2VL5A

Structure of anti-collagen type ii fab ciic1
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
218
structure length
218
Chain Sequence
QVQLQQPGADLVRPGVSVKLSCKASGYTFTSYWMNWVKQRPGQGLEWIGMIHPSDSETRLSQKFKDKATLTVDKSSSTAYMQLSSPTSEDSAVYYCARLKPGGTWFAYWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords CIIC1 ANTICOLLAGEN FAB
publication title The Crystal Structure of the Pathogenic Collagen Type II-Specific Mouse Monoclonal Antibody Ciic1 Fab: Structure to Function Analysis.
pubmed doi rcsb
total genus 43
structure length 218
sequence length 218
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-01-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vl5A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vl5A02
4X6DB 4N8VA 5DR5L 1T7YA 1BVLB 4ZDHB 4R2GD 4G43A 1IGML 1B90A 4PJ9A 5BOPA 4AEHL 1OP5K 2AW2A 4RFOL 1ZKAA 5IB2A 1X4ZA 3I02B 2F58L 4D3CL 1KN2L 3RGVD 2EDJA 4XPFH 4G42A 3DRTB 2FSEA 5I73C 1YEJL 3H9HA 3UJTH 3SGKC 4A6YA 5FECB 1OTSD 2Q76A 4ZXBB 4NRYA 3H42H 4IRJA 1H9VA 2XKNA 3MOBH 2ZKHL 3MJ6A 4Z77B 3S36X 4JHAH 3EO9L 4YUEL 4TN9A 4NO2A 1JMZA 1ZWIB 3MRNB 1UB5B 2VDLH 32C2A 3ES6B 5T1LA 2VISB 3RWHB 3CDGA 4ZOBA 4CNIB 1KEML 1N64L 3V0WL 2PTTA 3L5XL 5JW4R 4OI8A 3IU4H 2FO4B 3CFEB 4HJJH 3BKMH 1FNGA 1ZVSA 1OD7A 1CDCA 4FQHA 1MHEA 1CLCA 1B0WA 4YWGL 4N5EC 1YY8A 2VDRL 1GZPB 3O8XB 4MMZC 2R23A 3QWQB 1C12A 4OUUB 3QNZA 1G1YA 5BMFH 3VGGA 5EBMB 3CUPB 4DN3L 3QEGL 1IGYB 4LLVB 2BMKB 2ZUTA 4L9LA 1JTOA 4NSKB 1HXYA 4POUB 2F9BT 2AP2A 4HDIB 2X40A 1I8MA 4TNWK 4Q9RL 1BWWA 3GO1L 1RHHA 3BPNB 4JHWL 5C0JA 5KS9E 5MENB 1AFVL 1A7NL 4N9GA 2Z93A 3BE1L 3DVNB 1CICA 2VLJD 4L3AA 3RJQB 4K2UL 3ZE0E 4Z7WA 1P4IL 3C60B 2CLRB 1U8LA 2IFFH 5J13C 4PV9B 1MNUL 4JZOA 5GGTL 3GRWA 1S7SB 5CILL 4YHPA 4PD4J 4O51B 3OKNB 3QUXD 1INEH 4ZFGH 1WT5A 1A1OB 2BVYA 1VFOA 2W0FA 3RL1B 1EFXB 1J10A 3GMLB 3HAEG 5J11B 1EAPB 1S78D 4UDUA 3MMEB 1RV6X 2K7PA 4NIKB 1ETZB 4EI6B 3RDTB 3GI8L 1V7NH 4G6ML 1PLGH 3IF1A 4PB0L 4RX4D 4CN6A 3DUSB 3VFOA 3QULA 4NNYB 3ZTJH 4QXUH 3KPPB 3VH8A 2E3VA 4MJ5A 1R5VA 2OJEA 4AEFA 1A3RL 5AYUL 1GIGL 3FFDB 4NOFA 5DT1H 5EZLB 3UBXA 4EI5B 4KVNL 2MOVA 4APQC 1UM6L 5E99L 1UXWA 4PRPB 4GLRI 2ZUQC 1OGTA 2H9GB 3EGSA 1LMKA 3GBNH 3UTZB 1JGEA 4LVNC 1NAKL 1J9CT 3PWVA 1NC2A 2UZIL 1MVUB 1FVCB 3NIFF 2GTWB 2AEIT 1I3RA 2XG5A 1JHKH 4ZUUB 1MJ7L 5IESH 2NX5B 2IAND 3PWPE 1ZEAL 5C9JA 4PRIE 2HVKA 4JKKA 2CRZA 3NZHH 4U1LA 3U6RB 1UA6H 4ZO6A 5KN5B 3BMWA 3ZE0F 3IKCA 5JDSA 3OKKB 1LEGB 1HILA 2W65B 2EIEA 3ILPA 4M8QB 5D6DC 3GSNA 1M1SA 4HS8H 5DJZA 4Y4KA 1C7SA 2CH8A 4CRPA 1WUNT 1FZMA 3QDJB 1QSEE 4ORGA 1BJ8A 2X4QA 3NGBC 4YQXL 2DQFA 5D4QA 4M1GH 1J1XH 4UIMA 3TEUA 5KTEL 5IFAL 5LQBL 3O4OC 1RUML 3GSXA 4QKXB 1F00I 4G6FB 1OWRM 2W92A 5ESAB 2BDNL 2H32H 4G9FD 5EUKA 3F6LA 1WBYB 3VXQB 2HRPH 1EHLL 3L7EB 1ZHNA 2X41A 1W72A 1YYMH 4WUUD 2X1OA 1GZQA 4TYUA 2A6IA 2HJFB 3T0VA 1S8DA 4JG0L 1X9QA 4K94L 1JNLL 1DFBL 5I74C 2XRAL 2GJZB 1EDQA 1U8OA 2NTFB 3LB6D 3KXFD 4PJHF 2D4FA 3C2AH 5FGRA 3DI2B 3MODL 3MFGB 2IJ0C 3PGDB 1OAQH 4WY7L 4GAYB 3QT2A 4XI5C 1BZ9A 4Z18A 3FQUA 3SBWA 4H0HB 4ZQKB 5BZWA 4OAWB 4JVUA 1KBGH 3WO3B 4JQVC 3CCHA 2OR7A 3ULUD 4K7PH 3ZKXC 2NXZD 1PAMA 5EIQA 4YDIH 4PJ8A 3TBSA 3O11B 2CRYA 5DURD 3QUML 4MAYC 4K71B 3MLXH 5HHOA 2X4UB 4WU5B 4JVWA 5FOBB 4TSAL 3ZSSA 2EYSB 5GRWA 4EVNB 1T1WA 2R9HC 3TBWA 1AO7E 3EAKA 4TULL 3B9AA 4NP4H 5B3JE 3VXTB 5JHDE 2D2OA 4OCWL 1QD0A 2A77H 3ZTNH 4LSQH 4NZTL 4DGVH 2D7PA 2E6JA 1S7VB 3AM8A 1KEGL 1W0WB 1WICA 3ZLQC 4HUMB 1U8MA 3FHAA 3PP3H 2R69L 1FHGA 3S7GA 2ITCB 4YXHH 1IILE 3IXAB 4YHLL 4Z0BL 1V5JA 1M7IB 2X89D 3C6SB 1MAML 4LQFH 3B9VA 4S1DC 4OCSL 1RJZA 3DURA 5MP6H 4BQBA 1H8NA 1MQKL 3GNML 4KMQA 4JKMA 4QTIL 3Q1SL 4RZCB 3QH3B 4GMTH 5LG1A 2O5XL 2CUMA 2UZXB 3H0TB 5EORL 1Z9SA 3WEXA 3ARFA 5HJ3A 5BVPH 1JYXA 1PG7L 1DQMH 4KV5E 2AXFB 4HAFA 3CZJA 4NKOB 5IJVA 4IBLT 1K8DB 3BH9A 4X8JA 2R2BA 2HT3C 1FO0H 3VFWB 1NAMA 5GGUB 1J5OL 1IGTB 3RWGB 2CJUH 4RMVA 1PKQB 1QA9A 2HTLD 4U6YB 3C5SB 1E6JL 4HFWA 3LQZA 3N1MC 3DJ9A 2WINB 2NY6C 1IGMH 3LKQA 1VGEL 4Q0XL 5IM7A 2D7TL 3EJJX 2FGZA 3SHSA 4BSWA 4AEHH 4M9OA 4RFOH 1WC7A 2F58H 1KN2H 5DQJB 5KW9L 4YC2C 5C8JB 1J18A 4HZLB 3MREA 1YEJH 3FQWA 4WVRA 5DJ6A 3GSVA 3LKPB 1YA5A 4J23A 4HKXA 1FORL 4P2OA 2UWEA 4XPGL 3QEUB 5I1CL 4KRLB 1G7PA 4MJ6A 3WNNA 4P46B 2ZKHH 2R0ZL 4YUEH 1MHPL 5H94A 4GRWB 2HYMA 2Q86A 2EYRA 1U8PB 2YPLB 1KEMH 1N64H 4JDZB 5EOCL 3V0WH 4OZIB 3PHSA 3AU1A 4JY6A 1D5MB 2NY1D 4FFVC 2I5YL 3CLEH 3C8DA 2BVPB 1OGAA 3TFKD 5MEQA 4ZO7A 1HSBB 4G8IB 4KV5F 4YWGH 2ZUUA 4X7TA 4FQXD 5EG6C 1EJ6A 1YEDB 2VDRH 3X14A 3LEXA 1QPPA 1CZ8L 2IPUG 3O4LB 4P57A 3RWIB 4GUPA 3OR6B 4APQA 4G8FB 1WCQA 5F7KC 3UPCA 4DN3H 3QEGH 3AGVA 3S9DB 5DK0A 3F65A 3DIFA 4F3FA 1U8JA 1BOGA 4U1MB 3VGAB 5DI8B 5JQ6L 4H20L 3BQUA 2ESVB 5KSVB 4ZYKB 5C2BL 1P1ZA 2FIKB 1T21B 1IKFL 3F5WB 1KPRA 5I16A 4Q9RH 3GO1H 4UQ2A 3K2UL 4JHWH 4HUVA 3R06B 1M71A 1AFVH 5L8LB 1A7NH 1VEOA 3BE1H 2H1PL 4K2UH 3PE9A 3EJYD 3FKUS 1GHFL 4HV8B 2G60L 4PJ7B 1MNUH 5GGTH 5CILH 3WIFA 1KPVA 4WDIA 2DL9A 4ZS6C 1NCWL 3HE7C 1AGEB 5J57B 1RZIA 3C5ZB 4CVXB 1S5HB 3MRRA 5TDPA 1T3FB 3DV6B 5T3XD 5CBEB 4L8CA 3MGOB 2P5WE 4HWBA 3BXNB 