2DI7A

Solution structure of the filamin domain from human bk158_1 protein
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
124
structure length
124
Chain Sequence
GSSGSSGETGGERQLSPEKSEIWGPGLKADVVLPARYFYIQAVDTSGNKFTSSPGEKVFQVKVSAPEEQFTRVGVQVLDRKDGSFIVRYRMYASYKNLKVEIKFQGQHVAKSPYILKGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords BK158_1
publication title Solution structure of the filamin domain from human BK158_1 protein
rcsb
source organism Homo sapiens
total genus 4
structure length 124
sequence length 124
ec nomenclature ec 2.4.2.26: Protein xylosyltransferase.
pdb deposition date 2006-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00630 Filamin Filamin/ABP280 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2di7A01
3BKJL 4PJAB 3HG1E 5IG7A 3V6OC 1KJVB 3X3FH 3ECBA 1QD0A 2ARJA 5ICYA 3HZKA 4X7EC 1NBYA 1B4JH 2ATKA 4TSBH 5FA4A 2Z31C 3H2WA 1NEZA 3FB7A 4P2QA 4Q9BA 5E6ZA 4KK6C 2ZPKH 1QVOA 4TQEL 2VDKL 1S7VB 1F6AB 4OZFB 3G04A 3VU2A 3BKJH 3OHXB 1KXVC 1HXMB 1CVSC 3E1F1 4MMZC 5H37G 3SDAD 2YRPA 4PJDE 1GOGA 1R24B 4Z7VB 2P46B 4LK4A 1WJ3A 4U1GC 2M26A 2NX5B 5DC4B 3ZSSA 4TQEH 2VDKH 1ZLSL 3UTTB 1TIUA 3O41B 2OLDA 2XNAA 5C08E 4KROC 4LKXA 2I24N 4GUPA 1A9BA 4Y5XA 2EH7L 1EERB 2XQYG 3FQTB 4JFXA 3CH8A 5LXGL 5EUOF 3CU1A 4IRSB 3SHSA 1B0RA 1MAJA 1T04A 2ENYA 1KIRA 5EULV 2P8LA 4QRPD 1ZLSH 3O45A 5F72S 3LAFA 3ZHKA 3O3UN 3TN0C 5I1LB 3MV8E 3CK0L 4JDZA 3BP7B 4QHNA 4C83A 2EH7H 4KPHL 3K3QA 3R0MA 2DN7A 4PJ5A 4CVZB 2O61A 4LLUB 4JY5L 4F9PC 1M7DA 3BXNB 4HD9A 4P46B 4TTDC 3WKMH 4BQ6A 3VXRD 1EA9C 5BS0B 3CMOL 5E4IA 1ROWA 4ZPVB 3DUSB 4QCIB 1D5XB 5DJ2B 2VOTA 4QRQA 1BD2A 4JO3L 5C2BL 2VMFA 3ARFB 4U1KB 3MV7D 4JY5H 1MUJA 4J3VA 2J2ZA 4HK0A 5T1LA 5KSBA 1LE5B 5CUSL 4HC1L 2H26A 5DD6B 3CMOH 4XNUL 2NZIA 4N0UB 2XTLA 1CDHA 1XR9B 4OLUL 3QH3A 4NQXA 3L3KB 4RWYL 4JO3H 3BZFA 2VXQL 3KPTA 3KLSA 4WJ5B 5C2BH 5GSRB 4JFYA 1JF1A 5HGHB 3MRLA 4Y2DB 5ACZA 1CL7L 5JNYB 3DV6B 4PREA 1MY7A 4JRXA 4WCYL 3CFJA 1FPTL 3FAWA 5CUSH 1GAFL 1KFAL 5EZJA 1C16B 5L7XL 4XNUH 5ESQB 1CT8A 1CN4A 1FN4A 3ULVD 4OLUH 5JORA 1P2CA 3B3IA 4RWYH 3BWAB 3WUZA 2VXQH 4PRIA 3SJVD 1UC6A 5D4QA 3K2UL 1CL7H 3QDGD 2EEBA 4MHHI 3S35L 4WCYH 4YHLH 1FPTH 1GAFH 1T0NA 1CICB 3C5ZD 1KFAH 5L7XH 2ITCB 2AS5M 2W9EL 4LLVA 3GUTA 2AXGB 1RUAL 3PGCB 2BVPA 3K2UH 4WV1A 1BIIA 1DEDA 5D7JC 3QRGL 1DE4A 3GSRA 4GBXC 3CPLA 5I8EA 1FVEB 3SDDC 3T0XA 4DWHA 3H7BA 4OCRL 4MJ5B 2XV6B 3H9HA 4UU9B 1RUAH 3B9EA 2A83B 5DFWH 1MHHA 3M07A 1OGAE 5E1HB 5FO7A 1QA9B 1PAMA 1RZIA 3OPZL 2WLZA 2NY2C 4FQLL 4N1EA 1OT2A 4F2MA 4OCRH 3TZVB 1S8DA 1KB9K 3V5HB 1U3JA 3P2TA 1T20B 4LVOB 5F93C 3MYJA 4KK9D 3QJHA 3OPZH 3W39B 2AQ1A 4LVNB 1CGWA 2KH2B 1HOCA 4KVNL 4JE4B 2AK4D 4PBVC 4DKEL 3ULUD 4L4TD 1QSFB 3LOWA 2LFGA 4WWID 3WFCL 4P2QE 2NY4D 4F57L 4MAYC 1CGTA 2WQ8A 3V7MA 2VZUA 2FH8A 2E9BA 2V7HB 1SVCP 43C9B 3BPCB 4Z7WF 4XHJD 1BVKA 5HTSA 1Q9KA 1RUQL 4J3UA 3MLRL 5JLZA 3RVVD 4DKEH 4X7DC 3WFCH 1YY8B 4F57H 3P30L 3UTSD 4JZOA 5J6HA 4EDXA 1JPFB 1ULVA 3MFFA 4PRDA 3AFLA 1P4IL 3MUGA 4L9LB 2NY1C 4YNYB 1G7LB 1RUQH 3MLRH 5FOBB 2VDNL 4Z95L 2CKNA 3O3AA 4HS3B 3MRPB 2I27N 2W60A 2FHCA 3WJJC 1FSKC 3P30H 5ICXA 2JB6B 4HKXA 4EI5B 5C0CB 4RQQA 3RGVB 5EUKB 1P4IH 4Y1AB 4HW6A 4NGHL 4E42A 1QLFB 3SE4A 4JPVL 3SCMB 2MQ3A 5JDSB 1K5NB 1QSEB 2VDNH 1KN4H 5JMRA 4G7YL 2VLJD 1CLOL 3L95A 1BQHB 4YPJA 1MCIA 3U0TA 5EU5B 4PJ5E 2F9BT 1JWMA 1N8ZA 1CE6A 3W9DA 1HH6B 3BVNB 2DLTA 4NGHH 3JV5A 4E0RA 3RJDA 4JPVH 4KV5F 4NQVB 4R26L 5GS2H 4KAQL 1J9CT 4G7YH 4HH9B 2B39A 2V5MA 1CLOH 3NGBB 2GJ6A 3WN5A 3QUZA 4ZUSB 2OP4L 4XPTH 2EDNA 1ZT4B 2EYRB 4F33A 4HUUB 4P4KA 1A4JB 4R26H 5MENA 3VXSD 4KAQH 4YGVB 2YPLD 2O5XL 3F8UB 1KJ3L 4N90E 4PJEA 5ITFA 3MJ6A 3E2HC 2Y6SC 1P7KB 4M8QB 3H9SD 2OP4H 1BECA 5FYKL 1IM9B 1WTLA 2ZUWA 3BISA 3O8XB 1GZPA 1K4DB 2W1NA 3TWCL 4PRHB 4JRXE 3NFPA 3U83A 3NIGE 3GMNB 2O5XH 5DJCA 4WI2A 2WWKO 3BP5B 3VXOA 5F88B 1J8HA 2BFVL 2HFFA 2DLFL 1I4FB 3RDTD 1HYSD 2X89A 4PRIE 5FYKH 2RHEA 1K8DB 2VSCA 3HG1D 1NC2D 4R6UA 2VDRL 3TWCH 5GIRA 3VFOA 2NMSA 4B41A 4PJ9A 5GGRA 1FGVL 2BFVH 4FQQB 3B9KC 2DLFH 4CGTA 2NXZB 3DIFB 2P44B 3NCYS 3U0WL 4NKDB 5FKPA 2FSEB 2MNUA 2VDRH 5HHME 2V2XB 2HP4A 1EV2E 5IIEA 1H3WM 5E8PB 3M17A 1TZHB 1ZHKA 1NUNB 2A77L 1FGVH 4Q9RL 3W5MA 1M7IA 1N0XL 5CKAA 4XXCA 1CD9B 1TFHA 4R0LC 4I0PC 3Q6FA 4X9IA 4BH7B 1XIWA 3VXNA 5C0BA 4ELMA 2Q20A 3U0WH 1NDMA 4Y5YB 1H8OA 1DVFB 5C08D 3MLZH 4OAWA 1YPZF 3O3EA 4XRCA 5MEPB 4HUWB 3QIWA 5DJYA 3CU7A 4Q9RH 2A77H 1JFQL 5TDNB 1N0XH 4KHXL 1XFPA 1CR9L 1P5VA 1OGTA 4CAGA 2BMKA 1TITA 1U8PA 1SM3L 2IG2L 2YHGA 2AQ2A 3A6OA 5IHZA 3CH1A 3MV8D 5GZOC 5CCKL 1NCUA 3MSPA 1JFQH 1DN0B 1C12A 1JHKL 4P2OD 4C58B 3RPIB 4KUCF 1CR9H 2AJSL 2P8MB 3QI9D 4MX7B 4Q2ZA 3KHQA 1TCMA 3HN3A 1HEZA 3GEWB 5E2WL 5CGYC 5I8OH 4XVTH 4CN6A 5J1AA 4LGSB 4J7RA 5CCKH 1ZEAL 4G80B 3VFWA 5F7KC 3QEUA 2FJFA 4U1GB 5DF0A 5KBNC 4N8VA 4KMTL 4KQ4L 4IDJL 5I1EL 2H9GA 3QBTB 1EHNA 5D2LB 1N0LA 3DGGB 3IDYB 5KVMC 1T21B 2Z8RA 1P7QA 5E2WH 3NA4A 4KROB 1I1AA 4LLYB 2D2OA 3RI5K 3STLA 1RAMA 5JW4R 1Z0MA 4JO2H 5DQDL 1ZEAH 4I77L 4OF5A 4YAQA 4O00A 5BV7L 4XPFL 5CHNB 4KMTH 4KQ4H 3D39A 4IDJH 4KJPC 4PYHA 1NFIB 1D5ZA 