2VL5A

Structure of anti-collagen type ii fab ciic1
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
218
structure length
218
Chain Sequence
QVQLQQPGADLVRPGVSVKLSCKASGYTFTSYWMNWVKQRPGQGLEWIGMIHPSDSETRLSQKFKDKATLTVDKSSSTAYMQLSSPTSEDSAVYYCARLKPGGTWFAYWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CIIC1 ANTICOLLAGEN FAB
publication title The Crystal Structure of the Pathogenic Collagen Type II-Specific Mouse Monoclonal Antibody Ciic1 Fab: Structure to Function Analysis.
pubmed doi rcsb
molecule tags Immune system
total genus 43
structure length 218
sequence length 218
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-01-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vl5A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vl5A02
5ITFB 2L4OA 1ZT7A 5EU5B 2MWCA 2C3WA 3JSSA 1IKNA 4N0CD 4M1GL 1U3YA 3GRWH 4PJFA 1F2QA 3EYFB 4H5SA 4XCFH 1UM4H 1CXFA 3UBXI 5CJQL 1J9CT 4PFEA 2Z92A 3BKJL 1MCRA 3MJ6A 4XMLL 5B22A 1S7QA 2D4DA 4UZGA 3RHWF 4LSPH 3Q0HA 1U36A 3MR9A 2Y23A 3FB6A 1D9KB 3V52L 5HVHC 1RJLB 1IGYA 1YEKH 4PBVC 3VFUB 5GGRA 3DPBA 4E5XA 1BZ9A 4PGZA 2D9QB 2QHLA 3PIQB 4JRXB 1IGJB 1SJHB 3HE7C 2GK0A 3GM8A 5EBMB 1UFUA 1JF1B 5FOBB 2IH1A 1BZQK 1G6RH 1S9VA 4ZPVA 3C2AH 3ARSA 3AROA 4DWHA 1I8IB 4G7YL 3RWJB 3MJ7A 5DUPH 1A9BB 1OPGH 3WN5C 1MHCB 2NY3D 5TDNB 1TVHA 2EKSA 4Y19B 5CMAA 2DF3A 3RNKB 5EORL 1QHOA 3JTSA 4H0HB 3WS3A 4KK8D 2EXWC 3P0GB 2EZ0C 2FH6A 1AY1H 4LCWE 4CGTA 5C0AD 3VG9C 3TC9A 4JFOB 2QADC 4I3RL 5MENA 2X1WL 3I85A 2VXUH 2BVQB 1LK2B 5I1AB 1JBJA 4FN0A 2Q8AH 5EU6D 2DL9A 3U48A 4NT6A 1RUMH 4MHHI 5JNYB 3VXRD 1MCLA 1S5HA 4FQQA 3RUGB 4JKPH 3WXVL 5CD5C 2CLVA 4I18C 3DYMA 3WKML 5CJXC 1ETZB 5KW9L 1G7PA 4FNLL 5E6ID 5E8EA 3LN4A 1I85A 1GIGL 3QAZC 3KDMA 4JGMA 4U7MA 5DJ6A 4I0PB 3VFOB 4IHOB 1U3HD 2X89D 5ACLA 1IQDA 4XCEB 3CSBA 1VB9A 3O3EA 3VA2C 1RZJL 2AEQL 4M5YL 3U83A 3P9WB 1MFBH 1NEZG 2CJUH 2GSGA 5DZLA 2WBJD 4RNRA 3SQOH 4JFDB 4PY7A 1KSRA 1YQVH 4LCUA 1RY7B 2VC2L 5F7MC 3Q1SH 3JWDL 4UILH 1JI2A 1PZ5A 4TRPL 5FHBL 4NRYA 5HHMB 4CU7A 1JNHB 1VCAA 4DK6A 5LKNA 4K3DH 4KUCF 4OFVA 3RY4A 4LLWB 3KS0H 5JW5A 3HC4H 1JNNL 4DVRH 2B2XL 3TO4B 4PS4L 2W9EL 2BRRH 1TNNA 3FL7A 2R2EA 4FQXD 5DJDB 1ULVA 5DJXA 1OAUH 4ZFOL 3STZB 1XMWA 4JPIB 5SWSD 2FX7H 1H5BC 3UTZA 4DJMA 2CUMA 5A2IH 1QR1A 2ESVE 2BC4A 3LH2H 2QEJA 1FGNL 3O11B 4YO0B 5HYSG 3FJTA 2X6MA 4U6TA 2NMSA 35C8H 3F7PC 2AK4D 1DN0A 5D7LB 3F12A 2NXZC 3FQTB 1WIPA 1EVUA 1G7JB 1MREH 4YH6A 1IGTA 3RWHB 5ISZE 4NQCA 1ZHBB 1BAFL 1WV7T 2D7NA 1AE6L 3DUUB 2NX5E 5L88L 2HJFA 4FP8L 3TYGH 5CEYA 3Q6GH 1EHNA 1JUFB 4Z95H 5F72S 4G7VL 3TT3L 4P46C 4K7PX 4UDTB 1N6QH 3DLQR 3U0WH 2F53A 1U6AL 3O3UN 1D6EA 4YNYB 3P77B 4ZXBD 4J3UA 1T5WB 5GGRY 4ISVB 5IMLB 5GRJH 2QLVB 5LWYL 3BO8B 1EZVX 4ZFZA 2I9TA 5LGJA 3O3AA 3GHBH 3GUTB 2JJVA 4N0CC 4X8XA 3WXWL 3V5HB 1T6VN 3PHQB 1NANH 4Y4FB 2SEBA 5B39B 3AS2A 1FVEA 4NNPH 3FFCD 4OCSL 4TNWF 1PAMA 4K8RL 2OBGA 2X4PB 5F7LB 4J3XA 1A3LH 3VU2A 1KBGH 1OAYL 3OZ9L 4NQDE 3OAZH 1RZFL 1G9NH 5IW1B 4LPTA 2W60B 3PWNB 1UWXK 2P8PA 1SEQH 1WISA 4BFBD 7FABH 3WMSA 4WU7A 3I84A 3QEHA 5DF0A 5C6PB 2DDQL 1UWEH 3QEQD 3LHPH 1ZSDB 4LCWB 2RGSA 5EC1A 1D5XB 2EIEA 1NJ9B 5HGHB 3VFRA 3MYJB 3K7UA 1Q0XH 3DMMA 2NY3C 1JGUH 1CTOA 4IOSD 5D8JH 3PUCA 4P2OA 3MTRA 1I7RB 1TDQA 4XNYH 2UZYB 2VDKL 4KK8C 5E2JA 3PNWB 1ZGLB 2R1XA 4KH2A 4OI8A 4Y0GA 3VFTA 5BQ7A 1MUJB 1K8IB 4QT5A 2BVEA 2AJUL 4TNVF 1QBLL 4OCRH 1OCWH 4IDJL 3L6FA 4RGMC 4JFEE 3Q6FA 2J88H 5AZEH 3TJEL 2FBJL 3RJDA 3T77B 4WJ5B 2ZCLH 3P9LA 4RGNE 4K7FA 2IH3A 4K23H 4FQHA 4NUGL 4Z7UE 2DQTL 3H7LA 3AAZB 5E6IC 5F7EL 4HHAB 2DQHH 2X4RA 2GUOB 4NWUH 5T1DH 1EXUA 4UV4L 3SY0B 1IGIH 2D03H 5HHVH 4JFHE 4OAWB 3TCLA 4CU6A 5T1MA 3HAEB 5FO9A 3HRPA 4JY6B 1AD9B 4JN2A 1AGBB 4PD4J 4Q6IA 1MIEH 3FT4B 1MAJA 5A3ID 4LSSL 5ENWA 1HEZB 5GS0C 2WBJC 1T5XA 1D5MA 4RRPA 3B5GA 4YAQB 4YDVB 4RMSA 4H88L 3HTLX 4MNQE 3UTSE 3BW9B 4ONFL 3NCFB 2JIXD 1GOGA 1PX4A 2MQ0A 2UUDK 5D96C 1NBZA 4OFIA 1J5OH 2WMPA 1MFAL 4UNUA 1DLHA 2DI7A 4G8FA 2APBA 4L8SA 3U82B 3VD3A 5I1KL 4XCYA 5CJQH 1J88A 3DUSA 3BKJH 1Y6KR 2BJMH 4XMLH 3CFCL 2PW2B 4IJ3C 3K4AA 1BD2E 2UYLA 2Q6WA 5I1GL 1HZHH 2NX5B 3TA3D 3WO3B 4BQBA 4Z7VE 1C5BL 1W0VA 1MI5D 1MHHA 3QDJA 2L7JA 1RD6A 3F7VB 1NGZA 3MZGB 4Y16A 2R1WB 3K81A 3ARTA 4O2CA 5IEKA 3U0TA 5DEGB 1YMHB 3QIBB 5DUBA 3AMKA 4X5WB 3WIIH 5SWZB 1V3MA 4MJIA 1UXWA 5KSVB 1IL1B 2RFXB 3CXHJ 4G9DA 1FFNA 4NQVA 3S34L 1JZ3A 4MXWL 3C60B 4FXKA 3ZHLA 3BKMH 1QQDA 4G7YH 1JGDB 2IQAA 3GIZH 1CLCA 2PETA 2Q8BL 3TWCL 4YE4H 5I71B 1RK1A 5F88B 1OGAE 4FHBD 1HHGB 3TESA 3SN6N 4Z8FL 4N0YL 2DRUA 2VXQH 4JO3L 1D5BA 4LCIL 1PY4A 2EEDA 4NJ9L 3C6SA 1SJEB 2E7MA 2FL5A 3PWVB 4P2RE 1CS6A 2DYPB 1IM3B 1JN6B 2YR3A 5FYKL 2XACC 4FQ1L 2YPLB 5DJZA 1ROWA 1QBAA 1YNTA 4PR5A 3EO0A 3C6LC 4UINH 4PJ5D 1I8KB 5HYFA 4X4XA 2OZ4A 3BP6A 3WXVH 1E6OL 1FFOB 2WQRA 4JLRA 4LSUL 5DJAA 2FJHA 2QSQA 4M5ZH 4EXKA 4HK3J 5HI3D 3WKMH 1U3ZA 2QR0A 2F8VA 3TIEA 3GIVB 32C2B 4UIKL 4XVSL 3EOAB 4FNLH 2DQJL 3KPPB 1MCSA 3MBEA 1GIGH 1TVBB 4KK5D 3DVGA 5IR1B 2Y9RT 2I25N 3ECBA 4I2XB 4P3DB 5D5ME 3RL1A 2WUCH 3BE1L 4WFHE 3ROLB 1FVCB 3EGSA 3ROOA 2AEQH 4M5YH 3JUYA 3OKOB 1CFVL 2HWZH 4P59H 3OGOE 