1AD0A 3GHEL 3PHOA 4OFDA 3O45A 5SWSA 2JCCE 4LCCA 3VFUB 3K4DA 3GI8H 3HZYB 4G6MH 1ES0B 3QHTC 1F6LL 4MS8D 5E8OB 1I8KA 4PB0H 5CD3B 3HTLX 3UPAA 4K3HA 3VFTB 4K94C 1N8ZA 5EC1B 3D39E 1AHWC 4AH2A 1PQZA 1A3RH 5AYUH 3DX9B 1GIGH 2NY3B 4XX1E 5D2LB 4YHYB 4TNVF 5GZNC 4KVNH 4Y5YB 3VWJB 1UM6H 3EZ8A 5E99H 3LKOB 3ZKND 5DRWA 5F9DC 3MBXL 4ZAKA 1NAKH 3KNBB 2DRUA 2UZIH 3TO4B 3U0TB 1MJ7H 1JGDA 1F4YL 3MCKB 3FOMA 5F7HA 4MAYA 4M6NL 2V2TB 5DMGD 1R3LA 5HGDA 5DJ2B 1NBYA 4ZXBD 3BWAB 1ZT4A 1ORQA 3MO1B 4E42A 3F12A 2P8LA 4U1HA 4D9QE 4AENB 3DROA 1A7BA 1J8HE 2CO7B 5FIEA 4YQXH 5BVJB 1I4FB 5KTEH 5IFAH 5LQBH 1RUMH 4PRHA 2D7NA 2E9WA 3OX8A 4NBZB 2BDNH 5GISL 1EHLH 3P73A 1K4CA 3SDDB 2A6DB 2Q3AA 3IJYB 4JANA 5D7LD 5GRYA 2JCCF 4I3RL 4X98A 5DS8A 2H2SC 2XWJB 4JG0H 1X7QA 3NCFB 1I9IH 1DFBH 2ZNXA 4K94H 5TFSL 4E0RA 4X4ZA 4DVBA 5ITFB 2XRAH 4JKLA 4KKNA 4NZUL 5E8EA 1DP0A 3STLA 4F7MB 3P11L 1LK2A 3MODH 5IB1A 3TA3B 5JTWA 3CFCL 3HE6C 4WY7H 2IH1A 4MD0B 5CGYC 3VGFA 1Y18A 2ZUSA 2KKQA 2JLLA 1NKRA 1KTLB 2WIMA 5MEND 1A3LL 4DKDC 4W6XB 3BDYL 5KSBA 3I6KB 3VFPA 1VFMA 1GYAA 3IETA 3NOIA 3ZKMD 1I1RA 3LRGA 3QUMH 3F7VB 4C56B 1HEZB 4R96A 1C1EL 5I1HL 5EU7C 2MWCA 3EO0B 1YPZE 4TSAH 4LEXH 2R0KL 3LVEA 4NT6A 4QRQB 4X7EC 1MI5A 4TULH 1GXEA 4K3JL 1EFXD 3VXOA 1G7JA 1HI6A 4OCWH 5E08L 1ZS8B 3U7WL 1BD2E 4WHYH 4NZTH 3UTSB 1KEGH 3CJJA 1I3VA 5D7IF 4RGND 2EKJA 4LLYA 3RDTD 3GEWB 5EU7E 1KCUL 2R69H 4XX1G 1RZ8A 3DVGA 4BKLA 2A83A 5ABDE 1HHKB 4YHLH 4Z0BH 4KJWD 2X70A 4OCSH 4XHQA 1MQKH 1ZT1A 4LPXA 3TZVA 2AK4A 5EULV 4O5LL 5J7CC 4QTIH 1Y0LB 5K9JL 3Q1SH 3DTXB 1CD1B 4OLUL 2O5XH 4EI5D 4LBEB 3GI9L 3C5JB 4U7KA 4YHML 4Z7VB 5EORH 3STZB 4PRPD 4DN4L 1BHGA 4GS7C 3BWUC 1PG7H 4P23C 3WDHA 4ODUB 4P3CL 1R3JA 4LIQL 3RWEB 1VGKA 4IRSB 1J5OH 4JGJA 3G5VB 2AXGA 1F58L 4JDTL 5D1XA 3SGEI 4BH7A 3BPCB 1XCQB 1E6JH 1M7DB 4OV6F 5HYJA 1MLCB 2VQUA 4L4VE 5FA4B 5F6HJ 1HSAB 4JFDE 4PGDA 1VGEH 4Q0XH 1A4JB 3T0EA 1KXQE 1A2YB 2ARJQ 5GS0L 2G2RB 4MB4A 5KW9H 3CZFA 1MCBA 3WDIA 4KK6D 4G6FD 2EC9U 3UP1A 5KSAA 3F58L 4ODHL 1KJVA 1H3VA 5ACZA 1ZLWH 3UO1L 1XIWA 1PG7W 2AEPL 2DKUA 3HI1A 1FORH 4HIJA 3VXRE 3IDJB 4Y16B 3FOLB 1NGPL 4XPGH 5I1CH 4RQQB 4NKDA 4L1HA 4WV1C 5DHVA 4XRCB 2R0ZH 4KI1A 4DZ8B 2DJUA 1MHPH 4JPWL 1KT2B 3B8YA 3U30B 5BV7L 4JFHD 5EOCH 1NCBL 3B2VL 4QLRA 3S96A 4Z5RB 3FJTA 1JPSL 1XZ0A 2LU4A 3ULVD 4Y2DC 3QYCA 1MRFL 2I5YH 1F3JA 1BVKB 3MTRA 4LPCA 4YO0B 5E94A 1P6AB 1EVTC 4P9ML 3TNNB 3WL9A 1AY1L 1TCRA 5AEAA 3A6CL 1QLFA 1X5GA 2FLRT 2MQ3A 4Y5XB 3DOSA 1AIFB 5L7XL 1BFOB 3T3PF 1DQDL 2XPGA 2ID5A 1CZ8H 2H8PA 4L8SC 1Z5LB 1P84K 2PYEE 3ZDYF 5ID1A 1YMMD 5JQ6H 1BX2A 2VLRB 3PV6A 1ROWA 4H20H 3F62A 3VWKB 1W0VB 2AJYL 5C2BH 2XYCA 1VACB 1IKFH 5GGRY 5EU6E 3FT2A 3ROLB 3K2UH 3FRPA 2W38A 4C4KO 4UTAL 1X5FA 3FMGL 2NPLX 3Q5OA 4F8TA 2H1PH 4ELMA 5ICXB 1GHFH 1MCOL 2G60H 3FT3B 5IVZB 4J3TA 5ETUA 2D03L 3D18A 1FVDB 3B5TA 3D85A 1FP5A 1XCTA 2J5LC 3RWCB 1Q38A 5DD1L 2CIKA 5I75C 3X11B 2X4NA 1Q94B 1HCFX 1QLEL 5DFVD 5C09E 1QHOA 2DQCL 2NZIA 2VERN 3A67L 1B0RB 3U2SA 4ZFFA 2EZ0D 1T0PB 3BZDA 4JB9L 5J1AB 4PJXF 2F5AL 3GHEH 1CFBA 3MOAL 2NXYB 5L2JA 2B39A 4MNGA 1TQCC 4WGWB 4YDVA 4W4NA 4LKCB 3M1BA 3IFLL 2XQYK 5GZOD 3UTPD 3S34L 2GHWB 3MV8D 4S0TD 1XF4A 1S7XA 4OSUL 3BIBX 2BHUA 3VI4F 1B0GA 1QFHA 3MBXH 1OSZA 1EV2E 1H3PL 3KPOB 4JHBA 1FNEA 1KXVC 3O41A 5HVWA 3ARRA 1KJ2L 1ZSDA 1F4YH 1XGQB 3PGCA 1BFTA 1HDMA 4M6NH 1BBDL 3QXDB 4JM2C 4P5MB 2F54E 1UEMA 5E6ZA 2VR5A 3MYJA 3VD5A 3B83A 4CU6A 5D5MB 5A3IC 1K2DB 1IJ9A 5MHSD 3KDMB 3O9WC 4GRMB 5EO9A 1FFNB 1FH5L 4I77L 2KPNA 2GK2A 3TV3L 2PF6A 1NSNL 1MSPA 1MQ8A 1WFOA 4I3RH 4R0LA 1PW3A 2ZOKA 3VGEA 3PNWA 1CFVL 2DIBA 2VLME 5TFSH 2A2QT 3FFCE 3O4LD 4NZUH 4WNQB 5C0AD 1J0ZA 1BFSA 1QBAA 5J6GB 5E6IC 2LTQB 3OHXA 1CIUA 3BX7C 1DEEA 3MRBA 5F9AC 1JNJA 3B9KB 2PN5A 5F3BA 3TO2B 3CFCH 1D9KC 2UVFA 1WGOA 2ESVD 4MQ7A 4R4BB 3RZCD 1MCJA 1R3HB 5KSUA 2KQMA 3FCTA 1OPGL 2FWOB 1A3LH 1A1MB 5HYQB 3BDYH 4OFVA 3MLUL 3SDXA 5C0IA 1YMHA 2CKBB 3QWOB 1C1EH 4X6FB 4CGTA 4P59L 5I1HH 5D1ZA 5HGBA 4I9WE 4LIQE 1K9TA 2HG5A 2ICWA 2R0KH 1CG9B 3CFJA 5I1LB 1CVSC 5IVXE 2WIIA 3QEQB 4PJ5E 4UAOC 5L2KE 3KYNB 4Z7UB 4F7EA 4K3JH 3NFNB 4FQQB 5HY9B 3OL2A 5E08H 5GS0C 3KLDA 3U7WH 3RY6A 2AQ1A 5IWLC 3ARWA 3HZMA 1H8OA 4TUOA 2X4RB 4QRRD 3L7FB 3RWDA 2HWZL 1KCUH 3GMOB 2YD1A 3BEVB 4E41D 5EU3A 2D0GA 4PJGA 3MRQB 2JELL 4K3GA 2PKDA 3MROA 4KK5D 1UGNA 5K9JH 1P5UA 1YN7B 2NY3D 4OLUH 3SY0A 4XCCL 4Y2DA 3F6IA 3E3QC 3GI9H 3Q48A 5HVHC 4QYOB 2PR4L 4PBWD 2R2EA 4DN4H 1J7VR 3H7LA 1KB5L 4P3CH 3TN0D 4LIQH 4XMKL 1D5BA 3TO4D 1T0MB 4KI5F 4RAVB 3L6FB 4NQDA 4BQ8A 4GG6E 3CDYA 1L9MA 3QIWB 5A2JH 1HHGB 1Z3GL 3E3QE 2SEBA 1F58H 4GAFB 4JDTH 1EBAA 2D7QA 4WW2F 4XWGL 5B21A 4KDTA 3EYOA 3G6AB 3GMMA 4NO5B 1FFPB 4RFEA 5CMAB 1UJ3C 5DD5L 5CKGA 2WAHA 3IGAB 3VFRA 1TMCB 4N8VG 2VLJA 4J8RA 5TPWH 4F2MB 1F6FB 5D7SL 4LHUA 3O6FC 5GS0H 1SYSB 4DOHB 2BRQA 3GM0A 3UZVB 3HG1A 1NBZA 1QUNA 1NFIB 4F7TB 3T77B 5JLZA 1J8KA 3F58H 2R1YA 2FEDC 4HIXL 25C8L 1LP9B 3SDDD 3UO1H 4Z78B 2AEPH 3NCJL 5EU4A 2Q6WA 5KG9B 1QFWI 1G7MB 4PJFA 1NGPH 4OI7A 4LLDA 1ZA6A 1CTOA 4G6JL 2XTJB 3GJFA 3RL2B 1ED3A 4P4RA 1CDGA 4PGCA 1G7QB 4JPWH 5BV7H 2NNAB 1CVRA 2R4SL 1XGUB 2BVOA 