2DI7A

Solution structure of the filamin domain from human bk158_1 protein
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
124
structure length
124
Chain Sequence
b'GSSGSSGETGGERQLSPEKSEIWGPGLKADVVLPARYFYIQAVDTSGNKFTSSPGEKVFQVKVSAPEEQFTRVGVQVLDRKDGSFIVRYRMYASYKNLKVEIKFQGQHVAKSPYILKGSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BK158_1
publication title Solution structure of the filamin domain from human BK158_1 protein
rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 4
structure length 124
sequence length 124
ec nomenclature ec 2.4.2.26: Protein xylosyltransferase.
pdb deposition date 2006-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00630 Filamin Filamin/ABP280 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2di7A01
3DYMA 4OGYH 4QLRA 4Y19E 3TNNB 1QNZL 1DCLA 1QA9B 3D2UA 3QG6B 4NZDA 4OLVH 3TPUA 1T1WA 3TN0C 1MJUH 5D7LB 5L7XH 3UTQA 3T8XA 1K9TA 4KMQA 1Z0MA 3S98A 3L9RB 2HVKB 3TEUA 3I02A 4OCRH 5DA0B 1ERNA 4RBPH 4LCWB 4K7FB 3RDTC 3UPCA 1DQMH 1VACA 4LCCA 4UDUB 4ODHL 4ODUB 4E5XA 3U0PB 4QF1A 3QEQB 1K2DB 4D0BA 4OCXL 4ZFFA 4U31A 1QR4A 5FCSH 3JV6B 2F15A 4HUUA 3BT2L 1YNLL 1ORSB 3NPSC 4WHYH 1JPST 4HPYH 4X6CE 4MX7A 1CK0H 2L7JA 3HAEG 5DRWA 2P8PB 1DQJB 2D9QB 4PJCF 5IG7A 5FYJL 4ZPTB 2FO4B 2GK0B 3PGFL 3MYJB 4YDKL 3VFPA 2VLRD 2YK1L 12E8L 5HXMA 2XTJD 3B9KD 3HC3L 1ADQA 1A22B 1L6ZA 1D5MA 2YC1A 2XNAB 2XN9D 3L7EA 4L1HA 2ID5A 1IMHC 2YR3A 3BAEH 3EYVA 5SWZD 4LU5H 2VDNH 4L29A 2AK4A 4IMKA 5IQ9B 1JFQL 2HFFB 2GTZB 1KC5H 2EDRA 1XF5A 1ZHKA 4F33B 4H0IA 2A0LD 3IVKA 3RZCC 2DI8A 1DEDA 1HSBB 2HJKA 1MFEL 5DVLA 5I1AA 1B0WA 3VXUA 4JFXB 1UM6L 1ZSDB 3S37H 3H9SB 3I9GL 3BH9A 2EXWD 4H8WL 4P5KA 1A3LL 2P5WE 1I7UB 3IDGA 2UWEA 3QDME 5K59F 1U41A 3BKJH 4RFNB 2NW3B 3K2UL 5DK0B 2HYMA 5CJOL 3K8MA 5F7EL 1QBMH 3WN5C 2KH2B 1I7ZA 4XP1H 5GXBB 4JE4B 3TA3C 2BNRE 2E9WA 1PX3A 4K7PL 4U3HA 1DBMH 1VFAA 3N1GC 4GAYA 4I0KA 5I15H 3C87A 4MNHB 5F7YC 1UT9A 4ZTPL 2ARJQ 4MCYA 4HGWB 2Z31A 1HZHL 3H3BC 1SBSH 1KIPA 5IMOB 3LS5H 2AJZA 1VPOH 3NCEB 4QTHA 4HX1B 5FOBB 4HS8H 5I8KL 3V6ZB 4YDLC 3MV9B 3X3GH 3ZE0E 4AIOA 1KPRA 4RMQA 4CRPA 1Z9MA 3O81A 3DPBA 3BIBX 5HDQL 5CBAB 1A0QL 5EBWA 1I9EA 3FT4B 2NW2B 4UBDD 3FQNA 3L3KB 4YHPA 4WFEE 3N06B 4X6DA 5ANME 4XCNA 2OQJA 1UACH 1WITA 4CW1A 3VGAC 1T3FA 2VR9A 1YMMB 1BVKA 5I71C 1QVOB 1CXEA 3KPRD 5LJYH 5D8JH 1H15B 3LN9A 1P1ZB 4OM0L 3RP1A 4LPWA 4JZNA 1A9EB 2EKJA 5GJSL 4J3UA 1WBZB 4FQXA 4GH7B 3VXRB 2NQCA 1JRHI 4RFOL 2MQ0A 1AC6A 1UG9A 2AEPL 2AQ2A 4FS0A 1R3HA 4HLZH 4Q2ZB 1UZ6F 3C8KA 5FA4B 4S1DC 2DQTL 2OZ4L 1CDUA 1NBVL 4X8JA 3QQ9C 1LE9A 5EZOH 5I6XB 1RAMA 1CDCA 1NBYB 5DD0L 3MFGB 2AEQH 1KB5L 1AO7A 5EIIB 2HJFA 1TZGH 1G0XA 2D9CA 5EU7C 5CEZL 5CZXD 1BQSA 3KYOB 3GHEH 1JTTA 3ARBD 1BWWA 4K3JH 1IILE 2LAAA 4L4VD 3O8XA 1F00I 5DRXB 1KULA 3QAZB 1YEGH 2YD8A 4XAKE 5HDBE 2DQJH 4N0FB 2PF6A 4IS6B 4RAUB 2D7NA 3F6IA 4D0DB 4S0TD 4PJ8B 4R3SB 1MEXH 4WUUE 1U8QA 1KTKE 3EDJA 5F8RC 2R8SH 5T3XD 4BUHA 5IBUB 3L1OH 1MFDH 1DTUA 1AGFB 1MF2L 3UAJC 1SEQL 4OFDA 1WT5A 2Q20A 4L5FL 2O5YH 4KTEH 3MLZL 5FM4A 2XZCH 4YHYC 4JQXC 3TJHD 4G9FB 1BJMA 1ZHBB 1DL7H 1FPTH 2DWEA 1K8DA 5I75C 5C71A 4JFDE 5CIPB 2VLKB 4I8DA 5DC9B 4AEHH 1JWUB 4Z78B 4FMKA 5D7IB 2VLJB 2F8XC 3VFUA 4BFBD 1IC7H 3BH8A 1D9KB 1ITCA 1HH6B 4APQC 1BD2D 1G7QA 3NA4A 32C2A 1FNLA 2EDWA 4HZLB 4JZJA 4KXZH 3MXWH 1YEEL 4FFZH 4AY0A 5DJDB 3RWGB 2PXYB 2OJZH 1D6VL 5GRJH 5C0CE 4HIHA 3V52H 5DTFA 1Q0YH 1CT8A 1HSAA 2F5BH 2VDOH 4UT7L 5E1AB 4N8VG 1BZ7B 2DQGL 4HMEA 1IGJB 4K23H 5FHAH 1CFQB 4NQCA 5CFHA 3BDXA 1MLBA 2E9BA 3NAAL 2PCPA 1QLRA 1M7IB 3CVHH 4JY4B 3A6OA 4Y4FC 5CCKL 3WKMH 2EXYC 1T83A 2GKIA 3INUL 3BE1H 2WBJA 5F9WB 3V8CA 4LKCA 5GRXG 4WV1C 3KGRA 4RCAA 3EUUA 1MLCA 2HT4C 5MEPA 3WFBL 4UNVA 4HKXB 2X4RB 1PD6A 2W07A 3CFDB 3C6LB 3KXFA 1F3DH 4U1SA 5D1XD 3SDCB 3BQUC 5I30H 4XNZC 1HI6B 4JFFA 5EZJB 1UZ8A 3QFJE 1IEBB 3MRGB 1UCBH 1ZA3B 2GFBA 2QBWA 4D9LH 1NAKH 2V2TB 5ITFB 2VZUA 1TFHA 2MHAA 2PKDA 2DQUL 1IAOB 1VGKA 2R1WB 2L0DA 4OZFH 3O3DB 5KS9E 2NY2C 5IIEA 1WWCA 2WUCL 1IM9B 2DKMA 3E1F1 2JIXD 1BLNA 1BJ1H 4HDIB 3V7AG 1GXEA 4OQ1A 1EVTC 1LMKA 4OZIB 1JN6A 4Z0BL 4POZC 5HHXH 5DVMA 5E6ID 3SY0B 3QQ4A 1TXKA 1UA6L 5F1OB 3MODL 2G5BA 1NCAL 1GOFA 1KB9K 2OR7A 1MFBH 4DUXA 1IKNA 3TPKA 3H9HA 1P4BH 3BZFB 1KPVA 1K3IA 5GSVB 1TCMA 5BW7C 3LPGA 4K3EH 4IRZH 4LPXA 1PSKL 4HT1L 5IB5A 4J8RB 1JRHL 1UJ3A 1OPGH 1YNTA 1QLEL 4WUKH 1U8JA 1UEMA 5I1GL 3TCLA 4QNPF 3P4OA 3JV0A 4V1DA 1S9WB 3DUUB 3VJ6A 4X9BA 5DUBA 5BJTB 1A7NH 1MQKL 2E9JA 3ILPB 3BMWA 4KRPB 3KNBA 4QY8B 5DEGA 1YYLL 5F71A 3TM6A 5BVJA 1XH3A 4IOIA 5B8CC 2YBRA 2Y23A 1SJEA 1MQ8A 4HGKC 3G6JB 3IXAB 4PRIB 2KPNA 2LQRA 3BEVB 5E00A 3QXAB 2C4FT 4GFTB 5D7KD 4JAMB 3ZHKA 3G5YB 2HLFC 1CGYA 5FK9A 3BRFA 2FH6A 1G7HB 3ULUD 3WIIH 5H2BA 1MJUL 1DVFC 1CCZA 1QBBA 1KTRL 3PNWA 5L7XL 2EDDA 3ZSTA 5E6YA 5DJCB 2EIEA 2ESVD 4IRSD 1JNLL 3C5JB 4OCRL 3CZFB 3QIWC 3MBEC 4M5ZH 5KSVA 1DQML 5IW6B 3VFTB 3ARTA 1EVUA 3WO4B 5ID1A 3DROB 1G6RA 3PDOB 3EYSH 3HFMH 2YN5A 4JVUA 2FX7H 5F70A 3GI8H 4ONHB 1S5HA 2A9NH 1FL5A 3WJJC 5JW5B 4FQLH 4WWKB 3MJ7B 1CFSB 3GMQA 1DDHB 3OG4B 3V6FA 1FYTE 1S7RA 1F4HA 2GY7B 3MRNA 4HPYL 1CK0L 1ZOXA 