4WV1B

Crystal structure of the fgfr2 d2 domain in complex with fab 2b.1.3
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
230
structure length
224
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTFTSTGISWVRQAPGKGLEWVGRTHLGDGSTNYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARTYGIYDLYVDYTEYVMDYWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/immune system
molecule keywords Fibroblast growth factor receptor 2
publication title Redesigning a Monospecific Anti-FGFR3 Antibody to Add Selectivity for FGFR2 and Expand Antitumor Activity.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 224
sequence length 230
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wv1B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wv1B01
1WCBB 1F4YL 5MERB 3QIUD 4XAKD 4F33B 4LSSL 4OTXH 5FYLE 1C8PA 3FB7B 1FV1B 1MH5B 3O6LL 4JB9L 4P4KD 4QLRA 5C0FA 5T1KA 3FT3B 4KJWC 4P99A 3SDDA 1SEQL 3MUGB 3N9GH 5C0DB 4EUPG 5GRUH 5ALCH 3LPGA 1HILA 4YDKL 3GHEH 5FYLH 4TULL 5C0CD 5TE6L 3C6LB 4ZFOL 5BV7B 1KJMB 2E7HA 4P2QD 4UINL 3S37H 1NANH 3EFFA 5IBUB 5E1AA 3WXVH 3STZB 4Y8DC 4HPYH 3DX6B 3HPLA 3I6GB 4JZJB 3L3OB 3MUGA 4QHUB 4S1RL 3I75B 1ZLVK 3MNWA 3MNZA 3OAZH 3LN5B 3WFBL 3HE7C 3G9AB 1FLRL 1JI2A 4KTDH 1ZHKA 5FKAA 1OB1B 2VZOA 3BDXA 4OZHE 4PJCE 1KJMA 5AG9A 4FTVD 1PKOA 5L8LB 1B3JA 3SKMB 3V9FA 3QDJE 5IWLA 3DETD 1EFQA 5DJYB 4U1LB 2W60A 1MCFA 1ZEAL 1WFTA 1IC4H 3TPUA 2DQUH 2Y36L 3CFKA 4P2OA 5B4MC 4QHUA 5SWQA 3VWKB 2HA1A 4C58B 5LKNA 4ZSOE 4MD5A 3UO1H 5IQ7L 3RRQA 1NH6A 1U41A 2XG4A 5IWLC 1A4JA 2IFFL 1AE6L 3E8UH 1OB1A 3ZLQC 3UC0H 1CDJA 1BZQK 1OF2B 3L3HB 4WY7H 4JLRA 4P2OC 3RBGA 3BKCL 1SYSB 1QLRB 4R4NC 2HT4D 3DVGB 4FP8H 4U1LA 2YD7A 4FXGA 2OR8A 1LMKA 1CDIA 3VWKA 3BI9X 5I1CH 4Q0XL 1L0YA 4X99B 3TVMA 4P3CL 5LCVL 1NBVH 4XCNA 1QD0A 1BIIA 1OGTA 3K4ZA 3RL1A 4DEPC 3MXWH 3SKUD 4WTZG 2GK0B 1EX0A 1QLRA 4OLWH 4U1KA 4TUJB 2IPUK 3DVGA 4Z95L 3QDME 4G3YH 5HYSA 3ARGB 1AO7A 1WITA 3TVMC 3X3FL 1FDLL 4LSTH 4XB8A 5GS2D 5EOTB 1GC1L 3SDAA 3WN5A 4Z0XB 1K3IA 4P48A 5MEQB 5CINH 1XGYL 2H26A 1YA5A 3KWWB 3VCLA 1VEMA 5DVMA 3CDGA 3P77B 3C8KB 3E2HB 4QXWA 3IXAB 4AEHL 1WISA 3UZQA 3MFFA 4G8FB 5HHOD 4HFWB 4YPGB 3SCMD 1ORQB 4KROB 3SDAC 4UDTA 4PD4J 3WN5C 4HCRH 2W65B 1QSFB 3P0YH 1P4IL 2AJ3B 5KVFL 3MX0A 1HI6A 4H20L 1OAQL 1KCRH 4KKBC 5MEQA 4TTDD 2RCSH 4RQQB 4Z7QF 2Y72A 1RIUH 1QFUL 4CU8A 4HIXL 3BAEH 4NJAL 1D6EB 5DJXB 1CXKA 4ELKA 2R4SL 3PWVB 4HFWA 4F37K 1MI5B 4K94H 4GKNB 4X6EA 1PX4A 1QSFA 2I27N 4NKQB 1QEWB 2AJ3A 1UADC 1I9EA 3QNYA 4E41D 1M1SA 1WF5A 4MNGB 3A6BL 1OT2A 4JO2L 4KRNA 4O5LH 1YEGL 4WTWA 5HDQL 3WNNA 1REIA 1L6XA 4GAYB 4QYOA 4M00A 5DMKB 4HV8B 3PWJA 3I50H 1MFAL 4RWYH 3MV8A 3IU4L 5GRXG 4LOUD 3MZTA 1MCHA 3LVEA 4NQTA 3MJ8A 1TFHA 1S7XA 2DRUA 1FYTB 3DTXB 3SGJA 1ZA3B 1M71A 1HNFA 3N0PB 2AQ2A 2XPGB 3ROOB 4LDEB 3EYSL 5CFHA 2F54B 4AEIL 4PRAA 4ODTL 3RY4A 3CMOH 3QCTH 4XVTL 1JN6A 4M3KB 1F4WH 3WIHH 5HYFA 1T20A 2YSSA 4NP4H 1VFAB 3EYVB 4XP9H 1ZGLB 4W4OA 2EH7H 1JZ3A 3RVXD 3T0BA 4ONHA 4HWBA 1IM9D 4CNIB 3G08A 3MODL 1KPVB 1XF5B 3KYKL 4HKXA 4YUEL 4IRZL 5DJAB 5C0NC 2YUXA 4WUUA 3BMVA 4H0HB 2HFEB 2VZ1A 4PLKC 3ESUF 4PRHA 2GHWB 3O4LB 4O58L 3C5JB 3MQIA 1QSED 2F54A 4YFEA 4XCEA 3DSFL 3KNBB 4CVWA 4W4OC 1ZLUH 3L3DB 1QR1A 3ARBD 4HUWB 4UQ3A 2BRRH 2YEZB 1HHKB 3DXAA 3T1FA 5GGRA 1XT5A 3EDJA 3VFUA 5EC2B 4J3SA 5FV1L 2A38A 4LRIA 3LIZH 2JB6A 2LU4A 3BPCA 1T7VA 1BMGA 2G9HA 2DQFB 3JTSB 4DTGH 3VFGH 3IXTB 1TJGL 4R97B 2VUOA 4JVPA 1DDHA 4BSVB 4KH2A 2X70A 1RUAL 3KNBA 1KENL 2J8UE 2FECI 3CSYB 5KG9B 4YXHH 4HUWA 1INDH 4LRIC 4BFGA 3OKMA 2P24B 5L6YL 1RIHH 3G6DL 4LPWA 3BZFA 5ICZA 1EJOL 1L7IH 4QTHA 1KPUB 3OKDB 4WEUD 4D8PB 4XRCA 3TIEA 4K7FB 1RAMA 2DQEL 4N5ED 4WFGD 2VITB 2YMXL 1QBAA 3JTSA 1UB5B 4NKOB 2NY4C 1U95B 4NQED 4XCYB 2EKJA 3O3UN 4BSVA 4FQCL 1YJDC 1ODAA 2VERN 4XNYH 4LASH 5GPRA 1T22B 5EPMB 5E4EC 1BFVL 5HHQA 5J4MA 3CXHJ 1I75A 5IT2L 5GJSL 1OAZH 2Z31D 3VGFA 2YPLA 1CGTA 3HN3A 3LDBC 4M6NH 2V5TA 4O9HH 4LNVA 4K7FA 1J7VR 2D7QA 2R1WB 3EZJB 3S35H 2VITA 2UYLA 3C5ZD 3X13A 2OP4L 1U95A 1FFOB 4XCYA 2CGRL 1MFEH 5IBUG 1HOCA 1S7SB 3RX5A 3E0GA 4N0UA 5HI4C 3JUYA 1DBBH 4B0MM 1FFPA 3BPOC 4CRPA 1A9EA 3PWUA 5ANMA 5F6IC 5E8DH 3VXTB 3TA3B 3BP7A 1MJJB 3JWOL 3FAWA 4LAJH 5F7WC 2C4FU 3NIDF 2GCYA 4L3EE 4AY0A 3L1OH 4LLVA 4YZFE 1GH7A 5FYKD 2OM5A 3L3JA 4ETQB 2A6JA 1F90L 5HDOA 1ES0B 4GW4A 1BEYH 5KW9L 1DFBL 5FO7B 1RZFL 2R0KL 1FVDA 2X4SA 5EU6B 1KBGH 1PQZA 1GGIH 3ZDZE 4OLVH 1L4IA 2QV2A 5I66A 5JW3H 4RZCB 3OJMB 3VDAA 1NUDA 2ED8A 2ZP0T 3U9UA 4IS6B 3VXTA 4ISVB 3V5HB 4XGZB 1ULVA 1NBZA 1Z0NA 1R3JA 4WFFD 2VLRE 2ZCKH 4OFIA 4RMSA 3V2AR 4PJ8D 1HXMA 3ALPA 1DQJA 1NCUA 4U6VL 4DAGH 1U8KB 2DQJL 5FO7A 5KS9B 4JN2A 3FT2B 3S88L 3BKYL 4N90D 3PWNB 5HYSG 4HUXB 1MY7A 1DLHA 1U3YA 3ZKND 1E6OH 4MB5A 1SYVB 4RZCA 1R24B 1NGYB 2EDHA 1WZ1H 5DMYA 3V5HA 3QT2A 1G84A 5IMKB 1RK0A 1IGYA 4JHZA 1BGXL 1YMMB 3GSUB 2YA0A 4PFEA 5ESQB 2AQ1A 3I3DA 1S9YA 5D72L 1U8KA 3WKNA 1U91B 4G8EB 9CGTA 5EU7E 3LZFL 4EDXB 4MJID 1XF4B 1KUMA 5GGTH 4JFDB 3BJLA 1BQHB 3RGVD 1WBZB 1NEUA 5DWUL 3PP4L 1UYWH 4M43L 4JPIA 1R24A 2YUZA 1NGYA 1CR9H 4MQ7B 1C5BH 2GUOA 4MWFB 1Q38A 2IPKA 4G80A 