1OVZA 1MQ8A 1EZVY 2FEEI 3P40A 3TN0B 1FLTX 1KPRB 1ZANL 4BFIA 5IEHB 5BO1L 3TIDB 2EO9A 3CFEA 1A9EB 3DI3B 5DQDH 1VB9A 4I77H 4N5UA 5BV7H 4XPFH 2A73B 3ZDXF 5D6CB 1A1MA 5E5MA 3RTQA 1I75A 3BHBB 4M62L 3SEPA 5JPNB 2WWKT 1U3HB 2X09A 2HH0L 3G5ZB 4U1IB 2PYEB 2OSLA 3EYFB 5IMMB 5EC2B 1ZANH 1MCSA 1FJ1B 2VLLA 5BO1H 4OF3A 4MJIA 2AGJL 1T4KB 2V17L 1KLGB 1X5HA 4QHLA 1NCNA 1ZVHA 3C6LA 4QRSA 1C08B 2I5YL 4M62H 5AG8A 5C8JB 4WUUB 5JXED 2HH0H 5D1ZC 1KIQB 2CRZA 2WINB 2Q76A 2R39A 3GSXA 4F7CB 4FXKB 2AGJH 3X17A 5M94B 4JCMA 2V17H 3NVQA 3KDMA 1I8LC 1YMHB 5MENE 3WNKA 1I8MA 2I5YH 3FO9A 3TIEA 1W0WA 3ARVA 1OGAD 1AR1C 1NKRA 4PJEE 4OI7A 1IAKA 4U1LA 3TBVA 3IETA 5BQ7A 1JV5B 5GGVL 1ETZA 4NQSB 4GMSL 5K93A 4F3FB 4YIQA 4K9EL 4K3DL 3C60A 4APQA 2NLJB 5DFVC 1JPGB 2AEWA 3SKJL 2CJUL 4P57B 5F89A 3RHWF 3LEVL 3FOMB 1J8HE 2B0SL 2VDLH 2WLYA 1UKSA 4HT1L 3DRTA 3RWEA 5GGVH 1DLFL 3DO7B 4PJ7E 5FO9A 2W07A 3HI1A 3MLTA 4TUJA 4K9EH 2DYPB 4K3DH 4ZPTB 3VXQA 1IC5L 5J3HD 2AJYL 4JLRB 3SKJH 2CJUH 4OIBA 1S7RA 3LEVH 3KWWB 4I4WB 4P2QD 2B0SH 3TH3T 4R90L 5SX5H 1QACA 4HT1H 5EWIL 4NRZA 4NWUL 4YH6A 2XTJB 4GBXB 5MI0C 2EDDA 3OXSA 3V95A 5H37H 1RUKL 1IC5H 3U1SL 1OF2B 2GUOA 4W4OC 4EQ2A 1R5VB 2AJYH 5LGJA 3TP4A 3V52L 3AS0A 2FGZA 4KK5D 5ETUB 3TA3A 4R90H 4ODTL 1R3JA 4JPWL 4B0MM 3SGDI 5EWIH 3LRGA 4HFWA 4NWUH 1CD0A 2NY2B 3UPRB 4DFIA 1ZA3B 3CFCL 4ELME 1AXSA 4PLOB 3BZEA 1LEKB 1RUKH 4PPTA 3U1SH 3RU8H 3V4PL 5DSCA 2J4WL 5CMAA 5ID1B 1VKXB 1X3DA 5IFHL 4MQSB 3CFIC 3VH8B 1P1ZB 1ZS8B 3AGVA 3MGAA 1QKZL 3O0RL 5DDHA 3CFCH 4I18B 4PIRF 5DMGC 2BSSB 4EKXA 5EU7E 2J4WH 4YR6A 4XT1C 3QT2A 1PGRB 5IVXA 1BX2A 1FZMA 4PLJD 4Q6IA 1LEIA 4MAYB 1N6QL 1NJ9B 1QKZH 4WI3A 3NFSL 3PHQA 3O0RH 5I1AB 4PJ5D 4OZFH 3DURA 1AGDB 1BWWA 1HQ4B 3U36B 3KPRA 1ZHNB 4X6DA 3GMPA 3ISWA 2EXWC 3ZE0E 1WEJL 2QQLL 3DSFL 3SDAC 1N6QH 4N0CC 4OKVB 3NFSH 1KCLA 4MXWL 1BD2D 2BX5A 3PWPA 1AHWB 3BGMB 1Q9OB 2UWEF 1RULL 4QRRA 5T1LD 5F6HI 2QADD 2ZCKL 4HGWB 1T5WA 3QCVL 3LKSB 4NQUA 5T5FL 3V7AE 2QQLH 3DSFH 4N90D 3HI5L 4OCMC 2ZCHL 1QG3A 1J1XH 1OM3L 4QHUA 1A5FH 5T1DL 1CVRA 2C1OB 3QPQD 1RULH 1S9KC 3FB6B 2ZG2A 4NQDB 4PG2A 3WXWL 2ZCKH 4JRXD 3QCVH 4G9DA 1UB6A 5A16A 2E6QA 2BK8A 2DQGL 5JMOC 2C7UA 3HI5H 2VDPL 3LQZB 1JGEB 2ZCHH 3PHSA 1OM3H 3LHPL 3T8XB 3TBTA 1WSST 5T1DH 3GSOA 5EBMA 2J8OA 3HE6B 3QO1B 4J3WA 4PRID 2ZKHL 3ZT5A 2F74A 1DANT 4M6AA 3PABB 3WXWH 1F3JB 1RJYA 4OF7A 4PRAB 4MJIE 4KVCL 2LABA 1J7VR 1D6EB 2VDPH 4ERSL 5FF6A 5EO0B 1NCDL 3EDJA 4QT5B 5EOTB 5CD3A 3DOSA 1SJEB 3LHPH 4RMTA 5I75C 2YOCA 2ZKHH 1UWGH 5IR1B 4M48L 1YNTA 5HHMD 2FDBP 5E2JA 5E7BA 3HC3L 1RIVL 1I7UB 5DGRA 1AY1L 5F7LB 4DVRL 2X70B 3E2HB 4ERSH 4ZXBA 3OV6A 1AD9B 1NCDH 1BGXH 3DO3A 4L3CA 4NP4L 4NC1C 1HHHB 4AIZA 3HB3D 3MRRA 1SVZA 5GQBA 3SKOB 1FQ9C 4M48H 3S6CA 5ENWB 4J4PA 3HC3H 2LV4A 3TCLA 3OSKA 4BM7A 1RIVH 3L1OL 4WFFD 1AY1H 4DVRH 4KJYA 5CJXA 4NP4H 1MAKA 3ULVC 3QXWA 5I0ZA 3MUY1 3CFBA 3LKNA 3H9YA 5HYQB 3LRHA 4L8BA 4LCUA 4L8SA 1T5XA 3C08L 3VGBA 1AC0A 4ELKA 3W9EB 2CIIA 3B9KB 5D7KE 4BSJA 4QXUL 5FFLA 3C5ZC 3S5LG 1FV1A 5KAQF 3EJJX 1A6ZA 2NPLX 4U1NA 3N50A 1I1YB 2DQEL 1KF9B 3C08H 2PTTB 5C0FA 5HGDA 3MRCA 1INQA 4WGVB 4QXUH 2EDKA 2YUXA 1NAMB 4R0LB 4I0PB 3WNPA 4NO0A 1G7JB 1T1WA 2FR4A 3QNYB 1EXUB 4LHUG 3UBXB 4OD2A 2LVCA 1QFWI 4DZ8A 3ZMRA 5IQ7H 1X7QB 4PGEB 4JN1L 1Z9OA 2D7OA 5T1KA 1Q9WB 4D2NA 5JO5A 4GLRH 3JTTB 4ACPA 4DN4L 3I50L 1MF2L 2ITDB 2RR3A 3WNMA 5FA3A 4UQ2B 2O5YL 3I6GA 1T6WA 3P4NB 3CX5J 2BZDA 5GRYA 1MH5B 4I2XB 1JK8B 1RZ7L 4J3SA 4U7SA 1GYAA 4JN1H 5E8NA 1GGBL 3I50H 1MF2H 1IRAY 4B5EA 3T3PF 3C87A 3CZFA 5H2BA 2O5YH 1M71A 3LV3A 3QNZB 5IVXE 1ZLWH 4QHKI 1XCQB 4D9RE 1KG0A 1ZWIB 4IRZL 3F7RA 3WIFB 1MCOL 1PKQB 3EAKA 2X05A 3ULUC 4WW2A 1RZ7H 4UI2A 2NY4C 1GGBH 4MVBD 1QUNA 3KPRE 3DMMB 4OI8A 4Q58C 4X6DE 2EDLA 4P23A 4XHJC 4JRYE 1C1EL 4CADB 3Q2CA 4IRZH 5HHQA 3RVVC 1MCOH 4U33A 4PJFE 3AM8A 3FB5B 2GJ6D 2VR4A 1X5IA 1G0DA 3ARYA 3QUZD 4P5TB 4GAFB 3PWPE 3K4DA 1A7QL 4NO2B 5F7DB 4YO0B 3WUWB 2VABB 4P4KD 3FQXB 2F5AL 5MEND 4WHDA 5E00A 1MAMH 4GRLA 1C1EH 4ZTOL 4U6XB 3C9NA 3V4VL 4GXUM 5MEQA 1XGPB 3E6FA 4X7FC 4O5LL 1A7QH 4I48A 1QSVA 5HI3D 1BLNA 3E6HA 5ITBH 5TQ2L 5A2FA 1J11A 1JYNA 3SGKC 1ACZA 4HK3N 3IKKA 2F5AH 3M1BA 5ID0B 1BFOB 4J2XA 4ZTOH 1CDBA 3V4VH 4KWUA 1J8HD 3RZCB 3ARSA 4WHCA 1FL6B 5JOPE 3MBEA 2X89D 4U7KA 4G9FB 3MLSH 4OM1L 5D71L 3EZJB 5TQ2H 4POYA 8FABB 4RMVA 5ACLA 4P5KA 3GBLA 2DIJA 3WNOA 5D1ZB 1PVHA 3MCKA 4PJ9D 4UV4L 2X4UB 2BNUA 4HKZB 4HIEA 3P9MB 3QEHB 1JMZA 1PLGL 4CVWA 4JQXC 4OM1H 5D71H 3VFUB 1LDSA 5AAWA 3AXLA 4KH2A 3VWKA 1NGYA 1B90A 4IHOA 3DUUB 1OWWA 3JZ7A 4UV4H 4YGAB 3VI3F 1A22B 2J8HA 2X9YA 3DWTA 4NNYA 4A6YB 2HJLB 3IJHA 2QR0B 3MRKB 4D9QE 1I7TA 1S5IL 3WE6A 1PLGH 4U0QB 4M5ZL 1XIWD 5C0BD 3LKPB 5E5RB 2JK5B 4H88L 4YDVA 2VQ1A 3QIWD 2MFNA 4HQQL 4JKMA 4C4KO 3HI6L 2DDQL 2WWMD 3GNMH 1S5IH 3QXUA 4E41B 1ERNA 1DQJB 3MPCA 3BUYB 2G2RA 3MYZA 4RAVA 3RDTC 3L6FB 4JJ5A 4PR5A 1BFTA 2AJXL 2OR7A 5INCA 5B8CA 5IGXL 5L6YL 1HYSC 4YXKL 4H88H 4G6KL 5F9WC 4NJAL 3DROA 3H0TA 4QY8A 1J0JA 1HKLL 3JWDL 3P77A 5EBLA 2EKSB 3KPOB 4AK1A 4WI8A 4GKZA 3NIFF 1MCHA 1A6AB 3HI6H 5BVJA 2DDQH 1DUZB 4U05A 3GB7B 2AJXH 4KI5D 5IGXH 5L6YH 2BNQA 5IQ9B 2DM3A 