3T08A 3VWJA 2K7QA 4ZUSB 2R4SL 3ARFA 1UM4H 3UXFA 2QADC 4KXZI 2CLVA 1JL8A 4MLSA 4J1UB 3HC4H 1QEWA 3B83A 1MVFA 3P0VH 5D9SA 5HI5C 2ICWB 1LDSA 3SOBL 5IEHA 2WINA 5AD0B 3TYFA 1INDH 5GISH 5D5MB 4YBQD 4HFWB 2PO6A 2VDNL 3GSQB 5B3JF 5CKGA 4R0LC 2PW1A 4DKEH 1DJSA 3FRPG 4YHNA 4LNRA 5E9DA 5HY9B 2FZ3B 2C3VB 1ZT4A 2FD6L 1EX0A 5H37H 4N1HB 3V5KA 3T65B 1WWBX 1CXLA 4GW5A 2W9DL 1FFPB 1INEH 3QO1A 3S37L 1YUHA 4QRTA 4HIEA 1OHQA 3KPTA 3BKJL 3QUZC 2PYEA 3OKMA 3RWEB 5FA3B 1Z6JT 3BDYL 1QBML 4G6AC 4GUPA 4XP1L 4CVZA 1JPFB 2J88H 5TQ2L 3NTCH 2VL5A 3MMEA 2ADJB 3HTLX 2K7PA 1DBML 4NQVA 5BMFH 4O51A 5I15L 3WNMA 1T2QH 3ULVH 4LGSB 1HOCB 2P8LB 4ZOEA 1XGYH 4GO6B 5T1KB 1Z9SA 5ETUB 1T1ZA 4ZUVB 4U49A 2BNQA 3B43A 2UYLB 3LS5L 3GZKA 5J8OA 1VPOL 5E08L 4HS8L 3PWPA 1OARH 4PBWD 1XGQA 1WFOA 2C1PB 3OKLB 5DYOB 3IU3B 1U8HB 5HHNB 5ID0A 5FF6B 3BIKA 5IOPB 3KLHD 4WU7A 4NZRH 2XPGA 4ZAKA 5TQ0L 3G08B 3T4AB 1ZLUH 1HKLH 2BRQA 1NBZB 4OLZL 1CDBA 1UACL 4HD9A 2DQEL 3W9EA 3ZKXC 5DSCB 1IVLA 3TN0A 5J6HA 3KR3H 3MTRA 3B2VL 1ZHNB 4PJIF 4ZOBA 4R96A 1GC1H 1E4KC 5IUSA 2X9XA 4LIQH 1IAKB 1MCHA 2NXYC 3RTQC 3DX8A 3RDTA 3AROA 1I1AD 1NFDA 4QRRB 4K07A 4FXGA 3WUZA 2V9RA 3ZTNH 1NUDA 1QSFA 2NZ9C 2X4UA 1J10A 3NZ8A 2X4SB 2R2EA 2AKRB 3QUKA 4OZHF 2OLDA 5EZOL 1CU4L 1LO5B 2AEQL 2UZYB 1A6ZA 3ZDXE 1NDMB 5JPNA 1TZGL 1BVLA 1TENA 4OZ4B 2GJ6B 5EUOB 3EDDA 4X6DF 4K3JL 3KPLB 3HN3A 5JNYB 1UB5B 1YYML 5F9DC 2J6EA 1YEGL 3QFDA 3MOAL 5EG6C 1C16B 3LRGA 2DQJL 3RVXD 2AEIT 2BZDA 3AREB 3O45B 4C56A 3BI9X 1MEXL 4FQJL 2R8SL 1D5ZA 4OCWH 5EULV 3UX9B 3NBNA 1T1XB 1MFDL 1QSVA 1DQLH 2JCCA 2X1OA 4M62L 4MWFB 1JYXA 1ZT1B 4KTEL 4F7MB 3P4MB 3U36B 5J7CC 5IV2B 2XZCL 4WDIB 3S36L 3O4LB 1MCLA 2AXFB 4P5TB 1DL7L 1FPTL 2EDQA 3RZCA 4XVTH 2NCMA 4WI7A 3MO1B 3MRMB 4XH2A 2RBLA 1CGSH 4YPJA 1BMGA 3PWNB 1IL1A 5HI4D 1IARB 1VERA 2BVOB 4UV7H 2CIKA 3DO7B 4WTZA 3H7BB 1WFNA 3RWCA 4OLUH 2CO7B 5LGKA 2QLVB 3UPRB 4JREB 3WN5A 1AD0B 3TA3A 1G0DA 3K8KA 5F7FA 1I3UA 2R29H 4Z95L 3I2CH 1KTDB 4RZCA 1ZLWK 1XZ0B 5GS0D 8CGTA 3DMMD 3MXWL 5C09A 4FFZL 4PJEE 3GMOA 4EXPX 3MLTA 2OJZL 5GRJL 1HH9A 2XWBA 3FQXA 1BFVL 1Q0YL 4MA3A 3EYQC 4K94H 4UILL 5FUZL 3V0VB 1RV6X 4HAFA 2VDOL 4JY6A 3C5ZB 4Y5YA 1NGWA 4N9OB 4K23L 3KPNA 4WU5A 3QSKB 1F3JA 3O3AB 4L8SB 4DFIA 4U1IA 3QH3B 5FYLL 5GS2H 2PW2A 2XXCB 4JFQA 5SWSB 1H9VA 1W0YT 4Y19B 3T0EC 4V2BA 3BE1L 2H32H 5KSBB 1GOGA 4N68A 5DI8A 2K9UA 2YZ8A 3I6KB 1FLTX 2DL9A 5FO7B 2I9TA 2HJLA 4TTDD 3GI9H 2R1YA 3UTSA 3SN6N 2F53A 2L7UA 2BCKA 4MYWB 4F7TB 1J7VR 3B2UC 4LHQB 3SDAB 5DQJB 4JPVH 4AK1A 5HD8C 2ENSA 4MJ4A 1A6AB 3UTOA 3AUVA 1RJLB 4HIXH 1NAKL 4D9LL 3C9NB 2FJHB 1TQCB 3HR5B 5ADOH 1YPZA 3ABZA 1KNOA 3NA9L 3W0WD 1KB5B 1ZE3C 3MX0A 4LKXA 4RIRA 3MA7A 4PRBA 5DWUH 1YEJH 5GHWH 4L3CA 1JGEA 1T0PB 3SDYH 4F37F 2VDQH 2FJFB 5KVDH 4EIZC 3VDBA 3MV7E 2YUXA 2Y5TA 2Z0BA 2X70A 3EOBB 4PV8B 4U1MA 3F12A 2VDPH 1EPFA 3NCYS 3HR6A 1IGMH 2XZZA 4YPGA 5HHXL 2FL5A 2B5IB 4RFNC 4OCNC 5T1LD 3UMTA 2Z92B 4KK9C 3TESA 2EIZA 5FKAB 4RMWA 3ALPA 1P4BL 2UUDH 4U6TA 3ULVE 4IRZL 1MRFL 4YGAB 2KUTA 5F7MC 3CLEL 5FGCB 4JQXA 5FGBC 1BIIA 3O6KH 4ZTOH 3KS0J 3MA9H 4WUKL 5KSUB 2CUHA 4JHZA 3VXNB 1JPGA 3FB6B 4NQXA 3F58L 3HNTL 2IAMD 3O11B 5EC1A 1VENA 2GCYB 4RGNB 4IRJD 2DBLH 1JGUH 4LGRB 3QDMB 4WRLA 4M6MH 5L2KA 4M6NH 5LBSH 2AJSL 4APQA 3SJVA 5ILTH 5DJ2B 2Z35A 5C08A 3WS6C 4KKBC 2X6MA 4CAGA 1FIGH 4NT6A 2NY6D 4JRXA 3IKCB 3TBWA 1M6OA 5ISZE 1HHJB 2VLRE 5INCA 5FV2A 3P0GB 3ARDD 3KPSA 1OAUL 3WNNA 4LIQE 4PJAE 4GG6B 4GKZA 2XTJE 4J3SA 1EHLH 3MLUH 1N59B 1QD0A 4HMCA 2XN9E 5FM8A 3RWHB 4BA8A 4H1LA 5D1ZD 1IGYB 5ICYB 5IR1B 1SEBA 3G5ZB 1PW3A 2D3VA 3MOBL 1UKTA 3EYSL 4LSDA 4Y2DB 2ATKB 1Z0NA 3HFML 4OB5H 2FX7L 5GGRA 5I6XC 4F7CA 1AKJB 4Y4FA 2A9NL 3H8NA 3EFFB 4FQLL 4X99A 2BMKA 5EOCJ 3AS0A 3WFEL 3UZQA 1I4FA 1F11A 3WD5H 4WV1A 2F58H 3IJSB 3MRRB 4WFGE 4MQXC 1UM4L 4NPYB 2D0HA 3QAZC 3BQUA 4JRYB 3EO1B 4QOKA 5DEZA 2Y7QB 4FXKB 3HC4L 3LVEA 3QIBB 4PJ8C 5JDSB 2ESVB 5HPMB 3P0VL 1T04B 2HRLA 3KYNA 4PRHD 1F6LL 5FDWB 1INDL 1MHPH 4OD1H 5I76A 4G8GA 1KSRA 5C07B 1F58H 4OKDA 4S1SL 2GEEA 4DKEL 2CLRA 2FYYB 3K7UA 5K33A 1MWAH 4NRZB 4NNYA 4WCYH 3QQNA 3SKMA 3V6OE 5JOEA 3HAEA 1HHIB 3FQUA 3D25A 5IMMA 2IH1A 1PG7W 3S34H 4JCLA 1IM3A 2W0FB 5I8CA 1LILA 3LN4B 3P73B 3GSVA 3VD5A 3D2UD 1WC7B 3EO0B 4AMKL 2I07A 1FFRA 2HAZA 1D9KC 5C0RH 5EOQH 1MHHA 2VDLH 1BQHG 5CMAA 1NMBH 2VXVH 4JVPA 4E0RA 4NQSA 4WUUB 1QRNE 2J88L 3PGDA 1QSEA 3NTCL 3WL9A 3ULUH 4YDVA 2DTMH 3ULVL 4UQ3A 1C5DB 3KPRE 2BRRH 3RUGE 1J12A 3T2QA 5LGJB 2H6PB 3UTZA 1BAFH 2PXYC 2Z8WC 2I25N 5FO8A 4O58H 4PLKD 3N85H 1LK2A 4XTRD 4MJ5A 1OARL 5HBBA 3QUXB 4WY7H 4BFIA 5F96L 2P5EA 2JK5B 3SE4C 5DZOA 2MMXA 1I3RB 1OLZA 4Y2OA 2ZPKH 5D1QB 3SGDI 3CMGA 1S7UA 4A6YH 5B8CA 1TQBB 4NNPH 2C26A 5I8EA 3OX8A 2P7TB 3ARQA 3U0TB 2CJUH 2E8YA 5F1SA 1A6WL 1WSST 2JB5H 1E4WH 4PJCB 5GQBA 3BXNB 3TCXA 2VTFA 2H2SD 3BWAA 5JXEC 5F9WC 4GRMA 4OD3H 5I8OH 5DMYA 1DVFA 4MA7H 4I77H 3KR3L 1M7DA 4Y1AB 5BQ7A 4XI5C 1JJUA 2OR9H 1MRDH 3C6LC 2GSIB 4NSKB 1J1XH 5HJ3A 4D9RD 2HG5A 5C0CB 2X10A 4EVNA 1AR2A 3QIWA 1KTLA 3MBEA 2BFVH 3O2DH 4LIQL 3MLYL 3U2SB 4RISH 3I3EA 1MIML 3HPLB 4S10A 3VFRB 5K9JH 4P9HC 4Q6YA 2AK4D 2XOTA 4CL7A 3ZTNL 1JNHA 