4NSKB 1BZ9A 1BLNA 3DYOA 4OM0H 1T1WB 5JA8B 4Q6YA 1I3VA 4M7LL 1PZ5B 1YMMA 2HTKD 2P43B 1B0GB 1M4KA 1G9NL 2BP3A 3R8BB 5E94B 5IEKA 2JK5B 4G5ZH 1FIGH 3D3VD 3DRTA 4GKZA 4KK8C 3SY0B 2RQ8A 4ZS6D 2VQ1A 4JFDA 5IQ9A 1G9ML 3WFCL 5F3BA 3ZTJH 5INCB 2F53B 2HH0L 2ZNXA 3PL6C 1NC2B 3O2DL 4D9QE 1KFAH 1TVBA 1LP9E 4Y2DB 4MWFA 5DA4A 5IV2B 1ZSDA 4KI5E 3PWLA 4NSKA 4ELMF 4TYUA 3IVKA 4JM2B 1AGCB 5CILH 1PZ5A 1D7FA 4I4WB 5FCUL 4ZS7H 1SBBA 1B0GA 4XPAH 3VD3A 1R5IA 3WO4B 3V4UL 3EYFA 4W6WB 3VWJD 2X4TB 3SY0A 3MUJA 1DL7L 5ALBL 4BQCA 5HD8C 1U6AH 1I85A 4K8RH 5ITFB 1UM6L 4L1DA 3D85A 2LTQC 3RVUC 3C2AH 5B21A 1A6AB 3P9MB 5IV2A 1JNJA 1JGVH 1K4DA 4WEBH 4JM2A 1OCWL 3DURA 4CVZB 2UWEB 4MXWL 4XP6H 3NIGF 2R2HA 1I85C 2H1PL 5C7XL 2XN9D 5FM5O 2N4IA 4J3UA 2BHYA 5LBSH 3SGKC 2L7UA 3NPSB 2OXHA 3GSXA 3HZMA 4PJ5E 3QQ9C 3UYPA 2QSCH 3VRLE 3G5VB 1RIVL 1CFSA 2A77H 3OBAA 5CEZE 3LKOA 4MA7L 4LCWE 5K9OB 1SEBB 1ED3B 4YZFF 4HK3N 2O5ZH 1TQBB 5F9WC 1OTSC 2NW3B 5CJBA 4N8VA 5IFAL 3RJQB 2AJXL 1DQLL 5J3HC 5IFHL 1Q0YH 1NCNA 5DXWA 1Z9SA 2K1MA 3NFSL 1QQDA 3ZDZF 5CEZH 4K7PL 3B9KD 2XTJE 1QRNE 1R5WB 5D7LE 3LKSB 3NPZB 4DUXA 3HC3L 3ZHLA 3S37X 3IFLH 4HS6A 3BRDA 2F8VA 4JFPB 2EYTB 1JFQH 5EO0B 3LN9A 5C92A 4BZ1L 2P5WB 1J8HE 2PYEB 2AXHA 4JFXB 1SEBA 2ZSWB 4FABL 3QIBA 4PREA 3OAZK 1KGCD 5FO8B 1NLDH 1CFBA 4N9OB 3U0WL 4UIKL 1TIUA 2C5DC 1CIDA 3K1DA 3L7FB 5JHLL 2CLRB 3EO1A 1N59B 4U33A 4KY1L 4NWTH 2OL3H 2VLMD 5DEGB 5T5FH 5FECA 4NO3A 4WU5B 4K94C 3KPRB 3QIBC 5E56A 1WLHA 4MD0B 1AR2A 2VO5A 2YWZA 4LSPL 1FZOB 2QSQA 2P5WA 4XBEL 2GT9A 2ZSWA 4N0YH 5ISZD 5C07B 2E9WA 3T09A 5IOPA 5ICXA 3WHXA 4Y4HB 3DHJA 1OVZA 3QQ3B 3HMXH 4TSCH 3E6FB 2FO4A 4TUKH 1MREL 3RWEB 4IHOA 4XPHH 5IHLB 3OMZA 1Q0XH 3L5JA 2C7UA 2CLZB 4PJIE 1JPGB 2BHZA 2AKRA 3TM6A 3MREB 5FGCB 1FZOA 4JRXB 1K4CA 4RCAA 4JQIH 3NH7L 5MENB 5C07A 5I1IH 4RDQG 3MV9D 3HA0A 4Y16D 5CJOL 3DMMB 3QDAA 1RQ5A 4CN4A 2V9QA 4MQXC 3FT4A 5I8OL 4NUGH 4R4FL 4MCZB 2A6KB 2OQJA 5D1QB 1RK1B 1CGXA 3GJFA 1HSAB 2OMNA 3U9PH 4QHMA 4M7JH 1S7WB 1IGFL 4ZO8A 2HVKB 3SGDI 2OJEA 1JPGA 5E0QA 2LE9A 2FLBT 4QY8B 2RFXB 1MOEA 4CJ1A 5J7CC 2X4NB 1A6WL 3L5WA 4S1QL 4U6YA 4H5SA 2HFFA 4XC3H 1YN7B 1PJ9A 3C5SB 5CHNA 4FG6D 3DX8B 1Z5LB 3CGTA 4MCZA 1MSPA 2CD0A 5TDOA 1HSAA 4E0RA 2MFNA 3GHBL 4MD4A 3FB8A 3ULVL 1PG7L 1S9WA 2DBLL 4R4BB 3MBXL 2X10A 3CVHB 1N0XL 1OTUC 2RFXA 3MMEA 3BRFA 3EOTL 1HHJA 1XEDA 3WL9B 1G7HB 2B0SL 4J4PD 3TJHD 3C5SA 3MFGB 5HJ3B 3DX8A 1VACA 3AS3A 4KXZI 3VRLF 1KTDB 3HI6H 5TQ2H 2IC2A 1JGUL 4F7MA 1ZT7B 3FOLB 2G75A 2VJXA 4R4BA 3O8XD 4U3CA 2ED7A 2FHBA 5LAXB 2NYYC 3TNMB 4ODHL 4ZPTB 2BVEA 4L4TA 3U7YH 4ELMA 2FX8H 3TBWB 3QWOB 1KTDA 1GOHA 3DBXB 4HS3B 4ZTOL 1IMHC 4Y1AB 2Q8BL 3NN8A 5IMMB 2GAZA 5E5RB 3HNSL 4OT1L 3NZ8A 2AEIT 4HGKC 5F7NC 4XWOC 3UTZA 4U1IB 4UILH 2PKDA 2BMKA 3DUUB 5T1LB 4FQXB 5LAXA 1W0VB 3LPWA 1KEMH 4JO1H 1J86A 3BE1H 3NCCB 1QVOB 2ILLA 2NY1D 3AAZA 3MLYL 4NBZB 3TBWA 1FNGB 2ZOKB 4QOKB 5LG1A 5DK2A 1IQWL 5DFTA 2G60H 1FL6B 3QIUB 3DHMA 2VXQL 1BQHG 2ESVD 3D9AL 1RHHA 2ITDB 4P23A 4P4KB 1C12B 3FTGB 4U1IA 1J0HA 4LKCB 1QFWH 3DLQR 3DUUA 1FL3B 2DM7A 1VFUA 4URTB 1AXTL 2M26A 4FFWC 3HC0B 1MIML 3I6LD 2OJZL 3CFBA 5C0CB 4LCCB 2VSDA 3TO2B 4PJIF 4XAWL 2DJUA 2X4QA 2E3VA 1FNGA 3F5WA 2VDLH 2Z93B 5DFWH 5EC1A 4P23C 4FRWA 4OD2B 1JPSH 1T0NB 4P2QB 3OR7B 1ZKAA 2XQBH 1BM3L 4HC1H 3JV6A 1ZLUK 1I3RA 1CE1L 4ZFFB 2ITDA 4LCUB 5T3XL 1DP0A 4NN7C 1C12A 4BH8A 4ZD3L 5DJ2B 1MJ7H 1CU4H 1FL3A 3MRLB 5F7LB 1FZJA 4LVNC 4EI5D 3HC0A 3P4MA 2KUTA 4YEFA 2ZUSA 1FVEB 4HK0B 3ARSA 4H8WC 4GW5A 2VYRE 1ZWIB 2EXWD 3WIFB 1PSKH 4PJ9D 4AIXA 5F1IB 3OWEA 3BD3A 4FTVB 4G9FB 5FK9A 2CIKA 1D5XB 5TDPA 1TJHH 1CGSL 2XI9A 3TO4A 4LLYB 4X5XB 4N0FB 5FHAL 2BXYA 3DROB 4V1DD 2HKHH 2UZYB 3VFVA 4UB0L 1U8LB 2PW2A 3MRQB 4D0BA 4OCRL 1OAKH 1CCZA 4PBXA 4HPOH 4KQ3H 4O2FB 1ZANH 4NKDB 3LEVL 4JO4L 1MI5E 1MRFL 1YC7A 5HYQA 4I77L 3TO4C 1FVEA 5IM7B 1NKRA 2APVA 3WIFA 3CZFB 3IS1X 4KMLB 1EO8L 4UT6L 3THMH 4NHCH 1O7SA 4G9FA 1I1YB 1D5XA 5M94B 4TNVK 4WENB 2YPKB 4F2MB 4M6ML 4PJBF 1A1OA 1LWRA 1WAAE 2VDNH 2Y6SC 3K81A 5IB4B 5J6GA 5AD0A 1MJ8L 4MNGE 5E99L 4DGVH 5JA9A 3TN0A 4H0IA 5JUEH 1E6JL 2VDKH 4NM8L 3X11B 4L8CA 4FQLL 4PLJC 4GQ9H 1EUTA 2AAVA 2ICWB 4M1GL 4JFYB 1CD0A 3QUZD 4DUVA 1Z9LA 3V0AC 2KBGA 3LQZA 3HNVH 1H0DA 3TN0C 5CZVH 2QSTA 3OPZL 4OCWL 3U1SL 4PTUA 1Z2KA 5IB4A 1EEZA 1JCKA 2OXGA 3HG1E 5D6CA 4PJXB 1FYTE 4RGND 5B3NA 2AJVH 5DDHA 4GSDH 2ZOLB 1FSKC 4EKXA 2HLAA 3BKMH 1W2KT 1KELL 1F42A 1XMWA 1JI1A 1BWMA 1DUYB 3I2CH 5DFVC 3OF6D 4HLZH 3V5DA 4EVNA 5C0BB 3OV6A 3EYOA 5DK0B 5SX4I 3KPLA 5I2IB 1GGYA 4QF1A 2VXVH 1JL8A 4LVHC 1R3LA 2QEJA 5DMGC 5HHOB 4PY8I 5TE4H 1XGUB 3QNXB 4YDVA 4HD9A 5IJKC 4F9PA 3QAZB 1K3ZA 3EZ8A 5DLMH 3VFNA 4Y4KA 1EHNA 3U4BL 3IDMA 5ESAB 1OP3H 4L4JA 5IESH 2YD1A 1NGQH 2PXYD 1DUYA 5JDJA 2YRPA 1MRDL 1JHTB 5C0BA 4YHYB 1HSBB 5I2IA 4F9PC 3WBDA 3EO9H 1CTOA 2BVPA 2D3VA 1U8QA 1EHLH 4Y4KC 4RA3A 4KUZL 2BSRB 3MLRH 1OPGH 4HIIB 4JDTL 4YE4L 1SMAA 5I6XC 3FO9B 4KDVA 3V6OE 4NNXB 2Q86B 1ZLSH 1MWAL 1GL4B 1FO0B 1SY6L 4E41B 2P8LB 3QUXC 2BSTA 1MCLA 2EKSB 1JHTA 2JIXA 3ARPA 1RD6A 4G6ML 1U92B 2Y5TB 1VFMA 5DJZB 1LK2B 1Q9LB 1T7XA 4HDIB 1RZ7H 4DN4L 1JMZA 5DC0A 1EDQA 2APBA 