2VR6A

Crystal structure of g85r als mutant of human cu,zn superoxide dismutase (cuznsod) at 1.3 a resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
153
structure length
153
Chain Sequence
ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLRNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE [CU-ZN]
publication title Structures of the G85R Variant of Sod1 in Familial Amyotrophic Lateral Sclerosis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 40
structure length 153
sequence length 153
chains with identical sequence F
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2008-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2vr6A00
1YSOA 3F7LA 1B4TA 2GBUA 3KBFA 2AQNA 2Z7UA 3HFFA 1Q0EA 2C9SA 4A7GF 2LU5A 3HW7A 4A7QA 1HL4A 2ZKWA 2VR8A 1BZOA 4A7TA 2WYZA 1P1VA 3ECUA 3GZOA 3GTTA 1F18A 1IBFA 3RE0A 1IBBA 1UXLA 2Z7ZA 3KM2A 3QQDB 1AZVA 2K4WA 4N3TA 4FF9A 1SXBA 1DO5A 1JK9B 2WWNA 4A7GA 2VR7A 2ZOWA 3QQDA 1SXCA 1MFMA 2JCWA 2SODB 1IBDA 1YAZA 3SODB 1ESOA 2APSA 1COBA 1OZTG 5KBMA 4BCYA 1Z9PA 1JK9A 3KM1A 2ZKYA 3F7KA 3MKGA 2R27A 2AQPA 2Q2LA 1TO5A 1E9OA 1N19A 1OAJA 1OEZW 4L05A 3HOGA 3S0PA 1XTLA 2C9UA 1U3NA 1JCVA 1CB4A 2E46A 1KMGA 1OZUA 4MCNA 1B4LA 2GBTA 2XJKA 4A7UA 4BD4A 2WWOA 1YAIA 2ZKXA 1TO4A 3L9YA 2C9VA 3KH3A 1Z9NA 1N18A 1RK7A 1E9QB 3LTVA 3K91A 3MNDA 2AF2A 1PU0A 1E9OB 5CU9A 2NNXA 1EQWA 3GQFA 1XTMA 2GBVA 2Z7YA 1SRDA 3CQQA 2WKOF 1BA9A 1PTZA 1E9QA 4OH2A 1HL5A 3ECVA 1FUNA 2XJLA 2V0AA 3GZQA 2VR6A 4A7SA 1UXMA 1IBHA 1SXSA 1SOSA 1SPDA 2AQTA 3KBEA 1E9PB 3GTVA 4B3EA 3CE1A 3H2QA 1DSWA 1QUPA 1F1AA 1SXNA 4OJAA 1CBJA 1PZSA 3H2PA 1IB5A 3GZPA 2AQSA 2WYTA 2AQQA 3CQPA 1E9PA 2WKOA 4A7VA 2Z7WA 3L9EA 2WZ0A 2WZ6A 4BCZA 3KH4A 2JLPA 4U4IA 5KBLA 1SDYA 3T5WA 1XSOA 4N3UA 3PU7A 1SXZA 2E47A 1S4IA 4MCMA 2WZ5A 1F1DA 1SXAA 1F1GA 1L3NA 1SDAB 1OALA 2AQRA 3ECWA 2AEOA 1EJ8A 5KBKA
chains in the Genus database with same CATH superfamily
3B9VA 4RWYL 1ZSHA 2HP4A 3GSXB 2A73A 3STZA 4PRNB 1IQWL 1WS7A 5FFGA 2AVGA 3G5YA 2ZUWA 4ONGH 4PW9A 2GC4C 4B50A 4FA6A 2GY5A 4OLXH 4B96A 1DZBA 1KTLB 2BJML 3CN2A 4PTTA 4H5SB 4XT1C 4GG8A 5A2KH 1ZGLA 2ZX9A 1DUZA 1ET5A 3JWNH 4FG0A 4C83A 3LIZH 4LBEA 2ARJA 2XQBL 4YAQA 1G6VK 4P57A 1ITBB 2IO5A 2VLLA 1HH9B 4N2KA 4OFYD 4WO4A 3WFCH 4UDUB 1H9DA 2DWSA 1CYGA 2LLGA 1UTDA 5K9KB 3D52A 3MC0A 2VR7A 3AACA 1DBJH 1F4XL 2BIMA 4NPYA 5E94A 4XO3A 5DJXB 2ZG1A 3RFZB 5DQDL 4GRWB 2VERA 3VFPB 1JK9A 5ESQA 3BKMH 4JVPA 4XC1L 4F7CA 4LOVA 5FA4A 3H3PH 3RU8L 2VTFA 2EUXA 2IALA 5C6TH 1O6SB 2Y9RT 4ZZKA 2NCMA 2FECI 1HSAA 4HEME 3UAJC 2VKWA 3ARTA 2I69A 1CE1H 1MFEL 4OFIA 3IT8D 5FM5O 4WWKD 5ENWA 1LEIB 3CTTA 1I8KA 3UEQA 3H7BA 1ES0B 2QR0B 4H26A 5BUAA 4O9HH 2ROYA 4HWZB 4Z95L 3U9PH 4X5XB 2G3XA 5L0QB 3TASA 2X4TA 4DH2A 4BSVB 3QJUB 4GUOA 1IL1B 3JTBA 4P2OC 2C5DC 2J12B 5L6YH 2ITFA 3GB7B 3K46A 3NZ8A 3LKPB 5DUBB 1U2HA 5FUZH 2UX6A 1PG7H 4EKJA 2PPDA 1TEGA 1DUYA 3VXSD 2Y5TA 4J6RL 3C60C 4PJGF 5KOVC 4MNQD 4DGIL 5ETUB 1TUPA 4R7VA 3BP6A 3OAYH 5HI4C 1MCNA 3IDNA 1P84K 1PNCA 2OP4H 2ICWJ 3EDEA 3HHSA 4R4BA 4ZSOB 4O2CA 4X9GA 3MCYA 3MRLB 2FT6A 1WBXB 3COOA 1G7MB 4GQRA 4MTMA 2BH0A 1L3NA 2E5EA 1IEBB 4R5XA 4OI7A 2E6PA 4JZJC 2AEOA 1CU4L 3KDMA 5EZIL 5E7FA 2A6DB 4J3UA 3SQBA 4HS3A 4OCWH 4G1EB 2FQFA 1QFWL 3KBPA 1CVSC 4P07A 1NIDA 4QOKE 3MV7A 4R0LB 3QJFA 4RGNE 4DGYL 3VD1A 3OKKA 3D9AL 1G7IB 1QACA 4DKEL 5DRWB 4WF7A 1WITA 1B2WH 1MNUL 5JW4M 5KYXA 3RWFB 3DMMA 4HZAA 3SDDA 4J7RA 4OZGA 1CFTA 4KFZC 5INCB 3NGBC 2Z8SA 3F62A 4FJZA 3GSNH 2ADFL 3S5YA 5C2BH 4PGBA 4ONFH 4L3AA 3DXAE 3KL0A 3UYRH 5FYLE 3N85L 4UTCA 4PVBA 2X40A 4YGVB 5IB2A 1PY9A 3L4TA 4CVWA 4LGRB 4HOXA 1JHLL 1R24A 3T77A 2F1AA 1AY1H 1JPGB 3MRQA 2DEXX 3VXPA 1CF8H 2H45A 3ARDC 3OGCA 1NFIA 1BP3B 4HX1B 4WEUD 1ZK9A 1TO5A 3BC9A 4ZMAT 2R29L 4K4KA 1KJ3H 4GQQA 4KO7A 4QGTA 4RNRB 3KWWA 4F3FB 1UD4A 5DK0B 1YY8B 4LE8A 2ZONA 2OJZH 2JV6A 4PPTA 5IHHA 4A2MA 1KXVA 2EXYC 2C3VB 3Q5YA 4EPSA 3TPUB 4FFTA 1HKLH 5MI0C 1RK7A 1AFVH 1KBBA 4Q74A 3HR6A 3A47A 1JHTA 3Q6GL 4U1GB 4UAOB 3V5DB 3ULSA 4YIQA 5F3HA 4KK9C 4K3DL 3DSFL 3SIKA 4G9FA 5EN3A 1M6OA 3MRRA 3TVMA 5L9DL 2GG1A 3FCSB 3JWDL 3ZE2B 4LMQI 1TVBA 3WN6A 4OJYA 2Y06H 3S37L 3WIFB 4FGMA 5F96H 5I1GH 3OC5A 2D3NA 5GGSA 1WYJA 4B41A 1RVFH 2BVQA 3F3HA 3QWOB 4PIBA 1M05A 4XPAH 4UCFA 3FQ4A 4C4KO 2BWDA 5BVJB 1JP5A 4ZO8A 2BHUA 4M61B 3BVUA 3ZHDA 2WN3A 1H5BA 2XYBA 4IMKA 2NSXA 3LQAH 1AKPA 3PWJB 1SM3H 1QO3B 1U58A 4ABQA 1UH3A 2H6PB 3RAJH 1TYJA 1KJVA 4FERA 1Q4NX 2GT9B 1E2WA 1RUPH 1NMAH 4NM4L 2P5EB 2XZZA 3BP5A 4WI9A 5E1IA 3UJJH 3BMVA 3DPBB 4NJ9H 4YEEA 3CNKA 4R7XA 2EVHA 3KYMB 4NZJA 5I2IA 3LHPL 1TLMA 12E8L 4KK8C 1DVQA 1PJ9A 4N68A 4L8SA 3BSZA 4HBCH 4H0HB 3WIHH 2FHFA 3FZUD 2EDDA 2YD6A 3M8OH 4JAMA 2Z31A 5I5JA 1JYXA 1Y0LB 5JXAH 2ZCKH 2DMKA 5K69A 1FFQA 3CZSA 4HH9B 1LK3L 4CVZB 4HCIA 4PJAA 5GZND 2ZQKA 3IJYB 3HRZB 3NJKA 2C26A 2IH3B 3SDAC 4M9PA 4GQPH 2ZNWA 3M7OA 3PJSB 1TJMA 3MGAA 3MA7A 4HLJA 5GGTH 3C2SA 3JWNE 4Z7WB 2B1HL 4OJDH 1P0SE 2RD0A 2NMSA 1LWJA 4TTGA 5C0DA 1GZPA 2VDKH 3ULVD 5F6HI 3OX8B 4UYQA 2IBBA 1CK0H 1VEPA 3AG1B 4CC1A 2ZF8A 4XHJD 2CDEB 3L5WA 3B7SA 2FSEB 2HJFA 4LESA 5AAWC 3DIFA 3E1F1 