXL 2WNGA 1JPGA 5CJBA 5HD8C 3EW3B 2N4IA 1RJCA 4CAGA 4JANB 1JMZA 3FB7B 1C12A 4R6UA 3F7RA 3D18B 2WINA 3MJ7B 2DS4A 4PB0H 1HYSD 1CVRA 4KRPD 3K0WA 2F53A 4Y5VB 3D9AL 3MMEB 4OQTH 2Q1EA 3CSPA 4LVHB 1F3DJ 3UYOD 1DBAL 1K8DA 1SJHA 2BSRB 4I3RL 4DK3A 1S9WA 1VGKB 4DGVH 2A9MH 2CIKB 4YHZL 4RFEA 1INDH 3L3JA 4OI8A 4PJIA 2OMBA 1MCFA 1S8DA 1RZ7H 1K3IA 1NCCH 3KYKL 1R5WA 1T2XA 4Y16B 1YEDB 2HG5B 3WN5A 3CSYB 4KY1L 1AIFA 1MFBL 2WSKA 5TF1H 4LPVA 3RTQC 3WNNA 3STBA 1D5MA 2FECI 3I6KA 1HZHL 1FNEB 4LKCB 5C0GB 4N0YL 4Y4HD 3EZ8A 1WBZA 5ITFA 4LPXA 3VXSE 2M2DA 2VLMD 5DD1H 1R3LA 2FEDC 3UPRA 4XNQB 3OV6A 4L8BA 4HKZA 2HT4D 3T0EB 4QHUA 5C0IA 3QWRD 4OB5H 2CIIA 2CGRL 2X4UA 1UB5B 1F45A 4J3VA 1JHLH 3STZA 3ZTJG 3MGTB 4U1IA 1U91B 2Z93B 5LG1A 2CO7B 3SPVA 2AXGA 1H5BC 4LPCA 5DJZB 3TBYB 2VXUL 4KZDL 3BAEL 1QKZH 4Y4KD 2RAMA 4HS3B 3S96B 1A6WH 4UT7H 2OXHA 5IV2A 2NW3A 5MEND 2IAND 1BZ7B 3IYLW 2J8UF 3MLSH 2EDFA 4R2GD 2VDNH 4GUPA 1ODAA 1VEMA 1EFQA 2BC4A 2JELL 3DX9B 3SE9L 1R3KB 4QY8A 4F57H 1S78D 3OJDB 1FGVH 4B0MM 3NABL 1NAMA 4LSUL 1I4FB 3VXUE 4EEEA 3QRGL 3K3QA 1HHJA 2OTUA 1NGPL 3BP7B 4DKDC 4HF5L 5E5UB 3QIWC 2KZWA 2Q86A 5FKPB 2OYPA 4Y5XC 2GAZA 4QTIH 3BZEB 4UV4L 5I1DB 4KRPC 4QHLB 3CK0H 3BYTA 5E2WH 5I75B 1XR8B 1V3MA 4JPKH 1IC5L 3O6ML 3OKKA 1MFEL 3VCLA 3SDAB 4WI9A 1INQA 3OSKA 5IMKB 4AEIH 2V5YA 1KTLA 4JFDA 1PX3A 4EIGB 3CIQA 2NY3D 3KS0H 2YUWA 4AL8H 1ND0A 3E6HA 1T0MB 2UWEB 4WI8A 5C0AB 1U8MB 4LLMB 4N8CH 4NNXB 2RIKA 4N1HB 2OXGA 3FRUB 4YR6B 2MCPL 5J8OA 4ZYKA 5DGRA 1HSBA 2ZUXA 3PJSA 4U1JA 2P5WE 2MNUA 3FRPG 3JWDH 4XWGH 2W91A 4B7LA 2R1YA 1RZKC 2F74B 1EX0A 5SWSE 3PHQB 3I2CL 3NPZB 3FO1B 5BS0E 3CPLA 1QBAA 4QRSB 4BQCA 4HV8A 3HLAB 3OKDA 4PJFB 3IDGA 2A0LC 3ZYOA 3FL7A 2IAMA 3QEQE 1E4XH 2DWEB 5ANMA 3W11D 4DN4L 43CAA 4AT6B 4R0LB 4Z8FL 4AENB 4PJHF 5IFAL 4RWYH 1UXWA 5CCKL 1XF4A 2XFXA 5T3XE 1MWAA 1FCCA 1N2RA 3WN5C 4YZFE 4Z7WB 2KL6A 3G08A 1JI2A 4R2GC 1YMMB 4F3FA 4GXUM 1FO0A 2ARJQ 4P5TB 3ETBF 4RNRA 2Y7QB 5IB5B 2MHAA 3BP6B 2G2RA 5DD5H 1T7VA 4LNVA 2Q6WB 3TCLB 3V4PL 1CZ8L 2FSEB 2VIRA 2AEIT 4XPHH 3T4AB 4P46D 4PJ8A 3GJFK 3TBTB 5IBLD 4B7IA 2ZCKH 5D71H 5F1KC 5D1QB 1P9MA 1TNNA 1W72H 3ARDD 4NP4L 3C5JA 4OZFB 3OX8B 4XXCA 1OW0A 3LS4L 3CFDA 1RZFL 4QXGL 4UB0H 4HGWB 5HYQB 4Z0XB 4PGJA 1WC7A 3WNMA 2NR6D 3GZKA 3CAFA 2OP4L 4GW4B 4WV1A 4KMLB 2PYFA 3ULUE 3O3BA 3KPSE 4XB7A 5K9JH 3QJFA 3PWNB 4ZODA 1IM3A 3DRQB 4HXAH 5KSUA 2NYYD 3LH2H 2N7BA 5LQBH 2AABH 2LU4A 3MRHB 3ZSTA 4ONOA 4F7EA 3EGSB 3PDGA 1F8TL 1R5IA 5HYJD 3MRQB 2OS7A 3AMKA 3RRQA 3NIDF 2BNUB 4KVCH 1A7NH 4WDIA 1KXQE 1MAML 1JMXA 1LO3L 3WIHH 3G5YB 4OZ4A 2JTDA 4Y7MA 5GRXG 4ODUA 4PBVC 4O5LH 1FVEB 1PQZA 12E8L 3B43A 3O8XA 4ZUVA 1CFQA 3QO0B 3RVXD 4I4WB 3EO1B 4P4KD 2V5TA 5C6TH 2KUTA 4KQ3L 4Y4FB 3S36H 4RMWA 4XNUH 2HN7A 3QFJD 5GS0D 5EBGA 3FTGA 4XH2A 3HR6A 2OI9C 5KVMC 3BEVA 2BSSA 2VLRE 3AAZB 5T1DL 2R9HD 1N7ML 3PE9A 3L95A 3PP3H 4RISL 3V5HB 4ZFFB 1KEML 4YNYA 1NCAL 1RIHH 4U1KB 1XGQB 4UILL 1X9QA 1DLFH 3ZDYE 2FWOA 2QQKL 3MRCB 3B9AA 2BZDA 2NX5D 5DMKB 4OFVA 3IDIB 5HHOA 3JVGA 5F8QC 3C5ZA 5EUOA 1T21B 2VISB 2C3VA 5F1IA 1QYGH 2X89D 2VSDA 2X70A 2UVEA 3FQNA 1C5DB 3MTRA 3O3AB 3LKSB 3KPQA 3QG6A 4W70A 1J8HE 3B9DA 2VR9A 2E27H 4NQXA 5D2LB 2X4PB 2YSSB 4JLRB 3C9NA 5IB1B 3UP1A 4K7PH 2IAMC 3O6LL 4JRXA 1KJ2L 2NR6C 1KCRL 3DRTA 3ULVD 4KK8C 3QULB 1IQWL 5DRZB 1UM5H 3ZL4L 4L1HA 1UG9A 2AK4B 5ICYA 4HIJA 4LCCB 1WWBX 4GRMB 1EO5A 2UYLA 4JN2A 5I76B 4MQXD 1S7XB 3SDCD 2COQA 4YDVA 5D7IE 3AREA 5E5MA 3GJFA 