2YHGA 2BSRA 5GSVA 3KGRA 3T0VA 4MDIA 5FA4B 3CD4A 1EUUA 2HG5A 2VDPL 5ENWB 4NNXA 2XTJC 3JWNC 2YD4A 4NRZB 1DQQB 3MRDB 3U30C 4X4YA 3A67L 1QTYT 1FO0A 4X4MA 4U0QB 4OFDA 2P8LA 4JR9H 4TVPL 3QO0B 1FC2D 3HKFA 4QRTA 4NZRL 5D1XD 4ZXBC 3CU7A 4ONGL 3QEHB 1EPFA 4LIQL 3ZYOA 1GGBL 3P0GB 1DUZB 5JOPE 4HDIA 3ZKSD 5I0ZA 1E4XL 4XVJL 4FFYH 5H35A 4PR5B 1P4BL 4XWGH 2EDQA 3HB3D 1CDYA 5BXFA 1HHIB 3JV0A 4Q6IA 5KN5A 5JDSB 3V0WH 4LRNL 4MNHA 3VXOA 2GJ6D 2GTZB 5TE7L 1FP5A 4YXKH 3VGAB 3FHAA 1IM9B 3AGVA 1S78C 1YEIH 3GBNH 4JPVH 1IJ9A 3MJ9A 5BS0D 2V7HA 2D31A 3TCLA 4Q6IC 4DQOH 1CS6A 4PJIA 4Z6AT 1QSEB 4RFOH 5JMRA 4IIQA 2C1PB 3VD5A 1YEEH 3RVWC 1U58B 2ARWA 1FNLA 3ARBB 3DX7B 3V6BR 2EECA 5JDSA 1UWGH 4YBQC 1G7IB 1AXIB 1G6RL 4PIRF 2IGFL 4XNUH 3FO2B 3RA7L 3G04A 3SDCA 2VLKD 2OZ4A 3H8NA 3PE9A 3GJEA 1OSPH 2IH3B 2ITCA 4DZBB 5E7FA 4IIQC 1DLFL 4HGWB 4Q9BA 4LGPB 5MI0C 2ZJSH 1QSEA 4JGJA 3ETBF 4P5KB 4BUHA 3SDCC 5GISL 3FFCD 4MXVF 1Q9KB 1JF1B 2XG5A 4IMKA 2EXYC 4OZIB 4G8GD 3IYLW 5DJ6A 1F11B 4D0CB 5KS9E 2OR7A 1VERA 4JFED 1OSZB 3CC5B 1SHMA 2IH3A 3SE3A 3U0TA 4JANB 4FNLH 4ZYKB 4JFOA 1T3FB 1PBYA 1CFVH 1WC7A 1WFNA 2XA8L 4NQEB 1DVFA 3X14A 5IW1B 5IUSA 2UZIL 4IMKC 2MQ3A 1T0MB 3O6MH 1IGTA 4BFEA 3QR2A 2AXGA 3U36B 3DRQB 4PJBA 2HTLC 5GS0D 4NDMB 3IAPA 3UAJC 1KIUA 2YPVL 3QEQD 1UA6L 4OZIA 4NQXB 4JFZL 2Z31B 3PNWA 2C3GA 1OSZA 1A5FL 1DVFC 2FR4B 3NZHL 4JANA 2M2DA 4NN5B 5DHVH 3C5ZB 3B8SA 1T3FA 4NRYA 4Y19D 1T2XA 3VE0B 5DZLA 5JXEA 5GGVL 3H9ZA 4M6AA 4P9MH 3LRSA 4HS8L 3V4VL 3FB5A 2H32A 2CRYA 1A6PA 4HGMA 3U36A 3GI8H 3DRQA 3DWTA 2AI0L 3KJ4C 3IETB 1IZJA 3BVNA 2PR4L 3IDXH 5D9SB 5GS1B 1F45A 1T03H 4M1CC 2R4RH 2Z31A 5IB1A 1SVZA 4YHLL 1P7HL 1BVZA 1A0QL 5JXEC 1YEKL 4S1DD 3GEWB 2F53E 4WO4D 2CXGA 1FORL 3SHSA 1BECA 2WV3A 4X0KB 3FO1B 2A74B 1QG3A 2WIIB 2V2TB 5FGBA 1H8SA 3SJVA 2VABB 3BW9B 3NCJL 3PDDA 4EXKA 1A7RL 5LWYL 1T80A 3MXVH 2Q76A 2BSED 1AP2B 5L2KD 3QFDA 5DVNA 3QUYD 1I7RB 2AVGA 4P2CG 4MNQD 3IETA 3ILPA 5ITBL 4KAQH 4TNWF 1XAUA 5HSFA 2X44D 2I9LB 1JNLH 1G7LA 1U36A 3MNVA 3OGCA 5I74C 1OGAA 2FJFB 5E95B 4PJ8B 2NMSA 5DEZA 3GGWA 3PGFH 4U1MA 3OHXB 4X0KA 3DARA 2A74A 1G7PA 2CKBH 5JW4N 2R15A 3SKJL 2V2TA 1S7UB 3T0ED 2A1WH 1TETL 1S5HB 5EBGA 3CFEB 2OK0H 4JY6A 3LKNA 4HC1A 1JTOA 4G8IA 3MGAA 4P2RB 5FYJD 2I9LA 5IB2A 3K2UL 1YDPB 4XPGH 4OIIL 5HYEA 3O3EB 1PKQA 4KKAD 2YKLH 1ZMYA 3OGOE 4JPKL 3IDNA 4UAOC 4G6FD 2XKUA 3CIQA 3OR6A 3U7AA 2GITB 1GCFA 1YC8A 5C08D 3C9NB 1I7UA 5JW4R 4GG6F 2ED9A 3RGVB 1FNFA 1S5HA 3MRPA 4L1HA 3WNPA 4K07A 4NM4L 1IAKB 3QCUL 5I8CA 2RBLA 4NNPL 4P2RA 4Z7WB 3GMNB 1DEEB 1INQB 5H37H 5CCKH 1YNLL 3UTSA 4KKLC 5F7EH 3ZHKA 1FZKB 1KTKE 1RZIA 5EO1B 1FFNA 3T77B 2PYEE 2VDML 2W0LA 3D3VB 3REWB 2FD6H 3T2PA 4MJ5A 3BWAA 4BQBA 3HZVA 4J3TA 4KI1A 4J3VA 4G6AC 5CMAB 3UBXA 3MV11 1N4XL 1SVCP 2NY3B 3X3GH 1H15B 1Z3GH 2DIBA 1XGTB 5E8OA 3KYOB 4X80H 1LD9A 3WFDH 3MLZL 2XACC 3TJEL 3EYUL 2BVYA 5L7XL 3OXRB 1S3KL 1XCQB 3KPRE 3P9LA 4OZ4B 1ACZA 5EO1A 1RI8A 1CLYH 4NQVB 4UT7L 3VWJB 1ZK9A 3REWA 3QEGL 5J13B 4Z8FL 4WI2A 3AS0A 2FHCA 1VADB 1CG9B 1KC5L 5D1ZA 3UEZA 2BVQB 4PGEA 1BOGB 4U0RC 3B3IA 3IJSA 1RUQL 2UUDH 5HYJD 1AR1C 5CJQL 1AFVH 3TV3L 1CFQB 1NMCC 2FJHB 3L7EB 4BKLB 4ODVH 5D96C 2IG2L 5EFIB 4JRXE 5I15L 3HPJB 2XN9B 5MENE 3F12B 1OHQA 2D7TL 3BKJL 1JV5B 5D1ZC 4KZEL 2CR6A 1J0JA 4NQSA 1S5IL 3BGMA 5DJCA 2ZKHH 4X6BB 1CG9A 1NFIB 2BVQA 4XH2B 2WUCH 5SV4A 1MCQA 4MB3A 4DGIL 5IHBA 1UKSA 3GSNB 2IANA 4RMTA 3EOBB 3MRNB 1I7ZA 4UNTA 2J7LA 1NBYB 3PWPE 4ORGB 5GIRB 2EYSA 1GIGL 2G2RA 3OKEB 4MA3B 3B9KB 3LQMA 2X7LB 4DKFH 3F12A 4LLWB 3QRGL 1S8DA 2XT1B 4U2YA 4MA1B 5I1DB 4NZDA 1MFDH 4ERSH 3PP3H 4Z78A 1A7BA 1BF8A 3SE9H 3T8XB 1IAIM 4CVXB 3QUMB 3S34L 1T2QH 1XGQB 5IKCA 1JNNH 1DBJH 4I5BA 4JY4A 2H2SC 3W2DH 5IMOA 1ZLWK 2F5AL 5I9QB 4JCLA 2N7AA 3MLWL 3VFMB 1A7NH 1P2CA 4PJEB 2VDOL 2VIRA 3H7BA 5CP7A 3MBED 2OX5A 2WM0A 3QUKA 1U93B 2GY5A 5JNYB 2WUBH 2WINB 4YHNB 4FN0A 3CVHH 4XPBH 4MDJA 1GAFH 5ISZB 5DJDB 3PQYA 3MOBH 3FQRA 1AJ7L 5IW3A 2R29L 1WTLA 4X7CC 2V5SA 4NPYB 3V4PL 1OWWA 5ESVB 4JREC 5SWSD 3RHWK 3AU1A 1A14H 5AYQA 3Q6GL 4IRJA 4WFEE 5ADPH 4YC2B 3VFMA 4KGJA 1HH9B 1TQCB 1X9QA 4TPRL 4MJ6B 4M93C 2IH1B 4DFHA 1Q1JL 2M8XA 5L0QB 4PJDB 1N8ZA 5JNYA 3W9DB 3ULUL 1V7MH 4YHNA 3VGDA 5JORA 4XP1L 2W0FB 4Z5RA 4Y1AE 2BCKA 5TF1L 5IR1B 4IRJC 4N0CD 4WI8A 4XBPB 3MV9B 4LPVA 5E9DA 1IAIL 3ARRA 4Y16B 1J0YA 4YK4B 5JR1L 4WUKH 1LEGA 1J5OL 4ZFOB 1YQVH 5C8JA 3RDTD 5EWIL 1NFDB 2NY5H 3UPRA 4ZUSA 4M8QA 4YX2H 2H41A 4UOJA 1XH3A 2LAAA 3RL2A 2YD2A 3JXAA 4LSVH 1OD9A 4H88L 1XZ0A 4PJDA 1A2YB 4MCYA 2DYPA 4ZUUB 3W9DA 43CAB 1NBQA 4K7PY 2NXYD 3RZCA 4QOKE 2AGJH 4LDLB 2XZCH 1H8NA 2OSLB 5LXGL 4HFUL 2FX7L 4XAKE 4K3EL 3TWCL 5DO2C 1KJ3H 2EZ0C 4M9PA 2NZIA 3LB6D 1HXYA 4PB0L 5KZCD 3H9HA 1HQ4A 1WFOA 3RQ3A 5SV3A 3RZCC 3GSWA 3QXUA 4OCYH 5BRZA 5C0CE 1D5IL 1A2YA 4RGOH 5EZIH 3V6ZB 1PYWA 3EW3B 3IFPB 3VXMA 4GG6A 5DQJA 2OSLA 3KYNA 2CO7B 5AZEL 1OP3K 1VPOL 3V8OA 2Z91B 2C3VB 4YHOH 4MHHG 4AMKH 3NA4A 3TBSB 2EIDA 4JZOA 4J6RL 4YH6A 3RTQD 3QFJD 4OD1L 4MS8C 4U3XA 3VXQB 5HHMD 3LEYH 1NANI 4OIBA 5D70L 4LP5A 3T4AB 1DANT 2X41A 4CKVX 4O4YL 1KXTB 3IFPA 4FTVE 3T4YA 4ZODA 1J18A 1UH3A 5EU5B 1NCBH 5IW6B 3CSBA 2FEDC 