2DI7A

Solution structure of the filamin domain from human bk158_1 protein
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
124
structure length
124
Chain Sequence
GSSGSSGETGGERQLSPEKSEIWGPGLKADVVLPARYFYIQAVDTSGNKFTSSPGEKVFQVKVSAPEEQFTRVGVQVLDRKDGSFIVRYRMYASYKNLKVEIKFQGQHVAKSPYILKGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the filamin domain from human BK158_1 protein
rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords BK158_1
total genus 4
structure length 124
sequence length 124
ec nomenclature ec 2.4.2.26: Protein xylosyltransferase.
pdb deposition date 2006-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00630 Filamin Filamin/ABP280 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2di7A01
2D9CA 4ODSH 2NXYB 5IGXH 2CQVA 5IROA 1U95A 3QPQD 1XIWB 3NA9L 4G6JH 1A0QH 3TO4A 1QUNA 2LQRA 3T2OA 5C1MB 1B4JH 4DQOL 5DA0B 4HWNA 1DBML 1KEGH 2PNDA 5DSCA 4DEPB 1GYAA 3CFDB 4JVPA 1YPZE 2XZCH 5EU4B 5D2LE 3TBYB 5DGQA 4LPXA 2JELH 2IQAB 2FB4H 2GITA 3H2WA 4JPIB 1M7IA 4LEOB 2NY0D 1UKTA 1LO2H 2Y07H 3BGMB 1T5XB 4HIEA 4M00A 2ARJA 1KPVA 3GI8L 3LMJH 4KK6D 4K23L 1LO0H 3WHXB 3TN0C 3D2UA 1JJUA 5MEND 1TLKA 5I0DA 2BNUA 3FFCB 3QULA 1IAOA 4I0PD 4LBEA 5KVEH 4OV6F 5ALBL 3TPUA 1MHPH 3T1FA 4G80A 1DVFB 1ODAA 1QLRA 1R3HB 1X44A 2DTML 3PGFH 1QSFD 1QLRB 1R3HA 2VTFA 1NPUA 15C8H 3MR9B 3HI6L 3VXRE 5KN5B 4OZFG 2QQLL 4JM2D 4YK4C 5EBWA 2PYED 3GEWB 5BQ7B 3B4NA 3DVNA 4LCWA 4LLWB 1Z9MA 1BD2E 1K8IA 1BAFL 1T21B 4OKVB 2VLRE 1T1ZA 3AXLB 5TH2A 2P42B 1H15B 4MGXA 2YS4A 2AQ2A 1QSEB 1U8PB 3EYQC 2R2EB 2I25N 3KYKH 4Y2OA 4Y5YB 3M8OH 4P2RE 4ZFFB 1E27B 1DQTA 5DA4A 1UWXK 1MFEH 1DQLH 3HE7A 4XBEH 4C4KT 5F7NC 2DTSA 4CNIB 4JFYA 4H26A 3DBXB 5EUOA 3VFVB 1XF5A 5IEKA 3BGMA 3PG2A 1L9MA 1NC4A 4XAWL 2DLIA 1RZFH 1BQHG 4JZNB 1RZJH 4O58L 5DD5L 5FHAH 3OKLA 3PNWB 4LEXH 5E6ZA 5DK2B 4Z18A 4MD0A 4M7JH 1PZ5A 2DQCL 5C09B 4M48L 5A2FA 3FQTB 4N1EA 1LE9B 2D9QB 1ZXQA 4YHNB 2P7TA 1T7ZA 3C5JB 5KSUA 4BFBD 