3GBMH 1FPTL 4MDIA 1PAZA 5DRNB 2F68X 3BP4B 3FS9A 4ZUTB 1RLBA 2ZPKL 4CU6A 4FKKA 2B4CC 4Z7OE 5BNXD 1S2EA 4CMHB 2EDYA 3HZKA 4OVUA 1F90H 4X98B 5D1ZB 4LIQH 2F18A 3F84A 1Z9NA 1MW2A 5MEND 3B2UC 1INQA 4YHOL 4U7KA 3THML 5EO1A 2N7SA 3K72B 4YNYB 1K8IA 1SJEA 3UAFA 4NZUL 5DD1L 3NSJA 3UZEC 5DD5H 2VISA 3FFCA 2A0LD 1OGAA 4KGLA 4PJ6A 4GKSB 2DBLL 5CU5A 1CFNB 1JZEA 2X10A 1S5HB 2H32B 2XLLA 3CHSA 3O9WB 1F58H 1KIQB 4LZKA 4UBDC 5EWIL 3VFGL 4N26A 4OZIB 3TT1L 4EZKA 3TEWA 2ED8A 2IAMA 3ARUA 3BJLA 3G04A 2QPDB 4UILL 5AOKA 5J3HD 4KTDL 4QUOA 5KJ4A 4R7NB 4N90E 3U48A 4CGTA 3BKJL 3VSUA 5LHDA 1XF4A 3GXPA 3VQ1C 4LCWD 1QFHA 5DD0H 1TQBC 1ZHKB 5B38B 3I75B 3QG6B 1YEWA 3PQYB 4GBXC 1HHGA 5DCCA 3VYPA 1EDHA 4KROC 5FIEA 4KKZA 3OXRA 1DE4A 4POZC 1G9HA 2WB1A 2XV2A 4G5ZL 5CZVH 1WWWX 3HS0A 2YAHA 1AYOA 1I9IH 4LCUA 3MRHA 4UM9B 1CICA 4C56B 1U42A 2KYIA 1HESA 3VG9B 1UHVA 1NL0H 5DD6B 1ZT7B 4KU1A 3UC0L 4ECNA 3DDGA 3QEQE 2XZAL 2J57A 1BXXA 4XXDB 4OCXH 2WSPA 2NY1C 4G8GD 2NNCA 3R0MA 1L9NA 5DTFB 2PWHA 2P52A 4PVNA 1N3NB 3NQKA 1QRKA 3QWNA 4JVUA 5EUKB 1XZ0B 4U1HB 2FJFB 3ZDZE 3GKWL 3MO1A 1OOAA 1HCVA 4A2LA 4JRYE 3RJDA 1DFBL 2AK4B 2DIEA 1HCFX 3WTYA 1QLEH 2XWBB 1DVTA 3I85A 5KSBE 3D07A 4OJCA 2AXGB 2GSGA 1UKSA 4HHAB 1GGBL 3IU4H 1OCZB 5C1MB 1G4RA 3QYNA 1IKFL 2CIIA 2HG5B 3BZFB 2VR4A 5E9DB 2MSPA 3LKNB 4K3EL 2LW3A 1KLUB 1E8ZA 3V6OE 2VITA 4MMXB 2FO1A 1GZHC 1XD0A 5EZLB 3VFUA 1XIWB 3ABLB 3GBDA 1CTNA 3SN6N 5D1XD 1RULH 1NDMA 3MCLL 1EA9C 2IH1A 1DFXA 2XQYA 3BUTA 2XWRA 1YY9C 3CVDA 3MJGX 1GRWA 4XP5H 4F7MA 3T0DA 1NGWB 3X3GH 4S1SL 2NNAA 1EEZA 4Y4KB 2FJHB 1XGQB 4XWGH 5FYKU 2ENQA 4J1UA 3UAAA 1A66A 1WZ1L 2O6EA 5F8QC 4NQVB 3WS6C 4MWFB 5IFHH 1RZ8B 1TPXC 4XPTH 3SE3A 2JQZA 3FOLB 2Q2EB 1GXEA 3TBTB 4NIKB 5G5DB 4AV4A 3Q8AA 4DPBX 5AOLA 3AG2B 2AQ3A 3DV4B 2A9MH 3BLKA 3FHQA 3EYOA 1JFQH 1WK0A 2V8MA 3HG4A 3QNYA 2R2HB 5CP7A 5CSZB 4F33A 1RURL 2VO8A 3P4LA 5T33H 3EO0B 5J6HA 1Q1JH 2UY7B 4KWUA 1SXNA 3G08A 3LXBA 1FCGA 4WJ5A 2OMBA 3OKNA 5H4ZA 4Q7DA 2EO7A 1YN7B 2X4UB 1I3GL 2EDJA 2FO4B 3LNFA 3IJHA 2JKNA 2LLLA 4X4ZA 1KB3A 4Y0GA 3P4NA 2ITDA 4APQA 2DIAA 5DQ9A 5B8CA 4FI8A 2RA1A 5B4MD 4OFDA 1J0JA 1OE1A 3HNTL 3CZNA 3GSUA 3K0YA 1D6VH 4F91B 2A6IA 1JGLL 3K2UH 4LARH 1IC0A 1WE5A 1QSZA 4Z9KB 1ORSB 1XGUA 3GTNA 4X9FA 4ZBJA 1FFNA 4D8PA 3CSFA 1G7QB 4ZTOL 1RZPA 3DX6B 2X3CA 4BFRA 3SE8L 1JPST 4M1CC 5AKVA 3QEGH 1TTFA 1CXIA 5C9JA 4XVOA 2EYSB 2WYZA 2QQQA 1HC1A 1S7WA 1LQSR 1UWYA 1YN6A 4PRPD 4Z5RA 3HB3D 3PL6C 4PJ8A 2NPLX 1S78C 4OBRA 2CDFB 4HU8A 4X6FB 5FDWB 5KJ7E 5E8DH 5LWYL 1AZZC 3POCA 4RQQB 5HGAA 5E95B 2R0LL 2Q5BA 1U8QB 1I3RA 2A6KA 2AW2A 3W5MA 3RWIB 1UEMA 1NA8A 3G6JF 3B9DA 5DLMH 1L0PA 2YPKA 4LLDA 2UY6B 1GGTA 2XPYA 1J1XL 4P04A 3SE9H 1GMIA 1FC1A 1UH2A 2LR4A 2M83A 4JDTL 4V2BA 2R2EB 4Y2NA 3F7KA 2W80C 4PH8A 4CKVX 2Q2LA 4ZG1A 1EFXD 1OAJA 4JO1H 4YL4A 3MREB 5D7HA 5HVHC 5HHQB 2OV0A 2Q7AA 2X9XA 3CU1A 1A4BA 2ZXCA 3C60B 3PLYA 4MCNA 4GT0A 4E9RA 1OP5K 5IQ7L 1NOLA 1EH9A 2Y7MA 3D4ZA 5J13B 5T5NG 4IOSA 4GAJH 4XGZB 4JUTA 4XVSH 2H0PA 3O3BA 1KEML 1ADQH 4KKAD 1MIEH 4RFOH 3FNKA 4U1NB 1DHKA 1FYTB 5C0GB 1KZYA 2W07A 5E00B 4AXWA 1KCVH 3ZDYE 4XN7A 3VWKC 4R7DA 1D5BB 4LP8A 2X4QB 2ZXDA 3BQUC 2XTJE 1G6RL 5I19H 1A7OH 4FHJA 4NWUL 3E2HB 5IV2A 4DTGH 3GWJA 3LZOA 4HIQA 3SDCA 2XVKA 5HHOE 2AEPH 1WIPA 3C8DA 4FNTA 3WFDH 1OB1A 1OM3H 2A9NH 3UBFA 1EHAA 4UT9H 3NIFE 5BS0D 1D9KA 2OW7A 2ZYHA 3CVIL 1I1AA 3ARGA 5CN1A 2QVMA 1M7DA 2DI7A 3QQNA 4MJID 1ONQB 2OPCA 1R5IA 3CDZA 3RBSA 1BVZA 3A23A 4FA8A 1UG9A 4ODTL 5KBLA 1NIFA 3EOTH 4XI5D 1KFAL 1I1YA 3IXAB 1SOXA 1TYRA 1MHHB 3IF1A 3QNXB 4UUJB 2WUCL 5AB9A 1NFDA 1UM5L 4DFHA 5I30L 2EECA 2K3HA 1T0NA 2JB6B 2VLKB 3FT3B 3GZKA 3IRPX 1AZCA 4P3CL 4U6XA 3MRCB 4KHXL 4FMKA 2GBUA 2W9DH 1EPFA 3FO2A 3ZZLA 3KEDA 1VACB 4AYFB 1NKRA 3FQRB 3BE1L 1QI3A 1G9MH 2EQDA 4JFZL 2DS4A 2CZNA 1CIDA 5IMKB 2DD8L 4OM1H 4AGQA 3HJEA 3Q2WA 4WQOA 3B4NA 4N2HA 5ERWB 3MTRA 3SJVD 3ZDZF 5IB1A 5IMMA 3F05A 2NT1A 3GXIA 1ZLDA 4H8HA 5INDA 4K5MA 4OQ1A 4HPOH 5F7DA 3CFEA 4DOHB 2YD8A 1G6RA 1G7PB 1KSRA 15C8L 5DD3H 1JZGA 2VGLM 3X1EA 4OD3L 3TZVC 4KJYB 3TCLB 4O4YL 3LH2L 2BVTA 3F83A 3J8F7 5C0FB 2I60H 2IV8A 4KTGA 3AUVA 3MRFA 5I71B 4RDQG 2FBRA 3QUYC 4W6YB 3ZN6A 3BGFC 3P9WB 4Q9QL 4LCCA 5CAYB 3LKRB 2BVPB 3NOIA 5HYIA 5I82A 5KSAC 4PJXA 3BZ4A 3W0WB 3QDAA 5I1EL 3Q5TA 2BVYA 3RIAK 3PPEA 2QTEA 3K5RA 4TSAL 2QL1A 5HI3D 3I6KA 1TQWA 3BD4A 3UAEA 2QMJA 4HKJB 1DDHB 4NQEB 4R90H 4JK0D 2XIDA 3VXMD 1NAKH 1E4KA 2XN9B 2WWOA 3OG6B 2VXVL 3APFA 4Y4HB 4RAUA 5B21A 3H56A 4DQAA 4QRSA 3SBWC 5C09B 1H6UA 3BT2H 4OW6A 2WPGA 4ZUWA 5T1KA 4P3DB 1F8TL 4XB7A 3ZMEA 1F5WA 4TXVB 4N2MA 5C0IA 3OR7A 1S7RA 4NAJA 5I1JL 4K0OA 3X17A 5LAPA 3RZCD 1HXMB 4I3SH 3G5ZB 4WI5A 4PJFB 5E2VL 4HUUA 5AB1A 1RAMA 5BXFA 3SYCA 3VXUB 1GJWA 5FF6A 1FZJA 3ZT7A 2UZXA 3MLPA 2GFBA 4Z76B 3FTWA 3HS9A 4WO4C 3REVB 1ADWA 2H0FA 3NIGF 1KIRB 2CO2A 5H94A 3VSVA 3ROLB 2CSPA 4HFWA 5EU5B 5AVUB 3IJEA 2PW1B 4GMTH 3GMOA 4A6YL 2XOTA 4QKXB 3U7YL 2OK0L 1XGYL 5D70L 2DI8A 1M1SA 3SDAB 4UTBH 1QOKA 4TUOB 4UF7C 3DX3A 3X3FH 1F11A 2CRYA 2ZOLA 4N3UA 1MREL 3QDJD 4XP4H 3FO1A 4GLRI 4JX0A 5EU7C 1G7JA 2IV9A 5C0AE 4NP4H 1TOXA 1FI8C 3QUXA 4HJ0C 4YDJA 4NENA 