2VR6A

Crystal structure of g85r als mutant of human cu,zn superoxide dismutase (cuznsod) at 1.3 a resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
153
structure length
153
Chain Sequence
b'ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLRNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE [CU-ZN]
publication title Structures of the G85R Variant of Sod1 in Familial Amyotrophic Lateral Sclerosis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 40
structure length 153
sequence length 153
chains with identical sequence F
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2008-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2vr6A00
1B4TA 3F7LA 3RE0A 4A7QA 4B3EA 3HOGA 1SXZA 4A7SA 2ZKWA 2APSA 1Z9NA 4A7GF 3CQQA 1HL5A 5KBKA 1SDYA 3S0PA 1MFMA 1SRDA 2VR8A 1BA9A 2AEOA 1SDAB 2C9VA 1QUPA 3L9YA 1YAZA 2WZ5A 1JCVA 3KBFA 2JCWA 3GZQA 2Z7UA 1Z9PA 2R27A 3KH4A 1FUNA 1Q0EA 1SXAA 2V0AA 3GQFA 3PU7A 5KBMA 4A7GA 4U4IA 1XTLA 1SXCA 4MCNA 4MCMA 1N19A 2ZOWA 4FF9A 3SODB 1OZTG 1BZOA 3ECVA 4N3TA 5KBLA 1JK9A 1ESOA 1COBA 3GTTA 3HFFA 3GZPA 1S4IA 1CB4A 1EJ8A 1DSWA 1UXMA 2JLPA 1SOSA 2WWOA 1YSOA 2XJKA 1UXLA 2AQRA 2LU5A 1E9QA 2GBUA 2C9SA 3ECWA 3KM2A 2Q2LA 1JK9B 2E46A 2WZ6A 1F1DA 2Z7ZA 4A7TA 1IBFA 2XJLA 1PTZA 1F18A 2Z7WA 1E9PA 2GBTA 2VR6A 4L05A 2Z7YA 3MKGA 2NNXA 1DO5A 1OAJA 2C9UA 1CBJA 1AZVA 4OH2A 1E9QB 1HL4A 1B4LA 3QQDA 1XTMA 2AQQA 2AQPA 1E9OA 2VR7A 2WYTA 5CU9A 3GZOA 4A7UA 1PZSA 1SXSA 3CQPA 3L9EA 3KM1A 4A7VA 1TO4A 2WKOF 1L3NA 1E9PB 2AF2A 1OALA 1IBHA 4N3UA 1RK7A 4BCZA 1IB5A 3H2PA 3F7KA 2WZ0A 3GTVA 3HW7A 1E9OB 1EQWA 2WWNA 2E47A 2AQNA 2WKOA 3CE1A 4OJAA 2AQTA 3H2QA 2ZKYA 3LTVA 3T5WA 1IBBA 4BCYA 1F1AA 2AQSA 1TO5A 1PU0A 2SODB 1F1GA 1SXNA 1P1VA 3KBEA 1KMGA 1IBDA 3ECUA 2ZKXA 3KH3A 1OZUA 1SPDA 4BD4A 1XSOA 1YAIA 2GBVA 3MNDA 2WYZA 3K91A 1OEZW 2K4WA 1N18A 3QQDB 1U3NA 1SXBA
chains in the Genus database with same CATH superfamily
1UM4L 5GIRA 3EYVB 4HK3J 5EU6E 1ZV2A 3ROOB 5A7BA 4L3EA 4DQOH 4ODBD 1A5FH 3S0PA 4C4KT 2VXTH 2XA3A 3S3PA 1KXVC 4GKLA 4FXGC 4OZGA 4NQEB 2CGYA 3V7MA 3BIAX 3LPPA 5DJ0A 1AVAA 4F8TA 3IE9A 2ZAIA 4KMLB 1REIA 5HDWA 2Z7UA 1Y18A 1I8KA 3GI8H 4B9KC 4P04A 3HRZA 3RJDA 5JQ6H 2R69A 3L7EB 2ARWA 1BYNA 1JRHI 3NIFF 1SJXA 2RQ8A 1N19A 2JKWA 2DWYA 5CFHA 1U8PA 2DN7A 1E4WH 4JG1H 4GKSB 4NB7A 3ZGHA 5J1TC 5KEZA 4X2UA 1NWPA 2WINB 1QEXA 3CZSA 4JJ5A 4WWNA 5JXED 5C0CE 4WFGE 3FO2B 2YC1B 3AGWA 1FJ1A 2JJUA 5D1QE 3BD4A 1GSKA 4OF6A 1QOKA 1QWNA 3P30H 1AD0B 2H3NB 1FFNA 1BVNP 2E9WA 3TXAA 4O51A 2XN2A 4ZUSB 4KO6A 5EDXA 2BHYA 4CVWA 4LSDA 2I7SA 4UAOC 1P0SE 5CZXC 3VD4A 2CHNA 1WGOA 2FCBA 4MSWA 4IBLT 1CICA 1IKFH 5A2IH 1KN2H 5GHWH 2VDLH 2W38A 3QRGH 1G1KA 4Z7UF 4L8DA 1LO4H 1C5CH 2YQBA 4RETB 4XAKE 5DHVB 3WNPA 2XSKA 3WFBH 5B4MD 4EI5D 2VN7A 2Y1YA 3EYUH 3W0WD 4HHAB 3RA7H 3KDMB 4S10A 2G60L 1QUNB 1C08B 2A77L 1X9LA 5I16B 4NZJA 1Q4NX 4JLRA 2I26N 4LNRA 2NY6C 1NCJA 4LIQL 3LNEA 2VABB 2ITCA 1DR9A 3UAFA 3AUWB 4FZ8L 2DMBA 1SJHA 3PLYA 2QHRH 4BWTA 3UTZB 3BH8A 1BM3H 1XD0A 3SQBA 4M5SA 5M95B 3RKPA 1UWFA 1URZA 2IMMA 3RBSA 3IMBA 2EIZA 5FV2A 1VGEH 1THCA 2WYZA 4MA3A 4R4BB 3B6SA 4XXDB 2FATH 2XXGA 1M57B 1P9MC 3P0VH 5BS0B 3HMXL 1D9KC 4N20A 2QGBA 4M1GH 2ZXDA 4DSYA 4YEFA 1WA2X 4GRMB 3QUGA 4X9IA 4K5LA 3IU3A 5T3ZL 4DP0X 2J43A 2EC9U 4HS3A 5LAXB 3BGMB 1G43A 3NCMA 4UYQA 4MAYC 5AW4B 3VXNA 5F44A 4V1DD 1M7IA 3MV7D 4ZW3A 2MKWA 1E3FA 1OTUC 1ZSDB 3DO7B 4LAQH 1NFDA 4LPTA 4R90L 3HE6C 3QCVL 3QJFA 3QUML 4Y8AA 3L9BA 1M7UA 1QRKA 3K2UH 4LOFA 1A3LH 3C09B 3FB8A 3L5XH 3VXUB 1QKZL 3C5JB 4IRSB 3JTBA 5FO2A 3QQ4B 5D71H 4XMLH 1MXGA 2QVMA 4CUCA 1VDGA 3IU4H 4KNSA 4Y4FD 4WSGA 4HIJA 4XXWA 1E2VA 4C59B 1T20A 2AV7A 3B2MA 1T1YA 4WWKC 5DD6A 2GTWB 2YD9A 3PQYA 3MO1A 2WLLA 3WDHA 3REWA 2UWEB 4MA7L 2P5EE 1SJEA 3CU1A 4KTYA 3T1FA 5CF3A 1MCWM 3KYMA 3QUZD 1QP1A 4CU8A 1U3HC 1UATA 1AOHA 1URIA 4N8CL 2E86A 3MCLH 2V2WA 4OCSL 2XJLA 4G59C 1JZIA 3ARBD 1QYGL 3PDOB 2GTZB 1MG3C 2XQYK 4FHKA 4BSWB 3O3AA 5C7XL 5LG6A 3FQNB 5A2KH 2VMFA 2ZAHA 4PMFA 3COOA 4Y5YB 3QWRA 4GJTB 4MXWH 5KS9E 1ONQB 1W6WA 3JWDL 4OFYD 2QMJA 1R3LB 1XAUA 3RAJH 2ARJA 3H0TA 4HT1H 5HYFA 3KM1A 2AEQL 4MNGA 2VGLM 2XN9D 3S35L 1JZFA 5DHYB 1RLWA 3NA4A 2I5YL 1I3GH 1QTSA 1BJ1H 3D05A 4PLKC 3V5DA 5AAWC 3UX9B 3BZFA 4F57L 2F58H 4JY6A 4TLUA 5T5FA 1FNAA 2NQDA 1O9WA 3BRDA 5LUMA 4Z23A 1B0WA 3LKRB 3NN8A 2PCXA 1K6QL 2YMXL 1XF3B 3KHQA 3CN3A 1TMQA 3T0WA 1ROWA 1T04A 3N1QC 4HJUA 3REVB 4F2FA 5C92A 2FZ3B 3CFTA 4Z3IA 1GS8A 4GKNA 2WXJA 1E7UA 3C8KA 1XVSA 3H9HA 5D1XE 4P23A 4UT9A 3PS6A 1BYPA 5CZRA 4HWEH 3FQ2A 5IB3A 5T3ZE 4GIOA 2DM7A 3FRPB 3TT3L 4CSSA 1IE4A 1NSNH 4OKVB 2XIDA 4UNIA 5LN4A 5E03A 4R7VA 5A6MA 1B4JL 2CA3A 3HMWH 4ZO9A 3UIZA 4KJPC 4L4VD 1FCGA 3AMLA 3O6LL 4AYFB 2FWUA 3U0PB 4Y1AD 3HLKA 3TIDB 1OP3K 4IOFC 3P9LA 5KYNA 2NY4B 1D6EA 1SBSL 2YD3A 5TDNB 2XWRA 4N2CA 3DPBA 5IBUG 2ZOWA 4Z7QB 3KJ4B 4HGWB 4YH6A 4IK7A 3RGVC 3CFUA 1DDHA 2AVGA 2H41A 4YSOA 5AB2A 3EUUA 3HC0B 2WKGA 3WENA 2DTMH 3FTGB 4M61B 4CC0A 2VC2L 2AJUH 3HG3A 5F0MB 5GRXG 4UAHA 2G0KA 3IWVA 2Z65C 1E6JH 1RCYA 3CZLA 5G5DB 2X4SB 5GGVY 2YPLD 2WVUA 1Q0YH 5L8JB 3CPUA 2MQGA 1T83C 2WJ5A 2WZ6A 