1X6LA 3VXOA 4EKXA 1CYGA 1VKXA 3W9DB 4LSQH 1JGLL 4PJFA 4MA1B 1KYOK 3PWPB 3MLWH 4EEEA 2JIXA 1MFDH 1U8IA 5CD3A 1NCDH 4LVOC 2FD6L 3CH1A 5E70A 5HYIA 2J3SA 1CFVH 1AD0A 1RIUH 3LV3A 4NRXB 2EDLA 3ORJA 3FOLA 4OIIL 3SE3C 3K0WA 4NIKB 3LQZA 5E2UL 1LMKA 3O6MH 1MVFA 1E4XI 5I8CB 1QFWH 3SO5A 3WEXA 3QEUB 2HVJA 4BSWB 2VWEC 3CFCH 3DYPA 3MACL 1MAML 4JRXE 3S3SA 2YKLL 1BOYA 3DI3B 3E0GA 1FVEA 5FYJH 3ARBA 2OXHA 5ISZD 4OUUB 1UCTA 3MR9A 1EERB 4NQSB 3GSOA 3EAKA 4G7VL 1AKJD 4JFDB 1RJYB 4XPAH 5DJDA 3E3QC 5J11B 3SY0A 3QFJB 5JXAL 2R0KH 3V9FA 3PDOB 4K7FB 5C0NC 5DD0L 3AU1B 3B9AA 3V4VL 2ADFH 3BKJH 3IDUA 2G5BA 3U7AA 3M17A 3RWFB 2ICCA 4ZOAA 2PETA 3WHXA 1JTOA 2WP3O 1KEML 4MXWL 3TA3C 5K9KB 3QDJA 4IDLA 4WV1C 3DHJA 5HTSA 4APQD 2AXJA 3OMZA 3QIUB 1A5FL 4XAWH 3BPOC 2BVEA 1LE9A 2X7LB 3MLUL 1JZ4A 1JP5A 2E5EA 4U1JB 2AJZB 4HKZB 3DOSA 4LVNC 3HAEG 5TF1L 1JYWA 4MA8L 5C07A 1XIWA 5JOEA 4AEHL 1OW0C 4N0YL 1C5BH 3E6FB 2YPKA 5IESH 4J4PD 2A77L 2V9TA 1T04A 1OL0A 1DQML 2JJTC 1DL7H 5E2VL 3BZDA 3HPJA 4UB0H 3SGKC 5DMKA 1TIUA 4L8CA 5IP4A 1MPAH 3I02A 4LLAA 3ARSA 4GKZB 3VXQA 1BMGA 1JNLL 1S3KH 3OF6A 4HQQH 4LSPL 3U1SL 4ZAKD 3B9KB 5AYQA 4JRWA 1E6OL 2VZVA 4HXAL 4LLDA 3VFRB 3IJSB 2F53E 5D7JD 3U46A 1QQDB 4JY4B 4XNYL 5F7WC 4OUUA 3QQNA 4GFTB 4L9LA 4CDGC 5E5MA 4UB0L 4KROC 5ERWB 5DJDB 2B39A 2AXGB 3IDXL 1I75A 3BXNB 2DB8A 1SQ2N 2JJSC 1PX4A 2BMKB 4KRNA 4L8DB 4KFZC 1AGCA 2CIIA 1MQ8A 1NDMA 3ARBB 4U49A 1FN4A 5KSVB 1DBMH 3VWJA 1S7TA 1CD9B 3RY6C 4WU7B 4X6DA 3HRZB 1NC2D 3TIEA 3MRGA 4QTIH 4AEFA 1KACB 4NNYA 1FSKC 4FTVE 5HY9A 4HKBA 1A8JH 1F4AA 4AL8L 4NHCL 4OQTL 1LD9B 3CXHJ 3MRJB 2Y9RT 4RGNE 5I76B 4LCUB 4X9FA 1N2RA 2ATKB 4KUZL 4XWGL 3VFSB 1EMTH 2BNRE 4U1GB 1X7QA 4GMTH 5C09D 4DFHA 4ZOCA 4HFUH 5EORH 2DL2A 4P2QD 5CHNA 5C0EA 2X4SA 3VXSD 1QSZA 5GZOC 1KTKE 3B43A 4R26H 2DMKA 4Y7MA 1J8HB 5F7DA 3WNPA 2CUHA 4YK4B 3VRIB 2JCCB 4YHZH 3VFNB 2ENSA 2C4FU 4PBWD 4XHQA 1A6TB 4WTZG 3VFTA 3JV4A 4MDJA 5DRZA 3D1MC 4E41E 1HQ4A 3MACH 4XP4L 1P7KA 