2VR6A

Crystal structure of g85r als mutant of human cu,zn superoxide dismutase (cuznsod) at 1.3 a resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
153
structure length
153
Chain Sequence
ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLRNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the G85R Variant of Sod1 in Familial Amyotrophic Lateral Sclerosis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE DISMUTASE [CU-ZN]
total genus 40
structure length 153
sequence length 153
chains with identical sequence F
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2008-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2vr6A00
2WWNA 1TO4A 1YAZA 2GBTA 3HFFA 2XJLA 4MCNA 4MCMA 5CU9A 1ESOA 1AZVA 2R27A 4BD4A 1SXSA 1YSOA 3HOGA 1S4IA 1FUNA 1QUPA 3GTVA 2WKOF 3T5WA 4BCZA 4A7TA 1SXNA 2ZKXA 1RK7A 1U3NA 4N3UA 1KMGA 1F1AA 1XSOA 1IBDA 1B4TA 1SXBA 3K91A 1BA9A 1JCVA 1OEZW 3KBFA 1IBHA 2E47A 2VR7A 1SXZA 2ZOWA 3F7LA 1B4LA 3GTTA 4A7GF 1SPDA 2ZKYA 2GBUA 1TO5A 1PU0A 5KBMA 1F18A 1COBA 2Z7YA 2WYZA 3ECVA 1E9QB 3HW7A 4OH2A 1XTLA 3KBEA 1E9QA 1UXMA 1DSWA 1Q0EA 2JCWA 3CE1A 1UXLA 1SXCA 2WZ5A 1XTMA 2AQTA 1OAJA 5KBKA 1JK9A 2E46A 2Z7ZA 2AEOA 3MNDA 4L05A 3QQDB 4FF9A 1CBJA 1Z9PA 2AQRA 1F1GA 2WYTA 3KH3A 1BZOA 1E9PB 2APSA 2Q2LA 2Z7UA 1F1DA 2Z7WA 4A7SA 3CQQA 2NNXA 2WKOA 2WZ6A 4A7VA 3PU7A 1E9PA 1PZSA 3MKGA 2AQNA 3RE0A 3L9EA 3S0PA 2K4WA 1SXAA 3GZOA 1P1VA 3H2QA 2WZ0A 3GZQA 1L3NA 4U4IA 4B3EA 2C9SA 4A7QA 3ECWA 1N18A 2AQSA 1N19A 2JLPA 1OALA 2XJKA 3KM1A 2WWOA 4A7UA 4A7GA 4N3TA 1IB5A 2AQQA 5KBLA 1E9OB 2ZKWA 2SODB 1OZTG 3SODB 1E9OA 1SDYA 1JK9B 1SDAB 2AQPA 3GZPA 1YAIA 1IBFA 4BCYA 2AF2A 3F7KA 1EQWA 1IBBA 1MFMA 1PTZA 1Z9NA 3GQFA 1EJ8A 2GBVA 2VR6A 1SRDA 2C9UA 2VR8A 3CQPA 4OJAA 3LTVA 3KH4A 3L9YA 3KM2A 1HL4A 1CB4A 1SOSA 1HL5A 2C9VA 3ECUA 3QQDA 2LU5A 1DO5A 1OZUA 2V0AA 3H2PA
chains in the Genus database with same CATH superfamily
3QULB 3WN5C 3RDTC 1YAZA 3BQUB 3R0MA 1DVTA 3SYCA 3TCXA 2X4SA 5DFAA 2A6KA 1N59A 4HKJB 2OXHA 4MDJA 3VGFA 4FJ6A 4KKAD 4JO2H 4FYTA 5IMOB 5E8OB 4ONHA 2OTWA 1PAZA 4Z7OB 3MRGB 2JV6A 2A9BA 3BQUA 3GSQA 5DSCA 4X8CA 3QZLA 4WFHE 4IOFC 4QYOB 3D39B 1CFQB 2R0WL 2AV1A 4C4KT 2CRYA 4ZMQA 2A9MH 3ZKNC 3KDMB 3U0PA 1GH7A 3L13A 5KZCD 4ODUB 3RDTD 1BZQK 3TYGL 5LNGA 4LL4A 4J6IA 2EVFA 4HJSA 4N2BA 3OAZH 4RMTA 3GJFB 3HG1B 4PCYA 1Z3GH 5FM5M 5C07E 2XKNB 3PHOA 1DFBH 3H1ZA 3GSVB 4LCWA 2P8PA 5DJAA 5SX4H 3GMMB 5JHDA 5DD0H 1DVFB 4XB8A 5H37H 3NA9L 5B39B 3WTXA 3G08A 2ATKA 1UH2A 3G6JF 4KZDL 2QADB 2AQTA 4WI5A 5ENWB 3LNEA 3QDHA 3LY6A 4PV1C 2E5EA 4B41A 4JK0D 3HHSA 4PJ7B 4RSYA 4D0BB 3MV9B 4YFLF 1T89A 5D6CB 5HHPA 4H0GA 4UINH 3L6FB 4AZUA 2VDMB 1N8OE 3O8XC 1RJYA 2CK0L 4HW6A 4R7VA 4BFFA 3IFNH 1S9XA 1GKEA 5CKGA 5LHDA 3ME0B 3DI3B 1NCBL 1ETB1 1M05B 1NGPL 2JELL 1XCTB 3BPNC 1UKSA 2ESVB 3VTAA 2IAMD 3JZYA 5TE7H 3QIUB 2F54D 2VDLH 2JH2A 3QT2A 4Q6IA 3QDJB 5CJQH 5DJ8B 4YXKL 1KF9B 5KVEE 3U36B 4KJWC 4JM4L 4F8LA 1L0XA 4JPIB 1YNKL 1IJ9A 4E41A 4PLOB 1QYGL 3MNVB 1IM9A 4S11A 5D2NB 3FT2A 2J43A 4I89A 2D7PA 2DD8H 5EUKB 4X4YA 4KTYA 3C09B 4ZUTB 1IBGH 2K3HA 3AACA 3GSVA 4JPSA 4QD2E 3EFFA 4TULL 2CZNA 3MJ9H 1BEYH 1CD1B 3C8HA 1LJMA 1HCZA 1QFHA 2UZPA 1JNLL 5FK9B 4YHLH 3DOIA 1DQJB 5L7XH 2C4FT 1DVYA 1KTRL 2QDVA 1EAJA 4QWWC 3UJTH 1E4XI 2X4TA 3I6SA 5FGCE 4DP7X 4AW7A 4J8QA 1XF2A 3F7RA 2ZUTA 5ECGA 3OKEA 5D7HA 4Z7WE 5SWZE 5KN5B 3E38A 5IREA 2RHEA 4GBXA 1IEBA 4UBDD 3DX9A 3WLWC 3FYEB 4K3JL 1OLLA 2IQAB 4L9LB 3ZTDC 1YYMH 2AABL 3HZKB 3KBPA 3PJNA 4PREB 4X8JA 4Y4KA 5FOJA 5HDQH 3T0AA 2C9AA 3VXSD 4BXVA 3QP3A 4OIAA 3QEHB 3SGKA 5C0RL 1LQBC 3IMTA 1QFUL 1I9JL 2CIKA 4BDVA 1BXUA 2VDPH 1JDAA 4EDXA 1FFRA 4LNRB 1FORL 3I50H 3IFLL 5CD5C 5IB4A 1IM3D 2XWXA 4RFOL 5JDSA 1XIWD 1BPVA 1J10A 3L8QA 1T21B 2WXQA 4ZFFA 2OW7A 2XXMB 1DLFH 1O9ZA 2FGWL 2ZCLH 4LSRH 4QXTB 2F5AL 1IC4L 4HCFA 4WQOA 1CFSB 5EBWA 2D03L 2GEQA 2NY4C 2VZ3A 1DVQA 3PHQB 2HRGA 1HI6A 4XRCB 2WLMA 2CUMA 2J88H 2CR0A 4X4ZA 5F7NC 2V7NB 5IHWA 3B7UX 5L6YH 4YXHL 1YUHA 5JPNA 1U2CA 1DLHA 5HJ3B 4L1HA 1EAQA 3RGHA 1LDSA 2YUZA 3AREC 1CPUA 3KJ6H 3MRNB 4LHUB 4MMXC 3HRZA 3L3IB 4N2EA 2CO7A 5CHNA 5E51A 3KPRD 4V33A 1KCLA 4WO4A 2WYHA 1BOGA 2CGRL 1DQIA 2GBAA 4QR7A 3BYYA 3C60B 3V55A 4BSVB 2ENQA 4G5ZH 2CKBA 1UD6A 4KNTA 4TNFA 1N9PA 1LYQA 2WJ5A 4JQXC 5TFSH 5KJ7E 4ZQTA 3T3MF 4EZJA 4MAYB 2GCYA 4IJ3B 4GRWE 4I87A 1RIUH 3MGOA 2FSDA 4AKPA 3WIIH 3QUKA 4Z7OE 3WEMA 2W1NA 1G0DA 5F7MC 2YPLA 3CZSA 2J55A 3R4RA 4JDTH 4MD4B 4R4NC 1C1EH 1CFNA 5JQ6H 2BP8B 1B3IA 1Y7VA 2CCWA 2KT6A 5EZIH 3CXHK 2ZCZA 3O0LA 4PJ8D 1L4IA 3SKNA 2AK4D 2VZUA 5I1IL 5ICYB 3IGUA 2ZP8A 1AOZA 5CLXA 2Z35B 3W39A 3QIBC 3WNKA 4MX7B 4ZOAA 2YUVA 2WYIA 3IMBA 3N0PB 2JJSA 3ARVA 3SCMC 3SODB 1G6RL 2W9LA 1E9OA 4MD4A 4NZDA 4U31A 2JQMA 2XN2A 4JRXA 1BZ7B 4UQEA 4JG0L 3LZLA 1ZRUA 4YL4A 3MRNA 1OARH 3L2NA 2BNRB 3B43A 1BBJB 3LB6D 1D2OA 4JFWA 1BOGB 5FB8A 2DQMA 1ZV2A 3OQ3B 1CU4L 4AG4L 2CBTA 3EYVB 4P23C 5KWYC 2LVCA 4NP9A 5HYSA 3BAIA 5D4QA 1O5DT 1YJDC 3QUXA 4H4NA 4NWTL 1UH3A 4X6DB 4WV1A 3TFBA 5FXCH 3F62A 4BFBD 4BZ2L 1NICA 1ZY9A 5EU4A 1LK3L 4KVNH 4O2EA 2R83A 1RJCA 4XX5A 2YSSB 5I6PA 1OAXH 5T1LA 4Q97A 