2C3VA 1ITBB 1ZT4B 1X5ZA 5IJVA 3UJTL 2J88L 3P11H 3KPOA 5LQBH 5JW5A 2AEPL 3RUGB 3VFRB 3HRZB 3RPKA 5BZWB 4CMHB 1I7TB 1X5HA 3D0LB 1DSFL 4KJQD 4P5TC 4I0PA 3IGAA 4KZDH 4KK6D 3LEXB 3WXWL 1XR9A 2CUMA 3HE6D 2EDYA 2V6HA 1EVTC 3GMPB 1BBDH 1R3IL 2NY1B 4X7FC 5L2JA 3O3DA 2ZWLT 4YPJA 1CVSC 3FZUD 5I8EB 1GGCH 1RZKH 4M9OA 3KXFD 2EIZA 2PNDA 4I0PC 1U8MA 3HRZA 4RMVA 2ESVB 3WE6B 1YJDL 3SO3B 3UBXG 5KSBB 3HMWH 4UBDC 3DUSA 4NC1E 4PRNB 1Y0LB 1C5DA 1U3HA 4JGUA 4GRWF 4MAYA 5EU4A 1WK0A 1KCVL 1YYLH 1MEXL 3GO1L 4X7TB 4M62H 3FRUB 4PJXE 5ID0A 3VG0H 5I71B 8CGTA 5AWNH 4NNYB 3G6JF 1FRGL 2CMRH 3BPNC 4FQQA 3EHBD 1U3HC 3OXSB 4MAYC 2JJTA 5EOQH 3SN6N 1F3RB 4NT6B 1FBIH 2CKBA 2WP3T 1Y0LA 1YPZF 2GKIA 4GMSL 4HJGB 2VKXA 5HHOE 3CLEL 1K8DB 2WWMD 4EI5B 1F6AB 2Y7QB 1AGDB 2V5RA 2NZ9C 1T1XA 5EORL 2JJTC 4FFZL 1JZ7A 3HC4L 1Y18B 1P7QD 3CLFL 2DLEA 4PJ9B 1YQ2A 1NSNH 1I4FB 2EDJA 1CL7H 2PF6A 4CMMA 1SBSH 3MRBA 3OKYA 4QRPD 5GHWH 4V1DB 3FHQA 2NXZB 1QBLH 4A6YB 4PV9A 4NT6A 1FGVH 2R69H 4PG9B 5E8PB 2X9YA 1DZBA 3ULSA 1VFBB 1CLCA 4HJGA 5IROC 1BFSA 1INEH 1NCCL 2YXMA 2H9GB 3LS4L 4OCSL 3RWGA 1FNSL 1QYGL 3WIIL 1F6AA 3GMQB 1AGDA 2NX5A 4TVPD 2D03L 4X8JA 2ZG3A 3QCVH 5CKAA 3UROR 2XKNB 3H42L 2EDDA 4ONFH 1OTTD 2MCPH 4PJ9A 4HIHB 4W6YB 1WZMA 4M5YL 2E7LA 4XZUB 2JJVA 3ZE2F 4D2NA 1AC0A 4JFFA 3QZWA 4OTXL 3GMMA 3W5NA 1EZVX 4L3AA 1CICA 4OLYL 3N9GL 2NLJB 4PGZA 1N3NB 1U8OB 2HRLA 3D25A 1HNGA 3EDEA 2R1YB 3UTOA 5GRUL 1U8PA 2RHEA 3UTTD 3GHEL 3QUZB 4Y5XB 5DC9B 3IDIB 4ZQKB 1F8TL 2W9EH 4L8SB 4UDUA 1K8IB 4Y4FD 6CGTA 3FONB 4XHJD 4HIHA 1CICC 4I0CC 3S37L 3PHOB 4HWNA 5ERWB 3RWFB 2YUWA 4XHQA 3DYPA 1Q94A 5BMFH 4NWUH 5IG7A 1UJ3A 4YFLI 1ETZA 4MJ4A 4HPYL 1G0YR 1CBVH 5J11B 2NLJA 5F96L 4HJ0C 2IADB 2SEBA 2FGWH 2J6EH 2FH6A 2B5IB 2OYPA 4R0LA 3IDIA 5EBWA 1Y6MR 4L8SA 1UJ3C 2VQTA 4WVRA 5K9JH 4KK9D 5EO9B 5IVZB 3QIWD 4YHPB 3V7AE 3ZT6A 3OX8A 3SDYH 1H9VA 4OKVB 4FFVD 4RFEA 3T65B 5MEOB 3FB6B 4WHYG 5AZ2L 1IC4L 4PY7B 3WFEH 4OFYA 1WBYB 2DQUL 1DBML 4R0LC 4N8CL 3RWHB 4RMUA 3ISWA 5T33H 3MUHL 1KIRB 2PXYB 1VEOA 4WU7B 2YD8A 3UO1L 2R23B 1M7IB 1C16A 4WIQA 5DQDH 4JJHA 3UC0L 3DIFB 4HULB 5GGUB 2APFA 3BH9A 3CXDL 3G5XB 4WY7L 3GIZH 4X9HA 5J1AB 1RURH 4X6FA 4LU5H 4JKMA 4X6DF 4FP8L 5MEOA 5A2IH 4J1UB 3L3KB 1T0PB 2XKSA 3RWHA 4QRRA 1BD2E 2XXMB 2IQAB 5GS3A 1F4HA 1OP9A 3QI9A 4FS0A 2NR6D 4K2UL 3FQWB 4UV7H 3JUZA 4XNXH 1V3JA 4JG1H 1B9ZA 1CLZL 3MXWL 5CKGA 2XRAH 3FQNA 3G5XA 2AJUL 5GJTH 4OLWL 5DRWA 4GMTH 3AROA 4WFGE 2K7QA 3CH1A 3QI9C 1QBMH 3PGDB 2DJ4A 2FLRT 4J1UA 4PJHB 4LSTL 4L4VD 3MRCB 2DWDB 4NQEE 4Y5VA 3DYMA 2VLJE 1TCRA 2DM3A 4GW1B 3FQWA 3RNKA 4CVUA 3HHRB 5D1XB 4RSVA 3GSRA 2P5EA 4LCYA 4K3DH 3VG9C 1I1AA 4JFHD 3GMOB 4D9LH 3QULA 3ELAT 4Y5VC 3EFDH 1IM3B 7FABH 3GIVB 1JNHB 3WNKA 4FQIH 5I1HL 2XNAA 3P0YL 1AGFB 2GJ6B 4I3RH 1WEJH 5CSGA 1KCRL 2RCSL 4LEOA 3MLUH 2EEBA 1RZJC 2DDQH 1RIUL 4O51B 1I1AC 1QR4A 3QJFB 4KRPD 4XP5H 43C9B 1CT8A 3NTCH 1A22B 5BS0B 3MV7D 5F7DB 3M45A 3VI4E 5I1KH 3TZVA 3GMOA 4RX4A 3WMSA 3G6JA 2C9AA 4K94L 1OARH 1S7QA 5FYKE 4MXQC 4IRSD 4UZGA 2E9JA 3CMGA 2DD8H 4LCIH 1KN4H 2UUDK 1NAMH 3O6KL 5IB5B 2VLKB 1YPZA 2QR0A 4RFNC 3MUY1 4RISL 1V8HA 4LLDB 3TZVC 1L0XA 5FYKH 3P73B 5JLZA 3BEVB 1JMXA 4S10A 4IOIA 4XMKH 4O5LL 5BW7C 2J1KA 4WFFE 1J1OH 1EAPA 5HGAB 1VB9A 3FFCB 4RIRA 2R2EA 3ZKXB 4M4PA 1N6VA 3I50L 3ZE0E 5IB3A 4G8GB 4NO5B 2FB4H 2HJKA 4JFEB 4UUJB 2W38A 4MQTB 1WICA 1MPAH 3SGDH 1ACYH 3QSKB 2I07B 3IJHA 3LV3A 2ADJB 1Q9WB 4ZPVA 4R7NB 3ULVF 3V7MA 5DSCA 3B9AA 2XXCB 4K3JH 4PP2A 1S7RA 1BQSA 1M05A 5D2NB 4JRYB 5K9QG 1Q72L 5T1KD 5CIPA 4HKJA 1RZ8B 1TNMA 3RFZC 3CMOL 3QCTL 1GHFH 3WIHL 1F4WL 4JKPL 1CD8A 3MLSH 4M1DH 4NP4L 3VGGA 4PGBA 3QEQB 3WD5L 4XP9L 2EH7L 2X05A 2GYSA 1FPTH 4MJIE 4EOWH 5IHZB 4RAVA 5EZOH 4XTRC 3QA3B 4X83A 3BDYH 3C09C 4GAGH 5CD3A 4JRYA 4Z7WE 4PGCB 4L3CB 3NFPA 1OLZA 5C0AA 25C8H 3B5HA 4Z9KB 4KHTH 2BRRL 4KXZH 2GFBB 3D3VE 4GFTB 3TGXA 1IT9H 3QNZB 1RJLB 4PRPA 5IHZA 1LEIA 2CPCA 3BGFB 3BP6B 1LO5A 3PG2A 2HN7A 4WO4B 1G9MC 5C0RH 2PW1B 4DTGL 4OLXH 2HJFA 1W72B 3QZWG 4P2OD 5HDBF 5GSRA 3ARFA 1ADQH 3WNLA 4DGYH 1EXUA 5BO1L 5L2KB 1QBBA 4YXHL 3QUYB 1INDL 3KPPA 3I85A 4MNQB 2GFBA 4UV4L 1MHHA 5E70A 3BZDA 3IJYA 3T2QA 1NGZB 1IEBA 2PTTB 2NY2B 4F8TA 5B8CA 1NGXB 4LSDA 3QO1A 1ZOXA 2JKXA 3BP6A 3RI5F 3ARFC 4Z0BH 2ZCLH 3N1FC 3T0EB 5CGYC 1KLGB 3VWKD 4LASL 5HVHC 4NN6B 1ZTXL 3NGBC 5B8CC 5INDA 3TVMD 4X6DA 4NQCA 5FUCE 2ID5A 3EO0B 3KPNB 4U2ZA 1OAZL 4OZFA 4HXBL 4OSUH 1U8JA 4HUUB 5JPNB 2F8XC 3MJ7B 1GPOH 1M7DB 3PHQB 5SX5H 3BHBA 4L29B 3U6RB 5DD0H 4G6FB 1AO7D 2DBJA 5D2LE 3SDAD 4BZ2L 1KLGA 3VFSB 1DBBL 5DHXB 1CXFA 4LKXB 1KEGH 1UFUA 3REVA 3GSNH 2YUVA 4KKBD 5DR5H 3TC9A 4J3WA 3MJ7A 4H26B 3L1OL 3OAUL 2AS5M 3O45B 5FXCH 3GDBA 4L29A 4YBLB 3HAEA 4NQUA 4X6CF 1BEYL 1D5BB 3GB7B 3SCMC 3RNQB 1Z9MA 3ZE0F 1KGCE 2LAGB 3VFSA 1KB5B 1GGIL 4QNPE 5D7KD 1JPTH 4OLVL 3PXHA 5JW3L 2ICCA 1LO2L 4PJEE 4P5MB 2VLME 4POYA 2CH8A 2Y9RT 1ZVSB 4PJGB 4JZNA 3QUMH 3LRGA 1FZMB 3P9WB 3RP1A 4OF6A 3MA9H 4OUUA 3IB4A 2ZCKL 4H8WL 2DKSA 3L9RB 2YD5A 5TH2A 1OW0C 3NCYS 4DAGL 1QSFD 2FIKB 3O41B 3RNQA 4CW1B 1ONQA 3D5OF 5F1KC 4PV8A 4X4XB 4OD3H 2B20A 4Q74A 4QRQB 1JIBA 5C2UB 5JOEA 4XX1E 2IF7A 1WZ1L 