3EBAA 1FZKB 1HKLL 1T6WA 3TA3D 3R1GL 1NCBH 3B2VH 2BOCA 4OZFA 3SDAA 4EDXB 1JPSH 4QF1A 1PZ5B 3MFFB 2ENSA 4NNXB 4NO0B 1T20B 5ALCH 1MRFH 3N1GC 3I50L 5SWZE 1K4DA 1XR8A 4V2CB 2OP4L 3PJSB 5GGRB 4Z7WF 2P5EA 4F37K 4P9MH 1AY1H 4EQ2A 2P45B 3A6CH 5EUOA 4NQCA 3HFML 5EO0A 3VD9A 1YECH 2PO6B 1OTTD 3FB8A 5L7XH 1SVCP 3NCCB 4HS6A 4KGJA 4LEOA 1WFTA 1DQDH 1UVQA 2CDEA 1U8HB 4IDLA 3CH8A 1A9BA 3UX9B 4GG6F 3O2DH 4C56D 4OGZA 1A6ZA 4EUPH 3TESA 4JFXB 3T4AA 3AMLA 5IHBA 4XNZC 4BH8B 1NPUA 1BBJA 3VFGL 2AJYH 3QUZA 1M4KA 4FXKB 4L3EA 1U3YA 4UTAH 2V5SA 4OFPA 3FMGH 5HHNB 3AB0B 4LCWA 2H2PC 1CQYA 1MCOH 4Y4FB 2D03H 5D2NC 4ZFOA 4GKNA 3HPLB 3N85L 1DQTA 1T1YA 2Y5TA 5D7KE 4RFNC 3Q6FA 1A7PL 2YZ1A 5F6IB 5SX4I 1CGUA 1TVHB 1R3IL 3SO3C 1QLEH 4MNQD 1S7TB 2CXKA 2DQCH 2VITA 4WRLA 2HFFB 3O9WA 3A67H 4YNYB 1BEYL 2HJLB 5I2IA 5D2NE 4JB9H 3GJEA 2F5AH 1AXIB 3MOAH 2QADC 3MUY1 1T6VN 3BMVA 4FQ1L 5EZJB 4PJBE 3HCVA 3WNKA 4HQQL 5DLML 4IRSD 3WHE1 1ZGLA 3IFLH 3JXAA 3BP4A 5C0CE 5AUMA 1TENA 2XNAA 5SX5H 4G8EB 4OF0A 3S34H 2VZSA 4XNXL 1U0QA 3K4AA 4RIRB 4M1CC 3UMTA 1D9KA 4WEMB 4F33A 2GT9B 3BGFB 4Y19D 4OSUH 4QRSA 3VXME 3VXNB 4EUPG 2EDHA 5HDOA 3T3ME 1G7LA 4NFBA 4XNUL 3ARBB 1JWMB 2FYYA 1H3PH 3D87B 1K5NA 3RUGE 3L95A 4JFEA 5GS3A 4V1DE 4P99A 3QXAA 1FFOA 1KJ2H 5MERB 3HUJE 5AG9A 5EIIB 5KVFL 3QXWA 5EOTA 1BBDH 3S4SA 4O9HL 3QJFA 1MRCL 4FNLL 2C5DC 1TVBA 4WFEE 5IW6A 1FZOA 3U79A 3MV11 4OZ4A 3PV7A 5B39B 1IAKA 2WWMC 3I3BA 3SPVA 3QPXL 3SCMC 2XN9B 4M5YL 4M61A 3RI5K 4ZS7L 1JHLL 1NUNB 1J0HA 1D5ZA 4PJAE 4D0DA 3SKOB 4TVPL 3OGCA 4YHNA 1IM9B 1FH5H 4I77H 5CGMA 2VZ1A 5DVOA 1ZLVK 3TV3H 1NSNH 2FJFB 5I18L 4X5WA 4CW1A 1J05B 4ODWA 3C6LB 5HI3C 4UU9B 3AMKA 1CFVH 3D1MC 3O3UN 4QHKJ 4GBXC 2Z8RA 3OAUL 1I7TB 4LRNL 4FTVE 5IFHL 4U1KA 4OLEA 3PWJB 1BWMA 1ZHLB 2VLRD 3VWKD 5F7EL 1DBKL 1S7QA 5JW5A 3DXAA 2IAMB 2VMFA 3P4NB 2JIXA 1N5YH 4OV5A 1CDUA 3QIBD 5C08E 3HNVL 5E24E 3ROOB 5KANG 2YA0A 4WU7A 5E8DL 3ET9F 4QTHB 3MLUH 3MJ9L 2MKWA 5TJWK 3L3JA 4MA1C 1CT8A 2A74A 3PG2A 4L8BA 4C54A 2NW2A 5ISZE 1GAFL 1FRGL 1XF2B 5C0EB 1JZ4A 2JJVA 1DVFB 4P59H 4Z7QE 4XNQA 3X3GL 5EOCJ 2OMBA 3OJDA 3IS1X 5CHNB 5ERWA 3ZHKA 1BECA 3TYFA 5ESVA 4AMKL 3RQ3A 4LKXB 4XPBL 4HWZA 2J7LA 1GGIL 5HYFA 3DMMB 3TLRA 3QAZB 1JPFB 2B7DT 2VDOL 4WEUD 4NKIL 4PTTB 1MLBB 2DJ4A 2HWZH 1TQBB 2BVTA 5CINL 1NC4D 4PREA 4WI3A 2A9ML 5HHVL 3MNZA 2JELH 4WFGE 4UUJB 4HBQA 2X4TA 4B50A 5EC2B 2EIZB 1S9XA 2E6QA 1TNNA 1TZIB 4XCCH 4XC3L 4NHCL 4M00A 2AKRB 2PR4H 3KWWA 4RGOL 3HRZA 1QVOA 1KB5H 2X1PA 3GSWB 2JF1A 5E9DB 3DYOA 1LNUA 5CP3H 3TPUA 2E7HA 2HT2D 2R0WL 3IDGA 3DUUB 4XGZA 4K8RL 4NNPL 5FKAB 1KXTB 4JFOA 2UWEF 4JEGB 2DYPA 4NQED 2OR9L 3JWNC 3MRGA 4DCQA 4XWGH 5DK2B 5C6TL 2IALB 5DHYA 4U1SB 2XZCL 5DD5H 3DYMA 3B9EA 3QO1B 4KKBD 4MYWB 2L7JA 5D7SH 4BFEA 4Z7QF 4JZJC 1FYTE 3KLAB 4PJIE 3MJ7A 1AXTH 2QLVB 4QRPE 4QRUB 5I0ZA 2PW2A 1LO4L 3VFNB 2EYTA 2NW3B 25C8H 1TETL 1E6OL 3NCJH 4S10A 2UY6A 1BPVA 5IIEA 3B8SA 5FF6B 3GIZL 2CSPA 4G9DB 1AD9B 2YD3A 4P2QE 1I9RH 3U48A 1BVZA 4I5BB 4G6JH 1TFHA 4FRWA 4E5XA 2MPAH 1FVEA 4BELD 3M07A 3LKNB 2NR6C 2R4SH 4QWWD 1HKLH 3L3GA 3R1GH 3B9KD 3SJVE 4EKXA 4ODBD 4DVRH 3QFJA 2LV4A 1YEFL 4U33A 1S9YB 2OP4H 5IUSA 4DFHA 1S7RA 3BH8B 5CBAB 4ZDHA 43C9B 4KPHL 4HWEL 3I6LD 2P24B 3W5MA 1KJMB 3HFMH 4LRIC 4OD2A 2QL1A 3C09C 2VSCA 4QHUB 3VXSE 4NM4L 3RVVD 1ADQL 2VJXA 1HWGB 4P4KC 2DIJA 3I02A 1S7WB 4IOIB 3WO4B 3DRTA 5DJ8A 2DL2A 2X44D 3IFPB 3QEQD 3GDBA 3VFGH 3TP4A 2ZUXA 4FP8L 3GK8L 3R8QA 3W0WE 4ZXBA 5I9QC 4WO4C 1U3HB 4I2XA 5IB2B 1JIBA 5I1IH 4OD3L 3K0WA 4FA8A 4NJAL 1I1CA 1R24A 1T2XA 2FSEB 3HNTL 3IAQA 1FIEA 4KUZL 3H9HB 1UB5A 3N85H 1JK8A 3ES6A 2VISA 4CNIA 1W8OA 1J1PL 3CVHB 1PX3A 1A7PH 3SCMA 1JZ2A 2Q76B 5JR1L 4GRLC 3VXUE 1R3IH 5IHLB 4LQ1A 4G6KL 5F70A 3MRIA 1OY3B 3MJ8B 1NDGA 5HD8D 1N26A 2L0DA 3WN5A 3QFDB 3O8XA 5E1HB 32C2B 4OCNC 1QOKA 5BS0D 3S5LB 3HB3D 4H1LB 2PTTB 3VCLA 4OQTA 4XMLL 1JUFA 5HI4D 4HQQH 5DLMH 2VUYA 3RVUD 1NL0L 1IGYA 4LLVA 3QDMA 1ZVSB 2WBJC 2OS7A 5HBBA 4UT9L 2YD5A 2K3TA 4XNXH 5HVFB 4YHOL 4TVPE 3VJ6B 3WUWG 4KKLD 3DO3A 2R23B 5MENA 3I2CL 4R4NC 1YYLL 3ZYJA 1T5WA 2BNRB 1N6QH 4XNUH 1NQBA 3C60A 2HMID 3QIUC 4L9LB 1S7SA 3LPWA 3CNKA 2YD2A 4O51A 4ZSOE 1KIRA 1B4JH 1I8MB 3OKNA 4HPOL 1MJJB 4JJHA 5KVFH 4J4PA 4NUJB 1RHHB 1A1OA 3H9SB 4IMKC 1UQSA 5C0JB 3RL1A 2YUWA 5T3ZD 4N9GB 4O9HH 3JUZA 3RVTC 2Z93B 2XOTA 1CICB 1MRCH 4OF3A 3PXJA 4FNLH 4OFYD 1JI1A 3MMEA 4CMMA 5M94B 1U8LB 5I71B 2XTJD 4JZOB 3ARGB 5B38A 2AJ3B 2DM2A 3ARED 4F57H 5IVNA 3QPXH 1QR4A 1A6TA 4XVJL 5DUML 3MBEC 3S35X 43CAB 4J6RL 1U6AL 4ZS7H 1E4JA 1JHLH 3DUSA 5CSZB 3PUCA 4NNYA 2F53E 1HYRC 1BQHG 4NO0D 3UTTB 4TVPH 1FPTH 1GL4B 2BSRB 4OLXL 4UDUB 4MHHI 1N0LA 5I18H 3FFDA 5EZLA 5CIPB 1FGVL 1HINL 3OG4B 2PO6D 2JJSC 2YD6A 5H8DA 1KCVL 3IF1B 3U4BL 1ACYL 2EO1A 3VFOB 3QULB 3OAUH 1EX0A 4LCUB 3WE6A 4BYHA 4MDIB 4LRNH 1I8IA 4NN5B 5D1QC 3VH8B 5IFHH 1FVCA 2GTWA 4MJ5B 4BZ1L 1R5VB 1WISA 4YFDB 2X4SB 2OJEB 1UWGL 2NX5A 3UBXB 4FG6D 3PQYE 2Z8SA 1KIPB 4LSRL 3U6RA 5CJXC 5F7EH 1DBKH 4JRYA 1G0YR 1UXWB 4NDMA 3EGSB 1VHPA 3BDXA 1U8IB 2W65A 2UY7A 1JGEB 1NC2B 2UUDK 5E8DH 3MJ9H 4Y4FD 4KRPB 3QDJA 1K6QL 3TIDA 1GAFH 1OVZA 1FRGH 4IM8A 1KB9K 2AXHA 5C9JB 2DWEA 