5EMYA 4AUYA 3QR0A 4W1TA 4LPUA 5TDNB 1SMDA 5CR1A 1C5DA 3U79A 4LAQL 3JVGA 4C58B 5FCUL 1PYWA 1QBML 4I2XE 1IKNA 1TVDA 2FSDA 4Q56A 3SD5A 2F8IA 2YZ8A 4G80A 4BHUA 5CNHA 4DGUA 3GPEA 4DP4X 5ICZA 1KCSL 3D85D 3WNIA 3BKYL 1MRDL 5FV1L 2IEPA 3QI9D 2Q86B 4P2QE 5DUPL 1PZ2A 1VPOL 1JZJA 1SDDA 5DYOA 5J9PA 2XX1A 3B3IA 4H8UA 3G6DL 4JHWH 1DQJA 2DQCL 5AW0B 4NGHH 4N85A 4A7GA 4MAUL 2F54E 2ZICA 3BD5A 3ES6B 4P2YA 4XPGL 4WHDA 4ZAKB 3TBYB 2ARJQ 4A67A 4AYEC 4E5XG 4W9LC 4BKSC 4BV1A 4A6YA 2X5PA 3DHJA 4MQ7B 1T2JA 3TURA 2H6OA 3EOAB 1ZIAA 2W0LA 3UADA 3GI9L 2DQJL 4GG6E 5EN2A 4P5TC 4PJ9C 1NEZG 2FR4A 4JY4B 4PD4J 1E9OA 3ZTEA 4QRTB 3APNA 5GSRB 2H2PC 4IU3A 1Z2KA 4M6MH 2HRPH 1XTLA 4I1PA 2C4FT 4XCEA 3C5ZA 4IMLA 1AGEA 1P9MC 5D7IE 1O7VA 4NM8L 1AI1L 1I7ZB 4FYSA 3KPRA 1GGIH 3IFOA 1TQBB 3RI5F 1HX0A 3V0GA 4ZMZA 1AKJD 1X6NA 4U1IA 4URTB 4HIJB 3UJIH 3HE7D 4AMKH 5C86A 4X6BA 5DQJB 3IAPA 3U0PB 1AHWA 4N2CA 4HG4J 1I7TA 1OCWH 1A7QL 1P5VB 5J1SC 3RDTA 4IBUA 1SMOA 1PD6A 1T1XB 1PTZA 2EEBA 3QA3A 3DMMC 2W9EH 3SDDC 5K1NA 2I25N 4YHLH 5K9JH 2QSCL 4G8FA 4P4KA 1R0AH 5LBSH 1X9UA 3MV8E 4P0DA 5DHMC 4Z0BH 3RPBA 4DFIA 3QCTL 3TV8A 3V0EA 2BWQA 4XZUB 1W6WA 1QZNA 2P5WA 2MOGA 2NY1B 2H0EA 5GS0L 4IKLA 4N9GA 4JFFA 3SKNB 3G3LA 3I3EA 3HUJB 2XT1B 4UQDA 1OAXL 4HA1A 1VDGA 3VDAA 1YPZB 1JNLH 1OWWA 1KGYE 4Y1TA 3Q9QA 2JJUA 2PW2B 4TM9A 2D7MA 4IRSA 4F7PB 1FJ1B 1ZKAA 2DWDB 4NO3A 4MMZA 1A3LL 1I8UA 3JV6A 1J9CT 1IEAB 4R83A 1F4HA 3DARA 3GIZH 4PJBA 1UKQA 1CL7L 2QFPA 4ZNEE 2J1ZA 2OTUA 3VACA 3PWLB 1CZ8L 4JLRA 2Y3AA 3TNMB 5JNYB 3TLRA 1X4XA 2WBKA 3KJ6L 3U1SL 1LDSA 2Q7YB 4FXLA 1CLCA 4OIIL 1HEHC 5DZLA 3B2VL 4GW4B 4ODWB 1UWXK 2DQDL 2MH4A 3HG5A 3WELA 1CD1A 4FQQA 4ODUB 1XGPA 4HC1L 1F18A 1G9NC 5DHEA 4MMYB 2DYSB 3TVMC 5CEZL 1ZDQA 4X5RA 5I1CL 3HC3H 4L3EA 1Z3GH 2H1PH 1MJ8H 3O4OC 1RIHL 4HK0A 4TF4A 5F3FA 3V0VB 5A7EA 1GGCH 3TIDB 1SF5A 1TPXB 4N87A 4PJ5E 3T2NL 2BMKB 5I1AA 2UWEA 4G72B 2K3TA 5AKSA 3ILPB 1KELH 4JG5A 1COBA 4KKQA 4OF3A 5ISZA 2FT8A 2Z6FA 4UM8A 2AQPA 2Y7OA 1H5BC 1T21A 1WFNA 4J8RB 4BFGA 4OFKA 3WFEL 3DX7A 3RA7H 1NPJA 4E41A 4BQ9A 2Q76B 3EDJA 2IQAA 3KGRA 3RB7A 1BZ7B 4A7UA 4NNXA 2PPCA 2WINB 1TZIA 1YEGH 1TNNA 3LQMA 3QJVB 1AS8A 3QT2A 1Q0XH 4G8EB 4HQQL 4U0QB 1KGXA 4AK2A 4M56A 3TJPA 2WGNB 3DX9A 3MR9A 5L88H 3T6XA 5C8JA 5AYQA 2J5LB 4L8SC 1U3HA 1ZA3A 1BFSA 5IFAL 2NUTB 4OZFH 5C07D 3T0EA 1J1PL 1WZLA 2Z31C 4ZT1A 2PR9A 2NW3B 4HC1A 4OFQA 5HYJB 4LKXA 4J3OC 5FKPA 1P4IH 1AOZA 1MI5A 1CGTA 4K5NA 1KCRH 4HJSA 5J12C 4QXUH 3S35X 5JZ7C 4XMLL 3MJWA 5AAMA 4HLZG 1BLNB 1BVNP 4Y4FA 4QHKJ 1B4JH 1A0QL 4JRFA 3U6XA 1J9RA 1FZMA 1EWHA 5HHPB 4R8WH 4JFDB 2N56A 3PL6B 3D0LA 1N6VA 1L3WA 4NO5A 1XFPA 1X5YA 2WMPB 3HAEH 3MBXL 4R5TA 3KPSE 4Z7IA 4H0GA 1N0XH 2A4EA 1H0DA 1JPSL 1T1ZB 1Q9WA 1RUKL 3C6LD 3IGUA 4N8VG 3ZDXB 3VE0B 4HK3N 2FJSA 4Y9FA 3U2JA 3MLYL 4L23A 2DQTH 3FQXB 2CLZA 3O8XA 1JUFB 2A99A 4X8GA 4XMKL 1NUDA 3FHAA 5I24A 5I0YA 1BF2A 2EIBA 5LKNA 4FXKB 2D31B 5E2WL 2GVYA 5FFLA 3CD4A 4JJHA 4PB9H 2P28B 2VR8A 3EJZD 1O75A 5IB4B 4NO0A 3NCMA 4JFTA 2FECL 1QAWA 3P77A 1OAQH 2Q8AL 4KZDH 5E6ID 3ZE1E 3VI3E 2YKKA 2NNFA 1AYRA 1YNTA 1XL6A 3HLAB 2J2ZB 3GDCA 4B7LA 5GZOD 1V3LA 3MDJA 5EU4B 4KFMA 4G3YL 2IAMC 3UYPB 2QELA 5DJ0B 4JJ5B 4DVBA 4E2OA 5IOPB 3DO7B 4G1MB 4UT6H 3VYNA 1WBYA 2WV3A 3VWKB 3LZQA 3BQUB 3ZE2F 1KT2B 5ID1A 4WI3A 4I3GA 5HJGA 3EYSL 1LL1A 1ET7A 1Z6JT 1C5CH 4U1MB 4FQXA 3OKDB 3PV6A 5CLWA 3RVTC 1AGDA 4V2CB 4JO2H 3V4PB 1UFGA 3S6CA 1BPVA 5CZXC 3HA0A 1RJZB 5D72L 1VFUA 3WAJA 3FQWA 1MSPA 3ARBD 4MZ2A 2FB4H 1YEKH 1UUSA 4E36A 3HS0C 4D0DA 2EDWA 1FNSH 4OM0H 4GW5A 1EEYA 1K8DA 2OCFD 4K7FA 1YMMD 4BGLA 2DJ4A 4NUQA 3KE0A 3RPKA 3U0WL 2ZCZA 4HXAH 2CRMA 1DQKA 3H4FA 2CMRL 4Y9CA 1EUTA 2AV7A 4M6NH 3CVHL 1JI1A 4GO6B 5DRXA 3TEUA 1PZAA 4MNHB 3M1OA 3W57A 2GJJA 2FGZA 3QO0A 4K7PX 1S9XA 4ZPTA 5E9AA 4JDVA 2B4CH 4XNYH 4BH8A 3HG1A 1ETA1 2IGFL 1BZ9B 3UZQA 1Q0YL 1C12B 4BFEA 1L6XA 4N6RB 1HHIB 4JQIA 1ZOXA 3SPIA 1IM3B 5DWPA 4BFBD 3BWAB 4YHKH 1YJDC 1MCFA 5DHYA 2DQFB 1HH6B 2HJKB 3ML8A 2AEQL 3MUZ1 2AEWA 3CFQA 3TBBA 5JYMA 5KVEL 3VJ6B 3WNLA 3V0WL 3TZVB 5AW1B 1IC1A 1UCTA 1SXAA 3RTQD 4Z7WF 5C70A 1DJHA 1U95B 4KXZI 5D7LD 1K5NB 2DPKA 1OD9A 1BQRA 4KAQL 4ODXA 1CT8B 1UOVA 4XPFL 2APFA 3P0YH 5JIHA 2QGCA 4MAZA 4S1QH 3BSHA 4EBQH 2M8XA 4K55A 1UCBL 1T89A 4F27A 2IFFH 1EHLH 1K4DA 3IN2A 4PRHB 1AGCB 4HJIA 1IAIL 3F58H 5EU6D 2WWMD 1WIOA 2FATL 3LMJH 3KYOA 3OHXB 4D0BA 1QRNA 3BRFA 1QBAA 4PU2A 2AXJA 3CVHA 1VHPA 2WZPA 2NY3D 4NN6B 1IE5A 4LHQB 1QYGH 1ZS2A 2J6EA 4PG9A 3WJJA 1HNFA 3EYQD 3PWNA 3EGDB 5AAPA 2A73B 3QIBB 3STZB 3REWB 5FW8A 4G6JH 1ANUA 3LKSA 4NX0A 5KZCD 3G5YB 5GRXG 4XBEL 2DLTA 1Q9OA 4KRPD 2P49B 1GC1L 5HJ3B 5DUMH 5FEBA 2FQEA 1IGIL 4LSVH 4X8XA 1HVXA 4E9SA 5FS5A 1FRGL 4L8BB 5CINH 4D0CA 2AGJH 3PDDA 4PV1C 1J8HA 4OZIF 4XMUA 2OI9C 4YPJA 1FE8H 4WO4B 5B8CC 2Z4TA 1S8DA 1S7XB 4NCC1 2WKLA 3BW9A 2W95A 2OZ4L 4ZOEA 5EEXA 2HRGA 4NPYB 3RVVD 1C08B 3CXFA 4JFXA 1DEDA 3DOSA 5CCKH 3R19A 4S10A 2FBOJ 3BFQG 3UTTE 3D39E 5L8KB 3GRWL 5KEZA 1X7TA 1YEFH 2KKQA 1T20B 3CMOL 3PHQB 3M1CA 3MZTA 4TUJA 1HWWA 1F41A 5TDPB 1WG3A 5F93C 1QASA 2QGBA 2VLRE 3I3DA 4PJ8C 1HEJC 5DJ6B 5A40E 3Q44A 2WLIA 3VM7A 3U6RB 