3STZB 4HWZB 4PJ5E 4D9RD 1KBKA 3P9MB 1FL3A 3HPLA 1ZAGA 4FHBD 2YLHA 5KSUB 3C6SA 3V0IA 1UWEH 1X5HA 1CTOA 2CAKA 4XMKH 4XP1H 3L4TA 1ZLWK 3LRSB 4XE0A 4PRIA 1OIOA 4H0HB 3VGHA 1DVXA 1Q9KA 2OW6A 5CJBA 3FQ4A 4TMPA 4FTVB 3R4DA 4XODA 2FX8H 5DMJB 2VDPH 5LBVA 2DQUH 4U1HB 2LOEA 3RIFK 4G6KH 1YCSA 2VLKB 2VL4A 3DX9A 2NY2D 1WTLA 3EH5B 5F7DB 3B83A 5IWLA 4YHPB 3WEOA 4EUPA 3FRUB 1OVZA 1UA7A 1IAKA 1A4BA 4AT6A 1W80A 2PCFB 5CEZL 1WD8A 2X89A 2EDJA 4RVBA 2VUKA 4K0OA 4O2CA 1OCCB 5C97A 1KLGB 2W94A 3LNDA 5B3SB 1OWRM 1NCUA 4K3EH 4W68A 3WJLA 4F37F 1N64H 2J25A 4XO4A 2XDHA 3L3HA 1ZGLB 3K6NA 2Y36H 3LD8B 3PP3H 4JPWH 2OXGB 3APCA 4ZBJA 2UX6A 4JRXA 2IDQA 3GPSA 3KBEA 4MFHA 3ZDZB 5KS9F 2O6EA 3QFDB 4G9DA 5CN3A 3ALPA 1HQRB 3HHSB 3WAJA 1NCIA 3K91A 2BVPB 4KGJA 3SKNA 2J2ZA 1OEZW 2ICEA 3ZLQC 3L3DA 2APVA 3LKPB 2AJSL 1U3NA 2YD0A 4QUOA 3O4OC 2QSVA 3MROA 4M7LL 1KLFA 2H9GA 4KVNH 1ACYH 2OR7A 3DOHA 4E9VA 1PGRB 4HLZG 4PRBB 3TT1L 1AC0A 3VSVA 4Q9CA 4OF8A 3WIIH 3VMPA 4ODVH 3DX8A 5EV7A 4DCQA 1LEIA 2P5PA 3MV8B 1IGTB 2RFXA 4KMTH 3HZ3A 3Q7JA 3G6DH 4MYWB 5I2IA 2A9AA 2FO4A 4LVOB 4KDWA 2QGDA 4U1IA 2CMRH 5TF1L 1YDPA 4FMKA 4PJGE 5GXBB 5JHBA 3LS4H 1P53A 1PJWA 3SE4C 3UG5A 5I18L 4IIQC 3II1A 1KT2B 1RURH 2VZUA 3RWDB 3WELA 3F62A 2CPUA 5DHXB 3SE9H 3FHAA 4HULB 5HHQA 4HGMA 5DJAA 1AS8A 4JFYB 5E2TH 4PFEA 5ABDE 2ENYA 3AVEA 2QKIB 3JV4B 1TQSA 1RJLA 4KMQA 5LDUA 3BLKA 2CGZA 1HEJC 4PJFE 2WP3O 3LQAH 3VYNA 1MSPA 1OARL 1RMFL 2DAVA 1VADB 1AGDB 3AS2A 1PG7H 4KAQH 2DMCA 4U4BA 3UTOA 4P46C 3EFDL 2D3NA 3FQXB 3D2UD 4NQEE 3HBGA 1AD9B 3BWUC 5D7JC 1ORSA 4KV5E 1TZIA 3DURB 3V0JA 4LBAA 3PL6C 4DZ8A 1E8XA 2BNUB 2CDFA 1EJ6A 2VYRE 1J9QA 1KENL 2XPYA 1NCGA 1QSVA 4HEPA 5CD3B 1H9VA 3WUWB 1NLDL 4P4KB 4MXVF 3N1MC 4FP8H 2A3TA 2YXWA 2H45A 5TPWH 4HF5L 4LSTH 3KVPA 4WFGD 4PGCA 3ARZA 4X9HA 4YPGB 1JZ2A 3IRZA 1SBBA 5D1QD 5IB4B 1JV5B 1Q9OB 3II2A 3VFWA 3US1A 1ZWIA 2TSBA 3ASOB 3DVGA 4KX8A 4Z95H 1ZLUK 3F84A 3DRTA 4AYDC 1HHJB 1Q9WB 2IJ0C 3TS8A 3BUQA 1NC2A 3ZPDA 3IETB 3CZNA 3NMEA 1KN4L 5F9WC 4MB5A 4X4MA 1KGYE 1GS6X 3HN8A 4NGHH 5E6IA 3MRFA 5JDSB 1CFMA 4JVUA 5C08B 3OLIA 3ZTNL 4AI7A 5DJ2B 1RSYA 2V5SA 3DGGB 4HV8B 2V2TB 3K4AA 5JXAH 3SQOL 2XZCH 4ADIA 1BM7A 3QIUB 25C8L 4POUB 3RVVC 4U33A 1RU9L 3VMNA 4O58L 1N26A 1YQVH 2K9FB 5DUBA 1ND0A 4YDKL 1RFDH 2A73B 1A7PH 1KCSH 5BQDA 3ZKXB 1OSYA 1TPXB 3LYRA 1RVFH 3GS4A 3QIBC 4H8PA 2FUTA 2ZKHL 4JM2D 3DRQB 1UOKA 4U6YA 4PVLA 4MD0A 1P5VB 1EXUA 2VL5B 2NXYB 3T3PE 4NKMB 5L2KB 1HDMB 2HLAB 1SM3H 3IFOA 3WFEH 5IOPA 2VR3A 4HH9A 1TFPA 4HJ0D 4U6VL 2FWLB 3WG7B 1FVEA 2Y7OA 5BS0E 4N25A 1MHCB 4XCCL 5IMMB 4YSPA 2YUVA 3HS0B 2ZOOA 4F91B 3SBRA 1FPTH 3SN6N 1WICA 3CJJA 4WV1C 2WTPA 3PV6A 3ZE0B 2ZOLA 1PX8A 3F12B 3G5XB 3VWJB 5KVDL 2H5UA 5F1NB 5IJKC 2A83A 2DEXX 2WMPB 1FC2D 4WO4B 5EZJB 3OZKA 4L3FA 3QUXC 4ZTEA 5IMOA 2Z91A 3TPUB 4U49A 3DETC 4KK8D 5KUMA 5DEFA 4NM8H 1ID5I 2WB1A 1VA9A 1UOWA 3I74A 1QPXA 3M1BA 3EW3B 1AHMA 4QXUH 5I74C 2CRZA 2HKHH 2VLJB 2ICWJ 4YGVA 2ZG3A 1N7MH 3GXPA 1EFQA 2XWBB 2EACA 4R8WH 5B38A 2WTRB 3VXUE 3L4XA 2XOTA 4C4BA 1ZVSB 1LO0H 1XCQA 4BFOA 3AZUA 4I3RH 1LP9F 2A6KA 4QY8B 1FNGA 2VH5H 2ZOUA 5A6LA 3HAEA 4QR7A 3SGKA 4PJFF 5FO8A 3Q2WA 4JFFD 1JNJA 1XB6A 3WO3B 2UWEE 4APQA 2OULB 4KJYA 2I9LB 4UU9B 4ODHL 4PJ9D 3WHXA 4KC3B 2DKUA 1DVQA 3RVXD 5E99H 1BIHA 4QRRB 4PBVC 4GG6A 5C0DA 4KUZH 1JN6A 5ENWB 4X50A 4KV5F 1BQLH 5DYOA 1I9IL 2ZUWA 3UJIL 2H2SC 5CJ5A 1E8ZA 3TH4T 2JKRM 5C07D 1IQDA 3MNVB 5DUMH 4HQQH 1J0JA 4KU1A 5LLIC 1E4XL 3BYTA 5E6YA 2DDQL 2Z35A 3LEXB 1CYXA 3MZGB 5CP3A 4M48L 3KPSA 2IDTA 1I3RB 5DD3L 4ETYA 3WL9A 2DLGA 5HVHC 4KDTA 3W2DH 1D6VH 1U91B 3NACL 1CL7I 1QR1A 3JUZA 5FFLA 4JY4B 3TEYA 1ILUA 1RL1A 2OMTB 2PTTA 3QDHA 5KBPA 2EDXA 5EDSA 2BPBA 1KJ2B 2DQDH 3VB9A 2VSKB 4PSRA 4QRTA 3LNFA 2OZNA 3CIQA 4HFUH 1S7TB 1KTKE 4RDQF 4HUXB 4KY1L 3T77A 1M2OA 5FYJD 3LQAC 3SE3A 2OR9L 3D39B 5ESVB 3L16A 4MZ3A 2MCPL 5LGYA 3TN0B 3MLVH 3BZDA 3SJVD 2NUPA 3NSJA 4URKA 2ATKA 2G30A 3TYGL 1KPUB 1MY7A 5T1JA 3RX8A 2KL6A 3MGTB 3N85L 4GBXD 3HFML 3IJ9A 2C9QA 2YKKA 5T3ZD 1I9JH 2ZSWB 5F6HI 3UPRB 1T6BX 4XVTH 1IGYB 1GOFA 1XCTB 3Q43A 4JPSA 4L8SB 2Y7LA 4GINA 4OT1H 4ZSOA 3Q6GL 2FJUB 4IMKA 5BV7H 1Q72H 4WI7A 4NP4H 3W11C 4X83A 4E9WA 2Y1ZA 2CCVA 4FNQA 4H7VA 12E8L 1WVZA 5JR1H 3FUDA 1LL1A 3SBPA 3T3PF 3U6RB 1NAKL 5AVTB 2D03L 3EKCA 3MJ8B 4X4YA 3V5KA 4Z7QE 4IMLA 1FIEA 3MLXH 4UDUA 1EJOH 2UZIL 3I3BA 3GMOB 5CINL 4YAQA 3KPQA 2XIIA 4OBRA 3ZL4L 3D69B 1PPIA 1XF5B 4JQIH 1OLZA 4K23H 4AV5A 5GRJL 1XGRA 2BDNH 5SX5H 2YEZA 4JO4L 1GA2A 3ZDWA 1LTXA 1CIDA 2VLRA 2AQTA 3LH9A 3QO0B 3LZRA 3NTCL 3WKML 3SZKC 1WZ1H 5IW1B 2YKLH 1MKFA 3JTSB 5FYKE 3QA3A 1IBZA 4X8CA 1XZ0A 3OKDA 2BIPA 5DQDH 4HH8A 3FUFA 2KBGA 3QNFA 4GSDH 4C58B 1YJDH 4PJ5D 4J5VA 2RR3A 4XP5L 3VFSB 5ETUA 1AGFA 1FYTB 3EYQD 2BRRH 2VDQH 3L95B 2DBLL 5FO9A 4Q6YA 1E2ZA 3MJWA 2FBJH 1IC7L 4FTVE 4F80A 4K55A 5L6YH 1AY1H 1WRFA 4BUQA 4HIXH 4N2FA 5JW4M 1ZHLB 2VLKE 4JCMA 3RDTB 2OZ4A 4GH7B 4PRNB 4P2QB 2QHLA 3N40P 3WTUA 2JJTA 4DT2A 2YPKA 5SWZB 1W0YT 2BLFA 2V5TA 2UWEF 2HA1A 3MRJA 1SUJA 4D9LL 3GLEA 4WI5A 4XX1G 1CDCA 3WOVA 5JW5A 3QPQD 1QQDA 5KJRH 3NVQA 5LAPA 1SXAA 1IGIH 2C1PA 3KL3A 1IZKA 1LE5A 3GF8A 