2VR6A

Crystal structure of g85r als mutant of human cu,zn superoxide dismutase (cuznsod) at 1.3 a resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
153
structure length
153
Chain Sequence
ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLRNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE DISMUTASE [CU-ZN]
publication title Structures of the G85R Variant of Sod1 in Familial Amyotrophic Lateral Sclerosis.
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 153
sequence length 153
chains with identical sequence F
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2008-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2vr6A00
2E46A 1SDYA 2AF2A 2WZ6A 1F1GA 1AZVA 2AEOA 1IB5A 1SDAB 1SRDA 5KBKA 2C9SA 1N18A 1IBHA 1JCVA 1UXLA 1P1VA 1SXBA 4A7GA 2R27A 2WZ0A 1Q0EA 3PU7A 5CU9A 1TO5A 1HL4A 1SXSA 2APSA 1YAZA 2AQQA 4A7SA 4BCYA 1PTZA 1TO4A 2ZKXA 4L05A 5KBMA 1JK9B 1UXMA 3MKGA 1IBDA 1E9PA 3QQDB 1E9QA 1B4TA 3GZOA 2C9UA 2Z7WA 3ECWA 1SXAA 4B3EA 3H2PA 3T5WA 3HFFA 4FF9A 3F7KA 2SODB 1DSWA 3MNDA 1FUNA 2GBTA 2GBUA 1B4LA 2XJLA 1S4IA 2JCWA 3KM2A 1PZSA 3RE0A 1XTLA 3KBEA 1E9QB 2VR7A 1SXNA 1SXZA 4MCMA 1BZOA 2Q2LA 4A7QA 1U3NA 4BCZA 3S0PA 2WWOA 1ESOA 3GZQA 1BA9A 2ZKYA 3L9YA 1N19A 1F1DA 2C9VA 1KMGA 4BD4A 3F7LA 3KH3A 3CQQA 1OZTG 1XTMA 2WKOF 2AQPA 2WZ5A 1IBBA 2JLPA 2V0AA 3GZPA 4OH2A 1E9OA 1YSOA 1MFMA 2VR6A 2Z7YA 1IBFA 3ECVA 3CQPA 1OAJA 4A7TA 1RK7A 1EQWA 4A7VA 5KBLA 1E9PB 1F18A 1OZUA 4A7GF 3GTVA 3KM1A 2ZOWA 2AQSA 2E47A 1YAIA 2NNXA 2Z7ZA 3CE1A 1SXCA 1JK9A 3ECUA 4A7UA 2AQTA 3HW7A 1HL5A 3QQDA 2WWNA 2XJKA 1EJ8A 3SODB 1COBA 2K4WA 2AQNA 1OALA 1QUPA 1Z9NA 1CBJA 3KH4A 3L9EA 3GTTA 1E9OB 2GBVA 4OJAA 3K91A 1L3NA 1SOSA 3LTVA 1DO5A 4N3TA 4U4IA 1Z9PA 2ZKWA 2VR8A 1XSOA 1F1AA 3H2QA 2Z7UA 1PU0A 2AQRA 4MCNA 1CB4A 3GQFA 2WYTA 4N3UA 2WYZA 1OEZW 2WKOA 3HOGA 2LU5A 3KBFA 1SPDA
chains in the Genus database with same CATH superfamily
4ECNA 5TE4H 4K9JA 3B9KA 1S8DA 1YMME 5FAAA 3WD5H 5HI5C 4G8GD 5HHMB 3ARRA 5CWSA 1U8PB 2J55A 4KKZA 3IMVA 2CRYA 3KLDA 1G9MH 3B6SA 3MRHA 5JOFB 1NC2B 4MGXA 2GSGB 5FYKL 3WXVL 3WHE0 4PJAA 1AD0B 1MFEH 3PP4L 4WFFE 4UNTA 1KV3A 1KDIA 4KZEL 4UNUA 3UIZA 3ZYOA 3DMMB 4LPXA 3AMKA 4PJ7F 4JFXA 3WNNA 1S3KL 1HT6A 1NGWB 1NOAA 3QIWC 5J3HC 5E24E 2OSWA 2NOYA 3LV3A 4LSSL 2X6UA 2AP2A 4YGVB 1ML0A 2X4RA 1OB1B 2BVUA 3O3UN 2A6IA 3IKCA 4MCZA 3MJ9H 4AVJA 3V5DA 5GSVA 2UWEA 3F7KA 5CSZA 4M7JH 4K3EH 1MCHA 4F9PC 3WTXA 1HHIB 3WTTA 5DJAA 3WNPA 1TTBA 5TK4A 1XSKA 5HHVL 1WA0X 1S7RA 1TTUA 2APFA 3B8YA 2BVYA 3MGTB 3ULAB 4JHBA 4ODHH 1J8HB 3NOIA 2DMKA 4Z3TA 8FABB 2L3BA 2EVHA 4JGNA 4N0FB 4YE4H 3UBXB 5IQ7L 1TYRA 4HGMA 3JQOB 2X4SA 4DGIL 2C3VB 4OQTH 4X6CF 4UNIA 3VXMD 1NCBH 2XT1B 1P7KB 3MACH 4I18B 4Y1AE 3MMEA 3ZHFA 4JK0D 3KGSA 3WTSA 2Z1KA 2W65B 3MRKB 1JZDC 4LHQB 3SDYH 1MUJA 1DQLH 4R97B 3DVNA 3K74B 3CXHJ 1Y0LB 2Q10A 1BYNA 2VLJB 4TNGA 3HZVA 1G9HA 4H40A 4GSXA 1YNTB 1GIGH 2PR4H 3DGDA 3RJQB 4E41B 1S5IH 3QDJB 1OGAA 2V9QA 1A7RL 4FQ1H 3KPSA 5FV1L 4BEIA 3UEZA 1MPAL 1KCUL 2Q8BL 2ZUWA 4ZFGH 3UTQB 4N0YL 5SV4A 5ERWA 2X4OB 1TIUA 1JVLA 1QUPA 4PCTA 1OF2A 4K07A 4W9JC 4FQ2L 1QBMH 1UWGL 3ZDYF 4NNXB 4CL7A 4L5FL 1U8PA 5AKVA 4IRSB 3VH8A 2PW2B 4EUPB 4FQJH 1RZ7L 3GDBA 4GRMA 3SYOA 2DM7A 5EIIG 4PJCE 5FM8A 3AS0A 2Y5TB 4NC0B 4UQBA 5CJQL 4NRYA 2CA3A 2GSGA 1LDSA 1KNOB 3DK2A 4UZSA 2H2PD 1AD0A 4ZOBA 4YSTA 4XNYL 5E99H 5T1LD 3ATDA 3F7YB 2A73B 4CADA 4FLQA 4I87A 1D2OA 3DMMA 4GMSH 1FPTH 3SKJL 4ELDA 4PAZA 4YS4A 5IB3B 5B1JA 3LH8A 4HC1A 5KVMC 2JIXB 5B3NA 4YGVA 2I25N 3PL6C 4LQ1A 1OB1A 3UTSD 2YGNA 4DCQB 4PTUA 4WQOA 4Z3IA 3D87B 5E8EB 3BPNB 1E3XA 1OAUH 2DWYA 2R27A 3H6AA 4OW6A 3FUMA 1HHIA 5GS1B 3V52H 5EUOB 1P7QD 4N90E 2FATL 3GMRA 3D2UD 4P06A 3WEXA 3RWGB 3MGTA 4FXGB 1EZSA 2QPDB 4N0FA 1T5WB 2HTLD 1N64H 5HVGB 3OPZH 5IZ7A 5F7WC 4Z76B 1EAJA 2C3VA 2F19H 3TT3L 5ILTL 4KJWC 4RISH 4I18A 2ZOLA 5AW5B 2W65A 2JKNA 3MRKA 4JMXA 4A38A 5E4EB 3C8HA 2L7QA 1Y0LA 3SKMB 4DQOH 2VLJA 4TNWK 4HK3J 1KJMB 2JSFA 1YNTA 4AC2A 1K5WA 1RZJC 4E41A 5AD0A 4DTGH 4P23C 3SGJA 3TTYA 1Q9WA 1SXNA 1J9RA 1HCVA 2GJZB 1YNLH 3AG2B 4XOCA 4C56B 4GP4B 2NSMA 4KTDL 2XWJB 5AAMC 5FECB 3L13A 1N19A 4X7CC 1DR9A 1IZJA 2MTAA 3QUXD 5EEXA 1PZBA 1RZ8B 2A9CA 2O72A 3G5YB 1DE4B 2GJ6B 4P05A 2ESVB 3TNNA 1RKRA 2MIZA 1BHGA 2AZUA 3ROLA 3WUZA 3KL5A 4OH2A 2Y7MA 5DGQA 4JM2C 3ECVA 2PW2A 2YXVA 3OWEA 3QH3B 3WN6A 1ZOXA 2Y5TA 3FUDA 1RHHB 5I1EL 4JCLA 4A7GF 1H3UA 2OR9L 1UYWL 4CW1B 4J4PD 5KVFE 2CH8A 3F7YA 2A73A 3P9MA 4H0LC 3ZE2E 2WWNA 4JO1H 3OAYH 1U91B 2V3DA 5HJDA 3S88H 5HPOA 1P84K 1F2XK 2HFFA 5IB3A 2JFCA 4LK4A 5EA0H 2AKRB 3DHUA 3H9HB 4J3SA 2PO6D 3QIUC 4JN1L 3N1MC 5SWZB 4IOSA 4NQVB 1IAKB 3ERXA 1DUYB 4DCQA 2OP4L 1O6VA 1D2PA 4GAGL 1JIBA 3V0EA 3BKML 3DNKA 3N85L 3RNQA 1D7CA 5CP3H 2DF3A 3VG0H 3CC5B 4TTDC 4RMVA 3F64A 1B2YA 1FO0B 3RPIB 5EUOA 3GB7B 5G55A 3T0WA 2LU5A 4ZAKA 3APMA 1WAEA 2GY5A 3RWGA 4FX5A 4RRPA 4FXGA 1KIUB 4LSQL 5ID0B 4FQIH 2X0WA 4NYLA 1F58L 2X2HA 1T5WA 4YL9A 5F3FA 1ACZA 2AEOA 3L5JA 4IIQC 1BLNB 3BD5A 3Q8CA 4H13C 4Z76A 3QUKB 2DWXA 3D08A 4JRXE 4XPAH 2XKSA 5IR1B 3DYPA 4B5EA 2ICCA 4U6XB 5C0BA 3B34A 3HMXH 1S9YB 4QJ3B 4QLWA 3OGCB 