4Z0XA 1HQRA 1KJ2L 3BESR 3D0VA 2R39A 1NDTA 5AZUA 2EABA 1I8KB 2R83A 3SGEI 2J8UB 4OKVA 5TPWL 4JFVA 2JELH 2V17H 2VO5A 5TDOB 1SJHB 43C9B 4W9DC 2EC9T 4JGNA 3NTCH 3QE5A 1RIUH 4OF7A 4LU5H 5GGVL 1T04A 4LSUL 5IQLA 3O2VL 5EF0A 3FTVA 5KN5A 2D0FA 2YC1A 5AVZB 2R56H 1XSOA 5EF2A 1AACA 1JNHA 4UQIM 5ANMA 3RVUD 2BXYA 5E4IA 3NZ8B 1XF3A 4H20L 4RISH 2ZYIA 4H2CA 5CO1A 1JPTL 1TG8A 2YMTA 5C0CB 2OZ4A 3GXUB 3LS4H 3HR5B 2VDRB 3UO1H 2V3DA 5C0EB 1RFDH 3I6GA 4Y2DD 4JM0A 5HD8D 3K6SB 4QHUA 2ITCB 4EI5A 9CGTA 4P5TB 4PJ9B 4GH7B 3MGTB 5DSCA 3WY1A 1JMZA 3QFJA 3FTYA 2WQAA 2E7CA 2IQ9H 1R3HA 3GKZA 4YDKL 1UZ8B 5TH2B 4KO9A 3MV9D 1I4FA 3ZE1F 4RAHA 3LNEA 4W9KC 4WDIA 4XNDA 3D18A 4U6TA 2JI2A 2WLJA 4IU2A 1T6VN 1T66D 3KDMB 2FD6L 2GSIA 4PP2A 4F57H 4QTIL 4HS3B 2WQXA 1DANT 1R5WA 2LV4A 2UYLA 3LXAA 3QJFB 2OTPA 3OKKB 1SN5A 1KJ2A 1BG9A 4PGJA 5B7FA 1KBKA 4F8TA 2VXTL 1XB8A 4JZNB 4QR7A 1HE7A 3SDDB 4PBWD 1TT6A 1S5IH 1D9KC 1LK2A 4PRBB 1I1AC 3ARGC 1XH1A 4JG1L 5DJ2A 4YLQT 1AR2A 1K6QL 5F21B 5F7BA 2N7BA 2X4OB 3ARFC 2DQUL 2J73A 4U31A 5IUSA 2VXSH 1DSFH 4QRRB 3QZBA 4I85A 3S5LA 1IM9A 2MPAH 3B5HA 4PJCA 3S0PA 3QHTC 1WCBA 4DP7X 4OVVA 3QIWB 5MHSD 1B0WA 1S3KL 3FO0H 3CX5J 4A2HA 1LP9B 25C8H 1A65A 3ULUL 3L9YA 3VXPB 2C9VA 3S36X 3WNJA 3EIFA 3OGCB 4Y19E 5K59E 5TK2A 2KS0A 5DJAA 5A6MA 2EC9U 5IHZA 1BXVA 2XVLA 5CU9A 3TEYA 3ECBB 1MFAL 4FDWA 4JL1A 1PG7W 4U33A 2F5BL 4YH6A 5F7AA 1HL5A 3IDUA 5JDJA 3ZE0B 5J1TC 4OB5L 1E3XA 4OLUL 1U8LB 4PYHA 5T3XL 2ZYRA 4LSQH 4PGZA 2EDRA 1JHTB 3F85A 2FGWL 5F3HB 2H0JA 2NX5D 2Z64C 4IBYA 4PS3A 1FIGH 1MEXL 3MFGB 4KUCF 1IB5A 2BSED 1M6OB 1YMHA 5JPNB 5DEFA 4AVHA 1CDBA 3TVMB 1YNKH 4FFZH 3ZKND 1EJ6A 4XN8A 3KLDA 3I2CL 3WOVA 4LCCC 1W8NA 3WXVH 5CM1A 1Z1WA 2XBTA 4XCNA 3O4LB 5AW9B 5HY9A 4HGMA 3IU3A 1AD0A 2CR0A 3K4AA 1F6AB 2GEQA 1MWAB 2QPFA 5GGSB 1ACZA 3FSWA 3GYRA 3CFTA 3IDMB 1H3TA 4YMPA 2APWA 1X5MA 2YRLA 1T5XB 2CIKA 1NANH 1R3JB 4PWKA 5DMIH 2KLSA 3QR1A 1HEZB 1SEQL 4XNBA 4RWHA 5MEOB 1E4WH 4CA4A 1EZSA 2QADD 4QTHA 1WAAA 4A7QA 1UA6H 3BN9C 3HI6H 1PSKH 4BE6A 1MHPL 4X0NA 3L1OH 1ZLWH 3O3EA 1I75A 4L1SA 1DCEA 2G9HB 4NERA 3BP5B 4PQXA 4MCYB 3RGVA 4HH8A 3N2JA 5I75B 1BZ8A 3FH8A 4UQ3A 1FGVH 1ILUA 3PIQA 1W72B 4JRXB 3H2WA 2WJ5A 2YFNA 3IAQA 4HV8B 1T0OA 4N5EC 1JZ3A 1FBIH 4JAMB 4KXCA 2QHRL 1SVBA 4RX4A 1DVFC 1ZLUK 5I1HH 2P3YA 2ZAIA 3WXWL 4IM8A 5J12B 2PETA 2WBXA 5CUSL 5IF0B 2F53A 3FMGL 4G70B 4WNQB 3SY0B 1CTOA 1J8SA 4AQ8C 2PXYA 1YEIH 2CBPA 1MCKA 3ATAA 5EZJA 1TJHH 3MA7B 3SDXE 2BZCA 3U7WH 5F9WB 4QHMB 4YE4L 1H9VA 3FXIC 4NKMB 5BCAA 1R47A 3QORB 3QUXC 3VQMA 5C0DB 2CD0A 4QRQA 1XF2A 4LLQA 3QIUD 3EYUL 4I77H 4KKCD 4TNVF 1AMYA 3V9FA 2I9TA 1RPUA 2YMXH 3JVGC 3RWDA 5C0JA 3HNSH 3L5WB 1IKNC 5I15H 3V0FA 2HJFB 3EH5B 4KX9A 1GPOH 1SQMA 4LDCA 4MDIB 3DVGA 1RUML 2NLJA 2A5UA 3ZTNH 3MRJA 1P7QA 4XVTH 5C0RH 2H3NA 2G3ZA 3S8GB 3CLEH 2J8OA 2VDQB 5TQ0L 3TFKD 1KCWA 4U2ZA 1H8NA 5CIPB 4PREB 5SWZA 3DGGA 2V7NA 3O41A 5EO1B 3RVWC 3S34L 3TBSA 1NCGA 5IHUL 4LSTH 5I9QC 2VR3A 1O5PA 1MCCA 1AMXA 4M7KL 1SJMA 5D1QA 4XB8A 5ITFB 1RP8A 4HUKB 5EFIB 1OGAB 3MACH 3PE9A 3T0BA 3L3GB 3LQZA 2PYEE 3SYQA 4PRIE 2EIKB 2APVA 3IEAA 4RRPA 5TFSH 4PLJD 5IROA 1T22A 2BCKA 3LKQA 4JDEB 2WJ7A 1TJIH 4J3VA 2IAMB 3E38A 3A6BL 1K72A 3G04B 1RJLA 4V1DE 4XTRC 5BV7C 3QDGA 5CILH 4KDVA 5KYNA 1MZYA 1WP6A 4MJJA 3VH8G 2DICA 1XF4B 4S1DD 2YD2A 1JZFA 4TQEL 5KSUB 1NZRA 5B7MA 1BAFL 1N26A 5TTRA 1NAML 4I88A 4UWQB 5HYSB 4HIHA 3VWJC 1GIGH 1HHGB 3JQOB 4X6CE 2DDQH 3T8XB 4F58L 4OGXL 1AHWC 3WV0A 4KKLC 4CL7A 5KVDE 2FH6A 1H3UA 1WT5C 3FF7A 4HKBA 3KR3L 4PJIA 3HS0B 4DAGH 3DX0A 1WBZA 5C0BE 3BDYH 4P4KC 3NK3A 3WS3A 3OL2A 4M3JA 2CO7A 2H1XA 1QWNA 2HX9A 3UEZA 5B3NA 1P5UA 5C08A 3ILQD 1MH5B 4XRCB 4KKNA 4PJHB 4MJ6A 4PJFF 4B60A 3CFDB 5DMYA 4K73A 3GJFB 4DCQA 3UMTA 3L3HA 4YDZA 4EIBA 4CDHA 2D73A 1RIVL 2BHZA 3UTPE 4RH4A 3WSQH 4LNRA 2APTA 1HOEA 3P4MA 1EAPA 3GRGA 2CHXA 5ACZB 1OSZB 2XQBH 1FSKB 3MBED 1XB6A 3EJPA 4HCRL 2NY7L 1TCMA 1EMTL 3CSYA 1EANA 1URIA 4XNZC 2ZG3A 1F4XH 4HT1L 4QRPD 2VAAA 4UTAL 1NAMA 3KBHE 3UIZA 3V0DA 1QSEE 4FFVD 5DU7A 2ESVE 1FCCA 1SFHA 4YSUA 1Y1DA 3FRPG 4PBXA 5TE7L 4F15C 4AG4L 2IH1B 2J8HA 4PMFA 4Y1AE 4NRYB 4OGYL 2XA3A 2CHWA 1DL7H 3M1BB 3RU8H 4P5MB 3KWUA 1Z9OA 1QI5A 1PIGA 5AVWB 5AENA 2MCAA 1EZVX 2FH8A 2VB5A 2EXWC 2R7EB 2ZOOA 5A3IC 3VXRE 2FYYB 4JRWA 2CKBL 1N59A 4JKPL 1OCCB 4FP8H 5D4QA 2ZWNA 4OFYA 3CFUA 5EOQL 3PABB 3F6LA 5GS0C 3D08A 4I1RA 2BNQB 2Y7QB 4N5UA 2HH0H 4NPKA 3L3OA 3FU0A 4FNRA 3FBQA 4YGAB 3DYMA 4Z95H 5EPMA 2HT3D 4Z77B 2E75C 3I84A 4KJPC 3C6SB 2H2SD 3BPOC 4G8IB 5CP7B 2QGDA 3L3DB 4F33B 3U0TA 3VGBA 1XD1A 1THAA 3RHWF 4OIFA 1FNGA 4OIAA 2GK2A 5CN3A 5T5FH 3QULA 1N64L 4HCRA 3BVXA 3U4EA 2VQ1A 1YSOA 1PNDA 3CXHK 1S7SA 4YHIA 2OI9B 4GI8A 4J6RH 4UTAA 1ZAGA 4UT7L 2EDLA 3QRLA 4KRMB 3DJRA 3EGXA 1U3HC 4WWKA 4ZXBD 2NXZC 4G6AC 3T0EC 4EAEA 1CO1A 4WI7A 3UTSB 1OF0A 3QG7L 3LCYA 2W65B 3GO1H 2ZCHL 2PWEA 3IDXL 1JGVL 3A24A 2Z91A 4LFHG 1OTSC 2BSSA 3TV3L 5AAMC 3TGXA 4KI5C 2VDOL 4DESA 4PGCA 5EZIH 4Y4FC 4IYKA 3V6ZA 3VW3H 2CKBA 4YSAA 3QB7C 1QFWH 2VDNL 4N1HB 1IGML 3SODB 4Q58C 1S7WB 3D9AH 4Z5RB 5A2BA 4PJ8B 2CJUL 4HEMA 2Y6SC 3NPSC 2QV2A 1MNUH 5CD3B 2WLYA 3SDXF 1G9NH 