1A6PA 4GRWF 2EE3A 4N0UE 1XF4A 3GDBA 4OIIH 5JPMA 1FVCA 3WJJA 4ORZC 3FFDA 1Q72H 3X12A 3WHE1 3VXUD 5T3ZD 4LL9A 1ETZA 4GRLC 5C8JB 1AGCA 4CN1A 5DGRA 4MCZB 3CH1A 4CBPA 3TVMA 4MLIA 5C0BA 3UEZA 4Q9RL 3PJSB 4ORGA 1EEZA 2VN7A 2CK0H 2IC2A 4KJYB 5F9JA 1K85A 1TVHA 1XR9A 3PV6B 3WHXA 1B4JH 3REWA 3CMOH 3N1FC 4KC3B 2DQHL 1BD2E 5DMIH 3CFBA 4GSDH 5KN5B 2Z31D 4OCWL 4LLQB 4NO5B 1J9CT 5B4MD 1DQLL 3B8SA 4ELME 1A7BA 4R0LA 4MXVF 2HTKD 4CMHB 3CAFA 1VDGA 5IVZA 3VXSA 1KLGA 4JR9H 1HYSC 5J3HD 4RWHA 2VXUH 4KRPC 1CGSL 1RZKC 4K8RC 4K2UH 2J5LB 1AFVL 2XG4A 4UV7L 4QXUL 3VRLE 1QQDB 4PP1C 1G9NH 4EN3A 4DZBA 4P2RA 2QQLH 2QJDA 3R8QA 3R8BB 1CE6A 5DD3H 4Q6IB 2CKBL 3WEXA 3MUJA 4HJ0D 5DMGD 5H94B 2R29L 5MENA 3I2CL 2PYFB 4Z76B 1EIBA 3L3OB 4J3OC 4MJIE 3V0WH 2CO6B 1JF6A 5IB3B 1MAKA 4RBPK 1T0MA 4XXCC 1WFTA 4ZUWB 2A6DB 4FQXD 4KJQC 4F7EA 1CD8A 3O41A 4Q9BA 3MNZA 3S97C 3ILQC 3MRKA 2CMRL 4BZ1H 5HYJA 4K94L 5DA4A 2JCCF 3D69A 4W4NA 2P49B 4KI5E 1C7SA 3VXME 2AJ3B 4ODTH 4QWWD 1W0VA 1MVUA 1TZIA 1AO7D 3NIDF 3EOYG 4KKCD 1BOGA 1JF1B 3MRLA 4I2XB 4Z7WA 1ONQA 4WI2A 3P9MA 3MGTA 3QEHA 3R4DA 1IZJA 2DL2A 4RQQA 3ZDZE 4OAWA 4ODWA 3O8XD 4DOHE 3WBDA 2NZIA 2ED7A 2GUOB 1FC2D 1RJYA 5JW4Q 4R9HA 3ULSA 2ZOLB 3CFJA 3GI9L 2YUVA 4N0CD 5K93A 4N5EC 1E4KA 3JV5A 3D48R 2Q87A 1U8KB 4N8PA 4N9GA 4JKMA 3U7YH 1R24A 4PJ7E 2R4RH 3FB5A 4JPVL 1O0VA 1OGAA 4N8VA 2VXTH 4HIXL 4EDXA 2FWOB 2QHRL 4Z0XA 5E24E 5I1IH 3HUJF 4NCC1 1I1FA 2XQBH 4XXDB 4K9EC 3JWOC 3RVWD 5ADPL 3FB8B 3T2NH 3RRQA 4HUVB 5TDPB 3L3IB 4BSVA 5E8DL 2W0LA 1YEJL 3ROOA 5HPOA 5GHWL 4YE4H 3SDYL 2DJSA 2VDQL 4YAQA 5KVDL 4X5WA 3O6FB 3TIDA 5DUPH 5MERA 3DIFB 1C1EH 1H3PL 5JLZA 2VDPL 2EDKA 4EBQH 1IGML 2CUMA 1OAXH 3NIFE 3TO4B 4NRXB 3JVGC 4HAGA 4OGAD 2F54B 3WCYA 3WDIA 3TBTA 1B2WH 4NWTH 3FCTB 4M9OA 3IRZA 5D7KE 2VMFA 1VB9A 5AEAA 3ULUE 2VQTA 1WAAA 2CLZB 3WNOA 5C1MB 4NBXB 1EAPB 4Z7UE 1R3IH 4LDLB 3QWOA 2GJZA 4IJ3B 5DD6A 3B9AA 3O6KL 3ORJA 4JM4H 4ZTOL 1CQYA 1EO8L 2GI7A 1FLRL 1X3DA 4NQCD 3O2WH 4PJXA 1YN6B 1YPZF 4P2QE 2H1PH 1BM3H 4JPIB 1AIFB 2DBLL 4QYOB 1JGUL 1RK1A 1JHTB 1U58A 3EBAA 4ZD3H 4MDJB 3L3JB 2WBJD 1XIWC 4M7LH 4S1QH 2BVYA 4M6ML 4G80B 3TNNA 5IVXA 5LBSL 5ILTL 3ZDYF 4JKKA 3QG6A 5A40E 1IT9H 4YFEA 4UNTA 1KCSH 3GJFB 4BZ2H 5ACMA 4NBYB 5D7LA 2OSLB 1FIGL 3KXFD 5I66B 3E6HB 5IBTL 5T1LB 4C83B 1A7OL 3RX8A 4JFFD 4P3WA 5E1HB 3RAJH 3QCVH 1XF3B 2HVKA 4OF7A 5JZ7C 1OSPH 2VZOA 3S5LG 3SO3C 4OF8A 4LCWA 3M45A 2BERA 3IRPX 3OAYH 4K7FA 1ZAGA 1EZVX 4X9FA 1EHLL 3MLUL 3QRFM 4NFBA 2VDKH 4UDUA 4ODUA 2Y07H 3U0PA 1NMCB 1KJVA 1AHWB 1K2DA 2BNUB 3QEQA 2NY5H 4OB5L 3JV6A 3W9DB 2X4NB 3BYYA 4HC1L 1N5AB 3NFPB 1JWMB 4NKQB 4YR6B 4MHHG 3T0EA 3ZYZA 4MD0A 4HCRH 3WD5L 1DQJA 2ZUQC 5HHOA 4ZPTA 1A1OA 2F58L 2FO4A 2GK0A 3MYJA 5KAQF 5GGVL 1RZFH 2A6IB 3EJJX 5A2KH 1Q8MA 3N50A 1N6UA 4ZODA 2XNAA 3AREC 5J11B 3T2PA 1BBDL 1TTFA 3BHBB 4ZFOL 4V2CB 4Z7VE 3KYMB 1G7IB 3SE3C 1CDIA 4R4BB 1KIRB 5DFTA 1YEIH 1J11A 1MHPL 4OD1L 2F8VA 5B3NA 4LSPH 4KRLB 1F58L 2HFFA 2GTZA 4OZFB 4V1DD 3MCKB 5D1ZB 3I3BA 4F33A 3GB7B 4WHDA 4P5TC 2IMMA 2ADIA 3V5DB 4G6MH 1HSBA 4WCYL 3MR9B 1T6VN 1MELA 5DHVH 5DUMH 3H9SA 4H8WC 3S34L 1TDQA 4D9QE 3VXQA 1I7UA 1EJ6A 4Y5VB 3C60B 3OF6A 4OZGE 3UZVB 2DWDB 4OI9A 3CNKA 4CVUA 4NO0B 4JO3H 2NW3A 5DK0A 5GGSY 1A4JB 3DO3A 1KT2B 3WUWG 4JREC 5C0RL 4WI5A 4LRNH 1X5LA 2VDLL 4Z77B 1NMBL 2VXVL 4R4NC 1H3WM 5EZIH 4GQ9L 2BOBA 2YMXH 3CC5B 2WLZA 4F9LC 4MNHA 3W5MA 4YZFE 4LEOB 4W68A 4HUNB 1BIHA 4HGWA 2BRRL 5IBLC 2AXGB 2DLFH 1NEZB 5FGBA 4WHTB 2RJMA 3U1SH 5E2VH 4O58L 4HX1A 2V9QA 3FRPA 3BN9D 5FOBA 3V6ZA 5BRZB 1RVFH 5A3IC 3MV9A 5DO2C 1JMZA 1BREA 1QFPA 1C7TA 3VG0L 3C5ZC 1XGUB 5F9OH 5CBAA 2ZPKL 1R5IB 1SQ2N 4UNUA 2FB4H 5KBNC 3FT4A 2NW2A 3L3KA 1LNUB 3MCLH 4NNPL 4L8SC 5JW4R 4XZUB 1RUKL 3WNLA 2JB5L 5BOZG 1E4WL 1XF2B 4CGTA 3QUMH 3VWJD 4WHYG 1YMMA 3WS6A 5AUMB 4YDJB 3ARFD 3SE9L 1CFNB 4OD3L 5DQDH 4AIZB 5I8OL 4MNQA 4MA7L 4I77L 4ODVH 1H15A 3P4NB 4HKZB 4JG0H 4L3ED 3VI3E 25C8H 2OR9L 1MRDL 4PJEB 1UVQB 1P1ZA 4R7NA 1JIBA 1CG9B 3BZ4A 1ZLSH 1A9EA 2VXSH 3ARUA 1WV7T 3VXRA 4P46B 2BFVL 4J7RA 4X7EC 2DMCA 4YWGL 3SDAC 3WS3B 2VKWA 3QG7H 4RISL 4HEPG 4Y89A 2EC9U 2YSSB 5D2LE 3THML 2AV1B 2PO6D 5F89B 3TT3H 4Q2ZA 5K9JL 5FA4A 5HYSB 2ZUYA 1TQCC 2AJVH 1UZ6E 1AC0A 5E9DD 1J05B 2QQNH 1NBYA 1FBIL 3MXVH 1J18A 2IQ9L 1O5DT 3F7VB 5EIIA 4GMSH 1Q72L 3GSNH 1XGRB 1A6UH 2AQ1A 1L9NA 4FQ1L 5DRWB 4HF5H 5TGBB 2PYED 3QHFH 5DRXA 1QHPA 4RMVA 2R39A 4BZYA 4JFEE 2CK0L 2B5IC 5ECJE 4KJWD 4IS6A 4RAUA 1YECH 4U33A 4D0DA 5DHYB 4HWEH 4PJ8A 4R3SA 3CMOL 3UC0H 3QB7C 1D5MB 4GSDL 5DMIL 3NFNB 2MSPA 3MLSH 1U2HA 4FTVE 2BNQD 4AIXA 4OF5A 2EZ0C 1B4RA 5L9DH 3PWPD 1YEFH 1OAQH 1ZHBA 2CPCA 3KG5A 3I85A 2YD5A 4JR9L 5EO1A 4ZAKD 3RBSA 5CIPA 1GGIH 4HG4J 3MV8A 2VLKA 1MRCL 4YHIA 1JWUA 4Z78A 4K2UL 4RGNC 5D7IA 4ODSH 2VSCA 4E42B 4PP2B 2FJGB 2X09A 4Q74A 3TN0D 4ETQA 1D9KA 4RRPA 1MCPH 1HH6A 2F9BT 5SWQB 1HQ4A 4X7DC 5K9QI 3SPVB 5DD3L 4I0PC 5IM7B 4PJIB 1ZT7B 1UC6A 2GK2A 1ZLVH 4MXWH 1NUNB 5SX5H 3KVQA 4F15B 1D6EA 4NM8H 4GAYB 3RWGA 5I1HH 2PXYA 4OV5B 3O3UN 3LPFA 2AK1L 3Q6FA 1XFPA 4MCYB 3GO1H 3RDTD 5I0DA 1ADQH 1A7PH 5B39B 2AJZB 2V5SA 3IETB 4QTHB 4BZ1L 1QSFD 5AZEL 3EJZC 5E1AA 3M1BB 2ZCKH 3SE4A 