3PE9A 4PJ9C 4Q6IB 3RUGE 4POYA 2HVKB 1V54B 1KJMA 2QADB 1XH3B 5DA4A 5KVGE 1E9PA 3HG5A 3HPLA 2IF7A 2ARWA 5D1QB 1J5OH 4HJJH 5E1HB 4F8OA 4URKA 1IGIL 3F58L 5DTFB 3O8XA 4NKOA 4C56A 2WWMC 4WWID 3WTVA 2XWJA 1I9JL 5FECA 3ARFB 1ED3B 3TH4T 3X1NA 5GZNC 3TXAA 5DLML 1RZ8A 1QX1A 1DE4A 2GJ6A 4K9EL 4B9CA 2ESVA 2NY4C 1E4XL 3MR9B 1MCNA 1JNNL 3DX8A 1KZYA 1RK1B 4U1NB 2X12A 4FZ8L 4F57H 3FONB 5IROC 5T33L 1UCBL 4P49A 5DVPA 4PJHB 4A2LA 5B7FA 2CD0A 2EXYC 3QEGH 4OCRL 1KC5H 4XC1L 3QH3A 4X5QA 5FYKE 1RHHA 1QVOA 4JR9L 4QRUB 3S2CA 4DO5A 3RIAK 3ZTJH 4CW1A 4QHNB 1UM4L 4YMPA 4BUGA 1U91A 3A47A 4ODSL 5GQBA 3GZKA 2O6EA 3O45B 2IAMD 2HX7A 4GKSB 3RWHA 2VAAA 3H9HA 5C07A 2P44B 5HVWA 5DRWB 2FWLB 1MAJA 3B5TA 3QRLA 4B9YA 1X7QB 3O2WH 1L7TL 4NQVA 1IAKA 5IP4A 2EIDA 3DI3B 2ZXGA 1OTSC 3AS1A 4H88L 1F4YL 2ROXA 3CN3A 3NP3A 3KWXA 4YHLL 4ODVL 4Y16C 4XO3A 3CC5A 1MCWM 1B90A 4HAKA 4AWJC 1FO0A 4KHTL 4HXAH 4Y9BA 5CUSH 3RPIA 3WJJA 3GB7A 1XL6A 2AK4E 3PWPD 4NEHB 4C58B 2VERA 1DVFA 1SFDA 1KIUA 2XG5B 4HJ1A 1IX2A 4MZ3A 4OJAA 5CLXA 2W0PA 4FJYA 4ZTOL 1BLNA 1BM3L 4K8RC 3GBML 3G08B 1Z5LB 4WTZA 3ZQXA 5G4MA 2CJSA 1UACH 1RUPL 2CPUA 3NJVA 4FNPA 4HJGB 5L2KB 1D7FA 3IFOA 2OPCA 1TJXA 4U6XA 4YBQD 2JF1A 5CSBA 1S9YA 3BYYA 3VGBA 3OGCA 1WGVA 1W80A 3P4OB 4H8PA 4PJ5E 4Q6IA 4KRPB 2NNCA 3GO1H 4GAAA 1HXYB 3SE6A 5DJ0B 1XGYL 2N7SA 5D1QA 5C0DB 3X13A 3WIIL 4KVCL 4NQDD 4K23H 1FL6B 5IQNA 1GMEA 3CPLA 4WI9A 4XMXA 3VGGA 2RACA 2DEXX 4FZEH 4R6UA 1KBPA 1ED3A 3ARFA 1ADQH 1H5BC 1TOXA 2BIHA 3LOWA 3N5AA 4ADGA 1JPST 3V4UL 4H1LA 1M6UA 1Y18B 2ZOTA 3R7RA 2B2XH 4X6FB 3NZUA 3IBEA 2KDGA 2EEBA 2F53B 3FONA 1FYTB 2E8YA 4H26A 4BXVA 2EJ1A 1ZE3C 4PJHA 4X4XB 1LEIB 2A9MH 2HYMA 4J6RH 3RA7H 4WO4A 4A04A 5KN5B 3DPDA 1G7HB 4GXUN 2GT9B 2CK0H 4QRUA 4E9TA 3WTWA 5GS0L 1QPXA 3QFJE 5MI0C 4Y19D 2BVOB 4KMQA 5IEKB 5L8KB 4W4OC 1MLBB 1WCQA 1UQSB 1ILUA 1B2WL 3D39D 4GKSA 3QDMB 4HIHB 4QOKE 4XOBA 4MAYB 2XYBA 4IKJA 4N86A 4UMSA 3FHAA 2DQ6A 1X7QA 3KYKL 4OM0L 2F1BA 5D6DA 2NZ1A 3LXCA 5F7DB 3OAZH 1XGQB 1OTTD 2NX5E 3QFDB 4KVNH 4UYQA 1A4AA 4GG6A 1NDMB 4NJ9L 3F00A 3HB3D 4MYWB 4Z7QE 2OZ4H 4AV0A 3JT0A 1MREH 2Z9TA 3FO2A 2IMNA 3ZUNC 4L3ED 4P2RD 1ZWIB 3D50A 5E1AB 1EZVY 1T2QH 4NO0D 4AQAB 4A6YA 2HH0H 3O9WD 4QHPA 3SIKA 1MQKH 1ZXQA 2ENSA 4KK5D 4MZRA 1FGVL 1FNSL 3G08A 1Z5LA 3RJOA 5D72H 4OGQC 4UT7L 4HJGA 3UBXG 4NWUH 5L2KA 5DD3L 4UT6L 4I2XE 2WTPA 4MNGE 1F42A 4N0UB 2VXQH 4KTEL 5DQJA 4B9GA 2HN7B 4N2LA 4WU5B 4NENA 4TSBH 5SX5K 3HI6L 2R0LH 1OD9A 1HXYA 1BQLH 4LEEA 4F7PA 4OY9A 5I6PA 1FL6A 5FWQA 4M3KB 2Z93B 4Q9CA 2HT2C 5DGRA 1JGVH 1QFUL 1WGOA 5F72S 2FX9H 2C9RA 4TNEA 4XXWC 5FO7B 5IHBA 1NKGA 1Y18A 4U1MA 3WKNA 3BKYL 4Z7VF 4X6FA 3CG8A 3N44B 3FHEA 3K6OA 3IU4L 2F53A 1I9RL 4U1IA 2DQHL 1FYTA 1IGJB 1TQTA 5DMJB 1LEIA 3QPKA 3N91A 1IGYB 5HYJA 5DC0A 4N1HB 5KN5A 2Q86A 5J1SC 4EUPG 5KVFH 1P4BH 4PJEF 1OGTA 5ELIA 1PSKL 3CHSA 3TO4D 2BVOA 5AW0B 5IEKA 1YEJL 1FFPB 3RDJA 3EFFB 5D2LB 1UQSA 4HIHA 2UWEF 3QDMA 2VW6A 3IGKA 4G7VH 4XO4A 2NUTA 2ORBL 4UTBA 5EU6B 3RQ3A 1XZ0B 3GSNL 2DIBA 3MJWA 2KDYA 3P11L 5F7DA 1XGQA 3QFDA 2KZKA 3FQUA 1JPEA 5ESQB 1KB5L 3TS8A 5A6LA 3DJSA 1UM5H 1NDMA 4J3OF 4BQBA 2BNRE 1ONQB 4XI5C 2GCYB 4ZYKB 3LRSA 1WEJH 3MRFB 1X5KA 1YEGL 2C4FU 2IFFH 3PDDA 1E30A 3IDXL 2J1ZA 2NY0C 2YEZB 5E1AA 1I75A 4AQAA 4XMVA 1MDTA 3KXFB 1RIVH 4WEBH 3T6ZA 4U0RB 1TNNA 3EO9L 4HS6B 2VLRE 2VDKH 3CXDH 3KLQA 4AKQA 3NCMA 4HLJA 3L3KB 4FFTA 4Y2OB 2P49B 3GZQA 2VZOA 4KXCA 1JE6A 4N0UA 7CGTA 1MVFA 2X3CA 4XVSH 2ZCHH 5DHYB 4WU5A 3ZTDC 5AVQB 2XWXA 5T1DH 1ZPUA 4YPJA 4RSVA 3LZNA 5JHLL 5HGAB 5J06A 1U8QB 3HRZB 2K78A 1GGBH 1JXGA 1TMQA 3BUTA 3KPOA 4Y5VC 4DFIA 4ZW5A 3QULB 2ISDA 3TU6A 4AYGA 2JQZA 5FO7A 4OKVB 4NQEA 1AKJD 1HKFA 4WFGE 2EKSB 1JWSB 2AC0A 2YPKB 3MUGB 4XP6H 5JIPA 1ZDQA 1FG9C 1OM9A 4HWEL 5HGBB 2BXZA 5EU7C 3V4PL 3LB6D 1INDH 4QTHA 3QEQE 3H4HA 2VDNB 3OM3B 1ZGLM 3O6LL 4KV5F 4OAWB 5ACZB 3DSNB 3BRGC 1AACA 2X9ZA 4WUUE 1MZYA 3MX0B 2ZXBA 3MCKB 15C8L 4A2FA 4PWIA 4TRPH 2WYTA 1BXVA 3LKNB 3EFFA 5D2LA 3HHRB 3Q8FA 3AY4C 4I1NB 5A2AA 5IMOB 2ZXQA 5IF0B 1UOVA 2H8PB 3HTLX 1AR2A 2DIJA 5GIRA 4ATWA 5E8PB 5EU6A 2E7DA 4CVXB 1XZ0A 3FPYA 4R90H 4QXWA 1IC0A 3EYQC 4WDIB 3CFEB 4PTTB 1W0VB 4W93A 1NL0L 3LQAC 3WIHL 3LY6A 3MRFA 5I1DA 2MQCA 4OT1H 3MOBL 4K5LA 3DC0A 5I1LB 1IKNC 2YEZA 1E4XI 2CNZA 3EUUA 4GIAA 4ZQKB 3KXFA 4EI0A 4R4BA 3U0WH 4HS6A 4IEFA 3MV8E 1Z32X 1XEUA 2GTZB 4HPYH 1KGCD 1KENH 3SE4A 3TCTA 1IC5H 3K81A 4Y2OA 1EGJH 3WKMH 1DVTA 1TMCB 2O30A 1KXHA 4R2GC 2WM0A 3SJVD 4B9IA 5BOZG 3HS0C 3FUEA 2YMXH 2EUVA 1TPXB 4Y4FB 2N59A 4C4KO 5B3JF 1WCBB 5TFSL 4M6NH 5MENB 2PCXA 3D0AA 3EGXB 1F8TH 2IH8A 3TWCL 3UPCA 1BXUA 1U8QA 1SXZA 1EIBA 3DX1A 3AU1A 5TTRA 2C3HA 1U6AH 2WIIB 5HHOD 2OM5A 2WWOA 3Q3GB 3C5ZD 1NEZG 3MC0A 1XGZA 2OMVA 4OKVA 1CI3M 3VM7A 1EFQA 4LCWD 5KSAB 2EKSA 1JWSA 1DN0B 2YPKA 3WNIA 1CYXA 5DT1H 4X80L 4DK3A 4FHKA 3HBQA 5HGBA 1QPPA 2VR6A 4ZXBB 1JZ2A 3RU8H 2DJMA 3CSGA 3NCXA 4OAWA 4EI6A 5ACZA 3DSNA 5KBDA 4M48H 4BH7B 1AD9B 1UH3A 3CK0L 1C1EL 3UAJC 3OMAB 4PY8I 5HY9A 5C8JB 2XQBL 1I8AA 1AH1A 3LKNA 1Q9OB 4XPGH 3NH7L 3UP1A 4FYSA 1IFHH 1OCOB 4FTVB 1I1FB 3J27A 2H8PA 4PN6A 4HUNB 5D70H 5EZLB 5A2BA 5IF0A 1KJ2L 4YNYB 