3GK8H 4MNQA 5BRZE 5HGAB 1KCBA 5JDSB 1D6EA 2XZQL 1UVQA 3KPQA 1KMGA 3SKOA 2D7TH 2YO3A 3X2QB 3OKMB 3DLQR 3L4UA 5DC9B 1L0YA 5H35A 5JR1L 3HS8A 1YPZF 3CSTA 1MWAH 2RALA 3N85H 3O8XC 1JRHI 4XC3L 2ADJA 1JHLH 2FIRT 3RL2B 4M8QB 4NQDD 1D7BA 1MCQA 1CPUA 2VL5A 1AR1C 1JV2B 4QRUA 4BGDA 2NSQA 1SQ2N 4WNSA 4LEXL 4KH2A 4G43B 4AW4A 2P80D 3OQRA 3BX7C 5FO2A 3QCUL 2ZTBA 5EBGA 1KGCD 2ZXQA 3O3AB 4I9XA 1GA2A 5D7JD 3SE4A 2AJUH 3LN4B 1A1NB 1T03L 4X6EB 1NOFA 3MOBH 3Q8CA 2WCGA 1FVEA 1ZT1A 1U21A 4NHUB 1ZV2A 4JM2D 4YC2C 3SKMA 1JZ2A 1RI8A 1FAIL 1DSWA 3TH4T 3IDJB 1F1AA 1MLCB 2W81C 1CFBA 3ETBF 5BZZA 2YD0A 2RCSH 4UIMB 2JCCA 3BSZH 1A6ZA 3DSFH 3MUJA 5HGGS 5IVOA 5JW4R 4YUEL 4MA1B 2P8PA 5IV2B 4J3OH 1MF2L 1AG0A 3T65A 5HSFA 5I16A 1IGJA 4FQXC 5L9DH 1G84A 5D2LA 4WKZB 3ZT6A 1QMUA 3AZUA 3NH7L 4WHYH 5LLIC 2HFTA 4EVNB 3IRZA 3IN0A 2X88A 3ARGB 5ACMA 4X6CF 3CZFA 1R5IB 3FN3A 2W0KA 3CZLA 1PQZB 4UQ2B 3ARFB 2GJ6B 2VR5A 4DGVL 3ZDWA 3EJTA 2Q6WA 2J4WH 4GAFB 4DUVA 3ZHLA 2XICA 4OUUA 1MFCL 2IWEA 1A9VA 1SHSA 4ONOA 1S9VA 3MLZL 3ZRFC 1NFDB 1T0NB 3QFDA 3DRQA 3L5XL 4OUOA 1U91A 2HSIA 5BOZG 1AZVA 2BVOA 2YN3A 1CXFA 3FOMA 5SWSD 2VDML 3EO1B 4P46B 1YYMH 4HUMB 4LSDA 1YNLH 4M1DL 3WIIH 2YJQA 2VDQH 1KYFA 5KBNC 2HN7A 3FQYA 12E8H 3LHPH 3NRQA 1WFJA 3OKLA 4XOBA 5IMMB 5D4HA 1Z0NA 1KTJA 1J05B 2YIHA 4W68A 3DETD 3CK0L 3CH8A 2APBA 5KANI 2XG5A 2CG9X 1Z3RA 4G7VL 3BEWB 3JWOL 2A1WL 2AQ1A 5LNEA 3ULVL 4M3KB 4XBMA 1LK3H 1BIIA 3JYCA 1IILE 4GQ9H 3SCMD 1XEDA 4YZWA 2E3VA 1JXKA 2IAND 2OX5A 1IT9L 1NGYA 3L3JA 3MRFB 4U1KB 5KYUA 3V79C 5K39A 2V33A 4LCCB 5JW3H 3M6DA 1I1RA 1Z5LB 1MRFL 2L3BA 4WW2A 2EKJA 2X9WA 2DM2A 2B1HH 2YUZA 2KLRA 3ZU8A 3PFUA 2IADB 4I7ZC 1LNUA 2GBVA 4OV6F 4UB0H 4DP8X 1W91A 4A2GA 5G4NA 5BJTA 2D4FA 3ECVA 3NCCB 5BZDB 2FX7H 3WJJC 4BRJA 3MYZA 4DHLA 4N8CL 3GNMH 3IFPB 2VZSA 1BZDA 2C1PA 2DF3A 1JGDA 1BD2B 1NLDL 2ZPKH 2WVSA 4IKJA 5GZNA 3ZHKA 3S3PA 1E28A 5GS3A 2BP3A 3MN8A 5C9KA 5F89B 3I9GL 5C0IB 5ACLA 2MFNA 3DJZA 1CDUA 4YHOH 4N0YL 4TQ8A 1UURA 4WK0B 1L0XA 1TDQA 2WOBA 2QV4A 4H1LB 1AQKL 1I85A 2P46B 3KGUA 1MJJA 4FEIA 3RUGE 5DD1H 3KHQA 5BXFB 2G2PA 5E4OA 1FZJB 1DQTA 5FF6B 2F8XC 3VFTB 4NBZB 2HKHH 3GJFH 2DBLH 1XF5B 3MV7E 4JO4L 1AXIB 1DVFB 4GP4B 5IBUB 1CGUA 1P6WA 5EWIH 4YHPA 3TT1H 1MCJA 3NMEA 1LTXA 4YHYC 4OZGE 1E27A 3BFWA 2WWKT 4UILH 5GIRA 1E30A 4KTDH 1LO3L 4KX8A 4ZOAA 5JQIB 4JDZB 4Q2ZA 3BKJH 3K81A 1PD1A 1HZHH 1YJDH 3FO1B 3HZMA 2R69L 2K4AA 4JY6A 5MENA 1G7JB 1UUNA 1FVCA 2W92A 4YDJB 1IGYA 4NENB 1LE5A 3D05A 2YUXA 2A77L 1B90A 4J8QA 1RJCA 4U49A 5HGDB 4N0CD 4DPRA 4FQIH 1PYWB 2VLJB 4G5ZH 1JWMB 5HHMB 2FT7A 4L4TD 2XWTB 4LKCA 4Y16B 3VB8A 4GXVH 5ICZB 4MD5A 4HIIB 1BECA 1QHOA 3QNZA 5JMOC 1GC1C 4MS8C 5FWRA 1MCRA 1Q9LA 1BQLL 3KWVA 1KB9J 3UC0H 4BZ2L 1C7TA 1A6UH 2Y69B 1BG1A 5J9PB 3B3IB 3POHA 4J5VA 4LCWA 5IT2L 2VAJA 1YRKA 2X1QA 5FECA 2OMUB 1KB5L 2A38A 3GKWH 2ZCLH 3WIAA 1IC5L 5E1AB 4BH7B 1DFBH 5FHBL 3RZWA 3QZNA 4G9FE 3D3VD 3Q1SL 4QTFA 3AREB 3VA2C 1DO6A 4EI5C 5EN2B 1NGXA 4IIQB 1E9OB 1GGBH 4KOBA 1CQKA 1IKFH 4EDWH 4JZOB 1ZHLB 2DM4A 5BV7B 3CDGB 5LNGA 2R69A 3AXHA 1O6VA 3PDOA 3LEYH 2Y0SA 3RJOA 3M17B 3L4YA 3WI9A 3N44F 4MASA 4FYQA 3B9KB 4U3CA 4UDTB 4G8GA 4TLKA 1TU2B 3VWJB 3B3BA 3MCLH 2CJ3A 1V8HA 4FQHB 3GDBA 4YQXH 5HVGB 4QWWD 5ADOL 5K93A 4HWNA 4KK6C 1KGJA 4OJAA 3FQUB 1H3GA 3L17A 5DDHA 5AG8A 1TTCA 5GRZA 1BX2B 1PZCA 4S1SH 1HJBC 4A37A 3L1EA 4TNWK 1EXUB 4Q6YA 2YKLH 4ZMNA 1WZ1H 1Z66A 3E9UA 3LPWA 3TP4A 4PV8B 1PFOA 2CUMA 1E2ZA 2E8YA 2F58H 2B0SL 3HPJB 3P9MB 4HAKA 3OR6A 3VFNA 3D69A 2FBJL 2NY5C 1DJZA 5DEGA 3EDDA 4WV1A 2WXNA 1KB5A 3MAWA 3D51A 1A4AA 4TS6A 2CAKA 2B59A 4XBGB 1OAUL 4YSPA 5JHLH 5D1XA 3LD8C 1M2VA 1P53A 2F6AA 2FX9H 4LLVA 4FZ8L 2X3BA 4JMXA 5DJZA 4YSEA 2XVBA 4PJAE 4XN1A 3KZ8A 2VRKA 2I24N 3P9LB 1PDKB 3RWJA 4FULA 5KSBA 4XPBL 5CZRA 3TA3C 2EE0A 4ETYA 1CGWA 1D2OA 4JFOB 3BEVB 4XNZB 1EBPA 4Y5XB 2X6MA 4BFNA 2PTUA 4HGWA 8FABA 3TTSA 1JGLH 1L7TH 3PWPB 2R4RL 1A9BA 4R26L 4HIXL 4F15B 1KCUL 3P3RA 1CD1B 4FQQB 1E5YA 1XGPB 3MLUL 2V5YA 3FQ1A 4DW2L 5L2JB 1VEMA 4LPTA 4H2AA 5EOCJ 3SE8H 5ITBH 2JJTA 4BCYA 2OMVA 2CQVA 4XODA 2AJ3B 4LO9A 3IETA 4P59L 1JV5B 3SO3B 1OAYL 3B1TA 4KJQC 4J23A 1VAHA 5GGQH 4W9FC 1YDPA 5D71H 4NP9A 2VRQA 2FVNA 4I0PC 4UOJA 3VRLE 5I73C 4HOMA 4LPYA 5E6ZA 2R0LH 3OJDA 4PJ7B 3U9UA 1I82A 4MXVE 1HL9A 3FFCE 5BVPH 1DN2A 3BPOB 1T21B 1J1XH 3MNZB 5HDWA 4YSQA 3WE6A 3NEEA 3TH2T 3T4YB 3AG4B 1IAIM 3CXHJ 4JG0L 4W9EC 3VD2A 4XAWH 4D7BA 1T7ZA 4AVKA 3VFVA 4K23L 2PN5A 1TZIB 2X4RA 3WUWA 1YEDA 1KIPA 4W70A 3QK0A 5CEXB 2IVFC 5AYUH 4XP9L 4ZDHB 4CW1B 4V33A 3SE6A 5IQ7H 1HSBB 2FEJA 3DSNA 5FOJA 3EYFA 5JPMC 3IDIB 1HCZA 2F61A 1J48A 1U3HB 4NQCB 1PLAA 4JPIA 1J9SA 1YYCA 3BFOA 3T0EB 4YX2L 5DJ8B 1CI5A 3R1GH 2IGTA 1KEMH 4LKXB 3PXHA 1XGTB 3FUJA 1UQSB 4LOUC 1ZE3C 4KV5F 4X7EC 3WTSA 4HKXA 1R17A 2DJSA 2WYIA 1HZKA 1G6RH 4HLEA 4NWUH 1EFXA 2GTWA 1S9YB 1T2QH 3FJTA 3HVNA 3T4AC 3W9DB 4XO9A 2TSBA 2PP8A 1O9WA 3SO5A 3GBLA 3K2KA 3KYKH 2O61B 3ARZA 4CU7A 4BK5C 3MXVL 1XR8B 1Y18A 3BO8A 1GR7A 3HG3A 1R3IL 2BNUB 2BX5A 4ODTH 1NGZA 4X8JA 1PAMA 4XH2A 5EU3B 3GS4A 1KUMA 2FWLB 1KFAH 5F71A 2NR6D 3GPSA 3NP4A 3U4AA 5JW5A 3QJQB 4ELMA 3WEMA 2LHAA 2WUCH 