1MPAL 3D25B 5F97E 5JTWA 5C0NC 3LKQB 4TPRL 3D9AH 3L3KB 5F3HA 4PJ8C 3E2HB 3KS0J 4BFGA 3FFCD 1VFOA 4K3EL 2Q7YB 4I3RH 1S9VA 1P9MC 2YD5A 3VGAB 3LIZL 4XCEB 1SBSH 4YGVA 3BN9C 3DPBA 4NQCE 4XXCC 4P4KC 3ARXA 5DK0A 1OW0C 4PTUA 5SV3A 4HUVA 1G7IA 3LZFL 4BSVB 1J0HA 1HSAA 5DJAA 3CFEA 1MFBH 3RWFA 4WV1C 5C2UB 4N0UA 1HH6B 2BK8A 1KG0A 4BSWA 2GT9A 1HZHH 3L3HB 1KCVL 4IIQC 2XWBB 5IEHB 3LRSA 3BD3A 5DR5H 1ZT1B 1NLBL 5D7LE 1ACZA 3L3GA 1LWRA 3ARED 3W9EA 5F3BB 4PJ7F 5CGTA 1OP3H 4F7CB 2JCCA 3UYRL 5C0CB 4GKSA 5C2BL 2CGRH 4NQVA 1G7LA 2VUYA 4L1DA 4LLAA 3RVUC 4I3SL 3X11B 3VXSB 3ZKND 3ZKMD 4HMDA 5CZKA 1LE5A 4G6AC 2NPLX 1F2QA 2VXUH 3O8XC 1HE7A 1LO0H 4JFFA 4MMZC 3BAEH 5DJ0A 1E4WL 3VFGL 1MAJA 4HUUA 1P4BL 3BW9B 1I8MA 4UNVA 1CFVH 3PWUA 2IPUK 3QDGA 3QZWA 2VJXA 1KSRA 4QHKI 5IFJB 2Y36L 2LV4A 1TITA 2XG5A 4M7LL 5F7NC 5TE7H 3ES6A 2I9LA 4J8RA 1R3HA 2JJUA 4PRDA 4LIQL 3NABH 3LV3B 4D9LH 3P4NA 1FFPB 3BX7C 2QR0A 4RQQA 4P23B 3S34H 5IMMB 1NGPH 4MQXC 2VZSA 1WZKA 4HF5H 5EOTB 3BWAA 3ESVF 4JRYB 4NBZB 2NQCA 4OLWH 4CJ1A 3U0PB 1EAJA 2AJUH 4JAMA 3FFDA 3JVGC 4YDJB 3TA3D 5B38A 1IC5H 3D0VB 3KPTA 1MFEH 3O6MH 3VH8A 4A6YB 1ZMYA 3JSSA 4LSTH 3CVIL 1CLOH 3IU3B 4KKCC 4LOUC 3SCMD 5CBAB 1N59B 4FTVA 4EI6B 4CDGC 5JW4N 4J12A 2F15A 2VDMH 1KCSH 5JPMA 4PJAA 1ZVSA 5D5ME 2HFEB 1X5KA 1XEDA 4NNYA 4NZUL 4P4RA 4XAWL 2VITA 3T4YB 3RKPA 3I50H 3CX2A 4HWUA 2O93L 2ITDB 2MCPH 1DN0A 5FYLE 1J9CT 1RK1B 4OCLC 2CDGB 2GY5A 2GYSA 2AJZB 4R97C 3IFLL 5L2KB 4IRJA 3UTZB 3EYFB 3GMPB 3MROA 4OD2B 1AO7A 2EYTA 5I2IB 2NW2B 2GSIA 2C4FT 3MLYL 1WFOA 3AREC 1K85A 4HT1L 2C7UA 1U8QB 3D69A 4YE4L 3P9LA 3GSNB 5D1ZA 3I2CH 2X5PA 4JRWA 3N0PB 4GBXA 5E99L 3PIQA 3GKWL 1EVUA 1AQKL 1XF3B 3JWOL 3GMRB 5DEFB 2QSTA 3VRLE 4OF7A 2I07A 2H26B 4YEEA 5BS0B 5IB2A 5K9KB 4CADB 1DQQB 3VWKD 3MO1B 1FSKC 1SY6L 3CVHH 3VXTA 3RUGF 2CRIA 5MEQA 1A2YB 4MNQA 4Q2ZB 3PHSA 5IJVA 3FO9B 4PRPE 1LE9A 3BZDA 4E9LA 1DEDA 1KUMA 3PL6D 3V0VA 3MBED 4JN1L 1LK2A 2HJLB 5F9JB 1A7PL 3BQUD 3OQ3B 4IOSD 3CDGA 4AQOA 2OL3H 3KR3H 1T66D 5TJWK 1CZ8H 1GGIL 4ZFGL 2BVYA 3O3UN 2VB5A 1U8HB 4V1DE 3TN0A 2O61A 5F9DC 1IL1B 5I8KL 5HSFA 5K9OB 4RMRA 4Q9QH 4WFFD 4WHYG 4AM0A 3MRRB 2R4RL 5E1HB 4QXGH 1SEQL 2OSLA 4O9HL 1JWSB 4TOYL 4TQEL 2YMXL 4MD5B 1A6ZB 1NH6A 2OP4H 3QDHA 5AYQA 1F97A 2NY1C 3U30B 3KYOB 1WBXB 1NMCB 2BSTB 4J3WA 4MNQD 1U8NA 4HDIA 5CP3H 3KPLA 4HJGA 3PHOB 4GW5A 1X5LA 3S35L 1LP9F 1V7NL 2YXMA 4KVNH 4BH7B 1UZ6F 1E6OH 2QL1A 5E1AB 1AR1C 3KPSB 1IJ9A 2XQYK 2Y1VA 1FZOB 3QBTB 4KUCD 4H8WC 3FT4B 2Q8AL 5IUSA 3G5VA 1Q0XL 2LVCA 3RAJL 3VFNB 2WIIA 3CXDL 1MAMH 3W82A 5CJ8A 5DTFA 3MGAA 1J1XL 3OG6B 4H26A 4J2XA 2W1NA 4JHWL 5JPNB 3JWNC 12E8H 2PXYA 1KIQA 4UNTA 4WW2A 5FECA 4U1GB 1EFXB 3NH7L 4KQ3H 3VDAA 4N8VB 5KSAA 3FQTA 4OUUB 4HKBA 1TVDA 3QIBB 1VFUA 3ZKQD 4MAYA 2H41A 3MRFA 1N5AB 5I6XB 5FYKE 5T1DH 5HGHB 1EEQA 3VWKC 1CD1B 2AP2A 1N7MH 1QBML 5ISZB 1KEMH 3QUMB 1NCAH 2HVKB 5KBNC 1UH2A 1R6VA 1WBYB 3MJ9A 2RR3A 1D5ZB 2A2QT 4BH8B 1Y18B 4F2MB 3PL6C 4MNHB 4UILH 5FYJE 1ORQA 2QQKH 1TJHL 4IRJC 2CDEB 4PBWD 3ZHLA 4F7MA 4Z7UE 5HHXL 3MBXL 1QHOA 1T66C 4G8GB 3DURA 2YWYA 3Q6GL 1N6QL 3VMOA 4KUZL 3M1BA 1BM3L 2VLKA 3DSNA 5D1ZC 2QJDA 4PRHB 5M7QA 1JF1A 3TFKD 5D4QA 1MRDL 2UVFA 5FEBA 4Y19E 1WISA 2Q7NA 4MA3A 3S5LB 4WNQA 2N7AA 3O6LH 1KJ2H 4P9ML 3T1WA 4MAYD 5C0BA 1H8OA 1KCRH 3HNSL 3QA3A 1IQWH 3ZL4H 5T5NG 1XGYL 2ID5A 3QHZL 3ZTJH 4PY8J 4U1NA 2VLJA 1BZ9A 3F7VA 3DYPA 3IDYB 2R8SH 5DSCB 5GISL 3SQBA 3MXVL 5HVHC 3P0GB 1BREA 3S4SA 1WVZA 4HFUL 