2DQEH 3HMXA 2QHRH 5LBSL 3SJVD 3NCJH 3MCLL 5I1HL 2NQDA 3VDAA 4WJKB 3UTTE 1QSZA 4X80H 2XWTA 4KBPA 2WLLB 4N0YL 5E6YA 1HYRC 2O6CA 3FULA 3ASOB 4OUUB 4PJXA 3QNYA 5T5NF 1HX0A 3S97C 2NUPA 3WS6C 4ODUA 5ICZA 3T6ZA 4OB5H 4Y7MA 4C58B 4F20A 1COBA 1BIIB 5I30H 2WINA 4M1DH 2NXYB 5ABAA 1JWMA 1L5GA 4LSPH 4LCIH 2X41A 4PRHE 3U0WH 4Q14A 2IPKB 4N2LA 1OAQL 3ZDYE 4XVSL 3NABL 3MUJA 3CUPB 4G7VL 3K4DA 2C7UA 2KQNA 3A4AA 2YFOA 2EE2A 5JHLL 4RMWA 4E41D 3DMMB 4FQXA 2FT8A 4EZLA 1RZJL 4U6VL 4PRPB 4AIEA 1VFAB 2IH1A 2ZWKA 1JNJA 2J1ZA 2J6EL 5EU4B 2BY2A 3NZ8B 4N24A 1KN4L 3TC9A 3QJQB 5T1LB 2VH5L 3B34A 3O41B 4O51A 5GGSA 5D1QC 5KYUA 2YS4A 4FZEH 2OBGA 2XTLA 3RKDD 1NKGA 3KVPA 3OGOE 3S3BB 4HG4J 3T4AA 2HFTA 1JHTA 1M71B 1SY6A 1J1OH 3IN2A 2FB4L 2AJVL 4UTAA 2X53A 3NP4A 3MX0B 1B0GB 2XLLA 4FKHA 3PQYD 1CDGA 2E59A 2DBJA 3V5KA 4NRZB 4Z7VA 3FU9A 3ZGHA 4S1RL 4N0UE 1NCWL 4LSTL 4DN4H 2FWLB 2X2HA 5MHSD 2TRHA 4YGVA 1YHPA 1F58L 2B77A 5DRWA 4W1TA 3BZ5A 1A4KB 3OSKA 4ZW6A 5JXEA 3NTCH 4E9XA 5JIDA 4FL4C 2JE8A 3J27A 1LMIA 3LKPA 1FBIH 5C09E 4MA1C 4QJ3B 1AG0A 3NGBC 1MCLA 3L9YA 2ZCKH 4MNQE 3E6FB 5J1AA 3GKZA 3FT4A 1PQZB 3PWNA 4U1GC 3BQVA 2OL3L 1ROWA 5BPPA 4QHKI 4Z7IA 1IKFH 1HINH 1KCSL 1ZA6A 3T3MB 2IAND 3LKQB 1GA2A 1TZHA 5D2LB 2UY6B 3QWNA 4R7NB 3RP1A 4MAYD 5FGRA 2WZPA 1NANI 3FHEA 4QMEA 2E27H 1AXTH 1TCRB 5A2AA 3HNTH 4GIAA 2P24A 3DROB 4Y9CA 1T7VA 3H9HB 1RZKC 2KLSA 1A6TA 3NPSB 4FQCH 3L54A 4C83A 2HVJB 5BXFA 2QVIA 1EO8H 4EZMA 2QT6A 1CFSA 4L4VA 4P4RB 2IFFH 1R3LB 3GSOA 3ORJA 2FX8H 5D7LE 2E9IA 5AYUH 4OGQC 1Y0LA 5IQLA 7PAZA 5A6LA 4EI5B 5HVWA 1U8IA 4J3OF 5T5FL 4QJ5B 4GSDL 2GAZB 1QSFE 2EDEA 2ZKMX 2ADJA 5EBMA 1JPTH 3TBTA 4E0RA 1VF5C 2C5DC 3ARFD 1QTYT 2BNRD 1V3MA 4P4RA 3HS0C 3DX1A 1EGJL 4TRPH 1CFVL 1MRFL 4MKTA 2CO6B 3GLAA 2CLZA 1L7IH 4KOCA 1NGXB 5DYOB 1YEHH 3BGAA 4P4KB 2ADYA 1ZA6B 2CJSA 2HX9A 5FKAB 5D4HA 3TYFA 2VQUA 4HWBA 5GRZA 3PJLA 2CD0A 3G6JA 3L3DB 3U9PL 2UX7A 3CFCL 2XFXA 3QG7L 3GK8L 2AJSL 3M17A 1BQUA 4ZUVB 4IHOB 4XO4A 1XF2B 4NC0B 2WQVA 3OPUA 3ELAT 4JDVB 4JFFA 4JX0A 1NEZB 3VH8B 4GBXB 3DMMC 3FCTB 4XAWH 4IEFA 4ZMVA 3GMPA 3GSRA 3BISA 1OTSC 4U4IA 2NOYA 2VJ8A 4F7KA 4PY7B 1YO4A 1SUJA 2DQIL 1EEZB 2MJWA 3D51A 3VWKC 4HWZB 4OZHF 2LW3A 1NM9A 2ID5A 1JE6A 5D7JB 5SX4I 2AK4E 5A2CA 4KX8A 1T0OA 1MH5B 5FM4A 4P2RA 5ITBL 3OWEA 4G8GE 3FO2A 4QAWA 1SY6H 4BV1A 2P48B 3SOBH 2RFXA 4M4PA 3VVWA 1AE6H 1GW0A 4M5SA 4NPYA 2OMWA 5I17A 1IIKA 4WAFA 3UX9B 1XL6A 4A67A 3MV8A 1OGTA 2CNZA 3V6ZA 4PWJA 5I8EB 3CSFA 2C9VA 4G1EB 1FE8H 4AJYV 1FI8C 1WISA 2XXFA 4LQFL 4L8BB 5FFLA 4FFVD 2KLTA 4CADB 2AJYL 2CH8A 4MB4A 4GAYB 1TVBB 1VFMA 1I3VA 2LGNA 1AP2A 1ZJBA 3BUPA 3DX4A 4OZIB 1LO4L 2G60H 4Y5YA 1P69B 1X4YA 4KRNA 5HPMB 1RSYA 2YD4A 4QJ4B 1EZVY 3D08A 3V9CA 5AVVB 5T3XL 2DL2A 1MG3C 2OI9B 3E9TA 4LZKA 5KVEL 2COVD 4YVNA 4AGLA 3QORD 1P4IH 5I6XC 3RWFA 5C86A 3FSZA 3ZIYA 3VSTA 1F1AA 2DWEA 2EEXA 4MBOA 2HSIA 2Q8BH 2WUCL 4S1DC 1LO2L 4X4XA 3T4AC 2DAVA 2JJWA 4LRIC 4RLDA 4IKJA 3IJYB 4PRAB 1G7MA 1XGRB 4LAJH 4OLWH 7TAAA 5JW4Q 4N0RA 1NIDA 1KPRA 2JKRM 3FU7A 4X5XB 2QPSA 1QBAA 1MZYA 1H5BC 5CUSL 3F05A 4KMLB 1YMHB 1HL9A 3WIFB 1M7DB 1JV5A 1ZD6A 1CIDA 3CXFA 4A6YB 2VDRB 4ZMYA 4DP0X 3FPYA 3CLEL 1LO5A 5EEUA 4I2XB 2ARJQ 2VAAA 4X5XA 2XX1A 4IKKA 4E9TA 1ID5I 3LKOA 4PQXA 5HYQB 5FUOH 3P3SA 4PI0A 1T04B 3ULUD 5DS8B 1A1NA 1SYVA 4C4KO 5K59E 4HU8A 2ORBH 1KEGL 3QAQA 2Y2YA 2OMTA 2EYSA 4G9DB 3BWZA 1SNRA 4A68A 2DLFL 4PUBH 5AUMB 1M6UA 3PREA 3BX7C 1I7TB 1FIEA 4U0RB 5I0ZA 3VD1A 3F04A 4Y1SA 3PWVB 2QJDA 3NEOA 4FKEA 4ORGA 2DI8A 2SEBA 1MFBH 4BHUA 4Z7QF 2MWCA 5EHFA 1QFWI 1CR9H 1KYAA 2W60B 3C5JB 4E2OA 1JXKA 1SDDA 3OGCA 4KJPC 1N8ZA 5EOQH 4DETA 3H3PL 4Y1AA 2VDNB 4LDEB 3P0GB 3QARA 5BNXD 1D9KC 1DUZA 5EZLB 5JW4M 2EDKA 3OSVA 3T08A 3O6FC 4MRCA 1C5DB 4QOKB 1EO7A 4KROC 3U36A 4L1LA 1EJ8A 4ZUUB 4D3CH 2C9UA 2W60A 3VFSA 1RZPA 1AO7B 3UERA 5HY9B 2ZICA 1PNCA 4JFQA 1NGWA 4AIZA 4QHNA 3PIQB 3TJHC 1CB4A 1E8YA 2NSMA 5DRNA 3U1PA 2CO2A 1CTMA 2KYIA 2PWFA 4L5FL 1H3XA 1SJHB 2YPKB 4DIXA 3O4LB 4KKCD 3VM7A 3WKML 5DUJA 4JB9L 1CDHA 3CSYB 1GZPB 3V5DA 5E2WL 1ESOA 2X1XR 2EDYA 4ZO7A 4TSAL 4FFTA 4DPAX 1S4IA 3ZO0A 1GPOH 2V37A 4JO3L 5IB5A 3BKCL 4HSAC 1E5YA 3BH8B 1DANU 3ZDZB 2VXQH 1CVRA 4W9IC 2XWRA 5DMGC 2OYPA 4NYLB 3OQRA 1E5CA 4QF1A 1FFNA 1JVLA 1RJZA 1XGUB 3T2LA 3T6VA 3NZ8A 1R0AL 3QEHA 3FB8A 1D5MA 3GBLA 3LRLA 2YKLL 3FH7A 4G43B 2ICWB 4DGWC 1KIUA 1PU0A 4I7ZC 2VL4A 1KTCA 3VWKA 2DEWX 2CKBL 4JHAH 3LD8C 3QB7C 2XV0A 3VWKD 1G6RB 4QRPB 3OJMB 2FZ3B 4Y5VA 4XB3A 2VT0A 4YZFE 3ZY7A 1LK2B 4UDUB 4UM9B 5ALCH 2OXHB 5GGRY 4HCRA 1NDGB 3AGVA 2DQUH 3AXHA 1IGIH 1ZEAH 4KO9A 3KPLA 1CBVL 3BN9C 2UXGA 2X12A 3KYOA 2CAKA 3QR2A 3R7RA 5F6HI 3IGLA 1RAMA 4MNGA 1I8IB 4UTBL 3APFA 5GZNA 2Z7WA 1BZ9B 1OL0A 2H2SC 4ODVL 4NUQA 5A6MA 3BH8A 3SY0A 4O58L 4F1SA 1BP3B 4RGOH 2R7EA 3ZL4L 5HVHC 2H7WA 1K3IA 5HYSG 2Z31A 1FNFA 1J12A 3VFGL 1N18A 3CHRA 1JZDC 2O1AA 1J0IA 4KJWD 1HHIA 4LL1A 4C56D 1I31A 4MNGE 4PJDB 2N3JA 3GUFA 3MN8A 3KCWA 5F3HB 4P2RB 2MNJB 4LNVA 2BP8A 3KVQA 1ZTMA 3DV6B 1QSFD 4N9OB 3VD7A 1MFMA 4HS6A 4NCDA 4YHNA 1NLDH 3I9AA 3OZ9H 4WY7L 4EN3D 2VR8A 2BIOA 4HUUA 1SM3L 3APNA 4NM4H 5D8JL 5C0AA 3P3YA 1S3RA 5IMKB 