4RBPH 2I07B 1UM5H 2JSFA 3V4VL 3ZYOA 1CE6B 3BH4A 3CZUB 2XVGA 5IW3A 1MAMH 3X13A 2OYMA 4TOYH 1QLFB 3ZE0F 3BE1H 4RVBA 2FQGA 5L4JA 2DD8H 3AB0B 3AVEA 1T1YA 2R1WA 1U8JB 4KQ4L 4AL8C 5I18L 4D94A 5BS0A 3WN5A 2E7DA 2WBJC 5GS2H 1CGSL 1YNTB 3EJSA 2DJMA 3K8KA 4NQTA 4YC2B 5I8KH 1NGQH 4MJIA 3OJVC 1UXWB 3KPLB 1NBVL 2OL3A 4JFEE 2OMZB 1WBYB 2YSTA 2ZSVA 2P5ED 1MFBL 1UD5A 2GQHA 2A9AA 4OD3H 4PP1C 1XDTT 1SLVA 3LH2H 4O4YH 4DGWC 3V95A 5KAQF 3ULAB 5EV7A 4FQXB 1KGIA 2CGRL 2YEZB 3PV6B 2WQUA 2ZJSH 4BQCA 3SZ6A 5KG9A 1WPCA 1QLRB 4ORGB 4OT1L 1SRDA 1ND0B 4ZJ9A 1FF5A 3QXUA 4YDNA 3KAAA 1KYOK 3PV7A 3WO3B 5I17B 3LEXA 4D0DB 3NFSH 1RUQH 5IVXB 2ZNXA 3SJVA 4IBWA 1EEYB 1K8DB 3EG9A 3JV0A 4K7FB 2IDFA 4ZX4A 3KMDA 4Z7QE 5IR1B 3QAZC 2DOCA 5HXMA 2DIJA 2WLKA 4Z7VB 1URZA 2VXVH 4Z7UA 3TA4D 4F7EA 3STLA 2CDGA 1P5UC 4MBOA 1A02N 4FHKA 5EH1A 2H9GA 5TE4H 1CGVA 4BQBA 2P43B 4OBSA 1XF1A 4BH8B 5I1JH 5I0VA 2BS9A 3TF7C 1ZVNA 3F01A 3GLAA 5E2VH 1NFAA 2IGLA 5SWQA 4NUGL 4ODBD 4EIUA 4IGBA 4J3OF 1MJ7L 2RFXB 1TYEB 4PJAF 5HYQA 2WTRA 1EIBA 4UINL 3U2SA 4GFTB 4M5YH 5D5MB 2C3WA 3GMPA 5DHYB 5D1ZD 5KS9A 1LWHA 1PLGL 1A7BA 2ICEB 4A6YH 5IY5B 2AFNA 1UB5B 3U7YH 5D70H 1MIML 4J3BA 3D7PA 5CKGA 3VXQA 2OQJA 4PB0L 1MAKA 1OF2A 3OKOA 4JB9H 5GJTL 1WVZA 2BSDA 3LPPA 5BV7H 1Q90A 2B20A 4X4MA 5C2UB 1JWUA 4ZS6D 5ALCL 3TX4A 1OGTB 4D7PA 3O9WD 1PMYA 1KNOB 1SYSA 3KPOA 4MBRA 4OD1H 4XWOD 3RZCA 4L8CA 4B3VA 5EF1A 3L2MA 4AVIA 3UACA 1JDDA 1KBGH 3BZEA 3M88A 3VI4B 5FCUH 1QBMH 1ZXQA 3DC0A 3TBWB 3QZLA 4NNYA 2ZX6A 3D4YA 3L3OC 2NDGA 4G7YH 4ZFOL 5CGBA 2A9DA 1U8OB 3P3YA 3PWNB 7CGTA 3VUAA 4D9QE 3VRLF 3LKSB 4JW3A 3SBRA 3PQYD 2MCPL 1UWEH 4MXVF 3SZKC 5DR5L 1VPOH 4B9CA 4ONHB 1AIFA 3KGSA 4XNMB 1ECYA 3HMWL 3KPTA 4FNSA 3G6DH 1LDPL 2K0RA 3VSTA 2DQCH 2K7PA 3QDJA 1BOGB 1J8HB 4UM9D 3Q06A 3AWGA 1IC4H 3LTVA 4C56D 3TBVA 1N68A 4TUKL 2XWJA 4J39A 4KRLB 1S8DB 2F74A 1BQHA 4Q89A 4X4KA 2XG4A 1FO0A 3UBHA 4WWKC 1NINA 2EO1A 4YHYB 3NG5A 1XCTA 3IRCA 1KV7A 1N8OE 2DQIH 4AQEB 3DI3B 4M6OL 3AY2A 3D85A 3IMUA 3UZVB 3DGDA 2FYVA 2JI1A 1AI1H 3QI9A 4Y5VB 5FPIA 3HAEG 1RZ7L 3MPCA 5H4YA 4EI0A 2AK4D 4FCAA 4UIKH 4GAYA 3F2LA 4HF5L 2R8SL 2EUZA 3S96A 3KLAA 3C2AH 1MPAH 1UACH 3ALWA 1VGEL 2ZXGA 1S7TB 4HJGB 3T3PE 4ZFOA 1A7QH 1WC7A 4YR6B 3N5AA 1AGFA 5E9DD 3T5WA 5MEPA 1IEHA 3D0VB 3I9IA 4FQJH 3DBSA 1S4IA 1TQCC 2QSCH 3B83A 1XIWD 3BWSA 4EZLA 1OGSA 2EIZA 1B0GA 4IJ3B 3VFOA 3QCTH 3MMEA 3GFUA 4ODVL 4Q6IB 2BNRB 3LZNA 3OF6D 1R5VA 1A4JA 3GSOB 3DTXB 4P2QA 3T3ME 1RZGA 3OKYA 5GS0H 2X6AA 3WHXA 1LXMA 1BVOA 2VUOA 4I5BA 4PLKD 3LB6D 1DVUA 5ANMB 2WVUA 2H5UA 1QFPA 4BFIB 4Y4KD 1OAXH 1AKJA 1U8HA 5HGHA 3RPIB 2Y6TE 2VQTA 3L7FB 2G5BB 2I27N 3GC3A 1TLKA 4KJWD 4LL4A 3CFJA 2JJVA 3HE7A 4OF6A 1X9RA 3GSWA 1I7RB 4OLWL 2HVKB 1A3LH 3A4DA 1JGEA 4QHUB 3OJMB 4AYMC 2BIIA 1BMZA 3SE4C 5AKRA 2BSTA 4N3TA 1CL7H 1MXGA 4HUWA 3RGHA 1LO4L 4MD4B 4N22A 4NWTL 1CZ8H 3MLXH 1WICA 3PWUB 5H2BA 3WD5L 4AQ1A 2BY3A 4PJXE 4PSRA 3IXTB 4WY7L 3UABA 4B9GA 1N67A 4TQIA 1CIUA 4ERSH 4WDIB 1GZQA 1TKWB 3OGOE 3OLDA 5D7IA 3IFNH 3EJQA 4OIIH 4QXGH 1T7VA 2F19L 2GSIB 4PRAB 4BZYA 3B2VH 1B9KA 3NRFA 1LEGB 1Q1PA 5IB3A 1HINL 1A1MB 3C5XA 4FTVB 3KCPA 4L1TA 3VXTB 4HC1H 4X5LA 3SPVB 2DQGH 1RZIB 4IBSA 1JIBA 3NRPA 5F7LB 3FO9A 4YXLH 2NXYB 4MS6A 5AVRB 1W0VA 5E8PB 2C7FA 3MNWA 5J1AB 3CGTA 5DJ2B 4YVNA 5J11B 1I8AA 2ED6A 1JSYA 2UXVA 4PY8I 5IJBC 2EYTA 1DQDL 3T2NH 5T3ZH 4WENB 1VFOA 3E3QC 4JCMA 1J8KA 2AI0L 2O5XL 4PY8J 3TIEA 4MNGA 3BAYA 5DEJA 3MNVA 3E0GA 2XXMB 4EE2A 2YGNA 4KUCD 3WFEH 5D55A 4OZHB 5CXPA 3UAJD 3LD8B 3OAUL 5ESAA 5EBMA 3LRSB 3KJ4C 1QBBA 2WXOA 1LILA 5AALA 2XC8A 3B2XA 3NIDE 2PCPA 2Y36L 3EO9L 1YO4A 5DJCA 3TA3B 4WGVB 4HQQH 4PR5A 4R5VA 4B9JA 2A4CA 5IW6A 5JA9A 3H9SE 4X7SL 4N8UA 2VIRB 4QJ3B 2ZXWB 5JMRA 4F24A 5GSVA 5IFAH 2W5PA 4YFDB 5L2KE 2CGZA 3HI1A 3GIVB 1KGWA 3RWCA 3BI9X 3TNNB 2ZWLT 1N0LA 4MLIA 4JFQB 5B39A 4P2RB 2ZWZA 2RBLA 2DQHH 2GSMB 3VGFA 2ADIA 5E03A 1DP0A 1YMHB 5ID0A 3C60D 5CBEB 4XMLH 1L7IH 1HOCB 3GS0A 4AJVA 1QSFB 4JR9L 5HI4D 1ZIBA 5HDLA 4WW2C 3QZWG 3KGTA 2Y25A 5AZEH 3IU3B 1M7IB 1RZFL 4P9MH 2CU9A 3Q6FB 4KKBD 4Z7AA 3UGUA 4G7QB 1I8LA 2FIKB 3QPXH 1DYZA 4I0PB 1FYTD 3MBXH 1RH8A 1XEUA 3S4SB 2IG2H 4I48B 4PJ5A 2EH7L 4JFUA 4WU7A 3UPRA 1JPSH 1PZ5B 5C07A 1RUKH 3KEHA 5HBBA 2R2BB 1MFDH 3C08L 2E56A 4N2DA 2JLLA 4FADA 2CWRA 1JK8A 1P4BL 1X5JA 2Z4QA 1A4KB 3MLYH 1CFMA 4F2ME 2A74A 3NDYE 4P4RB 5GZNC 3FB6B 2LAAA 1QI4A 5DT1L 5E08L 2NY0C 1P2CB 1FFOB 1H6EA 1UZGA 1QUNB 3ZKMD 5DVMA 1I1CA 1H19A 3U25A 5E2WH 4L18A 3PPSA 1M1XB 2NQCA 3PIQB 4NJAH 3KPRE 1CWVA 5JPMB 3Q2NA 1FL3A 1LD9B 2ZWKA 1R3KA 1CTMA 3E8UL 3JWOC 1DJXA 3LH9A 3VD7A 4JCWA 1P7BA 4WFED 2YPVL 4AT6B 1QD0A 3K4DA 1HKFA 2HTKC 1UJ3A 1H3WM 1USZA 3C6LA 4OCLC 2VLKD 3L95B 4M9OA 4G3YH 4NI6A 1ORQB 4JBSA 4YXKL 5DK2A 4BJLA 2Y1YA 2F7OA 4JQIH 3NA4A 4X42A 2PPFA 5I23A 3HHRB 1E5UI 3EH2A 3MX0A 1XCQA 2AKRB 1HWHB 3EYSH 4EI6A 5KSVB 3T4AB 2P5WE 4WEBH 1V7MH 2ZUQB 3JWNC 4PHZA 4QRQB 1XF2B 4L4VE 1NCUA 4JFFE 1LMKA 1AP2A 2YBRA 4PN6A 3GXFA 5E4AA 4YHNB 2Z93A 1YUHA 5D72H 1V55B 2I9TB 4OJFH 1L9QA 1G7LA 2AJSL 2WGXA 2GCYA 4XMZA 4B9ZA 5C0JB 2YJLA 4FLOA 2VZ1A 1SY6L 5E6IA 3T3PF 1NFDF 2ENJA 2AJZB 1UWGH 