2BVTA 3IEAA 5J1AA 3TFKC 3ZKNC 2BMKA 4JDTH 5KYUB 2WPGA 1XB8A 4IKJA 2AITA 4KRPC 3TX4A 1I8UA 1MCRA 1I85A 5BRZE 3OG4B 4OGAD 2ITDB 2JKXA 4TL5A 1A8JH 3ZO0A 3MRDA 1CTNA 4L23A 3DPDA 3CVBA 3QHZL 4LBEA 2XNAB 3BRFA 1XMWA 1YSOA 3O2WL 3TBTA 4YWGL 1UD6A 2EEXA 4PB0L 4ZPTB 5F9OL 5FC9A 4JG5A 3HE7C 3CLFH 4JMNA 2DYSB 4AUYA 4MA1B 1MELA 3OJDB 1RZKL 3S35X 3SY6A 1BAWA 1O7DE 1Q0XL 2YPVA 3OXRB 3BGFC 1QSEA 4JVPA 5JZ7C 3DIDA 1E9PA 1ZLSH 3B9KC 3Q9PA 2JQZA 1KIQB 3KPMA 1P4LA 5EUOA 3ILQD 4H1LH 4AZ8A 3UO1L 4WWPA 1I53A 1UQSA 1KSRA 3MV8E 1UKTA 1Y6KR 4C8XA 3BQVA 4A04A 2F7RA 2VAJA 4EUPG 5EC2A 2OCCB 1XGTB 4L3CB 3ZDXB 5AYTA 5DZ9A 3WXVH 1FO0B 5I15L 5K1VA 2AZUA 1NCAH 4MD4B 5DZPA 3BN9C 2F2HA 4F5CA 1BQUA 3QZOA 4ONGL 2X1WL 1R5IB 4G2AA 4H13C 4KJWC 1A4CA 2V9UA 2P48B 2EXYD 2K4AA 2CUAA 5E6RB 3C60A 4AM0B 4UB0L 3V4PH 3FHQA 3QORC 5JUEH 4U1JA 3FCGA 2D0GA 4IEFB 2VSMB 1T2QH 4H5SA 4OIAA 2UYLA 4ZNCD 4AH2A 5TH2A 3OMAB 3X11B 4WU5B 5EOCL 1ANUA 5I1DB 3FAXA 3ARDB 3L1FA 4IGBC 2J3SA 5DFVD 5AVYB 5F0LB 4LB8A 2QKSA 4RMWA 3AS0A 3D3VD 3PABA 3ROLB 4FCAA 1G7LA 3R8BB 3ZVVA 5KVGL 2H32H 1ZT4B 3IDIA 4PB9H 4RA3A 3QZNA 3V55A 3I6GA 1FL5B 4NQED 4ODWB 3ZHLA 5JLZA 1MFDL 3U1SH 2OKMA 3FO1A 3MR9B 3EGSA 3RNKB 5CEZD 1MJUL 2KQMA 3MYZA 2CU9A 3HN3A 2F54D 4A2GA 2WLJA 3KGSA 4O2EB 1NBYB 4OB5L 5D2NC 4B7IA 2VR8A 3KYKL 5B7FA 2AJ3A 2BERA 3D85A 4PTUB 1DUYA 4R0LA 3GBLA 3SBWA 5GPRA 2ZJSH 2EO7A 3KXFA 3TJHD 4M02A 2EYRA 3HHRB 2R29H 5INCB 5E6SB 1KTRL 4FQHB 3VRJB 3AS1A 1IEBA 2VWEC 1T0NB 4UV7L 4F7CA 3Q06A 1JNHB 3VVWA 5E1GA 2ILLA 4A39A 4N9GB 1QSZA 3N1FC 2CDEB 2WZPA 2GW5A 5K39A 3ZDYE 4BKSC 4XO5A 5JW3L 3VB8A 4YXHH 4R4ND 3L3IB 3H9SD 2I69A 2Y07H 2NNFA 4ZUWB 1ZXQA 3S6CA 1YY9D 2OXHB 3QUYC 1MWAB 5IB2B 2JJVA 1JFHA 2LAAA 2MQCA 3BUYB 2I07A 5C08E 1NFIA 3CFEA 4LCWB 1F13A 2FX9H 3N50A 1BOGA 2WVSA 3JVFC 4HIQA 5GJTL 3RUGF 5CBAA 4NX0A 3UEQA 1T0MB 4FQJH 1GGCH 2OMXB 1WBYA 3K6SA 4BKLA 3VWKC 1RH8A 4IBWA 3QQDA 1MAML 1L0XA 4K2UL 2EVFA 3I6SA 2OMWA 1VIWA 2X6MA 2LE9A 4RGNC 4C55A 3T8XA 1AXTL 1PZSA 5HI5C 4HEPG 1U8LA 2X4QA 3L3GB 3TA3C 3O2DL 3Q44A 3AC0A 1KJ2L 4JFZH 1J88A 4S0SD 3GGWA 2DW5A 1DBKH 3V4VL 4D8PB 4EIZC 3SQRA 3GSRB 1WUZA 5DA0B 4OZGF 3UGEA 1CLOH 5IVXA 5L2KE 4JGMA 2BVOA 1JHKL 1X5AA 3S97C 3BJ91 1P69B 5BS0D 1T1ZA 4F3FA 4WHYH 4BEIA 4I0PA 3RWFA 3GHEL 5KVGE 5KANG 4M7JL 1NCWH 3ZE0E 5IMKB 3IMSA 1JWMA 3ECUA 4AYMC 3STBA 2HRGA 2B4CC 4DERA 4NC1E 1CGYA 3CDCA 2GBVA 1JWUA 3OR7A 5CN1A 4G6JL 1WK0A 4PLOB 3C2AL 4S1SH 4E5XB 4ZTPL 2O5YL 1KIRA 4Y2DC 4NN6B 5K59E 2KZWA 1A4JB 4F15C 1C1EL 1LMKA 3KE0A 4S0TD 3ATAA 3KPOA 2VLJE 4PJ8D 1TNMA 4PWHA 3SDDA 3BP7A 4L8BA 5D5MA 4MKTA 4ZUUB 1K8IA 4I48A 2WBJB 1SF5A 1KV7A 2BVQB 4PJHA 1IO4C 3EF7A 5CBEA 4IRSD 3ZE2F 4OIBA 4I7ZC 5HHPB 2VJXA 3QEUB 5JOFA 4P2RB 5DR5H 1PBYA 5C0JB 4GPVA 3HC2A 4QPEA 4GRLA 3G9AB 3V6FA 1MIML 4XWGH 2F1AA 2XVLA 3CN0A 1BHGA 5B4MC 1ACCA 1MEXL 2J1WA 1DFXA 1YG9A 4QRRE 3VXOA 1FHGA 4QKTA 5I5MA 5ID1A 2UXTA 5GGSB 1U8HB 4UTBL 4UM9B 1WIOA 5CCKH 5E8EB 4IBZA 2OTWB 3PWLB 4FQXD 4LEBA 4LSVH 3TASA 1RUPL 4OR1A 5BMFL 3FN9A 3GUTA 5DC4B 3I02B 2GBUA 4PJXB 4A2EA 1WFTA 3PWVB 4R26H 4OIFA 3GSXA 4F8NA 2MTPA 2E27H 4FLHA 3CU7A 4K07A 2PW1B 3PNWB 2CWRA 3QYMA 3HI6H 3T6ZA 5L9DH 1JI2A 5DSCA 2VXSH 4QO1B 4FHJA 4N9OB 5IFJA 1FI8C 3WSQH 3BVNB 4Y7MA 1TXKA 4OLVL 4LGRB 1XF2B 1J05A 4YNYB 4PY8J 2ZXBA 4Q14A 5C0RL 5JOPE 1U2HA 3ZDYF 5I6PA 4P2CG 5I66A 1WUNT 4NNYB 4A7VA 1OCOB 4I3GA 5B38G 4EQ3A 4MAUH 5AENA 2I27N 3CTTA 3D39E 1P7KB 5FIEA 4LFHD 1UXSB 3HAEG 1QFWL 2ZXGA 3BAJA 4OFPA 3WY1A 1JUFB 2DQIL 4CGTA 3FU3A 2IPTH 3DKHA 4LSRH 3DA0A 3CFQA 1QNZL 3CE1A 1NFDF 4BZ1A 4U6XA 3EH1A 4G8GD 3ECQA 1RJYA 1BQKA 1G94A 1G7JB 4H26A 2PABA 2ZKYA 4HC1H 2XTJB 5EF2A 3GJFB 2YWZA 4NZFA 5H8DA 4QNPE 2R1WA 3FT9A 5GGVH 2Q7YB 4PGEA 3TF4A 2JCCB 2Q3XA 4XNDA 2CR0A 1ML0A 5IROD 4PJCB 4NZUL 5FO7B 3RVTC 1QRNB 5JIIA 4UOJA 4M62L 1KOAA 3M46A 4RZCB 2PMZA 5HHMD 4F7EB 5J9PA 4Y4FC 1YEKL 2JXMB 3CVCA 5C0BA 2E4FA 4ZFGH 2HJKA 4I88A 1NBZA 2X9XA 1P4BH 4WWID 3JV5A 3L3KB 3FTXA 1EO8L 4KK5D 3FL7A 3SYPA 4MCYA 2WXRA 2GY7B 4K3DL 4XX5A 4LSSH 4PU2A 3QUZC 2Y72A 4RMBA 4PJDB 5AAMC 1AGCA 2MEJB 1AOZA 4FI7A 4HJEA 1FO0L 3IK2A 3ZE0F 2G3NA 2H0PA 2C9XA 3NJMA 2R7EA 4WCYL 3ULSB 1RIHL 4G71B 4L9LC 4EN3D 5C7ZA 1OZTG 5GS1A 1HAUA 3FU9A 5ECJE 5JIDA 4M7ZB 2DLEA 3INUH 5C9JA 2X9YA 5I1CL 1KG0A 2FD6L 1JPFB 3IPFA 2NTFB 1CFSB 4J3OF 5AVVB 1TCMA 3QQ9C 1W72H 2VCOA 1JCKA 4H40A 3AFLA 3J8F7 4ZO8A 2X4OB 1FYTE 1GGYA 4RMQA 5EUKB 4IOIB 5JIQA 1MFAH 2B8OT 4I5BA 4PIBA 4CJ1A 1UXWA 3NABL 1G9NL 5F88A 4UIMB 5KSAB 2V5MA 5B8CA 1F4XL 1VSCA 4NO2A 2JB5L 2PXYC 4CVXA 4FXGA 1S3RA 4P2QE 2VLKD 4FQIH 1IC5L 1LDPH 1GAFL 3IGUA 3QAZC 4P3DB 5JHDB 3BPCA 5SWZE 3WKYA 3A4DA 5DLMH 2BP0A 5HYSB 1NIEA 1MFCL 4ZUTB 3GIVA 1I1AB 2PO6B 1ETZB 2J5LB 4TSBL 3JXAA 1NAMA 4ELMA 3DTDA 3S88H 3R06B 4JPIA 2XLLA 1U8KA 2AK4A 4EI6B 2IOIA 4BQCA 1ZS8B 3PREA 2C3VB 5F89A 4NO3B 5T1LB 2ZWKA 1FH2A 2EIDA 3ZU8A 5HYQB 1FNEB 5HHVL 3NCFB 4XO3A 2PR4L 5H94B 4LHUG 1E90A 5H2BA 3E7JA 2MWCA 1AQ8A 2HVJB 3GTVA 4XVSL 3O0LA 4FFYH 5E8PA 3WJMB 3DTXB 2XWDA 3FT2A 3UTTB 1LO5A 2EH8L 4N5UA 3I6KB 5F1IA 3A21A 2DLHA 1CIUA 4UUJB 4H0LC 2Z64C 4ZJ9A 1QTYT 2WBWB 5D6DC 