1FLRL 4U1MB 2D03L 5GGVL 5EU7C 5E4EB 1MPAH 2RJMA 3SKMB 3D39A 4XZUA 2YD6A 4NC0B 2ADGA 1G6RB 3BVNB 4TPRH 3DUHA 4QHNA 5H35A 4X99A 4RDQF 5DJDB 3BIKB 5D7IB 5JIHA 2EYRA 1XFPA 3TN0C 5F1OB 2CKBH 2EXWD 4G6MH 4WU7B 4WI7A 3LIZH 2M8XA 1OT1A 5IOPA 2LVEA 3GSUB 3D85A 1FH5L 1S7SA 3UTTE 1U8PB 1CLYL 3LZFH 5GS0L 4WO4A 2ICCA 5HGAB 1VEPA 4JM2B 2E7MA 2YEZA 4PLJD 1NGXA 2WBKA 4NN6C 1K5NB 3ELAT 4LHUA 4PGBA 2NY4B 2X4OA 1NSNL 1NLBH 3N1MC 3UTSB 2YPLE 5JXAH 3IAQA 4UUJA 1AJ7L 3RWIB 15C8L 3D18A 4XP6L 1NKRA 5JA9A 3UYRH 2ICWI 3ULVF 5C2BH 4FXGB 3TIDB 5D7LB 3K81A 4I3SH 5L2JB 3MMEA 1PD6A 4WI2A 2PXYC 3B9KB 1E4WH 1G7JB 3ZSSA 5AD0B 2BSRA 3VFGH 5KVGH 4PIRF 3QQ3A 1P4BH 3QDJD 1W8OA 1CICB 3TFKC 4HW6A 3WEXB 3MUGA 5IVZB 3MREA 3FQXB 3DROB 5KSAC 4J3XA 2YBRB 2Y36H 2DMCA 4Y16A 4M7LH 2LFGA 1H3VA 4MAYC 2PUQT 1CE1L 3CSYA 3WUWB 3DVNB 5EUOF 5BQ7B 5IB3B 2GJJA 4G9DA 5SWZA 2OJEB 3ULVL 3KVQA 1CLCA 3EAKA 1EAPA 2VE6B 3T0BA 3BJ91 4LIQH 3SJVB 3BSZL 1FNEA 3DYOA 1OAXL 4Y8AA 1F4WH 1U6AL 3MNVB 3VD7A 3EOYG 4I48B 4XNQA 1U8IA 3WNOA 3QCVH 5F9WC 3UBXB 3FAWA 5E6ZA 4DEPB 1UB5A 5E70A 1JNLH 4ZSOE 2FO4B 3FO2A 1PY4A 1Q0YL 1PZ5B 3M45A 5F44A 2XY2A 1NCTA 3D0LB 3CVIH 3E1F1 4JPIB 3TBYA 5F9OL 3K4DA 4PJCA 4CGTA 4HS3A 3S96A 3EDKA 2RBLA 4F15C 2DQGL 2J8OA 2HTKD 4P2OA 4XAWH 1QLFA 3D3VA 1GH7A 1B2WL 2YD8A 1PDKA 1QQDA 5DVMA 3DLQR 3T8XB 3DX9A 4OBSA 5TQ0H 1R3KA 1OAKH 5D5MB 1W8NA 3H9SE 3IFLH 5ALBL 5HPMB 1IRAY 3V5KA 5J6GA 3TYFB 4XHJC 3MLYH 1GZQB 3BP7A 4E42B 3FQWA 5J11C 4HT1H 4YE4H 4G6JL 4IJ3B 5ERWA 5IBTL 5FKPA 5IKCA 3T0ED 3GB7B 5A3ID 5E99H 2LTQC 3JV4A 1C5CL 5I1DA 3GKWH 3CX5K 4XBPB 1PKQE 2E5EA 1CG9A 1NEZG 4JFHE 4E41A 4NZTL 5SV4A 3C60D 1QOKA 3KJ4B 1IILE 2JCCF 1SY6H 4NQDB 5IWLA 3AXLB 2AJ3A 1KJVB 2FIKB 4WO4C 3BMWA 4ZUSA 1T0MA 2UWEA 1Q38A 4LEXL 4NNXA 5EZLA 3HMXA 1CXHA 3ZZ1A 2RCSH 3UDWA 4JN1H 1B6DA 5CMAB 4NJ9L 1U3YA 1KTRL 2MPAL 1A7PH 4DUWA 3G04B 3I85A 3WNLA 3SGDI 4PRPB 1FNAA 1ZTXL 3U6RB 4GG6B 1GGIH 1FRGL 4ZPVA 4ZFGH 1DEEA 1LGVA 2Z4QB 3AS3A 1TCRB 4UBDC 3O9WB 3PHQA 3ZHDA 4DVRH 1S7VB 5HI3D 5I8KH 3IFOB 4MWFA 5C0JB 3HC4L 2DD8H 1GC1L 4QRSA 5CJQL 5I1JL 5TF0A 3HLAA 5E6IB 2R4RH 4PJFA 2P49B 5JA8B 2V2TB 1SEQH 4LVHC 3BDYH 4KK6D 4O9HH 3FOMB 4V1DB 4TQEH 4TOYH 2ZUWA 3SDAD 2YMXH 2AXJA 5CEZD 2EEDA 3RPIB 4R0LA 4AT6A 2XXCB 5HDBE 2CLVA 4KKBD 3RHWK 2Q3ZA 1MY7A 3DARA 3NA9L 3RX8A 5EIQA 1L6ZA 4Y16C 2B0SL 3EYQC 4U6VL 3T08A 2BNRE 2HTKC 5C0AD 2DQDL 3FRPA 1V7NH 1AR2A 2OR8A 1LDPL 2V5MA 2YC1B 3HI6L 4XWOD 3OL2A 4JGUA 4F7PB 4P49A 2Q8AH 1RHHA 2PYEB 3RAJH 4P5TA 2DKSA 4TULL 5IB5A 3SDXB 3BP6A 8FABB 3SDDB 1JIBA 5LWYL 2XTLA 2Q6WA 3TCLA 1J1XH 4RX4D 2FSEA 2W0FA 4UOW0 1MIMH 4JHWH 3DV6B 4RGNE 3IXAB 2ZZUT 3RQ3A 3VGBA 2AS5M 4OZFA 2I5YL 3OX8A 3J7HA 4OZIE 3P9WB 5HYQA 4N5ED 3HTLX 5J7CC 1NQBA 4Z0XA 1QSFB 5IQ9A 4OF0A 2HT2C 3OKEB 5DS8B 1QLRA 1ZGLB 2NXZB 4GW4A 4GRLA 3S7GA 5A2FA 2XQBL 3QUKA 3F7YB 2AERT 2BERA 4I5BB 3E8UL 5KG9A 1P6AB 1P2CA 3JBG7 2DTSA 1KCUL 4XNMA 1WTLA 3B5GA 1YMMD 3MRHA 5KSVB 1JGEA 3BFOA 1FE8L 1T1XB 3VD4A 4M8VA 3EGSA 1P4IH 5DFVC 3RGVB 1A6AB 2VR4A 1OARL 4EQ2A 1M4KA 3G5XB 4JDVB 5HHXH 3DXAE 2BNUA 1TVHA 3HE6B 4EOWL 5BVJB 4OZHB 1N6QH 3G5YA 4KUZH 1BM3H 5E24E 1A7BA 3MRGB 2J8HA 4B53A 1YNKL 1FVEA 2VN4A 3VG0H 5D1QD 3Q0HA 4M5YL 1MRDH 3QO0A 4KUCF 5E5RB 3TO2B 3ARPA 4NOBA 3ARGB 4I4WA 5I75C 1X4XA 4Y4FA 5HVWA 2ARWA 1CYGA 1XZ0B 4P9MH 1N6VA 4HMEA 3CZFA 3IKCB 4ZG1A 2FGZA 1DUYB 3HNSH 4UTBL 5IFHH 5IW6B 1XGYH 4XMKH 3QHZH 5IWLC 1OL0A 3DX6A 2MQ0A 1FBIH 4L4VB 