1DCLA 5HYJB 4Q9QH 4TSBH 4IDJH 5KVEH 1IC5H 2ATKB 5IF0B 3RZWA 3L5XH 3VXPA 5F71A 4UNVA 2YR3A 1J1PH 2AJYH 1F4YH 3GZKA 3MV9E 4Q9CA 2CDFA 4LSSH 1YEDB 5GGTL 4X4XA 3MV8D 4G9DA 1LE5B 1FGNH 1NFDE 1MVFA 5D5MB 1UYWL 1SEQH 5KVDL 1DTUA 3B6SA 1CR9L 1KJ2B 3SQBA 2BOCA 4NOFA 4JFQA 3W11C 4YDKH 1B0WA 4TULH 4K9EH 2J8OA 5CZKA 5C0ND 3S36H 4PLKD 2ERJB 2ZG2A 2A0LD 4G5ZL 2CIIB 1FIGL 2C4XA 5HY9B 2I9TB 4CN1A 3S4SA 3HRPA 1YEDA 3PDOA 5SX4H 1J05A 3QG6B 5F3HA 3EKCA 1AD9A 4WUUD 2ADGB 1EBAA 2AABH 5DS8B 2C4FT 2MQCA 4PRHD 5CS7A 3WFBH 1ZT1B 3ROLA 2YC1B 4P57A 4BFIA 1IGCH 5CILL 3HCVB 3ULVC 4ZS7L 1A7OH 1DQMH 3P4NB 5ACZA 3DXAD 3MBEB 3JV4A 1NMAH 3KPSA 1U6AL 1ZEAH 4EJ1C 3UTQB 1U8NB 1AQDA 1BD2A 4K8RL 2W59A 3I6KB 2X4PA 4KKCC 5HPOA 3JTTB 3C2AL 1YY8B 2ADGA 3QEUA 3MGTB 1U8IB 3C60B 4KMTL 3N1PC 5C2BH 1JGVL 4WEBL 3VXRA 2P1YA 5D2LF 5SWSB 1NGWA 3BO8B 2IFFH 2NY4D 4YDIL 3B2UC 1JF6A 1WBXA 1JGLH 1C7SA 2VRAA 3C08L 4AQOA 2QSCL 3H6JA 2J5LC 3O11A 4QXTB 4PTTA 2Z92B 3I6KA 4WGVB 5B22A 3U82B 1BX2A 5D8JH 2VLJA 4U7SA 1YY8A 1ZA6A 3MGTA 1KT2A 1NC4A 1U8IA 3C60A 3R1GL 4P3CH 2E27H 2BNQA 4GS7B 1Q0YL 5IFJB 2Z8RA 5D7IB 2B4CH 3RDTB 3G5ZB 4QNPF 3VXNB 5CWSB 4I2XA 5F9DC 2J2ZA 3F62A 4PJEF 3IFLL 2QLVB 2CRMA 3ZYJA 4Z95H 5HI4D 1Q9OB 3LD8B 2YPLD 1JFQL 2GQHA 2NXYB 2XWBA 4QXTA 3KLSA 2Z92A 1EMTH 4LAQH 5E2UH 4XBGA 3W39A 2ESVE 1T4KB 4M4RA 4U1JB 3S97C 1NLDL 3TBTA 4AEHH 2ICEA 1PG7W 5KZCB 1VENA 1W0WB 4NWTL 2OL3L 4QRSA 1UWEL 4Z7VF 5T5FL 1E28A 4DFIA 1ZHLB 4JKLA 4P4RA 3V6FB 3QYCA 2VISB 3UMTA 4BH7A 5E2WH 4KKNA 5KVFH 5FUZL 4H20H 2VN7A 1OAQH 4N0YL 2D7MA 3AB0B 1IGJB 3AM8A 1S7TA 4F7PB 3MGOA 3CK0L 3T2OA 1XF2A 3MRGB 1D5ZB 3HMXL 2ZSVB 2ZUYA 4DZ8B 5HHNB 1WWBX 4AH2B 2BNRB 3W0WA 4AEEA 1FLTX 3BXNB 3DUHA 4HWZA 1W0WA 4PGDA 3RTQB 3QFJB 4XPHL 3O6FA 1Q0XL 5E2VL 1T7YA 5HHMB 3WYRA 4I18A 4X6CA 1M6OB 3B5TA 3AM8C 1VGKA 4LHUA 2FHFA 3K8LA 4OZFG 5KSUB 4JQIL 5I1IL 2DIAA 4QGTA 3K80A 3WFZA 4V1DE 3O6FC 3HI1A 3AVEA 1D5ZA 2FZ3A 5EUOB 3T2NH 3ES6A 4JO2H 4NUGL 4PBWD 5HHNA 4I18C 1F2XK 1UH4A 2DIJA 1O7VA 2BNRA 3PGCA 4G6JL 3B9DA 1ND0B 4KVCL 3U9PL 2FDBP 4BK5A 1MY5A 3CFJB 4A6YH 1T7ZA 3OL2A 3WNMA 2OZ4L 4C57C 4EI6A 4NGHH 2R1XA 4HAGA 3F6LA 2B1AH 3HE6B 4WI3A 4D3CH 4OV5B 1CD1B 3W9EB 4XC3L 2H3NA 4FQHA 4LBEB 2NNAA 4QCIB 4YBHA 3M17B 4JRWA 3ZE1F 4LF3A 1FL5B 5EUOA 3GI9L 3HAEG 5DF0A 2GI7A 3KXFB 3EYSH 5TJWK 1IQDB 5A1AA 5F7UA 4IJ3B 1I8MB 2YXFA 4GUPA 4WDIA 3CPLA 4JAMB 3H3PH 5DT1H 5B39B 4GLRI 4WW1B 4XVTH 3O9WA 2P47B 3ZO0A 1JPFA 1YMMD 5T1DL 3GFUA 3QJHA 1UM5H 5C0JB 4Z7OF 2Y25A 1U2HA 2ZUXA 3KYKH 4LBEA 5EA0L 5FO9B 5JXAH 1A6TA 3RI5K 1CXIA 4Y7MA 4RGNE 4HT1L 5HHPA 4O58H 3O9WC 4EDWH 1T5WA 4U1GB 3F7VA 3FCTA 1IQDA 5KANG 4NO2B 1AXSA 1WIPA 3FQUB 5HD8D 3ARVA 4BELD 4ZUVA 4JO3H 5KJRL 1OAYL 2M1KA 4QHLA 3RWCA 3QXAB 3RVUD 3ZL4L 4EUPB 2MPAH 1L9NA 1QFWM 3MCKB 4NHUB 5IMLA 5FM8A 5A40E 2HT2C 7CGTA 1YZZA 3D48R 5LGKA 1LGVA 3TH3T 3F65A 4Z7UF 5H2BA 4PLNC 3U7YL 3KPMB 2FX8L 3EBAA 3BT2H 3IF1B 1CLOH 3MJ6A 5FHBH 2XA3A 4YIQB 1P7QB 1HDMB 4BK4A 3D85D 1YEJH 4QRPB 3FQUA 4UIMA 3QQ9D 1NEZB 3L3IB 4LQFH 1LDPL 1IAMA 2HKFH 4JM2D 4X7EC 4ENEC 3QXAA 5L6YH 4UILL 1DJSA 1MWAA 2Y1VA 4GG8A 4HF5H 4NHUA 3BFOA 3P40A 1OTSD 2CQVA 5C86A 3PUCA 4LVOB 5DQ9A 2B8OT 1JGDB 1T66C 1KEML 4JO1L 2ARJA 1SY6A 2G5BA 2XZAH 5J3HD 3BE1L 1GGUA 4UQ2A 2YMXH 1SJEB 3KPMA 2I26N 4KPHL 1DQTA 4KDTC 2GSGA 2O5YL 4ZNCD 1MCWW 4LLMB 2BC4A 2G60L 1A9BA 3S4SG 1DANU 2AXJA 5I75C 1BFVH 4QO1A 3LKQB 5FKPB 1JYNA 1IEAA 3N06B 4X98B 1QFWL 2JCCB 2YZ1A 3N50A 3TBVB 3UTTB 2W91A 5CBEB 5CP3A 4RBPH 3NMEA 1PEZA 5A2LH 2OP4H 2VDLL 4Y4FB 2A73B 3MLVH 5ELIA 1JPSL 1UGNA 2LU3A 2AK4E 2XQYG 2X4UA 2XQBL 3OKOA 1TZIA 3BUYB 4HC1L 5F1NA 3IU3A 3HZYB 1UQSB 2ZUVA 1BVLB 3QIBD 3K0WA 4WJ5A 2BDNH 2V2WA 4Y5YA 5FKPA 1G6RB 4LHJB 4N8PA 3JWOH 5C0EB 1MJ7L 4LLUA 2DB8A 2R2CA 3CDYA 1EGJA 3TBVA 1R3KB 2GJJA 4N9GB 3S96B 4F37F 5ETUA 2GJ6E 1II4E 5KW9H 3W82A 2YS4A 4Y5YC 4IOSD 5HDLA 1T6WA 3QIWB 3KHOA 3WLBB 1TJHL 1MHEA 3BUYA 4JHAH 3IDJB 1QFHA 2C1OB 1BVLA 5JHDA 1U8HA 2OBGA 3VGHA 3KPTA 1HWGB 1WVZA 2Q6WA 5BS0E 4Z7VA 1FFQA 4HJJH 1WWWX 1MLCA 4M5ZL 5C0EA 4HPOL 4KQ3L 5ICYB 2JJUA 5FYKU 5BQ7A 3TBYA 4MQXD 3S96A 4PJFF 2CRZA 2QADC 3O2VH 5J12B 4XCFL 1UEYA 4HH8A 5IVXF 2DQJH 3KDMA 4HH9A 4NHCL 3VXSB 3WLBA 3S88H 1I9IL 2VLKE 5C71A 1N5YH 1IE5A 2VDNL 3AXLB 1ZVYA 1CDUA 4WNQB 2DF3A 5D7JB 2DAVA 3TIDA 3P3YA 4N5UA 4FQJH 4DGVL 3D2UA 3QQNA 5I73C 5JUEL 2ICES 2VDKL 3GSOB 1ZGLM 1FC1A 3RAJL 1NL0L 4ZTPH 4HX1A 3BPLC 1T1YA 4NIKB 4K9EC 4GQ9L 4YDLB 3FFCE 4FZ8H 4S2SB 1WIOA 4XNZB 1NGPH 4G8GE 1QFPA 3HNVL 4R6UA 2WBWB 4MMZC 3VXSA 3LZFH 4ZAKC 3VFTB 4JFEE 4R3SB 5L8JB 4RAUA 4QTIH 4QRUA 4KRMB 4AENB 4EZMA 3QRFM 5D7JA 4R7DA 1OTUD 4BM7A 4MX7B 1AKJA 4XNMB 5GGQL 3GSOA 1MIEH 4L4VB 2BY2A 3OKLA 4FOMA 5D2NE 4GSDL 4JDVA 4LSRH 3U79A 4Z77A 4HAFA 3BKML 4KTEH 4F3FA 4M7LH 1MHCA 2PTVA 3I2CL 4FG6C 4PRDB 3I3EA 4MB4A 3RKDC 3VXUA 1NJ9A 1S9XA 2D4FA 4O2EA 3HZKA 5DJ0B 4QWWC 4JDZA 5I1EH 3FQXB 5TE4L 4R3SA 4CGTA 2ENSA 2X2YA 1AGEB 1BVKA 2Z35A 4ZUTB 5DLML 3FQTB 2FYYB 4MX7A 3O2DH 4XNMA 4Y19E 5GS0H 1EERB 4EN3A 2NYYD 5F9AC 3MACH 3K4AA 3OB0H 3TJHC 2RB8A 5IESL 5EBMA 1NGQL 4HWEL 4OZGE 1H3PL 4WWID 1EHAA 4KRPB 1KLUB 3VW3H 