2GJZB 3LAFA 4LKCA 4L8CA 2LV4A 1YNTB 3HR5A 2FNBA 3CHPA 4AIXA 4MD5A 2FSEA 3WNJA 2FH6A 1KB5B 4JO2L 1ZTXL 4KXCA 4DVRH 1ROCA 2C4XA 3ME0B 3OGCA 3PJSA 3MNDA 4KI1A 4XN8A 2DB8A 4Q6KA 1VAHA 4Z7WA 1CE6A 3GMQB 4JFOB 3RB5A 4LPUA 3PHQB 2HUEA 1OD9A 5D4IA 4YDJB 5GJSH 3MBWB 5C0EA 4B3EA 2MPAH 4HUWA 1JAEA 2G5BB 1DJWA 3MVSA 5AB1A 5E1HB 1JMXA 4KK6C 3CDGB 4E0RB 2YRBA 1M7DB 3GSWB 4PHXA 5AD0A 1B2WH 4RBPK 2Q87A 3U7YL 5F9JB 2YAQA 4HX1A 2VN4A 1L9QA 1TEYA 2Y06H 1ZOXA 4QXGL 2B2XH 3IPBA 4J6RH 4YFEA 4ZAKB 4ZS6D 4I4WB 1UM4H 1WTGT 2CRYA 1N59A 4C56B 3WEMA 1P1ZA 1R3KB 1P9MA 1D9KA 2NX5E 1CYWA 2ISDA 2NY2C 3RPIB 1MUJB 1FSKB 3FB6B 5EIIG 2Q86B 5HBBA 5HPOA 3RWEB 3PHOB 1OGAA 2VITA 2NCMA 3WE6A 3EO1B 5H4ZA 5J4MA 1A6ZB 3POCA 5BZXA 1NWOA 2E9JA 2Q20A 3UYPB 3FBQA 1GW6A 1JGVL 2WIIB 3UZVB 3HTLX 4MAYA 4Z3EA 5EB9A 4NPKA 4A6YB 3IFLL 4NHUB 2H3XC 1TEGA 1WC7B 1FGNH 3ARVA 4FG6D 1WZKA 3IDGA 4JO3L 3HE6A 1WCBA 4AYSA 1D5IL 4YSCA 3KEHA 15C8L 3GSNB 3DVFA 2DJSA 3TEUA 1YMHB 2BP5M 2FX7L 1AZVA 2VN6A 2PYEA 2Q0ZX 4IS6A 4P4KD 4TULL 4RQQA 4KROB 4XOBA 3FQ1A 2VLLB 4AQ8C 1RI8A 4QRSA 4U3CA 2AABH 4XZUA 3MBEB 1A66A 3BPLB 1GGUA 3CVHA 4ISVA 3GBEA 4WWKA 4GQZA 5ANHA 2DLIA 3C6LD 1QNIA 3QJQB 2E59A 2QDWA 1NANI 3O3BB 3O6KL 3HI1B 3Q13A 3RRQA 1BFTA 2FYYA 3QZMA 3QNYA 5GSVA 1U3HA 3CMGA 8FABB 1DTUA 1G9ML 4XCYB 4BE5A 4E41B 4P57B 1AAJA 5D93B 1M71B 2NCEA 2OJZL 1FBIL 3U7AA 5CWSB 3BGAA 3VCLB 1PQZB 3DX3A 5C08D 4LCWE 3NGBB 4ZOEA 3TCLB 2G60H 5L8KB 2WCSA 5HGBA 2A77H 2FT6A 3VFOA 2BXYA 4OZHB 4CMMB 1OL0A 5FECA 2ZUYA 2C3GA 2DQMA 3QXVA 3O6FB 4JL1A 4IBYA 4PGZA 4LIQH 2R56L 4Q9BA 3HI5L 4CJ0A 4FZ8H 4Z1PA 4MJ4A 5IREA 4UT6L 4LQ1A 1HH9B 1S7XA 5AAWA 1NBQA 1MHPL 1NLBL 1SEQH 2ZKWA 4PTTA 4N1EA 3T08A 3RZWA 3ARFC 2NNAB 2K9UA 3QJTB 4Y19B 2VIRA 3L3OB 3SGEH 5LGJB 1M4KA 3FB5B 3IJ8A 1GGIL 5FYJH 2F53A 1XGQA 1FIGL 5EEXA 1OF2B 1XH3A 2FUQA 3TFBA 3MRKB 4Q0XL 5KBDA 1XXFC 2NXYD 2YAOA 3KLAB 2WLKA 3KWWA 3LKOB 3OKKB 5TDOB 4YX2L 1WYJA 1NCCL 3DJSA 2WC7A 4OJDH 3DV6B 4ORGA 3TO4D 4GW5A 4HYTB 1F41A 2XQYA 3B5TA 4HKZB 5B1KA 3VSQA 4Z3GA 3OHXB 4NM4L 4F9LC 1G1YA 2F8IA 2Q1EA 2NY5L 3IKCA 2R9HD 3DOSA 3MRLA 4XOEA 4CU7A 3MLWL 1HZHL 3AACA 3OQ3B 3VWJD 4WY7L 3ISYA 3WTWA 1EBAA 1WZAA 2GJ6B 2IADA 4D0CB 4IKNA 1OGSA 2BSSA 4LK4A 4XB7A 2HLEB 3VFNB 5ADOL 4IRZH 1GOHA 1T66C 1SJMA 2XV0A 1L5GA 1AHWC 4NI3A 4R90H 3K72B 3QCVH 2N1TE 1Z9OA 3QUMH 2EE9A 4KKPA 2ZYIA 2EUZA 3CGTA 1K8DA 4UINL 4CC1A 2EVJA 2EEBA 4WNQB 1I8IA 2VM3A 2WJ7A 5AYQA 5D1QC 1PYWB 1AKJA 3U46A 1KBGL 2VLJD 1QKZH 3MRIA 1IGFL 4YBHA 5CUSH 3T4AC 1RK1A 5JOEA 2XQ0A 5MEOA 2QQLL 5I8CA 1OAJA 1KTJA 1TEFA 4EEEA 1C5DB 1KBPA 1NGZB 3QXAA 1WWBX 1E5ZA 3EOTL 3QIWB 4P2RE 1H3VA 4X5PA 1AO7D 1L6ZA 1TTBA 1XF4A 5B3NA 1A0QL 1ZLWH 5IBUB 4HWBH 1XR9B 2CDGA 2O26U 1DL7L 4N8CH 1RHFA 2KERA 4OCSH 3LZFH 2C4FT 1K3ZA 1H0DA 3VXSB 4FNLL 1T83A 2IH9A 4UQCA 1Z1WA 4FYTA 5EZPA 1UADC 3HNVH 3MV01 4NRXA 4PJXE 4TTDD 1D5XA 5DMKB 1U92A 2IDFA 2K70A 2AEQH 1BJ8A 1F1GA 1YYCA 1RZFH 2FAUA 2YUXA 3IF1A 3S35H 2R1YB 1RZPA 1VERA 2I5YH 2X3CA 4EXPX 3KLHC 1GKEA 1EGJL 4O5LL 3UCQA 1Z9SB 5KJ4A 1A2YA 4F57H 3BH9A 5AW1B 1T4WA 3M86A 2EXWD 4LHQB 5I1AA 4G9FB 4ATTA 4D0BA 1BD2D 3D2TA 2EUVA 4HA1A 2JKIS 4X6CA 2YMXH 3PWPB 4HJ0C 3WHE1 5JOPD 4N0RA 1I3VA 2HJFA 3DARA 1AFVH 4G43B 4QHNA 4DGWC 4K3GA 1D5MA 3FF8A 3NRQA 3FH7A 3FQTA 3CN4A 3P0YL 4A2FA 3E6FA 3QDJB 3TN0D 1WSST 2Z8WC 3IDJA 3GZQA 5IUSA 2VMDA 2EYTA 4F37K 2DWXA 3PU7A 1KTBA 4KK8C 2OL3B 3CXHJ 3D06A 3GJEB 5C86A 4QXVA 5J1SC 2A0LC 3MRQB 2XTJE 4R7NB 1KJMB 5CR8A 5GS0L 3ULVE 1B4JH 3N1GC 3IJSB 5KBLA 2OTUA 3LKQB 1BVLA 4N2HA 4PJCE 5K93A 3BPNB 2P5WB 2XICA 3O6LH 1U8IB 3FCTA 5E8NB 1QRNE 4TS6A 4P05A 4UQ9A 1SBSH 1KB5L 1HXKA 1WLHA 3SY0B 5BVJA 2AV1B 5E2VL 4XVOA 4W4NA 3SKJH 4OQTL 1M1XA 3KPRA 4QCIA 2DKSA 1AE6L 5F9AC 2PPFA 3CZUB 5A43C 5GQBA 3BEWA 2DD8H 4I1RA 1SHWA 1KLUA 4K7FB 2AEWA 1FG2B 1O0VA 1BIIB 2DS4A 2LFGA 3PGCB 4K5PA 2EKJA 4PJ9C 4OLXL 2X5PA 2WZAA 5DEJA 1GR7A 4PJDE 1MFBL 1CYGA 3V0VA 2VC2H 5AOMA 2IPKB 4MHHI 2D7OA 1J1OL 1WS8A 5DRXB 3SE4A 1FZOB 2XWEA 4NT6A 1MJJB 3D0AA 2YAEA 3DVNB 2F8XC 1YN7B 4NDMA 3UJJL 1ZV9A 3VJ6A 2BCMA 3LIZH 4UV4H 3CFJA 4JDEA 4KH9A 3WLBB 3ZMNA 2BOBB 2NW3A 1QO3A 1S46A 4KKAD 4WJ5B 1K85A 3VW3L 4JK0D 4DW2H 1FYTD 2ZOKA 2QPDB 5EN2A 5K1JA 1FRGL 3I9PA 4N2OA 1AIFB 5I82A 1CVRA 3CXHK 1T5WB 5JHDE 3RWCB 3W5NA 4PAZA 4WFFE 5CEZH 4MDIB 1IFHL 2IG2L 4M29A 2HFFB 1OE3A 1HJCA 4QHUB 4ABVA 5CIPH 2G9HB 4Y7OC 4A6YL 3DSNB 4PS4H 4KXAA 1ZLUH 3C5SA 3SPVB 5CLTA 5IEKA 2W0FA 1BPLB 3UTPD 1HHHA 1WBXB 2JKJA 4MRBA 4NJAL 4WZ9A 2ZX5A 5K5YA 3GSNL 3NCCB 1CXKA 3BKYL 4GBXC 5AG9A 1PD0A 4TUOA 5JHLH 3N44B 3SCMD 4AX3A 1I7TA 4IU3A 5DJXA 1QASA 4ZDHA 1ADQA 4H8WL 2LU3A 4MMZC 3KBFA 4N2IA 3RKDD 3MRCA 4Z7OB 3FSZA 4URTB 3MYJA 4AQOA 1JPST 3UTTE 2CNZA 2AJSH 5D7LA 3WXWL 3EIFA 4N0FB 1FLTX 1A65A 5DJZB 4ZMNA 1MVFA 4P48A 2VN3A 4XTRC 4CC4C 1FVDA 5SWSB 3IVKA 3RY6C 4LLWA 1RK0A 1T5XB 4M7LH 1X5ZA 4U6HB 2C34A 2DKMA 1WDAA 4JRYB 1MCEA 3IMRA 3ESNA 4JZOA 1T3FA 5DHVH 5EC1B 3TT1H 2CLVB 3D09A 2WWOA 1JGIA 3DK0A 5KVEL 1J8HB 3FU7A 4JRLA 3IJEB 5FFGA 3VI4E 3DUSA 5F72S 1VACB 3VRIB 3GXMA 3BFOA 4G7VL 4MCZB 3CNKA 2MH4A 3GUFA 5TF1H 2H47C 2W60B 5AKTA 