4O4YL 1D5IL 4ZFFA 3HAEG 5I30L 3DVGB 5GISH 3MXVH 3VGGA 4I9WE 4U1KA 3ARBB 1OWWA 3UDWC 3JUZA 1FLRH 3G6JA 2D03H 2D0FA 1FO0H 4I13B 5GGSY 5GGVH 3VI4E 3U0TB 3Q3GB 3MRCA 4BZYA 2VZTA 3QH3B 3IDIA 3QIUB 3RNKA 4RAHA 3RVWD 5HXMA 4P2RB 2OMNA 3QP3A 1QUNA 2VISA 1IC1A 3OZ9L 2DYPA 1F5WA 3MFFB 3T2OA 3O3AA 3LKSA 2IJ0C 3IDUA 5C92A 5GS1A 1CLYH 5D2LA 2X4PA 4JLRA 4LCIL 5IB1A 3CX5J 4PJ9B 5GS0H 5I1HL 4N5EC 4R0LC 1WIPA 5GRJH 3EIFA 1TJIL 4G8IB 5A16A 3UTTB 3QULA 5DRZA 2EIBA 4H88L 3ARSA 1FFNB 4NUGH 4LCCA 4X4YB 4BZ1L 4WUUD 1QA9A 1FZKB 4NBYB 4WFGE 5I76A 5HHNA 4HPYL 1T1YA 1AJ7H 4KXZH 5H37H 4PY7A 3O0RL 4ZFZB 5T3ZE 2ED7A 15C8H 4J3SA 4G3YH 3T3PE 3LKOA 4P5TC 1OAZL 2H32B 5GZOC 2DN7A 3I9GL 3D25A 2VNCA 4F33A 5FO8B 4JDTL 4Y1AD 3T09A 2BMKA 3LKQA 4FQCL 3RL2B 3L3KA 3L1OL 5AZ2L 3GMOB 3SKOB 1L7IL 2OM5A 3ET9F 4RMQA 1MREH 4O51B 4KTDL 2Q7YA 1AI1H 1KJ3L 2B8OT 3CMOL 4HJ0C 4ODWA 3IFNH 3MA9H 4KJQC 4AY0A 3QUXD 5D72L 3IRZA 1SYVB 5GQBA 1JNNH 1NUDA 1WEJL 3BEWB 5DJ8B 3MLRL 2VDQL 5HHMB 1CE1H 5F6HI 3ULVH 2HLAB 4TUOA 1HH6A 35C8L 2FD6L 4YDKL 2AK4D 4GRLC 4M1DL 4L29B 2JJTC 3HG1E 3BSZH 3L3HA 1OGAE 5IEHA 3N1PC 2XWBA 1T04A 3EOBB 1CR9L 1OAXH 4L3EB 5D1XB 4P2QD 3BZFB 1FAIL 4U6HB 1U6AH 3OKOA 4G9FE 2F54E 4OV5B 4D3CL 2QSCL 5KS9B 5F3BA 3BGMB 2E7LA 4FHBD 5ESVB 1JRHI 3RZWA 3X11A 4JFQB 1Q0YH 2MCG1 3VXSA 2PF6A 5L7XH 2BOBB 5JHDB 3F6LA 5F9OH 2ZCLH 2FYYA 4NT6A 4FQIH 2KPNA 3MLZL 1YMHA 1Z9OA 4NHCL 4LCWB 4K23H 3PGDB 3VI3E 4Y4FC 4CBPA 1BFSA 2DQGH 4UIKL 2DRUA 4OV6F 3HZVB 1JF6A 1OP5K 4YXLL 1IM9B 3HI5L 1LVEA 1CFNA 4PFEA 4E5XB 1MRFL 1A14L 4WHYH 3W9DA 1V3LA 1DL7L 4FZEL 1KTKE 5ALBH 3LV3A 1TLKA 4UDTA 1FFPA 3NZ8A 4OD1L 3GMNB 4LGPB 3K8KA 2HJFA 5EOTA 4G6JH 4M8QA 3H9SB 4TVSa 5IBTH 1A7RL 4DGIL 5C0CD 4TVPD 4Q9BA 5IM7B 3VXUA 3U0PA 5D8JL 4JO3H 1BEYL 4GAYA 1P5UA 3WFCL 1HOCA 4G8FB 3PQYE 4NZTH 4YDJA 3AGVA 1G7MB 2MWCA 3HUJB 1B0GB 1GGCH 3VJ6A 3IU3A 5CBAA 5EH1A 4EI6A 3VD9A 1I1RA 5GS1C 1PKQB 5I1AA 5E2VH 2ZOLB 3O2VL 4YQXH 1A1MA 1U92B 3B3IB 4WFHD 2X1OA 4DAGL 4PRIE 3T4YA 2ITCB 4LEXH 4QOKE 3GBMH 2Z31B 1MCIA 4NJ9H 4ZXBB 1EA9C 1RK1A 5B39G 2MPAH 4KGJA 3GSVB 2CDGA 3HB3D 4JY5H 4LCCC 1UEYA 5CKAA 2AJZA 3QPQC 1YEGL 5L2KA 2X9YA 4LSPL 3UTZA 3EYFA 3TJEL 1ZTXH 5CIPB 2LABA 4P23D 3GMPA 1UYWL 5I2IA 3QQ9C 2NW2A 4H25B 1U8QA 4JRYD 4KKAD 5IIEB 4ETYA 2P5WA 5C70A 5DMYA 2GK0B 1I1YA 3HC4H 1GC1H 5CJQH 1WV7T 4NQSA 3E2HC 5FAAA 3GMRA 5B8CA 2ZUTA 5SWSA 4RCAA 4WWKB 3GSXB 5DC0A 3O4OC 4FFVD 2H26A 4BFIB 5BS0A 5AEAA 4P2CG 4XBEL 5I15L 5DF0A 4CADA 3NA9H 1DQQA 1EEZB 4PRNA 1PVHA 3EFFB 2HT3D 5EBLB 3MZGB 1BFOB 4CMHB 2B0SH 3QEQA 3Q6FB 1A2YA 1QR1A 4OCMC 1NGQL 4Q2ZA 1JZ2A 3MA7B 5EOCJ 3HI6H 3MYJB 4H8WH 4KC3B 2HJLA 3QXDB 2G60L 4TULH 5L2KD 2BVQB 4JEGB 5DZLA 2CD0A 3C2AH 2Y06L 3LN9A 1KV3A 4X4XB 4X6CE 4NKQB 5EA0L 3EOAA 2E7LC 1CDGA 5E0QA 1IL1A 3QNZB 5AWNL 5K9OA 1ZWIA 1RZGB 4H20L 2I5YH 4Z0BL 1UKTA 5DUML 1NC4A 3MRRA 2PKDA 3L5WB 4U7KA 5J4MA 4RGNB 3HE7A 1JWSA 4RMTA 4JO2H 1A6ZA 2F8XC 2YD7A 2QSQA 4XNZB 2JB6B 3GIZH 1JL8A 4OZIB 3KYOA 1J0JA 1WBXA 2YN5A 2BSTA 2APTA 2J3SA 3MNZA 3E8UH 3PHOA 5T1LA 1KCUH 2YZ1A 5E1AA 1T3FB 3KPSA 4M7KL 1FZOA 3BISA 2FRGP 2VAAA 1BBDL 1OARH 3FT4A 3E6FB 3HB3C 4I0CC 4V2CB 2OR9L 6CGTA 5DQJA 3IFPB 4QKXB 4EOWH 2P7TB 3GBNH 4JZNB 3NFSL 2YD2A 2UWEF 1WSST 2QSVA 5IQ7L 1KPVB 3DXAB 4M5YH 5J1AB 1J11A 5E7FA 2VN7A 1EFXA 3T3ME 4XNYL 2HWZH 3C09B 4OUUA 2OBGA 3OWEA 4FFVC 1J1PL 5L9DL 1WUNT 4UTBH 1DQJB 4H1LB 4NPYA 2QV2A 4TUJB 3F65A 4M03A 4O4YH 5GSVB 1D5IH 4WCYH 