2QSVA 4R8WH 4POUB 3T1WA 3EO9L 3V4UH 3MV7B 1UM4H 1EHLL 1I8KB 1AI1L 4HQQH 1OM3H 1DL7H 2P7TB 5ALBH 4EN3C 5KVGL 4ODXB 3E6HB 1OPGL 4XWOD 3BZ4A 3MO1B 4RMQA 3O8XC 4GBXA 5HI3C 5TDNB 3S5LA 3ARQA 4L4TD 2EDWA 3QB7C 1QLFB 1VKXB 2FBJL 4NKMA 3BH8A 4PRBA 3BP4A 1KIQB 2B4CC 3HUJB 5L2KE 1X5JA 2PYFB 4MXWH 4LARH 5I16A 3VMOA 4U1HB 1P9MC 4MNQE 3DGGB 4Z7UA 1JUFB 3VJ6B 1W72H 4GBXC 1RZ7L 5DRNA 4ODBD 4LNRA 2ADIA 3E6HA 5DUBA 2Y06H 3VFWA 5C6WH 5KSAA 1AD0A 4ZUWB 2CUHA 1FG9C 2FL5A 2X42A 1DE4A 3QQ4A 1DQLH 3R06B 4FFWD 2BVOB 4M7ZC 2D4DA 1RMFH 2R2BA 3T0EE 3RY5A 4APQA 5TFSH 3S36X 4L5FH 3NFSH 1Z6JT 4JR9L 3UTPD 1EFXA 2A6DA 4U1HA 4YGVA 4P23D 4PRIB 2DLHA 3B43A 5C0FB 2DQIH 1UCBH 2A2QT 3EYQC 3VJ6A 5KSAC 1UZ8A 5FYJE 1LVEA 4MLSA 2QQLL 5B39G 3NABL 4FFYL 3ARDA 5DVOA 3MRRB 4AQ1B 4W6XB 1F3JA 2E6PA 5M95B 4APQC 3V0WL 1HILB 5I76A 1KYOK 1H3UA 4FABH 4ZNEE 2BSSA 5M7QA 1RFDH 1WTGT 5FYJH 3HE7B 1S7VA 1YEIL 3GSVA 4OUOA 4X7SH 5C08E 3U0WH 4UIKH 3EFFB 5E1AB 3ARDC 1KCKA 1H5BA 4PRIA 4DQOL 2HFGH 3HPLB 2DI8A 3K2MC 3INUH 1NLBH 1QNZH 3MNWB 3MNZB 1YEEL 3E3QE 3MRRA 1TLKA 5KBNC 3MRMA 4LSPH 4C56A 4BFBD 1UWGL 1ZHKB 4XC1L 5FKAB 4XNUL 2R56L 1H5BC 3HE7A 1AQKH 1OSPL 1XCTB 3TO4D 4DCQA 3B8YA 3VMNA 1OAUL 2W60B 5IGXH 1HK6A 4DKEH 3TPUB 4PJGE 3CFKB 4P2OB 1NEZG 2ZJSL 2JTDA 5SWQB 1ERNA 2Y6SD 1V3KA 1TVHA 3BEWB 1KB5H 1G7JA 3V5KA 1YNTA 4MD5B 1UCTA 5D93C 3D39A 3X17A 1A4JB 1J88A 5HHVH 1D5MB 4RRPA 1FIEA 4PLJD 2BNUB 3MCG1 1D9KA 4HZLB 1JWSA 1KCLA 3S98A 4G9FD 4JLRB 5I8OH 1XCTA 4DKDC 2IBZY 4WI7A 4R4FH 4FNLL 4YAQA 2PO6A 4DEPB 2IBGA 1JWMA 1CFVL 4FXGB 4J8RA 3TYGL 2WBJA 3TN0D 4PJFA 5HYJE 1SJHA 3CSGA 2OTUA 3PIQA 1C7TA 3DPBA 3O6ML 5IVXA 1OQXA 1YEHH 3BEWA 2X5PA 4OZGF 2NY0C 1D9KC 3TVMB 2P48B 1EO5A 1UJTA 4XCNB 1D5MA 1BIIB 1R5VA 1OGTB 2PO6C 3RL1B 2A6IA 2VLLA 2BNUA 4GRMB 4HZLA 5DFVD 2WBJC 4E42B 3P2TA 4U1KB 3KLHD 5D5ME 5HYSB 5DMGD 1AO7B 2ZUQC 3SOBL 2C26A 3SDAB 1PG7H 3WN5B 4P9ML 1BBJA 3K3QA 4I48A 2H26B 2BFVL 4RGNC 3VCLB 1NQBA 5I8KL 3GI8L 4HG4K 3CDGB 1P5UA 4X4ZA 5K93A 5GZNC 3IDXL 1T03L 1KJ2H 4U6XB 3MFFB 2R4RL 3CU1A 4GRMA 1N5AA 5E6YA 4E42A 4UDTB 3Q3GA 4Y8AA 1JGUH 1LNUA 1KN2L 5HGDA 3O3AA 4Y4KD 3ZKMD 1R3HA 1MAKA 1HI6B 1FE8L 5EIQA 5CEYA 3MXVL 4LMQE 2FIRT 1XGPA 5C0BD 3WSQH 1OT1A 4U6XA 4ODHH 1JNLL 4ELKB 4PJAF 3LKPB 4TOYH 1FVCA 1PY4A 4AYFA 4IM8A 2ICWJ 4ZTOH 4NQDA 1XIWA 4X6EB 3RIFK 3ZSSA 2MTPA 1E27A 1TZGL 3SGEI 4K3GA 2CKBL 5F93C 4OT1H 2XIDA 1NCDH 1Q8MA 5SWSE 2A1WL 5ACLA 3T3PF 2A83A 3QNYB 2XYCA 5J57B 2OK0L 2R0LH 2JIXD 5D7LD 2MQ0A 4PJ7E 1XIWC 4QHNB 4XPGL 3MLYH 1T1ZA 3LKPA 3BGAA 1SMOA 2YKLL 4ZXBD 2AK4A 3ULUC 1IQWH 3FAXA 3RVVC 4QYOB 5HHXH 2BRQA 3PWJB 2VWEE 3D9AH 3GKWH 3MV8B 5D7IE 3RGHA 3WLWC 1I8LA 3MJ8B 4BSWA 1S7XB 1P1ZA 1M71B 2X89A 3SDXA 1AXTH 2K3TA 2BERA 2X9XA 1BJ8A 1S78D 1FAIH 1XF3A 2DMCA 5CCKL 4QHNA 15C8H 1CF8L 3V52L 4S1SL 5F7EL 5F88A 5FOBA 4B41A 5FA3A 5CJXC 4OFKA 4PRAB 3QHFH 4B53A 1JN6B 4K71C 2O26U 1I8LC 1T20B 4C4KT 3CSPA 2FD6L 2YSSB 3AUVA 3PV6B 3AMKA 4NFDA 2EDXA 3LS5H 4OZHF 4PJCF 3RVWD 2HFTA 4ONHB 3G08B 3S5LG 3T0WA 3TT3L 4BQ9A 4YBQD 1CFTA 4HKXB 1IGMH 3U2SB 4WUUB 3X3GL 4X80L 2HVJA 3WFDL 2BOBA 4PRHB 1W8NA 4LVEA 1LE9B 1LO0L 1AHWA 1WWCA 4XCEB 3IDYC 3LQAC 1QR1B 5EIIA 5ADOH 5I17A 3BIAX 4UQ3B 3DXAB 5CSZA 3T1FB 5GGRB 3VFUB 4KU1A 3PV6A 3SDCD 5BOPA 4D9RD 1A3LL 4PS4H 3U2SA 5B3JE 2JB6B 3BPCB 3ET9F 1KCSH 1AHWC 2G9HB 2EXYD 3QFJE 5FUOL 4R90H 1CXLA 3RX8A 4OF8A 1B0RA 4JO4H 2HMIC 4UMGA 5GZOC 3MC0A 1LE9A 1DDHB 3WUWA 1LK3H 3CUPA 2X70B 1T21A 1SQ2N 4ODVL 5EH1A 2NY4B 5T1MA 4QXUH 4UT6H 3KS0H 3OKMB 2IPUG 4M6MH 3FJTA 3BZFB 2GTWA 5ICZB 4QTHB 2YWYA 2ZKHL 4H1LA 5E4EB 4XRCB 3TIEB 3WHE0 2HTLD 3MLTA 4NM8H 3UAJD 2B2XH 2DMBA 2AEQH 1P5VA 4W81A 3LDBB 4M1GH 4TTGA 1DVFD 3OAYH 2E6QA 4RBPK 3BESR 4XXCC 3K1KC 3BX7C 1F00I 4ZFGH 2VAAA 3WS3A 4DKFL 1QZ1A 5HHQB 4OCNC 4C54A 1L7TH 3D69A 1IAOA 3VI3E 1BQLH 4LL9A 2YPLB 3BPOB 1MVUA 1PGRB 1E4KA 1MFDL 5E2TH 4P3WA 5F6IB 5GS0C 3KXFE 2AJSL 1QLEH 2UYLB 4M1CD 3SE9L 3X13B 1NUNB 1NUGA 2PETA 2ZPKH 5JXED 4LQ1A 4QT5B 4F80A 1HOCB 2J3SA 4N0UB 1JWUA 4OIAA 1N0LA 4YR6A 1KV3A 4OV6F 2FJGB 1FFPB 4X9FA 4F7CA 1A7NL 4WW2F 1E4KC 4G7YH 1A9EB 3PWUB 1ZXQA 5ANMB 3BP5B 4J12A 1G0DA 3BP7B 3IS0X 4PJ7F 2DMKA 5C09A 3P30H 4J3OC 2GCYB 2WUBL 5I18H 2AXFA 3KJ6L 3H2WA 4LLVB 4RRPG 3SKOB 3QDGA 4I13B 3MOBL 3U4AA 3L3JB 2A6JB 5DURD 2VDQH 4WV1A 1P69B 4GW4B 4YXLH 4CADA 2JB5L 1A1NA 4QT5A 2P8PB 5HGBA 1RZJL 1FVDB 1H3VA 2X4SB 3CFDA 2ICWI 3SJVD 1PQZB 5I1AB 1S9KC 4YFLF 5I66B 2FJGA 3WUZA 3NAAL 5E8EA 3BP5A 5F8QC 3U9UB 4JDTH 4P59L 3CFCL 1NBZB 4WV1C 1V7ML 1R3JB 2VXTH 4EUPH 1V3MA 1OGAD 4OQ1A 3SKOA 3NACH 4IOFC 1HXMB 4QRPE 1DQJB 1F6LL 2YRLA 4WUKL 4JN2B 2P8PA 4OFPA 1TJIL 4GRLA 4TSAL 4G6MH 4MSWB 1NFKA 5I1AA 4PJAA 2NY5L 1DLHB 3F7YA 4AT6A 4YX2L 2VL5A 1CL7I 4LSVL 1EJ6A 4TVPE 1RK0B 1IGYB 3EJJX 4RGMC 4F15C 5F1OB 2AGJL 3PDGA 4GRLC 4OLZH 3A67H 5EU3B 3NA9L 1S9YB 5TGBA 1MLBA 4KKLD 4TVPH 2FCBA 4KKAC 1O5DT 4RWHA 4ONGH 4MSWA 3OJ2C 5B3JF 4L8DA 4ZFZA 2JCCE 4JPIB 5KOVC 3F7RA 2GUOB 3H9SE 3V95A 4OCYL 2IPKB 4G80B 1BZ9B 1BLNB 1X4YA 4G6AD 4P2RD 4F7EA 4AM0A 1I9JL 5SWZE 4RGOL 3PL6B 5EZIL 3UTSD 5DD3L 3MRKA 1UXSB 5TE7H 1CGUA 4OGAC 4E5XB 5IEKB 3DRTB 