1YNLL 2GSIA 3D34A 3Q01A 4RFEB 3EGXA 4L3EB 1IC0A 3OKMA 2B1AH 4AE1A 3VYPA 5I18H 3RFZB 3WEXA 3MKGA 4Z7VA 2YGPA 2ZCZA 3L45A 2CHDA 4L5FH 3ULVF 3GTNA 1B4LA 4KKRA 1W16A 4ZZFA 2JQAA 2VZ3A 5HGDA 5A2BA 2R8SL 2X9WA 3SO3C 2NYZA 3JWDC 2ZTBA 3SYOA 3EYQC 4FN0A 5E2UL 1WAPA 5DJ6B 1W8NA 4C56E 3C5ZC 1T22A 3SZ6A 1OT1A 1DQML 2IVFC 5A16A 3C08L 5EBMB 4NWTL 4GW1A 1CFVH 4WV1A 5AOJA 5C6TH 3D50A 3ET9F 4XN9A 3X1FA 1SHSA 1G87A 2AQNA 3D7PA 3EFDH 3NCJL 4PP1D 4DK5A 5IJKA 4BDVA 3NOIA 3E0GA 3QUXA 2IFFL 3QPQC 2SEBA 3SKUD 1HCFX 1KENH 5HHOE 5CFAA 1M42A 1P84J 2QT6A 4KZEL 3EH4B 3JYCA 1ED3A 4GS7C 5FKPA 5ICXB 4AJYV 1NLDH 3FFCB 5FYJU 3G6JE 1X5KA 3I6LE 4TL4A 3G3LA 3PAVA 1CICB 2R0ZL 3HNSH 3JV6A 5ESQA 3GNML 4HF5H 3HKFA 2C26A 4XR8C 3S37L 2NQCA 3EO0A 5CJXC 2J73A 2NT1A 4H8HA 5CJ8A 1S3KL 4CGUB 5A2FA 3VFTA 2V8MA 3A23A 1R3HB 4PRHA 3RL1A 2GEQA 3V8OA 1MWOA 3B7RL 4GRWB 5DD1L 1PZUB 4HXAL 1JWSB 3G6AA 1JHLL 4XP6L 1S78C 5EUOF 1U3ZA 2EYSA 1KN4H 3QI9C 5B1CA 1PSKL 4FG0A 2ZICA 3IDMB 3RVUD 5IHUL 1SJHB 4DP6X 3ILQC 4E41E 4I0KA 1A6WL 2CO7B 3BH8B 3SQBB 2IAMD 4F8LA 7FABL 1DQQA 2VM4A 4KUCD 3VRLF 4JHBA 2VZ1A 5KVEE 4R9HA 4BUGA 25C8H 2EIZB 5KW9L 3K46A 4LCWD 1RZJL 1AQMA 4O58H 3D33A 1C7SA 3PWUA 1U8MB 2I60L 1GW0A 3INOA 4NQDA 4OZHE 3NJFA 5FA4B 5KUKA 2V5YA 3BZEA 4YDKH 1R5VB 3FSOA 4OM1L 5I6KA 5FKAB 2EXYC 3QG6A 4M6ML 4U3HA 2F5BL 2Q2LA 1L9MA 4JFQA 2ZKHH 1XD1A 4XHJD 1CZ8L 3WFDL 4Y19E 5E56A 2Z7YA 1OAXL 2H6PA 4HIHA 3OD3A 5J12C 3WN5A 1QBAA 4F93B 1UTDA 5FA3B 3VXNB 1G7PA 1EDYA 1P84K 1PZBA 1M7IB 1YNTF 2VDLB 3I2CH 1JYXA 2BWDA 5DMGC 3PY9A 5GGSY 5DFVC 4RNRA 3FONB 4H0GA 1NEPA 3PFUA 4ZQKA 3A5VA 4XCCH 4NOBA 4W9IC 1BG9A 1KEML 1L7IL 2Q7AA 3S4SG 3SDXA 1YMMD 5KZCB 5GSRA 5KVDH 3UH8A 2B20A 5JNYA 1H8NA 3VI4F 2YBRB 3KLLA 4J3VA 4CN1A 3P4OA 4HIJB 4NHCH 1BMGA 3D87B 1B3JA 3FUNA 1Y0LA 3REWB 2J88H 4OD2A 3MLRH 5ALCL 3WDJA 3CFDA 1SJEB 4EOWL 3KYMB 4U1GC 1NFKA 3TJHC 1LWJA 2D8KA 3PJLA 5F3BB 1CGVA 3TESA 5C3IA 4DK6A 2V2WB 1BX2B 4NAJA 1P4IL 4N85A 1EBPA 2VDOB 2XZQH 4ODTL 4HCRH 3ETTA 3K1DA 2AP2A 3Q1SH 2PF6A 4O2FA 4P2AA 1R1CA 5DGRA 1AGBB 3N6YA 2IQ9L 4YHML 5JIMA 2AEIT 2IXQA 2WLIB 4K7PL 4LL9A 4Y16B 2NUTA 1ZCRA 4R4NC 4QXTA 1KZYA 2EDTA 4K9EL 1LEKB 2CKBB 3NCEB 3QEQA 2GB2A 3F7RA 4ODHH 3FQRA 4MNGB 2V6HA 3WLWD 4W81A 5J5EA 1JP5A 1YEDB 3L4VA 4ANWA 1AGEB 2YQ3A 3ZK0A 4UCFA 2Y6SD 4YC2B 2QSCL 1I9IH 5F9DC 3UJIH 5C0AB 5TE6L 2DF3A 1UM5L 4EZJA 1S7SB 3VXSE 4AENA 2R15A 1RP9A 1F5WA 3QH3A 4YDLB 2XQYG 4OCYL 3G6JF 1KPVB 1E4XH 2DDQH 4RISL 2YR3A 1QPKA 2BSDA 5HGHB 4OF0A 4M48H 1T04B 4XCEA 5DD3H 4LLDA 3P3SA 4QHKJ 4GKNB 2JLPA 1NKGA 1WFJA 4HAFA 1NJ9A 2W9LA 1DEEB 5AOKA 1WQVT 4P5TA 4AL8L 3G5WA 2FQFA 3AQYA 4K4KA 1GVIA 3GD1C 3N43B 2IIJA 1T0PB 3JWNH 3PWPE 3ES6B 5D7HA 4KO7A 4KY1H 2YK1L 1F2QA 1TYEB 2HTLC 1FWXA 4HU2A 3L08A 4YL4A 2MCPH 4X6BA 1FGVL 2TRYA 3NZ8A 2CM6A 1B88A 4Z0BL 4PREB 1T6VN 1V7NL 2Z3FA 3JZ7A 3T04D 1OM3L 3DXAA 4AQAB 3QDJE 3S2CA 1TZGL 1CURA 3P9LB 2BZDA 2JF1A 1D6EB 3C12A 5C6WH 1HI6B 4KKCD 4N24A 3N85H 3HFMH 3DPBB 4HAGA 4OFKA 1IGML 4N26A 4OZHF 5E94A 4LQFH 5INDA 1EANA 3PAUA 4AJVA 1MF2L 1XAKA 3L6FA 4YSUA 2XTJD 2HYMA 3BD3A 3Q6GH 5HYJB 2JI2A 4Z7IA 1S9XA 3HE7A 4J1UA 3CMOH 4WI6A 3VG0L 2P5WE 3MACH 4BQ6A 4KZDH 1CE1L 4UOW0 1CI3M 1QBML 2RALA 5F3FA 2BSEA 2R0LL 3C09C 3CHXA 2VAAB 2F6AA 12E8H 2NY1B 4GQ9L 4IRSC 1QRND 1KDJA 2L8AA 1EZSA 4Q6IB 2ENSA 4YDVB 4NQCA 3MV9B 3B9KA 3FT4A 4XB3A 4AE0A 4HHGA 4FAAB 1IBBA 3X14A 1NAKH 4Z7NB 3U1QA 3QXUA 2D03H 4FYSA 4AEIL 2QFRA 3I3EA 3QUKB 1TZAA 2Y2WA 3EG9B 1KMGA 1QVOB 3MRHB 3RTQA 3NCYP 2UZIH 4BA0A 5CINH 3ZL4H 3DNKA 1XSOA 1GXEA 3C6SB 1OE1A 3OKEA 2ZX8A 1EEYB 4OCLC 2E74C 5GRJH 5IF0A 1XXDC 4K5MA 4ZNEE 4WTXA 4JO4H 4JX0A 3MREA 3H42L 3ILEA 4NQSB 3NTCH 1MCHA 1MCFA 3D48R 5BXFA 1IVLA 4K3HA 1MDAA 2MJWA 3S96A 1IAKB 5TD4A 4Y5YC 2B1HL 3BUIA 4FA6A 5ID0A 4O2CB 1D7BA 3EXJA 3DGCR 3B2VL 3P4MA 3HZVA 1E5YA 4XP5H 4DPAX 4X0KB 5I8KL 1IM3B 4JM0A 2DBLH 1JVLA 1HCZA 3FQUA 3KVDD 5HDQL 2W9DL 4IGBA 3DIFA 4G6FB 1T03L 4JRXB 2PPCA 5IW6B 2J44A 4G80A 5I6LA 1G6RA 2BNQB 4P5RA 3ULUE 2BSTA 2ICES 2P80A 4J39A 3O45A 3D18B 4G9DB 5J6HA 1KTCA 1RSFA 2MTAA 4D9LH 4K15A 4HIPA 2YEQA 4PH8A 3SKNB 2J2ZB 4PWKA 3L3DB 1X9QA 1RZ8A 1GRWA 2P1YA 4U1MA 4GXFA 4YS4A 5A7EA 1FFOB 3GM8A 5IB5B 1QI5A 5DFTA 4OGYH 1Z7JA 3VD0A 3AMKA 1U8JB 2AK1H 2CR6A 3RWGB 2BFVH 3P3TA 3QHZH 1NDMA 2PYFA 2EIBA 4NFBA 4M93B 4NNPH 3O2WH 3O8XB 4Z7OE 3T4YB 4YWGH 2RFXB 4PB0H 4U1SA 2PNDA 2R2EB 4YFDB 2Y3NA 1SXSA 2WOYA 2VXTL 1NL0L 3CQFA 6TAAA 1AG0A 3MX0A 1BQHA 5SWSE 1RZKH 4UDTB 3WDIA 1KYUA 4E9XA 2WY3B 4N3UA 1Q0XH 3TNMA 2NY4C 2ROXA 4O02H 3GI8L 1OP4A 3M17B 2OCFD 5JQ6L 4KK5C 3QUYA 1I1YB 4JRYE 2V7HA 4ZMWA 2OSLB 4Q9RL 4JZNA 1XEDA 2LW3A 5HHQB 3KJ4C 4GLRI 2P4AB 4J3WA 5AVWB 3UO1H 4A38A 1J8HE 4P5KA 1OW0C 3T5WA 4WGWB 4TVPE 4FTDA 1DJXA 4LLQB 3BRGC 1S9KC 4DAGL 1OGTB 5DJDA 5TE7L 4X9GA 1ZJAA 3IBEA 5E5MA 5GGRA 2NTSP 3VWKA 4WHDA 2O5XL 4NN5B 4LP4A 3P30L 5DHEA 4L3EE 2OYMA 3P4NA 4L29A 4ONGH 2UVEA 3JT2A 1R0AL 3NJGA 3FO9B 1T2XA 1NGYB 2B5IB 1UUSA 2WD0A 4UB0H 1J0IA 3WY4A 5IHBA 3BDXA 2RB8A 1XZWA 3B9EA 3GSVA 4DOHB 1FCCA 1F4HA 2X10A 1BZQK 3G04A 3PAYA 3T8VA 4DZ8B 4ZAKD 5TQ2L 1Z9NA 1A3ZA 2COVD 