4U1LB 1SJHA 5BXFA 3X3GH 4JZJA 3KPNB 4DGYL 1IEAA 3QXVA 5ESAA 2BOBA 4R97B 3VXQA 1WBYA 4AMKH 5JDSB 3L7EA 1HILB 5GGVL 4XPBH 1BIHA 2VR9A 3ILPB 3K8LA 1GGIH 3H3BC 1OP3K 3GSNB 1HHJA 1P7HL 5DJZB 2MHAA 4NOBA 2HJFA 5IQ7L 4P2RE 2VDOH 4NKIH 2B20A 3PDDA 2DQFB 3W11C 4UIMB 2GJZA 4J3UA 5BRZA 2N1KA 4GAGL 4QCIA 2QQKL 2A9MH 2IBZY 3QB7C 3G5ZA 5HHVH 4CMHC 2VZVA 1ZHNB 1F3DH 1W72B 3PGDA 3T65B 3NPSC 5EOQL 3QG6B 3HC4L 1G9ML 4GAYA 2A6IB 4LVHB 2EEDA 1EXUA 4WGVB 1E28A 2RHEA 2GCYB 4KJQD 4XC3H 4OIAA 4NHCH 3FAXA 1U8OB 1N4XL 2CLZB 4RGOH 3WFCL 3ARBD 3MV9A 1WTGT 3EOBA 1Y6KR 3O11A 5L88L 4XXCC 3KJ6L 2R0WH 4LRIA 4WU5A 3CSYA 4K8RH 3FQUB 4NNPH 2EYSA 5DD6B 1KG0B 3DI3B 4KKCD 2OR9H 4KWUA 4MCYB 1UM4L 5BZWB 4F9LA 3LKRA 3BZFA 3EDFA 4O2CB 3CCHB 3JTSB 5C6TH 4X0KA 4KMLB 3PDOA 2XZCH 3PDGA 1WZMA 1S7VA 2J88L 1W0WA 4D0CB 2P4AB 4WO4A 4JQIL 4ZOCA 2XN9D 1PBYA 1T1WB 3TBWB 4PYHA 1OD9A 4QOKA 4D9LL 1VFBB 1LO4H 1VENA 1M7IA 2DLEA 4WENB 4X4XA 1IM9D 2YD7A 1TETH 1E6OH 3MV7D 3HR6A 3QH3A 2P8MB 1U8MB 3GIZH 5FGBC 2UZYB 4U6VL 5HPMB 3C6LD 3STBA 2IQAB 5LCVL 1R5WB 4LGRB 3U7YL 3LEVL 4JRXE 3QDGD 2AXFA 4POZC 1X6LA 4N0FB 2NY2C 4PP1C 4M93C 4NCC2 5GGUA 1IGTA 2NLJA 1AKJD 1YEFH 5I66A 3LRHA 1PKQA 2WP3T 3DRQA 4J7RA 4ELMF 3G08A 3C5SA 4PJCE 1RK1B 4X9IA 3DX8A 4KPHH 4HWEH 5IJVB 1AR1C 1Q0YL 3NCEB 4X8JB 4HGWB 2R2BB 4NM4H 1NAMB 4WTZA 1ADQH 1NFDE 5KS9B 1C5BL 4OFIA 5DQJA 1DVFD 4YXLL 5C8JA 3CC5A 1QA9B 3QIUA 1KELL 2APFA 5F7FA 3P4LA 3OQ3B 4HFWB 1HH9A 4U0QB 5FV1L 4CDHA 1XH3A 3LKPA 3BAEL 3ULUL 4FP8H 3GK8H 4JR9L 4YPGA 5KJRL 3C8HA 4BSWB 3SE9L 4PJEE 1WC7B 4JZNB 3L3OA 4P46A 1DUYB 1QSFD 4OD3H 3AS0A 4R2GC 4NJAH 3B6SA 3HNTH 4KUZH 2E7CA 3FQWB 5J13B 3EJZD 2QJDA 5DJ6B 3RKPA 2YPLA 4OZIA 4HUXB 4JDZA 1J1PH 3GSVB 2HRLA 2C3WA 5JR1H 4HKXB 3MBEA 1JF1B 1D5MA 2FZ3B 3FZUD 4G6AC 2ICCA 2FBJL 2BVPA 4G6KH 1G7PB 2QBWA 5E7FA 3W9EB 4Z76A 3MJGX 4R26L 5H94B 5ANME 2AJSL 4CU8A 3OBAA 4XTRC 5HDQL 4KHXH 2Q86B 4EXKA 2H32B 5E9DD 1TJIL 2Y5EA 1RURL 4JY6B 4XMLH 4G8FA 3C9NA 4QY8A 4D94A 4Q9QL 1NL0H 4WI6A 1XGRB 3MCG1 1NEZB 4PJCF 2BNQD 4U1MA 5DI8A 1QACA 4UT9H 1FQ9C 5D1QA 1ZGLM 2IH3A 5KSVA 4HIIA 1DN0B 4M02A 2EDOA 2FIKA 4YHOH 3LEXB 1T21A 4QHMA 4LMQE 4KAQL 4JREC 3R06A 1QFWM 1NFDF 3I2CH 3L3IA 4GUPB 1YYLH 4APQB 4IEFB 5E4EC 1U58B 2ZUQB 3VFMB 4HV8A 5IJKC 3D2UB 5DK0B 3DIFB 4ZOEA 1EUTA 1BOGB 1U8JB 4LVNB 4QHLA 4XHJD 3P0GB 1MPAL 6FABL 3BQUB 5F7WC 1MVFA 3B5GA 1OWWA 4HPOH 3C5ZA 4RWYL 1QSEB 4HUVB 1M71B 4TUKL 1MCIA 4PJEF 1YY9D 3DV6A 2F74A 5C6PB 2FBOJ 4LHJB 4X4ME 4G80A 4JQXC 1T0NA 1OB1A 4MJIA 2DICA 1KPVB 3HZYA 5J4MA 5JXEC 4XVJH 5DUMH 3T08A 5IB4B 4L4TE 1HIML 1NGQL 1U6AH 2H26B 1RZIB 2V5RA 4J6RH 1Q72L 3NGBB 4XWOD 5CD3A 2EDEA 2Y6SC 4JAMA 2J12B 5TDPB 5I17A 3O4OB 3MLSL 1AC0A 3VFTA 2Q87A 3MQIA 4L8CB 4OLXH 5DQ9A 3L3HB 4H0IA 4HMDA 1AD0B 3DX9A 3QUXC 3O45B 5SWSB 3SDXF 1HINH 4Y5YA 3VWJA 5DD0L 1LE9B 3DV4B 3U4BH 1P2CB 1KCVH 2EC9T 4PRBA 1G9MC 5I74B 1G6RL 2JK5B 3KNBA 1YEIL 1QBBA 1VKXA 1IKNC 1N8ZB 2VLKA 4AH2B 1UWGH 1PQZB 2X9YA 3MCKA 8FABA 4KY1L 4KROD 4LSRH 2V2TA 4EJ1C 1OM3L 2E9IA 3LDBC 3HMXA 5DJ2A 2F8VA 5CSGA 4PJ9D 1WIUA 1EK3A 4YXKL 1MCLA 4RGMC 2CDFB 1FO0B 4MD4A 4PJGF 1RUQL 4AENA 3ZKXB 1K6QH 1A5FL 3FOMB 4MAYB 5BVJA 1I4FA 3QP3A 1R3LB 5GQBA 5HGDB 1NBYB 4DGYH 2I07B 4GKSA 1ZT4B 4IRJD 2ADIA 5GGVH 4XPAL 4E42B 3F12B 2A6DA 1TITA 4C55A 1ERNA 2P8LB 4U1HB 1FV1B 5IQ7H 2W60B 3DROB 5GS1C 2YS4A 5BW7C 4E9LA 3WJLC 5T1LD 1LHZA 3T09A 1D5IL 4WI4A 5ITFA 4PRHB 4QGTA 4PJDE 4GAGH 2QQKH 4S2SA 2HKFL 4LVOC 1K4CB 3O81A 3VI3E 1AC6A 2IANE 4DJMA 5EOQH 5ICZB 5T3XL 4JANB 1I75A 5D93C 3HC4H 1G9MH 3MZTA 4MD0A 4JFZL 4HLZG 5DS8B 4DKFL 2C3XA 1H8SA 1X7QB 2ILLA 1F6AA 3WHE0 1KTLA 4DVBB 1E4XI 1JZ5A 3STLB 3PHQB 4KJPD 1LK2B 1N4XH 3RTQA 3WFCH 5FUOL 4Y1AA 3UDWA 3KJ6H 2A1WL 3ZL4L 1G7HA 2QQLL 4ODTL 2XWTA 5IV2B 4G9FE 4QRQA 1CK0H 3H9SD 1UM4H 4WUUE 1CICD 4JDVB 3K8KA 2IADA 3QEHB 5KSBB 2A73A 4NQVB 3VFPB 1JNNL 3FO2B 1DLFL 3UTSA 2J88H 3IDUA 2RR3A 2NY6B 4R96B 4W4OC 3K2MC 3KXFE 4ETQA 4D2NA 4JQIH 3ULUC 4NT6B 4XAKD 1SY6L 2FJHA 3G6JE 4OLZL 4A2LA 2NXZC 3I75B 1KACB 3VXOB 3ARYA 4D9LH 4YC2B 4XBGA 3V7MA 4LHUG 5GRZA 3MNWA 5EUOF 3GSQB 3KPSA 2OI9C 1JV5A 1Y0LA 4YZFF 1CD1A 4KK8D 1EEYB 4P5KB 1DEDA 3C5JA 4U6VH 1V7ML 4Z7VA 3ARQA 4HT1L 3ULUE 4JE4B 4HH9A 5LCVH 3QDAA 3U7YH 3LEVH 3DVGB 4BKLB 4PBXA 4ODUA 3DSNA 4IOFC 1FNLA 2X70B 2EE9A 5DMKA 4N0RA 1ZT1B 2AK4B 2H3NA 4IRSA 3U9UB 4BUHA 2J8OA 3G5VA 5IBUB 5C0BA 5H37G 3WFDL 4LASL 1X4YA 2FECL 3CH1B 4LAJH 4OZFG 1M7DA 4JN2A 4ZTOL 5F1NB 5FA4A 4P3DB 1DDHA 4OZGA 1NC2D 1A4JA 1XR9B 1WWWX 1A2YA 3RA7L 1C5BH 5I1JL 2G2RA 5FYKD 4D9RD 2NQCA 4PFEA 4YXLH 4N68A 1NGWA 5IJKA 1KELH 3FB5B 1BZ7B 1MCSA 5D96C 3FO9A 3ULUH 4PGDB 1OLZA 4JR9H 5KJRH 3MA7A 4Y4KD 4Y16A 1RK0B 3SE9H 4KRNA 1JZ3A 4KRMB 4Y7MA 1H3GA 5F9WC 5KSAB 3LN5B 5CSBA 2P5WB 2VAAA 4HJ0D 1T89C 1UWEL 3CIQA 3W39A 3U82B 4Z5RA 2DQJL 1XIWB 3RI5F 5JXEA 4YK4C 4HULB 3HI1B 4ZPTA 4HIJB 1IARB 1TZGL 1FN4B 2FBJH 4LF3B 2PW1B 1BQSA 1BVKA 4NKDB 3ZT7A 1TVDA 3M17B 1IQWL 5DC0A 4GAJL 3TNNA 1EZVX 1N5AB 5CCKH 4MQXD 4R26H 2AJSH 5GGQL 1AIFA 4ZMAT 3NVQA 3D39B 5CEZD 1U42A 5HDQH 1RZFL 3BRFA 3D5OF 1IGCL 1JPGA 2GI7A 1TJIH 4ONFL 1RURH 1XZ0B 3OKOA 