2ADJA 3DRQA 4YXKH 3KG5A 2AKRA 4G6KH 2JCCF 5GS1C 4NJAH 1OPGL 4HV8A 1JZ3A 1HKLH 3JWDH 3T0WA 1PZUB 1WIUA 4X6BA 4P2RA 3QXAA 5EIIA 3QCTL 1U8QA 2CH8A 4L4VE 4RFOL 4KDVA 4PV9B 4Z7OE 1G9NC 3TBYB 1DEEA 2DQIL 1K8IA 5TFSL 1P7QD 4XP6L 3S4SG 3MZGB 1I1AD 3SDCC 1VGKA 1OPGH 1I1FA 4S1DC 3FRPG 4C54A 1QBBA 2HJFA 3QCTH 4XCEB 2FLBT 2C3XA 4O2EA 4RFOH 2PN5A 3G5YA 2R56L 3D39D 3QO0B 4H1LB 2ZOLB 4MD5A 4B7LA 2H6PB 4TVPE 2DQIH 3KJ4C 3PL6B 5H8DA 2ICES 5TFSH 4MB3A 1A47A 1NCCL 5L0QC 1RIHH 4NN7C 2A6KB 1KIPA 3OF6A 4JJHA 1T1YA 4FZ8L 4L9DA 4JHBA 3SGJC 2PKDA 1CG9A 2ZNWA 3IT8D 3L3GA 3ARBD 1HN1A 2GTWB 3RTQD 2R56H 3T3ME 4GLRI 4P2OC 3KNBA 3QI9C 4PRBA 1NCCH 2IBBA 1V7NL 4QTHB 1CQYA 4FZ8H 4MJID 1S7VA 3SDAB 1EK3A 4OZFA 4Z7QE 5GISL 5DO2D 4RRPG 2DQHL 4MSWA 1HXMA 1BPVA 1L6XA 5D5MB 2VKWA 1V7NH 3BZ4B 4LMQI 5DJ6B 4U31A 1PX3A 1DCLA 2X1QA 4PJBB 1EAPB 3UC0L 1IQWH 2DQHH 5D7IF 3FJTA 5E08L 1NL0L 4FQJH 1TNMA 5L2JA 4Z0XB 4OBRA 2B5IC 2GSIB 1U58B 4XAWL 4QRPB 1AGCB 3FQTA 5ESAB 2Z93B 5EPMB 5EU4B 3DX8B 5ESVB 4DCQB 1F4WL 4X99B 1CFQA 2UUDH 2GITA 1BVLA 3C60D 4APQD 1VADB 2W59A 3UC0H 1AGFB 1GHFL 3OB0K 5E08H 4GRMB 4MJ2A 5CEXB 4C4KT 2CLVB 4XAWH 2AP2A 2Z8SA 3TYFB 1F4WH 5DK0B 4L1HA 5C0GB 2FBOJ 1JF5A 3MRGB 5D70L 3FQRA 1KYOK 5CLTA 1CK0H 1Q1JL 3MR9B 4LLUA 5D7KD 2GY5A 1GHFH 1E6OL 1A7NL 4P46A 1A7BA 1T80A 2DLIA 3BPNB 4CMMB 5JXEC 32C2B 2X4NA 3JWOC 3RGHA 4Q97A 4HCRL 2D3VA 3VJ6B 3BEWB 4D8PB 1D5XA 5D70H 2WK2A 4KY1H 12E8L 2HN7B 2K1MA 1FC2D 1Q1JH 1DBBL 2GTZB 3ARFA 4OFVA 3EO1B 1HHGB 1E6OH 4CL7A 5I1CH 5ECJE 3KPSB 5BVPL 1H9VA 3TA3D 4N0UA 4FRWA 3C6SA 1XR9A 4OZGE 4U1JB 4FG6D 4HCRH 3VGEA 12E8H 1ZHBB 3BE1L 3WS3B 4WJ5A 1DBBH 2G5BB 5GSRA 4ENED 1EJOH 2PF6A 5JNYA 3MRBB 3RY5A 1JWUB 2GSGB 2NQCA 4YPGA 5LGKA 5BVPH 1MEXL 3EGSB 2QSTA 4HUNB 1BZQK 4NZDA 1TVHB 3QDGB 3P73B 2V5YA 4ZFZA 3H7LA 3BWAA 4XP1H 3BE1H 4NUJB 5TPWL 3C5ZB 4W68A 1YN6B 3VGHA 4X6CB 2ZSVA 3DYOA 2LU3A 5J3HC 3VXMA 4D9RD 4FOMA 4WU5B 1JZ5A 3REWB 3GRWL 1JNHA 1JWSA 1MEXH 1OSPL 2ITCA 4MDIB 4Y16B 2FWOB 3L3HA 4YDIH 3VFMA 2EE6A 3UJJL 3NIDF 2BNQE 3C2AL 3PGCA 3KPRD 5TPWH 2UV3A 3VMPA 4GXUN 1RHHB 1RK0B 5B22A 3GMOB 4YFDB 5F96L 3T2PA 4MCZA 2MHAB 3GRWH 1OSPH 3DVFA 1MOEA 3VRIA 5GRZA 4Z9KB 4ZUVB 3PWPD 4U2YA 3UJJH 3C2AH 2A83A 4ZDHB 4M61B 4QRRD 3GJFH 4HWNA 5FM4A 1QLRB 1QA9A 3EW3B 1TCRB 5F96H 2VKXA 4Z7NF 4Y5XC 1XCTB 3O3BB 4D0BB 1JF6A 4P0DA 1FCCA 4ONGL 5SX4H 5DMYA 3V5HA 4X98B 5EN2A 1T20A 5F7HA 3RI5F 3IAQA 2AK4B 3MRIB 3X14A 3AMKA 5FIEA 3I84A 4L4TB 4HHAA 1CDIA 4RAHA 1LE9B 5HY9A 1CIDA 4QNPF 2XQYK 4HPYL 2NY4B 5F1KC 5JOPD 2R2BA 5CEZE 5HHNB 3VFVB 4WI5A 1QSFA 1QFWM 4GS7C 4J12A 1U91B 1MCQA 4WTZA 3O11A 2PO6D 3WEXA 2QTEA 1MCFA 2EDFA 2V7HA 4XH2A 1MI5E 5BJTB 43C9A 3BPCA 1RZ8A 3PP3K 2NW2B 4HPYH 1QO3B 3UTSB 1UB5A 1FIGL 5GS2D 4JDTH 1DJSA 2CDGB 5E5UB 2E9IA 1OP3H 1HHKB 2VZTA 1W0YT 5HD8D 3O9WA 1K6QL 1JZ7A 4JKPL 1JPFA 3TBSB 2K3TA 3WNLA 4Z77B 2QADC 3MNWA 4L9LA 2JJSA 1ORSA 4OLYL 4ZXBD 4HJGB 4D9QD 4YNYA 1FORL 1G7LA 4JZNA 3GMMB 1GPOL 3VRLE 5JPMB 1U93A 4YDLB 3L7FA 3I3BA 3TBWB 1LMKA 4HS3A 3RL1B 3BT2L 3JV6A 1FNGB 1K6QH 1FGNL 1NUGA 3QPQC 4QXGL 3IFNL 4JKPH 4J4PD 1FLRL 3C2SA 1HSBB 3RGVA 3TM6A 2A6IB 2VLJB 4OLYH 2ICEB 1QLFA 1FORH 3SCMA 5IWLA 1GPOH 1YA5A 1UCBL 5A2IH 5C09A 1BQHA 1FGNH 2X1OA 3JVGA 4JG1L 3EOBA 4NNXB 3RX7A 5BZDA 4QXGH 3IFNH 5K9JL 1N5AA 1ZVYA 2DIAA 2OI9C 4LL9A 5EU5A 1FLRH 2UVEA 3BPLB 2OJZH 4BUHA 2J88L 3QP3A 1T1ZA 2CDEB 1FFNA 2EC9T 2ARWA 5E2VH 3KPQA 4EI6B 1M05B 2H2SD 1UCBH 2XZCL 4G6AD 4HH9A 4UIKL 4JG1H 1JUFA 3IXAB 5K9JH 4WV1C 5KS9B 4MWFA 1MQKL 5GRUL 4M7LT 5SWQB 3NCBB 4MMXC 4RBPK 5B3JE 4GRWE 1MCCA 2YPLB 8CGTA 4L4VD 2EYRA 1AD0A 4Z0BH 2J88H 4GMTL 4NO0D 5MERA 2J5LC 2XZCH 1JYVA 4UIKH 4ISVA 5T1KD 4LLDB 1MQKH 3E3QE 5GRUH 3VFPB 1IM9A 2WP3O 4R7DB 1K4DA 2GFBB 2N1KA 2FHFA 4N5ED 4KZDL 3RWCB 1GOHA 4GMTH 4LEOB 4PRHA 3RDTB 1OWRM 1BMGA 4MS8D 1NBVL 3GMNA 4S1QL 4GW5A 3BP5A 5F9WB 5F88A 4G6JL 3HG1B 1NC2B 1U92A 4YE4L 1E27A 4KTEH 4X0KA 1CF8L 1KCVH 3T1FB 1K8DA 4KZDH 4NPYB 3VXME 3PGDA 3EO9L 1NBVH 2HLAA 4S1QH 1EHAA 2EDXA 5GS1B 5FDWA 1X6NA 3GJEA 4FQQA 4G6JH 3FN0L 5DS8B 1R5IB 1CLZL 3DX6B 1BBDL 4ZD3L 4OCWL 1CF8H 4PJDB 1N3NB 5KVDL 5DRNA 4H26B 3FTGB 4WI6A 4P23D 5KAQG 4X5XA 3O3DB 1H15B 2APFA 3MA9L 3FN0H 5C08B 5D6DA 1CLZH 4PGDA 5E4EC 3P0YL 3PF2A 1BBDH 1GRWA 4YK4C 3L3IB 4ZD3H 4OCWH 3V0VA 1E28A 5KVDH 2DICA 2E7LA 5MEPA 3FFCE 3KJ4B 1A1NB 3T4AB 4NKOB 1GOFA 3NZ8B 5L0QB 1P84K 2Y25A 3MA9H 4UUJA 1B9ZA 3DGCR 4AZ8A 1R0AL 4FHBD 3P0YH 3MV8B 3N1FC 3QIBA 4F7EB 3GSWB 4MA3A 1KC5L 5HGBB 1QLEL 1P5UA 3B9VA 2XG5A 4MAUL 2YC1A 3SE4C 3ULSB 4K8RL 1DQQA 5FECA 4LP4A 5IMLB 1DN0A 3MBED 1ORQB 1P4LA 2B8OT 2Q8AL 4LMQE 3BQUA 3EOTL 3Q48A 1QFOA 1MPAL 4MVBC 1FVDB 1QLEH 2QBWA 2X1PA 3K2MC 5CWSB 3KLDA 3ROOB 4MAUH 2ZJSL 2W65A 5CBEB 2LU4A 4K8RH 2GIYA 4G80A 2CLRA 5ABDE 4OZIF 3H6JA 3JUZA 5IB2A 2FJGA 2WIIB 1J18A 2PYFA 1H0DA 2P47B 1WBYB 3WN5C 2R0WH 3X11A 2Q8AH 3QUZC 5GRJL 3DGGA 4JFQB 1DDHA 3EOTH 1MPAH 3VWKD 3T0EE 2HTKC 1BREA 2B1AL 4P4KC 1ZOXA 2B5IB 2ZJSH 4W6WB 5TF1L 2AV1B 5F6IB 1AKJA 2EDWA 3UTQA 1T66D 1NDGB 5L88L 2AERT 1K3IA 3B4NA 3AAZA 1WFTA 1TZGL 4WUKL 3RVXD 5HJ3B 4QRTB 4U0RB 3UZQA 3F5WB 4G43B 1LHZA 5HI3C 