4OZHB 2DYPB 1BZ7A 1IGJA 4ODTL 1CFQA 3QDGE 4MS8C 4HULB 4Y2DC 1JCKA 3R0MA 1M7IA 4JY4A 3W0WE 3K4AA 3VMOA 5JXEA 3REVB 3IXTB 3V5HB 4CW1B 1JHLH 4KV5E 1UGNA 1UCTA 4FG6C 1BVKB 4LLMB 1Q1JH 4HKXA 1S9KC 1BBJB 2WIMA 4R6UA 3C6LA 2KL6A 3MREB 1HYRC 5BV7H 3RJDA 5DFWH 4LCIH 1JZ8A 3RIFK 2IPKB 4IM8A 3T0XA 4C56D 1HI6A 5EZJA 1KLFA 3GSOA 5TDNB 4PJAB 1IEBA 1EEQA 3U7YL 3QIBC 2R4RL 4HHAB 2V2TA 5ITFA 1IAOA 2R1WA 2BSED 1GRWA 1DBBH 5I1IL 4NQUA 2E6QA 3OSKA 3RZCD 4XP4H 4ZSOB 2VERN 4ISVB 3T2NL 1NFIA 2Y9RT 4RSVA 1OSZB 3BKCH 1FYHB 2HJFB 4GRLA 4HDIA 4YE4L 4YHZH 5JW4M 1FFNB 2DN7A 4JDZB 4OZIA 5DUPL 4Z7WF 1BPVA 3GNMH 1C1EL 2A9MH 2APFA 1RFDL 4S1RH 4P2OC 4EBQL 1N5YH 4BSWB 1OAXL 2V5TA 2VXQH 5AYQA 1U9KA 3SY0A 4YHML 4QHNB 3TA3D 1ES0A 3TGXA 3O8XB 4FQIL 1NLBH 1EHXA 2J8UB 5HVFB 4I0CC 5IMLB 3TFKC 3X3FH 2Y6SC 5GSVA 4DGIL 4PS4L 5C09D 3AXLB 3VA6A 5IVOA 5F6HJ 3DHMA 2MOVA 3RKPA 1TPXC 2WWMC 4LHUB 4J8RA 4XC1H 3RWDA 4IMLA 2VKXA 4CJ1A 2FHCA 3QULB 4ZNCD 1RIHL 1A21A 2GJJA 2NY4C 4PG9B 3WFDL 2EEAA 3MJGX 1S9WA 3DUUA 3QUXC 4UIMB 4OBSA 1F6FB 4G7YL 5BJTA 4QNPE 2ZKHL 3ILPA 4GLRH 4I3SL 1ZLUK 5D1QC 3O2WL 1X5IA 4QEGA 2LTQB 1PG7L 4QY8A 2H1PL 5K9OB 1DE4B 1TQBC 3BOVA 4XBGB 5JW4N 4PRIA 3IXAA 4ZD3L 3BEVA 3QXAA 3IS1X 3MZGB 3NCMA 4JAMA 4JANB 4S1QL 3G5YA 1ZGLA 1EO5A 1X5GA 2CKBB 4XWGH 3L3DB 1G7HA 3OB0H 1IT9L 1KCSL 2WUBH 4PTUB 3MRQB 4BZ2L 3SDXF 4FQQB 4XPTH 3UTSD 3OKDB 3HG1B 2F53D 5DJCA 4XXCA 3ESUF 4JFYA 3QCVL 3TBSA 4H88L 1CE1H 3BFOA 4FXLA 3CZFA 2DD8H 5M7QA 4L4JA 1D5BB 3G9VA 5I18H 2H26B 4XPGH 1WAAF 4KHXH 2J4WL 4S1DD 2D7OA 2BXZA 3FONA 3QQ9D 3KPQA 2VDKL 2DS4A 3DROA 3PDOA 2Y07L 1JNNH 3DECA 3GSUA 1KCRH 4PRHE 1F90L 1LO0H 4NWUH 1LE5A 1CICC 2ATPB 2D7TH 2NY5L 2ZWLT 4ONHA 1EJOH 2N7AA 1HWGB 5JW5A 3MJ7A 1CFSA 4PJXF 3LEYL 5GZOC 1JVKA 5I1CH 4HCRL 4PJDA 4ZOAA 2XWJB 4PRAB 5DJAB 3QHZL 4TSCH 4ZUSA 2QQQA 3R1GH 3OR6B 3K81A 5MEPB 4RGOL 5IVXF 2ZUXA 4OM1H 1B0GB 1RZFL 1MCOH 2YPKB 3KXFB 3RIAK 4U1SB 5HHMD 1YEKH 4J1UA 3RI5K 2H41A 4NDMA 1U93B 1TTGA 1EFQA 3UAJD 5JDJA 4JJ5B 1DUZB 1FE8H 3FFCA 4BFEA 2ICWA 3FL7A 4HUKB 5AD0A 5D5MA 4HFWA 4P4RB 4YUEH 3ZE2E 1JWSB 4LSPL 1VGKB 2IBZY 3A67H 4KPHH 4CMHC 2FZ3A 2C3VA 5IHBA 4U7KA 5EZLA 4G6ML 4X0KB 3T65A 4YH6A 1T2XA 1FFPA 3DX9B 1IC4L 2X4TB 2J5LC 2JB6B 4KUZL 4OJFL 5L2KD 3DVGB 3JVGA 4APQD 3SJVD 1JN6B 2ZNWA 3WO3B 3ZE1F 3GBNL 5C08D 1WEJL 4JO3L 3RWEA 5FA3A 3EOAB 3U9UB 3QQ4B 5I1DB 5KVGH 2G5BB 4LRNL 4Q6IC 1JPFA 4JRXD 4P23B 5EZIL 2ADJA 1KPVB 4R90H 1HOCA 1P69B 2P8LA 1UWXH 3KPSD 2NX5B 5KTEH 5T1KA 2Q6WA 3AS2A 4ELMB 5CJBA 5ETUA 4ZUVA 4RDQF 2UYLA 5JOPD 1NBQA 5CJXC 5E2VL 4QHMB 1RVFL 1UJ3B 2DLHA 2EH7H 4D9RE 3TIEB 3B5TA 1D3CA 1YNTB 3OKLA 4MMXC 3BP4B 5DYOA 3IU3A 1U8HA 1F97A 4JVWA 2X7LB 3VJ6B 1NKOA 5IOPA 3WIFB 4Y16B 5HYSG 2AK4E 4Y4FD 3G08A 2EXYD 3T4AA 4HBQA 1B88A 3TBVB 1XIWA 4JDTH 3S6CA 1NBZA 1T22B 3O9WB 2HT4D 2V7HB 3MJ9H 3PUCA 1FGNH 5DSCA 5INDA 1V7MH 3O6ML 1BQHA 5E8EB 3VXUE 5T3ZE 1EBPA 4POUB 5DQDL 4H26B 3BQUD 2XACC 2UWEE 4QOKD 4MJIB 3V4UH 4TNVK 5IMKB 1MHEB 3RY5A 2VXSL 1FVEB 1IAKA 1ZTXL 1A9BB 3CSBA 4NHCL 2JJTC 2WIIA 1FFOB 4TRPH 4QRRA 2VSDA 3QG7L 4G8GD 1OT2A 4EQ2A 5I19H 3VXMB 2X4SA 4M1CC 5F1NB 2AKRA 3FO2A 2NTFA 3RNKB 4GLRI 4R4FL 1LO5A 1FO0H 3Q3GB 1NDMA 4GMSL 1CN4A 1JGDB 1VFBB 2JJSC 5H37G 4POZD 2GJ6A 5DRNB 4PBVC 3O6FC 4JFPB 5EUOA 1Z3GH 5DVOA 3EYOB 4LFHD 3MLRL 4HF5L 3KPLA 5JNYA 3D85B 1UB5A 4N0YH 3TO4C 3ARFB 1AJ7L 4JG1H 4IOFC 1C16A 4LBEA 2EDEA 3BDBA 2UUDK 2D0GA 1YECL 3QJFB 1QSED 3AREA 4HWEL 2CLVB 4DKFH 1K8IB 5C0NC 1P4IH 1N64H 2JLLA 3UC0L 5K9KB 3C2SA 1R3JB 3F7RA 4ZS7L 3SE3A 3MLSL 1T1XA 4MWFA 4N8CL 1ZMYA 1ZT1A 2HT3C 1RHFA 3P4MA 3U36A 3N1MC 1TCRB 4C58B 4F7MA 5L9DL 2DQIL 4WDIA 3O4LA 1OAQL 2P5ED 1X5XA 4IJ3C 5C0DB 2AXFA 4P5TA 5IB4B 5E2TH 3DX6B 3MRMA 3MO1A 3GIZH 5F1IB 5E9DB 3HE7B 1NLDH 4MAYB 15C8H 5JXAL 2X4PB 3PWNA 1GGIL 2ED9A 3DO7A 5D4QA 4BK5A 3GMLB 1CDGA 4YXHL 4FQHB 4X8XA 2P47B 1RQ5A 3H7BA 1I1YB 2HLFD 1AO7E 2FBJH 3OAZH 1DFBL 4FZ8H 4ODSL 1FORH 3ZT5A 3UPRA 1YEDB 1DVFD 3QCUL 4LP4A 4EEEA 3T4YB 2D7QA 5EUKB 4HH8A 5MP6H 1KTDA 4GUPB 5I1KH 3UYPA 4F9LA 1XZ0A 4GMTH 5ACZB 4Q0XH 4JB9H 4MXWL 3QUYB 1QOKA 3X13A 3MMEB 3BSZL 4NM8L 5I1HL 3QIWD 3OMZA 4O2CB 3MBED 4JCMA 4ZXBB 3QRGH 1F4WH 3GO1L 4FRWA 4M7KH 5BCAA 1A7PL 1W2KT 4R7DB 2HLAB 4GRWB 4KH2A 3V0VA 1IC1A 5GRYA 3SCMB 3C5ZA 2ZCKL 2APBA 4U6XB 3GSRA 3WNKA 4B0MM 4WW2C 3UCRA 5LGHH 1NMCC 2P45B 1R6VA 1AHWC 2QTEA 3O3AA 4L8SA 3RA7H 4KMLB 3SHSA 4ZAKB 3QH3A 3HMWL 4J2XA 5SWSA 2QR0A 4Y19A 2UZXB 3AS3A 2NY1B 1GAFL 4EJ1C 3TVMD 1BJ8A 5C0BD 3M8OL 3OJMB 3I6KA 4HJGB 2QADD 5FO7A 3CX2A 1J0ZA 5HVHB 1Q1JL 1VEMA 5JW3H 4CMMB 3T09A 1BFSA 4QKXB 3BUYB 4G3YH 5BV7L 4F7TA 5HI5D 1TIUA 3DVFA 3IDIB 1PKQE 3SDAA 5DQJA 1A6AA 3QO0B 4GAGL 1RJLA 4YFLF 3C9NA 2FJHA 2OZ4A 4LHUG 3CUPA 3HR5A 3FT3A 4TPRH 2LU3A 1QSFB 1DBBL 3VXSD 1RIVH 2E7MA 3QXVA 1ACZA 4OT1L 1HQRB 1CGVA 1S3KL 3BKCL 2FJFA 2LAGB 4YHZL 4PJHE 1MCDA 3EOBA 5T5FH 4PV8A 1NCDH 1QPPA 4NQCE 4PRNB 4KQ3H 4OGZA 2AERT 4EN3D 2X05A 4P2RD 3WV0A 2CH8A 4OTXH 2OXGA 3C60C 4S1RL 2W9EL 1N5YL 4U1NB 2VXQL 4G6AD 3E6FB 2G9HB 2Z92A 2VUYA 4L1DA 1NLBL 5E94B 5MEND 1IAII 3L6FA 5FKAA 1LVEA 1ZVHA 1JYWA 1DQQB 4Z7VB 3MOQA 4MQ7A 4MVBC 