5DSCB 1Z5LA 3MLYL 3LQAL 4POYA 4Q9QH 1F3JB 5LJYH 1A7QL 3VGBA 1CL7I 1SEBA 5E94B 5IQ9B 1JWUB 1F13A 4EOWL 3WL9B 1T83C 1YUHA 3VWKA 1ORSA 1W0VA 4OCXH 3KJ4C 1AHWB 3CFBB 4M7ZC 1VACA 1HYSC 4KAQH 2BJML 2H8PB 4ZFZA 1J12A 5HHOD 2IC2A 2V5TA 1H0DB 5IVZA 4IOSD 1FVDA 4FQCL 5ID1B 4MQSB 3RWCA 2X7LA 4EXPX 1BX2B 4O58L 1MPAH 3PV6B 6FABH 1YNKL 1F3DJ 1UADC 1J8HB 1Q94A 3FT2B 4RWYH 3MR9A 1OT1A 1Z6JT 4TUKH 3MRHB 3DHMA 4ELMB 2FH6A 1B0RA 2Y1VA 1DQLL 4U2ZA 1JN6A 5ETUB 3U83A 4JFFA 3D18B 5J1AA 4S1QH 3D85B 4GKZA 4NZJA 3B4NA 4HS3B 2CIKB 2FEEI 3N1QC 4YDJB 3MXVL 1HIMH 1NGQH 4LKCA 4K9EL 1Q9OA 1Q72H 3EJYC 3WJLA 5BW7A 1GPOL 4OLWL 3P9WB 4HKJA 3U2SB 4NZDA 1VEMA 3V7AE 1KTKE 3CX2A 5L2JB 2GSIB 4N5ED 3QWRA 2XZQL 4XVUD 5DD0H 4YDVB 2BY1A 5DVNA 4HPYL 4OZHE 1G6RH 3M1BB 2I24N 3ULVL 3KPOA 2O5YL 1YEIH 3GBML 3SE4C 12E8L 3EDKA 4MS8C 2E9JA 3O3DA 5JIIA 1MFAL 1WV7T 4KY1H 1MWAL 1JHTB 3HE6B 5DGQA 1OM3H 1XF4B 1S7XB 4BA8A 5T3XE 4ODXA 1YPZB 3VMNA 1B0GB 4P5MA 4YXKH 4GW4A 2E9BA 1OSZB 1FFQA 1FNEB 1JF6A 1MFNA 3N50A 1RUQH 4XNMB 5EWIL 3O41B 4GSDL 4OGAD 1ZSDB 2BCKB 4PP2A 5D5MA 1U8KA 1A5FH 1HDMB 1K2DA 5SV4A 1VFUA 1WFUA 3ARDA 4LARL 2I9TB 2ICES 4GRMA 2A6JB 4P2OD 4O2EA 5DUBB 4X6DE 2Z31C 5A2IH 4XPAH 3RX7A 5CD5C 4PGEB 3WXWL 5T1KA 1I85A 5DMGC 2DMKA 3LKSB 4TQEL 3A6BH 2Z4QB 1HH6B 2QQQA 3S88L 2DWDB 1RU9H 2XXMB 4PR5B 1D5IH 1PFCA 1RVFL 4KFZC 1T04A 4WNQA 1AGBB 5ID0A 5J6GA 3K1KC 2HKFH 3VMPA 1DE4A 1OGAD 1X5KA 3QDHA 2PETA 5T3XH 1G0XA 4JFZH 2X1QA 4CAGA 4R4BA 4YFLI 3PNWB 1R3HA 1CE6A 1A1NA 4XP4L 2YK1L 5MEPB 4APQD 4WUKL 3PWUA 4GS7B 3D48R 1RHFA 4P23B 1DEEB 5FUOH 3MRBB 3VA2C 4R7DA 4UV4L 4L4VB 1CXFA 2KH2B 2WQRA 3L5HA 2A1WH 4JFDB 1GVIA 4X6FA 3BQUD 3LRSA 4LPYA 4MQ7B 2QQLH 3CXHJ 4ODTH 2EXWD 2VDML 3LQMA 3FCTB 3KYNA 4Z7UA 4K7PX 4JVPA 5GSRA 4PG9A 5D7LE 2VRAA 1JNNH 3GZKA 1DLFH 2X4RA 2FNBA 4J3OC 3NPZB 4MXVF 2ORBL 3VXRB 5D1ZB 5HGBB 2IGFL 2ICWB 3GMOA 3CFJB 3HZKA 1SY6H 4OLZH 3ALWA 3H9ZA 4X6DF 3QCTL 1GRWA 3MRQA 1VPOL 3FN3A 2ZG1A 2CQVA 3HZMB 5DZNA 3W82A 4WI5A 2XICA 5JZ7C 4TUOB 3C8KA 1YN7A 2QSQA 1BJ1H 5SWSD 2OTPA 3B5HA 4M7LL 1GGTA 1V7MH 4WWKC 1OHQA 2R8SL 4WV1B 3GMQB 5DZOA 5EU3B 4NN6B 3MSPA 3MXWL 4WI7A 2ZSVB 4RGNC 2B5IC 3GBLA 3L6FA 2KZ1B 2ADJA 3QIWA 1CGWA 3SY0B 3WFDH 4LASH 3MX0A 4Y2DB 3ALPA 5L9DL 3BKJL 4KDWA 2R2EB 3G6AA 4NO5A 5CMAA 1FFPA 4HUNB 4ZTOH 3BHBB 3LQAC 1LWRA 1D5XA 4RGNE 3L5IA 2EECA 2RQ8A 2HFTA 4D0BB 1D5BB 4FN0A 4EI5C 5T1MB 1FZJB 2H6PB 5EU6B 4NQDB 3TNMA 3VGDA 4N1CA 4AK1A 3RA7H 4XC1L 2AJVL 5I1JH 1SYSA 4MAYD 4L8SB 3MNVA 4N8PA 1OAUL 2JB5L 3LV3B 2J8UE 1NFIA 3T77A 3EYOB 4N8CL 2R9HD 3DARA 3KR3L 4RFEB 5LGKA 2D9CA 2GAZA 3CK0L 3RWFA 3H7BB 4Z78A 2R4RL 2DMCA 1YNLL 3L3KB 1G7MA 4WCYL 1QRNA 4ZNEE 2BX5A 4LSVL 1EGJL 5FYLD 3V8OA 4PRPE 4PUBL 1I8LC 2VTFA 1NBZB 4PRHD 2NNAA 2HP4A 5DTFB 5JDJA 1FZKA 2R1YB 2J5LB 1UWEH 1D6VL 4PGBA 3OV6A 2DQJH 4X6EA 1JI2A 2D0FA 5I75B 3AC0A 1PZ5A 4NNXA 5EU4B 1T20A 2Q6WB 1TZGH 3KVQA 1WCBB 3EOYG 1P9MC 2ZNWA 4PJFB 4LLDB 1IQWH 3PJSA 4GAJH 3V9FA 3RVWC 4K9EC 4BQCA 1EBPA 4P4RB 1YQ2A 2BVOB 1JNHB 1NCUA 1KC5L 4FQLL 1IGCH 1MY5A 2BOCB 4ONFH 1TQCB 3WSQL 4QF1B 3MLYH 3A0OA 3LQAH 2FD6L 4NJ9L 1K4DB 4CVZA 1A7OL 1FL3A 2AK1L 2P5EB 3V5DB 4EOWH 2C1OA 2C1PB 3JBG7 2MQCA 3SE4A 4NQCB 5EO0B 5DRZB 1MCWM 3FB8B 3PABB 2GIYA 3WS3B 3BD3A 4Q7DA 3V79C 5HDLA 2NY6D 1UT9A 2EH7L 1A6ZB 5M95B 3T4AB 4FQCH 3HPLA 1FNAA 1MI5D 4HK3N 4JFHE 4O58H 1YNKH 3FTGB 3ULVE 3TJHD 2EDKA 3BGAA 5HHXL 3G9AB 4L3EB 1EJOL 1Z0NA 4JM2B 1S7TA 1VESA 1T66D 1PYWB 1T1XB 3ZT6A 4C59B 1MELA 1DQLH 2HJLA 2NZ9D 1B6UA 4ZFOB 2Z31A 1A6PA 4GKNB 2N4IA 5FYJU 1T1YB 4G8GA 2Y5TB 2EXYC 3MXVH 4P48A 3TZVD 2AK4D 5LBSL 1AXSB 1GPOH 1Y6MR 2VITB 2YXFA 5HGGS 1YMME 3O9WB 4OLWH 3UZQA 4S1RL 5CAYB 1F3RB 4G8EA 2EEAA 3ZYZA 1CYGA 5KZCB 2OZ4L 4GXUN 3QUKA 4GO6B 4LOUC 3KPLB 4IHOA 3VXNA 2XZQH 4EZMA 5IB5B 2IWGA 3E8UL 1CF8L 4HPYH 2EZ0C 1IQDB 3ARBA 1JWMA 3BP4B 3ULVH 2O5YH 3GBMH 5AUMB 4JGUA 5E6IB 2XNAB 4HC1A 12E8H 3T4YB 5MERA 1MFAH 1MWAH 1D9KB 5GZOC 5LGHH 4UQ3B 3UAJC 4WFHD 3IRPX 2P43B 1X5YA 5L2KB 4CN1A 3RKDC 4JRWA 5B39A 1K5NB 1ZLSL 1MFDL 3QXAB 1FFOB 5EWIH 5INCA 4GSDH 3ULVF 5KSAD 2DIAA 1ND0B 5F7LB 3JSSA 2ARJA 2DF3A 2Q7NA 4WEBL 4PD4K 3RIFF 4LARH 1XIWD 3S4SB 3QJFB 3UTPE 3BPOC 4UAOB 3EOTL 1FZOB 1FC2D 3MV8E 3WXWH 1T2QL 3HKFA 3U46A 1IAKB 5DDHA 2EDLA 4TQEH 3FL7A 3JV0A 3D39D 3C6LA 3S88H 4RBPK 5C07E 4M61B 1V3LA 5DJAB 3F7YA 1IL1A 3BT2L 1D5ZB 1KPUB 1G84A 4YHNB 4UI2A 2F19L 1ZHLA 2X9XA 4ENEC 1N7MH 4CW1B 4MWFB 4ODWB 2X42A 3VD4A 2IAMA 2HFEA 5GJSL 3V4PL 3NIGE 4XP4H 2YK1H 1L6ZA 2VUOA 5GZND 3N9GL 1S7UA 3D3VA 1CFTB 4WUKH 4OKDA 4I0CC 4LDLB 4UV4H 2FCBA 1XF2A 1UH3A 5MHSE 5C0EA 2PTVA 3FONB 1E4KA 5L6YH 4RAUA 4DW2L 3DXAB 5CHNA 4JLRB 3AY4C 4KXZI 4LKXA 4XCFL 2C4FT 4H5SB 4OV5B 2JE8A 5CUSL 1IVLA 1WZ1L 2GUOB 3DMMA 4WU7B 1RI8A 1RUKL 1QFPA 4MHHG 1JPFA 2BFVL 1UJ3B 3L3JB 1CT8B 2A74B 5FDWB 3D85D 3RZCC 2NW2B 1MLBA 3O4LE 2ORBH 5C0AE 2IGFH 2VAJA 2Q8BL 5ERWB 3ULSA 5B4MD 4C83B 3QCTH 3P30L 2ADGB 4M62L 1VPOH 1CQKA 3BJ91 2ESVE 2VXQL 4BQ9A 4I18C 5EC2A 2EIZA 4HKBB 1YC7A 1T7WA 4ZO8A 3IU3A 4M7LH 3LS4H 1P9MA 1BQUA 2R8SH 4PREB 2YD9A 3JZ7A 4PJ7E 3JWOL 3MNZB 2XZZA 3MXWH 4MX7B 3WUZA 1FYHB 5FCUH 1IC7L 