3UX9B 2B1AH 3BDYL 4NBZB 3WFDL 5IEHA 2D7MA 4Z7UF 2WP3T 1A9EA 4L29B 5CJ5A 2BCKA 3WHXB 5D6CA 5A40E 5L88H 1D3CA 1FNEB 3BHBA 1FFRA 1MJJA 2K7PA 1TZGH 4WUKH 4YFLF 4DUVA 1U3HA 1FL5A 1PX4A 3G5ZA 5C09E 5TH2A 1VFAA 2NY5L 5IV2B 3BDYH 3GGWB 3WFDH 1XGRA 1FJ1A 4LLQB 5CJ8A 4QRUA 4PJ9C 2R0ZL 1B2WL 3OJ2C 4EQ3A 2BNQD 2CR6A 4PGZA 4O2CB 3RY6A 2WINA 5EDXA 2NY5H 3ROLB 2GT9A 5I15L 3KPLB 1JE6A 3NCMA 4F7CA 4F9LA 4A6YH 1MFEL 5CJOL 4QGYA 2DB8A 1F42A 1OGAB 1PYWA 2C3VA 5F9JB 5DK3A 1UEMA 1BOGB 3KR3L 4PJCA 1OARL 5DMKB 1B2WH 4XXCC 1P7HL 1DBML 1XIWC 3MLWL 3RIFF 2A38A 3WD5L 3BIAX 3SY0B 1P6AB 5I15H 3FB8A 4NQSA 5TE7L 3B9AA 4ORZC 2AJVL 2EEAA 4HCRA 1WAAA 1MFEH 3IYLW 5CJOH 4YEEA 2NLJA 4GG6F 2OK0L 4R3SA 4IMLB 3KR3H 1OARH 2VXVL 4Q74A 4HWBL 2WWMC 4UDUA 3ARZA 3S36X 2YN3A 5AD0B 2IMNA 1DBMH 4M3JA 5D72H 3MLWH 4RNRA 5T3XL 2LAGB 2P48B 1AP2A 3ECBB 4XB7A 3HZKB 3VFTA 5TE7H 2AJVH 4EEEA 3B2UD 5EU7C 3TH4T 1OD7A 1NBYB 2ATKB 2FBJL 5FA4B 1NEZB 2OK0H 4P2QB 1NFDA 4X6FA 2B2XL 1C5BL 1SYVA 4HWBH 1QVOB 4WWKB 5DD3L 3SDXF 3G04B 5AEAA 4KI5C 5T3XH 4NQCA 1F5WA 4CUCA 3BD4A 4OV5A 1ZLVH 4PJGF 2EDRA 1FG2A 4F7PB 4XP9L 4TVSa 1AIFA 1OF2A 2B2XH 4F7MA 1EVUA 4HMCA 3ZKQD 4GAJL 5DD3H 4HKJA 2Y5EA 2IANE 4X83A 2XNAB 3BD5A 3GRWA 1LO3L 3NFNB 1I1AC 4LKXB 2R0LL 2X42A 5J6GA 1A9BB 1U8LA 3L5HA 1CQKA 4XP9H 4JFXB 1DQDL 5I71C 4AEIL 2GAZA 4H1LH 3GJFA 2AABL 1B0RB 2VNCA 4QKXB 5ID1A 1UWXK 4GAJH 1KIRB 2P8LB 3O45B 3VH8A 1P1ZA 1ZS8A 1UYWL 3UBXI 1LO3H 3OKYA 2VE6B 4GAYA 2D4FA 4OZ4B 4HJJH 2R0LH 4JDZB 4QHNB 4C83B 1BZ7A 1YEFL 3QHFL 4I18A 1DQDH 4AEIH 4OI9A 3LD8C 3G9VA 4X5WA 2J7LA 4POZD 2AABH 3RTQC 3FRUA 2EKJA 5EG6C 4PJ5B 1K9TA 4ZOCA 5EUOA 4GS7B 3IU4L 1UYWH 1F2QA 1Z5LA 4KRPD 3U7WL 5SWSA 4W4NA 1YEFH 4RMQA 5DO2C 4TULL 5BW7A 5DQJB 4QRQB 3C6LC 3TF7C 1SEQL 1K2DA 3IU4H 1DBKL 1MUJB 3CDGB 3ZYIA 4HK0B 2ORBH 2O5ZL 3ZKNC 4OKVA 5KSUA 5T1LB 4F15C 2QADB 1J0KA 5C0AA 4XC1H 4ODWB 2DI9A 5E2UL 2YMXL 3U7WH 1AHWA 1JP5A 3ARFD 1XF5B 1CXEA 5DJZA 1V3LA 1CU4L 4HS8L 3PDOA 2VL5A 3BYYA 4TULH 3BESR 3QH3B 4NQXB 2CGRL 4M4PA 1CFTB 1SEQH 2P8PA 3VFGL 1DBKH 4JFYB 1JF1B 3MRLB 4K3JL 3UXFA 5JXAL 5ACZB 2O5ZH 1KT2A 4JRXB 3CFJB 5E2UH 2YMXH 1D6VL 5M7QA 1MVFA 4UB0L 1CT8B 3C60C 4APQC 1CU4H 3U82B 5M95B 5JORB 2CGRH 1P2CB 3B3IB 4PRIB 3ZDYE 1IGML 3VFGH 1S3KL 3JSSA 3F7VB 3FQNB 3LQZA 4K3JH 5JXAH 2R0KL 3K1KC 3UP1A 1Q94B 5F3BA 4L3AA 3HE6A 3QO1A 1D6VH 1IAMA 5HHXL 4YXHH 3G5VA 1IGJB 4UB0H 1EBPA 3PABA 4M1GL 3VXMD 4OGXL 1X5AA 4LLVB 4BSVB 3B5GA 3GUTB 2BVOA 4E5XB 2BVPB 4Y4FA 2ED8A 4H0IA 1IGMH 1S3KH 3S5LA 4WV1B 2R0KH 2B7DT 5HHMB 1VDGA 1SJEA 3MNZB 1DE4B 3GSRB 1CDGA 3L7EA 5I8EB 3CPLB 5HHXH 5J8OA 3PWVA 4LASL 3HE7A 5IR1A 3RUGF 4DQOH 2BOBA 5SWZA 4M1GH 5C9KA 4OGXH 2J5LB 3H9HB 1IT9L 1MHHB 4OUUB 2X70A 3TA3C 1AD9A 4PJCE 5KW9L 5FO7B 4LHUA 1RZIB 1HHHA 3IVKB 4FG6C 4OLXL 2IAMD 5TE6L 4LASH 4RDQG 4F2MB 4XWOD 5FO8A 5HDBF 1AE6H 5HVGB 1N2RA 4V2CB 4ENEC 4XNMA 1S8DB 1WAAE 5LWYL 4MA7L 3MYJB 5KW9H 1S9VA 3QJHB 2YUZA 4UV7H 1AC6A 5LGHL 5C3TA 4N0YL 4OLXH 4UDTB 5TE6H 5DZNA 3T2NL 2FIKA 4LF3B 1JN6B 4UT6L 3BW9A 3PDGA 4G3YL 1WCBA 5LWYH 2P4AB 1WFOA 2AEQL 1NFDE 4ZAKA 3U7YL 4MA7H 4Q6IC 4LSSL 5LGHH 4HIIA 1QSFD 1EO8H 4N0YH 5CZVL 2ZUXA 1ZGLP 1B4RA 2DKMA 1MCNA 1BVKB 1Q9KB 4NQCE 1IGIL 1I1YA 1BVZA 1WGOA 1QZ1A 2C9AA 1EEYB 4UT6H 2PTTA 4G3YH 3OBAA 4X4YB 3OAZH 2AEQH 3U7YH 4DJMA 5FK9A 3VFRA 5E4EB 1G6RL 4JZOB 4LSSH 5J6HB 4YK4B 3WS6A 5T33L 4DN3H 3MFFB 4KMQA 4PRDB 5LAXB 3MUGB 3O9WD 5CZVH 3RA7L 5D2NE 2ZNXA 2YPVL 1IQDA 1IGIH 1ZV5A 1BEYL 3GHBL 1ZTXL 35C8H 4Z7WA 3O3AB 1Y0LA 1QBLL 1RPQA 4HKXB 4K23L 5E99H 5T33H 4RQQB 2BVQA 4PJIF 3AREB 1J12A 4E42B 2YPVH 1OP9A 2P1YA 2JIXA 4EIGB 2QHLA 1JGUL 4PG2C 5CLWA 1BEYH 1ZTXH 2YXMA 1CLYL 2EDJA 2GK0A 1LO2L 5C1MB 1QPPA 3NBNA 1QBLH 2NY6D 3HC4L 3SCMD 1LP9F 4L3EA 3CMGA 4K23H 3U0TB 1EGJL 1JGLL 1ZWIA 5EUOE 3OJDB 1JWMB 1N8ZB 3W9DB 3DI2B 5C09D 1CS6A 4LBEA 3F62A 1S5HA 5FGBA 4E0RB 1FBIL 1JGUH 3LKRA 2YD6A 5SWSE 1CLYH 1LO2H 2EE3A 2IQAA 3DMMA 1TTFA 4PJHF 3QQ9D 4U6VL 5KANI 1KCSL 1EHLL 3WN5B 5E8DL 5EO1A 1EGJH 3QUZB 1JGLH 1PFCA 4K7PX 3Q0HA 1VSCA 4F33B 1S7TB 4R97C 4QXTA 5HD8C 1T7WA 1FBIH 4WEMB 2FRGP 4P5TA 5C0AE 1XF4B 3U2SA 5GRXG 1N59B 3WUWA 1AJ7L 1NGXB 4PJEB 4U6VH 5ITFB 1EHLH 4ZXBC 4EJ1C 5E8DH 1JZ8A 4EN3A 4ZOEA 4U6XA 3V6BR 4KI1A 3S8WA 1GZPB 2DM7A 1RURL 1XGPA 3V4UL 1INDH 1RSFA 5JIKA 5B38G 1BZ9B 4MA1C 4J4PC 3WFHB 1AJ7H 2PW1B 3VXOB 3DV4A 1J8HB 4PRHD 4HG4J 4LCCA 4GKNB 4PJXF 1W0VA 1CGVA 4PJ7B 5CJXC 5I6XC 3E0GA 4I3SL 5EU6A 2WV3A 4XNYL 4JFOA 3RZCA 3VXTA 1RURH 3V4UH 4XBEL 4KKBC 1FL6A 2A9NL 4Z5RA 2XWTB 3VFOB 4L8SC 5DVKA 1I1CA 3O4LE 5GGRB 4WO4D 1DL7L 4OTXL 3TGXA 4XNYH 1A7OL 1HXYB 3MXVL 4HKZA 1P9MA 3DSNA 2FX7L 2H2SC 2NXZD 3P9MA 4G6AC 4XBEH 5HVFB 2A9NH 2DQUL 3D9AL 2B1HL 5IIEB 1HWHB 5EU3A 3STBA 1I8IA 3M17B 1ZHKB 1KTDB 5SWZE 2R9HD 1DL7H 1M7IB 3CC5B 4OTXH 1FCGA 1II4E 3ARDB 3OXRA 2YD4A 3P3YA 2WM0A 3Q6FB 3V5DB 4MQ7A 2IQ9L 3VXNB 4ELMB 1A7OH 3MXVH 2FX7H 1WZMA 2DTML 1RY7B 2F53E 4OAWB 3O3EB 4XRCB 2DQUH 5DVNA 2B1HH 3QIWB 2NY3C 1S78D 1MREL 1T2JA 1FNAA 1SEBB 4JANA 3IB4A 2C3GA 3FRPA 4FABL 3S34L 5ADPL 4N5EC 2IQ9H 1OGTB 4LIQL 5GJSL 4NQTA 1U8PB 1CTOA 5C0DA 3QEQE 4E41A 5IHZB 3QIBD 