1M05B 3U0WL 4CDHA 2YN3A 1NGXB 2JCCB 4JFFE 5FGRA 4MB5A 5HYJD 4XC1L 2W59A 4DW2H 4LSSH 5KSUA 3SKOB 4NHUB 2YA1A 3VXNA 4WFHD 1P2CA 3FB6A 1LO2H 1TJIH 4XPHH 4QRPE 5DLMH 4F80A 3O11A 2GCYA 3DTXB 5I16B 4XH2B 4X7FC 3ZKNC 3B9EA 2Y1VA 4JFOB 3QDMA 3V79C 3MGOA 1UH4A 5DJ2A 1SY6L 1IEAB 3RWCB 4OZIF 1BWMA 1ED3A 1NSNH 2W9LA 4XWGL 2W92A 4I0PA 2DF3A 1U3HB 2WUBL 3ECBB 3IKCA 3IU4H 5ESAB 1HHJA 4EUPB 2NXYD 2HKFH 4YXLH 3OPZH 5IT2L 4GG6A 3D9AH 4J3VA 1G9ML 3S35X 3GJEB 1OGAD 5EO9A 4P2CG 5TE6L 1HH9B 3OGCB 4P46C 2NZ9D 1GIGH 3FQXB 5I18L 1N59A 3HUJB 4P49A 4XPGL 3BYTA 1ZS8B 5ICYA 5IR1A 1RZ7L 1T6WA 3G5ZA 1ODAA 5KZCB 1JNNL 4Y2DA 5D7JC 1KCRL 2NLJB 1YDPB 3BJLA 3Q6GH 3IKKA 4NWUL 1CL7I 2D7TL 1AKJA 1EJOL 4OQTL 3EFFA 5ANMA 2ED8A 2FDBP 1OLLA 5J1SC 5I1CL 3V4PH 5C6TH 3RVTC 4TSCL 3IJSA 2ADGB 1F8TH 3R1GL 3P0YH 5HI3C 4JRYA 3FQRB 4OM1L 2I9TB 1LD9B 1VEOA 3D39B 1MCOL 2Y7QA 4FXKA 4HMDA 2R1YB 4XP5H 2IQAA 5IKCB 2F53B 1FZJB 3QIBA 5D7SH 4AEIL 5JDSA 1NUFA 5HPMA 3A6BH 1F4AA 2EDYA 2EDFA 2YD3A 3FQTA 5FDWA 5DRZB 2FX8H 5C07A 1CFVH 4M1DH 2FYYA 2P46B 5DVNA 1WZ1H 4G7VL 1YPZB 1KNOB 4NRZA 4KPHL 4LKXB 1S7SA 4PRBB 1HHIA 2P48B 3CZJA 1LP9E 4LSTH 2W0FA 4NUJB 3LN4A 3P73A 1D5IL 5LVEA 1XMWA 4YQXH 5HTSA 2R2CA 3LV3A 1CD1B 4OBRA 1WC7A 3EO0A 2IBZX 4M3JA 1EGJH 4PJDF 4AEEA 4WFFD 1M4KA 5D7LD 1IGFH 4XCYB 3MNVB 5I1EH 2V9TA 4HUWA 4P59L 4NUGH 4WUUA 4XP6H 2FLBT 3OXSB 2EIZB 3ULVC 3UDWC 3UJTH 1C5DA 4R90L 5LGJA 2H6PA 4LCWD 4L3EE 5DC4B 3EYQD 2OP4H 1RUPH 1NC2B 4OFKA 2VITA 2EYTB 5DEFB 1F2QA 5T5NF 1BGXH 2ZCLL 2HRPH 2EH7L 3QUXA 1BIIB 2WM0A 2D03H 2JK5A 5D5MF 1I3RA 3MFFB 3QEQD 4KZEH 3MJ8B 5D1QA 1JPGB 3TNMB 1U8MB 2YPLB 1SM3H 5BOPA 2PTTA 3U0TA 2YD1A 3T0ED 1GVIA 4JDTL 4N1EA 1X6LA 3W11C 3WUWA 5HHOD 2I9LB 3KJ6L 1V7ML 1NANH 1WGOA 5KVFH 5ERWA 1RK0B 2IANB 4Y1AA 2BDNH 3VU2A 4G42A 1P7QB 1IAIL 2GSIA 4NSKA 3B2UD 4JRXB 3V4UL 3TBWB 5IHUH 5C0CA 5HD8D 1NC4B 3QEUB 3VI4F 3AC0A 4P4KB 1NUGA 1MCFA 1RULH 2RHEA 5I19L 3QDGB 2BNQE 1CICA 3G5VB 5GS1C 3O2VL 1FN4B 5DGQA 1FO0L 3H42H 1IE5A 4F7CB 3H9SD 2EO1A 5C0AB 5C8JA 1AR1C 1AQDB 3OF6D 1A7RH 1FH5L 1I4FB 4MCZA 5ITBH 3FQWB 1J8HE 4PGZA 5F7LB 3PJSA 4J23A 4EDWH 1A5FH 4KK9D 4N0YL 4JG1L 4KJYA 1REIA 3IF1B 3QFJA 2DIAA 4G43B 1V05A 4DKFL 1MAMH 1SJHA 1P4IL 5KN5A 1N64L 2M2DA 4DUWA 2JJVA 3RHWK 1QO3B 5KOMC 4LLQA 4NO5A 2FH8A 5LKNA 4TSBH 2Q86B 1FAKT 1QACA 2RFXA 3A0OA 3KYNB 4NJ9H 4R2GB 2LABA 3MV9D 4H20H 4NQEB 3K4DA 4DN4H 5KS9A 2NY2B 4Y88A 5E2TL 1NFDE 1UQSB 2E27L 4K71B 4CADB 5EOCH 3GIZL 3V6OC 5TE4H 15C8L 1BZ9B 1CL7L 5DHVB 3SKMB 1OT1A 2LTQC 2Q3ZA 4KMTH 1HHKB 2WMPA 1Q94B 3QZWG 2XT1B 2VIRB 5I8CB 2FGZA 4LARH 4YHKL 1YMMD 1DN2A 4KKBD 2FBJL 3GSVB 1FORL 4PGJA 5J9PB 5MHSD 5EUOF 4ODXB 4Q6IA 5SX4H 4GW1B 4KY1L 5GS3A 5H94A 4PG2C 4D8PB 3HNSH 4Z76A 5I1KL 4E0RB 4GMTL 3L3OA 4Q0XL 5FYKD 2VJXA 3ZL4H 5IB3A 1JUFB 4ZUWA 2A6DA 3OAYK 4Z7QF 3VXRD 1OGTB 5IGXH 1S7QB 1A47A 3QRGL 5CJXA 3UTZB 4C56E 2VZ1A 4UMGA 4K94C 1CGUA 2VAJA 4C4KT 1HEZA 4BFIB 1YNKL 2P5EB 1Q9OB 2AJ3A 4UOW0 3ME0A 5LGHL 1YQ2A 1JF1A 1S7UB 4I2XA 4NRYB 5LAXB 4KVCH 3DSFH 2XWTB 2R15A 4TYUA 2AJYL 8FABB 4QHLB 3ARWA 3U7WL 4MQXD 3H3KA 4ZMAT 1OAZH 2GUOA 3JTSB 2MQ3A 1HDMA 2ZOLA 4HKJB 4YX2H 1N0XH 1QTYT 1U8OB 2CDEB 1G7PB 3HKFA 4PJ8D 3VMNA 4Z7OF 4G3YL 3QPXH 4XVSH 1U8KA 2DDQH 5I1JH 4XCEB 1BOYA 2JJTA 4U1LB 3EDEA 4AL8H 1KTLB 4LEXH 2BSSB 4M9PA 1JE6A 2B4CH 2PR4H 5HGBB 1KCUL 2FWOA 2IFGA 4EQ3A 3CSYB 5TF1L 1T1YB 4BM7A 5BS0E 4L8DA 5F7NC 2R0WL 4PR5B 4XXDA 4HWUA 3FB8A 4HUVA 3Q5TA 5TDPA 3L3IA 1RIVL 2I26N 3OTTA 1FVCB 1P84K 2JJSA 2VLKD 2XA8H 3MV8D 5IW3A 1DUYB 1FYTA 2APXA 3S88L 3O6FA 2HMIC 2I24N 4BELD 2UZIL 1ETZB 1NCDL 1AGCB 1JMXA 1I3VA 4KQ3L 1NANI 1D9KD 3TO4A 4OTXL 5DURB 2F54A 3OJDB 1II4E 4LMQI 3FCTA 1KUMA 4JFZH 1AGEB 3IAGC 5DK2A 1CDJA 2LU4A 5BZWB 4H25B 4H0GA 4P23C 2EDNA 3QIUB 3WJLC 1NEUA 2PXYD 2NY7H 1JNJA 4LP5A 4QRQA 2XZAH 1SJXA 3UTSE 2Y25A 1CIUA 5JIHA 3DUSB 3GSWB 4A2LA 1EUTA 5IESL 4ZO7A 3VD3A 4DW2L 3EDFA 5TJWK 5JORA 1LO2L 1TJIL 2XA3A 1YN6A 2FHFA 5DLML 1YY9C 1KLGB 3G6AB 3NCFB 1WTLA 3OQ3B 1YJDH 1XF1A 4Y16C 1RZKL 1AIFA 4QYOA 4LCUB 4X7SH 1MCRA 4ZQKA 3OJVC 5JXED 3L3JA 2XY1A 1AY1H 4X6CF 1BFOB 3O9WC 3QUZB 4DZBB 4P2RB 3CD4A 1NSNL 3G9AB 4MA8L 4XI5D 2OSLA 5JOFA 3C6LD 1CXKA 4LMQE 1G1YA 3E6HA 1R5VB 4YEEA 4C83A 4XT1C 5JHDB 1BECA 3HMXL 3L5IA 1V3LA 5FHBH 2HKFL 1RUAH 4YXLL 3OPZL 2AXJA 4JPKL 5HGGS 3VFVB 5D1XC 4Q7DA 5HHME 1I1RA 3PP3K 4WW2A 3VDAA 4PB0H 4KI5C 3D69B 3X11B 2DQDH 5CEYB 1AHWA 2BNUA 4XVUC 2PETA 3Q6GL 3TJEH 4MD4B 1W0VB 3I3DA 3W9DA 2X4NA 1EMTH 4GRLD 1H3TA 1N5AA 3CVHA 3NFPA 1JWMA 4YR6A 3OXRB 3MRLB 4U7MA 4XGZB 3OJ2C 3MACL 3P9MB 2G2RB 4TVPD 4D94A 3MUZ1 1SHMA 3V4PL 2OR8A 1F8TL 5SX4I 1JP5A 3W5NA 5ALCH 3P0YL 4UT9H 1QYGH 2A6IA 5L2KE 1NCBH 5DMKA 1RZ8B 5BV7B 2DLGA 1QR1B 2EECA 3SJVE 4JM2C 1T0NA 2F19H 4Z5RA 5T1MB 3EHBC 1X5YA 3GM8A 3FO9B 3BHBA 3N1PC 2NXYB 3RTQB 1G7IA 1KBGH 2M1KA 2DM2A 1RPQA 4R4BA 4GXVH 2OK0H 1KIRA 4QHUB 4Z8FH 5IB1B 4OZFA 3KPSE 1TJHH 4M1DL 3MCKA 2X4QB 3ARSA 3ZE0F 1HYSD 1WZ1L 1I1FB 2X9YA 3GB7A 1KELH 3DXAB 2O93L 4KRPD 4K8RD 3V5DA 3WKNA 3MR9A 3HE7C 4OFPA 4MAYC 5DJ0B 1EDQA 4LSTL 1FHGA 1P53A 4PP1D 4PRID 4R26H 1KXQE 4X5WB 3C60A 4LPTA 2DWDA 4YQXL 