1F6AA 1JWUA 2IADB 1QD0A 5FYKH 4OW6A 2EZ0C 1J8SA 2JWYA 2EINB 1MG2C 1OZUA 2E9GA 1MSPA 4Z7UB 1A0QH 3MJGX 3DVGB 4UMSA 4FA8A 5IWLA 4MHHG 4F58L 1G1YA 1YA5A 4ZPVB 1B88A 2KBGA 4GOSA 1WHPA 2FE0A 4QHUB 1NCNA 1ORQB 4JCWA 4YDJB 4HIHB 3QUKB 2QEJA 1JI2A 3MA9L 2X42A 3RL1B 3D52A 2WXOA 3BPLB 3FQ2A 3IJEA 3VMPA 4YX2H 2W07A 4RISL 4PJEF 1H19A 5IVOA 5IFAL 4U3HA 2WZPD 5I0YA 2FYYA 5JIPA 5A16A 5CP7B 4HMDA 5E4AA 5LNEA 1DQLL 5B22A 4NQXB 4EIUA 2AERT 3SCMD 4OD1L 1MCBA 4WI2A 4IRSC 4NKIH 1EZSA 1FGNL 1V7NH 1KLUB 4K7FB 1F97A 4IRZL 1WWBX 3QAZB 3LZFH 3IJYA 4HDIA 1LWRA 4G6AD 2O5YH 2W0PA 2X5PA 3BFWA 4QRRB 4L3CA 5GGUB 1G5GA 2CKNA 1F3JA 6PAZA 3GC3A 2K1MA 2F58H 5MENE 4UM8A 1KPUA 2BHUA 4MJ4A 5BUAA 3PAZA 4YUEL 4ZW8A 5KJRL 1GVIA 1EEYB 2TAAA 3DYMA 5F7KC 2FX9L 4NEHB 4P23A 3QRLA 4PGCB 5J13B 4XO9A 4ZFOB 5FECB 4LGPB 3UTOA 4P9HH 3FRPB 3QUXC 2X6CA 4BDVB 1INQB 1U3HB 4R96B 2VNCA 1UZ8B 2AC0A 4GINA 4PS4L 3MREB 2ZG1A 2Z93A 4IGBD 5FFOA 3IPEA 4KUCF 3B1UA 1JZEA 3ZKND 4ZAKC 3C9NA 3C8KA 5E9DD 4UMGA 1Z3RA 3QEQE 4WHTB 2BS9A 3UTPE 1W0WB 3GMLA 3COOA 2GB2A 1KJ3L 1T66C 2ZG2A 2ZXEB 1JZ8A 1P5VA 3TBSA 4LDOB 4I8DA 1TTFA 4JR9L 4Z76B 3NDYE 1L7TL 4ZK8A 5DGQA 3HMWH 4Q9QH 2WGNB 4PJFA 4OF6A 5HHOE 3EO0B 3UYPB 5GZOD 2MOQA 4XT1C 3ZX1A 2CLRB 2NNFA 1AZZC 1BFSA 2R51A 5LGYA 3RPIB 5C0JA 4X6FA 4AQAB 1URLA 2FJFA 2Z0BA 4B9FA 4RGNB 1ZANH 2M83A 3BP5A 3PNWA 4JFDD 2ITFA 1VADB 1UEMA 1A1MA 1T4KB 2I24N 4RA3A 1SHSA 3GSNA 4GMSL 3DRQB 3CUPA 4MS8C 4QHMA 4ZFGH 1TUPA 4PAZA 5INCA 2XRAL 1MUJB 3U2IA 3SBQA 1J88A 5K5YA 3UJIL 5GZOC 3HS0B 2QDWA 4XAKE 3DO4A 3BAEH 1YN6A 4LGSB 5E8DH 4BFEA 1J18A 2EE6A 4AMKL 1RVFL 3WDHA 4WEBH 1BG1A 4HQQL 1MJUL 4BFOA 3K4AA 2Z35A 3W39B 2PXYD 2C1OA 4YWGH 4IS6A 4G7SB 3HG5A 4YLBA 2P5ED 3H6JA 4K4KA 4K8RL 2AQ1A 3HHSB 1IT9L 4LSSH 1BJ1J 4ZUWA 1G1KA 1YMMD 4PR5A 3TM6A 4TVPE 4UANA 5TPWL 1AKPA 4R6UA 4HAGA 2WLIB 1BD2B 3L1GA 1A7RH 3VXTA 5D1ZD 5CCKL 2AZAA 3BKJH 3RAJH 2VLKD 5HBBA 3LNHA 3TONA 1GMIA 2OZNA 3HB3C 1EBPA 5EZOH 2WB1A 1HILB 1YNTF 2VERN 2GTWB 4NHCL 5TQ2L 2VW6A 1NM4A 1NANH 3D0LA 3O3AA 5C0CA 1R24A 2EDOA 2WVSA 1EHXA 4OI9A 3A4EA 4DKEL 5IBTL 2XV6B 1RU9L 2VDKH 3DX6A 4PRBA 2BW5A 5IIEB 1RURL 4M8RA 5DJ0A 4IKNA 3LKQA 3NCYP 3ILEA 4Z95L 4YDVA 1PDKA 5JOFA 3LNFA 3T3PE 2DMHA 3SDDB 4TVUA 4J3WA 1NMCB 3HMXL 4NFDA 1GSMA 3D9AL 1IMHC 4L5FE 3JWNG 3TT1H 1N6QL 3QPXL 1PFCA 1JXJA 4Y2DA 4KVCL 1D5XB 1JMZA 2IV8A 3OXRA 3EO1B 1R3IL 3WHXB 3BD5A 2J8UF 3MCYA 4XXDB 3VFRB 4QEGA 1KB5L 3WMQA 4QTHB 4Q6YA 3KPQB 3UZQA 2GJ6B 2MIZA 5D1ZI 3TBYB 3BWAB 3LN4A 3W1ZA 5EEYA 1RPQA 3ALWA 4F7MB 3ULVD 2YR3A 2W81C 1TOXA 3A4FA 1YEEH 4K2UL 3LS4H 2W92A 2EEBA 2YXWA 3H9SD 4DTGL 3S5ZA 3GZPA 4IGBB 3FN3A 4HIPA 4WGKA 3OR7B 1ZT7A 5HYEA 4XN1A 5C0AB 2FVNA 4YR6A 4N0UB 4DK6A 4JM2C 6FABL 5E2VH 3IDJB 5HHXH 3TVMA 3WJJA 3JYCA 4WK4B 5DHMC 4EE2A 3FC8A 4Y19D 5AOKA 5C0BE 1VB9A 4RGND 3LXUX 3V52L 2J8OA 2OMYA 1KJ2A 1AZUA 4PP1C 4AVHA 5C9KA 1ADWA 1G7HB 3HBQA 5LUMA 4IU3B 5I17B 3CLFL 1KT2B 4LSUL 3QPQD 3SE6A 5I66A 1U8LB 3IKCA 2ICCA 3FRPG 3FT1A 1IM3A 1BJ1H 4M7KH 3D69A 2NDGA 3ARBB 3AU1B 2BOLA 3EJQA 2EIEA 2CGZA 4XXDA 1XO8A 4GG6B 4N8VB 4CU7A 4GS7C 3VXSA 2Z3FA 4EKXA 4CN4A 4WUUD 5D6DA 3HI6L 3GIVA 4MJIA 2QSCH 1DJWA 2FT7A 4GLRI 4DERA 1JZ3A 4LEOB 1OGAD 2YHGA 2HLEB 5CFAA 4I77H 1MH5A 2FX7H 1TR7A 1PNDA 2R7EB 3CJJA 5J12B 1LEKB 4KMQA 1MIML 2Q86B 2MCMA 1H6UA 3Q2WA 4R7DA 4ILDA 4JKPH 5B1AB 1N7MH 3BSGA 3SDYL 1AHWA 4DGYH 3GO1L 4ZFOA 3LEYL 1DBJL 4GRLB 3V5HA 1KBKA 4QY8A 4E5XB 3FB5B 5I9QB 2F1EA 1OAJA 3IFOB 3CVHL 4CADA 3KPPB 3VI4E 3RX5A 4AYEC 3R06A 4YJZL 2BY3A 2PLTA 4A39A 3G5VB 5DC0A 2VLLA 1S9WA 1UXSA 4LLVA 4TN9A 4YQXL 1UTDA 1FNLA 2Y7QA 5HPMA 3CK0L 5GZOA 2UXTA 2WXKA 3F84A 3MMEA 4NC2B 2F6AA 1YY9D 2A73B 1VPOH 3VXUD 5I0VA 1QQDB 1Z9OA 1EUTA 2V9UA 5E2UL 4UIMA 3MNWA 4G5AA 3P11L 3CHSA 2Z4QB 5I6LA 5D2NA 3QEQB 5DJCA 1I85C 3CD4A 4Y0GA 1J0ZA 1Z5HA 3SKJH 2AQSA 4UT7H 4UT6L 3VXPA 2CO1A 3W0WD 5KANG 4I18B 4YDJA 1CD1A 4CBZA 1QRKA 4I9WD 2A9AA 4U1HA 2G5BB 1JGEB 2EDWA 4TSCH 3WIHL 4BHUI 3IU3B 4X7TB 3ZKXC 4D9QE 3PNWB 1BG9A 4H44C 4JQVC 5HHOD 2WXHA 3VFTA 1WWWX 1NL0L 2YK1H 3US9A 2H6OA 1ILUA 4KPHL 4UIKH 5I1AA 3L5HA 3X1NA 5IWLC 3T3PF 1FZKB 1NCDH 3QXWA 2VDML 5FW8A 3CFDB 3FPXA 4K7FA 1DBBL 4OZGE 4NO5A 1INEH 1FC1A 3L3JA 1GZQA 3L3OB 4PJEE 5DJ2B 5ISZD 2CO3A 3AT8A 1L9MA 4TPRL 3ETBJ 1X7QA 3U1SH 2Q7NA 3EBHA 3J7HA 4HUXA 4L3EE 4YE4L 1IEHA 1QBMH 1TYJA 2BERA 4OFYA 3UBHA 1J9SA 3V7AG 4GRWB 2WWNA 4BWTA 1MWAH 2P8LB 3GNMH 5FWRA 2FR4A 2AQ2A 4HF5L 5CSZB 1I7TA 2XZAL 3KPSE 4W6WB 2LTQC 4WFHD 2XV2A 1NBQA 2VLKE 2OSLA 3EADA 4QIRA 1J1XH 1S7TB 4KKBD 5B8CC 4LOFA 5A3IC 4TQEH 4YHML 5FYLE 1O9VA 4XRCA 3AGWA 4WO4D 4KXAA 4S1SL 4G83A 4F2MB 3EH4B 4AEIL 1RUML 3FZUC 4U1HB 3FTXA 5E8PA 3DJZA 2Y2TA 2EICA 2VDNL 1FYTA 4UQAA 4NQCD 4PJGF 3VXMB 5IV2B 2JMRA 3LQAC 1I7RB 1G0YR 3LIZH 1JGVH 2OJZH 3EJZC 4M8UA 4LHUA 4RX4A 3ENEA 2A74C 1JHKL 4DAGL 1AY1H 4JZOB 1SOQA 3O4LD 1KN2L 3I9IA 1PGRB 2N4IA 3H42L 3BIAX 3QUYA 1QRND 1CE6B 2WO4A 5KS9F 5FC9A 4WW1B 5JOEA 2R56H 5E95B 4HFWA 5DQJB 1RZ7L 2VZ1A 1LXMA 4K55A 4GI9A 2X4SB 4IRJB 4P3CH 5JYLA 1GGIH 2CGYA 1UM4H 2ZJSL 3BESR 2FRGP 2JJUA 4E42B 3HE6D 1JF5A 1SJMA 3GF8A 5KYWB 1J1PH 