1Y18A 1ONQB 1MREH 5D7SL 3NMEA 2VUOA 3J7HA 1C12B 5ADPH 4FABH 3S34H 5F7EL 4M9OA 5D8JH 2AEPL 5BRZA 2QJDA 4LIQH 5GJSH 2J8UF 5GSVA 1HEZB 4WW2C 5J1AB 3A67L 1JHTA 3BQUD 4HWBA 4NO5B 5D7SH 1Z0NA 4RMWA 5EZLA 2F58L 3QEUB 2FJFB 1VEPA 4N8VB 3WFBL 4XNZC 5F7EH 5C0IB 1U2HA 2H9GB 4P23C 1HNFA 2AEPH 2Q7NA 3TO2A 1VPOL 1T3FB 2SEBA 2C4XA 1T89A 1P7QB 1HHJA 4PV9A 1I1AB 3AM8C 2NTSP 3A67H 1G84A 1XMWA 5I71B 5EZOL 2HFGL 3K74B 2F58H 1RZGA 3WFBH 5JOEA 2E8YA 4Z7WE 2HRLA 1D5ZB 1QYGH 4GRLC 1VPOH 1AKJD 5IB5A 1M7XA 3ZKSD 1IC7L 2Q6WB 4H1LA 2ZOLA 4BFIB 4Y19A 3LSOA 3CFEB 1YEKL 3X13B 3LD8B 5I1IL 5EZOH 2HFGH 3ARBB 4ZNCD 2IBZY 1T1XB 1A1MB 2CRIA 5E5MB 2D4DA 4TSAL 5IT2L 3NN8B 1IGFL 4OQTL 4L3EE 1IC7H 5BV7C 1VFMA 2A6JA 1OT1A 1SYSA 2APTA 2HLFD 2VLLB 5I17A 3MBEC 3OQ3B 1U3HD 4MJIB 4AQOA 4XXDB 1YEKH 4BZ1H 3T65A 5I1IH 4BZ2L 1A14L 2VISA 2W9LA 1XT5A 1RU9L 4QRSB 5K59F 1PY4A 4P59L 1G0YR 3UTPE 4TSAH 4MQXD 2KBGA 5IT2H 3WFEL 5ADOL 4F15B 1IGFH 4OQTH 1JPSH 3GSXB 4KDTA 2XPGA 4XMKL 4BZ2H 3LDBC 1A14H 3BZ4A 3KDMB 3FAXA 4X7CC 5J11C 1RU9H 1I8MB 3K81A 5DJ6A 3VWKC 4P59H 3TIEB 3F7YA 5IW1A 4KV5E 1AO7A 1EAPA 1OAUL 2EECA 2FLRT 3PWNA 3R8BB 3WFEH 5ADOH 5IB3A 1IAKB 2XXMB 1QFHA 3IETB 1ETZB 1T66C 4ONHA 3OKKB 2VERN 4KGJA 4MNHA 4YIQB 4FN0A 3GSUA 3C60B 4QRPA 4XMKH 4PGBA 4APQB 4O58L 5DI8B 3MODL 3RVXC 4DCQA 2J12B 2P24A 4OZHF 1JL8A 2FATL 1KB9J 3G5XB 5F89B 1OAUH 3GSQA 1MJ8L 2NXYD 4JGUA 3S37L 4IMKA 2W0KA 5EU6E 4TUJB 3TCXA 3EYOA 4X4ZA 3VXQB 5B8CC 1K4CA 2ILLA 3Q5YA 4JAMA 4O58H 1I3UA 1NAKL 3MODH 5DK0A 5ANMA 5KSBF 5C0GA 1QRKA 2C3HA 1ODAA 3ILQD 3T0AA 2FATH 4CRPA 3WO4B 2Y1VA 2I26N 5DRXB 2KZ1B 1MJ8H 4K9EC 4NRZB 3S37H 4NCC1 4AEHL 1V05A 2Z9TA 3WLWD 3V5KA 3OXSB 1LK3L 4MYWB 5TDOA 2ATPA 4U6HA 4JGJA 1NAKH 4NQCD 4BJLA 2XTJD 4OF8A 3VJ6A 5LGJB 2GI7A 4LAQH 5E1AB 3BJ91 2IALA 4PFEA 3PV6A 2CO6B 4WGWB 3TA3B 5J1SC 3EO1A 1HHGA 3QULA 4HFWB 4Z76A 4AEHH 1U8IA 1J5OL 4NT6A 1LK3H 4TSCL 5EO9A 3KPSA 1AXSB 4J3XA 3BZEB 3GIVA 3HNSL 4GKOA 1D5MA 2AJUL 3KJ6L 5DSCB 4U1JA 4AYFA 3IJYA 4L8CA 5CMAB 1ZKAA 5ERWA 3OJVC 1I7RA 1QTYT 3WS3A 2ZUUA 5DC0A 1FFPB 3MCG1 5DDHB 5GGQL 1J5OH 1A4KA 4TSCH 3HZVA 1RJZB 3RBSA 5AG9A 2AJUH 3KJ6H 5JQHC 3U0PA 4PP1C 1TVHA 3QDGA 4YR6B 5IVXB 1BX2B 2I9TA 1LEGA 5FYLL 1LEIB 1YPZE 3B2UC 1IFHL 5C6TL 2QQNL 2NY0D 3PHQB 4DEPC 3GI8L 4L4JA 5GGQH 5FM5M 3DURB 5BRZE 2YUWA 3R1GL 5C9JA 4OLEA 4NSKA 3KPRB 4MDIA 3HCVA 4Y16A 4X6DB 2R29L 5SWSD 3UAJC 4JRYB 5F9AC 5FYLH 5GZND 4B53A 4BYHA 4PJFB 4U1HB 3U7AA 5C6TH 2QQNH 1A6UH 3AUVA 5ISZA 3UDWA 5T3XE 4FFZL 3GI8H 3PWPB 3R1GH 2Y36L 4P3DA 1EFQA 5C0AD 2R29H 3PWLB 4ZUVA 2XKUA 4XCFL 5JTWA 1EMTH 4O2FB 3SO5A 3VFNA 1YEIL 4WDIA 5HYSG 3MUZ1 2ZUSA 4FFZH 1TCRA 4QHUB 2O26U 5JIIA 3GBNL 2Y36H 4JREC 3GK8L 4YHNA 4RIRB 3RL2B 3O3BA 4Y19E 2VO5A 4G9DB 4IRSC 5A16B 2UWEA 3D3VA 3CSGA 2HKHL 3QEGL 1YEIH 3IDUA 1SMOA 2AXFB 3MRHA 1REIA 1S9WB 3TBTB 3FHQA 3GSOB 5EBMB 1BOYA 4POZC 3GBNH 4P2CG 1UM4L 3GK8H 4MGXA 4KTYA 1RJYB 3QDMA 3HE6D 5HHNA 2HKHH 2PO6B 4JHWL 3O4LD 3QEGH 4KRPC 2XWJA 3LN5A 5DMJB 1F6FB 2IEPA 4ESKA 5CD3B 4XVUD 3PXJA 3HAEB 4Y4FD 4P46C 3VGFA 3ZDXE 1N5YL 1UM4H 2VLRA 5ALBL 2NW2A 1JBJA 1PBYA 4FQXA 4X7TB 1HK6A 1EGJA 4JHWH 4F8TA 3HE7D 3WDJA 1TTUA 1A3RL 1V5JA 4G5ZL 5SWZD 3ARFC 2F19L 3K7UA 3UJIL 3TBSA 4L3CB 4NYLB 3FO0L 4AIZB 3FT2A 3QG7L 1AO7E 1N5YH 5HDQL 2NNAA 3MRRB 3RWHA 5ALBH 5I66A 1Q9LB 2F53D 4LHUD 3GMMA 1T0PB 3EUUA 3CLFL 3FN9A 3TBWA 3E3QC 1FNGA 2FO4A 4G5ZH 5DA4A 1H8SA 1YQVL 2F19H 3UJIH 3KLHD 4KJYB 4NWTL 5I6XB 3FO0H 1U8HA 4D0CA 1BQLH 3QG7H 1PZ5A 3C09B 4NKIL 3RY4A 1EBAA 3CFBB 5HDQH 3LKNB 3VD3A 4L8BB 3QEQD 4PLNC 4LCUB 2EZ0D 2NW3A 1T5XB 3CLFH 5F1SA 3BP4A 1DANU 3QXDA 4XCNB 4ELKB 3AU1A 1C8PA 1E6JL 5ANME 4KK8D 3HR6A 4YHKL 3V6FA 4Y4KA 1FV1B 4NWTH 1A6ZB 4M02A 4OLWL 3ZE2F 5JA8B 5KG9B 4NKIH 4U1NB 4FS0A 4ZAKD 3UZEA 4YHIA 4NZUL 4QHMA 5FGCE 2E27L 4OIIL 4M7JL 1A6TA 1HCFX 1X5XA 4LQFL 5C0FB 5HGDB 2OTWA 4L4VB 5I1HL 2Y9RT 3IXAA 4YHKH 2CRMA 4NO0B 4P99A 1T1WB 3DTXA 5SWQA 4OD2B 1NKOA 3RHWK 4DZ8B 4NZUH 1W8NA 4ZOAA 2Z8VC 3LEYL 3V79C 1VFOA 1QHOA 2E27H 4OIIH 5T1KB 4M7JH 2HYMA 5JO5B 3D25A 1D7FA 4LQFH 4JY4A 3QUXA 1OLZA 4PRNB 5I1HH 2D9CA 4BKLA 2N7BA 5FA3B 3I6GB 4JVWA 4LLDA 1L9NA 2MPAL 4NCC2 4XWOC 1BWMA 4GO6B 1WVZA 1I8KA 1F11B 2FB4L 3LEYH 2QSQA 2XA8L 2F54A 3RWCA 2DAVA 5E8NB 3PNWA 4JO1L 2ERJC 4M1DL 1A3LL 2JIXD 3CZFB 5H2BB 1MCPL 4LVOC 5HDOA 1M71B 3LV3B 2MPAH 4LGPB 1QRNA 1KG0B 4U2ZA 4U49A 4KHTL 3ZT7A 2FB4H 2G75A 4L3ED 2XA8H 3MRNB 1TENA 3FKUS 3LQAH 4QF1B 3TNMA 1OHQA 3F12A 4O9HL 4JO1H 4P9HH 4M1DH 1A3LH 4LLAA 2YA1A 2APXA 4LGRB 4ODHL 3HZYA 4XNZB 1MCPH 3MRJB 4P23B 4GH7B 3DX6A 2ID5A 3UTPD 5HHQB 5JUEL 4NM4L 3CAFA 4KHTH 3DMMD 4OF0A 5ISZE 5CSZA 1XGYL 2EIZB 4HK3J 5IMOA 4DTGL 4O9HH 1S7SA 4K8RD 5JW3L 4NHCH 4XI5D 3O3DA 3UJTL 3O9WC 4ODHH 4P5TD 1TVBB 3DARA 5EBGA 1GGTA 4LDEB 3GDBA 3L3IA 3C9NB 5JUEH 4NM4H 3ZHDA 5MEQB 2MQCA 4L9LC 4YEFA 2JJSC 3RWJA 2R23A 3EDEA 1XGYH 4EN3D 2X9WA 4BH8A 3D85A 3M45A 1QBMH 4KI5F 5JW3H 5KJRL 3E6HB 3NZ8A 2ICCA 1JGDA 3M1BB 1P53A 4K3GA 2UWEE 3D3VE 4XBGA 4LSRL 3WO3B 1ZK9A 3I3EA 1ITBB 4F7EA 3RGVC 5KVEL 5BV7B 2ZG3A 3MBEB 1A3QA 2EDOA 2NY6C 3ESUF 3SCMC 5IWLC 5EU6D 4YFEA 3QG6A 5F9DC 2BP3A 