4QKXB 3VJ6A 4LIQH 3JBG7 1OSPL 4POZD 1SMOA 4X6DB 4PV8B 5D72L 3HCVB 3G5YA 1DQQB 2VC2H 3IRZA 3JWNC 3ZE2E 3VDBA 3JWDH 2JB5L 4MQ7B 2DI8A 1CFTB 3CAFA 2CKBA 2X1PA 3GSUA 4ODHL 1JNNH 4QRTA 2B2XH 5JIIA 1PBYA 4IOIA 4NUJB 4RGNB 4PS4H 3LV3B 2W9EH 2H3NB 1VPOL 1P5UA 2HVKA 3LS5H 5C8JA 4HX1A 4G42A 1QSFE 2K1MA 4N0FA 1UEMA 5KJRL 5IWLA 5EIIB 4CADB 3S37X 1PG7H 3UTPE 1FN4A 3MGTB 4ZUWB 1J1XL 2MQCA 3UBXB 3OR7B 1RMFH 2A6DB 2Z4QB 1AQDA 2DMCA 3QG7L 4E41E 5E8OB 5DD6A 3FO2B 1XCQA 3UTSB 1XGQA 1YY9D 1BAFH 2MCPL 3KXFA 1OTTD 4KQ3L 1K5NB 5CJOH 5GSRA 4M1DL 5BV7L 1X5YA 4FP8H 5CZVL 1VHPA 3RRQA 3SDAB 1XIWD 3GSOB 4G7VH 5EU4A 5A3IC 3MUGA 2XT1B 2JELL 3BKCH 1U6AH 3LQZA 2XQBL 4DUWA 5HI4D 2I07B 3UYRH 2AJVL 3DX7B 4GT7A 4PRID 1B2WL 3V0VB 3E8UL 1FO0L 3QDAA 5LWYH 2W0KA 3NPSB 2LU7A 2P8LA 5IESL 4ELKA 3G5XB 4I3SL 1EBAA 4Z7VB 3WXWH 5MEQB 3WIHL 3GMPB 2ENSA 1CGTA 3SCMB 3EYSL 5IIEB 1JWUA 2P44B 2XZZA 3RGVA 2KL6A 4OCSH 4N68A 4DEPB 1BIIB 1LNUB 4PY8J 4K8RH 4M02A 3MLPA 3P4OA 4D8PB 5F8RC 4PJ9A 1IGFH 5GRXG 3SDCB 3TA3C 3A6BH 5HHNB 4GKNB 1MFDL 4Y4KC 5L6YL 3OZ9H 4HT1L 2O5YL 1RZFH 4ZS6C 1U8OB 2XN9D 3V4PH 3MLSH 5F97E 3RWIA 4F9LA 4F3FB 2R29L 3RHWK 3D3VE 5EULV 1EBPA 3SE3A 1I7ZB 4J4PA 5F1NA 1A9EB 1KTDA 5B4MD 2APTA 2DDQH 1KELL 2P5WE 2CLRA 1HHIA 3OX8B 4HG4J 2CLZA 3GMRB 1UA6L 4YHOH 1LD9A 4FFWC 2PO6A 3B9KA 4TUOA 4LEOB 1HSAB 5IFJA 4M6MH 2QV2A 2P8MB 3P4MA 1EFXB 1XGUB 5F96L 5B8CA 3M8OL 1MVUB 2Y5EA 3MV8B 5KVEL 1RZKL 4GRMB 4JRXA 1QA9B 3FTGA 3CCHB 4TVSa 3SDYL 3MRLB 1AXSB 2PXYA 2AJUH 1QBLH 4KDTA 3KYOB 4IDJH 1I1RA 2EDXA 1A2YB 3ZYJA 4PG9B 5C3TA 3MRJA 2FBJH 1A9BA 5D93B 4RAUA 3WHE0 2DOCA 3UTTB 1R3JA 5HI3C 4NUGH 1J0IA 2X9XA 5F7EH 1INDL 5BW7A 3BH8B 4UV4H 1ZLSL 3DURB 3ARGD 4NZRL 1B6UA 4JVWA 4L4TD 3K1DA 2X4NA 3FT2B 1XF1A 4U3CA 4DOHB 4D0DB 4BH7B 4GMTL 2OMNA 2DM7A 2VQ1B 3T1WA 4POZC 1FNGB 2OM5A 2BNQA 3PV7A 5JLZB 5DR5L 4UIMB 5HGAB 2AV1B 2AVGA 1FE8H 4KGLA 2AQ2A 4ONFH 4YXKL 4XT1C 1ETZA 5IB1B 3PL6D 2FEEL 4LKCA 1TQCC 1QYGL 2Q76A 1MFAH 1LO3L 1CXLA 2OL3L 3WDIA 2I5YH 5B38B 4MB3A 1C12B 2YHGA 5I1KH 1NDGB 2AQ1A 4HUUB 3BN9D 2XIDA 1OARL 3VCLA 3E6HA 3CFCH 1Q9KB 1XCTB 1H8NA 3H3BC 3IJHA 4P23B 2OX5A 5I1GH 1ZA6B 2IPUK 4P99A 1I9JL 1AGFA 1C5BH 1OD7A 1YEDB 2PW1A 2NY0B 1QLRA 3RP1A 2BNRA 5BRZB 3HG1E 4WWID 4XNMA 2ZCHL 4XPAH 5DJ2A 5A1AA 5C0IB 4PLOB 1WBZA 1CVRA 1FVDA 1OTTC 2ZPKH 5L2KD 2OTWB 2BVOB 3ZKSD 5DD5H 3O41B 1XIWC 5JR1L 3S34H 4MXWH 4JZNA 5D7JD 1MCBA 3BWAB 4C4KO 4TUJB 1JHLL 1UH2A 2AP2A 4GW1B 1IARB 5HI4C 4DGIH 2EIZA 5CEZH 2Q8BH 3TWCH 1YNLL 3D2UA 5D1XA 5C09E 5I1JL 4JEGB 5BO1L 4M7LT 5EO1B 3FQTA 4YHML 2GT9B 4JO3H 1FJ1A 1CFBA 4JG0H 1NAMB 4LCIH 1ZANL 4NJ9H 3NFPA 1BGXL 5IHZB 1OM3H 1EA9C 1FAKT 1GOFA 5HHQA 1A6TA 4OGXL 1F11A 4ODVH 4D9QE 1R6VA 4OCNC 2ZSVA 4WY7L 5FYKH 1WWBX 2J6EL 4QRQB 3T2NL 1KGCE 1PG7W 4FQ1H 3VFPA 3TVMD 2M2DA 1JK8B 3RPIA 3O81A 1EEZB 1N3NB 1T0MB 3VFNB 3O2WL 3O4LD 1TZIB 4H8WC 3KJ4B 4JDVA 4EDWH 5T3XL 2ICEA 4LSUH 1KTRL 4Z7UF 4MS8C 5IB4B 4TNWK 4UIKH 4BSWB 3QA3A 4OF8A 5GRYA 1IZKA 1HXMA 2DQJH 1ZLUK 2YBRB 4GKZB 3ARDA 4UMGA 2QQLL 1A64A 2DJ4A 3L3KB 4L1HA 3QFJD 1UJ3A 3GMMB 4MZ3A 5ICYA 5B4MC 2ED7A 4FXGA 3MX0A 4WV1B 4M6NH 5AD0A 2H32A 5IEHA 4MX7B 1CFVH 4OQTL 2OSLB 5KSAA 1EGJL 4M9PA 3MV9D 5ICXB 5KSUA 5D72H 4YC2B 2CO6B 3IU4L 2C3VA 2F8XC 4MQXD 4LU5L 4ZO9A 4QHNA 2I60H 4HUXB 1A7OL 3MA9L 1L7TH 3LB6C 3HB3D 4ONHA 1ADQL 1ZGLM 1AHWB 2Q7YA 4JQXC 2D0HA 4IM8A 1VPOH 4EBQL 1CXKA 4DZBB 5I8OL 3O6KL 4WFGD 3G5VA 4LCWA 3BH9A 5JZ7C 1RZIB 4HZLB 4WI5A 5KJRH 4E0RB 1DE4B 3BEVA 1RJYA 4CW1A 1T7ZA 4Z7VF 3TJHD 4X7DC 4TNVK 3INUL 5ICZB 2IAND 4GRLD 2XOTA 1J1XH 1P6AB 1T4KB 1UENA 3QG7H 1IAIM 3UJIH 1NLDL 3ARGC 4S0SD 1CG9B 4QTHA 4JFFD 1B6DA 4I13B 5BV7H 4M1DH 1T20A 5CZVH 1X5LA 2IGFL 3S6CA 4LSRH 4NSKA 2XA3A 3D39D 2JELH 3FQUA 1LQSR 4KFZC 1NANI 4P5KB 3BZFA 2AJVH 4P57B 2GKIA 1I8LC 3E8UH 3QHFL 1CXHA 3O9WB 4NCDA 2EXYD 5EUKB 3T0WA 3GSQA 4GKSB 4YHPB 4RMVA 3VFVA 4ODWA 2CD0A 2NY7L 1ZHKB 4QWWD 5IESH 3ESUF 4FQJH 1WK0A 4I3SH 1L4IA 2XWBA 3RNQA 3MUZ1 3WIHH 5C0GB 5H35B 4PGBA 3EYSH 1I3RA 5K9KA 2YC1B 4LRIA 1AGCB 2EIBA 4HPYL 4Q2ZA 4YIQB 4BSVA 4Y2DD 4HUWA 1HEZA 3OR6A 3DX8B 1BVLA 1H9VA 2QSVA 1T80A 3TPUB 1MFDH 4JREC 4PJ8D 4J8RA 4HT1H 4PRDA 4Z77B 2ESVA 4Y5YA 1XH3B 4NQUA 5DDHA 5C6WH 3U0PA 3CMOL 2R29H 4H1LB 3OJMB 5D7KD 5D5MF 5FGCB 4GSDL 4PY8I 5DYOA 3MODL 5GSVB 4M48L 1KELH 4N90D 3HZYA 4XAKE 3SGEH 5FO7A 5ISZA 1F3JB 3U7AA 3ZE2F 3VXUB 4LHUB 4L5FL 3SKNA 4DK3A 1J1OL 1X7QB 4TVPD 4MD4B 2HTLD 5MEOA 3RQ3A 1I9RH 3THML 2FD6L 3SGDH 1HI6A 5F96H 3L3HA 4G9FE 1ZMYA 5KVEH 2NW2B 2I24N 5JTWA 1WWAX 3ALWA 4FTVB 1JE6A 3UZVB 1C7TA 3SDYH 4LSVH 5DEGA 2B5IC 2PYEE 3U30C 3CX2A 3GSWA 3VRLE 1IEAA 5CJ8A 3BX7C 2EEAA 3TVMC 5E9DD 4KUCD 4ETYA 3GKWL 4ZQKB 1K4DA 4MCZA 4OCWH 3LN5B 2EE2A 4LBEA 1UZ8B 4EVNB 3WNPA 4HIHA 3QDHA 1J10A 3CDCA 1WCQA 4LKXA 3IFLH 3AY4A 4HCRA 4RA0C 1J8HD 4EI5B 3SKMB 1INDH 5HHXL 5A16A 2EDKA 3VXOB 4EN3A 4NZRH 4NQDA 4D3CH 1F45A 2IPKB 1JN6A 3ARBB 3BZEB 4AMKL 3KPQA 1AR1D 4RBPH 3NFSH 3FFDA 2CUIA 1HH6B 1GPOH 2O5XL 5DK0A 4XX1G 3QBTB 4GMTH 4G6JL 4NC1E 1IC1A 5JHDE 1D5IL 3EYQC 3QR2A 5GJSL 5I8EA 5DR5H 4WIQA 5KN5A 4MQXC 4YXKH 4PB9L 1FC2D 3MCLH 2X9YA 4KMTL 4DVBA 