35C8L 2AANA 4MDJB 5J1SC 2FD6L 9PCYA 4XX1G 1DQDL 3QZMA 1ZHKB 5FCUH 2ZWNA 1SBBA 4HJIA 3TWCH 2DWEB 2MNUA 4ELKA 1JZ7A 1BZOA 2Z31D 3QUZB 1X9QA 3W5MA 4WTWA 4KFMA 2WKOA 5CN2A 2BSSB 2ALAA 3S35X 5C70A 4GRMA 4M1CD 3QJSB 1UKTA 3MLXL 4UM9D 2HFFA 2XZCH 2EIDA 1JGDB 1I8KA 4LLDB 4ENED 3PFQA 4HCRH 5GISH 5GZND 2XN0A 5KSVA 1E28B 2FO1A 2GHZA 3NCCB 1KBBA 3HCVA 4UV4L 2JLPA 3UZVA 5EO1A 3MRRB 3BHBB 3UDWC 4G43A 2O5NA 2GABA 2GC7C 4L8DB 1VA9A 1I3GH 1HHHA 4WLCA 3ROOA 1FG9C 4U3CA 4AGQA 4AQ1B 4RCAA 1HE8A 1IBFA 4OF0A 2DBLH 5L9DL 1TTBA 4JZJA 1IM9D 3OJDA 3S2AA 3ZZLA 2BY0A 5D1XB 5AW7B 4XI5C 1AXSA 3KH4A 4F57L 4U6YA 3ROOB 1N2RA 5G4NA 2NY5H 1ITBB 4WEUD 3KYNB 4JLRB 2YN5A 2O61B 3KD4A 3VXSE 5B7EA 1R46A 5LKNA 3BXNB 1HQRB 4G8EB 4HS6B 6CGTA 4JN1H 5I1JH 3BP4B 3VFWB 4JZJB 3WE6A 5HYFA 5G55A 5I28A 5CINL 3GUTB 3QIUA 4NJ9L 4AKOA 1FGVH 5I8OH 4I3RH 1BEXA 3D69B 1SN2A 3EYSL 1T7WA 2KI6A 5FGBA 1LO3L 5BRQA 5TF1H 4DGIL 5I66B 3IXAA 3ZZ1A 4G7YH 3EGDB 3BGMA 2P80A 1FPTL 3LKRA 4AGMA 5AD0B 1TJXA 5JPNC 4OD2A 1OE2A 3UH8A 5DFVC 1MHPL 2BCMA 5DJ6A 4DN3H 1NGQL 1BYPA 1M7UA 1FC2D 2QBWA 2QELA 4LCWD 1EFXB 3DK2A 2DM4A 3KXFE 3L5WA 2F1AA 3P2BA 1JGLH 2LABA 3HG1E 4WZ9A 4U1KA 1ZE3C 2CCLA 3EO1A 5IW3A 3JXAA 4NNXA 4PHXA 1QYGH 3TX4A 5LBSA 1AO7E 2XKNA 1NPJA 1PVHA 1RUQL 4XMPL 3GBEA 3EOBA 2F5BH 4N86A 3TBYA 4L29B 1JI1A 5GQBA 5C6TH 4E5XA 4KK5D 4LEBA 4XTRD 2P43B 1JK8B 3QDMB 3KDPB 4JPWL 1MPAH 2XBTA 1OPGH 5DC4B 4QRRA 3DNKA 1GR7A 3FBKA 1R5IB 5CM1A 1PLGH 3MODL 3AUVA 1LDPH 1ANUA 2GSGA 3N6YA 2AQRA 3T0EB 1GAFL 1JV2B 2VDRH 3THMH 3HC2A 4OLXH 2CQVA 4WDIA 4NBZB 3S3PA 1J0KA 1JDCA 1MCIA 3SQOH 4AOFA 2IXQA 3G04A 4JUSA 1MCPL 4R2GB 3S36X 2FEEI 4P9MH 1KB9J 1U3HD 2CDFA 3RIAF 1NFKA 4KRMB 4YC2C 1JNHB 2GSGB 1QABA 2GTZA 3MYJB 1X9RA 3QEQA 5DJCB 2VQTA 5JHBA 1DDHB 1UCBH 2XZQL 5JPNB 3PL6A 4XMVA 1IB5A 5JQIB 2AAAA 2O6FA 2YD8A 2LAAA 3H8NA 4TF4A 3GMQA 4HT1L 3OZKA 1IC4H 3DO7B 1I7UA 3IJHB 1YC8A 2FJSA 2VLRE 3HE7B 3JSSA 4FQPA 2YD9A 4RAUB 3WN5A 3QORC 5KOVC 1S7WA 3K71B 1EO5A 4IBQA 5ID1B 3Q8BA 1DQJA 2H2PD 2CK2A 1CDUA 5DQ9A 4QXWA 1NSNL 1X7QB 2AEQH 1QPPA 1HSAB 5LGJB 1HCYA 3L3OA 3KPSD 1IEBB 1KTDB 3QDME 2X3CA 5DZJA 4F37F 2HX7A 4RAUA 4APQA 5AG8A 2DJUA 3NFNB 2BSRB 2BY1A 5CEZL 1CLYH 3BZ4B 2UWEB 3QNXB 4OCMC 4ZMNA 5KSBE 1HHIB 3OL2A 4ICWA 2QFPA 3HVDA 1TVHA 1NJ9A 3BCFA 3CC5B 1J5HA 3Q9PA 5KVFL 1DEEA 2GFBA 3DJSA 4UOZA 2UVFA 3GI9L 1KYOJ 3EXJA 4WI7A 3NZHL 2RTTA 2BSTB 4R97C 3QPQC 5CIPA 4I0PD 5DS8A 3DV6A 2Y7QB 2C3HA 5E0FA 2Y6SC 4M6OL 1DUYA 5IB2A 4NI3A 5IB3B 4XNZC 3B9KA 4UUJB 5AUMA 4U1IA 4UDTA 3VGHA 3ZL1A 1SPDA 1WCBA 1HESA 2DLIA 3BP5B 2OAAA 4P2OD 5F7UA 2OA9A 5FA4B 2ADFL 3EOAA 3ZT5A 2BWIA 3FQXB 3PP3K 2NY3D 3X12A 1U3YA 3TO4D 2VLRB 1FZJB 3NCXA 2D3LA 2Z8WC 4MMYB 3LZNA 4KITB 1JGEA 3V95A 1XSKA 4JANB 1QLRA 1YUKB 4OY9A 3X1BA 5C3LD 3BEVB 3QJTB 2EH7L 2P42B 2R4RL 3P4NA 4G8AC 2F1BA 4UZGA 2VXVL 3BMVA 2VYRE 3DPDA 2E46A 2FECI 2MQ3A 4LDCA 5H2BA 3JVGA 2NPLX 2QQLL 1E3ZA 1HILA 3LRSA 3NIFF 4TOYL 3MNZA 1SMDA 3DTXB 4P59L 4X6EB 1T6VN 3LX9A 3UIZA 1RPKA 3QCTL 3P4NB 3E0GA 4NWTH 2EIJB 3PE9A 1QKZL 5BO1H 1AGCB 4AYFA 3QS3A 4B5ZA 3PQYB 1A1OB 3TO4C 4D94A 2HTKC 1Z1WA 2YRBA 1CLVA 4NLHA 1F8TH 5ES4B 1KPUB 5HHVL 2DQEL 1REIA 3L2LA 3MJ7A 3CMOL 2XWBB 1JXGA 4LSQL 4PWGA 1KCRL 1OCWH 1RZFL 5DJYB 1BM3H 4FLHA 2J8UA 4W81A 3TXAA 1HZHH 2AVGA 4GUPB 3OZLA 1OVZA 4WRLA 5GGQH 4H8VA 2HB0A 2MQCA 4BCYA 2NXZC 1FH5L 2OZ4H 2YD2A 4Q6KA 2LR4A 4F2MA 4EMZA 1MCWM 2X0VA 4ZOEA 3I2CH 3GXNA 5JORB 4YHYB 4PRBB 5E0QA 4KDVA 4P2QA 5HI4C 5DD6A 4JFPB 4HD9A 3CCHA 1QACA 2V7HB 3B2UC 3MU3A 4FFWC 4N8VG 2EUZA 4PJGE 1A3LL 1NFIB 1XSIA 3C5ZD 3N42B 3VXUB 4N0UA 1Q94B 2A4CA 2F0CA 4KJQD 3TS8A 3ETBF 3QO1A 3GHBL 3T2PA 4H2CA 1KN4H 3KPSB 5I1LA 5CJBA 4G71B 3VVVA 3NSJA 4KI5D 3DHMA 4Q0XL 3KW8A 3QA3B 2W59A 5CEYA 3MGTB 3LKRB 2JKTM 4JFHE 4U3XA 4W6YB 3N41B 3AABA 2ZX5A 3HC0A 5JLZA 3A67H 4LT7A 3NIGE 5FV2A 3EDFA 2X89A 4TUJA 4UB0H 3PWLA 2DZEA 2F53D 5BRZB 5KBNC 2E75C 3GKWL 2OMBA 1A2YA 3N5AA 5FAAA 3NACH 5AVRB 3NAAH 4B27A 1CF8L 4X50A 4ZOCA 1UXLA 1FNSH 1WBYA 1XT5A 3TN0C 3RIFK 1JWSB 1NLBL 1SYSB 5ICXB 4YH6A 5GS1C 2F61A 1NQBA 3DMMA 2VR3A 2EVHA 2GJZA 5ILTL 3WY4A 2P24B 2VR5A 2IGLA 4W4OC 2F7RA 2XG5A 3OXSB 4QWWD 4XWOD 2V3EA 4Y88A 4NN5B 5I74C 4NB7A 5IEHA 4FL4B 4P5KB 4KXDA 1UYWH 2H3KA 3DVFA 1BECA 2J6EA 4ONFH 1KSRA 3CZJA 5TE4L 4ZNCD 3PXJA 3L5IA 2FIKB 1BQSA 3MGTA 2DQJL 1EJOH 1ZVHA 1I9IL 4LNRA 2O93L 1S9WB 1UXSB 5AENA 5C0BA 1E2WA 3CTTA 3HNTL 5L4IA 3AG1B 2Q10A 5I76A 4CN1A 5K69A 1NDMA 2AJXH 2NY6D 3DX3A 5KVGH 3T0EC 1T2XA 4O00A 4AL8C 5BRZA 2GITB 4R7DB 2AGJH 3B9KC 4DH2A 4DW2H 2ZE0A 3RZCC 1CLOH 4K9EL 4FFYH 5AOZA 3T65B 1SLXA 2FX8L 2KERA 3EFOA 3V6OE 5AD0A 3I6LE 4LEEA 1UA6L 4H8QA 4P2OB 2QTEA 3AS2A 3MO1B 2H4EA 3WNIA 5DJ6B 1VGEH 2DH2A 4URKA 3K0WA 4XP4H 2EXYC 1P9MC 1WT5C 1SYSA 3P1VA 5D1XE 3KLKA 5TH2B 1NPUA 5ADOL 1AGFA 3DX8B 2NW2A 4XNBA 1HVXA 3RX9A 3VMOA 3TF4A 1M4KA 4APQB 2PPFA 1MCNA 2W9EH 7FABH 3S36L 1EEZA 2VJ0A 1KULA 3ZDZF 1NCCL 5LQBL 2MQGA 2Z0UA 2BSTA 4OZFG 5GJTH 4GXVL 4JO8A 2R9HC 2OCCB 3CBJB 3PG2A 4DPBX 4MB5A 3BPOC 2GHWB 2VN3A 5DHVA 1JZFA 1TZIA 4NWUH 3MJWA 2YMOA 2Z8VC 3ARRA 4OZ4B 15C8H 1MWAA 3Q6GH 1WFNA 1I3UA 