3F65A 5KJRH 2C5DC 2V2TA 5E9DE 5IMLA 1EUUA 3HPLA 3JVGC 4P5KB 2IFFH 5C71A 3QDME 1DP0A 3TJHD 2AK1L 4M03A 4LSRH 3P4MB 4RFNC 3MCKB 3QUYD 2BNUB 4HIEB 3D0VA 4HMDA 3RNQA 3QQ9C 1MCEA 4MNQA 5CBEA 1RHFA 2AI0L 1S7QA 1NCTA 3IDIA 1ZLWK 2VLRE 5J11B 3NGBC 3VWKB 4OQTA 1NGYB 1QNZL 3QPXH 2AK1H 4IHOB 1G1CA 1WBYA 4XVSH 3BRDA 2OS7A 4P3CL 4JFQA 4M3KB 1F13A 4NNYB 3OKNA 2W0FA 3MRFB 4WNQA 2RIKA 3WE6B 4OZGB 2Y23A 2AI0H 5JQ6L 1EHXA 2AV1A 1MHCA 3ZO0A 2J6EL 3CX5K 2VQ1B 1BFVL 1QNZH 4S2SB 4R4ND 2DWEA 3GSVA 5HJ3A 2X4SB 2PW2A 3F5WA 1MY5A 3N85H 3RVWD 1WIOA 4JFZL 3PJSA 2G2RB 1E0OB 3FOLB 4X8XA 2B4CL 1X9QA 1R3IL 3K46A 4PR5B 5INCB 5B8CB 5JQ6H 3FT3A 4NZTL 2EYSB 1CLCA 2H1PL 4E41D 1S7UB 3UYRL 3DROB 1FNLA 1FNEA 2J6EH 4QY8B 1BFVH 3P77B 1F2XK 1GZQB 1V3MA 5EBLB 4KKLD 4FQ1H 3TYGL 5DD0L 2F8XC 3VXUA 3GIZL 4NJ9L 2FECI 3GGWA 2B4CH 4G42B 5BRZD 3NH7L 2KL6A 2BNQB 4NZTH 1IGYA 2ADJB 3DRQB 2AKRB 2H1PH 3W0WE 1ZLUK 3UYRH 2CLZA 4HV8B 4PP2A 4X6BB 2NXZC 1CGSL 3S97C 5L8KB 4I1NB 1JHLL 5DD0H 5EIIB 1U8QB 3GIZH 5GPRA 5GGSB 3OKLA 3ARTA 5T3XD 5HYFA 3ROLA 4DK6A 1DEEB 3NH7H 1JI2A 3JWDC 3RAJL 3T4YA 1K8IB 1KGCE 4KUCD 1V3JA 5DZLA 5F9JA 4Y8DC 1VGKB 3HNTH 5EA0L 1I1FB 1H3PL 5D6DC 1CGSH 1PEZA 2JCCA 1JHLH 2HJFB 5DHYA 3AROA 1S78C 4O2EB 3I85A 5L8LB 2E7LC 4MD5B 2IGFL 3V0AC 4MB5A 4YWGH 2HA1A 1HKFA 3RAJH 5DD1L 2CQVA 2DMCA 2F54E 4WHYG 1PEWA 4Y19D 1UM6H 1RZKL 1PQZA 1T1YB 1IZJA 4NFBA 1CG9B 3RX5A 3L3GB 3QIBC 3U46B 4AY0A 4Y5VB 2Q7YA 1YEJL 4DEPB 3LS4L 2P7TA 3DPBA 1QRNE 2IGFH 1A1OA 3KNBB 4ZSOA 1UJTA 3HLAB 4DVBA 5DD1H 4LSTH 1U8NA 1BP3B 1BAFL 3I02B 4PRBB 3BKYL 4WEUD 4HX1B 4Z78B 1CDJA 3G6JF 1RZKH 4G6ML 4KUZL 5B39G 4WWKA 3L3JA 2QQQA 3BQUC 1MI5B 5C0EA 2WZPD 4WY7L 4LIQE 4MSWB 2HG5A 1YEJH 3IF1B 3LS4H 3SDDA 2BVUA 3T3PE 3IXTB 3QUKA 3NABL 4F7PA 3KYOA 1B3JA 1BAFH 5CZKA 3BKYH 3K8LA 1ES0A 1A2YB 4G6MH 3MGOA 4NHUA 4KJWD 3U48A 1OY3B 4WY7H 3VE0A 1QEWA 3IDYC 3NFNA 3ZYOA 3TT1L 2VAAB 2EDEA 5L2JB 2VIRA 1F45A 4U6TA 4JREB 1AO7D 3NABH 3R4DA 1CFQB 5CJQL 2GITB 4BQ8A 5DGQA 2QSCL 1BVLB 4NDMA 5A3ID 4GW1A 4WTXA 4LSQL 2RAMA 1DFBL 3TT1H 2VE6A 3S35X 1BM3L 4OZ4A 4HH8A 4UMGA 3V6OE 4I8DA 4D3CL 2YRZA 3ZL4L 3X12A 5LXGH 3BJLA 5AAMA 4DGYL 4XB8A 1IAIL 5CJQH 4MNGA 3FQRB 2HVJA 2QSCH 4KRPB 2HLFC 4GSDL 1U3HC 2Q86A 1H3UA 4GJTB 1OAYL 1DFBH 4RZCB 3H3PL 2HKFL 4JCLA 4J8RA 1BM3H 3CK0H 2R1XA 3ZL4H 4KPHH 1NGWA 4DGYH 2X4NB 4ZO7A 3HUJF 5F21B 1IAIH 4FTVA 4MNQE 5DQJA 1IGTB 2D0HA 4GRWB 4GSDH 3TFKD 2HFTA 3CDGA 1OAYH 3RY6C 3H3PH 2HKFH 2WBKA 4ODWA 1OTSD 1R3LB 1CDYA 4F9LC 3NCYP 1XF5A 3VRJB 4M5YL 2E7MA 4I3GA 3C6SB 3SGEH 3KPSD 1CFTA 2ZUVA 4GW4A 2UYLA 4X8JA 3TLRA 1D9KB 1UGNA 4MXQD 1MJUL 1G7PA 4YPGB 4HC1H 1H3XA 1YZZA 4M5YH 1I9EA 4NQEA 5F44A 2DQDL 3VI3E 4TN9A 4ZFZB 2NXYC 2VDQL 2BVEA 4LCWA 5BXFA 2W38A 3F7VA 3FQNA 5DQ9A 1MJUH 1Q94A 3QXTA 4M7KL 4MCYA 2ZSVB 2CUHA 3UROR 1BQSA 3VXMB 4IEFB 2YA0A 1K3ZA 3VXUE 1IGJA 1JNHB 1JWSB 1Q0XL 5CGMA 4BQCA 2DQDH 3L3HB 3O4OB 4BSVA 4UT9L 3VFMB 2VDQH 4E5XA 2GCYA 4KFZC 3WLWC 4TOYL 3F6LA 4FQPA 1KCRL 4Y16D 1KTLB 4M7KH 3S35H 3MNZA 4WRLA 3N1MC 4CU7A 2XTJC 4MCZB 3ORJA 1Q0XH 5T3ZE 3VGGA 5ISZD 3VRIB 2W9EH 4D0DA 1F4HA 3NIFE 5DRWB 4RX4A 5IEKA 4UT9H 5C86A 5JA9A 2IAMB 3BKCL 4OUUA 4TOYH 1WWBX 5KN5B 3QDJE 3BRGC 1KCRH 5IB4B 3CXHK 3LPFA 2B20A 3QRGH 2JCCE 3FFCB 3FQUB 3IVKA 3DHJA 1OSZA 4AJ0A 2ERJB 3TPKA 3EYSL 3BKCH 1KOAA 5EN2B 3EFDL 5D1QB 5JW4N 2Q8BL 5K9KA 2Z4QB 4ZFOL 3D3VD 4GKSB 5E7FA 4M7LL 3P4LA 3X14B 4CN1A 3OTTA 4UDTA 3V6ZA 5I0DA 4FQLH 4HHAB 4LF3A 1YMME 3CDFA 5HY9B 2WNGA 4I18C 1YUHB 5IVZA 1JN6A 2AVGA 1C7TA 5DLML 5IVOA 4JPKL 2R2BB 2JB5L 4OFIA 3I75A 2NY0C 4ZSOE 5FXCH 3EYSH 5IF0A 5T5NF 3EFDH 3ME0A 4LKCA 2Q8BH 4LU5L 3QDMD 1AQDB 1IARB 1UA6L 3O11B 3K1DA 3MLVL 4Z18A 3WEXB 4M7LH 1OP5K 4XH2B 1RK1A 2WAHA 3ZDZF 1F4YL 2VDOL 4KVNH 5GZNC 1RZ8B 2CUIA 2XN9A 4JPKH 1EEYA 1UB5B 2JB5H 5FDYA 5BW7C 3TVMA 2DQFB 4X4YA 3BO8A 2VLRD 3O9WB 5FYLE 2X44D 1Z9SA 4LU5H 3T0EB 1BJ1J 1UA6H 4FQXD 3MLVH 3MFGB 3MNWB 4HXBL 5LAXA 5F71A 1JNNL 1OLLA 1AHWC 1F4YH 1ORSB 2VDOH 4XNQA 2A2QT 1YYLL 2C3WA 1HILA 1X4YA 4JZNB 4OM0L 5I1GL 1U93B 2IADB 1TZIA 3L7FB 1B0GA 2CKBL 4ZUUA 4XMLL 2NYYD 3JV6B 1QR4A 4WW2F 4YHYC 2R2EB 3U4BL 3RWDA 4RFEB 2MCPL 1MIML 5FHAL 3S96A 5J9PA 1U8OA 4U1SB 4XVJL 3WFZA 2EICA 4HXBH 1WIPA 1JNNH 3AREA 4JQVA 2FYYA 4XCYA 3IFOA 2VQTA 1YYLH 2NY6B 1T22A 4OM0H 5ALCL 5I1GH 5C07E 1H3VA 4Z95H 4OB5L 5D7IE 2CKBH 4H25A 1UM5L 3QJFB 4XMLH 3T1WA 5C09B 3H9ZA 5J56B 3ARQA 3EOBB 3U4BH 5BZDB 2MCPH 1MIMH 5FHAH 1YC7A 1N5AB 1OQOA 3BYTA 4RFNB 4MNGE 3MC0A 4XVJH 3OJDA 3W82A 1WC7A 1BJ1H 3HE6C 4AM0A 1P69B 2F15A 4NIKB 1G7IA 4Y4KD 1L4IA 1T1ZB 5I1JL 3HAEH 1FFNB 5ALCH 3KPQB 4OB5H 1CCZA 2BXZA 3CDCA 3QFDA 4XVUC 2IPKA 3ESVF 4Y4FC 5B3NA 3C5SA 1JUFB 1MHEB 2Z8WC 3W0WD 4FTVE 4MWFB 1T0MB 4OGYL 2E9WA 3ARUA 5F1NA 2XA3A 4FQIL 3FONB 1AD0B 1S7TA 3G6AA 3HE7C 4KKNA 5I1JH 1XF4A 1W8OA 5MERB 3RX8A 3V8CA 4LFHD 3QDAA 1Z2KA 3O2DL 1O7VA 1N59A 1KGCD 4O51A 1NGXA 4ISVB 2QHRL 4U6YA 3LB6D 4XPGL 4ZOBA 5IW6A 4OGYH 3EDFA 3AMLA 4HWZB 3QUXD 1A0QL 4FQIH 4YBLB 3JTSA 4CVXA 2EDTA 1IAII 4GG8B 4LVHC 3T2OA 4YHPB 2V7NA 3CVIL 1BZ9A 1W72L 3KLHC 2BHZA 3O2DH 3OKDA 3WFHA 4R96B 4GW5B 1KJ3H 2PW1A 4NQEE 2F54D 