4KRNA 4LLVB 4N5ED 5AAMA 4OZIA 1YQ2A 3H42H 1QYGH 2V7NB 1QZ1A 4Q9QL 1LO3H 5BVJA 5EZOL 5D1ZA 2OL3H 4YDIL 4MVBD 3W82A 2X4TA 3ALPA 4K7PY 4BQCA 2BVTA 4JRYE 1IFHL 1OARH 2H45A 3OAYH 5IMOB 1E4KA 1DEEA 4NN7C 3RY5A 5F1IA 1P7KA 2ZUWA 5D2NC 4GW4B 3QYCA 1U92B 2BFVL 5DJCB 3HUJE 3QUZD 3CXDL 1KTKE 1EZVY 3QEGL 1BQSA 4X7TA 3P4NA 4JFEA 2VLKD 1CGWA 2GJ6D 4IBLT 5ANME 2W07A 1FL6A 2OQJA 3BD5A 3IFPB 2X4SB 1WICA 4Z7UA 5IJVA 4ZAKC 1NL0L 1I1FA 2XTJB 2UY6A 3QUYB 4WUUD 3S5LB 3KJ6H 1GJIA 3QI9D 3V7AE 5JR1H 1S7VB 4X7CC 1QHPA 1N0XL 4OTXL 1JHLH 3K1KC 4TSBH 1FL5B 3BRDA 4HMEA 1PDKA 4HUKB 1RZGB 3QEUB 3C09C 2JJUA 2FLBT 2EXYC 2ADGA 4YHMH 4FQPA 5FM8A 1ZANH 4PJIE 1DLFL 1I75A 4NM8L 4QWWC 1S5IL 1SYSA 2XTLA 3OKKA 5C3LD 4MNQA 1LK3L 4OKVB 3RL2A 5IG7A 3CJJA 4OGXH 2QQKL 2NZ9D 3TBSB 4WY7H 3X14A 3T2NH 2F74A 3K4DA 1CT8B 3O2WH 4RMQA 1E4WH 5DJ8A 2V7HB 3K2MC 5CEXA 5T3XH 3FMGL 5CBEA 3W11C 4OZHE 4PJ8C 1Q38A 3L1OL 2YRZA 1A1OB 1RURL 3ILQD 3MRNA 2LTQB 3VXQB 1BD2A 2Z31D 4Y16C 5A2JH 3V0AC 2QQLH 2XYCA 3H9HA 4MMZC 5J13C 2BNUA 3SO5A 1NCNA 4L29A 1SY6L 3RX7A 5C0BD 5FYJE 4YZFE 3O6LL 2NR6D 4OQTH 5DHVH 5JORB 4WTZA 5LGHL 1S9XB 3L3DB 2YD1A 4W4OC 4GXUM 1T1YB 5DXWA 2D7PA 2E7LA 3IU4H 2HTLC 4OLXL 3OAZK 1D9KD 1A7OH 3MA9H 5CIPA 4CMHC 2VDQH 4JZOA 3VFMB 3GKZA 3PWPE 1SM3H 3D48R 3VGEA 2D0GA 1U3JA 4UQ3B 1OGAA 5D70L 3N9GL 4EBQH 2AJZA 2A0LD 5I8OH 3O6KH 4OT1L 1WVZA 4C4KT 1F00I 1A47A 2VZOA 4F7MA 3K0WA 2VXTL 3AVEA 3KPRE 1TZGL 4P2RA 4QRRE 4QOKB 1HWGB 3EW3B 2P24B 2J3SA 3WLBA 2BHZA 3GJFA 4LAQH 5E8NB 4B53A 3D25B 2VLRE 1J7VR 3INUH 1LILA 5K9OA 1S7SA 4KI5E 4OD2A 3MRPB 1RV6X 3IVKB 4JFYB 2AJXH 4Y19D 5EZLA 3RWCA 1ITBB 5LXGH 1WZ1L 2YMXH 5C9JB 3D1MC 1NLDH 3G6JE 2WNGA 2HJKA 1G6RB 1AR1C 2IGFH 1A1MB 3BHBB 4XB7A 3TBVA 2GSIB 5GS2H 3H8NA 4MDIA 1V7ML 5FM4A 5I66A 4FG6C 3PGDA 5BS0B 1BF2A 5D5MA 5IMMB 1P4BH 5F3BB 1G9EA 1QBBA 1TCRB 3QQ3B 2UWEE 3MV01 4O2FA 4AQ1B 5CP3A 3KNBB 3MLYL 1T1WB 5F9WC 3T0EA 3ULVL 3N1GC 4GMSH 4PGDA 1UZ6E 3EO9H 5C9KA 2DIJA 4I0PD 4X99B 1FZMA 1BZ7B 3HNTL 3K8KA 3V6FA 1MJJB 4D0DA 4D9RE 4HPYH 3V6BR 1G9MH 1U2CA 1JZ5A 4U7KA 3BKYL 4PRAA 2QL1A 5I1HH 4JFQB 2X4UB 5DRXB 4JFDD 2A6KB 2AV1A 3RTQB 3DYPA 1QSFA 4ODXA 2A6JB 3HFMH 3MLTB 3CU1A 3MBXH 5HHMD 3DUHA 3U4EA 2C3HA 3HI6L 2H6PB 3FQWA 3CMOH 1FZOA 3TN0D 5D9SB 4KHTH 4GSDH 1N59B 3TO4D 4ACPA 1I1AA 2NTFB 4P5TB 4R7DB 5J11B 2HTKD 1U8LA 4M48H 3V2AR 2DI9A 3MLVH 3IAPA 1CLZL 2P5EE 5ETUA 4E41A 4MWFB 3QI9C 4RSVA 3IDMA 4PJXA 3I02A 3PP4L 4L9DA 3T04D 4W6YB 1ZTXL 4L5FH 1Q94A 4XC1L 4KUZL 3AREB 4I3GA 1PYWA 4ZUSB 1K85A 3THMH 5MERB 2FD6H 1YEHL 5D7LD 1VSCA 2Q3AA 2HJLB 1ZT1B 5I2IB 3EJJX 3AB0B 4FQ2L 1NC2A 3VWKA 4NO5A 1F90L 4JY4B 4OZHB 2F58L 3TIDB 3AMLA 2NZ9C 4WUKL 4R96A 1QLFB 2A9ML 2OTWA 3L3OA 2C1PA 2VMFA 2MNUA 5T33L 1G1CA 4G6FB 2XPGB 4NQEE 3IXAB 3C5ZA 4PJHE 1QSEB 3GKWH 5E7FA 2DM4A 4YK4B 1KPVA 3B2UD 3OSKA 1I7TA 1EAPA 1Z3GL 4LNVA 3PJSB 3ZZ1A 4HIIA 4PJ9C 5FK9B 3T3PE 2Y06L 3VRIB 3ILQC 3VXPA 2NZIA 3ES6B 1MCWM 1U95A 3F5WB 4NNXB 1EVTC 2AJ3A 5GS0L 4NYLA 3H9SB 3G5ZB 4AMKH 4LLMB 3SE3C 4U6HB 4AM0A 4YDKL 1MY7A 2CXKA 3LKSB 5JDJA 2NR6C 4Y4FD 1K4CB 2O5XH 1TETL 3D3VA 3IFOB 4G6JH 1N3NA 4CVWA 5FF6A 4B7LA 1FPTL 5F6IC 1D5IH 3LRSA 5FO8A 2V9RA 2VOTA 1AKJA 2HKHL 2P5WA 4FZ8L 5IB4A 4U1NB 4PB9H 4KMTH 2IFGA 2ITCA 1D9KC 4TTGA 3I6LD 1QR4A 3BDBA 5MEPB 1R3KB 4L8DB 5B8CC 2I27N 43CAA 5HHPB 3A0OA 5HHOD 2NNAB 4LCCB 3TNNB 3U9PH 4YDIH 1R5IB 3HNSL 2A0LC 1TENA 2VR5A 3AU1B 2G2RA 1IFHH 1XGTB 5JO5B 4A6YA 4URTB 2OSLA 4G80A 2XKUA 1MCDA 4GH7B 4DKFL 2BFVH 5I18L 5ESAB 4NO3B 3CXDH 1WBXB 3T0BA 3QEGH 3IDYB 2VDPL 1NBQA 4K2UL 4NZDA 4UQ2B 1KJ2L 2VZ1A 1X4YA 4R7NA 3WFHB 5ABDE 4NM4H 1MJ7L 3CFBB 4F15B 2GAZA 2BRQA 1A14L 1XF5B 2OCFD 3DSNA 2DWDA 1NL0H 3U7YL 1JGEB 5GRWA 3QIUA 1GC1L 2DKSA 4ALAL 1PKQA 1N0XH 5L2JA 3WFDL 4YWGL 2VLJB 2FJFA 5LGKA 4LNRA 2H9GB 4JJ5B 3TPKA 4Q97A 2DAVA 1B4JH 1OAQH 3MV7D 4C56E 3C8KA 5CZXD 4LGPB 1T89A 2VZTA 3O4OB 1M7XA 4RISL 4L8BA 4NM8H 3BPCA 4V2BA 3C5SA 1LK3H 4N5UA 3VRLF 1B4RA 1CVSC 3I2CH 3QXDA 3QUMH 4XPHH 1U58A 1NGXB 1U8PA 1EDQA 5EBGA 1BPVA 4U6VH 2A1WL 3DI3B 3DX9A 3T65A 1JZ7A 3BJ91 3FMGH 4OB5L 1JTOA 3L1OH 4IRJB 1P9MA 2P7TA 3MRGB 1ZHLB 4M43H 1KCVL 3MOBL 5CINL 1K2DA 1UH4A 4OF6A 1XF2B 3MLZL 1LO2L 5FM5O 3CD4A 3OKLB 3TO4C 1BM3L 3B3IB 5JXAL 3HG1A 2Z8VC 4X5XA 4ZOAA 4XRCA 3EO1B 5ID1B 2Y5TA 3O6LH 1W0WB 4Z78B 1Q9LA 3FN9A 1RFDL 3G04A 5LGHH 3WUZA 5E8PB 4K94C 1G7LB 3FRPG 3GSNL 3ETBF 3QXUA 2WZPD 3V8OA 3BMWA 3IDJA 4GS7B 2NX5D 3D0VB 1ZK9A 2DIBA 2MKLC 1RSFA 5JPMA 1N8ZB 3BJLA 1UM6L 3DSFH 5CD3B 4H1LA 3EYOA 3QNXA 3U9UA 1CDIA 4R2GB 5D70H 2DIAA 3C9NA 4X9FA 5C09A 3N9GH 3SE9L 1N64H 2HRLA 4I9WD 3SGJA 4M6OL 3DVNA 2P47B 1XGYL 3BQUA 4OT1H 1FH5H 3U6RB 5C0AE 1GL4B 2IJ0C 3QIBD 3NCYS 1AFVL 2EDWA 5KSBE 5SWZD 1TZGH 3NAAL 2VITA 2D2OA 3HUJF 3B2UC 3C60D 4KZEL 5EU6E 2G5RA 1T1XA 1EK3A 4X4YA 1CD1A 1CCZA 4PJAE 3VXRE 1S7XA 1IC4L 1S9WB 5JIHA 3VMNA 1JWSA 5TDOB 2JJTA 2OK0L 1YPZB 1PZUB 4JM2F 3G6DH 1R5WA 2O26U 2IFFL 3DI2B 4LPVA 2AV7A 1UJ3C 2DYPD 4HIXH 1UCBL 4Y4FC 1V7MH 1NUDA 2H8PA 2PUQT 2YPLD 3O3DA 3Q5TA 3S4SA 4JM4L 3S36L 1UZ8A 5KTEL 5EUOE 2Y4SA 4L9LB 5JIPA 5CSZB 2FZ3B 1D6VL 4LQ1A 3REWA 5FIEA 2ZSWB 1IAIL 1FAIL 