5C08E 1OAZL 5E8PA 3PS6A 4CVXA 4BFJA 1FFTB 3WUWG 4ZSOB 4EKJA 5AOJA 3CN1A 3US9A 4MA3A 5EC1A 4WKXA 1LWRA 3CFEA 4XNQB 4PHXA 1I1YB 1T5XB 4JL1A 1F90H 5KS9F 4AEIH 4U1SB 2E9JA 4HD5A 5I1LA 2XVGA 1SOKA 4ZQKA 4Y5YA 4Z0XB 4YZFE 1FIEA 5C3LD 3CSYB 4KKBD 4PJ7B 3B7RL 2GTZA 5F7BA 1WAPA 4RMRA 5KYXB 3QG7H 3R18A 4UQ3B 2MRYA 1KGIA 3CZUB 2Y4SA 4P46C 2LHAA 5IV2A 4Y4FA 3U4BL 3DJ9A 2BVEA 3GMPB 3NABH 2NNAA 1VFOA 2XLLA 4EOWH 3VO0A 4KO5A 2WQSA 1HNFA 2W60A 3EGXA 3O3DA 1XIWB 2P42B 1NCTA 4XMZA 2G60H 3UADA 3TJEH 1Z1WA 2WIIA 2DQUL 3KPLB 3Q3GA 1A7PH 1AGDB 2BNQB 1OPGL 3MODH 4XNBA 5HJBA 3LNIA 5D4QA 3T4AB 1ZV9A 3FZUC 1DN0A 5DHVH 1FUNA 3P2BA 1HCFX 1OT4A 2QHLA 2APBA 4OCYH 4P2QD 4ALAH 3UZEC 3MJGX 4GKZB 1S4IA 2JCWA 4TUKH 3RE0A 3DPBA 4ZXBA 3ULUD 4RDQF 4UOQA 5E51A 3WXWH 3ETBF 3QRGH 4Z7AA 1CE1H 3DOSA 1UXSB 4KQ4H 1T03L 4YHZL 3SBRA 4Z3HA 5AYQA 5E00B 5C8JA 5GJTL 1OCZB 1BBJA 3BRDA 1Q9OA 3O2DH 2YD4A 5FPIA 1UFUA 4WW2C 3KH3A 5FUZH 1LJMA 4LLMB 2J5LB 1I1FA 4CVZB 3OKKA 4N2AA 4YSPA 4ZPVA 2IV9A 5D5MB 1U3HC 2CU9A 2XA8L 2WQXA 3FFCD 2OK0H 5ICZB 1CK0H 4HFUL 4PRPE 3I6KB 4L1HA 4ZSOA 5BZDB 1UZ6E 4A7TA 3EJZD 4GLRH 1CLYH 4XNQA 1T5XA 4X2UA 3OWRA 4LSTL 4U4BA 2OTUA 3EIFA 4U1SA 1I8KB 3E8VA 5F70A 3LH9A 3RY5A 3VWJD 2BVQB 4TTGA 3CZEA 4O2CB 3GINA 4JM4L 1PFOA 1M7IB 4MXQC 3BAEH 5F7FA 4OLWH 1OKEA 4Z0XA 2K0RA 1F4AA 3L3DB 4QT5B 5C7XH 1QSFD 4X9BA 3CSYA 3V0AC 5DEGA 5KYXA 2MH4A 1CYGA 1MQ8A 5EULV 4UQ3A 2UYLB 5AW2B 2I9LB 2XTJD 2F5AL 3D1MC 1HQ4B 1KXVC 2E56A 1N68A 1J5IA 1YYLH 4OZIB 2GJPA 2E7LC 5IOKA 3QUZA 1TTAA 4L9LC 5KSBB 3D05A 1CC3A 1IM3D 3HKFA 4PJXB 1XIWA 2HX8A 3H55A 3LZFH 4NUGL 4XN9A 4JHWL 4P2CG 3APFA 4IDJL 3W81A 1JZJA 5EZIH 4NQSB 3Q2LA 1KEGL 4XNDA 3KPLA 5DC2A 1IBZA 4NQXB 1AGDA 4FFZH 3FO9B 3U6RA 2HSIA 5E6IC 5HHMD 2FGZA 3QDGD 5EEZA 3GEFA 1XVSA 3WOVA 2Q3AA 5ACMA 3FT1A 2XTLA 5C0JB 5TF1H 3GIZL 2J43A 2HMID 5TQ2L 1NC2D 5KG9A 4KO6A 2XNAB 4LGRB 1HWWA 4POZD 1WIOA 4HKBB 5HJ3B 1TEFA 3C60C 1RZJH 4WWNA 1ZPLA 1S46A 2ZUXA 2DQJH 4L29B 5L7XL 5J11B 5I6MA 2E27L 1UXSA 4PB9L 3ARWA 3RVXD 4BBWA 1KGUA 4XMKH 4OVVA 1HJBC 5E00A 5E6YA 4D3CL 4PI0A 4WHTA 3IN2A 4HWNA 2QVFB 5AZEH 1JZEA 3IWUA 4LLMA 4CVZA 1IM9B 4GG6F 4FQXB 4EEEA 1I1AA 2H6UA 5BZDA 3MJ9A 2EE3A 4RZKA 3H9YA 4G8EB 4KI5C 3REVB 3NTCH 4OCWH 5D71L 1CTMA 1PNDA 3X1FA 3N1GC 4L3FA 5FM4A 2IO5A 1J8HD 1HKLH 2YAEA 4JAMA 4XP9L 5AAWC 1I8KA 2DICA 2ENPA 2BM3A 5ADPL 5T3ZD 1A6ZB 3RGVB 3OHXC 4L4VA 4M7LL 1XSIA 3CQQA 1M7IA 1AHKA 4O2CA 4B0MB 2WLZA 1ZS8B 2W0LA 1TYEB 4N26A 4UTAL 5JIKA 1NCCH 2ROYA 2OJ1A 4OQTA 5FCUL 5M95B 4ZX3A 5C2BH 2UYLA 3EO0B 2I9LA 1X4ZA 1X44A 3P4LA 1M05B 4WFEE 3QDJD 2P7TB 5FW6A 2W80C 2FHCA 4L23A 4OZIA 4WSJA 3TLRA 3QWRD 2X89A 3D0LB 5KSBA 2O5ZH 5I75B 4QHLB 1KJ3L 1DVYA 4K7PY 3SDCD 2ZUTA 2GBVA 3QFGA 5CIPH 2D3JA 1PJWA 2HJLB 4NQSA 5I9QC 3K71A 5IMMB 3BD4A 1JTTA 4YXKL 3FO9A 3O0RL 4F92B 4IRSD 3CZLA 3VGAC 5EORH 2VLKA 3BPOC 3QA3A 3VFVB 1SYVB 2YAPA 1HVXA 3GMOB 3P3TA 1QI5A 5F9JB 5C0JA 3K2UH 1R9FA 1T7ZA 5G2NA 1U58A 2I24N 1U3YA 5B1BB 4D9RE 5HJ3A 25C8H 2NY7H 5J56B 1FZMB 3EYFB 4L29A 4N8CL 4NN7B 5GRUH 2ATPB 1UT2A 2JKLA 2VXTH 5C0GB 3ZE1B 4JQIH 1JFQH 1RPUA 2HG0A 1ZSDB 1DQMH 1NWOA 2JIXD 5DJZB 4YXLH 3ZIYA 5ISZB 1A3LH 1QLRB 3FYIB 4PWHA 3MRDA 3HR5B 2FJFB 4BCYA 1GAFL 1IM9A 1QW8A 2DWEB 2BY1A 4L4TA 3D85A 2I26N 2R9HD 3RWDB 3FYEB 3QPQC 3O4LD 2PN5A 3AQDA 3A67L 3T1FA 2A9BA 4HBCL 4G8EA 4BHUI 2A6JB 4XR8C 3NGBB 5EU7E 3REVA 5D1ZI 2CDEB 4ZOEA 3VVWA 4ABWA 2J3SA 3VFOB 3MQIA 4KOCA 1J1OL 5KEZA 2DKSA 5E4AA 5DRZB 3RGVA 5FO8B 5E08L 2WJ5A 2BRRH 5FYLD 5AL8A 1ZS8A 3BW9B 2Y07L 5C0RL 3L17A 3UBXI 2BX5A 4EI5A 3FCUB 4M93B 2R2HA 4B27A 3UZQB 2A74C 3FJTA 4ZMWA 6PAZA 1JVOA 1Q1JH 2A7BA 3F6IA 3SDXB 2FJHB 1QTSA 2HCZX 4Q2ZB 5I8EB 3FCSA 1J05B 4OLXL 3AXHA 2P7TA 3HNTL 4YSRA 4Z5RB 4W70A 1RERA 3D0LA 4RH4A 2YXWA 4XPHH 4PB0H 2R0KH 4HZLB 1OZTG 1DBML 3G5WA 4AQ1B 2K3TA 2NNFA 1KGYE 3RKDD 3S3PA 2APTA 3LDBC 3SD2A 3UJJH 2EDEA 1HL9A 1WD8A 4NAQA 2HJLA 1OE3A 5IMMA 4K8RH 3UGXA 3OZ9L 3IE4A 2PTTA 3EYUH 1Q0YL 3N41F 4O2EB 2W9LA 3ZMEA 4PV8B 3RAJH 4HMCA 3VFVA 4FJZA 1SYVA 1OAXL 2HTLC 3GMOA 4QRRD 3RB5A 1GSKA 1G6VK 3HMWH 3BWUF 1T0MB 4K73A 5HDBE 7FABL 3QC5X 1CZ8H 2D7PA 4D8OA 2WB7A 1FZMA 4OLVL 1WD9A 4NO2B 4NSKB 3ESNA 5BVPL 4K5MA 1XR8B 1TKWA 1J9TA 5DJZA 1IL1B 4HCRL 5ISZA 4Y9EA 1QLRA 2ZSWB 4K3DL 5SWZD 4HEME 3HR5A 1NBVL 1K8DB 4AQZA 4I77H 5TJWK 5I1IH 3HPJB 1FAIL 4DKDC 4CBZA 1BLIA 1JRHH 4RMSA 1ORSB 1JNLH 1ZE3H 2KC0A 4XOEA 2A6JA 3QUXC 4O5LH 5C71A 4D0DA 1MI5B 1M2OA 2CDEA 3FQ1A 2X5PA 5KJ7E 2H2SD 1THCA 5CP3A 5HDQH 1L0XA 1L6PA 4EXKA 3P77B 5DRZA 3C6LB 5FDWB 1RLWA 4GEIA 3T3PF 2PYEB 4UV7L 1G7LB 3BW9A 4R5XA 3MRJB 3ZKSD 2G0KA 4FXTA 1FDLH 3IU3A 2KKQA 1OM3H 2DQEL 3EH3B 4Q9BA 2DS4A 4KY1L 4QRSB 1QW9A 2FJHA 4RBPH 3SDXA 5I8EA 3MRIB 1ID2A 1FRGL 3HMXA 1TLMA 4Z5RA 1U93B 1GJIA 4OBRA 1IGCL 4HZLA 4AGQA 1AI1L 4LNRA 1B4LA 2DKUA 3PXJA 5CZVH 3VB8A 2XCMC 2LVCA 3MLUL 4PRHB 2V5SA 3C87A 4ZI8A 4AH2B 3FQRB 2XX0A 1AQKL 4YO0A 4PJDF 3QCVH 1FH2A 5LQBH 2H32B 1ACCA 1YMHB 3PWUA 2WO2B 3O6FB 4PV8A 4XCFL 1BVOA 1KGXA 4N2NA 1OY3B 2C9VA 1YMMA 5LWYL 3HR6A 3ZLQC 5DMGD 4CA4A 2I5YL 1T0MA 4MA1B 5GGVL 4G3YL 1A8JH 2OI9C 2JLPA 1ZEAL 4KKNA 