2DMKA 2QHRH 3DUHA 3IRZA 3C8DA 4GKNA 1U92B 4RGMC 4XPGH 1E27B 4PJ7A 4X0KB 3WL9A 2EZ0C 4LCWE 5LQBL 1HDMA 3MCLL 4WO4B 2AXJA 4MXVF 3SGEI 4FQCL 1QRND 3DYPA 2XWTA 3PGDB 3THML 2J6EA 3CVIH 1TETL 2HLAB 3UTOA 1DLHB 3IGAA 4PBWD 5I18L 4RAUA 5FDWB 4NNPL 3GJEB 2EC9U 3KLAA 4ZAKC 5AYUL 3PIQA 3MJ8B 5IB1B 3STZA 5LQBH 1HXYA 5DRNB 3MCLH 5C0ND 4FQCH 1RJLA 3THMH 4OJFL 4TVPL 2WW8A 4NBYB 5F97E 1LVEA 1RI8A 1TETH 2ZCLL 2APWA 5A43C 5I18H 1KLUB 4X5XB 1CL7I 2VZVA 2IANB 3W2DL 1KTDA 4NNPH 4CDGC 5AYUH 3CC5A 4FP8L 3SKMA 3ARDA 4PGDB 3UYOD 4HS6A 4YQXL 1YY9C 1SBSL 4MHHG 3V5DA 3WS6C 2CIKA 4XC3L 1FL3A 3V0VB 1E28B 1MJ7L 2GJJA 3NIDE 2CSPA 4OJFH 1M4KA 4ZQKB 4TVPH 4WU7A 2ZCLH 2ICWB 2ARJQ 3ZHLA 1SEBA 3W2DH 4UUJB 1G7HB 3VMNA 1TJHL 3D85D 3OKEA 4IDLA 4YQXH 1FYTA 1SBSH 3QIBB 3QUMB 4XC3H 1VENA 1MJ7H 4MA3B 3F7PC 4MJ6A 3UEZA 3VGAB 4ZNEE 2OJEA 2YC1B 2H3NA 1ONQA 2P5EA 1DQQB 5FECB 4QO1A 5IESL 4Z7NE 4KHXH 1TJHH 1P4LB 1TQCC 4JM2F 3VDBA 3BQUB 3QZWG 1SM3H 1LNUB 2IG2H 5I76B 4X6EA 2IH3B 4NC2B 5FGBC 2W65B 4NO5A 2CLRB 5IB2B 5IESH 2FJGB 2XN9E 4RMUA 5C0RL 3DMMC 1JHKH 1OQXA 3U9PL 1N64L 1BJMA 1H0DB 2GY7B 2PYFB 4MNQD 5C0IA 4I9WE 1A21A 3X11B 2AJSH 4QNPE 4XHQA 1T3FA 1T7YA 2GK2A 1DDHB 2BNRA 4R2GB 4K8RC 4M6NL 4XI5C 1KV3A 1ZSDB 3OB0H 4HXAL 4HLZG 4P5TC 4Q9QL 1UADC 1DR9A 4ODXB 1AKJB 1QBAA 4PJAF 3UTQB 1RUML 1U0QA 3U9PH 1N64H 3AAZB 5I1EH 2XZQL 4MZ2A 4EN3C 2X4OA 3LMJL 4M6NH 5F8RC 2Q6WA 4R7NB 4HXAH 4HUVA 2HT3D 4Q9QH 3X13A 2XKSA 2NR6D 3EYQD 3ARBA 3SBWA 1RJCA 1RUMH 1T1XA 2BCKB 3O6LL 4FXGB 4LCCC 1MJJB 2XZQH 2YUVA 2GEEA 2LE9A 1FL5B 3NN8A 5TH2B 4Z7VF 3CX2A 1VFAB 3RZCC 3LMJH 4WFHE 1XGRB 1I3RA 3TJHC 3QA3A 4XXDA 5JIHA 3VXUD 3ARRA 4N8VG 4QRUB 4Z7UA 2Z91A 3KYKL 4IOIA 3BEVA 2ADIA 5JHDA 4HIXL 1P9MC 4TPRL 1I3GL 2GT9B 3PWJB 4CKVX 1FO0B 1NEUA 1SY6L 3SE3A 2C3VB 1PYWB 1CFNA 4PJCB 3UCRA 3KYKH 3DNKA 4U3HA 2NY5C 4AIOA 3O6ML 5A2JH 2VN7A 4HIXH 2XFXB 2Z0BA 1MIEL 4TPRH 1I3GH 3FB8B 2FX8L 3OKKA 3R06A 1A8JH 3ALPA 4EXKA 1SY6H 4M1CD 4R4NC 5DI8A 4ZYKA 4R3SB 2NXYB 4UDUB 3RVWC 1CDUA 1KXQE 3G5XA 4WHYH 3O6MH 3H42L 4UBDD 2RB8A 1J1PL 4HC1A 1MIEH 1T7XA 4J6RL 4RNRB 4X9FA 1AP2B 2FX8H 3VFTB 4GMSH 2BSRA 4J3OC 3KYNB 3ZTJG 4KKLC 1NFDB 1HINL 4R4FL 4X6FB 5I9QB 1SYVB 4KDWA 3IS0X 3E8UL 1TLKA 3H42H 1J1PH 5DRXA 3D5OF 2DQJL 4J6RH 5E2TL 4NQCB 4PD4K 1D5IL 1DLFH 4G8IA 4OV5B 4WWKD 5EIVA 3B5HA 3JUYA 5INDA 1FG2B 5TDPA 4EDWL 4WEBL 5DEGB 1HINH 4TNVF 1AIFB 4R4FH 3SDDD 4YHML 4WFGE 4F7MB 4PTUA 4IRJB 1I85A 3E8UH 3QQ4A 5I73C 1B6DA 1YECL 5E1AA 1IL1A 4HKJB 1UT9A 1TJIL 5FYLD 5D2NB 2DQJH 3RVTD 1T89C 5E2TH 1I7ZB 4K71C 1D5IH 5J6GB 1U8LB 5GS0L 1S9XA 4EDWH 4WEBH 4ZMAT 2CK0L 2GAZB 3GJFB 3NTCL 3JV4A 4YHMH 5CEZL 2P5WA 2R15A 4PJGA 3V52H 3IU3A 5FV2A 1YECH 1DUYA 1TJIH 3U4EA 2EE2A 5HYSA 4ODTH 2WBJB 4JPWH 1FFPA 3QB7C 4GAYB 1FYTE 3S88L 5GS0H 1BZ7B 1RJZA 3PL6C 3EYUL 2CK0H 4Y89A 4UNVA 1X4XA 4X5WB 1AGBA 3V4PH 5CEZH 2XZZA 2NY0B 3PP3H 3FRUB 5C07D 4IIQA 3NZHL 4MLSA 2P5EE 5IFHH 5EUOB 2JJTA 1J8KA 1Z5LB 1L9MA 2LAAA 4RCAA 3S88H 3AC0A 5SWSB 4KJQD 2IMMA 4UIMB 4KRNA 5F7MC 3F7QA 5K9QI 4ZFOA 3NZHH 4JRYA 1NBZB 3SKUD 1K2DB 1YJDL 4PJFA 4U1HA 5DWUL 1IMHC 5KSUB 4FTVD 5C0AB 2AEIT 2DL2A 5IMKA 1WFNA 9CGTA 2BNRE 4X4MA 1E4XL 4KDTC 3TNNA 4KJWC 2XQBL 5DJZB 3BOVA 3BRFA 3LZFL 3NCEB 4QGTA 1FAKT 3PDOB 2DIBA 2UY7A 2VL5B 3PWLA 3IAGC 1WEJH 2DMBA 4O2FA 2JF1A 2P8PB 1YJDH 4YHYB 1EEQA 5DWUH 3EHBD 4HSQA 1KT2B 4MXWH 4OZIE 2WIMA 1JI1A 1PG7L 3ARGA 1E4XH 1X5JA 3QIUA 3MV9A 2XQBH 3LZFH 5CFHA 4RIRA 3RL2A 3AS2A 5T5FH 4U3XA 4NQED 2AXFA 4NO3A 1S9WA 5F3BB 1I3VA 1J87A 2AJ3A 1PG7H 4IMKC 2ZP0T 4LCWD 3G5VB 2CKBA 3O4LB 4RBPH 3D0LA 4XWGL 3AVEA 2BVOB 2DQGH 2PO6A 4Y4FB 1KIUA 4PS4L 3S5LB 4Z7UE 5CSGA 3TO4A 3HAEA 3L7EB 1IM3B 4GRWH 2VXUL 5JHDE 3PWVB 4BA8A 1GH7A 3HE7B 5DFTA 5DUPL 2APBA 3BPNC 5E94A 2BOBB 4XWGH 5SWZB 3A6CL 3IKCA 1XF3A 4X7TA 4KVCH 1M6OA 2IJ0C 1OTSC 4PS4H 5TGBB 4CMHB 4RX4D 3QFJE 2F53B 4LHUB 4NYLA 4AIXA 2VXUH 3DX9B 2DS4A 5KVGL 5C0JA 2AJZB 4LVHB 5DUPH 5FO8B 3HC0A 3BP6A 1JMXA 1Q9LA 3A6CH 1N2RB 1SJHB 3RBGA 3L5WA 4MXQC 3RUGA 4XNMB 3EOYG 4RGMB 5J0BA 3CVHL 1S9VB 3QEQB 5EOCJ 1Z3GL 2FIKB 3O2DA 5E6IB 3S98A 1CYGA 3BW9B 1G9ML 2R4RL 4R9HA 4XCNA 3L1OH 1WCBB 1IJ9A 1WZKA 5HGAB 4ZAKB 1FE8L 1MFAL 1MCBA 3CVHH 5FYJL 3VXRE 1KJMB 4GG6E 1Z3GH 4HIIB 5KG9A 5D7LE 1N4XL 4N8CL 1KB5L 5EOCL 1W72A 3IDGA 1DSFL 1WF5A 2LU7A 1AXTL 1N6UA 1QOKA 2IPTL 5EZIL 5C6PB 3RIFK 2J1KA 4Y16C 1HI6B 3MV7E 1G9MH 4NKMA 4L1DA 1YYML 3DVGA 4Y8AA 2XWBA 5FK9B 4L4VA 1FE8H 1MFAH 2XN9D 3VFRB 2Y7QA 2IBGA 1IAIM 5FYJH 3N0PB 3UDWC 4I9WD 3TVMD 1N4XH 4N8CH 4NC1E 1KB5H 2GW5A 5EOCH 1DSFH 1IQDB 2XIDA 1AXTH 2IPTH 2DQEH 3SDXE 4RWHA 4P5MA 1ND0A 2ESVA 3BIBX 4Z7WB 1E4JA 1Y0LB 4W6YB 5CS7A 5DEFA 1JIBA 1U8JB 1YYMH 4KQ3L 4PRNA 4JN2A 2P5WE 4PJGE 5D9SB 1MFDL 2PTVA 3WLBB 1BFSA 2YZ1A 2BVQB 1QFUL 5J06A 3PXHA 1F11A 3DBXA 2BC4A 3PV7A 4K94L 4DZBB 4LP5A 2JIXB 1UZ8A 3SJVE 4KK9C 5TQ0L 2Q1EA 1U3ZA 3ARED 2GK0B 2M1KA 4UTBL 2HJKA 4DN4H 4KQ3H 4WVRA 5D1XA 1TQCB 4L3EB 1MFDH 1GC1L 1QFUH 4UQ3B 4XX1G 4LBEB 1WFUA 1RMFL 1S5HB 3N06B 3MRNA 4PJIA 4WFHD 4QF1A 1LO0L 2A6DB 5TQ0H 3LKRB 2CDFB 4LLMA 4UTBH 4M43L 5CBAB 2IQAB 4R8WL 2V2WA 3L3OA 3MRJA 1LD9A 4JFEA 5EO1B 