3LOWA 2WV3A 1I3UA 4PJIF 5T1KB 1YC8A 5FDWA 3MLYH 3D85B 2VN7A 1NMBL 4HFWB 3ULVH 1WIUA 3MRMB 1TPXB 1BOYA 4KGJA 4PJGE 4QCIA 4X0KA 3BP5B 3QJHA 4M61B 2YPKA 4PLKC 4YHLL 5HI5D 4IIQA 1DBKL 1R3IL 3HNTH 2D7OA 4PREA 1HQ4B 4OCMC 5EO0B 2VQUA 3TLRA 1MFNA 3B2VL 1YEJL 4XH2A 1N5AB 3UPCA 4OZHF 5SWSE 3VI4E 1KJVB 3SGEI 2JF1A 5DMIH 4HWNA 2VN4A 1C5CL 3HI6H 4XPGH 5C0RL 3RDTA 1U93B 3QUXA 5INDA 4AIZA 5J9PB 4DUVA 2AK4E 1T21A 2A74A 3SGDI 1WFUA 2AS5M 3FCTA 4YZFF 3OKDB 1MCHA 4EZMA 2H41A 3GMLB 3MXVL 1FG2B 1CLZH 3OKMB 4U1JA 3ULUD 4O2EA 5JQHC 3H0TB 43C9A 5DJCA 2ARJB 1ZTXH 4HEME 4KY1L 4XC1H 4KUZH 5FYJU 5E00B 4UB0L 1L7IH 1W72H 3CLFH 5SV3A 5E94B 5IK3B 2EECA 1YEHH 4LARL 4GRWH 2Z9TA 1Q0YL 4LLYA 4R3SB 1JL8A 3MRRB 4FQ2H 4X4ZA 1FLRL 2F58H 4ZFOB 1A0QH 1KLUA 3MLUL 5GJTL 3UTSD 1ND0A 4UTAH 1CGVA 4OGAD 5T33H 4PLJD 4OV5B 5ERWA 1F4XL 4LRIC 3SDAD 4G8IA 4PGJA 2ZOKB 1KCKA 1QO3B 3FFCE 5CILH 1Z3GH 3QEUA 3O6FA 1M05B 4LFHD 4KI5F 2Y06H 1IM9D 5MP6L 1N5YH 3B8SA 2H26A 2R4SL 2GYSA 3W39A 3IF1B 5J1AB 1EHLL 3PWJB 4G6AD 4WW1A 3G6JF 3QZWB 5C0DB 1XF4A 4HS6A 1QEWA 3MMEA 5GS0H 3NH7L 2X7LB 2YK1L 4XBPB 5I1DB 4NKQB 3VH8A 5ACZA 4ORGB 4YDKH 1BLNA 3IJYB 2AJYH 1EX0A 4LCYB 3VGHA 4N0UB 3SCMD 5AYUH 1DBAH 1TETH 4OZGE 2CDFA 5T1LA 1KIQA 2C7UA 3MJ9L 3QEQE 2UWEF 3QO0A 5E95B 3LEXB 3MRQA 2HKHH 4YQXH 5M95B 5GRVK 3IDNB 3SDCD 1P84J 5BVPL 5KSBB 3CFKB 1Y0LA 2VKWA 4NOFA 3GJEB 2COQA 4QEGA 1UZ6F 2PKDA 3GGWB 3VXMB 1VEPA 1A4KB 1WTGT 1VACB 3HNSH 2W0LA 3NGBB 4G9FA 3HE6B 1OW0C 3QIBC 1G7MB 1ED3A 2VQTA 3WNOA 3AXLB 3FN0H 2PTVA 4X6FA 5D1QB 1QSZA 2PYEA 2CPCA 4DKFH 1DQJB 3SE8L 4F2MB 1U8HA 1A7QH 3L5XL 1C7SA 5C0FA 1M7IB 4U1HA 2VDPH 4JCMA 5F6HJ 3X13B 1R0AL 1JGLL 3VGAB 5I71C 3CSYA 1KULA 3LMJL 1CF8L 1KJ2H 4RMUA 4HJJH 1EFXD 4PJ7B 3VXSB 4I5BB 5EUOB 5JXED 2BOBB 3MV8D 5FKPA 4APQB 1RZ8A 1R24A 1YEFH 5C07B 3ULUL 1A14H 3BVNB 5INCA 1O0VA 3U7YH 2GJZA 3FO0L 4OIIL 4PP1D 3ZT5A 2VABB 1GC1H 4JGUA 4MB4A 1OQOA 4ALAH 1U8JB 3L5WB 4PJGB 2WANA 3KPNB 5FGBA 3WFDH 4EIZC 4WO4A 5E8NA 5L7XH 2ERJB 4XNXH 2R0KL 3GSVB 1WBYB 4Z7QE 3LKPA 4FQLL 3WFEL 3UTTD 3U7WL 5C2BL 3P0YH 4IS6A 1XT5A 2IAMA 2HA1A 1JZ4A 1JHTB 1HXYA 5JHDA 4RISH 4QGYA 4FFZH 2OJZH 2HH0L 4XNUL 1EAJA 3FQRB 2FR4A 4B41A 5JUEH 2V17L 3FOLB 5HI5C 4H8WL 5D1ZC 2BY1A 4FMKA 4PJHF 4J12A 2I9LA 5EZJB 1KJMA 5BZDA 4WWKA 1E4KC 1BX2B 5HDLA 1T7XA 5IHUL 3CH1B 3TZVA 3T3PF 4JRYA 4NP4L 1X5AA 5EPMA 2CDEB 3MOBH 5CINH 4G6KH 3BP7B 4OLVL 4PTTA 4GBXA 1LGVA 3HUJA 4QXGL 1MI5E 3BI9X 4ZNEA 4Y89A 1P4LB 3MRFB 4M4RA 5EU7C 1DQLL 4DKDC 1NFIA 1P53A 5JXAH 4RGNC 2E7BA 4ZXBB 2XKNB 1ZEAH 2R39A 5C0JA 1VKXA 4X98A 2W92A 1MWAH 1C5DA 1KCUL 1MFCH 2BSRB 5J12B 5ANMA 1RFDH 3WV0A 3WEXB 3KPOB 5ID0A 1NEZB 3GSNH 5F44A 1OP3H 4JM2A 4P23D 1JZ8A 4PRHB 1IGCL 4H20H 3B6SA 3PXHA 2AK1L 2NY0D 4UT9H 4GAJL 5BRZD 3VD5A 1UM6H 5M94B 2XY2A 5D6CA 2ADIB 1UB6A 3EFFA 1UVQB 1AGEA 4XP4L 4D0CA 3HS0B 3MJ8B 5KVFH 5D6DA 4M6OH 1XGYH 4LASL 4OGAC 1YDPB 4J3VA 4PLJC 4PJIA 4MWFA 1KIRA 4EI6A 2XXCB 4F7EB 4S2SB 4OM0L 5IB3B 1KN2L 1FIEA 2V6HA 4G8GB 1CFQA 3I6KB 1J87A 4JHAL 5E4EB 1VADA 1VFBB 5HYSB 5DHYB 1GGYA 3IDGA 4PJ5E 4S11A 4I48A 5HSFA 3PWLB 3LKRA 3NPSC 4RRPG 5C70A 4MSWA 2EYRA 4XCNA 5E5MA 4ETQA 1JJUA 2OK0H 3GEWB 5DC9B 2C4FU 2OS7A 4M3JA 1KEGL 1QSVA 1UCBH 3AC0A 1KEML 4GLRH 2VAAA 3SCMC 2Y6SD 5A2KH 2DQUL 4TSAL 4HKJA 4G6MH 4Y4HA 1UYWL 4U1KB 1GGCL 2OR7A 1JPST 3S36H 5KTEH 3UJJH 1KFAL 1ZVHA 2ZUVA 2FATL 3SDCC 4YGVB 1TITA 3FB5B 1FAIH 4O4YL 3QH3B 4UDUA 1MAML 4NQTA 1HSBB 5CSGA 5GIRB 1YUHA 1FNEB 3IT8D 4HKZB 4AIXA 3DHJA 3UZEA 1KF9B 3QNYA 4HGWA 2DWEB 1OAKL 4U0QB 4KJWD 3VWJB 3J7HA 1DBKH 1M7DA 3KYMA 1QVOB 3KYNB 4RBPK 4LLUB 5FHAL 4KAQL 1LEIB 3PWPA 4KKAD 3MGOB 1KENL 3B2VH 4WEBH 2OTUA 4HKXA 4F7PA 3LEYH 2AXFB 3BZ4B 4NBYB 4KROD 1ZHNA 3V5DB 5BXFB 5CCKL 4ZD3L 3EDDA 1BVZA 2EC9U 3BIBX 3KPRA 1AD0B 4Z7WE 5H2BA 4QRRA 3QUKA 4MQSB 4HKBA 4XPFH 1EERB 4RQQB 25C8L 1C5CH 3QIWA 3NZ8A 3RKPA 5JHLH 3Q3GB 4HD9A 1J0HA 1DBML 2VLRA 4UU9A 3VG0H 2RJMA 4ERSH 3PQYB 3T09A 2FECL 2IBGA 1WEJH 4PGCB 1UB5A 4PP1C 1TXKA 3BEWA 2V2TB 4JO2L 4IRSA 5D71L 2GCYB 4PTUA 3G6JA 5GS1A 5LJYH 3RU8L 3DV6A 5ESAA 3IU3A 1P5VA 4XNZC 2MPAL 5F3HB 4U3HA 5HVGB 2CUHA 4AENA 5D93C 2YD5A 5DVKA 1MHPL 4DGYH 4ZS7L 2AEWA 1IQWL 2ZG3A 4PRIE 2BSED 4WRLA 1JPFB 3STLB 2HFGL 1F3DJ 2UWEA 2YA2A 3MFFB 4Y2OA 3WLWC 3MLUH 5L8KB 3LD8C 1NFDE 4KDWA 4NC0B 4Z0XB 3WUWB 4ZUUB 3NIGE 5KSBF 1CIUA 1S8DB 5DMKA 3CFEB 4HUVA 1DQDL 1QBML 1LP9B 1F4XH 4Y5XB 1Q9OA 4K3JH 1CFNA 1YZZA 3QPQD 3R0MA 4PJAF 4RX4D 5BMFL 3PDOA 3UCRA 1DSFL 5DJ0B 5MP6H 2ORBL 4MNHB 2HT4D 4MAYB 3O9WD 4KXZH 1AP2A 2R4SH 1NDMA 3W5NA 1JV5A 4QRPB 4HULB 3WKNA 2B20A 2XY1A 1EO7A 3L7EA 5BV7B 1PSKL 2XN9E 4GXVL 3EYUH 3NH7H 4R8WL 1QKZL 1GGUA 3MNVB 4XPTH 4X6EA 2WWKO 4PJ7F 5EUOF 4ZDHB 3MJ9H 1OTUC 2ZOLA 4P23C 3D87B 3BP4B 2P5EA 5I17A 1CQYA 4HXBL 5BVPH 4JG1L 4TN9A 1SEBB 2NY0C 1C16A 4W81A 4U6YB 4GG6B 4M8QB 2DTSA 4HDIB 4PJGF 3NN8A 1DZBA 5J8OA 3TYFA 4KK6D 4U1GC 4WHYG 1NGPL 1P1ZB 5BZWB 3WN5A 4M7ZB 4NQXA 3MO1A 3SDDA 3RX8A 1T7WA 2HYMA 1KYOJ 3VI4F 2VUYA 4IOFD 3S35L 4M62L 5EZIL 4M6AA 5T3ZH 5IV2B 1A7NH 3SE8H 4P2QD 1G0YR 3RWEA 3VXUD 4LHUD 2BVPA 4NQEA 2EC8A 4PJHA 1JGLH 2G9HB 2VISA 2H2SD 3LMJH 