3QUMA 2HVKA 4ZOCA 5I30H 1QBLL 1WBYA 5IW1B 3LQAL 3ZE0F 4PJFF 1MCJA 2VL5A 1Y18A 1I1FB 4BK5A 5I1IH 4MNHA 3KG5A 2Y25A 3MLUH 1KB9K 5K93A 4G42B 5CZVL 3QCUL 3RVTD 2A6DA 1YNLL 1KB5B 1JYWA 1ZT7B 4Z7WF 1FL3A 1VENA 5IVNA 3S5LA 4YHLL 1MFCH 1XAUA 4LCIH 5DO2D 4DKEL 5B8CC 5I1HH 1ZLWK 2XV6B 3QIBD 4FMKA 4U0RB 1TJIH 1J8HA 1ONQB 1N5YH 5F89B 4H88H 1DP0A 4V2BA 5ISZD 1NBVL 4BZ1H 3UYPA 4MJ5A 4PR5B 5DSCA 4N0CD 1YJDL 4MLIA 4TTDC 3O0RH 2FX9L 2DQHL 4HKXB 2WZPD 4F80A 1GAFL 2ZJSH 2C1OB 4K94L 3RIFK 2AGJL 3PV6B 3GRWL 2IMNA 3I9GH 4KHTH 4KK5C 4FQCH 1G6RA 3N85H 4G8GD 3L1OH 4QRTB 5AZ2H 3QG7L 1L7IH 2ILLA 2DQCL 2VDPL 3QSKB 3BIKA 5D7IA 1AD0B 2HLFD 3SGEH 4KTDH 1S9YB 3BP5A 5L6YL 4QTHA 3IAPA 3GSWA 4PRHD 3L3OB 1KJ3H 4BUGA 4WU7A 2E3VA 3GSUA 4C55A 4M62L 3FT3B 5D72H 3H2WA 1WEJH 3UTPE 1EV2E 3HE7C 2HAZA 3HA0A 5HGAA 4ACPA 3BPNB 4JM2A 35C8H 4NQCA 2FD6H 4YDKH 2BX5A 2VWEE 3MUY1 3U30C 4MXQD 1L7TH 1NMCC 3U46B 1K5NA 4LDOB 1CR9H 1DFBL 1EJOL 3UTSA 3HKFA 5JIPA 3ULUC 2AJSL 4CVUA 1W0VB 3K8LA 3OAUL 5CHNA 5TPWL 2QSCH 4D3CH 3RWIA 4KJWC 1OGAB 1MNUL 4NKDB 2X4NB 4ELMB 3TIDA 4JFZL 3KPRD 4LPYA 4OIIL 5D7LA 2DWDB 4BKLB 5INDB 1EGJL 4B41A 5L2JA 3GMMB 3Q48A 4HIIA 3B9KA 4OM0L 5AD0A 2IEPA 5TE6L 1IZKA 3G6JF 2F19L 3MFGB 4NHCH 3KLHD 1CICA 4Y2DB 4U1GC 1EPFA 4NC1C 1N4XL 1U2HA 3MLTB 4YHIB 5IVZA 3FQXA 5DO2C 5HGDB 4UIKH 1MJ8L 1NC2D 3DROA 4Y2OA 5LXGL 2YBRA 4PJDE 2OR7A 3QIBC 4MHHI 5F21B 3CFJA 3HI5H 4YXLH 3NACL 3LCYA 4JM2D 4XP9L 3DVNA 3WUWA 5KAQG 5IB3A 4P59L 1MH5A 5I1KH 5I6XC 4M7LT 3S37X 4LSQH 1A14H 1O0VA 1H9VA 3F7PC 5KW9L 3I02B 5EC2B 5FCUL 4FZEH 5D2LF 3UTSD 4OD1H 3RHWF 4EXPX 1XR9B 2XN9D 5I71B 5DUBB 4KI5D 3MNVA 5D6CB 1J12A 3FT2A 5EU6B 1A7RH 5GZND 4DGIH 5D8JH 3CSGA 5JIKA 1BEYH 1B4JL 4OLYL 2BOCA 4L9DA 2FO4A 4EXKA 3GJEA 4NZDA 5IB4A 3VMNA 1PZ5A 2HLFC 4M5ZL 1I3VA 5J3HC 4JPIA 5JO5A 4RAUB 4HG4J 3TIEB 4KHXL 4GS7B 5F6IC 3V6OE 5A40E 4EQ3A 3S88H 3O2VH 5EIIB 4MHHG 4DAGH 2PN5A 5C08E 2AJYL 1JYXA 2UZIH 3WL9B 2GW5A 3O4LE 1DBJL 1M7DA 1MCWW 1NMAL 5KSBE 2D7QA 3T8XA 2ICWA 5DC4B 4MXQC 5D5MA 3DMMA 1ZHNB 3SJVD 1YEGH 3DECA 4LSPH 4NC2B 4PRIB 3TJEH 1IEAB 4QOKB 1UYWH 2P8LB 4L3CA 3TYFA 3ARFA 1GZQA 3O2WL 4E42A 3MJ8B 1Z5LB 3FONB 4U1LB 1ZLVH 5E4EC 2FL5B 4MCZB 4NRXA 2I9TB 3GB7A 2N56A 2BVEA 1WAAE 5DYOB 4YFLI 5C0EB 4XBPA 4M3KB 1LEIB 2NTFB 3VFRB 2SEBB 1GYAA 1II4E 2HVJB 2LAAA 2FHCA 4XBEH 1IGJA 1JFQH 3KYMB 3FB5B 4HIXH 3P3YA 5CINL 5EO0A 3MUHL 1ZLSL 4BQ6A 2IG2H 4NQDA 1ZEAL 1K4DB 4OLZH 3U4EB 4XPGL 3BKCH 4JM2C 5DWUL 1OTTD 1XIWD 1J10A 4KROB 3TNNB 5CMAA 3QUZB 5I17B 1FNGB 3UJIL 4ISVB 3C8HA 3G04A 2NY4C 2Y06H 4CMMB 4PRPA 1EUTA 4QT5A 3U6RA 4XPFH 5DZNA 5I1LB 2V2WB 5C09D 1ZVYA 2ATPB 1D9KA 1NCBH 1NEZA 4P5KB 3UTQB 2ICWJ 3U9UB 1TCRA 4NN7B 2DQTL 4TVPL 5AWNH 3IFOA 5C0JA 4H20H 3UEZA 2FHBA 4NQTA 3HAEH 4Z0BH 2PR4L 4X6CB 2FIRT 4NO2B 5E6IA 2V2TA 5LCVL 4OI7A 4JREB 1D3CA 3FOMA 3MLXL 4V1DA 3B9KC 4XTRC 1ED3A 3RPIA 3V9FA 3SO5A 4G7VL 3GIVB 5BO1H 4L8SB 5GGVY 1CICC 3BKML 3CFKA 5DEGB 3MLVH 4NQDD 3C5SA 2GFBB 4AIXA 1T2QL 2VKXA 1GGBL 4DTGL 1KLUB 2XY1A 4CVXB 2M26A 1DCLA 2B2XL 2CR3A 2DICA 3QEGH 4M7KH 4RA3A 2YC1A 5BZWB 4F7PA 2CR6A 3TPKA 1BBDH 2EZ0D 2F5BH 2OR9H 2PYEA 3TVMA 3GSRB 4PP1C 3MRIB 3N9GH 8FABA 5JLZA 2ENSA 2ZNWA 2BJMH 4Q9RL 1QLEL 3ZT6A 5HYEA 3H7BB 2BY2A 3TBVB 4IBLT 3DV6A 4GFTB 3O9WD 3IXAA 4W4OC 4G43A 4KJYB 4FQXB 2EKSB 3DNKA 1JCKA 4PRBB 1RIUL 5DHYB 4NFBA 4OM1L 4A6YL 1S5HB 1RUAL 1H0DB 1J1PH 5CEZH 3P30H 3EO0B 1A9EB 2WQRA 2D7NA 5DS8A 3OKEA 1ZGLA 3H9ZA 