5JLZB 3AGVA 4NO0A 4DUVA 3B5HA 3K0WA 3S36X 4NQDB 1KT2A 5IW1A 3SDXB 1EGJL 1ZLVK 3LH2H 5SX5K 1IGFL 3ES6A 5D2NE 4GKSB 1YMHB 5I1EL 4XP6L 5F88B 1S7XA 4KJQD 2W1NA 2OX5A 4X6EA 3QUYC 3PE9A 3AS1A 3V95A 4KJPC 1KN4H 1WBYB 43C9B 3UJTL 3ILQD 1EFXB 3PDDA 4ZXBC 1NEZA 3EO9H 4QOKE 4WHTA 3S7GA 3KYKL 5E99H 2OP4L 2VR4A 5BRZA 1RUPL 5JA8B 1FNAA 5DJXA 1K6QH 5I2IB 5E2WL 1BGXL 5F8QC 2GJZB 5DD6B 1EH9A 3SCMC 2D03L 2ITDA 4BQ8A 1H3XA 4ODBD 3LEVH 4KZEL 1R5IA 1NDGA 4G8GE 4PJXB 1LNUA 1NGZB 1DLHA 3N9GH 5TH2B 3O0RH 3C08H 4NO3B 1A6TB 5EB9A 2VL4A 4GG8B 3JWDL 5ALBH 3UBXG 3DGGB 4W6XB 1XF2A 5ICXB 5AUMA 4OI7A 4YDJA 1W8NA 2NY1C 5IVXB 1CFNA 3LQAL 1X5ZA 5CZVH 4AIZA 2XRAH 5F3HB 4N5ED 5HGHB 5HVHC 3P4NA 4HKZA 2BDNL 2EH8L 5HDBF 4PJEA 5K9QG 4GAJH 1UVQA 1JV5B 3RKDC 2ZJSH 1CG9A 4GBXB 5IHUL 1FNFA 3FFCD 4X4ME 4P46A 2EO9A 1FDLL 3H3PH 1CF8L 3WS3A 1KLUB 1N7MH 4PJFE 1TETH 4M4PA 2OYPA 5B38B 2YSSA 3E8UH 4FP8L 2AV1A 5F89A 1MPAH 1RULL 5CGTA 2AV7B 3QCTL 5HYSA 4U7SA 4WTXA 5D7JA 3OZ9H 1U8IB 4OFYA 4F7PA 3PP4L 1J05A 1KJVB 2ZNXA 3F7VA 3BIAX 1TJGH 3H42L 2OMBA 1XGRA 1LGVA 2X44D 3BPOB 3NCJH 1P9MC 3JXAA 3T0EB 4MD0B 5ABDE 5EO0B 1A7RL 2GTWB 5TGBA 3GHBH 5IFAH 3T0AA 3ALWA 1RZGB 3MRJB 5HHOB 1A1OB 4EDWL 1A5FL 4JHBA 1RD6A 4HUXB 1MAJA 1OVZA 4NZTL 4JEGB 1S8DB 1XCQB 5DHYA 1QRKA 3PWVB 1PKQB 3ZKMC 4PJBE 3DVNA 1MAML 5T1KD 4R8WL 3NFNA 1ZK9A 4LLVA 4P5MB 2YPVH 2N7BA 3N1QC 3VFWB 1PYWA 4TVSa 4TSBL 2VZSA 4NJ9L 4YHLH 2D0FA 4H20L 1CFTA 4DN4L 2YRPA 5L88H 1IRAY 3SE8H 4RX4A 5C92A 4JLRB 1UH2A 5EOCL 1R3LB 2ADIB 1RU9H 4PJHB 5TE4L 1XIWD 2WQRA 1E28B 3HLAB 3P3YA 1HIMH 2EDOA 4YDIH 3GUTB 3FHAA 5FUCC 1FCCA 4E42A 3RWIB 4LARL 4PP2A 2FJGA 3SEPA 3VXQB 3OB0K 1M7XA 4M48H 1WQVT 5SWQA 4M93B 2PN5A 3H6JA 4DTGH 3SPVA 1GHFH 2FR4A 3PL6C 2NR6C 5IM7A 5JQ6L 4OCMC 4PJIA 1ZT7A 1U3HC 4W4OC 2DIBA 5JZ7D 3HNSL 3UDWA 4JPWL 2R0ZH 2BOBB 1X44A 4PYGA 3LOWA 4XNMA 4LVOB 4OV5A 3B4NA 4HEME 1RURH 4JDVB 2VQ1B 5IGXL 2Q8BH 4QRRD 5B39A 4I5BB 1CXHA 3IETA 2IG2H 2Z4QB 3MBXH 3M1BA 4X80H 4OZHA 1F45A 2DYPA 2YA0A 4QRPB 5CGYC 2HVJA 1I1AC 3SKJH 5KS9F 2VZVA 3FAXA 4MHHI 4HXAL 3T3PE 3RU8H 3NCBB 1HE7A 2GJ6D 1UM5H 4W70A 4UAOB 4LOUC 5FYJD 3REVA 3IXTA 3V5HA 2F74B 4KKAC 4XPBH 1T03H 2FBOJ 4LLMA 5E4IA 1BBJA 4AT6B 5F7UA 1OAZL 4MNQB 4WI8A 5GGVY 5ISZA 3MREA 3ARED 2IPKA 4HPOH 4NN6B 4Y7MA 3QPXL 5DD1H 4PJAA 5TDNA 5I1JL 5FEBA 4R7NB 3BZ4B 3WXVH 5MENE 4WW1B 4JN1H 1DN0A 4HHAA 3BKYH 1ZHLB 1KCVH 2B4CL 2PR4L 3O4LD 4L8BB 3IDXH 5ESQB 1MCWM 5GS1A 4P5TD 5JIKA 2B1HH 4PY8J 2AEWA 4HWZA 4ZSOA 4ISVA 5KANI 1HN1A 1OSZA 4ALAH 2XA8L 3CDYA 1FFNA 3GMPB 4WFHE 4JDZA 3SGEH 3OKNB 1KYOK 4QXGH 3MNWB 4CJ0A 1F6AB 4BSWA 3NACH 1IGIH 4QHNA 2DLIA 4R4ND 3GKZA 5ESVB 2P44B 2J8UA 5IMLA 4ZDHB 1KGCD 3CIQA 2AAVA 1UWXK 2P42B 4ZNEA 3AXLA 1NQBA 5IBLD 3MUHL 2NY7L 3T1WA 2XZAL 4LHUA 1W72L 1RHHB 3UJIL 5D71H 5A3ID 4N90D 2C3HA 4OLWH 5DO2D 3IJHB 3DOSA 2HFGL 1LO4H 3QULA 3RVVC 3C5ZD 1A14H 2BHZA 3X17A 4PG9A 4XWOC 1J0JA 1WZMA 4MAUH 1OGAE 4UIMA 2DB8A 5IQ7H 1V7NH 3V6OA 1LP9B 5EO1B 4HXBH 5K9OA 1DE4A 1YJDL 5SWSD 4XBGA 4ELKB 4U3CA 3MV8B 1A1MA 4Y19D 4YHIB 4PRPE 3BGMB 2YRLA 2APTA 4JANA 3ZKSD 4XP9H 2FGWL 35C8H 4G6FB 4ETQB 2CKBA 4FFWC 3L3DA 4NP4H 4PG2A 5D70H 4PTUA 2FCBA 1HQ4B 2R23A 3MRQA 4NO2B 1QRNA 4FQQA 4NBZB 1U8NA 3UTPD 2VO5A 3LKOB 3OKDA 3HG1A 1N2RB 5KJRH 2BY3A 4G8IB 1D6EB 5FHBL 1WCBB 4E41B 3FMGH 3SDAD 5IJVB 1GH7A 1RUAL 5FCUH 4UV4H 5GJTL 3Q6FB 2QQKL 3GKWL 1D5BA 1C12B 2AJUH 3TP4A 2H26A 2XQYK 1KXTB 4P4KC 1AH1A 3FHQA 5DD5H 2ILLA 4BKLB 4F9PC 4D2NA 2ZOKB 2B39A 5DVKA 2ATPA 2NY5C 3GK8L 1DANT 3LSOB 5CEZD 3I50H 4KUCF 1EMTL 2ITCB 3L5JA 3V8OA 3QNYB 4TQEL 3WMSA 4O2FB 4L4TB 2H32A 3B5GA 3TO2B 5DJAA 2YHGA 2XWJA 4PRAA 4BJLA 5F3BB 5F7DB 2O5XH 2HWZH 3OR6A 3QXDB 3SBWC 4A2MA 3BD3A 3OV6A 4Q97A 5ALCL 1B0GA 3FOLB 4PUBH 1NCBL 3BKMH 2YPKA 1DBJL 3H2WA 3TT1H 1KYOJ 3I6GA 3VW3H 4DVBA 2F19L 1U93A 2B1AL 4XPFH 4Y4KC 4WFFE 4JJ5A 1DUZA 1VGEL 3GSOB 4NC1C 5D7LE 2QSQA 2EZ0D 2VB5A 4X7CC 4POYA 1INQB 2OK0L 5LCVH 4P4RA 3TH2T 3HE6B 3BMVA 4Z8FL 4N0UA 4R2GC 1JWSA 3VFMB 1FNEB 1ACYH 4LCWE 1UXSA 4GS7C 5GRZA 4WW2F 4C55A 2VDMH 4X0KA 1NFIB 4K71C 4AH2B 4RGND 2VR5A 2CD0A 3AFLA 3DX9A 3OAZK 4GRLB 2R2BA 1DP0A 3QEQE 3QDMD 2X4TA 4DKDC 2JB6A 2R0LH 3IJYB 4R26L 3DVGA 2EE2A 3SDDB 4XNUL 4MXQC 1JF5A 4I0PD 3ZHLA 3LEXB 3EOAA 2Z91B 3U9UA 1Y0LB 5LQBH 1ES0B 5I1DA 3BN3B 3LH2L 2GSGB 4QHKJ 2JE8A 3CXDH 4P23A 3WJLA 5TDOA 1KN2H 3Q1SH 2R0KH 3BD4A 2NX5A 3X14B 4ELMA 4UB0L 3IDMB 3EJZD 1KG0A 4EI5B 3MQIA 5CJ8A 4QHMA 1K6QL 3TIEA 2WANA 3RWDB 2OTWA 4IMLB 1I8IB 2LFGA 3FN9A 3WFHA 3BP4A 4MGXA 5LG1A 4MS8D 3AMLA 5B38G 4Y2DD 4O02H 2X7LA 4DZ8A 4G5ZH 2EKSB 3WIFA 1JGVL 4Y16A 1AKJD 4RMRA 5CWSB 3TBVA 3ZDXF 1DQTA 1SVZA 3N9GL 3O0RL 3C08L 1T22A 1NMAH 3O9WA 2V7HA 3DETC 4FG6D 4PD4K 1TITA 1CBVH 4OGYL 4LNVA 2VOTA 3VGFA 4KGLA 5E8EA 5I74C 2O61A 1ZGLB 5CZVL 3H9SE 4H26A 4WHCA 1QBAA 4JRYD 4OLVL 5E03A 1C5CH 1XGTA 1TVBB 4MJIA 2OMNA 4MJ6A 5IHZA 5IMKA 3QIBD 4FFYH 1IGCH 1MHEA 4RAHA 4DAGH 3WFCH 1FVEA 4JFYB 1A9BA 3TBSB 1AQKH 4IDLA 4NJAH 3H3PL 4EOWH 3KDMB 1FFOA 3OHXB 1N7ML 5D93B 3S9DB 1TETL 5C07D 2IFFH 1XT5A 1G7MB 3FONB 5EH1A 3VXMA 5F1NA 3GFUA 3KPQB 3RNKA 4HC1A 4ZG1A 3GSUB 4MB4A 3Q3GA 