3ZTCC 3ARGB 4GS7C 5ITFA 3G3LA 2HWZH 1C5BH 5HHXL 4NO2A 4NSKA 1OAKL 1KBKA 3T2OA 4RGMC 1HESA 4Z8FL 3DTUB 3M7FB 1XR8A 2VJXA 4G43B 5BV7C 3IAGC 2E47A 2HRPH 1OSZB 2ZSWA 2O6PA 1K8DA 4HW6A 1RLBA 3JVFC 3HPJA 1TJHL 5JPMC 2OXGB 3BVNB 1M53A 2V5YA 5LJYH 1N5YL 4KKQA 1F02I 4HPOL 4U6VL 2ICWA 1ORSA 4OD1H 5AQ0A 4OCLC 2EECA 3C08H 3MV7B 1MI5A 4HUMB 3LN4A 4OI9A 1CFBA 4MNHB 3C6LA 5BO0D 5CINL 1EX0A 2ZWLT 2PYEA 2AEWA 3NJFA 4PLNC 4Q9QL 3KPNA 1O7DC 4FNUA 1KTDB 5FFGA 3UJIL 2XQYK 3ZGIA 3VQ2C 2IPUK 4Z3JA 5MEQA 3QAQA 3WGUB 4YFLF 2CWRA 2FR4B 4Y1AA 1NH6A 4KRPD 3ZDXE 3BLKA 2IAMC 4LVHC 4ZO8A 5D6CA 4CMMA 3MYJB 4UILL 3T2LA 4AM0Q 1LP9B 1U93A 3HG1B 5KVDE 2I27N 3CN0A 2BS71 2RFXA 3RP1A 5DHXB 2AEQL 3FQTB 3DIDA 1UJ3B 4NERA 1R5WB 5EV7A 4AH2A 1H3VA 1RUQL 1REIA 1FFRA 3FQRA 4ZFOL 2IAAC 1IC7H 1TUPA 3X3FH 3ARBD 1ADQA 1YMHA 2YPVL 3T08A 1JZ6A 4PJFE 4M3JA 3TPUB 2IDQA 1JXKA 4CSPA 4BFOA 5EO0B 1TQBC 3HNSL 1SM3L 1CXLA 1CF8H 1N4XH 3DYOA 4BZ2H 3MBED 4LRNH 3NSJA 4B96A 5FC9A 4IBUA 3ARGA 4F7MB 3KZ8A 4NZUH 4JKMA 5TPWH 2LE9A 4YBQC 3BPCB 2VXSH 4LSDA 2MNWA 5HDLA 1KG0B 4MAYD 2PUQT 3BAKA 1ZLWK 2O5XL 2VQTA 1OSZA 2Y69B 3UFIA 4PJ8B 1ECZA 2J20A 3WCYA 2AS5M 3LAFA 4CNIA 3SQBA 4WI3A 2WIMA 4XPFL 4RFNC 3BVNA 2VWEC 4HK0B 4AJVA 1AJ7H 1IE5A 1QRNE 2KT6A 3T65A 4DGYL 4J3UA 1A3RL 4YDMA 5IVXE 1ET5A 5JHDE 1LXMA 3AVEA 3MV7A 3RBSA 3DXAB 1OAJA 3UZVB 3TA3B 2BZCA 4K94L 1U21A 2G2RA 4FABL 3JZ7A 2NSQA 4Y4KB 3C6EA 2OZ4A 5TDNB 5JORB 4MNHA 4JUSA 5E95B 1U4FA 3QJXA 2IG2H 5C0CD 4X4ZA 3BKJL 4NLAA 3O4OC 1NMCC 2Z3FA 3LHPL 2BP0B 5E1GA 5DUBB 4AUYA 4Z7OF 3QI9A 4PRIE 3VG9B 5DMKB 1T89C 4AV4A 1C7SA 2A1WL 3Q5TA 1R46A 1J8SA 1PFCA 5EU3B 5A43C 1SEBA 2XWBB 2L04A 1MVUB 2VXQA 3MYJA 3C6SA 4KI5E 2IFGA 2XXGA 2ZX7A 4HZAA 3E8UL 4WI8A 3D9AL 3LQAH 2VDMH 3VXPB 5HHPA 4I1RA 4G8GE 1OTTC 1DJHA 4H20L 2XQYG 3FQTA 1KYAA 4Y2NA 2IPUG 1UJ3A 2V5MA 4J28A 3M1BB 4NRXB 1ZLSL 3FT3B 1BG9A 3ZT7A 5ABDE 3TYFB 3HB3C 5AOMA 3UAEA 5E2VL 4XPTL 3IGUA 5IUSA 3RFZC 2E5EA 3O6KH 1SDAB 1BVZA 1GPOH 4OGZA 2B0SH 4PSRA 2EVJA 4A2HA 3TPUA 2IGLA 4HS8H 3O9WC 4L8CB 1M7UA 1LL1A 4KK5C 4N2HA 4NIYE 5EO0A 3H7BA 3SOBL 4QRPB 5DQ9A 2VDQL 4K5NA 4RZCB 5K69A 4R26L 2L7EA 1I8UA 1WG3A 4FQQB 1SHMA 4DN3H 3MKGA 2GC4C 4F7MA 4D94A 3NIFB 3TBTA 5IG7B 2BS9A 4TPRL 3BPCA 4XMTA 5A7EA 5F1IA 5EBWB 4MLIA 4W9EC 1KG0A 2DWDB 2BSCA 3NJJA 2Z34A 3PV7A 1BIHA 4OLZL 4TSCH 5A16B 2WCPA 2YZ8A 4N9OB 1JS4A 4JFQB 3GSXB 5HDRA 5IGXL 2L8AA 4YXHL 2XV0A 2GBUA 4HK0A 2VXUL 3VI4E 5MEOB 3LKRB 4NOBA 1AMYA 1PZ2A 1Z9SB 3DDGA 1I4FA 3DXAA 4R3SA 3VXME 1L0QA 3HZKB 3UZVA 4OGXH 4G8FB 5F1SA 4GXVL 4YBLB 5TDNA 5JORA 1PKQE 2VCOA 1AE6L 4HPHA 2QHRH 1YECL 2P5WB 1KTJA 1EEYA 1EEZA 4K2UL 1KIPA 1MRCH 3GRWL 4DVRH 1CICB 5B8CC 3DLQR 2IOIA 1BZ7B 1J86A 1XGUB 2WXLA 4MB4A 3QUGA 4FLRA 5DUBA 1EXHA 1KBVA 4YDLB 2TSBA 3X12B 1B0WA 1U8LB 3SYAA 5DMKA 4M7LT 4O58H 3TO4C 3TVMB 4PGCB 3ILPA 5EN2A 2N0KA 3QUHA 2XWBA 2BJML 5F21B 5E8OB 4G9FB 1MVUA 3U83A 5KOVC 4KJQD 4KO7A 4AIOA 1KACB 5JR1L 2BY3A 4H7VA 1YAIA 2X6BA 3SKNA 3VXPA 1G5GA 3N42B 5JQIB 3TIDB 2FQEA 4IIZA 4YHIB 1G5AA 2YARA 1DBJH 1S9VA 4YDNA 3FT3A 1R24B 3MLVL 4FCHA 2KYIA 3QCUL 4M61B 2R56L 1AIZA 1NDTA 1ZIBA 4W6XB 1Z9PA 3L5WA 4P2OA 4PYGA 3JTSA 4F1ZA 3U6XA 4L8CA 3PAYA 4HUWB 5K9JL 4QRPA 4RCAA 4RZCA 5E2WH 5EBMA 4HEPG 1L5GB 3IETA 2WKOA 4ELKA 4BWUA 2N1KA 1JF5A 4FQQA 2BSRA 3F5WB 2FL5B 1BIIB 3JWNE 3UTSE 1RURL 2W9DH 4LCCC 1LMIA 1MHEB 2W07A 3MXWL 3WN5B 1N6UA 1QA9B 3H42L 3MJ7B 5EBWA 2CGZA 1NEPA 2PLTA 3FUIA 5D8JH 2IH9A 4AV5A 1TVBB 3GSXA 3KJ6L 5TDOB 2AQQA 4WJ5B 1AO7E 2DJUA 3K6FA 4H2CA 5E5MB 5GISH 2N3JA 5H37G 4TQ8A 3LKRA 1T0OA 3K72A 3L5XH 4YSAA 5JDSB 1Z9SA 3INUH 4IBZA 5A40E 1TFPA 3E6FA 4G8FA 3V4VL 1I8IB 2OJZH 4POUB 3U79A 1W0YT 5AW4B 1M3JA 4JRYB 3Q2VA 3QHZL 2Y1YA 1E4KA 3D8MA 3LB6C 4YHNB 3VX1A 3ZKXC 1CICA 1E40A 4OZFH 2BVPA 1XGUA 4PRNB 5F7LB 4HDIB 3QIWB 1RVFL 2TRYA 4QRFA 3X12A 1U8LA 1QABA 4HG4J 1KCWA 4FD0A 1GC1L 1EZUA 3DSFL 4PGCA 1EGJA 1CDGA 1BZOA 3KWUA 5MEND 5E8OA 2EYTB 35C8H 2JK5A 1VGKA 4Z7IA 2Q3ZA 4PJ5A 1F6FB 2YAHA 5KVDH 5K33A 2C9QA 3KCPB 4YFEA 3CMOH 1RZKH 3B8SA 3WU1A 5FR3A 4ODXB 3TIDA 4YHIA 4F2FA 3K8KA 1KBWA 3ZHLA 2HXAA 4HH9B 5E9DD 1KXTB 1R24A 1IIKA 4XN7A 1ZJAA 4M43L 5KSAD 3COOA 2EICA 1A7NL 1RQ5A 1TXKA 5JQ6L 1CLOL 3IXTA 2EEDA 3QUYA 2WO3B 2F8XC 4ICXA 5JOPD 5CD3B 4TOYL 5TQ0H 3AU0A 3ECUA 1HNYA 4ZUWB 1JK9A 1HHHB 4HUWA 4M5ZL 3UTTB 3LCYA 4QEGA 4XNMB 3OKLB 4EZLA 4M1DL 1A4CA 1L5GA 2WUCL 4HUUA 1OK8A 1JHTB 5TE6H 5D2NC 3HE6D 4RGOH 4LAQL 3QNXA 3F5WA 1BIIA 4HWBH 5L2JB 4F58L 3GTTA 2DQGH 3WN5A 3K91A 3QFJA 4JRFA 5DD6A 1QA9A 2R1WA 2J2ZB 3MJ7A 4KKCD 1JV2B 4FTVD 1FBIL 5JW5B 1T5KA 4QDGA 2HJKA 4OCNC 1TVBA 2CRMA 3ZO0A 3ZU8A 3ASWA 4MXVF 4QOKA 3Q7JA 1YUKB 1YUHA 2BC4B 3PGFH 1ETB1 3GHPA 2VN4A 3PWVA 3RPBA 4Z7WB 1IARB 3QBTB 3FTXA 5JYMA 3C5ZC 3W38A 5ESAB 4PSPA 2WXQA 2AF2A 2IPTL 2VDRL 4PY7B 2V5TA 1I8IA 3AREC 4WSGA 4O00A 3NIGE 4FQLH 2HFGL 4I3SL 1QSED 4JRYA 4KFZC 4YHNA 2XUWA 4YDVB 2P47B 4UUJB 4PRNA 2Z91B 4HDIA 3N43F 2FBRA 3QIWA 4N1EA 4NP9A 3HG0A 3V0VB 1NFDB 3DGCR 2PCPB 4LU5H 1GTFA 1EO5A 3PL6B 2H0FA 4OU3A 2WMPA 4R7NB 1YYML 2ZG1A 2QGBA 3SN6N 2NZIA 2UXTA 2B9BA 4F9PA 3IFNL 1CJYA 2BP5M 5E7BA 