1NMBH 1FNSL 1AFVL 2GIYA 3OAZK 5ITBL 5DRWB 5ICXA 3F7YA 4MD0B 4I5BA 4HH9B 1QBLH 5DVKA 3LQAH 2VDOL 3BRGC 1IGTB 1OTTC 3BT2L 3SDYL 2F9BT 5E2JA 4P9HL 1VFBA 4JDZB 4PREB 1T1XA 4XRCB 2PYED 3DMMC 3RGVA 1A6AA 3G5XA 4JDVA 3A67H 3QCUH 3SDDD 4F8QA 2H45A 4OZHA 1YNLH 1GOFA 1ZHKB 3T77A 3UZEA 4KGLA 1CBVL 3BUTA 4IJ3C 1M05B 3GSNL 2ZSVA 1ADQL 1IT9H 3DBXB 4Z7UA 5E94B 4C4KT 4EUPG 4YHYB 5J1SC 2H1PL 4R7NB 4ETQB 2EKJA 4O00A 3ARGA 2EO1A 4DKEH 2A9NL 4YZFF 3BO8B 4S1DC 1CQYA 1OAYH 4KKLD 4RSVA 3V52L 4QCIB 4R26H 3OAYH 1QSFD 1WCBB 3IKCA 4RBPH 3NN8B 1MHPL 2NXZD 3KJ4C 5GGTA 1DUYA 2DOCA 3VXRD 4CVZB 4X6EB 1EUUA 5IW6A 3C08H 4Y19A 1NBVH 1ZKAA 2OX5A 1TVBB 1PBYA 3ZDZE 4W6XB 5KOVC 1DVFA 4MGXA 5C7XH 4FFYL 5DHVH 3DVGA 1NDMB 3TO4A 4UOJA 1LEKB 1KLGB 2FX9H 2DQHH 3WBDA 2XG4A 3ARBA 4IRSB 4P48A 4JG0L 4K94H 5B21A 2AGJH 2EZ0C 3GRWH 3Q3GA 3HPLB 2GTZA 2NZ9D 3QH3A 3IDMA 3HE6D 4FRWA 2BCKA 2UUDH 2VDPH 4P2YA 3SO3C 4LSSH 5L6YH 1TMCB 4RAVB 5E9DE 1G9EA 2B4CL 2A1WH 2RGSA 3O9WC 3FB8B 3MFFA 2B20A 3ECBB 3LB6C 4M62H 4OZFH 3DUUB 5E6IC 4XT1C 3LEYL 1WT5A 4Z7VE 4PJ9A 2R69L 1I9JH 2G75B 1C12B 2VO5A 2R15A 2RFXB 3UTTA 3CH1A 1G0DA 4U1SB 3DJ9A 1FFNA 4L4VD 1HI6A 1CDUA 5EDXA 3V6FB 4GW1A 4TRPL 1FZKA 1TDQA 2AJSH 5DZOA 3ARBD 3DI2B 5TPWH 2Z8RA 1K8DB 2NXYB 4WY7L 1IAII 3TVMC 1GJIA 3L3JB 4JFZH 4PJIB 4OIIH 2YPLA 1S8DB 3SDDC 5FO8A 5DRNB 5MHSD 3QIUD 1EGJH 3QPXL 4OF3A 1GSMA 2QQNH 3SKOA 4P2RD 3WN5B 2P5ED 5KTEL 4O51A 4OM0H 2DQUL 5TE6H 3A6OA 1D5MB 3B9EA 4X5WB 1N4XH 4PJ5B 4YDLB 3I6KB 4Z7OE 1SYVA 2VLLA 3ZDXF 1F2XK 5ITFB 4P59H 3ZDYF 1R3LB 1J87A 3UPRB 4L8BB 5KW9H 5FCUH 3V6BR 4L29A 4QHUB 3WO4C 2X4UB 3EOBA 3STZB 5D1XA 5H2BA 4HQQL 4U1IB 1A5FH 1EO8H 3BZFA 1DR9A 4PLNC 1A3LH 5CLWA 3QDME 4OV5A 3K74B 3RGVC 3DGCR 3VFMA 4JJ5A 4JKWA 3BGMA 2QHRL 2E9BA 3IS1X 3O6KH 5TDNB 1B4JH 4OLYH 3WJLA 5IV2B 2NW3B 4OLUL 3MOAH 2BOBA 4M5ZH 4ZQKA 3PWVA 1TIUA 5FDWA 1CLZL 4JFEE 4WFEE 4GUPB 2BC4B 3BZ4A 4GQ9L 1OCWH 2BDNL 1LO2L 2D4FA 4ZSOA 5F7LB 3ARGC 3PGDA 4NYLA 1I7ZB 2NNAA 1NAMB 4C59B 1MCOL 5IHUH 3HZVA 2OTUB 2AJYH 5HHMD 3W2DL 1U95B 5D7IF 1DBJH 3LQMA 3AMLA 2C3WA 3QXUA 4E5XA 1FFRA 5J89A 4OFYD 3EDJA 3KYNB 3V0WL 1DVFC 3KWWA 5LKNA 1ZT4A 1OTSD 4L3ED 2VC2L 2X2YA 3GMNA 2IBBA 1YEKL 4M1CD 3VWJD 5D7KD 3TYGL 5KSBB 3O2WH 3ARBC 4ZFOB 1X6LA 1EEYA 2A74B 3OKKB 4PJEE 2P46B 3VCLB 4JM2F 4X6BA 3H9SA 1KTLB 3HR5B 5EWIL 3QIUC 1PKOA 3W81A 1N64H 3BKYL 2BNQE 4WI3A 4G8FA 1ND0B 1QRNE 4EKXA 4IOFD 5GGUB 1G7MA 5JHDD 4MJ4A 2DM4A 3I6LD 5CINH 4ZYKB 1ZLSH 1V7ML 4KI5F 4LCWD 3KDMB 1N0XL 1PKQA 3PJSB 1ZEAH 1WT5C 5K59E 1U92A 3B3IA 4PJ9C 4XPGH 4Q58C 4QRPE 1IM9D 1WLHA 2ITCA 2Z31A 4ZXBA 4DQOL 3O81A 2D31A 4HHAB 3MV8E 3CPLB 4Z95H 2E8ZA 2DJUA 3EJZC 5AYUH 1OTUC 3IDGB 4UDUA 2IAMB 2AQ1A 1EHLH 1G9NL 1UVQB 2DQTH 5IIEA 1UXWB 4TVPH 5ACLA 1XF4B 2W59A 5LCVH 1SJVA 1UWGL 1F3JA 5ADOL 4X6DE 1M7IB 4WWKA 4G7VH 1J0IA 2DQEL 3DV4B 2EO9A 3BKMH 3P0YL 1ULVA 1EEZA 4RNRB 1H3PH 1T2QH 3EFFA 1GGBH 1AKJD 1UA6L 2G2RB 2XOTA 1ZVHA 3K8MA 4DTGH 2A38A 4L9LA 2VIRB 3BP4A 5F6HJ 3BE1L 3MA7A 4PRAA 2B2XH 1NGYB 5F7FA 5JXED 4DFIA 3EYOA 4ZS6D 1HXMB 4JY4A 2BNRA 5D1XC 2BVQA 2YUZA 2J4WH 1AHWB 3CFDB 4Q9RH 1CGSL 3VGHA 4K7FB 4X4XA 3HZKB 5KVFL 1AGBB 1WC7B 2Q87A 1YQVL 1F42A 1Q94B 4WV1B 1NEUA 4LDLB 2CQVA 3O3BB 4L4TD 1KTDA 5D5MF 2CDFA 3WLBB 2DTML 2MSPA 4D9QE 2XI9A 3RIFF 3V8OA 3VXOA 4NQEE 4A6YH 1MFDL 1AXSA 2DF3A 4W4NA 4WWKD 5DJCA 2YRZA 3IF1B 4F7EB 1FNSH 2A6IB 1AFVH 5HYSG 4OCWL 1E4XI 2JB6A 4OZIA 4Q6IB 1MIEL 1Q9WB 2EYSB 3DTXA 