3VACA 1U0QA 5J56B 4M1GL 2ATPA 4OJDH 1BAWA 3T3PB 3BN9D 3GFUA 4RQQA 5HDBE 3CVIH 3PF2A 1J9RA 4IIQC 3DSFH 3J07A 5FX3A 4LARH 2IOOA 2X4QA 4N25A 2OR7A 1U93A 5FHBL 2ADJB 3UTZA 4Z0BL 1JD7A 3M88A 4H1LB 2EADA 2F18A 3KWXA 3FFCB 4JN2A 3QXAA 3U2JA 3MPCA 2C9XA 2JCCE 2VXTH 4L23A 1DBAL 3WNPA 1MJJB 4XPBH 1KGXA 5DUML 2R2HA 3WEBA 3U2SB 1ED3B 4CC4A 1RL1A 1GIGH 6PCYA 1V05A 3ET9F 3GIZH 3HFMH 1C5CL 5H4YA 1U3JA 4LK4A 3NSDA 2NSQA 5D7IA 1FVEB 2YPLD 2J4WH 3LAFA 3MKGA 2VXUL 2WVUA 3L81A 3HZYA 4OT1H 4XZUB 1YMME 1CZ8H 4GAJL 2WC7A 4OCNC 1HOCA 1U8KA 5IQNA 1P4IL 3HIZA 3V4VL 4IOIB 2ZUWA 2N0KA 5D7IB 4YK4C 4YLCA 4P5SA 1GHFH 2BZ7A 2E4FA 1LO5B 3EF7A 4OUOA 2H9GA 1H9DA 4JZOA 2EILB 5IMKA 1R5WB 3DBXA 3IETB 2ZUVA 4JCLA 1QLFA 3U1QA 3W57A 1U58A 4XAKD 5HYSB 5LG6A 5CD5D 1DUYB 4H1LA 1ACYL 4N2AA 4DVBA 4W68A 3LRMA 2WLIA 1URIA 1H5BA 1Z32X 2V5YA 4IRJD 2KZKA 4D8OA 5BRPA 5I1GH 2HT3D 4HK3N 2RB8A 3U7YL 4HIHA 1G4MA 4B0MB 3KR3L 4U2ZA 3I84A 2XY2A 1CC3A 1MAMH 3EDKA 3D34A 3KEHA 1AP2B 3MQIA 3RGVD 4AQ8A 4OZIA 3TNMA 3RDTB 1PMYA 2SEBB 4ALAL 4PWFA 3FFDA 2CNYA 2JTYA 2V2WA 3BUIA 1W91A 4XP9H 1A3ZA 5L88H 2AJ3A 3HNSL 2OYKA 2Y24A 2BNQB 1R4XA 1E8XA 1KXTB 3FTWA 3K74B 4O51B 5ACZA 3TEYA 2HMID 4M7JH 3QO1B 2GUOB 3BD4A 4AQZA 3P2DA 1A21A 1UD3A 4OLVH 1E3FA 2VIRB 4X9HA 4DVRH 3PDOB 3GUTA 2E9JA 5E6IB 1LE5B 1NMBH 1A7BA 3MHZA 1Z9MA 3I9PA 4Y4KD 4AL8H 3QCVL 1W72L 3LQZB 3IMRA 3FN0H 3EJTA 2VR4A 1FVCA 1TQWA 1GZQB 2D3NA 2ED9A 4OAWB 5C0CE 4Z7WB 1ECYA 3TZVD 5IK3B 4AIOA 5ANMA 5DK3A 3KGRA 2IDCA 5GRYA 5KUMA 4CVWA 1R75A 2CR6A 2LFEA 3H3PH 4A1RA 4MMZB 1B3JA 5CMAB 4FQXB 5LWYL 4Q2ZB 1AI1H 25C8L 1N2RB 1E5ZA 1TIUA 2ZT9C 4HWNA 2O72A 3FO9B 4MD5A 1H6EA 1F4AA 4HX1A 4YPJA 3VXNA 4PJ7A 3WE6B 1QUNA 4JFDE 4N2IA 4CUCA 1DL7L 1G7LB 2EDNA 1UUSA 3I3BA 3OR7A 4UT9L 5LXGL 4HKZB 4PB0L 5HI5C 2LU4A 1Z9PA 1WAAA 3EOTH 4QO1A 4D0BA 5IQ9B 2LLGA 2NCEA 5F9JA 1DFBL 2B5IB 5GGTL 1BQHB 3K6OA 4FXKB 1HHJA 4A7VA 1AH1A 1X9LA 1U8OB 4KY1L 4P5TB 2P5WB 5DHXB 3SYQA 1QHQA 4YFEA 4P2CG 4GP5B 3Q7JA 1KIUB 1TLMA 3VMNA 3GINA 1ZGLP 1ZIBA 1J8RA 4MNQB 2VITA 2VLJE 4UV7H 1A6WH 1NDMB 2BIPA 4NQEE 4DKFL 2E6QA 1KJMB 1F86A 1OALA 5FHAH 4UOJA 3ZRFC 1MFEH 5ICZB 5MHSE 3OF6A 4TLUA 2CHDA 2P5WA 4AJ0A 4WKZB 1R3LA 1T5XB 2FO4B 4POUB 2C9RA 2F8VA 2X70A 3ZRCC 4QTIL 2WQAA 5H37G 2NY3C 5IUSA 2YQGA 1ZDQA 2ENSA 3HUJF 3LJ3A 5EUOF 1M2VB 1Q9WB 2E8ZA 4LEOA 4OCYL 3GBNH 3FT9A 4QHNB 2ZXBA 4HBCL 3WI9A 4HEPG 4UQ9A 5LAXB 1SLWA 3G6AA 1KGIA 4NQVA 4OV5B 3HPJA 5SWSD 3PIQA 3ZOAA 3UADA 3KGSA 2DD8L 4WU5B 1RJLB 4ZSOB 3H2PA 4GI8A 4IRSA 4M8QB 1ZLUH 1U3HC 2XJLA 5DQ9B 3MJ9L 2D7OA 1YNTA 3MRDB 1L9QA 4U2YA 4KI5C 1FFQA 2GG1A 3FW6A 4FMVA 1TJMA 4KC3B 4YK4B 5KW9L 5F7BA 2UYLA 2IDTA 1IKNC 3OMNB 5KVDH 4PTUA 3U7WH 1KTDA 4X9YA 2HA1A 2AMGA 4XVUD 4MCYB 4F7EB 1NC4A 5HHPB 5B1JA 4U6TA 3VI3A 4K3JH 3Q44A 4K9EC 2PTTA 5L2KA 5SWZB 4F8PA 5ISZB 5D93C 2UYLB 3VFGH 4JM2F 2ZWYA 3O3EB 2VWEE 3DO7A 1A7QL 2A6JA 3ZYOA 4M43L 4AGOA 1EHLH 3B3IB 4XO8A 3N55A 1RP8A 2GSIB 2R23B 5E1HB 2HTKD 1YUHB 3TYFB 1BW8A 4PBDA 3BP4A 2PTTB 3VFWA 5L2KB 4KZCA 3ZW3A 4D9RD 3A22A 1MJ8H 2WXGA 1M9SA 4I48A 1QSED 4JY5H 4KVPA 4CBPA 4MA8H 3MBEA 5EUOA 5K9OA 1N0XL 3WJMA 3WXWL 4OV5A 1FIGH 3JWOL 3X11A 2FHCA 3FQYA 4MNGB 3VQMA 3MO1A 3WHXA 4CMHB 3O45B 3C60A 3SKOA 4TLKA 1EEQA 3A4DA 4KJYA 4UU9A 1FVEA 1ED3A 3W0WE 2WVTA 3IBOA 2DTML 2HJLB 5KSBA 1MREL 2AV7B 3X11B 4IQHA 3MROA 1MCCA 3OAUL 1OT4A 2P46B 3OB8A 4U1KB 3BPOB 4UOW0 4K3DH 1H3TA 3LKNA 4QLRA 4XMXA 2Q76B 4FXGB 5DLML 4ZDHA 3SGJA 3KLAB 4TUKH 5CJOL 1VIWA 1MFVA 1BBDH 4PP2A 2ZKHH 3HA0A 5E2TL 1P7QA 2QL1A 3O2VL 1SBSH 1EWHA 3SDDC 4WWKA 3ZMEA 4XBEH 5KAQG 4L1SA 4J3TA 1XGRA 2BINA 4S1DD 5F89A 2NTSP 3MOQA 1BVNT 1OAKL 2CUHA 3QDMA 1RMFH 2FTAA 3O6KL 5D7JC 4R4FH 2VLRA 3NZSA 3F7KA 4ETQA 1Z9NA 4NX0A 1X4ZA 1C5BL 2MPAL 4I18C 3T0WA 3T0DA 1P6WA 3V0JA 1QHPA 3GSUA 1JWUB 1LP9A 2JQZA 4JM0A 4F9LC 4AW4A 2Y36L 1NAKL 2D0GA 2WUBH 5AW1B 1ICTA 2ZYHA 3VWJA 1NC2D 1K85A 1ZA3B 3QNZB 4NRXA 4LP4A 5EBLA 3FUKA 1LP9F 4X6DA 2W91A 1EXGA 1AQKH 2PXYB 2MKWA 1S7RA 3TT3H 1V3KA 1CURA 2R29L 3CFKA 5D72H 2IALA 3ZE1B 1R5VA 3HTLX 4PRPD 3DUUA 1XAUA 4JDVA 3ULUL 4GW1B 1PCXA 3FB6B 4UI2A 3EXLA 1GKOA 5E6IA 5I9QC 3UZEA 1YYLH 2OR8A 1OSPL 3TJEH 1X5JA 5I73B 3LQZA 1B4TA 1KZYA 3NT0A 2FYYB 4GRLC 3ZUCA 4OAWA 1BQHG 2Y06L 5EFIA 5BVJA 4P2AA 4EXPX 1NCHA 5T8IA 3R0NA 4GUPA 5DVOA 1SDDB 2YD0A 3OGCB 2ZCHH 4Z7WA 1XH2A 1QNZH 2PABA 2D4DA 3HUJB 3JV6B 2XX0A 1AJ7H 4RAVA 4YXLL 1JG9A 2BRQA 3M6DA 2YRPA 1BVZA 2BDNL 3P0YH 4ZO9A 2WINB 1JL8A 4G42B 5L8LB 2ODHA 2YEVB 4ENEC 3LEVH 3TN0B 3GGWB 4HAKA 2F68X 4CVXA 3U0PB 1AO7A 4U6HB 1N26A 1QLFB 1P9MA 2V3FA 3DIFB 4FQLL 2JKJA 5E56A 3IXTB 5T3XD 3BE1L 4H8WC 4QLWA 1AMYA 2WKLA 4YDKH 1ZLUK 3QHZL 5HGDA 4P8QA 2WQRA 2LU3A 2EO7A 1FO0H 2NY2C 4PJ7F 1JERA 1UFUA 1KV3A 1UHVA 2PCPA 5MERA 4N90E 2IPTL 3OHMB 3D12B 4HQQH 1F45A 5K9QI 4LLWA 1NCUA 2KDYA 2K3TA 1L9TA 4X83A 4GAGL 3JQOB 5HDWA 3MACL 5ALBH 1XGQA 4JM2B 4CSZA 4QYOA 1YQVH 3BUTA 4H26A 1VHPA 4XNYL 2R8SL 1KGUA 2EDXA 2WBJD 2NSXA 1FWXA 4LLWB 3RWEA 2CU9A 1IAOA 1T2QL 3GWJA 4P46A 1IGCH 3V0VB 5J9PA 4WKZA 1U6AL 5HHQB 1TMQA 1E67A 1I1YA 5EORH 5AOLA 5J4MA 4YDVB 3K72A 5EOCH 2VM4A 3SDXE 3TN0A 