1LE5B 3MV9E 1KJ2H 3PQYE 1JGDA 1VFBA 2EC8A 5E8OB 3STZB 5DRNA 3GGWB 4JFPA 1FZOB 1BQLH 3EYOA 4PJDB 3GHBL 2IMNA 3CX5J 3D85A 4PGEB 3RX5A 3TFKD 3WXWH 2Y6SD 1R3KB 4JM2A 2C1OB 5EU6B 3CLFH 4WUUD 1YMME 3QJFA 4HSQA 5GRVL 3K1DA 2YOCA 3LS4H 1DQDH 1K8IA 4ZFOA 5JA9A 2WWMD 5K9KA 4NDMB 1R3JA 3QIUC 4PJEF 4LQ1A 2YKLH 1VFUA 2X40A 4W6WB 1OWWA 3FFCB 2YPVL 4KTYA 3D3VE 1UYWH 3BAEL 5FYKE 2NY4D 1TCRA 4ZPVB 4LU5L 3QUXD 4YHLL 2KDGA 5C0DA 5IB4A 4DGVH 1ZWIA 3PF2A 5D1QD 3DX6A 3IB4A 1KC5L 4B5EA 5F1IA 4XTRC 2EYRB 3HE7A 1A3QA 4MAYA 3G04B 1HXMB 2X4PA 1MCWW 5EZLB 2OCFD 4HH9A 1U0QA 3LY6A 3GMLA 4FQHA 1I1YA 1HIML 4YDIL 5CINH 2LVCA 5HGAB 4GW4B 2APWA 1YEDA 3DNKA 2BJMH 2XKNB 4DTGL 3T4YA 1GHFL 4Y1AD 4XNQB 5EUKA 2H2SC 2CSPA 4PD4J 5ACZA 3QYCA 3QUYA 2DBJA 1F02I 4ZFZB 2GQHA 2R0ZL 1S5IH 5C0CD 4IBLT 1J88A 2W60B 4O2CA 4ZXBA 3WIHH 5GGTH 2HA1A 3UTTE 1RURL 2Q6WB 3RIFF 5CD3B 1S9XB 5B21A 2ERJC 1SBSL 4R7DA 2X4OA 2XIDA 3U4EB 2HLAA 2IG2L 3SCMA 1A6VH 3MBXL 2A74B 4U6XA 3X3GL 5CKAA 1CICD 3DI3B 4P2QA 4P99A 2XQYG 5DDHB 4WGWB 3SKJL 4O9HH 4KKNA 4G9FE 5GZOD 3RU8L 3RZWA 5JQHC 3NN8B 2W0PA 3C09C 1XIWB 1OF2B 4AG4H 4KROB 5GGRY 1S9VB 1NGYA 2Q76B 1WICA 5INDB 3QPQC 4KVNH 1BQHB 1N0LA 4XPBL 4HJGA 3RQ3A 1U8LB 1JYVA 3AVEA 1T03L 2X89A 4MD5B 5D7IE 2VLJE 2WW8A 4CMMA 3ISWA 1RMFH 3BUYA 5DXWA 5D8JL 3QFJD 5BV7C 2VE6B 4Y5XC 3IDIA 3RJQB 3C6SB 4F58H 3SO3B 4F3FB 3ULVF 3VFOB 4I48B 3WXVL 4Y8DC 3QO0A 4B50A 4UTAH 3KPMB 2X1WL 2WIIB 1KCVL 1FVDB 4WJ5B 4HS6B 1BFTA 4XMLH 4M7LT 3IDXL 1LEKB 3T3ME 3TH4T 2B1HL 3FO2B 4M02A 2NTFB 4I9WD 3AU1B 4MNGE 1HQRA 1P9MA 4ALAL 4NFDA 4PRNA 3P9LB 1W0WB 4DKAA 2ZUQB 3GHEL 4U1NA 3FAWA 3VRJA 1IGIL 2XV6B 3E6FA 2G9HA 5EN2B 4X4ZA 1EHNA 2XKSA 5E94A 5F6HI 2LVEA 4LBEB 3STLB 4YEFA 1S7TB 4LSQH 2ZSWA 1DQQA 4Z7VA 4JN2B 2WV3A 4NOFA 3QA3B 3LKSA 3AY4C 3FZUC 1M05A 1FZKB 2R2HB 3L1OL 4Z7NE 4PJAF 5D71L 1HHGB 1NGXA 4OLWL 4U1JB 2O5YL 1FGVH 2XYCA 3SKOA 4RMUA 4KKLC 4NHUA 3RFZC 2YRZA 4MAUL 3O3EB 3IGAA 2H3NB 1V7NL 2IH3B 1CWVA 5I16A 3DTXA 4WIQA 3VCLB 4HXBL 4PJ5B 3I6LE 1UH3A 3DJ9A 4JFOA 4TULH 4AEHL 3BT2H 3CCHB 2JF1A 1MCJA 3JV4B 1IEAA 2E5EA 4JQIH 3PL6A 35C8L 1IC7L 3CFEB 5D2NB 1P7KB 1U3HA 5FYJH 4W4OA 3PGFH 5D70L 4YDKH 5GIRB 2QSTA 1FRGH 1MNUH 3ECBA 5ESAA 2J8UF 1MI5B 4EUPA 3X13B 1KOAA 4WO4C 1QPXA 4GBXC 4PV9A 1G9MC 5FCUL 3GJEA 3RIAF 3RI5F 3OGCA 1PGRB 4OKVB 3HCVA 3BPLB 2OI9B 3HUJA 4LLUB 3V52L 4M1CD 3GRWH 5DD5L 1ZS8A 2F5BL 4LDEB 4XC3H 4C57C 1RZIB 5A2JH 2ICCA 3GSRB 3QDJB 3EYUH 5FGSA 4U2ZA 1RI8A 2HFEA 1YDPA 2DLEA 2NLJA 3TWCH 2D31B 2Y06H 5FHAL 1FYTD 3TZVC 3I50L 3RVUC 3O6FD 3MLVH 3RVWC 5IJKC 3BPOC 3RWJB 2QR0B 3CVHL 1J0IA 3WKML 3LIZH 1UM6H 1NCNA 3TO4D 3I9GH 2F54D 4QXTA 4IOFD 2ADGA 3G6JE 3FQRA 3K2UH 1LD9A 3D39A 1CDYA 4Y0GA 1X6NA 3BKML 5F7EH 5C0ND 1K5NB 3TT1L 2RIKA 3VW3L 1U92B 5IKCA 1MJ7H 1FZJA 4IEFB 5I30L 3FKUS 4FFVC 2HT3D 4PJFB 3RUGF 4JZJC 5D2LA 1UCBL 4ZTPH 3B9VA 3KPPB 5DRZA 3K3QA 3CDGB 5T3XH 3BZEB 3CUPB 1ACYL 3FT3B 4KUCD 3BVNB 1EO7A 3BUTA 4MQSB 1ZVSB 2VDML 1H8SA 3DI2B 4LCYB 3SKNB 4X6CB 4NUJA 2R0LL 1JTOA 4AENA 1JZ3A 1CD1A 1IEHA 3S35H 4JFEA 3F7PC 5DC0A 2CRMA 1NJ9B 4M93C 4XCYA 2BK8A 1N8ZB 1V3KA 3GMRA 3MNVA 4CNIB 4QRSB 1RIUH 5EIVA 4PJBB 1I7RB 1MFBL 3L6FB 3OXSA 1KN2L 2Y5EA 5C0GB 5EU4B 2R0KL 4LAQH 4FTVA 1W72B 3ZMRA 4K3EL 3OGOE 4OM0H 5I0ZA 4LVOC 4MQ7B 4N0RA 4JZOB 4TNVF 1NC2A 3LMJH 1WBXA 3IDYC 5EBLA 4ZO6A 1GZPB 2EYTA 3D1MC 5DEFA 1CGTA 1FCGA 1KACB 4YBHA 1OPGL 2E9IA 3MFFA 4Y4HB 3FO1B 3M17B 3MJ8A 3VGHA 4X5XB 1P2CB 3TNMA 1U8MA 5D5ME 2YPLA 5FYLD 4G5ZL 2OZ4H 1A7NL 4NYLB 4YK4C 2QKIB 1N6VA 3D5OF 4HK3J 5DD0H 4DK3A 1KB5H 5IK3B 2P5WB 4HIJB 4OGXH 5HYQB 4UAOC 5CEZH 2I9LA 3OKOB 3MGOB 1F42A 1ED3B 1EZVY 1RK0A 2BNRB 2IANA 4I0PB 2YA2A 3WIIL 1C5CL 3LB6C 1P7QA 5FECA 1CD9B 2VZ3A 5EOTA 5L8KB 1O7VA 4PJ9B 2NY0B 4FFYL 4NN6C 4DAGL 3WFCL 1NC4A 4OCLC 3QEUA 4J3WA 5MEOB 4P4KA 1NL0H 1LEIA 4NJAL 4EOWL 3L3GB 4RA0C 5EO9B 4ZYKB 4WVRA 4F9PA 1MF2H 4UZGA 4ELMF 3NIGE 4M5ZL 4OLEA 2DI9A 4L5FH 3QDGA 3G5VA 3A6CH 1A7QH 1FN4A 5AWNH 5SWZE 2DMKA 1I85C 3GI8L 4KWUA 1KJ2L 1J5OH 4HCRA 5ANMB 2FECI 5C0AA 3MRCB 2E7BA 1AQDA 3C60D 4PGBB 1E6JH 3VRLF 5KW9H 2ARWA 4NO0D 4XCFH 3FQWA 1BQLL 3FOMB 3SBWA 4HIIB 4PJGE 1FC1A 1HILB 3WXWL 4ZUTB 4JO4H 3IF1A 2AVGA 4Y4KA 3S5LB 3LS4L 4G43A 2FX9H 1OP5H 2IQAB 3CSGA 3WLBB 4MVBD 2X1PA 1QO3A 2OM5A 2YKLL 3KLDA 3W82A 5BRZD 2Q86A 1D6VH 4HUMB 1UYWL 3FQTB 3ESVF 5GISL 4NQEA 1UEYA 4FN0A 2H45A 4M7ZB 3BJ91 4DGVL 3C5SB 4G6JH 2A6JB 4K3DH 2CDGB 3G5XB 4R97C 1UQSA 4KI5F 4QRRE 4CADA 3BP5B 1I8MA 3ZKND 3R06A 1Q9KB 3DRQA 1BZ9A 5DHVA 4HWBH 1NCCH 1S7SB 1BP3B 3WDJA 5IFJB 2HKHH 1HHKA 1Q94A 3NAAH 1LHZA 2VIRA 5J12B 5FYKU 1INEL 4YFDB 4O2EB 4P2OB 1T80A 5JHLH 3D87B 4XB8A 3ZDZF 5J9PA 3INUH 3LV3B 5I17A 3MPCA 4EIGB 4ODXA 1NCWH 1UFUA 2GJ6E 2OBGA 2Z8SA 2BJML 5DFVC 1Q9WB 4GW1A 5FYJE 1VESA 3O4OB 4ZS6C 1AD9B 4D8PA 5EFIA 4QGTA 4HUWB 1PG7X 5BW7A 5EU5B 3RY6C 4JM2F 3IS0X 1S9YB 1JUFA 2QHLA 5BMFL 3HRZB 4P46D 1T2QL 3WE6B 1OGTA 5GGTL 1S7QA 1TPXB 3WIHL 1PY9A 3U6RB 1QLFB 1U2CA 1XGYL 2BHYA 3OR7A 5HHPB 2VITB 4AYFA 4HFUH 2NY4B 1A6VL 1UWGH 5D7JD 4OFYD 1Q9OA 2DQUH 4P9MH 4WI9A 3DWTA 4JFDB 4XNXH 4NRYA 1N3NB 4NZRL 4PRPB 4P57B 5LAXA 2PTTB 2XWTA 