1KACB 4OF8A 4WDIB 1D5XB 3BH8B 2VDOH 3U0WL 4OZ4B 2Z92B 3BT2H 4FOMA 3SDYH 4AJ0A 4D0DA 3QEUA 1BD2E 3OR6B 1FYTE 1UADC 3O2DA 3MCLL 1T3FA 3VGDA 1QD0A 2QQQA 2ZG2A 2J8UE 1CFQB 3W0WD 4X7TA 1UM4L 4S0TD 1OHQA 4JZNA 1E4JA 2HN7B 5FUZL 4U3HA 1CBVH 1H15A 4J7RA 3GSNH 3DSFL 3O6FB 1ADQH 5C0RL 1KPVA 4KK9C 3DXAA 1K2DA 2H1PH 3F12B 3BEVB 3BWUC 1HIML 5GS2D 2ATKA 3QXTA 3L95B 1KCLA 2A9NH 5BV7B 3E3QE 4WJ5A 4L8CA 5JIIA 4D0BA 3OGCB 3LKPA 4GG6F 3TPUB 1JTOA 1K6QL 2NY0B 3MCG1 2IGFH 3V7MA 2ESVE 1DQJA 4H1LA 5F72S 2MMXA 2FWOB 4GOSA 2NY2B 2BVPA 5ELIA 4TUJA 2H3NB 5GSVA 4K8RD 2Z8SA 4FFYH 5IW1A 5DUPL 5HHOB 1AXIB 3VFWA 3C5ZB 4C56E 2ARJA 2C3VB 2Z31C 5JXEC 4JG0H 1I1FA 1PG7X 4ZXBC 1TCMA 3RY4A 1UKQA 1KYOJ 2A73A 4ZS6C 2X70B 3FQNB 3MRPB 3QG6B 5BW7A 3GSOB 4NQXB 4G42A 1XCTA 1KPUA 2NY5C 5J13B 4JRXB 2R1XA 3MV9E 3UPCA 2DLTA 4NO0B 2B4CH 2D7TL 2R0WL 4K55A 7CGTA 5ID1B 2XTJE 1DSFL 1W0WB 3AS2A 1IGYA 4MXWL 5ICYB 1BWMA 4HIJB 3LEYH 1EXUB 3PXHA 4X9FA 3SDXF 5E9DB 1SJXA 4EI5B 2R69H 5HPOA 4WWKC 5D6DA 3T0VA 3RU8L 1ONQA 5E5MB 3VE0B 3GJFB 1IEBB 4CMHC 4Z7VB 1I3UA 2VXVL 4PJHE 3C6LA 5IT2L 4TRPH 4PR5A 3VG9B 43C9A 4U6XA 5EUKA 3GO1L 4LRNL 7FABL 4HKXA 4HMCA 3PV6A 5CSGA 3CFCL 1F6FB 1RUPL 3LY6A 4OKDA 3QPXH 4PTUB 4XMPH 4HUVB 1BJ8A 1UFUA 1U8KB 1HSAB 5KTEH 3WDJA 1QFHA 1BP3B 2DQUH 2E6PA 3KPOB 4LAJH 5F1NA 4QYOA 4N0UB 3SQOL 2FCBA 4YHNA 4BELD 3FT3A 2IH3A 2GQHA 4RGNC 1XGUA 2FX7L 3L3GB 3HNVL 4OZHF 4MZ2A 4K3HA 1S9XA 2V5SA 3ALWA 4X4ME 3W9EB 5IJKA 2PO6D 5L88H 4XNZC 3QUMH 4PB0L 3U46A 4NQVB 4MVBC 3O45B 1B88A 5KVEL 3D5OF 4OF6A 3PDOB 1NL0H 1HHHB 4U1HA 1U3ZA 3LAFA 4JFFB 3DHMA 3TNMB 3HG1A 1OGAA 2QHRH 4DGVL 5I9QB 4HUUB 5D7JB 4NKDA 3VXPA 2X4NA 4ELMA 4H0HB 1INDL 2C3GA 1C1EL 2DWDA 3PWUB 5JOPE 2PTTA 4OLUH 3QDGB 2IADB 4ODTL 1I7RA 1NCCL 4G9FA 2F54A 5GRVK 5JHLH 1PEWA 3NIDE 3ES6B 5A2KH 2I9LB 1R3HB 4GQ9H 3UMTA 1G7QA 1LO2H 2BDNH 5C07E 3STLB 4Y2DA 4O02H 1GCFA 3NAAL 3MLTA 4YHIA 1UKSA 3P4NB 5HGDA 1QSED 3QQNA 3C09C 2QR0B 4RQQB 4JFEB 1I1AA 4KV5E 1QPPA 1CXLA 4N5UA 1OGTB 2WM0A 2ZUQC 4I8DA 3S37L 5B3JE 2QBWA 2EIEA 3V0WH 1ITBB 3I02A 4K3DH 4KWUA 2X1XR 1U58B 2VC2H 4JAMB 4IDLA 2OJZH 3FFDB 1SVZA 3RWEB 1T4KA 5TGBB 1YEKH 3TYGH 4PLKD 4F37F 1XR9A 1M7XA 4MXVE 5B38B 3VH8B 5FGRA 2DQFA 5DUBA 1A6VL 5D6CA 4U33A 1Z0NA 2J88H 4FTVB 5EWIH 5JOEA 5BW7C 5JPMB 4PJAB 1QFWL 3VXME 3BKYH 4ONFL 1QFWM 2KDGA 2CRZA 4O2EB 4NNYB 4P4RB 1MRCL 4XPBL 2VITB 3MLSL 3IJHB 3TIEA 1V7MH 4BQBA 5EC1A 1N0XH 1RZ8A 2BNQB 1GRWA 1QRNB 2IPKB 4IRJB 3T1FB 1KXTB 1CN4A 1G9ML 2OTWA 4TNVK 1AO7B 1UH3A 5D6DC 3PNWA 1F13A 4N9GB 2GSIB 4U0RC 3WL9A 2VYRE 1UM6L 2C7UB 3X3FL 5LBSL 3P9LB 1KIRA 2DDQH 2V7HA 4GBXB 1ZHNA 3PWPE 4YUEL 4QTIL 4NFCA 3C6LC 2WUBL 4E0RB 1VFAA 3PIQB 3VFPA 4PRIA 1BIIB 1IEAA 4QOKA 3FN0L 2P8LA 5CD5D 2XKNB 4PUBH 4NIKB 4LU5L 5FUCE 5HJ3B 3TGXA 1A8JH 3FONA 1MI5E 5EU6D 5IB2B 1MCWM 3CC5B 4JFPB 1FFOB 4MCZA 1HILA 3H7LA 5DYOA 4KMQA 3LSOB 2EE2A 3BMVA 1JNHB 1UWGH 5CZXC 3OMZA 5ADOH 5MEQB 4UU9B 3VFRA 2ADIB 5IJVB 1X4ZA 1LE9B 2HVJA 3FHQA 1J05B 3IJYA 2DQEH 5FM5O 1KNOA 1U3HB 3QO1B 5JW4M 2W65A 3KYMA 4HUMB 3NCEB 3V0VB 5KS9F 3K80A 3V5DA 1MUJB 1P7QB 3LPWA 2WWKO 1UA6H 4X6DB 4I2XE 4G8EA 1NGZA 3U4EA 1E4KA 3BE1H 3BPNC 1FZMA 2B39A 2IFFL 3TNNA 5IJKC 2QEJA 3DX8B 3LS5H 2O61B 4ODHH 1MCBA 3RBSA 4PRID 4AM0B 3U36A 4CMMA 1CGSH 2H2PD 5I1LA 2V2WA 1NFDE 5KVFH 1E4XL 1YQVH 3B8YA 3OHXB 3U9UA 3K4ZA 4S10A 3SHSA 2ZUUA 2DTMH 1CGTA 2DM7A 4X6CA 1RIVL 5JZ7D 5GGSB 4NO2A 1U8NB 1FNHA 1MFDH 4GW5B 2BXZA 1ZLWH 5D2NE 