3OB0K 5EU3A 4GKZB 4P2YA 3E3QC 2VQ1B 2FNBA 1YN6A 5E2JA 5IQ9B 4AMKL 2EIEA 5F3BB 4ZDHA 4L9LA 4M61B 4ZOBA 1P53A 5T3ZE 1TVBB 4ZSOB 1KF9B 4GAJH 4U7MA 1ZSDB 4LPXA 3PWLB 3LEYL 5F9JA 3IAGC 3IVKB 4WCYH 2RR3A 4BYHA 2LTQB 5E8NA 3PL6A 2D7NA 4JY5H 1G6RH 2GSIA 4OZHA 4PJCA 4WI9A 1UXSA 2J8UF 2DTMH 1R5IB 4GKSA 4OF3A 2R0WL 3RA7H 4A2MA 4E5XA 3F58H 2LFGA 1AR1D 2DQDH 3QDJA 3BIBX 1F4XL 3EYFB 4L9LC 2P45B 5T3ZH 1NCBL 2UZXB 4TNVF 2FECL 1DLFH 1RUKH 3M1BA 5DVKA 4RNRA 1XGRA 3P11L 5D1ZD 1L0QA 3GMRA 3PJSA 4DVRH 3LN4B 1FG2A 3D85B 3GSQB 4M61A 2NY3D 6FABL 3G5YB 4BA8A 1M7XA 4ZSOA 4N1EA 1BPVA 4DOHE 2IMMA 1K4DB 3RBSA 2WK2A 5GRZA 4WHCA 3DURB 5F72S 1C1EH 5F9WB 2R2HB 1JZ4A 3SE8H 1YUHB 4HXAH 1CFNA 3KLAA 5A16A 3HG1D 5JQ6H 1BBDL 2L0DA 3GSXB 3HZMB 3FL7A 2X1OA 4YDJA 1GGCL 1RZKL 1TNNA 1CFSB 4M48H 3LKOB 3LN4A 3GSQA 3SGKA 2NCMA 2NW2A 4LPUA 1PY9A 5MEPA 3B4NA 3G5YA 3HR5A 2IAND 1LO3H 4N8VB 2FATH 1UB6A 2WZPD 2G5RA 2VB5A 3HMWL 2W1NA 1A3RH 2YOCA 5DD5H 3DX9A 1WQVT 1QQDB 1YUHA 1YYLL 3QDMA 1JPST 4HS6B 4M62L 2H2SD 2N7BA 1F97A 3VG0L 1RZGA 2BY3A 4XCCH 1FN4A 4L4VE 3ECBA 5AWNL 5GGVH 2CMRL 4HCRA 4IMLA 4ETYA 1EAJA 4HS8H 5EOQL 4NOBA 3QIBB 4WGWB 4PREB 1CI5A 1UWXH 1FBIL 2AI0H 5DD1H 4JE4B 3QWQB 1CE6A 2CUIA 2QHRL 3EO1B 4YHLH 3DV4B 1VCAA 3GRWH 1YEKH 3WUWG 5FECB 4NO3B 1FORH 4NC0B 3WEXB 4I9WD 1G7MA 2QKIA 1J0KA 1NSNL 3C2SA 2GT9B 3NCJH 3PQYD 4X9GA 4CU6A 4H1LG 5IOPB 5ICXB 4WW2A 3SPVA 3WHXB 1QBLL 2O61A 2YRZA 3FFDA 2WBKA 2B1HH 1FGVL 2R69L 3BN3B 3MV7E 5DYOA 3ORJA 4IRJD 2FO4B 3QPQC 3DV4A 1EEQA 4IHOB 4OQTH 1FJ1A 1B6UA 2C7UB 3BRGC 5DMIH 3MZGB 5DJ8A 4KK5C 4MJ2A 1FH5H 3L3GA 4WW2C 2CR3A 3WEXA 2AKRB 2MCPL 3F8UB 4R26H 1K4CB 3SKJH 5E9DD 3HUJE 3IKKA 2FEEI 3O0RH 1CK0H 3FT4B 2APXA 4J3XA 5JOPD 4LPCA 4EQ2A 4PB9H 2OQJB 2VWEC 3GJFB 2WLYA 3V79C 3GK8H 4QHMB 3TESA 2EZ0D 2OI9C 2OJEB 2W9EL 2FH8A 4OCXH 5FM5M 2DYPD 1DN0A 3RZCD 4MHHI 3UJIH 1T04B 1CVRA 2BJMH 1RJYA 3L5WB 2P46B 2A9ML 4U6YB 1QPPA 2HFFB 4H5SB 5BMFL 2Z8WC 3WIHA 5CHNB 2E9BA 2VH5H 5JIPA 5FYJU 4NM4H 2V17H 3CCHA 1CBVL 1RY7B 1K85A 4NNPH 1A47A 2IAMA 3NVQA 4YQXH 3DJ9A 5TDOB 2V2XA 1J11A 4E0RB 2FGWL 4MD4B 3FB8B 1LP9F 1S9WB 2CRIA 4KI5F 2VDMH 5BRZD 1I8IA 4RAHA 4N1HB 4Z18A 2H45A 3MMEB 5IVNA 5K9JL 4MS8D 1DBAH 3SKNA 1LO4H 4OAWA 3MRHA 1T04A 5HPMB 1J12A 1HHJB 3VXMD 5KTEH 4NO0A 1OP5K 2IAMC 3SDYL 5EUKA 2CK2A 4QXGL 2CSPA 3K8KA 3JZ7A 2QBWA 5J9PA 1UXWA 3WFEL 1VACB 1N64L 1YMHB 5K59E 4HZAA 3R0MA 5T33L 1A6ZA 3EYUH 1G1YA 4P46A 5L7XH 1MCPH 3QXDA 4F7MB 2G75B 2FEDD 4AIZA 4FQ1L 1G1CA 5B38A 4UT7H 5DQDL 5TQ0L 5HPMA 3GIZL 2EC8A 4P5TD 1B2WH 1RURL 4LU5L 5AUMA 3G6AA 4P46C 1NDGA 5C0GA 4L4TB 4OLUH 3UBXI 4ELMB 1YMHA 5BV7H 5JOFA 3QBTB 3TV3H 2EDFA 2NTSP 5BZDA 1P6FA 2J8UA 1I9RH 2FSEA 3NN8B 4O2CA 4PY8J 2GAZB 4UV7L 4HW6A 1RVFL 3NZ8B 5I15H 2XTLA 2VZTA 4XNXL 3EOAA 4JG1L 1N6UA 4DJMA 3UTZB 4I0PD 2WWKT 4KZEH 1JHLH 1S5IH 3EGSA 2BMKB 3DV6A 4KQ4H 1FAKT 3O4OC 1F6FB 2JF1A 5GJTL 3FKUS 1AY1H 4GMTL 4PUBH 4UBDD 5GRWA 4Z7NE 2EEDA 4UU9A 3AAZB 5DHYA 1MRCH 2JELH 5T5NF 1UENA 5DK2B 5ILTH 1FNEB 3MR9A 1T89A 2D0GA 1RHHB 4P23B 4XP4H 2WLZA 3QRGH 2IBZX 1U3HD 1OL0A 4K3DL 4MAYD 3VFOA 3S7GA 4D9LL 1JK8B 2AV7A 3HLAA 7FABL 1LEKA 1E0OB 1ZHNA 2XZZA 1ZS8B 4NN7B 3CFBB 1EEUA 4FQIL 3SBWA 1A6VH 2HLFC 3Q5TA 1AO7E 1D6VL 1WEJL 2X4QB 1T89C 4I3RL 1JRHI 3F5WB 3V0VA 5EC1B 4LVNB 3AREA 1L9MA 1ZHBA 3MLUL 1MFBH 4YHIB 4GKOA 1FNEA 2KKQA 2DDQL 4XP5L 4G6KH 3JV6B 4NYLA 2DLGA 3NTCL 5JIHA 3MLWH 1I3RB 2VDOH 3DECA 3SBWC 4BH8B 5I1KL 2V5MA 4YGAB 2F74A 4L3EA 1T83A 1JK8A 1OARL 3CX2A 1FZJB 1NCAH 3AREC 4EIZC 3P4MB 1ZS8A 2LVCA 3LOWA 2VUYA 4GW5B 2QQKH 2DD8L 4LCIL 2V9RA 2BHUA 1NAML 3J7HA 4KV5E 5FK9B 5TDPB 4YHIA 2CIKB 2HAZA 5D7KE 3TO4B 5LGHL 3QWRD 3Q6GH 1GZQA 5FYKL 1T83C 4DW2H 3VFVB 4XMKL 2PW2B 4D0BB 1Q1JH 3WDJA 5FB8B 2VLRA 4NUJA 1J1OL 2YD6A 3PF2A 2BVUA 4OGYH 5HYQB 2NX5D 1ZLWH 1WSST 5IK3A 4KJYA 5FM4A 1HEZA 1QSFE 4HG4J 3QHZH 2FB4L 3VRJA 1MPAL 1ACYL 3OAYK 1RU9L 5EWIH 4JFFD 1A1OB 5J6GB 4R2GC 2NXZD 5AD0B 3H9SA 1A1MA 3TN0B 1CICD 2E5EA 2FWOA 5K59F 4L8CB 4N8VG 5GGTA 5FB8A 1BF2A 4YNYB 5GRJL 1GHFL 3CVIL 3MROA 5HVGB 3MLSL 4M1DL 4YHMH 2IMNA 1C08A 1FSKB 1QKZL 4XMLH 1J1XL 4NCDA 2FX7H 4YWGH 1HQRA 3LQZB 1T5XA 1FPTL 4HJ0D 1H0DB 3EJZC 3RPIA 3MV8E 5EZOL 4GLRH 1TITA 4I3SH 1NCWL 3HNTH 4PTUB 4JJ5B 4LVHB 3NFNA 1EEZB 5D6CB 1KIPA 3OJDB 4GAGL 2AQ3A 2WAHA 4DVBA 1VFOA 5DDHB 4WTZA 5CAYB 1K6QH 5DI8A 5BJTB 5DUMH 1D5IH 2EDRA 2HLAB 5EU7C 25C8L 4YNYA 3FO0H 3K4DA 4KHTL 3V5DB 4EVNB 3NBNA 1KJVA 3EYOB 3KPLB 1IT9L 2ZCHL 4QF1B 4DUWA 3S35X 1CXEA 3L95A 1R3LB 4TUOA 4RA0C 3TCXA 2VC2H 2O5XH 2Z9TA 2EE9A 5DD6A 4YDVB 3KG5A 1N2RB 4JJ5A 1N6QH 4WUUE 4Z7NF 3OJDA 1XF1A 2VZSA 2ATPA 1LP9A 4IEFB 4L8BA 3VFNB 1VESA 4Y4KB 4OFYD 1HH6A 5BJTA 3IDMB 2DQTH 5IJKA 3OSKA 4UTAL 3D0VA 1YECL 2Y5EA 5E6IA 1ADQL 2F54E 4DGYL 4HWBH 4XMPH 3MA7A 1QO3A 5I6XB 1G7QB 4MA8H 3RU8H 5C6TH 2D0FA 3DXAE 2BVPB 3AFLA 3B9EA 1U8QB 4KI5C 3QUXB 3UJTH 1N2RA 2J88H 3IDGA 5E6IC 4K8RC 2AJZA 2NY6C 4Z0BL 5IIEA 5E00B 3O4LE 3BZEA 1DSFH 4QRRD 4FXKA 2ZCLL 4LGSB 3IT8D 4V2BA 3PWPD 3QI9D 1ORSA 2OTWA 3BQUA 1G7QA 3WXWH 1AGBB 2BSTB 2JIXB 2XTJB 4LPYA 5D7LB 3U30B 1MFCH 4OSUL 4YO0A 2NR6C 3ME0A 4PJ5A 1R3IH 