3VFNB 1DR9A 3RVTD 1HKLL 3L95B 1ZV5A 1HXYB 8FABA 1S78C 4QHLA 5I1LB 5JO5B 3WUWB 5HI3D 3NIFF 4KVNL 3ELAT 3JTSA 3MLPA 2X5PA 5ERWB 1HCFX 4HKJA 3EOTH 3IDUA 4LVHB 4H5SB 1UA6H 1U8OA 2CDEA 1G7PA 4G42B 2OTPA 4XCEA 4L4VE 1I9RH 2W38A 2JTDA 1GC1L 4KJWC 4U1LA 5DS8B 4F58L 5C3LD 3ULUF 1Q9LB 5GZNC 1KGCE 4L9LB 2BSSA 2R1XB 4Z7UF 4UTAL 4HT1H 5HGBA 1T66C 4FQ2H 5FIEA 3CSYA 3HPJB 3MV11 1T1YA 4XMLL 3HE6C 5T3XE 2B8OT 4PR5A 4HV8B 4U6YA 4UINH 1KF9B 4F8QA 5I1GH 1DZBA 3IFNH 4RX4D 1CICB 2RQ8A 1BF8A 2HN7A 2G5RA 3GSNA 4P3DB 1DUYA 1MQKH 4H1LG 5KSAB 4GOSA 4J3TA 4YO0A 1T5WB 1G7LB 1QHOA 1G84A 2AABH 3S96B 4LK4A 1B0RB 3SDDC 1B6DA 3ARGC 3OJDA 5SWSE 5C0FB 3LQZA 1NAMH 2W65B 2DQCH 1AGEA 5KSBE 1L0XA 2NY3B 4FMFA 5C0IB 5BZWA 1ORQB 3ULVD 3FN0H 4H25A 3QIUA 3QFJB 3S4SG 4LSQL 1BF2A 2E6JA 3CU7A 4X4XB 1SJHB 3IFLH 3UTPE 4RGMB 4TUOB 1JNLH 3DUSA 3GSWA 3IDNB 4I1NB 4XMKH 4FHBD 2RFXB 1MCSA 2BSTB 4O5LH 1FGVL 2DYPD 4EI5C 3U46B 5KS9B 3VWKB 1MHCB 3CXHJ 3P77B 4XVTL 3G6AA 4JO1H 3OKEA 1S7VB 3ZSSA 2MTPA 1QKZH 3GMNB 3W11D 4LCUA 4TULL 5A2LH 1U3ZA 2FECL 1BFOA 3QUZA 1MH5B 5CEZE 4PGDB 4I3GA 2AJXH 4OLUL 5KG9A 4JQIL 1MOEA 1OL0A 2R4SH 3MZTA 1R5VA 5ISZD 5JHDA 3WLWC 1FRGL 1MNUL 3CDCA 3LHPH 4LFHG 5CSGA 1Z9OA 4NNXB 3VFVA 2R9HC 2Q1EA 4Z7VF 2RCSH 1CGXA 3IDJB 3SOBH 4JGUA 3GRWL 5D93C 4RAVB 2FHBA 3OKYA 2DJ4A 4XC3L 3ROLB 3X11A 2J1KA 5CEYA 1HEZB 5FGCE 3EYUL 3BPCA 3MSPA 3DX7B 4MD4A 5DMJB 3TWCL 5IB2B 2Y06L 4X98B 2FD6H 1T20B 3NH7H 1AR1D 3OXRA 4XGZA 3MLVL 1WJ3A 2G2RA 1HK6A 2GY5A 3LIZL 4WFGD 2W9DH 2OTUA 4RGNE 4OZGF 3ZTJG 3KHQA 5GRVK 1VKXB 2FRGP 4AM0A 1RZ8A 1YY8B 3L5HA 5CS7A 1QR1A 1HDMB 4Y5XA 3BDYH 4UUJB 2OJEB 5T1MA 1HKFA 1MJ7L 5CD5C 3FO9A 1G0YR 5TQ2H 1MIEH 2X2YA 4YZFF 4LHUD 3RTQA 1IZKA 5IEKB 1N26A 2ICES 4QHUA 4RMSA 5GGQH 5IB1A 4KK8C 4GG6E 5E08H 5T3XL 2E8ZA 2X4QA 5ADOL 4L8DB 1TVDA 3CFCH 3DXAA 5IWLC 5M95B 1BHGA 1RJCA 2DMBA 3PQYB 2XTLA 5A2IH 3DLQR 3J7HA 5DJ0A 5DWUL 4Y5YC 4BH8B 2NXZC 5CSZA 4JFHD 1FYTB 5TQ0H 1TZHB 2VZTA 1CVRA 2VQUA 2VLLB 4OLZH 2DQEH 4NQDA 5BZDB 3S35L 3SDXA 4PLOB 3OG6B 1QRND 3PWUB 1PEZA 4GKSA 1YMHA 3HG1D 3FTGB 4CKVX 3P30H 3S3PA 1RIUL 5DK2B 5F88A 3VI3F 4LLAA 3AY4A 4LAQL 4DCQB 1WBYA 43C9A 3B2VH 1LEGB 4JRYE 1PZUB 1EFXA 4NZUH 3D3VB 4QRQB 2CXGA 1EAJA 2P8MA 4XVJH 3QP3A 5GS0H 1SYSB 3LMJL 2P43B 5I2IA 5D2LF 4P2YA 2ESVE 5TE7H 1RJZB 4HKBA 5CHNB 3MA9L 3OKKB 1U91B 2B2XH 5JORB 5C07E 5GS2D 4PGCB 1NGZA 3HB3D 3MRBB 4NOBA 5TH2A 1CU4H 5TPWH 4NO3A 1CLOH 1A6TA 4EZMA 4GG8A 3JWDC 4U05A 3DGGA 4ZQKB 1RZJH 5ICXA 3RPIB 1SY6A 3RNQB 3BWUC 3GSXA 4KROC 4OGXL 1Q38A 1X5JA 2E7HA 3PXHA 2WLYA 4M6NL 4UIKH 3LQAC 3HZVB 2CUIA 5F3HA 5C86A 5HGHA 3AM8C 5JOFB 1YYMH 4HWNA 4OUUB 3MOAH 1JV5A 3L5WA 3QDHA 4WO4A 2XICA 4GBXA 5CUSH 3UTTB 1YA5A 1KPUB 1BX2B 1U8PB 4FQJH 5MEQA 2XZQH 1KLUA 1NL0L 5B38A 4U1GB 3QNZB 3CK0H 2J2ZA 5AZ2H 2AV7A 4M62H 3RHWF 4WW2B 1U8IA 1XR8A 3A6CL 3QQ3B 3S36H 1CQKA 1A7QL 1S7WB 4OQTA 2HFTA 5AWNL 3TZVA 2HMID 3EJYC 3ZHDA 4TNWK 5IJKA 1WVZA 1W8OA 3AB0C 3CVHB 1J5OL 4HK0A 2G60H 2GW5A 5EO0A 3PWJB 1KJMB 2GTWA 4PLJC 1E6JL 5KW9L 1CR9H 2CR6A 4XCFL 4D0CB 1RZGA 1PZ5B 3MRJA 3D18B 3BRDA 3K1KC 4PJCE 4HUXA 1WZKA 3FT2B 1ZGLP 1MUJB 1S8DA 1XCQA 4JO4L 4P23D 5DMKB 4G8FB 5EBMB 3NFSH 3PWVA 1PKQA 2A83B 1T0NB 3GJFH 4Z95H 2FX9L 4Z5RB 4DGYH 2NX5D 5MI0C 4Y1AE 4P5MA 1L0QA 2V5RA 3VG9B 3VFWA 1CIDA 2N56A 4TUKH 1VA9A 4DK6A 5CP3A 1BFVH 1I75A 1YY9D 5FUZH 4UILH 3HRPA 1OQXA 4G6JL 4K3DL 4BQ6A 5ACLA 4MNGB 4PPTA 2A6KB 2GAZB 4JLRA 1MWAL 4Y16D 1R3LA 3NMEA 4PJHA 1QBLH 4HWBL 1NCCL 5KANG 5DT1H 1E28A 2HKHL 3O9WD 3HLAA 5C0JB 3MROB 3GUTA 5FYLH 3LKQB 3RWIA 4RFEB 5GRWA 5JHLL 4KV5F 4NKMB 1K4DB 4KK6D 5K59E 1NCWL 5IW1B 1BVZA 5D2NC 2R56H 5EOQL 2VYRE 4MJID 5IHLB 3ES6B 1OTUC 3VD9A 1V3JA 5HHQB 2GITB 4XNYH 1S7XB 4X6EB 3EDKA 3ULUL 2DTML 4JDVA 2VQ1A 3ZT7A 2J7LA 1BAFL 4GAFB 4I5BA 5F7WC 3N85L 4KI5D 2Z4QA 3LRSB 4TN9A 3BPLC 2OI9C 5DJXB 3VXMD 4FABH 2RB8A 4NFCA 4XVUD 2C4XA 4HFUL 5FYJU 4HG4K 4K3HA 4QRPA 1UWGL 1X5HA 1AGBB 3OBAA 4WY7L 1T5XA 2ITDB 3LDBB 4P9ML 2ZP0T 1PDKA 3ARZA 2WSKA 3NA9H 3HZKB 1NDGB 1WIPA 4XNXL 4A6YL 1DLHB 3SGKC 1UXWB 4QCIB 3MJ9A 2CJUL 2F74A 4I9WE 3CSPA 4M8QB 1T7ZA 3D85D 4F57H 1U36A 4AT6A 1T89C 4JM2D 5H35B 3EOTL 2KQMA 4M43H 1IAMA 3EHBD 2DM3A 1J1XL 1H5BB 1I9RL 4KK5C 5CLWA 5J57B 4WW1A 1H0DA 3O2DL 1EXUA 1MRFH 1ZHLA 2B4CC 5E2JA 2HT2C 4FQ2L 4L8BA 5ESQA 1VHPA 1DBAH 1CGWA 3CLEH 4BH7A 4UINL 5D7JB 3PP3H 4F7PB 1FO0A 1I85A 3MRDB 3HE7D 3IFNL 4MAYD 4OCYH 2VH5H 4OIIL 2OL3H 4PY7B 1KJ2B 2IGFH 2P24B 4U1KB 3GMPA 3F58H 3HNTH 1Z5LB 2C7UB 3KAAA 3OKNA 4LDOB 3MNWA 4I2XE 1F6AA 2AABL 5GGSB 1SBBA 4Q58C 2AJSH 5ESVA 1NAML 4CU7A 5AYUH 4UT6H 2DQCL 4ZDHA 2SEBB 4XRCB 3QUYD 3EZ8A 4KJPD 1V5JA 3FN0L 1B4JL 4ZOCA 4ZXBD 3BPNB 3LD8C 3LCYA 2V7NB 3VRIB 2MQCA 2HTLC 3DVNB 4AZ8A 3VXOB 3IFLL 1RHHA 2CRYA 4LLVB 3PHQA 3T1FB 3UPAA 1OAUH 1PYWB 3TBYA 3IJHA 3SCMD 3KLSA 4XMKL 2K3TA 3NCYP 4O5LL 1JPTH 2H9GA 4RDQG 1CFTB 4P2QD 1IQDB 4Y4HC 2LV4A 2WNGA 1LP9A 1XGPA 1NGPH 1AP2A 3MOBH 4JO1L 1OD7A 2B0SH 1YJDC 2VXUL 1QKZL 3ARXA 3MV7B 4UI2A 3UBXI 4ELKA 2FEDC 4NKIH 3BGMA 2NY1D 3E3QE 2VAAB 5JIPA 3WFEH 3LKNB 5E8PA 1XAUA 5AAMA 1G9NL 2EIDA 5ICZB 2AJXL 2QQLL 3BEWB 4GQPH 4NC2B 3VXPB