1H3TA 2N7BA 5TH2A 4QRSB 1GZQB 1NC4B 3FRUA 2E8ZA 3MACL 3S96B 4FTVD 3RVXD 1HIMH 1A4JA 3QUMA 1ZS8B 2X1XR 3FO0H 4I18A 2Y6SC 4H25A 4OD1H 5CJXA 4CVXB 2NW3B 1JPGA 3KWWB 5F9DC 2DBLL 4OF0A 3HMWL 5KOMC 5GGSA 2R0KH 3KJ4C 1G7HA 4JPVH 4FQLH 1S7WA 3U7WH 5C2BH 4KKCD 1M6OB 4Y5VB 1P7QB 3GSXB 4EI5D 4OD3H 2FO4B 4XNUH 4HIJA 2X41A 4KJWC 4NWTH 3QCTL 4H8WH 2YUXA 3ARBD 3O45A 3CFJB 1R3LB 4WV1C 3SBWC 4AQOA 3CDFA 5CJBA 4KKAC 4NZTL 4F8QA 2A2QT 3WHXA 5IHUH 5ESVB 1LE9A 4NP4H 3HZMA 4YC2C 1MOEA 1FORL 1F6AB 3CFDA 2R0WL 4U1SB 1MCQA 3U1SL 4QXTA 4CRPA 2ADJA 3B83A 4NO0B 4QXGH 2DLFL 5DUML 1Q9WA 2A73B 4KQ4H 2GTZB 4FQCH 4HV8A 1DQLH 1AHWC 3IKKA 3BXNB 1KCSL 3DIFA 2BERA 3KPMB 4OZGF 5K93A 4CVUA 1OOAA 1NUNB 2ZG1A 4QYOB 4XXDA 2X70A 3QIUC 5L2KE 2G5BB 5E56A 3ZHKA 1IGCH 1QLEL 3HRZA 1T3FB 4HGKC 1M71A 5JOEA 2AK1H 5DA0B 3MROB 4RFOL 2DQFA 4MNGE 1FQ9C 5DC4B 3FO9B 5FGRA 4OZFA 2OL3B 4P46A 1OY3B 4C56A 4H26B 4WFED 4PRBB 3GMLA 3CC5A 3A6OA 4LASH 1MRCL 4AG4L 5F9JB 1FFPB 3ZKMD 2OZ4L 2XTJD 3P73B 4HS3A 3QUYD 1IGMH 3JVGC 1S7UB 1KN2H 1GSMA 1WITA 4I8DA 3QPQC 5J06A 3MREB 1FFRA 3DVFA 4YDLB 1F6FB 3RWGA 1DDHA 2X1QA 5E94A 5FUCC 2HT4C 3O4LE 3O9WC 1MRFL 4OUUA 4V1DB 1RHHB 2DKUA 1IC5L 5E8DL 1U8IA 4CNIA 4P4KB 3W5MA 3JTTB 1UKQA 5C1MB 3QFJE 2DQUH 1W8NA 4TSAH 1DBBL 1GGCH 3PE9A 3WFBL 1ES0A 3UTQA 2AXGA 2CKBL 4Z7QF 2ICWJ 4S1SL 1KFAH 1F4YL 2FATH 2BOCA 4WCYL 3LQAC 3IXTA 2GW5A 3JWOC 5DGRA 5I19L 2W65B 3HI1B 3MV9E 4O4YH 3QULB 3F8UB 5E1HB 3FZUD 1T6WA 1U8NA 5HYJB 4YHIA 5L9DL 3FO1A 4KK6C 2MHAB 3KGRA 3N85H 3FT3A 4I77H 1BQUA 1A6PA 5FHAH 4LAJH 4O5LL 1FV1B 1VENA 1UQSB 3RVWD 4U31A 5GGSY 4MA1B 1KENH 5DK2A 3GMQB 4Y7MA 1YYLL 4GOSA 4IOFC 4WFGE 1CXEA 1RJZB 3EHBC 3HZVB 5C0AA 3P30L 2IWGA 4NKOB 3CLEL 5D2NE 1W72A 1P6FA 4WI9A 3TT1L 2H2SC 5KBNC 1AC6A 2V2WB 4OIAA 2VERN 4NIKB 5FYLD 3V9FA 3TBYB 5EU6A 2AERT 3L9RB 5EOQL 1A4KA 1E6JH 2IANE 3ARVA 4U6XB 4ODSL 2YEZB 5TE7L 1KNOB 4PJAA 2FYYB 1VACA 5HYQB 3VXRA 3F58H 1EJOH 2WSKA 3RVXC 1NGYA 5DVMA 1MLBB 5DHVB 1S7TA 4UUJA 2DN7A 1P2CB 2OJEB 3DETC 3QWOA 4JO2H 4XVTH 3S3PA 4JFFE 3AXLA 2ITDA 3JV5A 4KK9D 1PX3A 2BHYA 4I0KA 4QOKD 5E6IA 4FFVC 4KV5E 1YEEL 2MPAH 4NRZB 4N9OB 3D39E 3ILPB 1U3HA 1HWHB 2X89A 4R0LA 4BQ6A 4MLIA 1MHPH 1KG0A 2O93L 1RZ7L 4KKCC 3J8F7 1YN7A 1IC7L 2X9WA 3QG6B 2HN7B 1X4ZA 3UTOA 1SBSL 3CZJA 4LP4A 1HDMB 2HFGH 5EFIA 1H3VA 4Q9RL 1G0XA 2H1PL 2WBJA 3MQIA 3U4BL 3ULSA 1D5ZA 3RFZC 4MCYA 3ARBC 1KJ3L 5GZOD 1QBMH 3I50L 2KBGA 2Z35B 3R06A 4QO1A 3RA7L 3UZQA 1NBVL 4AT6A 5BS0D 4GG8A 5BMFH 3DGGA 5TGBB 1X5XA 2XFXA 1DSFH 4I4WA 3BGFC 4FQXA 2Z91A 1UC6A 4HC1A 3OWEA 4F7TA 3MRBB 3V4UH 5SWSA 3V5KB 3P11L 1A6ZA 1T0NB 4WU5A 1PSKH 3ZKND 3N1QC 4GXUN 4R8WH 5TE6H 1QKZH 4JFPB 4PRNB 5LG1A 1DVFB 5D7KE 5IROC 3DECA 5DSCA 4DCQB 3OJDA 4AJ0A 2AK4A 5DEZA 5TQ2H 2G75A 4JR9L 4N90E 3QDMB 4R4BB 4YR6A 5I1IL 2CRMA 4ZSOE 2P46B 5KANG 1UXSA 3TNMA 5IB5A 2CDEA 4HXBH 4L4JA 3R1GL 1N7ML 3RTQD 2MJWA 3HLAB 1MRDH 3MNWA 4TVPE 4AL8L 3O2VL 4OFKA 5GHWH 1F13A 3DROA 1PLGL 1J05A 3F6LA 5EN2A 4LK4A 3P2TA 4ZXBA 1X5KA 4MDJA 5GRZA 1NGPH 1B0RB 4NFBA 4P5TD 2NYYC 1FCCA 4U1LB 3NVQA 3ZKMC 2Z8RA 1HQRA 2XTJC 2Y7QB 3QUYC 2AXHA 4NKDA 4JHWL 3S35H 2WINA 5EZIH 1NCBH 1UEYA 1RIHH 3L5HA 5E9DE 4CVZA 5FUZL 3ARED 2GY5A 4M7LH 3V7MA 5DURB 2LE9A 2Q3ZA 2FWOB 4PBWD 4XCFL 1UM4L 3LKNB 3FFCA 3MACH 3HC0B 1KPRB 1KPUA 3HS0A 1J8HE 5ACMA 3C6LA 2O5ZH 3FAWA 1YDPA 5ALBH 1Y18A 1T04A 4X6CB 4HQQL 2GITA 4G6FD 5F89B 4CKVX 5TQ0H 2J5LC 3L3JA 4L8CA 1T0PB 1YEKL 8FABB 1QSED 1MF2L 1OB1B 4XVUC 2JB6B 1WUNT 4OZGA 5JW4Q 4L3CA 1RU9H 3STBA 1MVFA 2WBKA 3X3GH 5EBLB 3QEQA 4MA8L 3FZUC 2LTQC 2IADA 1INQB 4WI4A 4NJAL 2F19L 1ZVSB 1NFDF 3L7FB 3NIGF 5JMRA 2WWKT 4Z76A 3I6GB 3H9SD 4P5MB 3VFGL 1KXQE 5DUPL 3JUZA 1OPGL 3O3BB 4GRLB 4NZTH 2IPTH 1CICB 1HILB 3MCG1 2Z93A 4LOUD 3F7YB 4TSCH 3FQXA 1URLA 2ZUXA 1FORH 1AY1L 3IETA 5IVZA 2R0WH 1WF5A 3U1SH 2ENYA 1B0GB 1RAMA 3IJSA 4NN6B 5LAXB 2DLFH 5DUMH 5HGDA 4K94L 2VLKE 1KCSH 1Y6NR 4BFGA 2GJ6E 4JANA 3S9DB 5EIQA 1TQBC 2C3GA 5MI0B 2BY2A 1JZ6A 3LSOA 1J8KA 3HPJA 1KIPA 3VFWB 1BFTA 3OGCB 4GW5B 4XZUB 2X2YA 4WUUE 1S7RA 1ZWIA 2J8UE 1I1CA 4GO6B 1EUTA 3CUPA 2ED9A 2HG5B 4QF1B 3HHRB 4RFOH 1P7HL 3K8LA 2A83B 2IAMC 2VE6B 5E2WL 4Y2DB 2FRGP 2W9DL 4YJZL 1H8SA 4IRZL 2CDGB 3NFNA 4JAMB 5C0CE 1K8DB 1MRCH 4AG4H 4ZFGL 3UX9B 1ACZA 2OZ4H 3Q1SL 2WLZA 5IF0B 2JIXA 2XZQL 1T66C 3HE7B 4K3DL 4QY8A 2Y25A 4GLRI 2VLJD 3RVVC 2NY1B 3IRPX 4P4RA 2AKRA 2BRRL 1G84A 1SYVB 2BY0A 2WIIA 2QBWA 5EDXA 1OAUL 1SJXA 3UROR 1XR9B 5TDPA 3P4LA 1IC5H 4F33A 3SDXE 3ZKNC 2HKFL 2FX7L 5E8DH 5K33A 1U8MA 4DAGL 1FNFA 3OKEA 1JNJA 3WUWA 2LFGA 1ORQA 3QNZB 3TA3A 3LH2L 2GTWA 4LMQE 3CFIC 5JA9A 1MIML 1MI5A 1AGDA 35C8L 5F8QC 3VXTA 3WFBH 5C0BE 4GUPB 2CKBH 2QADB 3DO7A 4S1SH 1F4YH 2F5BL 2CQVA 3RTQC 3HR5B 2C4FT 1QPPA 15C8L 4IRJD 5I19H 1DUYA 2OI9B 1KUMA 4KJQD 1IAOA 2W0FB 3IKCB 3TYGL 5L9DH 2BSSB 1A6AA 4Z95L 2B4CC 3N0PB 3D0LB 4YXLL 5IP4A 3Q48A 2R15A 4JFXA 4P5TC 5CWSB 5J11C 2DM2A 4O5LH 4WHYH 1V3JA 2QTEA 1YYLH 1FO0A 5F7WC 2EDDA 1HHKB 2PCPB 3PV6A 4UAOB 1I7UA 3QJFB 2JK5B 1ZLUH 3DNKA 4KVCL 4BK5A 5B3JE 4RWHA 3CLEH 5J6HB 1KT2B 1LVEA 3AREC 3TT1H 4N1CA 1SEBA 3DRQA 1ZA3B 2CXGA 5CP7A 5EOQH 4JKKA 4RAVA 