2VC2H 2VLKB 2EDJA 4DESA 2APFA 2AJZA 4NQCE 2E86A 2X0UA 4S1RH 2VAAB 5E94B 3LTVA 1PQZA 4HC1A 4M3JA 2WP3O 3D25A 2R0KH 5FO8B 3O2DH 5MP6L 3KLDA 2XYBA 2B59B 4KQ4H 4WHYH 1M53A 4HEPA 3FT4B 2NXZB 3FZUD 5DS1A 3AWGA 4OLEA 1RU9H 1H3PH 1J5OH 5GS0H 1DQVA 4H88L 5HVFB 5B1KA 2WD0A 5CU9A 5LCVL 2XIDA 4IRSB 4KJPD 5IBLC 4AE1A 1XAKA 5CN3A 5B7FA 1E4HA 1Y6NR 2X4TB 1D5MB 4HOWA 3S34H 3KPNB 1NEPA 2OP4H 1N64L 1TYEB 4YBLB 3U82B 4AK2A 4OM1L 2VABB 5SWZA 4Y2DC 2N59A 2W80C 3UPCA 3ZU8A 2DKUA 2MPVA 1A5FH 2BXZA 3ZE0E 1X5AA 3P77B 3O9WC 3FUNA 4CGUB 1WVZA 2WP3T 3LQAL 2JIXD 2MOGA 5D93B 3V0VA 5FYLH 1KENH 3PFUA 3WAKA 5CLTA 3HB3B 5IMMB 2CG9X 2EKJA 5D70H 3C6LD 2AEIT 3U30C 3EGXB 4XVJH 3U4BL 1YC7A 3SE8L 4HMEA 5AZEL 2YO3A 1WFMA 5HYJD 5A2KH 1WZMA 5TDOB 5D7SH 1K6QH 4EN3B 5E9AA 1TJGL 2DQHL 2LFGA 3EDJA 3QRFM 1L3WA 1MFCH 3NQIA 1M6OA 3MRJA 1AQMA 4DUWA 1F90L 2FHFA 1PEWA 1OK8A 5A2BA 1CBJA 4HWBH 2J56A 2Y5TB 3DGGB 5IVZA 5EC2B 4KXZH 1EZUA 4G6JL 4JFZH 3HCVB 5ACMA 4MSWA 1CFVH 2R1WB 5EEWA 5I75C 4JDZA 2PP8A 4XC1H 4M6MH 2BHFA 3LHPL 2CRMA 4FTVD 1KUMA 3GZOA 3PS6A 1X5FA 4LCCC 3UIYA 4OCRL 3H53A 1RJZB 4AQ1A 3AITA 4U1SB 1OAYL 3F7VB 4KU1A 3NIDE 4L3EA 4XPHH 3U25A 3FB8B 4MJ6A 3BUQA 4NQED 2XJKA 4F1ZA 4X6CF 1PF3A 3LN5A 2B0SH 2PW1A 4N3TA 5A2LH 2EXWC 4YGAB 4UOQA 4DO4A 2DWTA 2VW7A 4GRLA 5CZVH 5SV4A 4LPCA 4IK6A 4JAMA 1RD6A 2C3XA 4IOFD 3MRCA 1E0OB 3QDGE 4OCLC 4ZXBB 4XVTL 4TXVB 4IOIA 3VXRE 3ARZA 4L4VB 4LCWE 4EZKA 5IEHB 2IIJA 1CDJA 5C07D 3WGUB 1AZCA 1NWPA 1IC5H 2OMWB 1R5WA 2BM3A 3RL2B 12E8L 4DGYL 3DVIA 3CZUB 2QGCA 1CWVA 3WFZA 4LKXA 4FNTA 2ITDA 3RVWC 1O5PA 3VG0L 4IOSA 3WSQH 2BNUA 2IALB 4A7SA 2H0PA 4W9JC 1B2WL 2W65B 5F9AC 3ZJAA 1U42A 2K7QA 5E1QA 2IWGA 4X99B 4F91B 3KLLA 4PSPA 2ZPKL 1MFDH 1MQ8A 1OP5H 3WY2A 1IX2A 1MQKH 3HC3L 4L3AA 2A77H 3ZE2E 3GJFK 1GS6X 4NGHL 4JJHA 3K91A 4WI9A 3FFDB 2ADGB 3E7JA 1OQXA 3QC5X 3WFDH 5D4IA 1I85A 1MCOH 1MLBB 3AZUA 3TA4D 5MEPA 1RZGB 2Y5QA 4HPOL 2B2XH 2WWMC 3ARXA 1Q9OB 3G5XA 5IFJB 4HGKC 5KBMA 1XXFC 5C0JB 1V5JA 3WIHH 1AGBB 2CSPA 3CC1A 3ZHDA 1KV7A 4KQ3L 4P46C 1IGFH 1KNOA 2PYEA 3IPBA 1NBVH 1UXMA 4GI6A 3VXQA 1MLBA 4W9ZA 1F6AB 1Q9KA 2D4FA 4QHLB 1A4BA 3D2TA 5L0QB 4U33A 2HKAA 5D96C 5F0MB 2F8XC 1X5GA 4G2AA 5EWIL 3V0IA 5CEZE 3WD5L 4BBWA 3BPLC 2BNUB 3T0XA 1LLAA 2I9LB 1A1NB 1D6EB 4CMMA 5GS2H 3N1PC 4GXUM 1ZS2A 4OJFH 1FZOB 1T3FA 3NMEA 5HYQA 5JHLA 4PJIB 4MA3B 1PD6A 3JTSB 4GAFB 3ASWA 5F2FA 1SYVB 4KK6C 4OSUH 5LBVA 3UTPD 2HRHA 4BK4A 2HVKA 3FFCE 1JSYA 2DYRB 4KHXL 2C7UB 4UBDC 3OLGA 4G9DA 2GI0A 3UBXB 2K9UA 3GEFA 3UJJH 3WKQA 3ZDXE 4ES8A 4HF5H 1S3KL 2J1WA 2BCKA 2FATL 4NQXA 2QQNH 4AVIA 2ILLA 3W9EB 2XTJD 4MZRA 3S37H 1ACZA 4PJ9B 1RQ5A 4I18A 1A3RL 1MHHA 1H0DA 1LGVA 4OIFA 1CE6A 3F8UB 3GXTA 2H1PL 1J8HE 5B1JC 3O41A 4OR1A 3ISYA 1EHNA 3ZZQA 2DQCL 5DDHB 4AEIH 4YSAA 4X7SL 5AAMC 1BIIA 1BMWA 3HR5B 5E6UB 2ZOTA 4QXUH 1WPCA 3EYFB 3UTTD 2AP2A 3E8VA 5GS3A 4OCWL 4J39A 1JGVL 3KPMA 3QJXA 1YZZA 5CJ8A 2OMXB 3MJ9A 2FJUB 1PG7H 3ZMNA 3N40P 5I6OA 3H42H 1HKLL 2R1YA 3FAWA 4I3SH 4Z0XB 4AXWB 2RAMA 2R56L 3BKYH 4PW9A 2IWKA 3HR5A 1NFDA 1T5WA 1TSHA 2HJKA 4ACPA 3TEZA 4P3CL 1ADQA 4HKZA 3NIGB 5MEND 3KPMB 4NNPL 4WI6A 3MUGA 4TSBH 2H0JA 3GJFA 3HG1A 4ES9A 1XR8A 2FR4B 1JPEA 2P3YA 5D6DC 1EFXD 1SJHA 2YPKA 3NH7L 1Z5LB 2Z92B 4FD0A 1JPFA 2R0LL 3CX5J 5TF0A 5D2LF 3P3UA 5LGHH 5JHAA 2DMGA 3CIAA 2E4TA 4JFSA 5FO7B 2Y7LA 2DQGL 4NYLA 1B0GA 3TV8A 1CD8A 3EOAB 4IIQB 1CXEA 2OXGA 4LU5L 4KWUA 4JB9H 4A6YH 4WNQA 3UABA 1YEKH 2X6VA 2EECA 4KGJA 1OCOB 8CGTA 5JHMA 3K8MA 3UXFA 5GRJL 2A6DB 1K8DA 2ADIB 3PGFL 2ESVA 3AW5A 4OZHE 3WDJA 4WI0B 3QZWB 2Y0SA 3LN9A 3OBAA 4M7LL 5CILL 2GKIA 3DJTA 1S7VB 4H5SB 2EIKB 2X9WA 4GUOA 4KFZC 4XMLH 1QFOA 1OAUH 2WXPA 3ARDC 4OLYL 1Y07A 3CWGA 4PTTA 2AJ3B 5EB9A 1BJ8A 4KK8C 1YEJH 2BWDA 1AGCA 3P9LB 1DJSA 4R3SB 2F8IA 4NUJA 3TBTB 4E0RB 2XIIA 4NQDD 3QJHA 3PDOA 1Q38A 3HLKA 1UZ6E 3KYOB 2AVFA 2BSBA 4JN1L 1ZXQA 1MRDL 3QFJA 1NOFA 2Y1YA 4F7MA 3QUZA 2VZVA 5DUPL 4BSJA 5I1CL 3LQMA 3MVSA 8FABA 2B1HH 3X3GH 2DYPA 3W2DL 2C9SA 2Y07H 2HWZL 3FJTA 3SE4A 4R2GD 4WNSA 4LLQB 2HJLA 1TZ8A 4PD4K 3NUKA 2EKSB 1AQ8A 2EDMA 4XP1L 2XQBH 1OZTG 1KCVH 3QZNA 4JFPA 4IK7A 4JVUA 1NMAL 2N1KA 2UZIL 3BAWA 4FQ1L 1UZGA 4FN0A 2ZWSA 4TUUA 4YO0A 1ZWIA 3E8UL 4BINA 1VLXA 2XXGA 1SEBA 3NK4A 1HH9B 2FCBA 3K5RA 3WJMB 1T83C 1C7SA 2GJPA 2N01B 2B1AH 3LB6C 1AQDA 4Y4HB 5EBWB 5E4OA 5D5MF 3CN0A 1GS7A 3BGFB 2X2JA 4YFDB 4PWHA 2R69L 3MCKA 4P5TA 1PL3A 1L0YA 5D1ZC 4YDIL 3UTTB 2BP0A 3S8FB 1JXFA 2PWEA 4JE4B 1DHKA 3EYQC 1J5DA 1FHNA 1FL3A 4G59C 5EU6D 3U48A 1UM5L 3SPGA 2GBTA 1Q0XH 3JBG7 1S7UB 1V10A 1J5IA 3FFCA 1LDPL 2DWSA 1UC6A 3MUY1 3FSOA 1BSIA 1KFAH 3T4YB 1W2KT 2CHZA 5IW6A 3GXMA 1UWGL 2E0PA 3DXAD 2CR3A 3IXAB 3RILA 3RWCB 2VN5A 4GQZA 4Y5YB 1RZGA 3QUHA 3CN3A 4A63A 1EMTH 3CZKA 5D7JA 1XF5A 3F7LA 1WBXA 2YXMA 5L7XL 5LAXA 1MXDA 2FJGB 3UAJD 2XZZA 5IFJA 2G3MA 1B4JH 3HPJB 3VTTA 4X0NA 5EN3A 1XTLA 2X88A 3L7EB 3MLWH 3B6SA 3F6JA 4CC1A 2OL3A 4ELMA 3NEXA 3MV8B 3CE1A 1YNTB 3MRDA 5D9SA 1TYRA 1BZDA 4MWFA 3TVMB 4QRUA 5HDQL 4G9FB 5LLIC 3LZFL 4G8GD 1ZA3A 2IG2H 4NRXB 3FU6A 3QJOA 3V4PB 1TZGH 2O5YL 1BVKB 3GRGA 4R7LA 1KFGA 2J57A 3QC6X 1QQDA 1BJMA 1S7RB 3ALXA 5L2JB 