4BSJA 4AY0A 4X6CA 2XY1A 1S9WA 4JPVL 3DO7A 2E7MA 4DGIL 5L9DH 3BKJH 4DKAA 3HRZB 1ITCA 2VC2H 5CZKA 4U1SA 4GRWF 1LNUB 3ZE1F 2X2YA 4KK5C 2X4OB 5AWNL 4QRRE 3QO1A 2QSCH 3BUYA 3TPUB 4OZIF 3IDGB 3L9RB 3KLAA 4JFOB 2AJVH 2NTSP 3W9DA 4E41E 1B88A 1OAUH 5IHZA 3MRGB 4NP4L 2JB5H 4DCQB 2DQDH 3TN0C 2IPTL 1XFPA 5EIVA 3B3IA 2NW3A 4WTZG 4N8CH 4FS0A 3JTTB 1DR9A 3H9YA 3KR3H 4XNZB 1T22B 2I60L 5DHYB 3CK0H 5D2LE 1Q1JL 1EEUA 2R29L 5HSFA 2R4RH 1PY4A 5FF6A 1YNLH 4G9DA 3ETBF 4LSVH 1EGJH 4PUBH 4X9GA 1KJ2B 3MJ7B 1JJUA 2EYTB 5D2NB 2V9RA 3WBDA 1L0XA 1D6VH 4Y8DC 1NBVL 2VQ1A 1VA9A 4PJBB 3SO3B 1WTLA 2DQEL 3BH8A 1OW0C 5CBAA 5GIRA 4Y4HC 4PJ7F 4NO3B 3OZ9L 3SDDC 2P24A 1KJMA 2CIIB 5E2TL 4XCNB 3CXDH 4ZNCD 4HJGB 5ILTL 5HYSA 1KC5H 4FQLH 2QADB 3WLWD 2GJ6A 1RFDL 3L3GB 4XPTH 3BEWA 4N0UE 3WSQH 3VXMB 1S7WA 2CJUL 2JTDA 2FD6H 4NJ9H 3Q3GB 3OAYH 1A7OH 1S7RB 2AK1H 3IFPA 2OX5A 3CX5K 4UBDD 3RUGB 1L0QA 4V1DB 4Y5VA 1AP2B 4OD2B 2ERJC 3HUJB 1M6OB 1MFEL 4GXUM 3MLWL 1U3HA 3QUYC 5C0RL 3EDEA 4XCYB 2ZSWB 2EH7H 3OKMA 5D1ZD 1HWHB 5DJ8B 2ATPA 5IROC 1U92B 2HT4D 3KPRA 5D2LF 2DD8L 3CVHA 3BIAX 3KPTA 1W0YT 1CD8A 5HHXH 1A9EB 1FLRL 3QNXB 1HE7A 1EJOH 3V5KB 5IMLB 4I2XB 3UBXI 1KGCD 1MAJA 3MJ8A 4GW1B 5B8CC 5F89B 4PJAB 1QFOA 3TT3L 5EU5A 3HAEH 4UDTB 1R24B 2EDTA 3QFDA 4Q2ZA 2DLIA 3BZ4B 2GFBB 1JK8B 2AEQL 3S5LA 4W6YB 4OFKA 4H1LA 4C56E 3SCMB 3I9GL 5A40E 1MHCB 3CLEL 5LBSH 4X5XB 3MRIB 4AM0B 1NDGB 4P49A 3N1FC 4S1RH 4Y2DD 2OLDA 4FTVB 3WN5B 2OZ4H 3VJ6A 5IMKB 4BSVB 2P47B 3MLTA 3Q5TA 2OR8A 3VCLB 2GY5A 1JUFB 3E8UH 2BNRA 1CF8H 4NQDD 1NDMA 4V2BA 3QDMB 4K55A 1AGFB 4GBXB 4Z8FH 2FB4L 4I48B 5C08B 3OF6A 3NIFE 2RAMA 1KIQA 2V9TA 5DO2C 4J12A 3S98A 5IOPA 1MJJA 4LK4A 4F7CA 5ISZB 4NUJA 3H9SA 4MNQE 3TPKA 3TBVB 3U0PA 1KB5B 5JW3L 2XQBL 5HVGB 1MJ8L 1T5WB 1KULA 4HCRL 1BJ1J 3BN9D 4LHUD 4DUVA 3SE3C 1JRHL 2CKBL 3ARGA 1ZLSH 2AJ3A 4WI8A 1MFDH 1TIUA 3LD8B 3HG1D 1KIRB 4MA1B 43CAA 4RMTA 1JL8A 3OKLA 1NMBL 5CSZA 1UQSB 4WEBH 5GHWL 3WJJC 3UTTA 5JA8B 4EIZC 5L0QC 5DJXA 4DEPC 2BSRA 3EOTH 4CMMB 1OTUC 2FRGP 1MOEA 1T2QH 5BCAA 5B38B 4PV8B 4OCRL 5CIPA 5ACLA 4Y19E 4H8WL 1A6TB 4I18A 4DTGL 5E95B 4QT5B 2C4XA 4LCUA 3SDAD 3DWTA 3BT2H 4MDIA 4PJHE 3GSRA 5I1EL 5I19L 5JIHA 1JZ7A 2X4SA 5DHXB 2F19H 2P5ED 5HHPB 3JWOC 1KIPA 5KOVC 4NQCD 3BP7A 5GJSH 3V4PH 5FM8A 1P4BL 1EERB 1U8IA 4AJ0A 3WE6B 3N9GH 1I8IB 5F72S 3QHFL 3Q6GL 4Y5XC 1SMAA 1CD9B 3V4VL 5FDYA 3QUZD 4DW2H 3KPNA 4JRYB 2Y7QB 1IAIL 4YBLB 1FYTB 1AI1L 1MJUL 4NDMB 4PJIB 4L3ED 5F6HI 4Z7VF 4PGZA 4XCFH 1FGNL 3JVGC 4QRPB 4WFFD 5CUSH 4M6OL 2Z91A 1WZ1H 4LCWD 5B22A 1JVKA 2AV7A 1RUKH 3QI9C 2BFVH 3MRKB 3FO1B 1CGVA 3TIDB 1PEZA 5FCSH 4U3HA 4HBCL 2OL3L 2DWEB 3QCVL 1SJHB 3QIBC 5BXFB 3HNSH 2E5EA 3Q0HA 4JZJB 1IEAB 1BREA 2Q8BH 5DEGA 5A3ID 2BOBB 5IMOA 4YHZL 3P30H 4M62H 5T3ZL 4XP9L 2X10A 4F9PC 1U91B 3T65A 3BISA 3QG6A 3O9WD 3I85A 2VLRE 4X7CC 1HHJB 1AE6L 1IEHA 2VXQH 2MHAB 2VXTL 5KZCD 5ICYA 4FXGA 2MQ0A 2GCYA 1I9IL 1UB6B 3OAYK 3ZHDA 3T2QA 4FZEL 3TCLB 3NIDE 5BRZB 5FO8B 2CLZA 4QCIB 1SVZA 1X6NA 2ZP0T 1NLBL 1OW0A 3G5ZB 3JWOH 4Y4HA 2DM3A 4P0DA 3PIQB 3MGTA 3G6DL 3V0VB 5CWSA 3ESVF 1EXUB 5DD6A 3ZYIA 1KG0A 1E28B 1IC7H 4WI9A 1D9KD 4CU7A 4MCYA 4MJ2A 3AS1A 4JPVH 3SGJC 5IFJB 4O2CA 4DGIH 2DN7A 4ODVL 3JTSA 3KHOA 4I9WD 3V6OC 1NCDL 2V17L 3MV9B 3EOBB 5AWNH 1IAIM 4LU5L 4JFED 3C09B 5KVDL 3CSYB 4HF5L 4HUUA 3W0WB 4D0CA 3PF2A 4H88L 3FT4B 4LEXL 3QUYA 4LLWA 3K80A 3WNMA 3LKRB 3BZFB 4EBQL 2D4DA 1VFBA 3K1DA 2IPTH 3V6OE 2HT2C 3P9MA 4X0KB 3TC9A 2I60H 3PDOB 3UXFA 3SGKA 3DX6A 3HPJA 1Q1JH 2R29H 2P8MA 4L9DA 3OSKA 1FC1A 1JGUL 5I9QB 5HPMA 4WO4B 5AD0B 1LO5B 2IQAA 1R5WA 5C0NC 1RMFL 2GTZB 5B8CA 3NN8B 4QOKB 2A38A 2R1XA 3LN9A 3R0NA 4KKBC 4N0FA 4X4XB 5F44A 3NFSL 2FL5A 4MJ4A 1NBVH 2OXHA 4NQEE 3IDYC 3EOAB 5I15L 3DVIA 3OKEB 1OLLA 1DN2A 3NIDF 1PY9A 2DQEH 1RK1A 1B2WL 1FNHA 1MREL 3OZ9H 2DQIL 5E2TH 3UROR 1NANH 1NGYB 3UEZA 4P5TC 4HGWA 5ILTH 4X83A 2WWKT 1WFNA 4PLJD 5E5UB 3DSFL 1RFDH 3N0PB 3T1FA 5KS9A 4X80L 2QSVA 4NM8L 3CX5J 2NLJB 3RAJH 2GK0A 5I66B 3DRQB 3DXAD 3DVFA 3G08B 4BZ2L 4NBXB 2JIXD 3DX8B 5CZVH 5IB3A 2XTLA 5E8NA 2ED9A 1MFEH 3TH2T 3MLWH 5C0RH 2VXSL 4JZNA 2NYYC 5IW1B 1DUYA 5F7DA 3N06B 1X5HA 3S3PA 3CC5B 3QIUB 4KZEL 5DGRA 1HH9B 2HAZA 4HUXA 3D0LB 3RVVC 2DD8H 1XH3B 2RJMA 4PBVC 4IRZH 1JF1A 3B9DA 4JFQB 2VWEE 1NUDA 2VZUA 3LEYL 2FZ3A 4YPGB 1FLRH 5DA0B 2FEDD 5HHQA 2VO5A 3L3OB 1LO3L 1MCHA 3I6LE 3W9EA 3TT3H 3BP5A 2Y72A 3B6SB 5FA3B 4MB5A 4AIZA 4R6UA 4K3EL 2AEQH 5DFTA 4MA7L 2H32A 4KDVA 4YLQT 3L5WB 5ALBH 3MBEB 1ZTXL 3I9GH 1T03L 4H8WC 2AJXL 1ULVA 5EA0L 4CDGC 1EVUA 2B4CL 5JHLL 1XGRA 2EE3A 3QEQE 1NEZA 4Z76B 4XT1C 1DN0A 5DMJB 2DTSA 3LY6A 1FFRA 1ZHBB 3PWPA 5D5MF 5DFWH 3PQYB 5C0GB 4PRIA 2YRLA 5MEOB 4LP5A 5HD8C 4UOJA 3C9NB 1U58A 4QY8B 3RY5A 1BLNB 4YX2H 2DLGA 3VFMA 3D2UA 2FB4H 2DYPD 5D1QB 2OBGA 3HB3C 2IH3B 3MLZL 5DYOA 4HIIB 1ACZA 5HI4C 4QHMB 1QSEA 3AFLA 3FO0L 3RVUC 3RP1A 4B7LA 3FQXA 3WDJA 5JW3H 1CFSB 3L3IB 2XQBH 1U8NB 1U8QB 1MJ8H 4HCRH 1WAAE 1JTTA 1LVEA 5TF1L 5BS0E 1JRHH 2CKBH 4QHLB 5D6DA 4KKLC 4OD1L 2H2PD 2APXA 3QI9A 1MFCL 5IB4A 4P2RB 2H26A 2B2XL 5DVKA 2HMIC 1NMBH 3RPIA 4FXLA 5GHWH 3ELAT 1BF2A 2F74B 2FR4B 2YSSA 3FQRA 3L3HA 4G80B 