3U46B 4ODSH 4ONGH 4NNPL 2D9CA 3AB0C 3UYOD 4Y19E 1NUFA 5HGBA 4PJ5A 3NCYP 1BBJB 3EDKA 2EC9T 3W0WB 1YJDL 1KBGL 2HFFB 4Z0BL 4DFIA 4Y4HC 3MLXL 5DRNB 4D0BB 1CTNA 4YK4C 1YEEH 4RFEB 1UCTA 4PYGA 1RIVL 3GMOB 4EDXA 2WAHA 1V3LA 4X8JA 4Q9CA 3K80A 4MAUL 1RZ7H 4F7CB 4DW2L 1AC0A 3WL9B 1IC7H 4OCXH 3RUGE 3GDBA 4WDIB 1BEYH 1OP5H 4KXZI 2BSTB 3P40A 4Q9RH 1MH5A 4PJCA 3FONA 1INEL 5CHNB 1NCWL 3QUZB 3I50H 2VKXA 2B7DT 4PRPD 3RA7H 1JPTL 1MQKL 1S9KC 5JOPD 4K07A 4WGWB 1NBVH 1R5VB 4LLQB 5ADOH 4LOUC 1ZV5A 4MJ5B 2FGZA 3CVHA 5KG9B 3T4YA 2CMRL 2PR4L 3EYVA 2VLMD 4WHDA 1PVHA 1S3KH 4JFDE 4WTZG 1KYOK 4NNYB 1HH9B 4X80L 3GSXA 5T1KD 5EU3A 3D85D 1OCWL 1QRNE 1I1YA 2P45B 3P11H 3TO2B 3U36A 5I0DA 3VXNA 4L3ED 5HHME 4Z7WA 1HOCA 1E0OB 3MNZA 2R1YA 4KI5C 5J6GB 1ZT4B 4U1IA 3T4AA 3OAUL 4G8EB 4KMQA 2XWJA 2CR6A 4MJ6A 3OV6A 2XG4A 5FA3A 2BMKB 5GZNC 4JR9H 1MLCB 4IRSC 4WI7A 3FOMA 5I1IH 4XBGB 5C0CB 3G6AA 5HY9A 2WLYA 3JV6B 3LKQB 4HBCL 1G9NC 5KS9A 1KB5A 1U8KB 3R1GH 2VUOA 4NWUL 5T1DL 3IDYC 5IKCB 4HMDA 5DS8B 2A6IB 5HHVL 5KVMC 2VDNL 2FX9L 4AL8H 3O2VH 5SX5K 1A1NB 1XIWA 1PLGH 2BVYA 3W9DB 1NSNH 4NDMA 3R4DA 5AUMB 3SQBA 1U2HA 2VYRE 5D7LE 3DTXA 5HPMB 4YDJB 4F15C 3KLHC 4NRXA 4PRIA 1VFAB 4Q74A 4BKLB 1X3DA 4RIRB 1ORSB 3D18A 2YSSB 4XGZB 4QHKI 4HCRL 3WJJC 4JHWH 1OSZA 1NFDA 1OP3K 2Z31B 3TBTB 4ELMA 1J5OL 4Z6AT 4HWBA 5FUZH 1BOGA 1RUQL 1NBYA 3H7BB 3BISA 4JRWA 4JZJA 3OL2A 5C0BB 2EYSB 3REVB 5DVNA 4XNQA 3O4OC 3M17A 2EIDA 5DJYB 1RUPL 4ZYKB 1NFKA 2BJML 4Z7OE 4OFPA 1YMMB 4NKMB 4ZUTA 5H94B 1HZHL 4HQQH 1ITCA 2G60H 3OPZL 2R2HA 1I8MB 2XN9A 3CPLB 4KV5F 5CUSH 4HH9A 4WHTB 1MF2H 1HINH 3DX6A 2E3VA 4GRWB 2XWTB 4IRJC 3QQ4A 2NCMA 3MFGB 4KJQC 4MA8H 3WIIL 4NJAH 2F19H 4N9GB 5IMKB 1XGRB 1QPXA 1UGNA 3I6LE 2VR9A 3KPSB 4OCYL 3BKML 3I75A 5IQ9B 3GIZL 5HHOE 3PWUB 3VFGH 2RBLA 3NCMA 3MRHA 4YE4L 2BCKB 3SDDC 5A40E 1A7PH 2VXQL 3ABZA 4JQXA 2P43B 1IVLA 4GS7C 1U42A 1WC7A 2W65A 3RVUC 3HI1A 5FA4B 1EJ6A 5EC2A 4K71C 2C1OB 3T8XB 1LEGA 3VXMD 2J6EA 3HPLB 4K94H 4R2GC 5DMYA 2Q86A 4BZ2L 1U91A 5JOFB 3SKJL 4UINL 5C0EB 5D96B 3HE6D 2F15A 3W9EA 4K8RD 3UXFA 5IUSA 2J7LA 4M5ZL 4Y1AB 5GGTH 3V6ZA 4LLAA 3ZTJG 2X4OA 5D1QD 3RPKA 4XP1H 3OXRA 1H3PL 5DMGD 3ARGA 2NY2B 1I4FB 4L4TA 4XB8A 5E6ZA 3OKNB 1OF2A 3GZKA 3T0ED 3NA4A 3FB7B 2WUCL 4W68A 2YRPA 5TJWK 4IJ3B 4KZDL 3MV7E 2QQNL 8CGTA 5E2WH 4NQSB 3SPVA 3VXSD 2W9DH 2RIKA 4IRZH 2HWZL 4P59L 3T2PA 4APQD 4LIQL 2HFEB 5C07D 1EGJA 1I8LA 4ZFGH 5F9OL 3KPLA 4YHNB 2PTTB 1QRNB 2FJGB 4ZTOH 4RZCB 1T1ZA 3PL6A 1WJ3A 2JKXA 2XZQH 4BFIA 1GZPB 5ADPH 2CRIA 3K8MA 5JDSB 5EO9B 2IQ9L 3TN0B 1KJ2B 4L9LC 1E28A 5DRWB 1G7IB 2P48B 3LS5L 3QG6A 5FUOL 4NZUL 5GGUB 2H32H 3GMNA 5HBBA 1TPXC 1XZ0B 2HKFH 3C08L 4DAGH 4NPYB 1AIFB 1ZKAA 3PABB 2KZ1B 1W2KT 5DD1L 1OD9A 1VEMA 1MIMH 3MRCB 1PG7L 5CKAA 5E1AB 1XGPB 3EOBA 2NLJA 1RMFL 4NKIL 4S10A 2R2BA 1G7QB 3LPFA 5I76A 1EV2E 2F5BH 5L8LB 5I73B 2NY4B 4ZUVB 2C4XA 1DUZA 5C08B 3UPRB 15C8H 3PHOA 5L2KA 4C83A 5CJOL 3HZKB 1KV3A 1T0NA 3MUHL 5IM7B 5D7JA 3G08A 4MA3A 4PB0H 4AH2B 3BKCL 4YXLH 4MNGA 1RZJC 3OXSA 5AZ2H 1LE5A 2A38A 3WE6A 4O51B 3UYRL 5CLWA 4I9WE 2QKIA 1DQTA 1E27A 3BGMB 2FECI 4YFLI 3BDXA 1JWMB 5DK3A 1NUGA 2DQEH 5SWZE 3JWDC 1WCBB 2CIKA 4MA7L 3RZCB 4KVCH 4XXCC 4IEFB 2JCCB 3RZWA 2X44D 4PRHD 3ZDXE 3WIFB 5EOTB 1F97A 1GGIH 2V2XA 1K3ZA 2LU4A 3U2SB 3TVMA 1PY9A 1VDGA 1KC5H 3FQNB 4F37F 4ZPTA 5C86A 2QQQA 2FIKB 1MWAB 3O4LA 4NO2B 4K7PH 4ZO8A 3QFDB 5IFAH 3ORJA 1IGFL 2CIIA 3LEVH 1YJDH 3A6BL 3GSNB 1XR8B 5D2LA 4Z0BH 2J8UF 3DGCR 3VGFA 3MLXH 4LF3A 4U05A 3MA7B 4G8GD 3V4PL 5IVXE 3MLSL 5FAAA 2YPLE 1RIVH 5HHOB 4Q0XL 3QFJA 1H15B 1FL3A 4S1RH 3KR3H 4MAUH 4DW2H 4PGEA 3BPOB 3DRTA 3HAEH 3SGKC 1C08B 2EDBA 3JV4A 3DV4A 4W6XB 5IB2A 1KPRA 5F7NC 5BJTB 2Q20A 3LKOB 4LSQH 2Y07H 1BWWA 2IF7A 3MV9A 3GO1L 2VLLA 1T03L 3L3IA 1INEH 4YHOL 1NCWH 3KYAA 5F89A 1TMCB 1JPTH 1MQKH 4I2XE 4M6ML 5CEZD 1U8QB 2ATKB 1GCFA 3MRKB 2CMRH 4ODUA 3BPNB 5I6XB 2PR4H 5HXMA 2QSTA 1N2RA 2VIRB 2OR9H 3T1FB 1NGWA 5SWQA 3QO1A 4X6DE 1RK0A 4X80H 5FB8B 4U1MB 3VRJB 3SDXF 2AI0H 2RHEA 1L6ZA 5D2NA 1BQHA 2B1AH 3DARA 1X6LA 5FYKD 1WFOA 3RIFK 1FYTB 3VWJD 4CN4A 5J89A 3HE6C 5EU7E 3OAUH 2IANA 3MV7B 4GRLA 4K8RC 4H1LG 4ZTPL 3U79A 1HNFA 5E5UB 4HJGB 4NHCH 2ATPB 5D1QC 3X12A 3ULUE 2AABL 3HI5H 3L5IA 4QHLB 1HYSD 4HK3N 5DMGC 1T22A 4HBCH 3VGDA 4JFFA 3LQMA 1Z9MA 1OGTB 1R3HB 4MD0B 4ZAKA 3UAJD 4MD5B 1U3HC 4R0LC 2VDNH 3VGAC 2FX9H 4KC3B 4UTBL 4OJFL 1A21A 3D39A 2IALB 3OF6A 5DRZA 1X5FA 1WZKA 4NFCA 4Y4KB 4APQC 1A22B 5F7DA 1T2QL 3PQYD 4QRUA 1RI8A 4MXVE 4U0RB 4LDOB 1FE8L 2YZ1A 5FCSH 5IW6B 4HCRH 2ZUSA 3TCXA 5HJ3A 5B3JF 1HHHA 4XHJD 1XEDA 1RUQH 1BVKA 2ERJC 1KTLA 1DANT 3FB8A 3QDGB 3SHSA 4Q7DA 5D7IB 2VDLH 1NLBL 3ARFB 2HT2D 2ICWB 3VD9A 2I5YL 5ECJE 4FQXC 3S4SG 4X9IA 5I8CB 1EIBA 2VE6A 4Y2DA 3QCVL 1G0DA 1RUPH 4OZ4A 4HPOH 4ZFFB 3AFLA 1YY8B 4HIEA 3ZMRA 9CGTA 4KKNA 2D31B 3D69A 4GAYB 3TGXA 3MOAL 4PJ8A 5I16B 3OPZH 3X17A 3VFSA 2ID5A 5C6TL 1VGKA 4XPAL 3VE0B 2ILLA 3RUGF 3HN3A 2NPLX 4Z5RA 3BUYA 4MAYD 2KKQA 4JDZB 1A6UL 2ZPKL 5E24E 4ZSOA 3MCKB 4QRPD 4P48A 4QHUA 4A6YL 3GM0A 5DD5L 5GS3A 4L4VB 4HWZA 4W4OA 4OCYH 1J0YA 4DGIL 4ZXBC 3DBXA 2RQ8A 4ESKA 5CEZL 5J12C 1L0QA 3RWDA 4KTDH 1RJCA 