1MCEA 4RSVA 3F5WB 3NJNA 4AC4A 2WBXA 1MHEB 2X0WA 2A6IB 3GI8H 4RFOH 3VNZA 5LO7A 2BIQA 2EJ1A 4HIEB 3EYUH 3VXUE 1AKJB 4LPUA 1UWXH 5IW6B 3ARWA 2NZIA 5AWNH 2C3GA 3L9EA 4ODSL 1TQBC 2IPUK 3A5VA 3TCLB 1Q0YH 2QTVA 1P5VB 3BT0A 4DQAA 1XIWC 3U4KA 4Z76A 2CLRA 5DWUL 4UYPA 3N9GH 2DIEA 4BEIA 1FZJA 4PJCE 5T1DL 4DGVH 5C0FA 1AKJA 1P2CA 1MI5A 5KBLA 3QIWD 4PY8I 1RSFA 2ZAIA 3CDCA 2WQ8A 4K71C 5JXAH 2EQDA 5DEZA 5TH2A 3FN9A 4CGTA 4LASH 5DDHA 5AB0A 1JK9B 2HRPH 2VOTA 3FUFA 2X3BA 4RETB 1L7TH 1S78D 4GLRH 4HALA 4KKQA 4K3EL 5AKSA 1XD0A 1TETH 4FS0A 4WW2B 2WCGA 4X5LA 4NQQA 1SRDA 3WN5B 1FAIL 4HZAA 3PLYA 5C71A 3HLAB 4ODXA 5I23A 3NEEA 1ODAA 1KJVB 1E43A 1WZ1L 1N3NB 5ANMB 2NMSA 4LF3A 2AV7A 4XODA 4CW1A 2H0EA 4UILL 3VFMB 4UM8B 4ZG1A 1RIVH 4JRFA 5HD8D 1X4XA 3BP7A 1OD9A 2X9XA 1IQDA 3GHPA 3SYOA 4Q2ZA 4ZMPA 1GCYA 2I69A 3B37A 4MDIA 5K9JL 3JWOC 2BVOA 4Y5XB 1OCCB 5AB2A 4N2GA 1F00I 3WHE1 4LBEA 4MJ5B 4LSVL 4XHQA 2OYLA 5KBDA 5FDYA 2UWEE 3QCTH 4MDRA 4WI4A 3ZYZA 1Q72L 4QGYA 1JZGA 5IB2B 3VGAB 2Q7AA 4Z18A 5F3FA 3Q06A 3V5DB 3D30A 4LL9A 1JGUL 1U93B 3II3A 2X4RB 1MJUH 2MCPL 4K94C 2XT1B 1NCAL 1DUZB 5DVNA 2VDPB 2BOCB 4QRPE 5EZLA 1TU2B 5E24E 1OAZH 4H8HA 4EI5C 1XB6A 4P5MA 3F7PC 5IROC 1IGYA 2CKBB 3L3JB 5GS1B 3MJ8B 2G75A 2XVBA 5DO8A 2NZ1A 4HCIA 1FH5H 1J48A 3V0EA 2BOCA 1TDQA 4X7EC 5C0NC 1ZHNA 3BVNB 3QHFH 3QCUH 4PJ9D 3X1FA 1VJSA 1IQDB 1S7XA 3CHPA 1UEYA 3MNDA 4BRVA 1IAIM 4MD0A 5E8OA 4A2DA 2GIYA 2APSA 4HJJH 3CQQA 5BVJB 1MVFA 2AV1B 2WSPA 1D5XA 3OXRB 3G6AB 3P30H 4QKTA 4AYFB 2O6EA 2EO9A 3FMGH 1G9ML 3BAXA 5DD3L 1JPST 3HE7C 3ERXA 4XNAA 4Q9CA 1HTYA 1SVCP 4BWUA 2X4RA 5E00A 5B7MA 2BFVL 2R0ZH 4LAQL 3ETSA 4KDTA 5B4MD 4PLKD 4WGWB 4DP1X 3FQ1A 4G1MA 3SZ6A 5B38G 2YD3A 2FBRA 3ATBA 5E99H 1AYOA 5BMFL 3IXTA 5BQ7B 4ADJA 3HZ3A 3MV9A 1PYWA 4A55A 5C7XH 1F3RB 1WUZA 3GKWH 1IBYA 1FNHA 1N4XH 1T1WB 4IBUA 3ULUC 4OVVA 2ZX7A 4O2EB 2EVJA 5FKPA 4AM0B 1YQ2A 2R4SL 3LYRA 2WXLA 1QRNE 2EACA 1HEZB 3PWPA 4XNDA 5IGXH 2WCSA 2DB8A 2XWJB 3JV5A 2H6UA 4H13C 1MFAL 3WAJA 3HC4L 3EHBD 1OP3H 1FDLH 3SGEH 4BD4A 1IFRA 3OX8B 5GGRA 4RBPK 3FTZA 5I6KA 4PJ5E 4E5XG 2OYMA 4IBSA 4AQ1C 1GGYA 1H15B 2Q3ZA 2R2EB 4R3SA 1QFPA 5FYJE 4ONFL 3MV7E 3RA7H 4EUPG 2NCMA 1AGDA 1TJIL 5DMGD 4WW2C 2H6PA 5CMAA 3T6WA 3CDGB 3EFFB 3VXSB 5GXBB 1HAWA 3QQ4A 2F7OA 4LSUH 1Y1DA 2VDLL 4X6CA 4Q9RL 1LEKA 3P3TA 3O6LL 5KS9A 4NIYE 3FO9A 4TLSA 5IJCC 2ATAA 1DANT 4KDWA 1DBKL 1K5NA 5FM5O 3TH2T 1CJYA 1IGML 1PZ5A 2BVYA 2WLJA 3B6SB 2ZYIA 3SEPA 5D1XA 1G9NH 4XCCH 3RZCA 5D9SB 4XXWA 5A1AA 1DSWA 1RFDH 2V17L 4NKDA 4O02B 4ABVA 2IADA 5BZZA 1K2DA 5KS9B 1DBMH 1HT6A 5L2JA 3MRLA 4XHJD 3ZYJA 2X87A 4HVBA 3FRUB 1GOGA 3V4PA 3T09A 4AEEA 1DJHA 1ZS8A 1AIZA 4F7TA 4QXGL 2DWYA 4OTXH 1LP9B 1KB9K 4Z7QE 3C8DA 2BFGA 1W72A 1WRFA 1MAJA 2BVTA 2N0MA 1Z0MA 1HJCA 3EUDA 2VM9A 1UB5B 2A74B 3N85L 3LMJH 5C0BB 3AS1A 5IG7B 3C60D 3ZKSD 3QQ9C 5JW5A 1I7UB 3ATEA 3DA0A 1U92A 4K8RD 5TQ0L 5IQ7H 1UADC 1XF4B 1XHHA 2NNAA 5MEPB 3QYCA 3I3DA 1ZHBB 4OM0H 1LEIB 1A6UH 2PYEE 3FONA 1FF5A 2YMXH 4L8CB 2CMRH 1T20A 3LDBB 3IU3A 1ASOA 5LAPA 2V2TA 3EYOA 2IGFL 3JWNC 5T3ZH 1H3VA 4AKQA 1EAPB 5C08E 3AY4A 1FZKA 1LEIA 2QZQA 1X44A 3V4UL 2IEPA 4L37B 2DQTH 5M95B 2XTSA 2QKIA 3EGSB 1FG2A 1HL4A 5I15H 1INDH 3MCG1 3DTDA 1BFVL 4L4TD 1JZ6A 3RBSA 1WIUA 1YMHA 3GRWA 1FHGA 3HZYB 3WIFA 4KPHH 4UIKL 1IILE 1AR2A 4XCFL 3GYRA 4D9RE 3LRHA 4Y5XA 4L3EB 4D9LH 2XBDA 4KNQA 1CGSH 3V79C 3UYOD 1Q4NX 5D1ZB 3LN5B 1HWGB 1QUPA 3BAJA 4JKMA 3ZLQC 3CVHA 5T1KA 3SE9L 3KPPA 3O3EA 5GRUH 5FUCE 4YE4H 5JW5B 2YEQA 2L7UA 4GT0A 4XN2A 4BYHA 1H8NA 4ZW5A 1KGCE 3PGCA 1MNUH 4JAMB 3B3IA 1QOKA 4YSDA 3Q0HA 3VFUA 5E8PB 4Z78B 1KCUL 3ZSTA 5HDRA 2H5UA 1TEYA 2CJUL 4HXBL 4WV1C 5EZJB 5I1KL 1RUAH 4YBQD 1IGJA 4LPXA 3RNQB 3PWUB 3V4VH 2IQ9L 3MLTA 5F7EL 2PCFB 2XV3A 3MRFA 4OV6F 4GW4A 4JFEB 1G9HA 4G80B 3U6RB 4LKXB 2FBJL 4N26A 4RRPM 1RUMH 2KZBA 4PJBF 4J2XA 3HR6A 1O7VA 4CDHA 5KTEL 1N0LA 4JRWA 5JORA 4F2ME 1OKEA 5H94A 1HXYA 4LLYA 1O0VA 4NUMA 3WY1A 4N90D 3QZWA 4XNMA 1YN6B 3ISWA 2ZXWB 4G80A 2B5IC 3S37X 4ZX5A 2WK2A 4L0PB 2IBZY 2YAEA 1KN2H 4WFFE 1CU4H 3KR3H 3CFDA 3ZXAC 3V0AC 2IOIA 3P69A 4MJIE 2Y22A 3HLAA 4ODXB 5EIIB 4L9LC 5FCSH 5AQ0A 1OB1A 3WKYA 3CPUA 1HXYB 2O6DA 1KTLA 1P4BH 2J8UB 3CPLA 5H8DA 2X7LB 3BO8A 3ULUF 5EC1B 4O9HH 4P57B 1B0IA 4IKLA 1ZV5A 1TEFA 1NBYA 3MRIA 1UM6L 2QHRL 1JZIA 4CDGC 1JN6A 1EVUA 1JNNH 4HC1L 5FYJH 4DEPC 4N2FA 1R3HA 3KS0H 4NHUA 4BE6A 3GSUB 2VSCA 4FABL 5EO1B 5DD5H 3MRRA 4AL8L 5F97E 3QSKB 3ZDYF 3CLEH 3FFOA 3HG1D 4QRTA 3UMTA 5BQ7A 2H9GB 5MENA 3VWJB 2IFGA 1DSFH 1OM9A 3V9FA 1X7TA 1CTNA 1E42A 3D50A 1T1WA 1UT2A 4HSCX 1RUPH 3BEVA 4MS8D 4NQUA 1DQMH 1O6SA 1AR1D 3CX5K 4KKBC 5DFTA 1T03H 1G7JB 5I2IB 3TLRA 2NLJA 3QHTC 2HKFH 1T7XA 1VERA 4LP5A 2ROXA 4UNUA 1JFHA 1Y6KR 3S8GB 4R4BB 3NOIA 1YVLA 2DBLL 3UBGA 4X6CE 1TPXB 4HFWB 4LFHG 1KXVA 1OB1B 1F02I 2XG5B 4MJHA 5DSCB 1JHLH 4FP8H 4XWGL 2WTPA 3FBQA 3L4WA 3OG6B 1CFQA 3TASA 2WPGA 2NY5L 3B7SA 3T77A 4RFNB 4KZEH 2B08A 4PN6A 4TUJB 3W37A 1I1AD 2ARWA 3A6BH 3MRIB 5F8QC 1NCGA 4FI7A 2GUOA 4I4WB 3FQWB 3Q6FB 5CINH 3CFBA 2EKSA 1FVCB 4A6YA 1GGUA 5I18L 4G6ML 5D7LD 5DHVH 3K6DA 5DU7A 1A6WL 5EF3A 1JPSH 1B4LA 1NGYA 1Z9SB 5HDOA 