3KCPA 1CQKA 2BWDA 4N2KA 3DBSA 4Y7OC 3ZDZE 2Y2TA 4DETA 2BNQD 1D5ZB 2A83A 5FUOL 4JVPA 5KSVA 2IWFA 1DFBH 4J3OG 3WG7B 3QXDA 1J8KA 1O7DE 4MB1A 4WNJA 5DI8B 2E7CA 4PS7A 4Y4HB 2OMWB 1HFUA 1BYOA 1P4IL 4TLSA 3D06A 3CTTA 2YD0A 4LBEB 4HIJB 4U2ZA 5DHVA 5CD3A 1JZ7A 1KFAH 4ZUWA 1N12A 1HHHA 1OP3H 4DF9A 2EILB 5JXAL 4KKBC 4XNMA 2F2HA 3OKLA 5D96C 1TQCC 2ZKHL 4HV8A 4LPYA 3ASOB 3DX6B 1F4WL 4N9GB 5D9SB 2CKBL 5L2JA 3FK3A 1XHHA 4P23B 5E8DL 5BJTB 4FLOA 3UL4A 1D9KB 3IPBA 2J2ZA 5JW5A 1JV2A 4Z77A 2WVUA 4OSUH 1M7XA 4A37A 1Q38A 3ZY7A 3TFKD 3O2DA 3PWPE 4P3CH 2NNXA 2Z7ZA 1NCIA 1FCCA 1KBGL 3GK8L 3JXAA 3MRNA 1JFHA 1O7VA 1X5ZA 4Z7WA 5I15H 4JM2B 4PS4H 2CUIA 5K9KA 1VCAA 3EGDB 4OJEH 2BNRA 3NJKA 4JB9L 4NWTL 4M6OL 4U4IA 4FNRA 2V17H 3T6WA 4JFPB 5JIMA 1SY6H 4I9XA 4LDEB 4QIRA 1Y6KR 4JO4H 3SPJA 3DV4B 3ULUC 4WCYH 5IIEB 4YDVA 2UUDK 3BFQG 2X0UA 4PG9B 4QHKI 2GQHA 2Z91A 4ZUTA 2R15A 1J48A 5KTEL 1FSKC 2PCPA 1I85C 3QIUB 3JV4A 2EDHA 3PL6A 4XBEH 4X9IA 2VWEE 5D7SH 4AYMC 4ZMTA 5CKAA 4GMTL 1LDPH 5MHSE 4WWKD 3N0PB 2JQAA 4QXUH 1KJVB 1NLBL 5E2UH 1X6NA 5K39B 5LGHH 3BZFB 3PWJB 3NK3A 4YE0A 1HL4A 1WQVT 2OBGA 4U1KA 4HUXB 3OB8A 4GRWE 4IU3B 3FRPB 1JWMA 5CIPB 2PYFB 4LCUB 2HRLA 3O2VL 4EIZC 4IIQB 2OMWA 4F3FB 3VWJC 1V05A 4Y19E 4FFZA 2X4UB 4ZBJA 2KI6A 4JPWH 4XB7A 4PJCF 2AHIA 4LBEA 1GMIA 1OXYA 4HIJA 3GSRB 3ZQWA 3AQYA 3GJFK 4JCWA 5JW4M 4L2YA 1DSWA 3CVBA 3U9UA 2VDLL 2AJVH 1TVDA 4PJ9B 1BJ8A 1TF4A 5I66B 1E2ZA 5T1KD 3BVDB 3NCEB 3NIDE 3BSZH 4HHGA 4N9GA 5D9SA 2VR3A 3VDAA 2XTJC 1GRWA 5BJTA 1OVZA 1XTLA 2LVEA 1K85A 2L7JA 1ZJBA 2A9NH 4D0CA 2BHZA 1PIFA 4F7EB 4RIRB 1A7OH 5AAMA 4A7QA 3L7FA 3WFEH 4X42A 4FQXD 2A77L 3PAZA 3ZE0B 2H7WA 1KCSH 4L3EE 2NY4B 2G0LA 1ASPA 5F6HI 2QKIB 4DP6X 5DJ8A 1O9ZA 4JM2A 3JT2A 5BZXA 3EGDA 4DGVH 1JAEA 2AGJL 3MRGA 3BT2L 2DYPD 5JHBA 1YN6B 3KWVA 2WVSA 2HMIC 3FTWA 2VXVL 4POZC 2HVBA 5EZOL 3DV4A 4F9LC 2YAMA 4M5TA 4D7BA 3CNKA 2C8NA 4PG9A 4M6MH 2F7PA 1G7QB 2OMYA 3RVXC 4JY4A 1KIRB 3ZHNA 2WAQA 3NZHL 3QIUA 4LFHG 3B2UD 5BRZB 3QEUA 3LTVA 1KJVA 3P0YL 3QEHA 4Y16B 5DZJA 1A64A 1RIUH 3WELA 3BZFA 1HEHC 1LK3L 2WXJA 5HDOA 5EEVA 4MKTA 4GJTB 3UO1L 1RJLA 4NGHL 3ARXA 4JG1H 5EOCJ 5F0LB 3EHBC 5AVWB 1ZHNA 4ZOCA 5EOCL 4DGWC 1HE8A 5CIPA 4S1SL 4TYUA 5LNDA 1AHWC 2ZNXA 3MLWL 2Y1AA 1NA8A 4IIQA 4LCUA 1A6WH 4NQCB 1N5AB 1YRKA 4F3FA 1LO3L 2W92A 3STZB 2X4UA 4ANXA 2D0FA 2IMMA 2FYYA 3FT4A 4DKFL 1YY8B 3QS3A 4XVTH 4CC4C 4X6BB 4UIKH 4WV1B 3VXOB 2H1PH 5FYKU 4Y5XC 2OCCB 4IBQA 4DKTA 4PJ9A 3ZE2F 4FEMA 5C86A 4OUOA 2ENQA 1BBDL 4KAQL 4WK4B 5D1XD 2EH7L 2EKJA 4FNTA 4ODTL 3TWYA 4JQIA 1P6WA 5TE7H 1N8OE 4M1GH 5C0AE 2ZONA 5I18H 3CIQA 1MFNA 5DUPH 1EZVX 1S78D 2CCVA 4PJDB 5JA8B 2BZ7A 3SDCC 1VF5C 5K9OB 1WIPA 1BZ8A 1HHJB 4JO8A 1DLHB 2DEWX 3NCYP 4YDKL 2RCSH 3LS4L 5BOJA 5IROA 3WXVH 2G2NA 3MRBA 4XBGB 3ORJA 1V3JA 2KLSA 4KRMB 4WHYH 2V3EA 4KZEH 3CLFH 4IRSC 3D25B 2C1OB 2X41A 3MHZA 4PLKD 3ZSTA 2BIQA 2YFOA 1YN6A 2O93L 2Y7QA 2YAFA 5MI0B 1YQVH 5E6RB 3S0PA 1SQ2N 1MCEA 5BV7H 5TD4A 4FKEA 4B9JA 4NKIL 3IT8D 4RDQG 4XMLH 4AKPA 5DMIL 1G7QA 1K2DB 2J5WA 1G0XA 1MHPL 1BGXL 4PWGA 1KIRA 3RUGF 4GQQA 3WFCL 4LMQE 1VZGA 2K7QA 3A6BL 1AZRA 2OMTB 5BRZA 2XN9B 2GSIA 5E6SB 5HHVH 3TEXA 3MGAA 3HIZA 2R9HC 4Y16A 3W9EB 3VXSB 1NOFA 2V8LA 2NUPB 4HOMA 3VFTB 5GS1C 1JZ8A 2K6WA 1JP5A 4KH2A 1K9TA 1XL4A 4LLAA 4QYOB 2CGRL 3DYMA 1VHPA 4U33A 3WFDH 3KH4A 4NQCA 1N5AA 1WE5A 3STZA 4PGEB 1YY8A 2ZKWA 3ZYZA 4X6BA 4DOHB 3ISWA 4HC1L 3NQIA 2XWEA 1R3LB 1NIEA 4XCCL 4XMPH 3TCXA 3MLYL 1A47A 1OP9A 4HGWB 5E4EC 3V10A 1BJ1H 2X1XR 2H4EA 3LMJL 1KCUH 3H3BC 3BAXA 1A1OB 1RULL 5FYJL 3RTQA 3H1ZA 1BQHB 3SOTA 2WQUA 4FQ2H 4OJFH 2DQTH 4OCMC 1H5BA 1W8EA 3D4YA 3WLWD 3RKDC 2W94A 5E94A 2RQ8A 1A0QH 3B83A 3MA9L 5K9OA 4G1MB 2GTWB 2NQ3A 3F7PC 1HHJA 4QGTA 1DLHA 2GI0A 2ADJB 2IQAB 3EGSB 4PRPA 5CJQH 4C4BA 1WHPA 1PX3A 3FRUA 4XBGA 1AZZC 1CGTA 1KGCE 2JELL 1R75A 2R0ZH 3D25A 3CVHH 2C1OA 1KN2L 4XHJD 3D69B 4TF4A 1OSPL 1T7XA 4GW5B 4BQ6A 3RDTD 1OARH 4ZUVA 5AVRB 3FOMB 4I13B 3BMWA 2ZPKL 5DD1H 1NUNB 1WLHA 1K2DA 5BZWB 2OL3B 3NFNB 1USQA 4W6WB 1SVBA 2EDRA 4NNYB 3FT0A 3FC8A 4PBXA 3JBG7 3W1ZA 2XIBA 2OMTA 5HHOE 2G9KA 1AOZA 3II3A 1CIUA 5CJBA 1S7QB 3LPGA 4XH2B 3PQYD 5BW7C 3ECQA 1A4KB 5JO5B 4YGAB 4PRHD 3UYRL 2NUPA 3CFKA 3OV6A 3VFTA 3QJVB 4PYHA 4YDZA 2AJZB 3S9DB 4H0HB 4QCIB 3ARYA 4GRWH 2D7TH 1NGQL 1X9RA 4ZODA 1RAMA 3EOBB 4HAGA 4K3JL 1CL7L 2H2SC 3WKPA 3O6FD 3MBXL 4LHUA 2YD3A 1X3DA 2H6OA 1X9LA 2D4DA 4M02A 4PGEA 4OGYH 1CGWA 2AJ3B 2XC8A 4LSUL 3FUNA 3S8WA 3ARGD 3QUMH 2X4TB 2QDWA 3OKNB 1N9PA 4RMUA 3MYZA 5EBLB 4HGWA 4NM4H 4JDTH 1JHLL 3RWEB 4H8QA 2YKLL 1A1OA 2ZUUA 5J1TC 5IVZB 4AL8C 5ANMB 3L9EA 3MLSL 4O9HL 4P9HC 4TQEH 1G6RH 4BJLA 3TJHD 4Y5VB 3DX3A 3EO1A 3IJ9A 4R83A 1FHNA 4XXWA 5I0XA 1WICA 3JSSA 2CUHA 2UZPA 4ONFL 5DUJA 5C0EA 5INDB 4YSDA 2GTWA 4M4RB 3S4SB 3SGEI 3U46B 5E70A 3OJ2C 4KNUA 1P53A 4Z7QF 3NJMA 3BGAA 1TLKA 3BESR 1UYWH 3R0MA 4NHCL 5I2IA 3GMQA 1GSMA 1N59B 3TM6A 4BK8A 1P4UA 2XTSA 3JWOC 1JF1B 2IBZY 1KWKA 1INEH 3J8F7 4GW5A 5CD5D 4X6DB 3HLAB 5DMGC 3NN8B 3FOMA 1NLDH 3ZGHA 1DHKA 3FTUA 3CQFA 1ZHLB 5EU5B 4JN1H 3BH9B 2ADGB 5SWQA 2XQ0A 3NT0A 2OP4H 3NFNA 3QJHB 4HHAB 3TESA 4BFGA 5I1HL 1YNKL 