4JG0L 2XA8L 4B7IA 2WP3O 1CFSB 1OM3L 4IMLA 1CD9B 4EUPA 3TH4T 4ODVL 4PP2B 1FZKA 4X7SL 5E9DA 5IVXB 2HVJB 2OTPA 2DLTA 4BZ2H 2XNAA 4YPGA 5CWSA 5DMJB 3KS0J 4RFNB 3SKJH 3MV8E 4JO1L 3M1BB 1J1PL 5IJKC 3BGAA 3EZJB 3QXAB 4BH8B 2BDNL 4EDWL 1FZJA 1LEKA 5GRVL 3SKOA 1J8HA 3NACH 3GSRB 2JK5A 1Z6JT 5DI8B 1H3PH 5CLTA 2FSEA 5IOPB 1GHFH 2E9IA 4TQEL 5E4EC 3DYOA 1CE6B 1B9ZA 3DXAB 4X6BB 4WFFE 5CBAB 3WYRA 1TZHB 5HD8D 4KZDH 5ESQB 2O61A 1GXEA 1NC4D 2QQNH 1SY6A 4M6NL 3UTTE 1EHXA 1HHJA 3GB7A 4KJYA 1KLGA 2H2PD 4PJDB 4HK0B 1YN6B 2LAAA 5F9OH 3I3EA 4F57H 1KACB 3BIKB 3VMOA 1CWVA 1JPSL 5EBWA 3PGCB 4PJBE 4G43B 4DOHE 1L7TL 3VH8G 2IQ9H 1CR9L 4WW2B 5DQJB 1S9YB 1FNHA 3OHXB 4CMMA 3B43A 1AI1H 3EFDL 1H0DA 5I9QB 3BWUC 5FUOH 4NZUH 1XF3B 1P7QD 4Z7OF 3MLWL 5LBSL 3C08H 4GQPH 1OT2A 2EDTA 5DWUL 3VWJC 5DD1H 3E3QE 1IEBA 3MRDB 3SJVB 1ZT7B 2VLKA 3KG5A 2YKLH 5FCUL 3WO4B 2GJ6A 2EO9A 4NKIH 3CDGA 5CIPH 4BZYA 3FAXA 1T2JA 1OAZH 4PJFB 1A7BA 4H5SB 3UJIL 3EDJA 1V7NL 3UAJC 2Z92B 5I75C 4JQVC 5CJ5A 4N8VA 4WUUA 4DZ8A 5EA0L 3QI9A 2J8UA 4NO0D 4LSRL 1S7QB 5E2VL 2ZZUT 5BRZE 2E6QA 3ARRA 3MR9B 1PFCA 2WM0A 3GJFH 3FB6B 1IGYB 1PQZA 2FO1A 5GGRB 1IM9B 4E5XB 1BZ9B 4R4ND 1IAKA 4RDQG 3B4NA 2EYTA 3RWFB 3CZFA 3TBWA 4MA7H 4XHJC 2GK0B 4X9GA 4FQJL 3D9AL 2VWEC 3C5JA 2IH1B 1LO5A 5FV1L 4ZPVB 3NZHH 5I1LA 2ZJSL 4J1UA 4OLEA 4R4FL 3MJ7B 4JN1L 3NBNA 5JPNA 1EH9A 1HYRC 1TVHB 5CMAB 3JTSB 4FFYH 3WS3B 1MFEH 2FHCA 3SDXA 1MY5A 2DQDH 5CFHA 4XMKL 5CP3H 3K46A 2Z31A 1MNUH 5ITFA 5EU5A 4Q0XH 5MENB 2JJSC 1A8JH 3LDBB 1RIUH 4NN5B 2Y36L 3EYFA 4MAYC 3REVA 4NT6B 1D7FA 4V1DD 2BX5A 1S5HB 4FQQB 3LIZH 5BV7C 4KWUA 3GO1H 1T03H 2CLVB 3FKUS 4P4KD 5IVOA 1D9KA 1G7PB 3EJZD 1RJLA 5E8EB 3LN4B 3VFUA 1I9RL 3KVQA 3KDMB 4XI5D 4BFEA 5DJ6B 3PIQA 1IQDB 1IGJA 1SJHA 2LU3A 3O3EB 2APXA 4LSVL 1UACL 3BT2L 5EBMA 1JF1A 5FOBA 4HSQA 2GSGB 3ARPA 4RNRB 4YEEA 4PY7B 5HYJD 2BHUA 3GBNH 4LCUB 4P49A 3V7AG 1I8IA 1MCJA 4J23A 3RWJA 4OCWL 5JMOC 1PZ5B 4NRYB 4YHYB 1MHCA 4ZTPH 2VDOH 5TDNA 4Y19A 3IFLL 2NTSP 3RNKA 5JW5B 2AABH 5T3XD 1QFUL 4QLRA 3WD5L 2DLIA 4W6WB 1RQ5A 2R2EB 1BIHA 1QFOA 4KK5C 5DJXB 4XP6L 2P4AB 3ZTJH 1TCMA 4D3CL 4JFOA 3GBLA 1H3GA 5HD8C 2BVQA 1LK2A 5I1AA 4PJBB 3UTZB 1TTFA 4UTBH 4OJFH 3NFSL 1QR1B 1CU4L 2BC4B 3QRGL 2DLGA 2H2PC 1GPOL 3PDGA 5JNYA 1T2QH 3RUGA 1DN0B 3F12B 4HH8A 4OFYD 1J0KA 4S0TD 3MCLL 1IGTB 4NQCB 3ZDXF 1YYML 2ZP0T 3H42L 2YPVL 4I0PA 2HJFB 3VFOA 4EOWL 4IHOA 1NLBH 3AM8C 2KZWA 5CEYB 1T83C 2FH8A 4XCEA 1RZKC 4Y5VC 2F53B 5FUCE 5DZNA 4JCLA 1D6EB 3QCVH 5KAQF 4XBEH 4KVNH 3WNKA 4JFDA 2LQRA 4Z7NE 3MOAH 4ZFZB 2I9TB 1U0QA 5GISL 1JNHA 4P9HL 5HTSA 3O3AB 5IVXF 5C6TH 4LLWA 5EO9A 3TN0A 3TO4A 2VJXA 2SEBB 1YY9C 1FVEB 5DJDA 4J7RA 4RMTA 1A6UH 3ZYOA 2EDNA 3STZA 1KN4L 4JPIA 4F58L 4A6YH 3KJ6L 1FGVL 3EDFA 5DA4A 6FABL 4TSBL 3BYTA 3O11A 2MOVA 2D4FA 4YO0A 5GS2D 1N4XH 1DVFD 5FGCE 1HE7A 2R23B 1H3WM 5D7LA 5GGTA 1V8HA 3BYYA 2P8PB 3QDMD 1G7JA 1AQKL 2XA8H 1IJ9A 3FHAA 3RWHA 1OAXH 4WU7B 1JTPA 4X6DF 3QEHB 1ZHBA 4P2QE 1CGSL 3DUUA 3VXUE 2RAMA 5EC1B 4JZJC 4X7SH 1JUFA 3ZDYE 3VFRB 4DGVH 4UDTA 4RWYH 3TF7C 5DVOA 2E27H 3O8XD 4UBDD 3DMMB 5JW3L 4YNYA 3P77A 1X5HA 4JO1H 1J1PH 1T5WA 4BJLA 1E4WL 4P2OB 4ISVA 5IMLA 2BDNH 1Q1JH 4FTVE 2HLAB 3ULUF 2EDLA 2R1XB 3BO8A 3VFTB 5BQ7B 1QFWL 4QT5B 3GUTA 4TQEH 4YDLC 1YECH 1P4IH 3V5HA 2FNBA 1E4JA 3PHQA 4PV9B 5DURD 3L6FB 4Y4FA 5B39A 4FRWA 3Q6FB 2XRAL 5CAYB 4KROB 2X4PA 4K7FB 4MXVF 4AIOA 2IH3B 4P4KC 4FQHB 3EJZC 4DN4H 3OTTA 1JIBA 3ZL4H 2X4RB 5IW1A 4OIBA 1JPSH 2W60A 1EXUB 4XI5C 3PWNA 2VDQL 2APWA 1CR9H 1MCFA 3TCLB 5T1MB 1SM3L 2WQ8A 2NY5L 5FO9B 4JN2B 3EFDH 2R8SL 3TM6A 4Q6IB 5ENWB 3MLWH 4LEXL 4MQTB 4ZO7A 1ZSDA 5LBSH 1T5XB 4U2YA 1OP5K 1D5XA 3C09B 1NJ9A 5HGHA 1ZXQA 1MHEB 5KANI 1U41A 5DWUH 2F9BT 3MYJA 3LQAH 4LAQL 3P9MB 2WWMD 4YBLB 3JWOH 1JGVH 1NBZB 4UNTA 4Q58C 5FCUH 1I7RA 4AEIL 1CICD 5CGYD 4XTRD 1DLHB 2AJXL 3PNWA 1CD8A 1ZGLA 4H1LH 4G8FB 4L8SB 5LXGL 2YMXL 12E8H 4XCYB 1MUJA 1V7NH 1K8IA 1OVZA 3DUSB 3OB8A 2EE6A 4HAFA 5EA0H 3PG2A 4WNQB 5E2VH 2UYLB 2Q6WB 1MCOL 3RVTD 3H3PL 1P4BL 1W0VB 3T77A 1MHHB 3QDJB 3MV7A 4WJ5A 5JQ6H 4HJ0D 4WFEE 4LGSB 1NGZB 4Y16B 2HP4A 2A77L 1CXIA 4HJGA 5J13B 3EDEA 4M4PA 3AAZA 3PL6C 2XTJE 4JKLA 4O2CB 4HHAA 5IEKB 2GUOA 3U0TB 4GMSL 3SY0A 4PJEE 3D9AH 3EO9L 4OAWA 3HAEA 4MJIB 1UXWB 2ZJSH 4JY6A 1AD9A 1FFNB 4G9DB 4K3GA 4NQVB 3BN9C 1AGBA 4ZO6A 1QQDB 3FT4A 4R4FH 2MQ3A 1G9ML 2IQAB 2YD4A 4JN1H 1BHGA 5I1HL 3V8CA 1ACYL 4YDVA 1RK1B 4YAQA 2YOCA 5FYJL 1HNGA 1Z5LB 3BW9A 4EIGB 1D5BB 3QWRD 3HFML 4XMKH 3C6SB 3MBXL 1MCCA 2FL5B 3HE7D 4CL7A 4EQ2A 3WJLC 2D7TH 4LVOB 1CYGA 2EO1A 2NY1D 4KHTL 4HLZG 3QSKB 4GAGH 2Y36H 4A2MA 5DJZB 2PF6A 4PG2A 3MLVL 1YNTB 4PR5B 4UT6L 1NPUA 1NMCB 3EO0B 4GQ9H 4ZFFA 2PW2A 4X4XB 3BP6B 3Q5YA 5D7JC 4JLRB 4P2QB 5C7XL 5DJAB 2FJHB 2NX5A 2QR0B 3TIEB 1DVFC 2AEIT 4PJBF 3F7VA 3MBEB 3DVGB 2R1WA 3QXVA 3ECBB 3ARZA 2QADD 3ZLQC 3RL1B 1KCRH 3EGSB 3I3DA 3OG4B 3ROOB 2VNCA 1UACH 3BT2H 1YMHA 1OW0A 3QIBA 4X5WA 5SWZA 3VJ6B 1BJMA 5KSVA 3P0VH 1IL1A 2RFXA 5FYLE 3C60A 5CD5D 3G5YB 4UBDC 4ZG1A 4JHBA 4POYA 1JGDA 1Z0MA 3H9ZA 5F9WB 4OZFG 2CKBB 5F88A 1HHGA 3GSUB 4QRTB 3GFUA 1QFUH 3HMXA 4IOIB 3WD5H 2HVKB 1SJEA 5C8JB 2PYFB 1H3XA 3PWVA 