1JOIA 3VU2A 4C56D 3LRHA 5DQ9B 1WBZB 3BD5A 5EOCH 5FGSA 3NJHA 1DVTA 5BOZG 1Z3RA 1QSFA 4I77H 3EYUL 3UTSD 3OL2A 3UTQB 3RA7L 2EIMB 3D51A 1MLCB 3HG1E 4PGCB 1W9XA 4PGDB 2DWDA 3O2VH 3VFWB 5IHLB 2F1EA 1ZMYA 1CFQA 1S5IL 2B59A 3MRRB 5I1KH 4RESB 5KSBA 2FK9A 1KCUL 3ZTDC 1MJUH 1T5KA 4WFHD 4LCCB 2C3WA 3DJ9A 4LF3B 3L1EA 4OB5H 4Y2DA 2QHRL 4RFOL 1PDKB 3KYKH 2BNRB 3LD8C 3FFCE 4A2HA 4ZD3L 4XXCC 3R4RA 2FIKB 4DKTA 1BXXA 3V0FA 4FLOA 1HNFA 4N2NA 2GAZA 5E6IB 1H8OA 3L4UA 3MRFB 3OSVA 3BX7C 3Q6FA 2VDOL 2WQWA 1T80A 4KROD 3HA0A 4FDWA 5KVMC 1YEEH 3MNWA 4JFUA 1IC1A 2FATL 4MQ7B 3G08A 1QFUH 4MS8D 3EOYG 1F18A 4DUWA 2FGWL 3UAJC 1HSBB 5E6UB 3O41B 1OSPH 2CKBL 2FHBA 1PS3A 5DUBB 5AL0A 1O7DC 2XWTB 3ULUF 1R6VA 3FULA 4YE0A 3U83A 4KHTL 1M9SA 4NZRH 2L7UA 1U8NA 4X7SL 5T5FL 3D07A 4NUGH 4HJ1A 1A9EB 1IBHA 4LAJH 2DQFB 4LAQL 3HC4L 4RIRA 4YHKL 3JBG7 1EXUB 1AXSB 2GITA 2J21A 4Q4EA 4U0QB 3TV8A 4AVIA 3K6OA 1BVKA 1LJMA 5D7KD 6PCYA 3VU1A 2P8PA 4LVOC 4FGMA 4ADGA 1DDTA 2J8UB 1MAMH 1S9VB 4K2UH 5D71L 4OZIA 5DVMA 1MLBB 3EDJA 1QLFA 1DQJA 2D9CA 4LT7A 1FA4A 4QF1A 1AXTH 4K5NA 3ZKSD 3B56A 1RZIB 2KYIA 4UT9L 5KAQG 4ZS6C 4YBQD 3O2DH 2Q8BL 4DGYL 3RZCB 2QKIC 1YAIA 3V4VH 3VXRA 1OCWL 3ABGA 4Y19D 1AIZA 1SYVA 2ZYSA 1UENA 3EJCA 4GXVL 2APFA 4RMVA 4TOYL 1MCWW 1JHKH 1SXBA 3MCLL 5AVSB 2D7NA 2YLKA 3MODL 1G9HA 2XX0A 3TWCL 3M1BB 3BKCL 4AEEA 2IV8A 3GHEH 4HALA 5EEWA 2H32A 4M7JH 3ZRSA 1KGCE 3HJEA 4N0YH 1ASPA 2A6KB 5GGQH 2NYYC 4V1DA 3CUPB 4HT1L 4N90E 3EH3B 1IGJA 3MRBB 3OKOA 1L6PA 1J8SA 4X5XB 5EO9B 1RIVH 2CIIB 2ED7A 2OMYA 2OP4L 4G6JH 4PP2B 4MNQD 3RNQB 5BCAA 5FO8B 2GJ6D 3DX6A 1KPRB 1S9YA 3C2AH 4YZFF 4ZTPH 2O5YH 4P4KC 3EJPA 4HUMB 1UASA 2F58L 2O30A 3BP4A 1FV1A 3QRBA 3KG5A 3VA6A 1JERA 5BUPA 4Y4FA 5DRWB 5KBNC 5C0DB 4BUHA 4JN1L 1GYWA 2PTUA 5DYOB 2CJTA 2R29A 3MCKB 1LQBC 4YK4B 4JDVA 1I31A 2XPGA 4L0YA 1JMZA 4EAEA 4FYQA 3W5MA 2QZ5A 4XPHH 2I32A 1H9DA 1CK0L 3TBYB 3GIZL 2BCKA 3MMEA 1UT2A 4IBTA 4RAVA 3T2PA 3QIWD 5AAMA 4R4FL 1MIMH 2Z35B 3ZT7A 3WKNA 3MRMB 1JGEB 5FEBA 4J4PC 1MEXH 3QFJA 4BFRA 1NEZA 3GXUB 1NSNL 1YUHB 3FQWA 4XNAA 3VXMA 1CU4H 2QADB 4BKTC 5IG7A 5C0AE 2PTTB 2M26A 1AP2B 4GP4B 4XMXA 1UH3A 2E7DA 3FF7A 3RL2B 4Q74A 3QIUC 1ORQB 4QRTB 3U0TB 2C3XA 2OJEA 2WYHA 2XN9A 3CHOA 4QHPA 2HG5A 1D2PA 4FC3E 3RWIA 6CGTA 1PZCA 2LQRA 4Q4IA 1X5LA 3KBPA 4ZYKB 2EILB 5D1ZD 5IOKA 2QDVA 3ZKXC 2NUPB 3CDFA 1CPUA 1OXYA 35C8L 3NCXA 4K7PY 3UBXA 1TPXC 2ATKB 2PXYA 3UZEC 4EKJA 4MB4A 4YIQA 1E4JA 5DQJA 3MJ9A 3TBVB 1MI5A 4NUPA 1OK0A 2Z31D 2BIOA 4FRWA 3SYQA 4PCKA 2NXYC 4ZO6A 4XNXH 2DTML 1F1AA 3S9DB 4G9FD 3PGDA 2BOCA 1DSYA 1M56B 5IMLB 2E9BA 2FE0A 4TNGA 2QR0A 3PWPD 2PPDA 1EEUA 3MLPA 4RMUA 3BDYL 2A9MH 3HS0C 1QFWH 2R9HC 4W9DC 2DQIH 3MUJA 4WW2B 3AG3B 2O5NA 4NKQB 4AMWA 4J8QA 1NGWA 4Z76A 3QDJD 2D31B 4OF7A 4XX1E 4JFPB 4WO4C 2OI9B 3LKSA 4X8GA 4X4YB 3V5KB 2HLFC 3CQQA 4RX4D 5I73B 5IHZA 4QYOB 1U0QA 4IHOA 5HYJE 3KPQB 4J3OC 2IC2A 2HT4D 4NLHA 4DGIL 2D7QA 4NZUH 1MHEA 1UZGA 4LHUB 5D6DA 2HRLA 1GJIA 4I2XA 5AOLA 3MLTA 1MOEA 2P5WD 4M62H 4M5YH 3ARPA 3TBCA 5DO8A 5HJBA 3MQIA 3OKYA 1YEKH 3QEGL 3LZPA 2J12B 3V0EA 2VLRB 2DWEA 3BVUA 3MV9E 1Q38A 1F4YL 1OB1A 1BZOA 1EO8H 1N64L 2DQCH 1T1WA 2BRQA 3QA3B 5I0VA 4M00A 5D7EA 4ONFL 4ALAL 5F7KC 1E5UI 3QO1A 1ZA6A 2KHAA 4GIPD 2O61A 4NAMA 2N01B 4UIKH 3A6BL 4MJHA 1FO0H 5FO9B 2WSDA 2D9QB 2FO8A 2EABA 3CZKA 1V3KA 2FWOB 2GT9A 4XOCA 1JDCA 4MBRA 1RIHH 4AQEA 3THML 4AOFA 4LVNC 2QV2A 1U41A 1XH0A 1GZPB 1WIPA 1IZJA 4X99A 4B5EA 4J7RA 2Z7WA 3SEPA 5I1CH 2YPKB 2FD6H 5BV7B 2R2BA 5EMYA 1BSIA 3MRJB 5FGBC 43C9B 1JXJA 4AGPA 2K7PA 1U8CB 1KJ3L 1E9OA 5DK0B 3BSZH 1S7RB 2F74B 3K5RA 4TNEA 1GMEA 4OGZA 2C1PB 1F3JA 3VD5A 3CQPA 3EHBB 3L1OH 3NABH 4OUUA 1G9NH 4Y0GA 1LE5B 1R24A 3ML8A 1E28B 1C9SA 2BMKB 2JB5H 4JRXE 1U42A 5E9DE 4EZMA 2JSFA 3FPXA 5KYYB 1IC5H 1IB5A 1GAFH 2BNQE 3EFOA 3NFPA 3NP3A 4NN7B 2MNUA 1IKNA 2WVVA 4HJGA 5L2KD 5EIIB 3MRDB 4R96B 1MFCH 3QWNA 4TSBH 2DYRB 1G7QA 3V79C 3LS4L 3TBTB 4RDBA 4MLSA 1R3JA 1RURL 3LTVA 3TN0C 1TJIH 4N0CC 3AXHA 4QHLA 2RA1A 2MSPA 3SE9L 5J3HD 4BA8A 3FO0L 1BZDA 1L9RA 1MZZA 3MZTA 1MREL 1F58L 1ITCA 2ZXAA 5HHVH 5MENB 5AAPA 3VI3B 5E2TL 3VAEA 1HE8A 4OBSA 4XVSH 2XTLA 1M2VB 4Y5XA 4CVZA 1XCWA 5KWYC 2VDQB 1UQSB 2AAVA 3ATDA 5HHXL 3DV4A 3RE0A 2Z93A 2VE6A 4KAQL 1CDGA 2L7JA 1SEBA 1XT5A 5EN3A 4KKNA 5FLVA 1J12A 5FUOH 4H8VA 5SWSD 4FQ1L 5FDWA 3U1PA 1EDQA 1BF8A 4JO2H 1ZTXH 2OFQA 4I1PA 4HKXB 3FZUD 5EFIA 2NXZB 3BP6A 1PEZA 3BZ4A 3UMTA 1ZHKA 3JUYA 4L18A 1BFOA 3Q2NA 3UBFA 5CCJA 2QVFB 1J8HD 2X3BA 4H5SB 4B6ZA 1JHTB 4FP8L 4GKZB 4HUNB 5FM5O 4HG4J 2UYLB 3W39A 4TV3A 4YHOL 2GTQA 1JGDA 2VSCA 2J8OA 5BJTA 5E5RB 4YXLL 4OV5B 1KNOB 4A2DA 3S36L 2BP8A 4L1TA 2OSXA 3L54A 3WNLA 2Y24A 4JHWH 4L3ED 3U7YH 3O4LB 4GSQA 5BVPL 1G7LB 4OZFA 4Z95L 2YD6A 3UDWC 1UXLA 4U1NA 3ARFA 1J9CT 4WAFA 2ZXWB 3SPCA 4I87A 3AY2A 2BIHA 3FYIB 3OR6A 4QRPE 1CFNA 2E46A 4KKAC 3ZKMD 5EU6A 4DOHE 1W2KT 4FNRA 5C09E 3IXTA 3G9VA 4EI5B 1FNSL 2AS5M 4FJYA 4ODXB 2X4UB 4JO5A 1MFUA 2ITFA 3W0WB 1S7VB 4BK5A 4XNQB 4E68A 1DUYB 4P9HL 3RDTC 4R0LB 3PXJA 4AXWB 5JXAL 4ZT1A 2XZCL 3KXFB 4XMUA 1RZGA 5B3JE 1JGVH 1BQHG 5HGAB 4BCXA 3US0A 1IEBB 3GSUB 4I1NB 4ZMPA 2ZQKA 3IJHB 