3FN3A 5EMYA 4NNYA 2VITB 4Z78A 2R2EB 2VN3A 2YOCA 3HG1D 5C7ZA 4XH2A 5ITBL 4IGBD 5FO2A 4J3OD 1A4KA 4H8VA 5JO5A 4U6TA 3FU5A 3GS4A 1QTYT 3LQMA 4G8AC 4G8IB 1OT2A 4N28A 5B39G 2XZQH 3ABGA 1MRFH 1QBAA 4ZS7H 1Z3GL 2AJZA 2W0FB 5CR8A 4QCIA 5GGQL 1UOWA 1E65A 2O1AA 5F93C 4A2DA 2H26B 2Q5BA 3T2QA 4Z7NE 3CDFA 4PJAE 5CFHA 5JPNB 1JDDA 2VZSA 1KCBA 1DQDL 1A14H 1TEGA 1EDQA 2G4GA 1K4DB 3FRPG 3RGBA 5JYLA 3MFFB 3VXTA 1A9VA 3BVWA 1I8MA 4HP5A 4R2GB 1XGRB 1IFRA 3HS0B 4Z7UF 4J1UB 4JMNA 4KHXL 4Q14A 3OKNA 4UT9H 1EAPB 1G9NC 1SJVA 5DVOA 4BZ2A 1KLGA 4NNPL 4B50A 1DJZA 3I75B 3CH1B 3GSUA 4KRPC 3RWEA 1J9SA 4KQ3L 3CJJA 3S3DB 3MLXH 5IVZA 4ES9A 1K6QL 2NLJB 4BYHA 5IFHL 5ANMA 4PJ8D 4AMKL 1FO0L 1NMAL 5LLIC 2JKWA 4QGYA 3EZ8A 2EDBA 3X2QB 1X7TA 4Y5VA 4G82A 1ZRUA 2CRIA 1IV8A 1WAAE 2VE6B 1DBKH 1QATA 4UAHA 2AANA 2MJWA 4ZPTB 5INDA 3KDMB 3ML9A 2OYMA 3SE9L 3U46A 3TA3D 4E5XB 2NYKA 1UATA 1LVEA 1QSFE 3ARBC 1S3RA 2DDQL 3IB4A 3LEYH 4G72B 4KX7A 2GI7A 1N59A 4Y4KD 2MCMA 3X14B 2B4CL 1OGPA 2VC2H 5JZ7D 4ODSH 2VLLB 4U31A 2IANB 2XTJE 4OCSH 5FGRA 2XIIA 4M8RA 4Q0XL 4X6DA 3HLAA 3U2JA 4JLRB 3V0JA 3NN8A 5IK3B 3Q0HA 1OGAE 1MFCH 4QI3A 3MBEC 4MCYB 5A3ID 5EU5A 4UOW1 3EOYG 3BH9A 2ADGA 4KKLD 4U1JA 2BY2A 4N6RB 5IBUB 3AY4A 3WFZA 2AJSL 3QJHA 4HHAA 2E4FA 4LEBA 2APVA 1E6JL 2VITA 2IPKB 1OAYH 4P59L 2PXYC 4QHMB 3NA9H 2ADYA 4AIXA 3Q1SL 3VYPA 1AZVA 5HHME 2JJVA 1TQUA 3VGDA 5IKCB 1FFOB 4G8IA 5IFAH 1TNMA 1V3MA 1P1VA 1L9QA 3LEXB 2W0FA 4BQ9A 5CO1A 2AXFA 3V4LA 1HXMA 5CEZL 2N7AA 3WTUA 2I60L 3CCHA 2H26A 3MJ6A 1IKNA 1WZLA 1MCSA 2ID5A 2ZYIA 1PTZA 4JEGB 5CILL 1K4DA 3GGWB 4UDTB 3MFFA 4BKTC 1TQSA 4C57C 2V8MA 4QRPD 3QO1B 3L1EA 1E4HA 5B38G 1E4WL 2JH2A 1C16B 3BVXA 1XGRA 3VVVA 3HS0A 4OJCA 4P46B 4J1UA 2BS8A 4AYSA 1EAPA 5F3HB 4HQQL 1OQXA 4HF5L 3UG4A 4N87A 3CH1A 4FG0A 1KCVH 3U1PA 1CUOA 5FYJE 1SHSA 2NLJA 4YDIH 2AABL 4ZD3L 1G7IB 2BOCB 2J6EH 1J8HE 1NBYA 2CBTA 1O7SA 4LVOB 2P43B 2PWGA 3K4DA 4ZPTA 1VAHA 3ZN6A 4A6YL 4BWWA 3THMH 3KDMA 4YDJB 4MXWL 4B9FA 2CO6B 4JFEB 4RRPM 2FK9A 2R1YA 5JW3H 2DI8A 1JWUB 3SY0A 4JHZA 3V55A 3X14A 5IB4A 4PWEA 4KMTL 4WJG3 2P5WD 1BM7A 3VWKD 2VLLA 4ANKA 1VJSA 2O6DA 2VLJE 1USZA 4E41E 3DROB 3QDJE 4LFHD 3HG4A 1B4JH 1QO3B 4TUJB 3H6JA 3MV11 2E9GA 3UAJA 5I1CH 1NOLA 1OZUA 4MJJA 2R1XB 3TVMD 4LXFA 2NY6D 4N6RA 1QFWI 4Q52A 4WW2B 2PCYA 3V5HB 3HW7A 1QKZH 4V11A 3VFUB 1U3HB 4G9FD 3MREB 4QHMA 5F9WB 3TX4A 4EDWH 4JE0A 4HA1A 5IMKB 1JERA 1CFSB 1IVTA 3DK0A 2DBLL 1I9IL 5F8RC 5AG8A 1FFOA 5DS8A 3U4KA 4PM1A 2ENYA 3LEXA 2J44A 2YC1A 3DRTB 1RXLA 3D3VB 2IQ9H 1LO0H 1P69B 1UZGA 3TBBA 2WKGA 5KYUB 5F89B 1KULA 1X5IA 4UDTA 4Q9RL 4NS0A 1OOAA 4JFFD 4KNSA 4U0RC 3NFSL 3QO1A 3HFML 3KYAA 3BZ4B 1C16A 1T3FB 3QG6B 4MX7A 4P46A 4XP5H 5C6TH 1SZNA 2JJUA 4WWOA 5DVNA 3B43A 1OHQA 2I7SA 4L9LB 2MSPA 3QJFB 2DQIL 4HETA 4FFYL 1BFVL 3ZL2A 3MRLB 5EUOE 1GOHA 2A99A 4KJQC 2V33A 3B4NA 4M3HA 3QQDB 1G7IA 2BOCA 3HRZC 1VFAB 3IU4H 4X9YA 4M8VA 3HN8A 5HI5D 3RX9A 3HZMB 1BQHG 2YJLA 5E6IB 1ODUA 4ANWA 4WEUD 1T21B 1DLFH 1OK0A 2D73A 4QXGH 2CO6A 3FU9A 3WY3A 2CJUL 3LEVH 5L6YH 2YQ3A 5C09D 1LEKB 5F97E 1CD0A 2LOEA 3FN0H 4YHKL 5I76B 1H9VA 1JWUA 1LYQA 4OIIH 4DW2H 2OFQA 1IAOB 3C60B 4MQSB 4YZFF 4YR6B 2IBGA 5FGCB 3DROA 4UB0L 1HINL 3LN9A 1NAML 2CMRH 2P52A 4H44C 4TUJA 1J11A 1CR9H 2QTEA 3IVKA 4KXDA 3GSNH 3R0NA 4C56E 3FSAA 3FCGA 1YPZB 2CO3A 4WW2A 2N7BA 3V5HA 2DN7A 5HYSG 1OV8A 1U3HA 4MS6A 2QMKA 3MREA 3LPWA 3GMMA 4KJPC 1TQVA 2GJ6E 3HG3A 2ESVE 1T6WA 5IMKA 3QHTC 3OR6B 5FK9B 1CFMA 4AGNA 3GBNL 5KW9H 3FW6A 1XGTB 3GXNA 2X05A 2QPEB 3IGFA 3EH1A 1YEHL 4PD4K 1E50A 5I82A 4KQ0A 2WV3A 4AZ8A 3DRTA 1NINA 2ZG3A 3FO1B 4OFDA 3SE3C 3ULUH 3OHXB 4ERSL 3UERA 3FQNA 2CJ3A 4NUMA 5KYUA 4KO9A 2VH5L 2FGWH 1QR4A 1WO2A 3MLRL 3AXLB 1A22B 3UTTD 1HAUA 4PJFA 5AW9B 3OQRA 3BZ4A 5AB0A 1EERB 1S7SB 4OZGB 5SWZE 3GSVB 3QG6A 4NXSA 1KXVA 2BDNH 3TJPA 3GEWB 5J6GB 1ID5I 3KE0A 1TPXC 1OP4A 2HRGA 2V2WB 3W0WD 2E7LA 5B22A 4L9LA 3QJFA 2FQDA 1N6VA 4LSRL 1ZKAA 3H53A 5EDSA 1JL8A 3MRLA 4HWBA 3EFDL 2YGOA 1UA7A 1XV8A 2WZPA 5I19H 4AUJA 5I9QB 1MFBL 1VFAA 2VQ1B 3POHA 1WA1X 4X5RA 1UZ6F 5C0FB 2Z65C 1K5NB 2DI7A 4OCXH 1ZA3A 2X7LB 5E6IA 1MEXL 4ZOAA 4ZK8A 3V4PH 4LOVA 2K6YA 3M7OA 1IEBB 3BPLC 3GI8H 3V95A 3VGAB 4NZRL 4QKTA 5E56A 5KSAC 1YEFL 1QRNA 5I1JL 3VM5A 5JHDA 3S4SG 3AUVA 2P45B 1MFDH 2P5ED 2WXFA 3G9AB 3C60A 3U9WA 5HGGS 1RMFL 1W8OA 4FG4A 4PUBH 3GLEA 4YR6A 3SQOL 3EJTA 3QCTL 1HN1A 5HI4D 1X6LA 4YHOL 3FB5B 4PS3A 5D1QE 4IJTA 2WXMA 2AZAA 5DWPA 4ZUSB 5J7CC 5L88H 1MLCB 3HE6C 1GOFA 1YPZA 3C9NB 1FIGL 4AW7A 4PRIA 3F05A 4JKKA 3GHEH 3EW3B 4KKCC 5A2IH 3K80A 3KMDA 1MNNA 2M8XA 1O9VA 4YSOA 2NY2D 3WIHH 4HT1L 2N1TE 5EUKB 3OR6A 4F8LA 4QYAA 5FK9A 1A7QL 4ICWA 1MNUH 1YJDL 4IJ3C 1BF5A 2CBMA 1T2XA 5IHZA 3BN9D 3QZWA 5AEAA 1XGTA 2E59A 5CJOL 4JGMA 3VSVA 2AVFA 1XZWA 1G0DA 4TQHA 1LO4H 1Q0XH 1JF6A 4G8GA 3L4TA 4S1RL 5AAWA 3FO1A 4BFIA 2VDNL 1ZY9A 4Y4HD 3CSFA 1V7ML 3OHXA 4NM8H 4ISVB 43CAB 3EYSH 1NQBA 4L3AA 3BCFA 4PBDA 2EDWA 3IDNA 2MHAB 3ABZA 5T1LB 3AXLA 4AZUA 3QJSB 3BLBA 1F3JB 2DKMA 1ZHBB 4AVIA 1KELL 1QAWA 1S7SA 3CMGA 4C55A 3GSVA 1IO4C 1VZIA 2BINA 4FYRA 4P23D 2AJXL 4FE9A 4IBWA 1AY1L 3IS1X 3L4WA 1AGFB 3QXUA 1D9KD 4TM9A 