1R34A 1FNEB 3LKOB 3MRJB 2DAVA 4JY5H 2V5RA 4PBVC 3U0WH 2H3NB 4PJBE 3ILEA 3W56A 2QVKA 1QR1A 1V5JA 2CMRH 3ZHNA 1QWHA 3CVHH 5D93C 1BOYA 2BP0A 2KUTA 2X4NB 4IBQA 1GVIA 4PJGB 3CFBA 5SWZB 3W0WD 1EAJA 2BFVL 2V7NB 5EO9A 3MJ9L 2JMRA 2J6EH 2YPLE 2EDOA 5FM4A 4E5XA 4NYLB 3K1DA 3LOWA 4NQED 5GRUL 5DI8A 3MLWH 3QUGA 3IMWA 2QQLL 4HS6A 2XN9D 4OR1A 1YECH 2WBJB 2IGFH 1DJGA 5IFJA 4AGOA 2OFQA 3VI3A 1Q0YH 3ARBA 4LQFL 2Y7NA 4MJ5A 4U1LA 2C9SA 4L3EE 4KNTA 5C09D 1FGNH 1HHHB 1DLFL 1RJLB 1XGRB 2ALWA 3K6IA 4KVCL 3WFZA 5LG6A 1I7UA 2J1XA 4IBTA 1SEBA 2EVJA 3VCLA 4NHCL 4X7TA 4DWHA 3V0WH 4PJXF 2QFRA 4MAYB 2UWEE 4KK8D 3AW5A 4APXA 5ISZE 4N8VB 5I8EB 4KAQH 3VXUD 3IJ8A 3V52L 2BW5A 1KYOJ 2YHGA 4LVNB 4XPFH 3U7AA 4QHLA 2A4ZA 4RZKA 4RIRA 1SY6A 3UIYA 3VXOB 1QTYT 4TNVK 1INDL 3L54A 1UCBH 2EDKA 1OL0A 3FU7A 1KXHA 4E41E 3P54A 4QYOA 2APSA 4HBQA 4XZ4A 4BBWA 1K4CA 5FYKD 5KBMA 4Y9GA 2FATH 4S2SB 4XOCA 2K9UA 3SDAD 3OZLA 4D9RD 5F6IB 2CO7B 3QAZB 4JN1H 4A2DA 3GXMA 1OAZH 2CXKA 5AL8A 4AZ8B 3HFML 1OTTC 1XSJA 3MJ9A 1U8KB 4NKIL 4EUPB 5J4MA 2Z9TA 3QEHB 3MI6A 4HIEB 5DVKA 2Y1ZA 4M8RA 4WV1C 4WKXA 1KFGA 3G5WA 2LOEA 4I9WD 3DRTA 4LSRL 3QISA 5E5MA 2OKMA 1GHFH 3RTQA 3AM8A 3GHPA 3L3HB 5LB1A 1GGUA 1HHJB 5D1XC 5D7LA 1CFSB 1GC1H 2XA8L 1IGIH 1MI5E 3ISYA 3PRZA 5CEZE 3U4BH 3KXFB 2WUBL 2J88H 3GI8L 1FRGH 5KJRL 3R06A 5BMFH 3MFFA 4KI5E 2B1AL 4LCYA 4WUUB 1KLGB 4TTDC 1RQ5A 4Q0XL 5DWUL 1ZSDB 4OY9A 1JG9A 5EU6A 3GMQA 2YQ3A 3WFBL 1Z5HA 3NIDF 3US9A 2OZ4H 4XXCC 1I3UA 5IOKA 3FTXA 1XH0A 3DUSA 5FGRA 1BVNT 1OE2A 3B2UD 4U6VH 5T3ZE 3TJHC 4ODSL 1HYSD 4LCIL 4X4YA 3GMRA 2ZOKB 1A6AA 3V6OC 4FG2A 5HDQH 2VZTA 3WEXA 4XCFL 1RZJL 5FO9A 4ZAKD 4KNUA 5KVFL 2YSSA 3EFDH 1MHEA 2QVTA 3CMOH 2XFXB 2R0KL 2WP3O 1V7NL 4I1NB 1XH3A 1VSCA 3OZKA 5EEWA 2G2RA 1I8IB 3QDMB 1MHCA 4GMSL 3BKCH 4YHML 2J7LA 1KJ2H 2BY0A 4YWGL 2B2XL 5TPWH 4MXQC 5JHDB 4LXFA 2G2NA 4PSPA 4R2GC 4TULH 1RERA 4UZGA 4DEPC 4F8PA 4MQTB 4IRZL 3UP6A 4ETQA 3B6SB 4HJJL 4UOZA 4A7GF 3CUPA 4FG4A 1TCRA 5B22A 5C7XH 2MNWA 4LSUH 3O2VH 2Z92B 2WXMA 4POZD 4M29A 3T2PA 1PX8A 3F7VA 5HDOA 1HIML 3HI5L 2XY2A 4H20H 5C92A 1A22B 4N6QA 5CMAA 5FKAA 5AW3B 1ZA6B 4Z3FA 3FT4B 5CBAA 3QR2A 3EGXB 2WQ8A 2NY1D 1L0QA 4TLTA 3EXJA 4Z3HA 1YQVH 4K5LA 2VABB 2NZ1A 3NK4A 4K3GA 3H1ZA 4ZFGH 3ESMA 2BRRH 4MB5A 4Q52A 5E8OA 4Y8DC 2JIXA 4YDKH 5IM7A 1WO2A 1X5IA 1NMBL 2X9YA 2V3FA 3X14A 4ZOCA 4XO4A 2FD6H 5D1ZI 3DHMA 4KY1L 1MW0A 1KTRL 4PM1A 3QC6X 1QA9A 2OS7A 2TRYA 3BIKA 3L5JA 1YAIA 3L08A 2MQCA 5FR3A 1E4XL 4CC0A 2XXCB 2HRHA 3C8KA 3CZGA 4Y7MA 5EORL 1A3RL 4JKWA 3VFMA 2VXTH 4Y5YA 3WMQA 2VZUA 1TZHB 2O93L 4JFYA 5E56A 2GB2A 4IRZA 4Y2DA 2DW5A 2FJUB 2TRHA 1TQCB 2G30A 4MA3A 3NBNA 3KPQB 4JG1H 1N5AA 4FFWD 2ERJB 4E9XA 4XE0A 3ASNB 4U6YB 1DQQB 1L9TA 3CX2A 3HG1E 1E9QA 4K9EL 2WLMA 4MA8L 3QH3A 3CIAA 4KKAC 4YFLI 3GEFA 1IVTA 5EUOE 2RR3A 3MV9A 2C3GA 4K94C 2GTZB 2KDYA 1JDCA 1ZHBB 3ME0A 3ZUCA 4DK5A 1A6WL 4RGOL 1DBAL 2QBWA 1DJWA 5AG9A 1GYCA 2XCMC 1U2YA 2WZ0A 2X53A 4WFHD 1IGFL 5HTSA 1BCIA 1INEL 2JLPA 5LXVA 2J21A 4FTDA 2F5BH 3WN5C 4E9WA 4OQTA 4I87A 2X70A 2XPGA 2CCVA 2PCFA 4OLUH 1ZLSL 5CJQL 2YOAA 5T3XH 1IKOP 3B1UA 1X5XA 1R33A 2FGWH 1TSRA 1QRNE 3TWCH 1J1OL 4O2EA 3ZKSD 1MEXH 5EULV 5DS8A 4QOKB 4RGNB 4GYBA 4TPRH 5A2AA 3SEPA 3ZMNA 2VERN 1IGJB 1VADA 4K5PA 1T1WA 3CPLA 3IMSA 5IB5A 1I1FB 1XZWA 1ZE3H 2UWEF 3ECUA 1NJ9A 2X09A 4HUXB 5CJXC 3ZOAA 1BBDL 1QNZH 1GAFL 4MA7H 3VGGA 3CZFB 5HYJD 4XX1E 2N0KA 3IJSA 3LN5A 5IKCA 2EP6A 4AX3A 3DXAB 3GMLA 4IOIA 3ZTJH 4M1CD 5E2TL 3W39A 1S9VB 1FL6B 2WCSA 5CJ8A 5I76B 1S9WB 3ESVF 3JYBA 5KVEE 3QJHB 3LNIA 4YO0A 4KQ3L 4DP1X 4BEIA 2NX5A 4JFDD 3PL6D 2Y7SA 1U8MB 1S78D 2BVOB 3AS0A 1FG9C 1BMGA 2FJGB 1MHPH 2HFFB 2NUPB 2ESVD 4L1DA 4UMGA 5DK3A 5IMOA 4HISA 1TIUA 4NZRH 3NZHL 3JTTA 5KTEL 3LHAA 4WTZG 5SX5H 1FFTB 4KPHL 4IGBC 5JOFB 4G7SB 2AQ2A 4PJDE 1GY2A 3LRLA 3APCA 3SKJL 5D9SB 3AU1A 3AUWB 1AG6A 5HI3C 5JQHC 3FHEA 1QTSA 1ID5I 2C9PA 2QHRH 3HMXL 4KI5F 2XTSA 3ATDA 4IHOA 3S2CA 1J5CA 2F0CA 2X89D 2IWFA 4LEOA 3N0AA 3K7UA 5K33A 3V4UL 3WGUB 3F7PC 4AL8H 5IIEB 2G4GA 3O2WL 43CAB 5LBGA 3HEIB 5FK9A 4NQXA 3D2UA 1OHZA 4L9LB 2LVCA 3PHOB 4FQPA 4L3CB 5IUCA 1HN1A 1AZRA 2QKIA 2H41A 4F1ZA 3FRUA 1NC4B 2OJEA 4K3JL 4NZ8A 4MB3A 4O51A 2JQAA 2E7LA 4NT6A 3UX9B 3ALXA 3RZCC 1LNUB 3HIZA 1DBBL 3N40F 4J3SA 3EYUH 4ZPVA 2VMEA 5ILTL 3VWKD 1CXKA 3P4OA 3BQUD 3MRGA 1CFVL 2BIQA 1JAEA 4RMWA 2EDMA 3O3DA 4H40A 3GBNL 1LO0L 2KZKA 3AQYA 4X7DC 3GXTA 2NY0B 5EOCL 3WY2A 1I8MB 1ACYL 1BM7A 2IPKB 3QFJE 1KJMA 1KXTA 1J9QA 3S34H 5I26A 3NJVA 5IHUH 1YNTF 2FUQA 4M7KH 1MJJB 4P9HC 4HEPA 4RMVA 4P23A 4KH9A 4KHTL 3K80A 3DTUB 5KYYA 3QIUA 3S3BB 4O5LH 5HHNA 1U0QA 2VM4A 1WGVA 1CR9L 5E6RB 3DV6A 4LRNH 1WISA 4HZLA 3QQDB 2UX7A 4E42B 3PNWB 5MEQA 3B7YA 4HHGA 5IEHB 2YR3A 3T8MA 1A64A 5IBTL 3JV4B 1SXBA 1DO5A 3OAZK 5C97A 5EBLB 1E6OL 4TQEH 1DQLH 5FFOA 5AWNH 4ABWA 5BZXA 4M4RA 1BAFH 1UM4H 1H6TA 3WJLA 4Z7NE 1TEYA 1NAMH 3MRIB 4JPVL 3US1A 1FVCB 3NSDA 3EAKA 4PJCE 1IGYB 3D12B 1N8ZA 3WDJA 3CFCL 3TCXA 4F58H 1UB6A 2CHZA 3I50H 4JFHD 4OGXH 1Q9KA 1B0RA 4ZD3L 5KAQG 4MD0B 1IM3D 3HBPA 1M56B 1KACB 2WVVA 3EBGA 4Z7VF 3KR3H 3EJYD 3FB7A 3VXNB 1U3NA 3TZVD 4WU5A 2Y2YA 5IESH 1B4LA 1IAOA 