1T0NB 1UM5L 5FO9A 1OB1B 2A9NL 4MJIB 5F9JB 4OCRH 4YDLC 3BPLC 5CZXC 4H8WH 2D7OA 1LE9A 3DV4A 1P2CA 4DTGH 1TTGA 4OCYL 3RX8A 2QADD 4JAMB 4NQXA 1RZGA 2JK5A 4I3GA 5DEZA 5E1AA 2ZCHL 5I17B 5DWUL 4DOHE 3BO8B 3QFJD 4Z7UF 5I1EH 3AREC 5I19H 5DQ9B 5C2UB 4CMHB 4JFPB 4U6HA 4EQ3A 2Q8AL 4ALAL 3RZWA 1LP9E 4JO2L 5T3ZE 4AG4H 4V1DD 5GGSA 3O2VL 4PRBB 1P4BH 5FK9A 2NY0B 1AO7A 2CDFA 2XTJE 3SGJA 1FO0A 2XFXB 4I8DA 4JQVA 4GQ9L 4OT1L 1VKXB 5JHDA 4KQ3L 3QHFH 4X8XA 3PP3K 3Q6GH 2VLKB 3TM6A 2OM5A 3DGGA 4X4YB 3PGFL 3S37L 8FABB 2HFGL 3V4VH 3QPQC 2I07A 1IAIH 3QG7L 1EH9A 2OJZL 1MJUH 1AI1H 5JO5B 1WAAF 5HHMB 1FGNH 3ZDZF 5F1SA 4M6OH 5JW4M 3IXTB 4EN3C 4LSPL 4MD4B 1KTDA 3HMWL 5JORB 1FV1A 2W60A 4HD9A 2WNGA 5D7IE 2WWMD 2OL3H 4HBCH 1REIA 1H5BC 3QCVH 2CR6A 5D7JC 5J3HD 3SCMD 3ALXA 4GKSB 4UIKL 4PRNB 1G9NL 4YHZH 2ADIB 4XP9H 5T3ZH 2ENYA 4JRXB 5ICZA 2IPUK 1AE6H 2F5BL 2VXTH 2YEZB 4RMQA 1V3JA 3O8XD 4UZGA 5FGCB 1IAOB 4FZEH 3PHQA 5C0FA 1X5JA 5HI3D 4S2SB 1NLBH 4NPYB 3QDMD 4NWUL 1CLZL 3G6DH 5C08D 4YFLF 1LP9F 4P5TA 2NY2B 2VL4A 2Y36H 4M93B 1CWVA 5FB8B 5IV2A 1TDQA 1F6AB 1UWXH 1T7XA 1CS6A 2J1KA 1IGIH 3V6ZA 2XY2A 4H25B 4ODVH 4JDVA 4LL9A 3RTQB 1NCDH 1K8IA 3QEHA 5SV3A 2V17H 1F02I 3C60D 1WZLA 4NQVA 2G9HB 3FO2A 2EH8H 4Y1AB 2J6EL 5KOMC 2BSED 2HJKA 1RPQA 4HXBL 4NHUA 4LU5H 3P9LA 4KJQC 5KVDH 4HF5H 1ZXQA 1WSST 5I6XB 1G7HB 4H88H 4I0KA 2XWTB 4J4PD 4MA3A 3NCYP 2BHYA 4NQTA 3I75A 4EBQH 2P42B 2IADB 3GSQA 5D6CB 2A73B 1F11B 2CRIA 4KKCC 5GGTA 1EEYA 4P5KA 5HGHA 1JGUH 4N9OB 4ETQB 5GRVL 3AUVA 2CR3A 2L7UA 4A6YL 2FJHB 1RMFH 2HH0L 1Z2KA 3TVMC 3NABL 4XBGB 1FL5A 4DAGL 2PTUA 3MNWB 3NFSH 4HUKB 4HHAB 3IDIB 4X9FA 1ZMYA 3KPSB 2R15A 3U9UA 1JV5B 5T33L 4TTDD 5I15H 4JGMA 3CH1A 4HH9B 1B2WH 4L3CB 3E1F1 1MREH 5F1NA 4HGKC 2DQIH 3DBXB 4P3DA 5EBWA 5C9KA 3BYYA 1XR9A 3T3PE 5DMKB 3DSFH 2H3NB 2XN9E 4KMTL 4O00A 5K59E 2NX5D 3CFDB 4X80H 4NM8H 5C0BB 4JRYD 4BZ2H 3FB5A 1FYTD 3ZDYE 1UG9A 5J89A 1BZ7A 4JN2B 1MIML 3MV7E 4R7NB 3CMGA 2W9DL 4F80A 2P7TB 3O6LL 1DDHB 3KPQA 3BYTA 4HMCA 4OZGB 5TPWL 3TBYB 4RA3A 1RK0A 4JREB 3QDJD 2VXSH 4RNRA 2KQNA 3QDGE 4NRXA 5E4EB 2IMNA 1NGWB 4KZEH 3LN5A 2A0LD 2P5WA 4TRPL 3WHXB 2JCCA 1XGTB 1ZA3B 3FO9B 1QPXA 3HE7A 4L5FL 3MRCA 3LEYH 2DB8A 3MA7B 4ONOA 4L4TB 1FN4A 4LF3A 2PW1A 1T4KB 4S1SL 3M17A 3GRWL 1LO3H 1WEJH 1N5AA 4Q9BA 5KVMC 4XCEA 3WNPA 5E2WL 5BRZD 5K9KA 3D39A 4PJXE 2MCPL 2VAAB 4K3EH 4MA7H 3W39B 5AZEL 1XGPB 2NR6D 2Z35A 4YFEA 1ZTXH 4ZPTB 5ALCL 5DSCA 1T03H 2AJXH 5EA0H 2B4CH 1UKQA 5JHLH 5IQ9A 1JWUA 4FMFA 1X5ZA 5DQDL 5H35B 4YGVA 1AHWA 3CFBA 1YECL 3EKCA 4UB0L 1EUUA 4QHKI 3ZDXF 1JPGB 3MV9D 4LLUB 4YEFA 5K59F 3O2DL 1U41A 1QSFE 3OKOB 3VI4E 1L0YA 4JY5L 1H0DA 3O6MH 4RMRA 5IF0A 1SEBB 2VABA 4R90L 2B1AL 1YUHB 3MLZH 1ORSB 1R5IB 1GH7A 5LWYL 5IBLD 1J8HA 2DBJA 3FO0H 5H2BB 1ONQB 3MRHA 3LDBB 3QNYB 4ZFZB 3QUMA 4LFHD 4PY7A 4NZRL 4WO4D 5TF1H 2VIRA 4OKVB 1A4KA 3AAZA 3HLAA 4HK3J 2E27L 4RGMB 5FM5M 2X7LB 5FYKL 4QOKD 5E9DE 4HS3A 5J12C 4OD1H 1MFCH 1U93B 4YDJA 4GG8B 2VKXA 2B2XH 5B39G 3MR9B 1RAMA 5IMMA 1H5BA 3DECA 1DQJA 5D7JA 2BNQE 3GSNL 3M8OL 1HQRB 4XHJC 3IJSA 3S3SA 4PJDB 1JN6B 1WBZA 4JFFB 1UM5H 2A9NH 3GIVB 1N59A 4GKZB 2GSIA 1UWXK 2BSTA 1YY9C 4QXWA 2BXZA 5GS1B 3BD5A 1Q9OB 4OCYH 4TOYL 4TVPD 1FL6B 1W72L 2VLLA 2ZCHH 3FB6A 5DWUH 3I6GA 3MRLA 5IEHA 4HEME 4HKJB 2ICWI 4Q6IC 2ARWA 3MUZ1 1FIGL 3L3DA 4LVOB 2OK0L 2Q8AH 4ALAH 5FHBL 4JO2H 1JHTA 3F7QA 1CE1L 3HE6A 4YGAB 5D93B 1MAKA 3NA9L 3I3DA 3O2VH 1YPZA 3NCYS 2FX8L 4FOMA 5FUZL 2HTKC 4GQ9H 4R4ND 3SKJL 4OT1H 3ZSTA 3SDCC 1FAIL 1QLRA 4KQ3H 3VFSB 4XNMA 1BD2A 3QIUD 3WD5L 2BCKA 3O3DB 3PGFH 3S37H 2HFGH 1B6DA 3P0YH 2I9TA 4RSVA 2A6JA 3QG7H 2OJZH 4ODXB 5GS2D 4B41A 5DUBA 1LDPL 4GW4B 3WO4C 3G6JB 4Z7NF 3DX7A 4PGEA 1P7QA 4P46D 3RVTD 3BGMB 4LSPH 1JPTL 4I3SL 3HMWH 3NFPA 4KROC 3F8UB 3LKSA 2Z4QA 1HH6A 2DWDA 4PP2B 3EDDA 4PJ9C 3QXUA 5BO1L 1U8KB 4PR5A 3IJHB 5IVOA 2YPLD 3OAZH 4N5UA 1PD6A 3ARDB 1AGBA 3MBED 4UIKH 1P53A 4O2EB 1G9NH 3BN3B 4OCMC 4K7FB 3WXVL 2I9LB 2NXZB 4L29B 3TVMA 4CKVX 1UZ8A 3VE0B 5T1KB 2F5BH 4KI5C 2OI9B 3WNLA 1C5DA 4DK3A 5MEPA 4IRJC 1T04B 3PQYD 4WW2C 5ID0B 2BSSA 1NUGA 1DE4B 4P23A 3UTQB 4MCZB 4NWUH 1CLZH 1OAXL 2EDBA 5TDNB 4L4VA 3BUTA 3RU8L 3MLVL 4JFDA 5D1QD 4ERSL 5JOFB 4KI5E 3DETD 3CD4A 1CE6B 1A1NB 3RHWK 2CGRL 1OOAA 1N5YL 5C7XL 4ESKA 4N0CD 1ZLWK 5K9OB 3PWUB 2AV1B 1NAML 4L8DA 4R7DB 2J6EH 4HKZB 2YKLL 4HXBH 4ZODA 1A6VL 1H3TA 3VXRA 3LRSB 4LSUH 2X4PB 3C5ZD 4OLVH 2W9EL 5F9OH 3VG9C 5GSRB 2ADFL 4PG9B 3PL6C 4KC3B 3T2PA 3GMRA 4MJID 1OQOA 1T1ZB 5D96B 5FKPA 5DVLA 4WV1A 3GMQA 3HZKB 4A6YH 5TQ2L 3ZO0A 2HH0H 2V9QA 3AVEA 4YBQD 3NABH 2ZSVA 2UYLA 2YPVL 4DAGH 2IQ9L 1MRDL 4AQ1B 5F9WB 5T33H 1MCEA 5BV7C 3C8KB 2BVEA 4J3SA 2D7MA 4K3DH 5E2VL 1WT5C 1VDGA 3NAAL 4M6ML 2YZ8A 4W81A 1OT2A 3VWJD 2FX9L 2FDBP 2PYEA 5EO1A 4Z7WE 3BHBA 2NY0D 5J6HB 3V8CA 3X13A 4D0BA 2WBKA 2W1NA 1LGVA 5T1MA 2VLKD 1FZJA 2H6PA 5EU6A 4KMTH 2ADJB 4XAKE 4L8SA 4W6WB 2K9UA 3LV3A 3EZJB 4NN5C 4LHQB 4AIXA 1MIMH 5HHMD 5DK3A 2W9DH 4TNWF 1D5XB 3H7BA 3O6LH 1ZGLP 3KJ4B 2Q20A 1NCAL 4M7ZB 1VSCA 5BJTA 3L3KA 4XZUB 3TNMB 2OYPA 5C09A 1UFUA 1AXTL 2ZG3A 3MNVB 4NKMB 1C16A 1KFAL 4HUWA 3H2WA 5KAQF 1YJDL 3SKNB 5DTFA 4TRPH 