4QOKE 4TUKL 4XP6H 1IT9L 2DYPA 4HFUL 4RCAA 1OP9A 1IM3A 4G42B 4FXLA 4N0FB 1ERNA 2YPLA 1CU4H 3QRGH 4X83A 3PHSA 2ADFL 3R0NA 1NGQL 1FN4B 1MCPH 1I8KA 3QXAA 1FFOA 5T5NG 2UZIL 2CK0L 3W0WD 2FBOJ 1AQDB 3GIVA 32C2A 2ZUTA 1DFBH 4CJ0A 3EOAA 2NY6B 5DD6B 1XCQB 3KPPA 1XGQB 1YYMH 4W4NA 1TVBA 3HB3C 3ZKXB 3KXFB 5IR1A 5CSBA 1K6QL 1Z0NA 2YPVH 5GSRB 1QNZL 4EOWH 4I2XA 5BS0E 3ME0A 4P3DA 5I30L 1LO4H 3U9PL 1FSKB 3JXAA 1OHQA 1TZHA 3ROLA 1FVCA 5EU4B 3MUGB 4ZOEA 3LQZB 3OKOA 3ZKQD 1BMGA 1DCLA 4X6DA 4R97C 4PV8A 3TJHC 3HCVA 1DQQA 2WWMC 2NXZD 4MQ7A 5GISH 2VSDA 4P9HH 1CFTA 2P8LB 4GRLC 4XP9H 1CICC 2EDEA 5CGYC 5K9JL 1EEYB 4ELKB 2R4RH 1DJSA 4NM4L 4NUJA 3LV3A 2H3NA 1JWUB 3RGVB 1ZLWH 4F9PC 4FZEL 1KN4H 4C55A 5GGVY 4F58H 1FGVH 4PJ9B 4CJ1A 4PJEB 6FABH 3UC0H 3RVTC 5EIIA 4CADA 5HPOA 4HJ0C 5MI0C 1FP5A 1NCUA 3MGTA 4ZUWA 1TJIL 2DLHA 1B4JL 1OAQL 5FYLH 3UBXA 3RWIB 5IHLB 3OR7A 4YHZH 2A6DA 2Z4QA 4KHXL 3PF2A 1AQKH 3BD3A 2GIYA 5F1NB 5C0CD 1KTDB 5E8OA 3FO2A 3UTSA 1OL0A 3ULVD 2XG5A 1CGSH 3I2CL 1K5NA 3QUML 2C9AA 4XPHL 2CLRB 1HHIB 3SDAA 2CLZB 5F6IB 3GSOA 1KIUA 1LD9B 2PO6B 3B9KB 4K9EC 3TH2T 4TUOB 4NHUB 4Y2DC 4U6VL 4BQ8A 5JW3H 5IFJB 1DN2A 2I07A 3P4MB 4PUBH 1IM9A 3DX7A 3V0VA 5B8CB 3TFKD 2PTUA 4M43L 1GOHA 4BZ1H 3RWFA 3FTGB 2VL4A 1QFWH 3KLAB 2PXYB 3G5XA 4Z7VA 2NY1C 5MEQA 1QSEE 1BREA 3GMPA 3SCMA 5IIEA 3B5TA 1BIIA 3MRJB 1LNUA 2XRAH 4RAUB 4D8PA 5JW4N 1MAKA 4YUEH 3NIFE 1CLOH 1R3JB 1YMMD 3SDCA 5HHNA 4GKNA 1KCLA 3MV11 2W1NA 2N56A 4A2LA 3H9SE 4KI1A 1U8OA 4OBRA 2JJWA 2YA0A 3DSFL 4DKEL 4F3FA 2X4NB 2NY5H 4RGOH 1I7ZA 5HDBE 3S8WA 3ARWA 4WI6A 1A9EA 5AAWA 2R8SH 1N64L 5EOCL 2OI9C 3WS6A 1FH5L 3WBDA 4LEXH 1A3RL 3OX8A 2BNQB 2E5EA 4Z7NF 3GMRA 1BJ1H 3UO1L 3KPSD 1W0YT 2I26N 4LEOA 1HSAA 2A9NH 1WAAE 3KPTA 4LKCB 3E2HB 4BUHA 2P8MA 2L0DA 2PNDA 1EFXA 2Q76B 4N1HB 1XGUA 4AEIH 2YD8A 5JXEA 1AO7D 2YXMA 1MVUA 3MV8A 2B4CH 2F54D 4UAOC 4GRMA 5E2TH 4YXHH 1QA9A 3CCHA 3MRLA 3G6DL 3VCLB 1AXSA 1SJVA 3D6GA 3E6HB 4HIXL 3NMEA 2LABA 5GS0D 3KYOA 3IJHB 1JYWA 1A2YA 1MCOH 3H3PH 2APFA 4PG9A 1AGFB 1SVCP 2PW1B 1QLRB 2BNRB 3OKYA 3UTTA 4XNMB 2A77H 5DJ2B 4ZNCD 2BXZA 3IDIB 4Y1AD 4N5EC 1WBZB 1OTSD 1ODAA 1FVDB 3BH8A 3DURA 2DM3A 1JF5A 2NY2D 4OF3A 4MVBC 2VLJE 4ODTH 3FT2A 4PJBA 3ZDYF 4JZNB 4BH7A 3DHMA 1RUAH 1QTYT 2VQ1A 1FNGA 2EIZB 1ACYH 2XZAH 1T7VA 3D2UB 5D1XB 5FYJH 1IEHA 5JLZA 5C92A 3QUZC 1EEQA 2DS4A 4ODBD 4UIMA 4Y8DC 4X4ME 5HGAA 3TP4A 1FJ1B 4YLQT 5DMIL 4KTEL 4O58L 1QRND 5IB1A 3NFPB 3CNKA 2CGRH 4XPGL 5HHQB 1F2XK 1A6TB 1F11B 1UKTA 2ZSVB 5F1SA 5J1SC 5B38A 1C12A 3VFPB 1NDGA 3RPIB 4HUUA 3RX5A 4AZ8A 4UT6H 1Q9KA 1XCTA 3NABH 4JDVB 1CDGA 4W70A 3ZE0E 5M7QA 2ICEB 2UY7A 4P23A 2KDGA 5C7XH 1ZA6A 3H9YA 1KB9J 3QA3B 1YEDA 1L7IL 1HXMB 1W72L 3CLFL 3F7RA 5BRZA 3V95A 3ARDB 5F70A 5LQBL 2EDJA 1VGEL 2ZG2A 2Y1VA 2ZNXA 1UJ3B 3O2DA 5C0IA 5ICYB 4JPKL 4FXGB 4P9ML 2NY4D 5AD0B 2H32B 3ULVC 1A0QL 5C08D 1N6VA 5IEHB 1QACA 4UTAL 5KSAB 2BVOA 3O41A 3C6LD 1EMTL 3I3BA 5KSUB 1EO8L 3BWAA 4TUJA 4GW1A 3ISWA 2C3VB 1BECA 1UM5L 1JMZA 2YUWA 4TPRL 5CILL 1A7RH 4QHNB 2AXJA 2R0LH 3TFKC 2R23A 5EO1A 5GXBB 1F8TL 1N5YL 4ONHB 5C0ND 2GT9A 2Q7YB 1NAMA 3BUTA 1ZLVH 1E4XL 2Z31C 5E2UH 5IHZA 1FRGL 3D5OF 3RZCD 4TUKH 1IT9H 3RAJL 4HFUH 3G5VB 2LVCA 4R26H 3BH9B 4QRQA 1BFOB 2HFTA 2AJYL 4OZIE 1JK8A 4F80A 3BN3B 2ADFH 1DBAL 1RJYB 3BEVB 5AYUL 4CW1B 1EEZA 3EUUA 4LL9A 3BESR 1NGQH 1T0MA 3VFNA 1BF8A 1TZIA 2GI7A 4KMLB 5J0BA 2UZIH 4YQXL 2CK0H 2HLAA 1YPZE 4HC1L 4BSWA 2M1KA 2WUBH 3WUWG 3CH8A 4PJEF 4PRPE 4QTHB 2YBRA 4GKZA 5JOPE 4X5LA 1K6QH 3L3KA 1QNZH 1T20B 5I30H 4PV9A 3GMMA 5JW4R 4NSKB 4WV1A 3SBWA 3FQUB 5TF0A 2VLME 4MX7A 3BZFB 4AEHL 1IKFL 3FN0L 4FQIL 3SOBL 2VB5A 4U33A 5ICXA 3TV3H 1Q72H 3GSQB 4L3EE 2Q87A 1A7QL 3VFVB 4R9HA 4ODWB 1A6WH 1CL7H 3UJTH 4HUXA 5K9JH 4HJJL 5J3HD 3IFNL 4LHQB 4QGTA 2XWBB 1BWMA 3HC3L 3RNQB 1AHWA 4PGBB 1I3RB 5K9KB 1YEFL 5CGTA 1G1YA 4DZBA 5AG9A 2D0FA 4Q2ZB 4Q6YA 2VXSH 4BSVB 4FZEH 4HUWB 4JKMA 1REIA 4D9LL 3OR6B 1BVLB 1RZIA 4HZLA 1MCEA 1MHEA 4EKXA 4E0RA 1DE4A 4J8RB 1V3KA 3P9MA 4PRDB 5L7XL 1FYTD 2ESVB 4XNXL 3V6OC 1TJIH 4Y5YB 2DKMA 4MGXA 5ICZA 2FGWL 5DDHB 3U0PB 1MPAL 4X9HA 1F6LL 1CDHA 3P0YL 4KHXH 4M1GH 1T4KA 2EDHA 4LIQE 1OTSC 4PPTA 5DYOB 1FDLL 4NZJA 4FFZL 2OJZL 4BELD 2NY2C 2WBWB 1CG9A 5DO2D 2XZCL 3OMZA 5JUEL 3HZYB 4O9HL 4I0PC 4M9OA 5IBTL 5FO7B 5ISZB 4WNQA 3JVGA 1LHZA 4U7SA 3SKNB 4Y4KD 4OGZA 4P5KA 4RX4A 3GJFK 5MEOB 3V52H 6CGTA 4ZS6D 4P57A 1HI6B 3L3HB 3O9WA 5EUKA 4GKSA 4YHPA 4G6KL 1K3IA 2JTDA 2Z8WC 3EKCA 4XCCL 1DP0A 1ZHKA 3TN0C 3GSWB 5AG8A 1BJ1J 3QDGD 1IEAB 5C0GA 5H35A 1O7SA 2HTKC 3ARFD 1ZEAL 2YC1A 1AGCA 1MWAL 1MFCL 4FFWD 3ESVF 1K4DB 4HLZH 4MCZB 4YIQA 4QTIL 4LBEB 2XQYG 3DX8A 4HIHB 4LP5A 4LKXB 1Z5LA 1GC1C 5EORH 2R0ZL 2VAJA 3TPUA 3DOSA 4H20L 3C8DA 4Z77A 5A16B 4EN3B 1H3UA 1XH3A 4UT9L 3ARUA 4NQDB 2DL2A 4DKEH 4FABL 4I3RH 4N0UE 3EOTL 3KPQB 5I73C 2NY4C 3FFDB 5KVGL 5EOCH 3GBML 5GSVA 5DC0A 5KVFL 1UADC 5DK0B 3L95B 5J57B 1A3RH 5EG6C 4M8VA 1F3JA 4L4VD 5I8EB 4P2QA 5KN5B 3UO1H 3VXUA 4LHUA 5DD0L 2IBZX 3VXME 1X7QA 4DVBB 5KW9H 4MD4A 2XKSA 4OZIB 5A2LH 5E6YA 5C0NC 1N6UA 5BVJB 2AQ3A 1X5ZA 4XWGL 1XFPA 5D1ZB 2NW2A 4OZFH 2X4TB 4FTVA 1YEGL 3N1PC 3RZCC 2VZUA 1NCT