1GC1H 5AZ2L 2HT4D 5CD5D 5T5NG 1LP9A 1EUTA 1RMFH 4LPVA 4QXTB 3U2SB 1ZE3C 2EIZA 4K3EL 4HZLA 2YWZA 5CGTA 5J12C 2BVTA 4FQXC 1ZVSB 4X4ME 3DX7A 2NY7L 4R8WH 4YDJB 4P9ML 1TVBA 3IDNA 1OAKL 4EN3B 4KJPD 3ES6A 4PJHA 2IFGA 4NZRL 1NC4A 3K8KA 2OXGA 3INUL 1PD6A 4K3EH 4BZYA 3DETD 5A1AA 4HDIA 2W91A 4YDLC 2RFXA 3MV9E 2NY7H 4PY8J 3MOQA 3DV4B 4P9MH 4LCCB 1W0VB 3WHE0 4WW1A 5F7YC 3DLQR 3O6FA 2X41A 5EU6B 1UZ6F 4S0TD 4JFOB 4NZRH 5DT1L 4LPWA 3INUH 3VXTB 1ZMYA 4S11A 4Z5RB 2YS4A 5H35B 4O5LH 4I0CC 5D2LF 4L5FL 3QUYB 1A6PA 3A0OA 3L5XL 4Y4KC 3GFUA 3P4MA 4LSUL 4AQ1B 4DOHE 3BMWA 2O93L 3BPLC 4PJXA 5DT1H 3SO3C 3OL2A 2V9RA 5EU3B 4L5FH 1I8IB 2YPKA 2IH1B 4WFGD 3OXRB 3L5XH 4XMPL 4LSUH 4MQ7B 1FC1A 2OL3B 5FYJU 3MRFA 1C5DA 3ARDD 1B88A 4OLVL 3KYAA 4OZGA 3LB6C 1NCBL 2FZ3A 1V7ML 4YX2L 3LRSA 4ODBD 1DN2A 3S4SB 4JANB 3QUXC 3VA6A 4S2SA 3RUGE 1QQDA 2X4SA 3NCCB 1SY6A 2W92A 5C0DB 4P4RA 2YRLA 4OLVH 1FYTD 4Y4HA 3FOLA 3WIHL 2DQCL 1V7MH 1Y18B 3OB8A 4M5ZH 3WDHA 4YX2H 1KPVB 2EYSA 1YPZB 1XAUA 2ICWJ 4B50A 1S7UA 3VG0L 3PHOA 4HQQH 1GZQA 1AR2A 2P5ED 5HDBE 5BRZB 2JLLA 5KZCD 5GSVB 1AFVL 1OW0A 2VLME 1JHTB 5B21A 3V2AR 1ZT1A 3WIHH 2DQCH 2MOVA 4G42A 3T77A 4EUPG 3WJLA 4KU1A 5EZLB 5CZXD 2ADFL 2DKUA 4K07A 1DBAL 4A2MA 2H32H 2BSED 3VG0H 5B39A 5J13C 5C0NC 5I73B 3TO2B 2OX5A 2SEBB 3UYPA 4K71B 3VXSE 1HHJB 5GGSA 1AFVH 1XGTA 1YNKL 3B83A 3QUML 2J8UA 3CNKA 2BNRD 2P49B 2ADFH 1RZGB 4HLZH 2OR9L 1DBAH 3H9SE 5DJ8A 4LRIA 2LTQC 1OCWL 4M00A 2ESVE 2YD1A 1PSKL 4Y2OA 3LKOB 4J23A 5IB5B 1YNKH 3VDCA 4Y19B 3QUMH 1V3KA 3LSOB 1Y6MR 4XP6H 4HG4K 2AV7A 2A74A 3ZT6A 2OR9H 3LPGA 1KCUL 1OCWH 1IE5A 5B4MD 3SDYL 1PSKH 1JYWA 3U46A 4CN4A 1X44A 3N1QC 4Y5VA 2A6JB 1SYSB 5I17B 3HLAA 3GMRA 3T65B 3I02A 2VISB 4HX1A 4PJIE 4Z78A 1KCUH 1WBXA 2QV2A 3SDYH 1HHIA 1CDCA 2EXWD 5K9OB 1LK2B 1MI5A 1J05A 5I30L 3ALXA 3IF1A 4FQ2L 1MVUB 1YEDA 4JFEE 4P2YA 4N0CD 1JGVL 4K55A 3IXTA 5L2KA 3I9GL 5JHDD 1LP9E 2PXYA 3BI9X 2XPGB 2UZYB 1YEEL 4WI7A 3EBAA 1A2YA 2DM2A 2FNBA 3LH2L 3FZUD 3F7YB 3MACL 5IW1B 5I8CA 1AO7B 4WFEE 5IB3B 2XKNA 2XYCA 3PWNB 5GISH 5I30H 4PV8A 4FQ2H 2VAAA 3QFJD 1CZ8L 2VC2L 4ONHB 4G8GA 1JGVH 4MNHB 2X5PA 4PJHE 3I9GH 3GSUB 3B8YA 5HPOA 4PGBB 5F6IC 3U9UB 5EBWA 1YEEH 2P24B 5FB8A 2PNDA 2GJZA 3LH2H 3MACH 4NN5C 4RA0C 2HT3C 4ZUTA 4HUKB 3ZYZA 3GSQB 4U0RC 1NL0H 4ZFFA 3WKML 2NR6C 3SKNA 1CZ8H 3EYQC 2VC2H 4RGNE 5CP7B 2FD6L 4Z8FL 2OTUB 3ZKXC 5CEYB 3EYOB 3HNVL 1KUMA 1K4CB 1IAOA 4JAMB 1ITCA 5ANMB 3ZTJH 1HNGA 1I9RL 3EIFA 1FO0L 3L5IA 4OZFG 2AXHA 4OZHA 5DJXA 1CFVL 4RZCA 5FGCB 1T83A 3RKDD 2FD6H 4Z8FH 3V5KB 1JTTA 5D7LD 5TDOB 3HNVH 4PJXE 4CNIA 2ATPB 5JDJA 4U6HB 1QHPA 1X5YA 1G7MA 2DBLL 3NPZB 1JZ4A 1I9RH 1FO0H 1IGTA 4LCYA 3I2CL 2PTUA 2IALB 3PV6B 3IJSA 1CFVH 4RDQF 4U1MA 3QULB 4Z76B 2OBGA 2DQTL 1A7NH 1U8IB 3EDDA 1R3LA 4NT6B 5EO9B 3VRJA 3GIVB 3HKFA 1D5MB 3FQWB 2DBLH 1CXIA 3R8QA 3IJYB 4L8CB 3SN6N 4XP5L 5ERWB 3B5TA 1S9YB 1I7RB 3I2CH 4PY7A 2L4OA 3GSNB 2MWCA 2X4PB 2P5WD 4C56A 4YHLL 1D9KA 4M1CC 2DQTH 3FO1A 1A4KB 3HZMA 3HZVB 2OQJA 2QKIA 3GKZA 2YD2A 1EIBA 2CUMA 3OR6A 4UBDC 4PY8I 3U0PB 2VITA 2DOCA 2BY0A 5BMFL 4XP5H 4PRPE 2D7PA 2I9TB 5C70A 1LEGB 1HQRA 3MRDA 4LSPL 2YEZA 3T09A 1R3KB 1WT5A 3OX8B 5C9JB 3SE9L 4NSKB 1FFQA 3S3PA 3MLXL 3HCVB 2WBWB 5BMFH 3CVHA 4KRMB 4TNWK 5DJDA 3IFLL 4WWKC 1KNOB 2VLKA 3UPCA 3MGTB 1KTLA 4LSPH 4DUXA 5ISZB 3VWJA 3K4ZA 1VA9A 2PETA 3CSBA 4JRYD 5LG1A 1XF2A 3IDMA 5FOJA 3SE9H 1R5WA 3ABZA 4P3DB 3MLXH 4NBXB 4KK5C 5DRWA 3RVTC 2J8UE 4YDKL 3IFLH 1RVFL 4LEXL 3VFNB 2IAMA 1N7ML 1UJ3B 1KB5A 1FZKB 5KN5A 4WDIB 5IB4A 3RKPA 3FQUA 3FFCA 4UZGA 5IK3A 2EE9A 4YHNB 5I1DA 1TXKA 5C7XL 1G6RB 2UWEB 3D3VB 4YDKH 3ARGD 1RVFH 1L0XA 4HIHA 3RP1A 3QIUD 4LEXH 3MV9D 2Y4SA 1N7MH 5KVFL 5GRVK 3MRHB 5D1QA 4C57C 2Z4QA 4GKSA 1IEAA 2FEEL 1MCLA 5T1MA 5DVLA 1YUHA 5E9DB 1MRFL 2ADGB 2ICWI 4PLJC 4ONGH 3QDMB 5C7XH 1UFUA 4V1DA 5FEBA 3T08A 5KVFH 2XWJB 3LN5B 4KJQC 1MCJA 1AQDA 1FFOA 1EEZA 2OMNA 3ZLQC 3SE8L 2VLRB 4YBQD 3TO4D 4AENA 1MRFH 4HIJA 5J12B 5L2KE 4FQXB 2DQFA 4XPHL 4H5SA 3T0EA 5HHPB 3LIZL 3OKOB 3FT2B 2X7LB 6CGTA 3W11D 3SE8H 2NNAB 5K59E 3RWHB 3BIKB 5I66B 5HPMA 1KN4L 1KEGL 3FT4A 4G8GE 3EHBC 5IUSA 1FIGH 4F37K 2IADA 5HSFA 3HPJA 4XPHH 3TEUA 2FO4B 4EIZC 2R2EA 4RFEA 3BGAA 3LIZH 4U1SA 5DUBA 1U8HB 4D0CB 1PZ5B 2J3SA 1IVLA 5I8KL 2H8PA 1KEGH 4N0FB 2NW3B 5AYQA 1FDLL 1H3TA 3BP4B 3QXDB 2C26A 7CGTA 3QJFA 3AU1B 1NUDA 3BT2H 4WTZG 3V6FB 4Y4KB 4XPTL 2V9TA 3BH8A 4OZHE 4YHIB 4O02L 4HPOL 1L7IL 3UMTA 1QR1B 3SO3B 4QHMB 5I8KH 3W0WB 5I74B 1OB1A 4QOKA 2VLMD 1FDLH 1A6TB 3MRQA 1E4KA 2P43B 3TT3L 3G08B 1UQSA 1V8HA 3QISA 2OTWB 1BD2E 1MHEA 5EH1A 3KXFA 1T0MA 3DTXB 5KSBE 4O02H 4HPOH 1L7IH 5D93C 3FONA 5J57B 1X4ZA 1WISA 4ODSL 5BZWB 3TT3H 3D25B 3FO2A 1CXLA 4JY4B 4K2UL 3QUXB 1IKNA 3P4OA 4BKLB 3HB3C 1YNLL 3IAPA 2ESVD 1A6VL 4HWZA 1I8KB 3LEXA 4HUMB 2C4FT 2E7BA 4C56E 4GG8A 4WHTA 2F54B 5HHOA 3SPVB 3VA2C 4YHPA 4ODSH 4TVPD 3PNWB 4EOWL 1BQHG 4R96A 4K2UH 3QXVA 1U6AL 5GGTL 1YNLH 4JFFA 1QRNB 3X3GL 1A6VH 5DHVB 2G75B 5D1XD 3SGDH 4WO4A 3PQYA 4OFDA 3TNMB 2I9LA 4HWUA 3F12B 4ZO8A 5DURB 5KSAA 4EOWH 4HGMA 4H8WL 1DLHA 1MLCB 4P49A 3HZYB 5J13B 4YE4H 1U6AH 5GGTH 2XI9A 3QZWA 3MJ8A 5IB1A 3WIHA 3LQAC 3X3GH