4PY7B 3U9PH 1A7RH 3HMXL 3PJSB 3SDYH 3G9VA 4CNIA 5JA9A 4IRSA 4QRTA 4P48A 2CIKA 5D2LF 4E41D 2YZ1A 1E27A 3OG6B 2WWMD 1HWHB 2R8SL 3B5HA 1RIHH 2DLFH 5I17B 2WNGA 1HH9A 4WWKB 4DN3H 4U3CA 1QBAA 4PJ5B 3VGAB 4ZDHA 5E6IA 2VERN 4LPVA 5T33H 2ATPA 4ZFZA 2EDTA 4C58B 5D7KD 4XNQA 3QUYC 3KDMB 4XMPH 3DVNB 4LCWB 3C5SA 2A9ML 1T2QH 1FV1A 4Z5RA 3TGXA 1L4IA 2X1OA 1DBJL 4WFGE 1ONQB 1IC5H 4ODTL 2N4IA 3MRLA 4OF5A 3SGJC 3X13A 4KKCC 1JHLL 5JW3L 3I6GA 2Q20A 4PP1C 4X80L 3SE3A 1N4XH 3IU3B 5CZXC 2GJ6D 5C2BH 12E8H 1CVRA 3OKMA 4QHNB 5E8OB 1Z2KA 2XQYK 4XMKH 3C5ZC 1CLOH 3OG4B 3L95A 4LRNL 2H26B 3JTTB 5BJTA 2EKJA 5CS7A 3SQOL 1U8MA 1RU9L 4F7EA 5EU7E 1P4LA 2RGSA 5DJ0B 4IS6A 5C0EB 2OQJA 4MHHI 2WUBL 5GGRB 5KSAA 1NGXA 2FO1A 5D1QC 3W0WD 1G9NL 2VIRB 4I4WB 4OFIA 4JFFD 3DMMA 2H8PA 3KS0J 4AIXA 4KI5F 1Q94B 4PJAE 5FXCH 2FX9L 5FYJD 5JO5B 1N2RB 4AENB 1W0VB 4C4KO 3B5GA 1T89A 2RHEA 4HKBB 1A9BA 4XCEB 2BCKB 3HMWL 1T7YA 4JR9H 5IB3B 4AQOA 5ICXB 4K7PY 3X11A 2BOBB 1MFCH 1DQJA 4DTGH 3FB5A 3MBEC 5HHME 2RBLA 3OHXB 3WKML 4R3SA 1NUFA 5E5UB 4HHAB 5BZDA 5D93C 3PWVA 4MQ7A 4UV7L 5DRWA 4JREC 3BKCH 5GGUA 1IILE 4RAHA 1C12B 2DQUL 1G9MH 1F4WH 1X5GA 3ZE0F 3QO1B 4ZSOA 5BV7B 2X4OB 3FT4A 2OK0L 3U2SA 3GI8H 3GBLA 1KN2L 5EOTA 4PGCB 3UDWA 5I73B 1XEDA 5BZWA 1JWMA 4G9FB 4JFHE 3STBA 3MRIA 1I9RL 1JYXA 3G6JF 2DQUH 1U8OB 3GSNA 3BPNB 1NAML 1TTUA 3K3QA 4MNHA 3MNWB 1KIPB 4K3JL 2GSIB 4X7EC 4DQOH 1WZLA 3EBAA 4KJQD 4PRAA 1I1YA 1KJMB 4V2BA 5E6IB 3MXWL 4Y1AD 43C9A 5I15L 1T04B 4ONOA 3FRPA 1I1AA 1GCFA 1DBBL 1D5MA 3HPLA 3VXMB 4YNYA 1C7TA 2X40A 3LCYA 1ZA6B 4C59B 3MRFB 5EOQH 4JE4B 1BLNB 3HFMH 2I5YH 4G9FD 1S7RA 1KT2A 4JM4H 4O5LL 2X4SB 1NAKL 4ZUTB 5ISZE 1XGTA 3ARGB 4Q58C 3QA3B 2VDKL 1JYNA 1MIMH 2FBOJ 1KC5L 3BZEB 2DKMA 5FB8A 4KJPD 3OJVC 3UTTB 3DVIA 4R0LB 3F5WA 4X6CB 2JB6A 1INEL 5EBMB 3FB7B 3EUUA 2A0LC 3SGKA 1S9XA 4PJHE 4NO2B 5GS1B 1AJ7L 1YUHA 2R4SH 2IG2H 4PRPB 4Y19E 3DGGA 2HRPH 2R56H 2P5EA 4NSKA 5I76A 2Z8WC 4YZFF 4KHTH 2Y1VA 1JF1B 3OGCA 4BM7A 