1AR2A 2V5MA 2GAZB 3UPRB 5DA4A 3RWFB 4XPHL 3HC0B 3UCRA 4JY4B 1F2XK 1YQVL 4L5FH 1WCBA 3G04A 1QRNB 1I9RL 4S1SH 5E5MB 3GRWH 2MPAL 3E2HB 1U2HA 5E2WH 3V4UL 4X7DC 2GW5A 2MCPH 1CR9L 1JNHA 2UV3A 3TIEB 3QQ4B 4Y4KC 2VN4A 1JMXA 2V5YA 4PGBB 5AZEH 4X6EB 1TPXC 3WKML 4POZD 4DVRL 5FYKE 4PP1D 3VDCA 4HWBL 3S5LG 3WS6C 4OZHB 1DLHA 4H1LG 1YDPB 3V5DA 2C1PA 5E00A 5FV2A 5DQDH 1F4WL 3MRJB 3PWLB 4Q6IA 4HG4J 3EYVB 5DRZA 1P6FA 4UB0H 3PABA 3RTQD 3WS3A 3ORJA 2BVUA 4XBPB 5KAQG 3DHJA 4Y1AD 3ME0A 4PG2C 5LGJA 3DYPA 3VMOA 3BW9B 4JY5H 2F54A 4CVZB 1FL3B 4R90H 2B1AH 3QZWB 3GKWL 2C1OB 5KVGH 2PXYC 1XGYL 3SDCA 3OAZK 3FTGA 5F93C 3V6FB 2LVEA 3RNKA 5LWYH 3EYFA 2JJTC 4U6XA 2NY4C 4PY8J 3UTSD 4JM2A 3SBWC 1PYWA 1T1XA 5I1IL 4NZRH 5AAMA 3TH3T 5FOJA 1JWSA 5CEZE 2E27H 3UC0L 3LH2H 5FYKH 4PJ8C 2YBRA 1MCRA 4JKWA 3SKUD 3KPSD 1AXSA 1X4XA 3FFCA 5TQ0L 4FHBD 3GSNH 3M8OH 3QQ9D 1UZ6F 2JB6B 5FYLL 4G6AD 1WBXB 2Z31B 4LDEB 3QO0B 4M6AA 4LNVA 1CGTA 3KPLA 1UKSA 4G8GB 3AM8C 3LOWA 2WMPA 1AQDB 4C4KT 5HHOE 1M7XA 5IB5A 4TOYH 4XTRD 4EDWL 3X12B 2G5BB 1IQDA 1W72H 5C0BD 4WW2A 4HIHB 3IVKB 5E6IA 3RNQB 1SYVB 1FIGH 2DAVA 3T4YA 2CUHA 3OXSB 3QUKB 2OK0H 3FQTA 5FHBH 4IHOB 2VKWA 1CE1H 3VH8G 2C7UB 2F15A 3NA9H 1LILA 2YA2A 3O6KL 4M43L 5CEZH 4UQ3A 2FX8H 1N6QL 1MCQA 2VZOA 5FUZH 2N56A 3UBXG 5IVXA 5L2KA 4PJ5A 3ARFC 4IIQC 4OIIL 3SKJH 1OAZL 4CJ1A 1EHAA 1FAIH 4X9HA 5D7LB 4JN1H 2CKNA 1HZHL 1B4JL 4XVUC 5JPNA 3SDYL 3WD5H 1ND0A 2YN3A 5GRVK 2B0SH 3HR5A 4GXVL 3T8XB 5GRXG 1INQB 4RDQF 4L4TD 3KLHD 1LDPH 4Y16D 1MHHA 3HRPA 2YD4A 3INUH 5JIKA 5DRXB 1JPTH 3BDBA 5EH1A 3PL6A 4I3SH 1HCVA 4F57L 5IWLA 4GMSL 5INCB 4KJYA 4LSTL 5BO1H 3ARUA 3WV0A 2EE2A 7FABL 5DJAA 2ARJB 5IR1B 1F90L 4A2MA 5JXED 5EFIA 4I4WB 1E27B 1KPUA 1TXKA 2B1HH 2C3VB 4XVSL 1FPTL 4GLRH 3WXVH 4UMGA 2Y6SD 4OGAC 3REWB 2ITDA 3U46B 4QO1A 5DDHB 2XXCB 3TYGL 4MWFA 3MLRL 1AQKL 4P2OC 4GG6A 4OF6A 3F7YB 4M7JL 1IL1B 2WM0A 2Z8WC 5I1KL 4WWKB 1CFTA 5KANI 4NYLA 3REVB 2DKSA 1OAXH 4RDQG 1KLUA 4RGNB 1U2CA 3RU8H 3MLVH 4ERSH 3FONA 2B5IB 3BI9X 2HFEB 3LN4A 2UWEE 4JLRA 3HC3L 5EZOL 1IT9L 2CGRH 4YJZL 4H5SA 5D9SB 5C7XH 1S7UB 3D3VB 1NJ9A 2XT1B 3O2DA 2GUOA 2J8UB 1N2RB 3P4MB 3QA3A 4XH2B 1NAMH 1JZ8A 4EUPA 1UJ3A 4DQOL 1AGCA 5C86A 5FDWA 2YKLH 3WYRA 1A6VH 4RAUB 1RIHL 1LDSA 3ARXA 4YAQA 4TPRL 1SJVA 3O6FA 2W9EH 4IMLB 4C83A 1LE5B 2D9QB 1OGAE 2PYFA 2ADGA 35C8L 3BP6B 1NLDL 2ADFH 2LFGA 4RISL 3BQUC 3ARZA 4JFFD 4HKBA 1YJDC 2EXWC 2NXYD 1OF2B 4F58L 2QHRL 5KS9F 4FQ2L 5SWZA 5DXWA 3ULSB 1P7KB 5TQ2H 2ZOLB 2R2HA 2YPVH 2IQ9H 1MRDH 4MX7A 1BIIB 3GB7A 4IS6B 2GQHA 5J56B 4NQUA 1NGXB 1LEKB 2V2XA 5E2VH 3TGXA 2O61A 3MUGA 4MD5B 4CL7A 3NAAH 1L7IL 3GSUB 4M6MH 3IU3B 5CLWA 1B9ZA 3O3BB 3QWRD 2FX9H 3WS6A 4PTUA 3VRLE 5ESQB 1IGJA 1XF5B 4FABL 2X4OA 5CKAA 1A6WL 1QBLL 4L4JA 4LCCC 3L9RA 2DQGL 3MRPA 4PG2A 5K93A 4X6CB 5DVMA 1S9WB 3ZTJG 3IDMA 3DO7B 3RY4A 1FG2A 3QCUL 1UKTA 1EZVY 3JTTA 1T22A 1KSRA 3D25A 4U1IA 1U3JA 2PXYA 2O5ZL 5I1AA 3BUYB 5AZ2L 5SWSE 3SN6N 1NCAH 4UILL 2JJTA 5E0QA 1KJ2A 1Q9WA 3W9DB 1EHNA 5IHZB 1MWAB 3ARDD 1KFAH 4F7PB 4ZAKC 5CJQH 1YJDH 3B3IB 5D2NA 4RRPA 1SJXA 3H6JA 2HLFD 4XPHH 3AXLB 3DLQR 3VRJA 1YQVH 5T1KD 4R8WH 4PJBA 5SX5K 4N90D 4QEGA 5C0CA 2EKSA 1YMMB 2AQ3A 4NO3A 5DUPL 2CIIA 4HLJA 2M1KA 3V4UH 5HYIA 4XCNA 3SQBA 4HJGA 1CR9H 1KYOK 3OR7B 4ZUVA 3RVXD 2IBBA 3TT1L 4MB3A 3WKMH 1F45A 1KV3A 3VXMA 4IOFD 2H41A 4EIGB 1A14L 3EO1A 2VQ1B 4RWHA 5TE4L 4BFIB 4HWBH 3Q3GA 4LCYA 3MPCA 5FEBA 3VRLF 5GIRB 3H8NA 3RUGA 1F4WH 2GYSA 5C0DA 4V1DA 1AP2A 5HYSB 2WSKA 3HUJA 4WTXA 4O2FB 1M6OA 4TUJB 1NEZG 1JGVL 5FYLE 2GJ6B 3BEWB 3K74B 1X5LA 2NY7H 1YEEL 4XCYA 4KKAC 2ZSWA 2K1MA 4PRHE 4XP1L 3E6FA 2BZDA 3JV6B 5BOZG 2V2WB 1U92A 2CXGA 4IIQA 3GKWH 1XGYH 2EEBA 2YN5A 1M05A 4Y5VB 5IG7A 2DLHA 3RRQA 2XZAL 1A9EA 3QNXA 2XIDA 3V5KA 5IMLA 5GXBB 4FFYL 4GW1A 4XAWL 1A47A 5F89A 4PJAA 3OKMB 4UDTA 2ATPB 4MXQD 3BZ4A 2GFBA 5DR5H 4YPJA 3UC0H 3MV8B 3D69B 3KPRB 4BM7A 2A6KB 5JOPD 4NWTL 1F4HA 5C07B 1MHCA 3U0WL 3AROA 5TQ0H 4X5XA 2LE9A 4AM0A 3BPOB 4D3CH 5EU5B 4FTVA 5B3JF 5FYLH 3TJHC 4Q2ZB 5C1MB 5KSBE 5IMKA 4BSVA 4KHXL 2C4FU 4OF8A 1T66C 3VD3A 4UOW1 4EDWH 1S9VA 2NZ9C 1AGFA 4GBXA 3QIWD 1MI5E 4I48A 5C08A 5A16B 3EO9H 5EN2B 2GITB 3BJLA 3QISA 3ESUF 1JYNA 3G5XA 5ISZA 3TZVC 3MLTB 3TBVA 1QBML 3L5XH 1KB5A 3O6KH 4M43H 5CP3A 2N7BA 1HYSD 1L4IA 3CFKA 1NDMB 1U9KA 4WW1B 4YH6A 2HKHL 4OIIH 1OAZH 1EO7A 1KIQB 5F97E 2ZUVA 1HZHH 3SDYH 5IOPB 4OF5A 3I84A 4F7CB 2AK4E 2DM4A 2BRRL 4GXVH 1QO3A 3U0PB 4UT7L 2IG2L 1IEBB 5C0AB 2YC1B 4RAHA 5D1XC 1QRND 5IEKB 2G75A 4PV8A 4KHTL 2GEEA 4GMSH 4LSTH 3RZCB 3T0EC 3OKLB 7FABH 5LXGL 1LD9B 1F90H 4QT5A 1IZJA 5EPMA 5C92A 5INDA 5DJXB 2ZWLT 4NQSA 4XVSH 1P4IH 4K7PY 1MUJB 5KSAC 1I1YB 3S36L 5KSBF 2PUQT 5HYJE 5HHPA 4JCMA 3TYGH 4URTB 4MA8L 1XIWC 3MLRH 4I18B 1AQKH 3T0EE 3IYLW 4N1HB 4WFHE 2R2CA 5ITBL 1KLGB 4XXDA 2EDXA 4M7JH 4OLYL 3U1SL 3GSOA 5I1KH 1SQ2N 1GGCL 3GSRB 4LNRA 1Q9KA 1CGSL 1S5IL 2FATL 2W59A 4U7MA 3F7RA 3QQ3B 4QRRB 1NGZB 3BP7B 1TNMA 3GMPB 2Y7QA 1FYTA 4PJIA 3HC3H 5EZOH 4E41B 1IT9H 4K8RC 4QRPA 3WUWA 2L4OA 2HN7A 2V7HA 3MRKA 4DQOH 3FO1A 1G9EA 1U95A 3ECBA 2Q7YA 1DQQB 1YEKL 3MC0A 3MUJA 1RIHH 4ZD3L 4P2QA 4HK0A 5HI5C 3JV5A 4TPRH 3T1WA