3GNML 3GIVA 3TBWB 4LIQE 4BZ2L 4Y2DC 3OF6D 4OCWH 3G5VB 1CT8B 4CN4A 2GFBA 1VDGA 1I1AC 3U0WH 5DD5L 5DTFB 1JZ8A 1KLUA 5BZDB 2DLIA 4M9PA 2O5ZL 5B4MC 3MCLH 3HUJF 1KIQB 3QUZD 5D71L 1I8LA 4WW2B 4C58B 4NZJA 4OFPA 1UM4H 3GSRA 4LLVA 2QADB 1GPOL 1W72L 1ZK9A 3J8F7 5E2UL 4F9PA 2GJ6D 5FUZH 5JUEL 2ENYA 4UB0L 2DLFH 3F58L 5I71C 3KXFE 3DSFH 3WHXA 4MA7L 4TSCH 4POZD 5C0RH 2WUCL 4Z7NF 1YYML 4NM8L 4OKVA 5DVLA 4XC1L 5SX5K 2DLHA 4FQXA 4JO1L 4PRBA 2E9WA 4HXAL 5DHYA 5EN2B 3LH2L 1S5HA 5HD8D 1H0DA 3S6CA 5GRUL 3EO0A 4GMTL 4GS7C 2BRQA 4FQQB 1ORQB 3OKNA 3T2NL 4HK3N 2EDYA 4MD0A 1MFAL 4HH9A 5DUPH 2VLME 1L0QA 1XCQB 3WIHL 1IGTA 3M1BB 2VLKB 4O58H 3AUVA 4FXKA 4O5LL 4JDZA 4XRCA 3D2UD 4FQ1H 5I1GL 4HKJB 4NO5A 5JDJA 4HFWB 4N0FA 5DI8A 1QBBA 4HWBA 3V0AC 4MA3B 4C56B 3VU2A 5ADPL 5C6TL 1JGVL 2H2PC 2Y07H 4F15B 3VDBA 4QRRD 3D1MC 1ZHKA 2R0WH 3JV5A 1WITA 5HDBF 5ETUB 1DSFH 5JQHC 3CMGA 3RTQD 5MENE 3DBXA 1OF2B 2IANE 1SJEA 4MXWH 3QHTC 2ERJC 4DN3L 4R7NA 2APFA 4ZNEE 1BQSA 4MX7B 3HS0B 2MKWA 4UNUA 1B0WA 1T1WB 2A77L 4UINL 4HZAA 3GM0A 4AMKL 4QCIA 1RIHL 2XTJB 1J7VR 4HSQA 4Z7QF 4F7TA 3L6FA 4Q97A 3A6CH 3S4SB 3RU8H 3NN8A 5J11B 5ENWB 4CVZA 3L9RB 1JGDA 4X6EA 4DW2L 4XZUB 1TVBA 2VXVH 1RU9H 5IT2H 2ADGB 1YUHA 1E4KC 4X7DC 2CXKA 4QHNB 5H35B 4X99B 5EPMA 3WYRA 1NDMA 1JZ5A 4KROC 5D9SB 1KLGA 1LEKA 3GO1H 4LRNH 7FABH 3CLFL 4IRSA 4B50A 5SWQB 3RUGE 5E4IA 3NGBB 4PTTA 5IOPB 3CFCH 4Y89A 4HLJA 1AGCB 1S7SB 5A2IH 4L5FH 4EUPA 4OZIF 1H3TA 2E27L 3PWLA 1URLA 4XCYB 5BRZD 4K7PL 1AXTL 3NBNA 1I9EA 4RAVA 4POZC 3SQOH 1D6VL 2YEZB 3FB8A 3ECBA 4J3TA 2BFVL 2BY0A 1VEOA 4LHUB 4PGBB 1FPTL 4JREC 1J1OL 2FX7H 4P3CL 3HNVH 3LPFA 2GSGB 4Q7DA 4UUJB 2G75A 4ONHB 4L8SC 3RI5K 1ZLUH 3QIWD 3VFOB 2RFXA 3OG4B 5GHWH 4C54A 1IAOA 4U1SA 4K8RL 5KVEH 1XGRA 5FA3B 3V6FA 3X14A 1UJTA 5ID0B 2KKQA 1HHKB 5I1CH 4OBRA 1FQ9C 3OXRA 1I8LC 3SKNB 1BQHA 3QQ3B 1YPZE 3HZMB 4R7DB 1C1EH 1LP9E 1SBSL 2ADFL 3MUGB 3MREB 1UZ6E 4UV7L 5DRNA 2HP4A 4ODTH 3UJTL 4HCRL 1BZQK 3H9HB 4I0PB 3CXHK 3AM8A 3EZJB 4G9DB 2IQ9H 5SWZB 3S3PA 1MCSA 4KRLB 4X5WA 1EAPB 1VADA 3OB0H 4PJ5A 3NAAH 3QISA 4FQXC 2Z91B 3TH3T 1K3ZA 5CILH 3BH9A 4MNGE 4WHTB 3RVVC 5DR5L 1FG2A 3U83A 5GGTH 4WUKH 4RMVA 5FM8A 2XPGB 4HIHA 4MQSB 3S37H 3U4AA 1G84A 1U8IB 3V6ZA 1B6UA 4NDMA 5E8DH 5HHPB 4PJDA 4LSVL 1AC0A 2F53D 3FO2B 5GGQH 2JK5B 3BHBB 2A0LD 1SVCP 4LSDA 1HKFA 1S7RB 2W60B 1A6VH 4J23A 1LO0L 3VXNB 4PJCB 4CU8A 1QFWH 2ZOKA 5TDNA 1CFVL 4ONFH 3LOWA 2AEWA 3MNWB 2X1QA 2MKLC 3BUYA 2Z9TA 1KB5L 2JJSA 4P2OB 1MRCH 2IQAB 3MGOB 4XPBH 1QLFB 3D3VB 4M6AA 5TDOB 2HH0L 1QQDB 5TE7L 1Q72H 1PX4A 3HRPA 4YHYC 3V79C 3RWHB 2BHUA 4PJ5D 1V5JA 2V9TA 1BFVL 1DUZB 1A3RL 1I7ZA 4D9LL 1G9MH 3V5KB 5J6GB 3LN5A 4NZRL 3RIAK 3DO3A 3QR2A 3S34L 4EJ1C 1U95A 4ZO9A 5JDSB 3FQWB 5HYJE 1UM6H 3X3FH 5LBSH 4EN3A 5ERWB 3V6OA 4NKIL 5IKCB 3KYNA 4YUEH 2WUBH 3JV4B 4OLWL 2I60H 2I25N 2AJUL 2DBJA 4PS4H 2OZ4L 3FN0H 3REVA 1CG9B 4HWEH 3O4LA 4E41B 1MLBB 4Z78B 2AXFA 5KSBA 1EDQA 4IRSC 4LU5H 4ZFOA 2A74A 4LSTL 2H32H 1CLOL 3PWPB 4OCSL 5C3TA 3HR5A 1KGCD 2VDML 3PGCB 1KCSL 3QFJE 4XP4H 2AJ3B 3PP4L 5HHVL 4BSJA 3OKMA 1HHIB 2DI9A 4ZUSB 3WNKA 4ZMAT 1MI5B 2X09A 3ZMRA 1QP1A 5GGUA 2VKWA 5EZLB 4YEFA 1PSKL 3I50L 1WAAA 1MHCB 1RZJL 3KDMA 1U8LA 5T1MA 4ELMF 4DOHE 2JJWA 4GRWB 3CLEL 3PDDA 3OXSB 3BPOB 1JGLH 4ZPVB 2VQTA 3VA2C 1RUML 2IFFH 4L3AA 4XX1G 1BLNB 1DEEB 1Q8MA 1HQ4A 2J6EA 4B5EA 2NX5E 1Q1JH 3ARZA 1OAQL 3QWQB 4HHAA 4MWFB 3MV7B 4I2XB 4IM8A 1Z6JT 3FZUD 4LPWA 1CTOA 3HZYA 2NXYC 1UVQA