2Q7AA 3NEOA 1XXDC 3T04D 4ZMZA 1FLRL 5AVXB 3SODB 2VZTA 3LDBB 1OQOA 1KLUB 2D8KA 4AYID 1TTFA 3NUKA 4EXPX 3MN8A 1S7VA 5KVEE 4PP2B 2FLBT 2PPEA 2VQ1A 3GM0A 5C0FA 1P7QB 3II1A 4N2IA 3PAUA 1NGYB 5T3ZH 2X7LA 2X38A 2DD8L 5TDPB 3WJLC 3L48A 5I8OH 5CLWA 4X6EB 2EO9A 2XY2A 3EJRA 3T4AC 3OAYK 5IVNA 5JW4R 3QQNA 4RMWA 5L2KE 1VPOL 3AWGA 1EFXD 3GM8A 4MB3A 2OR7A 5J9PB 3REWB 1YC8A 1C1EH 3VXMA 3L5IA 4FL4C 3U36B 4E5XG 4JZNA 4BCXA 2P8LA 1RP8A 3MDJA 2K8MA 2V7HB 2VW7A 4FQPA 4HGKC 1GOGA 3FB5A 5ALBL 2LTQC 4NN6C 2IOMA 3EF7A 1JZGA 1SY6A 1CDJA 4MDIB 3V8OA 1WWBX 4X9FA 3C9NA 2IDUA 2XZCH 3A23A 5D7EA 2XICA 1UB5A 3TH2T 1LEGA 1Z7JA 4BXSV 1TZGH 2J5LC 2B8OT 3FO0L 5AYTA 5F3BB 5F96H 1A6UH 2XI9A 1JSYA 1HZHL 2QZ5A 1CBVL 3TFKC 2O5YL 5EUKA 1F4XH 2E0PA 3WEBA 2F53E 1YEKL 2ZF8A 2YBRB 1FYTE 1O6SB 4EUPH 1BX2B 3BDYL 3MZTA 4TLUA 3QNFA 2E9WA 2BW5A 3WFBL 4L37B 1XF4B 43CAA 3N2JA 4YHMH 5I74C 4IW4C 4XCEA 3ML8A 1WWAX 5HI3D 1T04A 2MHAA 5T1LA 3QDME 1F3JA 1ZHBA 4FNLH 4OD3H 2A74A 4JKWA 4Y8DC 3UROR 2VQ4A 1HAWA 4BV1A 3LNFA 2CLZA 3KD4A 3UG3A 1E2WA 1E8WA 3NSFA 5DQDL 3KR3H 3M1CA 2FEEL 4PCYA 1E67A 2CLRB 3BSZA 3UTSA 1AQ8A 1TQWA 4WWKC 2D2OA 1P5VA 3GUFA 1ULVA 2IEPA 2O5NA 3EF4A 4WFHD 4E9WA 4DT2A 5GZND 1XX9C 1MCOL 1MIEL 2D9QB 5L4IA 4JFZL 2DM4A 3BIAX 3KJ4C 2NY4D 1P7QA 3D2UA 1TENA 1NGYA 1T80A 2CSPA 4AE1A 5FYLH 5TDPA 2EH8H 2QR0A 3B9VA 4MDRA 4X6EA 2MPAH 3P02A 5FKAB 1BYPA 3ZBMA 1A4JB 1IC4L 1VACB 1FZKB 5J9PA 5F7YC 3JVGC 1Q1PA 3I02B 4N0UE 3SHSA 4E0RB 4FGMA 3U36A 1PPIA 2OI9B 3AABA 4K71C 2XZAL 2DQDH 5BOPA 3H56A 2FJUB 5J11C 5LGJB 4N8PA 4RGMB 4M5YH 4MDIA 3CWGA 3KVQA 3TNMA 2HP4A 1N70A 4GT7A 2XXFA 3MO1B 4ZTPL 5SX5H 3SYPA 1XCTB 4U49A 2J8UB 1DQQB 1EPFA 1JD9A 5INCA 1CFTB 3ARTA 1PG7W 1S5HB 4PLJC 5JPMB 2A6DB 2G9HB 4JDZA 4FQXC 3KHQA 4OLUH 2YBRA 3QUXA 5E9NA 1O6SA 1TZAA 5TE4L 1SNRA 4WRLA 1CIDA 3FAWA 3H7LA 1BX2A 4PJIB 3WD5L 1BFOB 4U3HA 3T6VA 4LDCA 4M03A 4HFWB 1HILA 5DD5H 3WY4A 2K1MA 3EDDA 1JCVA 2KS0A 3PG2A 4L37A 1WP6A 1XF4A 1G9ML 3DUSB 1FZJB 3OMNB 3SBQA 5FUCE 1YN7B 1MFEL 3KNBB 4OF0A 3WEOA 2HUHA 5LNEA 4L05A 4J4PA 4XVUC 5D2LE 3WSQH 5HDBF 5JHMA 1YEDB 3VU2A 3MNVB 2ZAIA 3ZZ1A 4DO6A 2IAMB 4LVHB 5EU6E 4GAJH 2A4CA 3MOAH 5AL0A 4XHQA 2X44D 3ULSB 4FFVD 3U1QA 4ZUUB 3VW3H 3MJ9L 2QSCH 4KTGA 3B2UC 2CLRA 1FV1B 3WKYA 4M7JL 4K3EL 3FH8A 5L0QB 5AUMB 3LNGA 2Y24A 1QNZH 3L4ZA 2ZWZA 5CN1A 3QWNA 4QUOA 3GIZH 2QQKH 3KXFE 2QPSA 2D03H 4ODHL 5I24A 1F00I 1ZANH 3VUAA 4YE4L 2KZ1B 3LPPA 3P9LB 5L7XH 1A4JA 1QRKA 4YIQB 2WW8A 4LASH 1FZKA 4OQTL 1TQBB 1NCBL 4LCVA 4MA8H 3I02A 4XXDB 1QQDB 3CVHB 3SDYL 1DQLL 1I9EA 2XV2A 1FYHB 4AL8H 3OAZK 1QLEL 5LGJA 4NN7C 4P9HH 3WY1A 3ZTJG 1GIGL 4R96A 4AQEA 4CU6A 1S5IL 1N10A 4LCIH 5IQ9A 3K2KA 1PZDA 2CK2A 3MO1A 3FUJA 1IKFH 3MCYA 2XN9D 4OZHB 3LN5B 5D1XC 4FQ1L 4NQDB 5DYFA 3L3OC 1DQQA 1CFTA 1PCXA 1S5HA 4ZFGL 5JPMA 4CKVX 3VD2A 3VXSD 3G7TA 2G9HA 1JI1A 2YN5A 3JWOH 4N22A 1S78C 2Z31B 4KUZH 5F71A 4NJAH 2XVBA 3M17B 4PJIA 3KAAA 1QBML 4CAGA 1JYWA 4HFWA 1WS8A 5FKPB 5E2TH 2XBZA 1J9CT 4FQJL 1E5BA 1WUNT 3OKDA 3RY6A 2R23B 3F84A 1QYGH 3DUSA 3CFTA 2XETA 5CR1A 1MY7A 2I07B 1EA9C 4PLKC 5MERB 5E99L 3O4OB 1NMCB 4ZMNA 1FC2D 1VB9A 5K1JA 3KNBA 3DECA 3R8QA 4KJYB 3S8GB 1C8PA 3K3QA 2JB5H 3G6JB 1A1MB 4U3CA 3BDXA 1YEDA 4GMSL 1FPTL 4M93C 3QSKB 2BIPA 4J3BA 1CFVH 1H3GA 2IAMA 3A0OA 3IMSA 4XAKD 3D39B 3EH2A 1DEEB 2Y3AA 3HZYB 3DX2A 3KEHA 1ZGLP 1EHNA 1D5BB 3ARVA 4JFYB 2QGEA 4LESA 2E86A 4XBPB 3CVCA 2R51A 1OAUL 1SN5A 3LQZB 3VE0B 4XPBH 5D7LD 4ORZC 5DZLA 2D2CC 5AUMA 3V52L 1FA4A 4AQ1C 4HIIB 4RETB 5FO9B 1MFAH 5KVEH 3KPMA 4KZDH 1G6RB 3HB3B 3VFGH 3E1F1 4ZMVA 3RFZB 3AXIA 3PWPA 1NGPH 1E8XA 1YEEH 5EIQA 4JBSA 2XN1A 4P2RB 3LS5L 3SY6A 3UJTH 1N64L 3P9LA 2JJSC 4I48B 4NO0B 3OPZL 3O9WB 4YIQA 1QPKA 3ATFA 1FWXA 3VD9A 2F19L 1G9NH 2G5BB 2X09A 4R8WH 5B4MD 4APXB 1VEPA 2UXFA 4RISL 1IJ9A 2Y7LA 1IAIM 4XXDA 4Z7UB 3S48A 4XGZB 2UY7B 1QQDA 3L9RA 3MRRB 3CVHA 4F7CB 1A6TB 3AB0C 3ULVE 1GHFH 5MENE 3VDBA 3VMPA 4DQOL 2PW1B 3GT6A 1MXDA 1W72H 2GJJA 1WITA 3ZDXF 2X6CA 3QYMA 3S34H 1YNLL 4OZHA 3LN5A 4TVPD 3KCWA 4NQDA 4DFHA 2J88H 1QI4A 3BXNB 2VLME 1MFVA 1C12B 4XCNB 1BQSA 2BHFA 4XI5D 1GYCA 3WLWC 4U7MA 2CXGA 3KG5A 5IFJB 3LZPA 1BV8A 2GEEA 1MELA 5A2LH 3FB6B 5FKPA 2F7RA 1UT9A 4YZWA 5I6OA 3ENEA 2R23A 1F18A 1HI6B 3EBGA 1NANI 3KBPA 5MERA 4EIGB 5CGBA 5B8CB 2HFEA 3RDTC 1NCHA 4TVUA 3ZMRA 1OW0C 3FL7A 2Y72A 3G6JA 4XNUH 1A1MA 4JO1L 4Y19A 5I1AA 1XEDA 1T89A 1Z5HA 2V9UA 4FTVE 3TO4B 3S88L 4UTBH 1X5MA 4GQ9H 1JYVA 3HC4H 1J5HA 3CZGA 3FB8A 3NPSB 3D39A 3I85A 4YFLI 3HJEA 4ZSOE 3Q5OA 1DEEA 2WJ7A 3HZYA 4JFYA 1D5BA 1SLVA 2VZVA 4GI6A 5GGTL 4RAUB 2HZHA 4IMLB 3VFRA 2BXYA 1W2KT 2Y6TE 3VG0L 1Q0YH 2F08A 2OKMA 4HIIA 5DK0B 5EC2B 1NMBH 4MLSA 1G6RA 3ESPA 4ZW8A 1IGMH 3II2A 5IVXF 3RFZA 5IB5B 4PEEA 4JG0H 4RDBA 4FQIL 1BPVA 4L3EA 4PJ7E 2VKWA 4P2RA 5T1MB 3L08A 3OB0K 4NO0A 3O6FC 2AMGA 2G5UA 3O9WA 4J8RA 5T3XL 4X9GA 1IUZA 4APQD 4APXA 3AADB 3MSPA 1ND0B 4CDHA 5ADOH 3RWJB 4XPAL 1FN4B 1ERNA 2PP7A 4HVBA 4XGZA 2XACC 4MA1C 3MRRA 4X7FC 2VC2B 3HMXL 4F7CA 2ZKXA 4M8UA 4LCCB 1QI3A 4M9OA 1NBVH 1E42A 2PW1A 3TGXA 4UOJA 2YN3A 3P1VA 3SKOB 4AT6B 3L3JB 5LBSH 5CLYA 1J5OL 4HJJL 1C08A 1MDAA 4WTQA 