4P8QA 1E0OB 3I6LE 2DM3A 3AMLA 3BVNB 3QUYD 2VDPL 5H8DA 4HZ1A 2G60H 4Z7OB 2Y72A 5D93B 1ASPA 1JXGA 5KSAD 3SBPA 1SF3A 3N06B 3EBAA 2LGNA 4R96A 4PRHD 5DFVC 3RTLA 4PJEA 1KTCA 4PUBL 4NZTL 1BVKA 1EJOH 2FK9A 3VDBA 3HE7C 1XR9A 4RFEB 5PCYA 4E9QA 1A5FH 1AXSA 3CFMA 3UTQA 1UXMA 3MRDB 1H15B 1D5ZA 2DMCA 1NGXB 3KYAA 1MRCL 2F5AH 1NCBL 4J3OG 5AZ2L 3MUGB 3QQ4A 1AE6L 2RTTA 4OV5A 3BPNC 5D2NA 4HT1H 2MPVA 2X2YA 3APDA 1RK0A 1A2YA 4WHYG 3RX8A 4P2CG 2W88A 3PGCA 3QUMA 5EZPA 1EFQA 5A16B 3T6WA 3WKMH 3NCJL 5ALBL 1IAKA 4AG4H 3NEXA 1WV7T 3ALPA 3ULUE 1FFPA 4OGYH 4WO4D 5DUJA 1E3FA 1RMFL 2HFEB 2YAQA 1D5IL 4HS8L 3VI4F 4FI7A 2CBOA 3R0NA 4PV9A 1SDAB 1F4WL 3F7YB 1M2OA 2GUOB 1WAAE 1DJSA 4G6ML 3V9EA 2CO6A 5LCVL 3PGDA 1IFRA 5ABAA 1HQ4B 3MBEA 3VSQA 5AVYB 1TFPA 2N59A 1Q0EA 3OSKA 5EOQH 5IQ9A 2WO3B 5EO0B 1TVHB 1WEJL 5IJVA 3CLFL 5DURB 3BH8A 3D06A 1BMWA 3QEQB 1KWKA 5DJDB 5T3XE 4QRPA 2OSLA 3BZDA 4NKOB 2EACA 1QEWB 1ZVHA 4HDIA 3SDYH 4P5KA 1FG2A 4HJ0D 4JQXA 3LIZL 4X80L 3B7TA 5CCJA 3D4GA 1TNMA 5DJZB 3ZDZB 4P3WA 3P3TA 2F08A 1MVUA 2F53E 4JRYB 3FUDA 4R6UA 2HLAB 1AGBB 5LN8A 5JOPE 3BGMA 1ZTMA 4TRPL 5CCHE 3B56A 3RWJB 5KSBB 2FLBT 1O0VA 4F7TB 2CK0H 4ZFQA 2ZKMX 5F88A 4X7CC 3BUYB 2V9RA 1ASOA 1WFUA 3F12B 5AYTA 2DWEB 2IPUG 1A9BB 2P9RA 3H3PL 2YBGA 3QG7H 5GGUA 4DZ8A 3ZT5A 4MVBC 3Q3GA 4QXTA 5CLXA 5C0CD 1C16A 1TTBA 3RVXC 5FUOH 1OSEA 4HIPA 1K2DA 3GSRB 3L9BA 4UQ9A 1DBML 4JANA 1BAWA 1JXJA 3LRMA 4NN5B 4P5TD 4PJ9D 3F5WB 1IGMH 3IS1X 3MRMB 4ABUA 2H2PD 3V8CA 1B88A 3ORJA 3MQIA 3VXRA 4FKEA 2B16A 4O9HL 4OF8A 3WMPA 1QTPA 1GY1A 2CUIA 3U9PL 2J3SA 4BIKA 4F8NA 5JLZB 5JTWA 4IBVA 1I8LC 4UV7L 1J5OL 1I31A 1GSKA 5D1QE 3U9UB 3C5JB 4L3FA 4XO8A 4ZFFB 4R2GB 2KQNA 3LIZA 3G6JA 5L4FA 4XCYB 3V6FA 5JR1H 3CC5B 5EIIA 5L6YL 2X4SA 3ZK0A 4R4NC 3RKDD 5FUZL 1CLVA 1PG7L 2A74C 3HN5A 4PY7A 3WNNA 4O02L 1PZSA 3AT0A 4XC3H 1ITCA 2DLFL 4UOW0 3SDDD 3UGXA 2VWEC 1A14L 4Q97A 1GJUA 1UM6H 5I8OH 3QDGE 2HJLA 1KTKE 3FT0A 4QIRA 1IVLA 1FVDA 4GLRH 3PS6A 4NB7A 5FO7B 3FRPB 3QCUH 1BIHA 3V0AC 2JKRM 2R0ZL 1W8OA 4QRRD 3NCYP 1T03H 1PKQE 3K6OA 2BSRA 3QIWD 2ARWA 1U93B 2FQDA 4XOEA 1UJ3C 3C6LC 1WHPA 3IGAB 1JGIA 2EICA 2YGPA 4PJIE 4RGMC 1E5CA 3QUKA 4LGPB 3LVEA 3H7LA 1NUNB 3IE4A 4OLYH 5FYJH 2H3KA 1HL4A 2E9IA 3AABA 3CPUA 2FNBA 5A2JH 3VVWA 1U92B 4NQDA 1N6QH 1ZPLA 4JHZA 5C08E 1QR4A 1RK1B 2KL6A 4WK2B 1QBLH 4FX5A 3GSNL 4W9CC 4KXBA 2P80A 5DO2C 1AOHA 2JI3A 2ODIA 3EJJX 3EJZC 4ONFL 2W60B 3LN9A 5D7JA 1JVKA 2C9XA 1KGUA 5BOPA 3GMMA 1QG3A 4HKZA 4ZOBA 3U36A 2CM5A 4Y2LA 2QTVA 3VFSA 4O02A 4DGVH 4Z8FH 1NGPL 4XH2B 4LHUA 4OZHF 4X8JB 4JM2A 2BOCB 1AY1L 2VMDA 1R3LB 1UYWL 3ESUF 3H4HA 5F1OB 1WHOA 4ZFZA 3Q8EA 3TVMD 3BAEH 4U7MA 3IE9A 1KENL 2B39A 2GJZA 3F04A 3MLZH 2Z8VC 2AXFA 2NY6C 1DEEA 1GKEA 4WGKA 3O4LD 5E4EC 1LE9A 1HWGB 1KJ3L 1U8PA 4GIAA 1AD9A 1OLLA 4R9HA 1DSYA 1AO7E 2V2WB 2WTOA 5BUPA 3CC1A 5L8JB 1BM3L 4ELKB 2OJZL 2R0WL 2VDMH 4UNVA 4BCXA 4P99A 4AH2A 1EX0A 2PLTA 4B0MM 1QPKA 4RA3A 4NO2A 5KBPA 1A9EA 3P73A 2QKSA 3S35L 1JF6A 3K71B 1MFNA 3CK0H 3P02A 3VD3A 3RKPA 1KIUB 3BVTA 1KPUA 2OL3B 2WBWB 1HHKA 5DVPA 1LEKA 4EDXB 2MIZA 1R19A 1YLBB 2ZSVB 2A1WH 32C2B 3JWOH 2GUYA 3ZDYB 4ISVA 3AITA 3GSNA 4G6KH 3NFNB 2ATPA 2XTJB 2CPCA 3FQTB 3ZYIA 2CH8A 1AHKA 2Y06L 4JRXD 4CNIA 1IT9H 3SB3A 3GSVA 5HHOB 5F96L 3QO1A 3RGBA 1EDQA 3WHE1 3IKKA 3X11B 3NIFB 2BZDA 4OD2A 3HN8A 5SWSA 5I6XC 3FF8A 3SSGA 3LEXB 1CVRA 4TVPD 1TTGA 5HPMA 2YUVA 3PUCA 2C3XA 1A4CA 3LQAL 3N40P 5JZ7D 3WTVA 4ZUSA 4LDEB 3V0JA 3RAJL 2WLLA 3TN0B 1U8CA 5EBWA 1NCWL 1W0WB 1RUPL 1NMAL 1IX2A 2DQMA 4N8CH 2OLDA 5EZOH 3RLSA 1NLDH 4NJ9L 3MBWB 3QORD 4QT5A 5BPPA 3BISA 3RTQC 3O2DA 3AM8C 4M8UA 1FQ9C 5I6KA 5GS1A 2VH5L 3TYFA 3UMNA 3WIHL 3RX9A 3M8OL 1AQKH 4XNXH 4IGBB 4OCRL 4FA7B 4X9YA 4BKLA 3CHPA 3EFFB 3KNBB 2DTML 3ESPA 1JZDC 1G0YR 3GMPB 1G7HA 1BJMA 3QUZB 5SV3A 4JRLA 4GRMA 3OB0K 2V4LA 4UOQA 2SEBA 2GI7A 3C09C 3E1ZA 2NY3C 5FA3A 1VFAA 3VXSE 1L5GA 4MNQE 1BGXL 1S7QB 3MRPA 2A2QT 3L2NA 5FO8A 1P4LA 4H25A 1OGAD 2VDKL 3VRJA 4AIZA 3LPOA 3V5HA 3FTGB 3MRBB 2R69H 2YN5A 8CGTA 1SYSB 3KPOB 9PCYA 4L8CB 3FH5A 5F1NA 1QLEB 4BWUA 4LOEA 2IAMD 1JCVA 1JPFB 1NCHA 4CILA 4RFNB 3GBML 1ZDSA 2DBJA 4BDVA 3IWVA 2NYKA 4JHUA 3TEXA 5F0MB 1ZTXL 3IJ9A 4K7PL 4LIQL 3H0TA 1KOAA 4Z78B 2ICWI 4WWPA 3K6NA 4HUVB 4K8RD 3RVTD 3WIHA 2ICCA 1BA9A 5DD5L 5G55A 5HHVH 3E6HB 1RY7B 2J1YA 5CWSA 3V5KB 4LVOC 5FWQA 5IT2H 1C8QA 1I9EA 3G6AA 1IBZA 1KB5H 1VRSA 2JCCE 4QHNA 3RUGA 4B3EA 2IDSA 1IC5H 2F74B 1BQHB 3IDYB 2GK0B 1QVOA 5FHBH 4RA0C 2WWKO 3CSBA 3P11L 4LLUA 3ET9F 4XP6H 3MUHL 4HU2A 2OYLA 2AQSA 4M43L 4FXGB 5D2LE 1FLRH 2Z7WA 4QO1A 5DD0L 3CH1A 5IJKC 5I66A 2ZP9A 1SZNA 2ZXAA 4GRLC 4OU3A 1T6WA 2PTTA 4KK5D 2JKWA 4YDVB 5HGBB 2WTPA 1OP5H 1XCWA 1MUJA 2NY4C 1J0IA 4GAYB 3OC8A 1T7YA 4PJIF 2AJXH 2JVUA 3E3QE 3MCKA 3FL7A 5C0AB 4KO5A 4JEGB 4LT7A 3BIBX 5BO0D 2RACA 1EBAA 5FW7A 1WC7B 4ZO6A 4X6DA 4HJEA 1NL0L 4DZBB 2QVIA 5MEPB 4Y5YC 5IJCC 5I0DA 2HMID 2ZSWA 1R6VA 1OCOB 2XV6B 4I2XB 3D3VA 5HD8C 1CUOA 4OCXL 3GSXA 3EOBA 1W8EA 1B0IA 1IAII 2Q7NA 3KCWA 1BV8A 2F8VA 3VMPA 4QEGA 5T1LB 5B3JF 2WOYA 4P2QB 4R97B 1A1OB 1KTLA 3ZMRA 1DJYA 4H5SA 5FYJE 4H8PA 1NWOA 2PR4H 1T66C 2NYYD 5HDRA 4EIGB