1EZLA 2BS8A 1ULVA 5BZXA 4Q56A 5EPMA 3MNVA 2MMXA 4ODTL 3WY3A 4PLJD 2KDGA 2FIRT 1G7QA 1G7PB 3U9UA 1QR1A 3WFBL 1Z3GL 4L29A 3RTQA 3MXVH 5D2LA 3VRLE 4QTIH 1MHPH 1JD9A 1PW3A 2OLDA 1HH6A 1C8QA 3F7YA 5PAZA 1FBIL 4Z5RA 1U91B 1CE1H 1ZLDA 4FZ8L 4Y4FA 3C08H 3OG4B 3LPPA 4KXBA 3QQDB 4UTBA 2A83B 5BZDB 1W72B 2WWMD 2D3JA 5DEGB 1IKFL 1KCSH 2OULB 3LVTA 2Z6FA 2P1YA 2YFNA 4KK5C 4KV5F 4PV8A 2VERA 1UASA 4F2FA 4EOWL 3RE0A 5IM7A 4Y1AB 3UC0H 4JPWH 2IXQB 2I60H 2ITDB 3TPUA 1I1AA 4WI0A 4IDJL 1SOKA 3GRBA 4GQRA 5BQDA 3BC9A 2GT9A 2E7LA 4HHAB 2VL5B 5EU5B 4AYID 2AK1H 4NZRH 4TVPL 1AZNA 4KH2A 3VXRD 3APDA 3RHWF 4F8NA 3TESA 1U8QB 1N6UA 2FNBA 2KZWA 3BKML 2BZCA 2FO4A 4J3OC 3WFHA 3VWJC 4PWEA 4LXFA 1ZLVK 1G7IB 1H8OA 3L16A 5DC9B 2HUEA 5AYUL 4DUVA 1A6VH 1HI6B 1YN7B 3D85A 1L9OA 1J86A 3GQFA 3LCYA 1FLRH 3RUGA 3SO5A 4PB9H 1H6FA 4X8JB 4Y4KB 2QKIB 4K5NA 3JWDC 2Z1KA 2E6PA 1DVZA 3HBGA 3OKMA 2J8HA 4OF8A 1MJ8L 4JY5L 4ZFQA 1WFOA 5I73C 3BZDA 3VFPA 4M93C 2EVIA 1MFNA 2UZXB 1ZGLA 3MV7A 4KTEL 4WW2A 2EC8A 1WLHA 2DYPB 2BW4A 1F2XK 3F6LA 1O7DE 5IFHL 1T21A 4PRHB 1S8DA 5EU7E 5EN2A 1YSOA 1P7QB 1T7YA 4XR8C 4OFQA 2VDPL 3LH9A 5CWSA 4D0DA 5C6WH 5J57B 4HUXB 4KKNA 4FKKA 4NZ8A 3VFPB 5CF3A 5K93A 3L4CA 1J11A 2GSMB 1RK7A 1Y18A 3E1F1 1FSKB 4RQQB 1N5AA 1LWHA 4JPVL 3H9ZA 4F7TB 3DYPA 4O2CA 3MV7D 2X05A 1P2CB 3SD2A 4LO9A 4FC3E 5JXEC 3UTZB 4KUZL 1PKQE 4EKJA 4F15B 3HG2A 4TS6A 2I7OA 1MFUA 2EYTA 3LNGA 3B9KB 4JVPA 4NAMA 5F9WC 3EFDH 3QI9D 3FT2B 5DZNA 4XNXL 5F70A 1N5YL 4JBSA 5HGBA 2CO4A 3CFQA 3EDDA 2PUQT 4FNLH 1I1CA 4DZBB 1P6AB 1EDHA 2XN9A 3B7TA 3MLZL 3O6KH 2H3NA 1JP5A 2WOBA 4QKXB 3B5TA 3KJ6L 3KLHD 3N04A 1XR9B 2NW2B 4M5TA 3IGKA 3CFEA 3TP4A 5I16A 2FJFB 2NY0B 5ITFA 1BAFL 3ZR5A 3DVNB 1A9EB 4BSWB 3V10A 5DZLA 3TPKA 1XGTA 3SDCA 2WIMA 5J13C 2D0FA 3Q2LA 3WUWA 1F1GA 4P2YA 4YAQA 2C26A 4LMQE 1A25A 3C6SB 4XH2A 2Q2EB 5BVPH 5E1GA 2O5XH 2VDQB 5FFGA 4HPYH 4NKIL 1ZHNB 3BVNA 2OSLB 3W81A 4F7CA 3O6FD 2P47B 3ARGD 3L17A 1G4RA 1RZIB 1BYOA 2X6AA 3G9AB 5CP3A 4ZTPH 5EZIL 3E1ZA 3O0RH 3VDBA 4NSKB 4PWKA 4ONGL 4AYBA 4FMFA 4AYDC 4FI6A 1T1XA 4OLUH 5B3SB 2F08A 3A3YB 2OR9L 3OKKA 3CFNA 4PJGA 4EBQL 3BSZH 2SODB 5IHZA 1C12A 2BVPB 2YPVL 2PYED 3NG5A 4X5RA 1IVTA 2E3VA 4L4TA 2BC4A 1V8HA 3SZKC 4GQPH 2C3VA 3D2UD 3IDGA 4QUOA 4YHPB 4YN3A 2XDHA 2ZOOA 5HHVH 3E2HB 1EHKB 3CHXA 1ECZA 4KKZA 1AJ7L 2IH3B 4JM2D 4JHWL 1IKNA 4DO5A 3PL6C 2NQ3A 1BM3L 2GW5A 3Q13A 1ORSB 3GJEA 4EI6B 1I82A 2MNWA 3IJEB 3EJSA 3U2SA 3QULA 5HD8C 5IJKA 3KAAA 1WAAF 2WXMA 3CSGA 3QNFA 2YOCA 2WBJA 2HKHH 3CZNA 3EJCA 3KPOB 5GSRA 4DEWA 1BCIA 1TQUA 5C0FB 1MF2L 4DHLA 4OUUA 4PJXB 1KG0A 2YZ1A 4GT7A 4JS7A 5BV7L 5H2BB 5LVEA 4E36A 2OCFD 2ZKXA 1IJNA 5ESAA 4C47A 4I1PA 1GTNA 2WV3A 4DKAA 4IU2A 3B8YA 4FLQA 4G9FE 2D9QB 2RALA 3FTYA 2CLVB 3ATFA 2CXKA 4N2KA 4PVBA 4J12A 3BDXA 2DYSB 3D1MC 3SOTA 3JWNE 2WLHA 5DWPA 4YHOL 1TQCC 2FO8A 1J0HA 3LSOA 3GXIA 3WTVA 4LCYB 4MD5B 3B83A 5FYKE 3P4OA 5EC1A 2OSWA 4QCIA 2P8MA 2P9RA 3PWLB 4UQ3B 4WI8A 1ID2A 3VD5A 4LCIL 3MR9B 4OD2B 3WEOA 3U0WL 1G7QB 3GGWA 1XF3B 4FNPA 3LXAA 3NABH 4J28A 5IQ9A 2XVLA 4G42A 4G7VH 4GPVA 1LEGB 3ZGIA 4AENB 3BRFA 5D1XD 1T0MA 3IDXL 1VDGA 4PRIB 3T2OA 3ZIMA 1JYVA 4U6HA 3RHWK 1U8CB 2R0KL 4PLNC 1JPGA 1MN4A 2NYYC 5TDNA 1EXHA 3B7RL 1LVEA 4QHPA 2BSEA 4QF1B 2BOBA 1XMEB 3WKMH 3V7AE 3P77A 3VGBA 1T0MB 4K3HA 4HJ0D 1S9XB 3UTSD 3SDAD 5D2NE 5DRWB 3X3FH 4CVZB 4EUPH 5CLYA 5LGKA 5I0WA 2VIRA 1TQBB 2PCYA 4HHAA 2VLJD 4B50A 1QBLL 3UPRB 4JPIA 5EBGA 1G7HA 5H4ZA 2XTJE 3QQ4B 4I0CC 4PJAF 1A1MB 4V11A 4BQ9A 3ARBD 4NHCH 2I25N 2AEPH 4LCYA 2QLYA 3A0OA 4NZUL 3T1FA 2ARJB 4XP6L 1E6JH 4MXWH 1NFAA 4PJDF 1HZKA 3N0AA 4FEIA 1PZ2A 1UWEL 5FYLL 4A2MA 4A66A 5IVNA 1WEJL 2IPKA 2A1WH 3HPLA 1EV2E 1CDCA 3BVUA 2EIBA 4JM4H 2CE6A 4JMNA 2CA3A 4HS8L 3N3EA 3KM2A 3O3DA 2NR6D 3DK0A 2CM5A 3L4UA 1IRAY 3UZEC 4Z3HA 1PD1A 3FNKA 1OE3A 5AZ2L 1UT9A 2UZXA 1ZGLB 1R3IH 4AZ8B 1BQHA 4FXKA 1EUUA 1IGIL 3HZMA 3F58L 1CBVH 1RZQA 2EXYD 3CFUA 5AVQB 5T33L 4KNSA 2X1WL 4UWQB 4B6ZA 1HHGA 5KSBB 4MQSB 2ZWZA 4OLZL 4DP5X 4ZFFB 3MROB 1PFOA 1IBDA 5JDSB 1CK0L 1ZHBA 2JXMB 4XC3L 2FWUA 2IFFL 3S4SA 1NJ9B 3CC5A 4PP2B 1D9KA 4I48B 2YN3A 3CU1A 2QSVA 3GM8A 2I07B 3IDYC 4I0PC 3C2AH 2A38A 4H20H 2WANA 3TTYA 3EYOB 3T2NH 4Y4FC 3TPUB 4XPAH 4B9CA 2F7PA 3PYCA 2E7CA 2YXVA 3WEXB 5IMMA 2GT9B 2EVGA 4I9XA 4OGYH 3FTSA 2V33A 3MSPA 3FCUB 1OTTD 2D7NA 2QKIC 3KPRB 4E9WA 1HSAA 1CYXA 5J1AB 1OP9A 3O3DB 1ZLWK 4QHUA 1PY4A 1XF1A 3CLFH 3SPJA 4FHJA 2D03H 3D18B 4NM4L 5D8JH 1UJ3C 3QQ3B 1LO0H 1RJLA 4M7KL 4X6DF 4ZSOA 1CO1A 1IAMA 3BCDA 2VDOB 2DMBA 3C6SA 1F4XL 1F4WH 1TJHH 2AJUH 3DHPA 1SFDA 1V3JA 4M62L 4XH2B 3KGTA 5D4JA 5DJ2A 2JNZA 5C97A 3BWAA 2WBJC 3LN4B 3Q8AA 1UWXK 2QSCL 1YNLH 4Q7DA 5FGSA 3M86A 3UBXG 4EVNB 5BV7B 2EXTA 1K4CB 4P07A 4KK9C 3CMGA 1D9KB 4AWJC 5IFAH 2RFXB 2P28B 3S2CA 4KKLC 2HFGL 5DZAA 4B9PA 2YJQA 1EEUA 2B14A 4LBEB 4MJ5A 5EDSA 1NIFA 2C9QA 3N2JA 4FQIH 3DXAE 1NBCA 1U58B 3V6ZB 1T2JA 4ZT1A 2NZ9D 2IDFA 4MAUL 5F7HA 2MCAA 2NQCA 1GY2A 2GJJA 3SOBL 5D5MB 1U8JB 1M7DA 3OHXB 4NO0A 4LLYB 2YGOA 1CXFA 1KBGL 1EANA 5DEJA 3PPEA 1KIQA 1OSZB 4J1UB 3TNNA 3WS3B 3KYKL 1PZBA 1F56A 4GRWF 4I2XA 3O2DA 1YEFH 5FA3A 1QASA 1MRCH 2B4CL