4PVMA 2A9CA 3TNNA 1SYSA 5CEYB 4U3XA 2BNRE 1D5IH 2Z4QB 3RWJA 15C8H 5C0CA 3HG5A 4TULH 3EYSH 3FFCD 1CDBA 1SLUA 1CICD 1OOWA 3AWGA 3MCYA 3TEXA 3T4AA 1XBDA 3HPJA 2EDEA 4LMQI 4EXKA 2YAMA 1KIUB 1MCKA 5JIHA 3RKDC 3S3SA 3NK3A 2I07B 4ES8A 2WLNA 2XY2A 3WFEL 1NFIB 2X2HA 3CFEB 4QLWA 1RJZA 2K0RA 3AROA 1RIUH 2UXVA 5L0QB 3P77A 5CBAB 4AVJA 4MA1C 3SPGA 5DC9B 2HG0A 1WBYB 2ZF8A 4BFJA 4M9PA 3K6SB 4HOWA 3QQDB 3CK0L 3BAKA 3MV7B 3T8XB 4ZW7A 4A7SA 2NY0D 4B97A 1F4WL 2R23B 2BC4B 2IBZX 3TF7C 5GZNC 1U8LB 2X4QB 3BIKB 1S8DB 4L4TB 3EBGA 4RAHA 2GYSA 4Z7VF 2HMID 5IIEB 2FT7A 2V2XA 5ALBL 1BZ9A 1N7ML 1AZUA 1CG9B 2D3JA 3AWEA 3MFGB 4CN6A 1BBDH 1ZLEA 3GSOA 3QXDA 2BVOB 4OCMC 2J8UE 4ZFZA 1LO0L 2R56H 3QWOA 3HI5H 2CO6B 4UT6H 3ECBB 1T1ZB 4YVUA 5AEAA 3RWFB 1EH9A 1MHPH 1NLBH 4JMXA 3VH8A 2J20A 3SDAA 4P5MB 4N2DA 5DXWA 4WJG3 1HOCB 1JWMB 3S3CB 4AITA 2ZCLH 1EJ8A 1GGIH 2JFCA 1O6SB 3T3MF 1FIGH 4ILDA 5CSZB 4UM8A 5DEGB 4Q0XH 1NFAA 3PPEA 3ARBB 1MCNA 5I1EH 1R75A 2VXVL 4PMEA 2DMGA 4YX2H 4KUZL 2QJDA 4IBSA 4MJJA 2BIMA 3ARDC 1G9NC 4PP1C 4MDRA 3O3DB 4KFMA 1CI5A 1FHNA 4NM4H 5LVEA 3T0VA 5D5MB 5KAQF 5C3TA 1LLAA 2NW2B 4XZ4A 4YQXL 3LRGA 1CT8B 3MLWH 4PJHB 1HZHH 3N42F 5G2NA 3V5HB 2VJ0A 4WY7H 1KGCD 2Z92A 4O00A 4LASL 4QWWD 2YRZA 1XB3A 2X3AA 1XTMA 4N8VA 4U1KA 2K1MA 5JOFB 2C1OB 2AHIA 5ADOH 4NZTH 1D6VL 4N8PA 4ATWA 5CLXA 1I1FA 3IGAA 3PQYD 1UD3A 2W59A 3QHFH 3QR0A 3QEHB 1KXTA 3DSFL 4UINH 4BZ2H 1XGUB 3CC1A 3U9UB 1J1PL 4R7DA 2G5UA 1D5BA 1F97A 2D73A 1KBGH 2HVKB 3LNHA 1IGFH 2QQLH 1JJUA 5CGTA 1DUZB 2ED6A 2VQ1A 4OJAA 2EAEA 1EEQA 1ZJBA 2Q76B 5T8IA 4X4XA 4MA8L 2P5EA 2XRAL 3MLVL 4PJ9A 4UI2A 5IUCA 2FEDD 3WKQA 2BSBA 5EPMA 3D0VA 4QTIH 3RVUC 3NP4A 1L6XA 1FVCB 1U93B 4HKBB 4G72B 3U2SB 1DL7H 1Y1UA 2JIXA 5DSCB 5FF6B 1BLNA 4FFTA 5IQ7L 3H3PL 2W1NA 1OSEA 4JO8A 2OZ4L 4LSPH 4L4VB 1X3DA 4AVKA 4FNLH 4OT1L 2PW2B 3K0YA 2X41A 2M8XA 4AIZA 5KS9A 4AQ1B 2MFNA 1Q72L 3LEYL 3GWJA 4W9JC 3S3BB 2YIHA 2R2CA 1IL1A 5KSVA 4PJ6A 1BA9A 4XMVA 4UQ3A 1PKQB 4O5LH 2JKTM 3DHMA 3EJJX 2OA9A 2CM5A 4UQAA 1NMBL 3MLXL 3WTXA 1EJOL 1BEYL 4JUTA 4OAWA 3GMRA 4HIIA 4P23D 2V37A 4H26B 3SODB 4QTHA 2VDMB 4JQIL 1KEGH 5CSBA 1SLWA 1CXHA 1T6WA 3SOBL 5F7MC 5GISH 2XFXA 3HMXA 3KCPB 3KNBA 3GZPA 5BW7C 1EXHA 1WZ1L 1YEIH 2B14A 3P0YH 5D1XA 2MPVA 4GQPH 1FZMB 3M88A 3BAEH 2YPVL 1Q9LB 4OIIL 2YSSB 3LQZB 4OFIA 5C0BB 3F04A 2HJKB 4X8JB 1FQ9C 1YJDL 2YRPA 3R1GH 2ZWYA 3G5ZA 3F05A 3ZN6A 4MMZA 2NZ1A 4QKXB 2VDQL 2WN3A 1NEZG 2FBJL 1GCYA 1DJGA 2ZKMX 3ZJAA 4NN6C 1AY1L 5BQ7A 4HIXL 1ET5A 1TLKA 5HYJD 1AGCB 1TLMA 1PZ2A 3RY6A 5F96H 3ZZ1A 2R7EB 3CDZA 3HC3H 1UM6H 2WBJC 2XWXA 1CDUA 4A63A 4PG2C 5E2VH 3SE8L 4FKEA 4HJTA 3VG9B 4BSVB 1F6LL 5TGBA 1AE6H 5GS1B 1WIUA 3MV9D 2ERJB 5TE4L 4YHNB 1SLVA 1KG0B 3K71A 2X2JA 5D2NE 3RHWF 4V2BA 4NENB 4JDTL 1HXMB 2W80C 4JDZA 1LO3L 4WI0A 2Y6SC 1DP0A 1G9MC 1GGBH 2JH2A 4PRID 4JKKA 4XH2A 3U4BL 5HY9B 5F88B 5CS7A 5B8CB 4NO2B 4UTCA 1E50A 2XTSA 4YVNA 3BKML 2G5RA 5GRZA 3AS3A 2GPZA 3OLEA 3UJJH 4N6QA 4PJ5A 3BPCB 1T21B 4LL1A 1U4EA 3ZXAC 4JPQA 1Z0NA 3KYOB 2BP0B 4DEPB 4YHYB 5T1MB 3C5ZA 3A67L 1U8KB 1IFRA 3KWXA 4LU5L 5SX4H 5F89B 1TMCB 1WFMA 4HJJL 1FRGH 5DK3A 4NWUH 3I9IA 2FJGA 1TFHA 3O3UN 3NSFA 4U6TA 1II4E 5DZVA 4G6FD 4XHQA 4JRXD 4EQ2A 1TVBA 2ZSVA 3NT0A 2Y5QA 1UKQA 1IFHH 4WEBL 5E8PB 4EF3A 3W57A 5DMYA 2JCWA 5E24E 4NQUA 4L1HA 2J6EH 4HMEA 4EDXA 3FT2B 5EG6C 1MCLA 1NCAL 3OZLA 3B7SA 4UBDD 1KTDA 3NEOA 1M05A 5F1IB 3TYFB 3W3BA 4NFDA 4AYBA 1CFTA 4OGXL 3LKNA 3WMPA 4RMSA 4JANA 4KKCC 5A3ID 3RU8L 2NY5C 2IAAC 3G5YB 1BAFH 1KV3A 2J1YA 5MENE 1TT6A 4PHZA 3VI3E 5CJXA 1NMAH 1VGKA 1W72B 3ILPA 4PRPB 5EEUA 3BP5A 2XTJC 3ISWA 4O9HL 2MOVA 4PJEB 3ULVC 4HMDA 4Z7WB 2W0PA 1YYLL 4ENEC 4M4RA 4MB1A 2FR4B 3TURA 5HHNA 1F3RB 5DJYB 5C0EB 5I19L 4HUWB 3D2UB 1FNFA 3WJJC 2N7AA 2NY6B 4FNSA 4F7TB 3QI9A 4PSPA 4N22A 4EN2A 3ESMA 4AK2A 1PKOA 2X28A 1AZCA 2UUDH 3LHAA 1BVZA 1MRFH 4NKOB 1IAOB 3U25A 2O6FA 3VGDA 3CZJA 3ZR6A 1MNNA 3JVGC 4U3SA 1B6UA 2J6WA 4HX1B 4YSSA 3BQUA 1FFTB 2LFEA 2APBA 2JKSA 4GEIA 2OPCA 1KIPB 5LQBL 3UJTL 2FJFA 4FKKA 5CJQL 1AZZC 4DN3L 4OSUL 2X40A 1N59B 4G7VH 1P1ZB 2GK0B 1QW9A 3LZNA 1N2RA 4WW2F 5IB1A 4PJGA 2F18A 1GJUA 1YNLH 5DFAA 3VXOB 1I7UA 1OSZA 3L2MA 4KKBD 2HT2D 2VZVA 3IWUA 2CG9X 4FFVC 3O4LE 1OGAB 1X5YA 4M7ZC 4P4RB 1V7ML 1PZ3A 3NQKA 4IOSA 2JE8A 2R8SH 1UD8A 1LP9A 3QQNA 4GAYB 5EIQA 2FO1A 5E2UH 3EYVA 1CGUA 2QELA 4PJFA 3BVWA 4PV8B 3ROOA 1DQMH 1C16A 2RQEA 3B34A 3C08H 1Z5LB 4FE9A 3IDGB 2E7LC 4CAGA 2F15A 1WCBB 3W0WE 5KSAC 2XHNA 3PXHA 4PS8A 1R9FA 1XR8B 1KULA 4NQEA 3NCJH 4RQQB 1ADWA 2IFFH 1TENA 1CR9H 1I1AC 2PO6C 2J5LC 3CVHB 4OF3A 2XBZA 3S4SB 1PCXA 3AY4C 4GKSA 4KZEH 1JD9A 4LRIC 1ZS2A 4JM2B 3OJMB 4G1EB 4J27A 1X9UA 3SDCB 2WINA 3M6DA 2GFBB 4M3JA 1UJ3B 1U2YA 3FO2A 1W8OA 4KKLD 1JDDA 2YC1A 3GNMH 3S37H 2HZHA 5IJDC 4JJOA 4R2GB 1DBKL 3E9TA 1X4ZA 1AD0A 2H3NA 3WIHH 1XSKA 1S3KH 5F7WC 1VFMA 5E6ID 1CLOL 3GMPB 4ZUSA 5GS0C 3NZSA 1JXKA 1HU8A 3UYRL 5DD1H 5I5IA 1ASQA 3SD2A 1DE4B 4OZFG 1JHLH 3MU3A 4S1DD 1G7MB 5FECB 4ZMAT 5CHNA 2X9ZA 4GP8B 1E27B 4PUBL 2IEPA 1PSKH 1IMHC 4CDGC 5IHUH 1HYSC 3F8UB 3ECWA 3MV7E 1JFQL 5GRYA 1SF3A 2B3RA 4LLYB 4YDZA 3AAZA 2F8OA 2ZAGA 4XBGA 4HHAA 5I5JA 