1EZVY 5J1TC 2GJZA 3QUXA 1GPOL 5DRXB 4GH7B 4ZXBB 1EEYA 4LCWA 2FBOJ 5GSVB 4FZEL 3BOVA 4MDIB 5DD0L 3BQUC 2HG5B 2H6PA 5IVOA 1E4WH 5E00A 1VSCA 4X4YB 2PCPB 2CLVA 3BYYA 5A43C 1IKNC 3TYFA 1N7MH 5D71H 3O2WH 1AGBA 1KEGL 1QRNA 1KCVH 4QRTB 4HHAA 3GSNL 5D7LA 3GBML 2P5ED 2DWEA 3OKKA 1I1AD 2YPLE 5B38G 3LKRA 1IKFH 5H35B 5DRXA 4ZXBA 3O3BA 1X7QA 1J8HA 5BXFB 4Q6IB 5KN5B 3BIKA 3RWIA 4MNHB 2OL3A 3VXOB 3I02A 2XWTA 2NTFA 2PCPA 4N0UE 1OWRM 1JPTL 5ID1B 4BZYA 1ZV5A 1QHOA 3RHWF 3CLEH 4HKBB 4XPFL 5ANME 2V7HB 4R96A 2D31B 3TCLB 4UT9H 4PJIB 1BHGA 3HMXA 5EORH 3TZVD 1UEMA 4IIQB 2WQRA 4RX4D 5IBLC 2VDRH 3CLFH 1BIHA 4JG0H 2H8PA 5MI0B 5HI5C 5DGQA 2VSCA 4WWKA 4QEGA 2BX5A 5K9QI 3SDCB 3G04B 2CJUL 4IRSC 4KHXH 2DS4A 3GJEB 2ITCB 1EGJL 5ID1A 5D4QA 1WAAF 2I5YH 2KL6A 3LS4H 4OCSH 2VOTA 4HKBA 3WIIH 3OKNA 1DBKL 4IDJL 4TSBL 1IFHH 5KVEL 1IC5L 3NCEB 4WWKC 4MMXC 3T0AA 5K9KB 2XY2A 3P4OB 3UJJL 1JZ5A 2AJYL 4Z7QE 4HUVA 1TTFA 3LMJH 1BZ7B 1MF2H 5DJ6B 2MCG1 5EU6E 1FGNL 2EDEA 3MOAH 1CIUA 4OLYH 1K9TA 3U0TB 4JFOB 3EJYC 4FHBD 1WC7B 1UG9A 1DVFB 3X14B 4XTRD 4K9EL 3S36L 1A4KA 2VXUH 1P4LA 1F8TH 1CZ8L 5K9KA 1IGTB 3P4OA 5I30L 2EDOA 5E1HB 4I8DA 2VKWA 4F7TA 2AXGB 4U7KA 4JEGB 3MRJA 4PJBB 1WCBA 5MERA 4NCC2 3SDDC 4F33A 1BZ7A 2QQNH 1MCOH 3FB7A 1FV1A 1MH5A 3PNWB 1KXQE 1UWXK 3FT3A 3KJ4B 5F96H 1TPXC 1W8OA 5LJYH 2AABL 3N1MC 5C0DA 4NRYB 1TCMA 5HVWA 3I84A 3ZTNH 4JRYD 2W9LA 4LFHG 1IGCL 2LU7A 3C6LA 2VN4A 4ESKA 3LRSB 3FB5B 1YMME 5C0AD 2H32B 1A7OL 1DQML 4BUGA 3C8DA 3BVNB 1NMAL 3STZA 3NCYP 5AZ2H 5IB1B 4PRPD 4JFDE 2EICA 3DX6A 1DBMH 3I6GA 4JZJA 4N8CH 3L3OA 4OGZA 3C6LC 5BV7C 3I75A 5DURB 2I60L 4OJFL 2X1WL 3LN5A 3Q1SL 5C2BL 2HRPH 5D6DA 5I74B 1KLFA 3SJVB 4FQPA 3ARFD 2Q76B 3QFDB 3CXDH 2F5BH 1JGLL 4JZJC 1JE6A 3SKMA 3ILPB 5CGYD 3ILQC 1CTNA 5DJYA 3GM0A 4B7IA 2AK1H 1G7LB 3MNVB 4RDQF 5D6DC 3VD4A 3OGCB 4ODSL 3L5IA 1OGAB 4ALAH 4F58L 5D8JL 3MRIB 2J4WH 3GGWB 4U1MB 4K2UH 3QXTA 2E27L 1G7PB 2B4CL 3WKMH 1CLZH 3EDDA 2F58L 5JZ7C 4TN9A 4UAOB 1OF2A 4JY6B 3L3HA 2NY7H 3LKNB 1RUPH 2XOTA 1SYSA 2AJUH 4NQCD 1H3GA 4G8IB 3ZTJG 3VWKC 3RVTC 1VGEH 5IB2B 5KSVB 1HE7A 2NY2D 5TPWH 4J7RA 2ZZUT 1MCKA 4LEXH 1EMTL 4G7VH 1PKQB 1V7NH 3ZMRA 1F4AA 4LAQL 1KSRA 4XPTL 5E2UL 3MRIA 1XFPA 3CFIC 3IDNB 4X99A 3OR6B 4M7KH 5J8OA 4S0TD 5C9KA 1I7UB 1U0QA 3VGEA 4CL7A 3MRPB 5ACMA 2UWEE 2GK0A 1R0AH 5DA0B 4DN3H 5I8CB 4TUJA 4K23H 5E08L 1B6DA 5E6ZA 5KSVA 3ARGA 5I1HH 3UTSB 3CJJA 5E2WL 5EOTA 4Z0XA 1RZIB 1FFNB 1QSVA 1JTPA 1QA9B 5DTFB 3KWWA 4MJ5B 3BWAB 2E8YA 3HZVB 3C8KA 3P77A 3VA2C 2KQMA 3IXAA 2DN7A 2IPTH 4MVBC 3KPQB 1MELA 3ARGC 1BREA 3UBXB 4G8FA 5EOCH 4JN1L 4YPGA 1ORQA 1RUML 5E8OB 5F9OH 1PZUB 1LD9B 3HI5H 2KH2B 4U0RB 2W65A 3P9LB 2K7PA 3E2HC 4J2XA 3O6KH 2P5WE 2EYRB 2ADFH 4RQQA 4RISH 1QA9A 5DTFA 4U1SB 3U4EB 1EO7A 1NMCB 3SQOH 3HS0B 4KROC 4TVSa 3T2NL 5E5MB 5D96B 5KS9F 4G42B 1D6EA 5DJXA 3NIDE 3KPQA 4PGEB 5D1ZB 3B3IB 3PWVA 3IJSB 5FCSH 3PV7A 1MI5A 4HSQA 4GKNA 4A6YL 1C5CL 4OM1H 1X5LA 1QEWA 2E8ZA 1IC7H 4NGHL 4Y0GA 2B1AL 3TH2T 4D3CL 5IHUH 3QP3A 5F7FA 2EYRA 3W11D 2OR9L 5C07E 1WAAA 4XT1C 3HG1B 4U1SA 3U4EA 5T5NG 5L9DL 4NQSB 2LABA 4MNGA 3HS0A 5E5MA 3BGMB 1BJMA 5DJCB 4G42A 3WHE1 1Q72H 4YJZL 1MHPH 3ARZA 2IANB 3H3PL 5DT1L 3J8F7 4GAYA 4JKPH 1I7ZB 5DMKA 1V3LA 4HV8A 3WD5H 1H8OA 2EYSB 4I0KA 2G2RB 3SGJC 2WIMA 5AYUH 1UM5L 5FGCE 5I1JL 4OGXH 3GJFH 1F58L 5JXAL 3HG1A 2CK0H 2F15A 3TFKC 3ULVD 1S8DB 3DTXA 1FYTA 1SJVA 1IGIH 1ZA3A 2A0LC 3MV01 2XPGA 3ROOA 4EDWL 1F2QA 4Z78B 2E7BA 2OCFD 5CBAB 2HWZL 4NBYB 5IKCB 4JO3L 4Q9RL 4KKCD 4I5BB 4JY4B 1VFAA 2MPAL 3EYVA 4JM2F 5IMOB 1PX3A 1ZGLA 2MNUA 2R9HC 4CNIA 2LQRA 1P2CB 3BN9C 1KPVA 2VIRB 1XF5A 3H7BB 5CP7B 1CDGA 5DJAA 4JREB 3KPSD 2HFEA 4AIOA 3QUKB 3BT2L 1CLOL 2Y07H 3FMGL 5FHBL 5IEHB 3O4LA 3B2UD 3C5JA 1BD2D 4M93B 1YEJL 4MDJB 1A7QH 2N56A 3PQYB 3FQRB 5BO1H 5CBAA 3L3DA 4LQFL 2HT3C 2F19H 2DLFH 2YEZA 1HHKA 4MGXA 3VXRD 2HKFL 4JCMA 4UV4H 3AU1B 1NMBH 4HF5L 4IRJB 1I1RA 5EC2A 1GYAA 1RPQA 2UWEF 2KDGA 5BVPH 3SGEH 2XZAL 2VXSH 5CSBA 4OCMC 12E8H 2DQFA 4L4TE 3IXTA 1N8ZB 3V6OA 4ELME 5IEHA 3L5HA 5JORB 1CN4A 4OBRA 4Z5RB 2BCKB 2VLJD 1NC4D 3C60D 5E9DB 5DUPL 4CJ0A 1ZTXH 3F7PC 3CSYA 5KG9A 3QPXH 1LEGB 2BNQD 2P24A 5C8JB 4HXBH 1EK3A 3UPRB 4ZUSB 1KPUA 3OKDA 4M8QB 4R97C 3V6OC 2VAJA 4D8PA 1JBJA 1XH3B 3RL2B 2BK8A 1UB5A 4NKOA 1CQYA 1XZ0B 4MCYB 2DYPB 3MLVL 3IRZA 3RZCB 2IQ9H 1GSMA 1SM3L 1OQOA 1IRAY 4BZ2H 1KNOB 3NIGE 1T22A 5EPMA 2ZUUA 3UTPE 1MCBA 2A9NH 2BDNL 5KVMC 4LSQL 1HXYB 2Q8AL 4UNUA 1RJCA 3H9HB 1HQ4B 4O02H 4L9DA 1YY9C 1J87A 5MP6H 3GSWB 3OAUH 4GXUM 2R1WA 5BRZB 4HBCH 1PLGH 5HVFB 2X1XR 5T3XD 1A7PH 4V2CB 1FFOA 1PYWB 1KOAA 1S7SA 3VXMB 4GG6B 1EH9A 5DQJB 3KYNB 3VU2A 4JHAL 4AJ0A 2L4OA 3DI2B 1KNOA 4PLOB 3FOMB 1LO2H 4WFHD 1HYSC 4HJJL 1YYMH 3DOSA 3TA3A 4XVUC 3FN3A 1MJJA 4JZOB 3W0WD 1CYGA 3O6FD 4H8WH 3O2VL 4ETQA 3RY6A 3LQAL 1ES0A 3U7WL 4LHUD 4FQ2H 2DQCL 2YK1H 1KPRB 4X5LA 3C6SB 1N5YL 5EU6A 3TA3C 2X4OB 4P2QE 3T4YB 4P5TB 3DO7B 4GO6B 3FOMA 4FQJL 5CD5C 1X5AA 2VNCA 4EBQH 2EH8L 5C0IB 4PPTA 1GXEA 1KG0B 2X9WA 4IS6A 4ISVA 5IJVB 4XGZA 3RY6C 2DICA 3KPOB 4ZTPL 1T6VN 2BNRD 5JW5B 4FZ8L 5DHVB 3ARWA 2JLLA 4YHKH 3MUZ1 4I0PB 3Q0HA 1NGPL 3IGAB 1KPRA 5KS9A 3FT2A