5KZCD 2F54D 3QRBA 2HKHL 4S2SA 1DEDA 1A5FH 3CU7A 4KI5F 3H0TA 3VFSB 1HWGB 1I7ZB 2BNQE 5JUEH 2Z92B 1TDQA 3RG1C 1C12A 4XCNA 2BFGA 4J23A 5LDUA 4NC1E 5DFWH 5DXWA 4IOIB 2WVVB 3TZVC 5EIIB 4LCYB 1PZAA 5EFIB 5IFJA 1AKJB 2NZ9D 4IBVA 4W4NA 3Q8EA 1T6BX 1IEAB 5ID1A 4F57L 4UIMA 3FB6A 1WFOA 4X8CA 4MJ6B 3HUJB 3PXHA 3TASA 4QF1A 5GRWA 3CXHK 3QEGL 1BD2B 1KC5L 3FUKA 3RVWD 1HI6A 5ABZA 1MF2H 1N3NA 3ZKXB 4JFDB 5B8CA 2VQUA 2B14A 5CD5C 4MJID 3RILA 1VADB 2DJ4A 2EVGA 4ENED 4PJBF 3NBNA 4J12A 3TO4A 1IQDA 3LXBA 4XP1H 2WQWA 2WNKA 3DIVA 2PCFB 5D5ME 1KTRL 5CGYD 2WXPA 3VXNA 3SYQA 1G0YR 4X7SH 3HI5H 2F7OA 2DL2A 3HS8A 2YK1H 1IBFA 2B1HH 3VI3B 2ICWJ 4UT9A 3O2WL 4FXKC 4M56A 4NKDB 5L9DH 5DJ6A 4CN1A 1KT2B 4RAUA 1AQDB 2R29H 3X11B 1NFIB 4IGBC 3QZPA 4J3OC 5CP7B 5AVZB 5DK0A 3MKKA 4UV4H 4HXAL 4RWYH 4CJ1A 3AY2A 3P2TA 2FSEA 4MBOA 3VI4F 3ET9F 3BEWB 1JDCA 2YIHA 2ZXAA 2K70A 3DGGB 4WI4A 5HGDB 3VYNA 4NZTL 3FUFA 5JW4Q 4X99B 3MPCA 5T1MA 4JFOB 1O5PA 3KPPA 4KPHL 1UH4A 1X5AA 3HNVH 3BI9X 2R0WH 2IAND 1ND0A 1D6EB 1UACL 3BN3B 2NDGA 5E8NB 3RWJA 3GQFA 1JV5A 4U1LA 3HRPA 3OXSA 5D2NB 3V0GA 3QNZA 3SJVB 5KSBE 2MPVA 4DP9X 1AHMA 1M6OB 5HYFA 4PJXE 1XCWA 1JHKH 2FBJH 1XSJA 4G7YH 4OF5A 4AT6A 4KFMA 3L3JA 3X1EA 4HPOH 5HBBA 3BE1H 4K23L 2WZAA 1UASA 4WI5A 4O4YL 4PJ8C 3VFSA 2FIRT 4YQXH 1VRSA 2Z92A 4BA8A 4FZEL 1ADQL 5HHOB 4R7DA 2KLTA 8CGTA 4C8XA 3C5ZB 4IOIA 5DLLA 5EIIA 4LCYA 1AKJA 4LCWB 3FSOA 4AUUA 2D7MA 3AREB 1HYSD 1BVKA 1UCTA 3HUJA 2P28B 4WF7A 4J6RL 3RA7L 3K2MC 1JJUA 1SEQH 3TL5A 4FLSA 2OW7A 4TULH 5JZ7C 2CK0L 5AOZA 2CHXA 5B7EA 7TAAA 3QJQB 3MNWB 5DUML 4JPKH 1M2VA 4XWGH 1WHOA 1VADA 5A3IC 1GYVA 2OLDA 4UILH 4NT6B 1H8NA 1A6AA 2PCFA 4KKLC 4KX9A 3IN0A 4L8BB 3AS2A 3PGDB 3GXIA 3VI3A 2GIYA 4Q4IA 4Z95H 1PNCA 4RGNC 1JPTH 2NXYD 4BCZA 1KT2A 1AQDA 4KVNL 2PMZA 4PLOB 2DMHA 2C9PA 5CP7A 2Z0UA 4N0CD 2IADB 1MREL 4BZ1H 2X6MA 1XTMA 2P4AB 2J6EA 3BEWA 1CU4H 1UUNA 3LYRA 4JFED 5HGDA 2LABA 2X9WA 3DKHA 3HNSH 3R7QA 1IILE 1T2QL 1VFUA 2AQ3A 1KIQA 3HI1B 3KPRD 5I8CB 2HH0L 4JFOA 3MUY1 1N8ZA 1MQKL 3O81A 5AOKA 4PFEA 2YPLD 1RUMH 2P24A 5D72L 5SX4I 1YZZA 3SE8H 5E8NA 5D96B 1TQCB 2G3MA 1NPNA 4NWUL 1FNLA 2NR6D 4WWPA 5D2NA 12E8H 4JZJC 4RWHA 2VXQL 3WAJA 3SJVA 4I0KA 4HIEB 1M6OA 1WRFA 1PLCA 3LNEA 4TSBL 2R0LL 5AVYB 1IBGH 4P57B 4YWGH 5DC4B 1BQLL 3BVVA 4RMBA 3GSNB 3N9GH 4N3TA 1V27A 5PCYA 2XPYA 3B2VH 2AITA 4FOMA 1E5ZA 2NDFA 3IJ7A 3OKMB 4FEIA 4NI3A 5HHOA 4Q4EA 4YSUA 3C5ZA 3I2CH 3BQUD 4L8DA 4FN0A 1AG6A 4HUVB 4LCWA 3D3VD 4RESB 2I9TB 1CWVA 3AREA 1U8IA 4P2QB 5T3XD 3MGOB 2BFVL 4LIQH 1U2CA 3BGMA 4V1DB 3ZE1E 3LNDA 4PGBB 3VWKC 5BVJB 1EV2E 5D4JA 5KVFL 3MNWA 5AB1A 1JDAA 4KNTA 5ISZE 3O3BB 5DYOB 5I1KH 1HIML 1CF1A 3K4ZA 1FSKB 2Q9OA 4NT6A 2ZT9C 3ELAT 4Q58C 4L8BA 5DK2A 2NY6C 4KITB 3OQ3B 1E0OB 4G7VL 5IM7B 3PGDA 2QPUA 3CDCA 1RSYA 4JREB 3IPFA 2Y6SD 3E2HB 3FFCB 3VAEA 1UM5L 3O41B 3OLDA 1R0AH 1QEWB 1U4EA 2V9TA 3D09A 3R8BB 2DYSB 1WEJL 2J4WH 4L1SA 2J12B 2IFFL 5CMAB 5FHAH 4LF3B 5HSFA 1JZ4A 2EDYA 3M8OH 3VWJB 2ZSVA 1IAIH 2CIKB 3UIYA 3D12B 3V4PB 4WEBL 4GUCA 3AACA 1Z66A 2BHUA 3NIGF 1QUNB 3P30H 4WFFD 4WKZA 1A2YB 2VDKL 1JI2A 2D7NA 3CXDL 4TPRH 1F5WA 3SDXE 4M4PA 2H0EA 3GRBA 3MTRA 1N7MH 4XVSL 4AQ8C 2ZCHL 3OKEB 3O8XC 4FAAB 4ZMLA 4X8GA 2DIEA 4OF7A 5T1DL 2FO1A 5A2CA 3N55A 1IM3B 3GSNA 5FX3A 3V7AG 3P0GB 3VRJA 4FP8H 1CE6B 1CLZH 2Z8SA 4WU7B 5I71C 1TYJA 2QT6A 4LRIC 3A6OA 1IBYA 5D7IB 3C2SA 2R8SH 2IH3B 3OKMA 5ETUB 2BZDA 4A2GA 4A2MA 3ZDZF 5CHNB 4HUVA 3FSZA 2W9EH 3QDGB 4QXVA 4XP6L 2OW6A 2VR4A 2I9TA 2HKFH 5BXFB 1V7NH 4NRZB 4UCFA 1F11B 2IWKA 3R19A 4DWHA 4N25A 1S7UB 4P2QA 3MGOA 1INDL 5DO2D 3RL1B 5DDHB 5DK3A 3FPXA 1YA5A 1DSFH 2Z6FA 4PGBA 5HVFB 4M6AA 5BVJA 4FERA 4GSDH 3CU1A 1HZLA 1E8YA 1R3HB 3HE7C 1NSNH 4TRPL 5HXMA 1I85A 1UWEH 2DTMH 3NP4A 1Z3RA 4GQPH 4AGLA 4QKXB 5IM7A 1SDYA 2WZ6A 1D5RA 2BLFA 1EXUB 2Z0BA 4PJGB 4R90L 3WJJC 3UTPE 3FFCA 1MI5E 5D1ZB 4DK5A 4AX3A 1AXSA 1DVFC 2XV3A 4JPIA 2AXHA 7PCYA 3FCTB 2XKNB 3O41A 3EHBB 3EYOB 4XNZC 2WHVA 1BAFH 5EZJA 1T1WA 3DUUB 1AHWB 2PYEE 4Z6AT 2L7UA 7PAZA 3QYNA 4LF3A 5IHUH 1WAAA 3VWJA 2CIKA 3V5KB 1HSAB 1KPUB 3AWFA 3V4PA 2WXRA 3CHPA 4P07A 3T0AA 3U0WL 3PV6A 1AZBA 4LQFH 4JW3A 1P4LB 3D07A 1QSFA 4Y5XB 1FE8H 5C0IA 1KENL 4LARH 1IC5L 1P9MC 1EGJL 3WKML 2CUAA 2YMXL 2D7QA 4G83A 5M7QA 1CD8A 1V3KA 4MJ5B 4F7KA 2DLGA 1OGSA 4JG5A 4PRHE 1DVQA 1F8TL 2WXGA 3AG3B 1IM3A 3QPQD 3CPUA 1CE6A 2JXMB 4WU7A 3W2DH 4HHWA 2YA1A 3SDCB 1ORQB 5DVMA 1U6AL 3ZMNA 1EUTA 4G6FD 1JPFA 4NFCA 4N90D 5D7IA 4L0PB 5ETUA 4C83B 3WIHA 2J8OA 1I3UA 3BC9A 2I32A 3VXUB 4R4ND 5CHNA 3QDGA 5DT1L 4O02L 5CZRA 5BXFA 4ENZA 1E5AA 1XXFC 4NRZA 3EDKA 1F11A 2XRAH 1S7UA 2XA3A 1NC2A 5JOFA 1H0DB 1Q8MA 3PRZA 5DDHA 2IC2A 5AFAA 1NEUA 4L48A 3RU8L 4F9LA 4Y2LA 5EF1A 2QJDA 1CLVA 3QARA 4M48L 4MWFB 5IEHB 4KWUA 2DYRB 3CZNA 1R3HA 3L1OH 1FVDB 5HI4C 1NGWA 4P4KD 1BJMA 1XGPB 1YC7A 4JQVC 2UY6B 3T4YB 2Y23A 1ACYH 1SMOA 4XPGL 5DWUH 3NIDF 2MQ0A 1IFHL 3WKQA 4OFIA 5D70L 3PUUA 2EIJB 3TCLB 3PIQB 3DX7B 1RH8A 4BHUA 4PJGA 1KCRH 3MV7E 2WUBH 1PVHA 5IJBC 3O4LB 3S5LB 2NY2C 5CZXC 1JNHB 1A7NH 1FNAA 3FCTA 1K8IB 1DUZB 3BN9C 4DH2A 1F90L 2F9BT 2R4SH 4AEIL 3DUUA 3PNWB 3I74A 1J8HA 1AHWA 2PABA 3UO8B