7FABH 1A4AA 4ZUVB 1H15A 3KDMA 4L4TE 3MRGB 1E40A 2VIRB 2WO4A 4C54A 3CSYA 1QUNA 1C08A 1X9RA 1JZ4A 3FAWA 1XGQB 3QXWA 4ABUA 3DGDA 2I60H 1MCPL 3GS7A 4LVHB 5CAYB 5DD0H 1V8HA 4KKZA 1RHHB 1JF1B 2VABA 3U4EB 1KFAL 2PWDA 3V6ZB 1AQDA 1OPOA 2BZCA 3UTZA 3NEEA 4JFFB 5AZEL 1Z0MA 3FT3A 4PI2A 3QP3A 4P5SA 1CZ8H 3PWJB 2R1XB 3WFDH 3FXIC 4BZ1L 2CJSA 3PUUA 3FC8A 4ZAKC 2VDML 4XWGL 3ZQWA 2JV6A 2DQJL 3QZWA 1BPVA 4M5TA 3QQ3A 1A1MB 2YMOA 5C07B 1PG7X 1FSKC 3FMGL 2QVTA 1NEUA 5E9NA 1G0DA 5CCKL 1KEMH 1L7IH 1LEGB 5A1AA 4L3AA 1OANA 1I8IB 4GO6B 4BFNA 4ECNA 5FW8A 8PAZA 3MRIB 4K8RC 2YBGA 5GS3A 2YUZA 2Q9OA 1JZDC 5LAXA 2E8YA 3ZZSA 3BGMA 5GZOD 3BSGA 1A7NL 4M6OL 3E2HB 3IAQA 5D7IF 3QXAB 2MOQA 1ZSDA 3DO7A 3T0DA 3HLAB 1G7HA 4TLSA 4X80H 5ALCH 4EOWH 4N86A 4JQVC 3NCYS 1XF4B 5LNEA 1RZQA 3WSQL 3ZE1F 2DM3A 4I8DA 3UC2A 4APQD 1XEUA 4G8FB 4IRSA 3VXUA 3ZT5A 5JPMB 2VMEA 4KROC 3QQ4A 1A9VA 5C8JB 4MQXC 4KXDA 3MBEC 2YARA 1Z32X 1AYRA 4H8WC 3BPLC 4MAUL 2FQEA 2GKIA 4YHMH 2GTWA 3JSSA 4WO0A 3FCBA 3SJVB 4K7PH 3PUCA 5E6ZA 3KPNB 2UWEA 4AGMA 5CZVH 3VH8G 4K9EH 1DFBH 5LNDA 1X7SA 1H5BB 3MNMA 1OF0A 2BIIA 1XGYL 2XVBA 4PJIE 2EINB 1BMWA 2D7TL 1QHQA 2N4IA 2GTZA 5TE6H 2ZP9A 1UM5H 4UQ2B 1ZHBA 4L4VE 5JYLA 4OZIF 3NBNA 3NRFA 2QADD 3LOWA 4TF4A 2FECL 3NGBC 1ONQA 2WXKA 1L7TL 4OCYH 4D0BB 1R3LA 4CVUA 3T0EB 2YUWA 4QRUB 4RISH 1A02N 1HZKA 1NAML 4HWNA 2QGEA 2YD1A 3ILDA 3O6FC 1A1OA 1T7ZA 5DHYA 1D5MB 5EZLA 3TCXA 3Q2LA 1MCSA 1P4BL 1UWXK 1QI4A 4APXB 1PKQE 4N8VG 4R7LA 3E6FB 2W07B 3KD4A 1UD5A 1E0OB 1ZPUA 4AL8H 3NJXA 2LR4A 4ZX6A 1BREA 2EYTB 1DVFB 4MMYA 4X42A 1JGLL 5I9QB 3L3OC 3CFIC 3ARGA 3LKRA 3GHBH 5SV3A 5J13B 2FB4L 3BH4A 1MNUL 2YK1H 4W9HC 3U48A 2YPLE 4JCWA 3U4KA 4LCIH 4Y1TA 1DANT 3ZQXA 3QPKA 3REVA 2AI0H 1FGVH 2FZ3A 3DX4A 4Z0BH 2Y3AA 1V7NH 3B8YA 1SDDB 3FCTB 1OM3H 3OHXC 2VNCA 3INUL 4D9RE 2DQEL 1TZGH 1A7RL 2WLYA 5DZAA 4BK4A 1ACZA 1B9ZA 4R97C 1ZA3B 1W72L 2GG1A 3FRPA 5EO0B 4JJHA 4L9DA 1R5WA 4J8RB 3PDGA 5CEXB 1FL6B 1P7BA 1QBLH 3KPRB 4NOFA 4QCIB 4DJMA 1HJBC 3VACA 2ADGA 3LVTA 2J7LA 1GOGA 2CBOA 4J3SA 5GRUL 3UIYA 3VG0H 2ZCKL 3U0PA 1X4YA 3TIDA 2JK5B 1QBMH 4FQIL 2R0LH 3MN8A 4LHUD 4GQ9H 3QC6X 1QHOA 5TDNA 2EZ0D 2WWMC 2O1AA 3NCWA 1F3DH 4NT6B 1HYRC 4KOCA 5MERA 4Q58C 1PX3A 3KGRA 4AEIH 3KGTA 2VLRD 3S88L 3QJRB 3PPSA 4NDMB 3QIWC 1CF8L 3HRPA 4HGWA 4IHBA 1OW0A 5BRPA 3AITA 1XH1A 3CFJB 4JL2A 1A6AB 4JDEB 3VFRA 5IHWA 3FUHA 3HC0A 3IXAB 5T1KB 2NW3B 3KLSA 3M8OL 3EDKA 4FMVA 5F3HB 5ITFA 1SN0A 5DRZB 4ZODA 2X4SA 5MP6L 1DZBA 3CDYA 3WI9A 4Z7AA 3H42H 1UB5B 2LLLA 5TQ0H 3IN2A 4D3CL 4U7MA 2KDYA 3NFNB 3H7BB 4X5WB 1CF1A 2XV3A 1LK2A 4HWZA 2VSDA 4ZMZA 4DVBB 2B1HH 3P9MA 3DLQR 5KSUA 4X5LA 1RZJC 2R69H 3V9EA 3B2VH 3LRSA 3MUGA 2PWHA 1UKSA 3KCWA 2DM2A 1XIWA 2H6UA 2WK2A 4FTVA 2ATPA 2LU4A 1ITBB 4ZQTA 5IJBC 2NZ9D 2W9DH 1HHHB 4IDJL 4Y8DC 2BY3A 5FOBB 5F7YC 1T03H 1HSAB 2HFEB 5F7DA 5F7EL 4YHPA 2E3VA 3FRUA 5DK2A 3OXSB 3HCVA 2XV6B 1QACA 1RPKA 2CE6A 1I7TB 1WZMA 4ZDHB 3K6FA 2X6BA 1M7XA 1E9QB 3SB3A 3TEZA 1KLGA 3CVHL 3VFPA 1HIMH 1HH6B 4PR5B 5ANMB 3MYJB 4PJIF 1HVXA 1KXHA 4A7UA 1G84A 3RUGA 4AEHH 1AS7A 2VRQA 3BCDA 2B3IA 3PCYA 4XXCA 2A6IA 3H3KA 2AEPL 1CCZA 4LLWB 3NIGB 1G9EA 1L0PA 5BRZA 5E4IA 3DO3A 3QFGA 4J6RL 5GRVK 2Y5TA 1JK8B 5MEND 4PRPE 4KTDH 1HQRA 3HHSA 3DHPA 2ETWA 3O6MH 4PJEE 2G0LA 3N2JA 4IW4C 1JXGA 2WXMA 3D3VB 4GRWH 2QPEB 3UAJA 2HKFL 3GEFA 3L4YA 3RWHB 5I1GL 3BPNC 1NL0H 2CK0H 3S5ZA 4F2ME 5FK9B 4N4YB 3HKZA 2JTYA 3OKMB 5FW7A 4I0CC 4PRBA 2F54B 4G42A 1ZE3H 5CIPB 4KY2A 4GYBA 2F7IA 4N6RB 3ZIYA 4Q9RH 1FGNL 4LARL 3MV8A 5K9JL 2NXZD 5HGDB 3UL4A 3FBKA 1AJ7L 1OTTD 3DX1A 3C60D 3L13A 4K9EC 5E0QA 2CK2A 4DAGH 5TE7H 4TQPA 3CZFA 5FYLL 2O5XH 3IDUA 4ZOBA 2AABL 4FXKB 3ZRFC 5MEPA 1KT2A 2QL1A 1G5GA 1PLGL 5DU7A 1O6TA 1R0AH 1JPSL 4X9FA 1FUNA 4FI6A 1OGAE 4R3SB 3GLDA 3N41B 4JFYA 3O4LD 1SXCA 4KRNA 2AKRA 3X1NA 2QKIA 3H9SB 3N1PC 2A7BA 1SY6A 4NKDA 3TU6A 5TQ2H 1XFPA 4H4NA 5SV4A 1MHHB 3GK8L 1FZKB 1H3GA 4ZXBC 4G5ZL 5FKPB 3X3FH 1NC4A 2OQJA 4XWOC 3W9EB 3VDAA 3EZ8A 2XJKA 1VKXB 4LHJB 3PNRB 4G6AC 3ULUC 3D85D 3BEVB 3OAWA 4PD4K 3ZT6A 3LB6C 3C6EA 1HL8A 3KXFD 2Q3ZA 4OLEA 1S5IH 2IH3B 4QDGA 4Y4KB 1KCUH 2VT0A 2DQHL 3WIAA 3WY3A 3WUWA 5J3HC 2RTTA 4D7BA 4RFOH 2EECA 1SEQL 4B96A 4ZD3H 2EYSB 3O9WA 2WZPD 1NOAA 2WVTA 1T1XB 2PCPB 1GZQB 5AVUB 1EAOA 5FYJL 1JV5A 2GUOA 4M43H 1Q9OA 2EDYA 2VDOH 5GGTA 2F19L 3FU6A 1NUNB 2OX5B 3Q5OA 3UC0H 3VGGA 3UACA 4OCNC 2FGWH 1HHJA 1Q9WA 2CO2A 2ALAA 2DQGH 3KPPB 3T2NL 4PRAB 2F8VA 2CKBH 2FEEI 4KH2A 2CIKB 3GHPA 2OYLA 2D3VA 1VCAA 4J4PA 2X4RA 5GRWA 5B1AB 3T09A 1OY3B 4KHTH 3MFFA 3OPUA 4NRZA 5JDSA 3RGHA 3MOBL 3MPCA 1ZHNB 3EJYD 1MFVA 4YBLB 5DJ2A 5C08A 1QFOA 3EXLA 4X7SH 5T5FH 3DGGA 3HG2A 3MLSH 4IRZL 3HC4H 2VZOA 5KG9B 1MG2C 4PJ8B 3EJUA 3QIUA 4J2QA 4YHKH 3X12A 5EZIL 2H6PB 4NBYB 4L4TD 4LLVB 3WN5B 1BWWA 1MFEL 3VD9A 3F7VA 3V0GA 3ARUA 3X17A 5EU5B 3KL5A 1JV2B 1DHKA 2DRUA 2MQ0A 4LOVA 5CUSL 4PM1A 1L9SA 2A73A 4P0DA 1DBJL 5FWQA 2TSAA 3RFZC 1H3PL 3T0BA 3PWNB 1Q90A 3UZEA 4PWFA 3SDXB 4JFFE 4UT9H 3A22A 4NSKB 4BFEA 3DRQA 5I1HL 4I0PD 5B39B 5JNYB 4HK3N 2Q8BH 4QD2E 4DGYH 1P5VA 3OMIB 3ZOAA 2KQNA 3GT6A 4LLMB 1OCWH 2OYKA 1GYAA 4NKMA 4OD3H 1I7RB 3V52H