3MROB 2APXA 3MROA 5AG8A 5C3TA 5EOCJ 3P11L 4HJGB 3IRPX 4WEMB 3EJYD 5KSVA 3GSQB 1UENA 2CD0A 4LARL 3CC5A 4P9ML 4X0KB 3D0VA 3ZKMC 3PIQA 3RVUD 4UIMA 1T03L 3BXNA 3S3JA 4DZBA 3TT3L 1KN4H 3D39E 5DUMH 2RCSL 4GAYB 4LLDB 5JPMA 1S7VB 3MLZL 1JNNL 1MCLA 1S8DA 3H0TB 4LCIL 5C0AB 4MA1C 1A6AA 4LCCB 4MCZA 1U8IB 4X8JB 5EO0B 4JFDE 2WBKA 3PWPA 3BD5A 1OPGH 2A38A 1IAIL 5ADOH 1T1WA 5HHVL 3RIAF 2Q7NA 4X83A 4HHAA 4JM2A 4KHXH 3QHZH 1FNGB 4U05A 1LP9B 3H3PL 1T22A 1OAXL 1FYHB 2ZUTA 1Q9WB 3V2AR 4DZ8B 4EBQL 2Q8BH 4D9LL 1X5XA 1KJMA 2AABL 2AXFA 5HHVH 3QI9A 3VXRD 3D25A 2D2OA 1C08A 2XN9B 5CLTA 2OTUA 4OQTH 1AFVL 1J87A 4AT6A 3FTGB 3FQNB 2CDGA 1GOFA 4DGVH 3QXDB 3MRMA 4XBPA 5F3BB 3QWOB 2P8MA 1HE7A 3OAUL 2MPAH 5D4QA 1AC0A 1WFTA 2AEPH 3DRTB 1A14L 2VAJA 4DCQB 3TBWB 1UCBH 5ITBH 2OL3L 3DVGB 3SBWA 2SEBA 4X6BA 5HVHC 1BFVL 4N68A 1RJCA 3DV6B 3KPMB 3I9GL 4NN6B 3AMKA 1FVDA 1YEDB 1NCAL 4WI9A 2Q86A 1K5NA 4ONFH 1IEBA 1NKRA 3ULVF 4R97B 1P5UA 1NFIB 2H6PA 1QR4A 4HWZB 2VLRD 1FPTH 1NEZB 5AZEH 1A9EA 1EGJA 3D69A 4O4YH 5J6HA 3EO9H 5E8EA 5CZXD 5AZ2L 1LK3H 4AENA 2VE6A 4DUXA 5HVGB 3ZE1F 4WJ5A 4LSUH 4OZGA 1X4ZA 5F7YC 4YE4L 5E9DB 4XPHH 1KPVB 2D7MA 4KI5E 4I3SH 5IW1B 1FFPB 3QSKB 5CJ8A 3S36X 5H35A 3VGAC 3P4MA 1N59B 1RK0A 4H88H 1CXFA 1MHCA 3TBYA 3V52L 2W91A 5I1JL 4DVBA 1CGWA 4HUXB 1UJTA 1LILA 1TJGL 3BWUC 4GKNA 4JFED 1G6RB 1KIUA 2YN5A 1MCOL 3V0VB 2WINA 1D9KB 4JZJB 2AW2A 5AG9A 1A6AB 5F96H 3K4AA 2W59A 3FO0H 1RD6A 1JGUL 5F72S 3O6KL 5E2WL 4PJIF 5KANG 1X5AA 4QHUB 2ARJQ 1AIFB 1FBIL 3DX9B 1H3XA 4RRPA 5CEZD 1IL1B 4BZ1H 3MJ8A 4NYLA 3MODL 2IANB 3T2NL 2Q7YA 3MV7B 1BX2A 3NVQA 3IFNH 1TITA 4K55A 3EOYG 4ALAH 2AQ1A 4I18B 1BQHB 2ADJA 4K3JH 5INDA 4JGMA 1UM5L 4BFIA 4PUBH 4YXLH 4K7PL 5JMRA 4NCC1 5E8EB 3PWLB 4XCNB 1FO0L 1M71B 3HE6C 25C8H 5EWIH 3CC5B 1C1EH 3G04A 2FGZA 1D9KD 5IW1A 1FRGH 1BFSA 3WO3B 2F58L 3HMXA 2DJUA 3EDJA 3O6FD 3OX8A 2KQMA 4MHHG 3RWHB 1KIQB 4TUKH 4KH2A 4U31A 5IBLC 5DLML 1F4WL 3FFDB 5DFWH 3UXFA 4U2ZA 5IB2B 3Q0HA 3VXSA 4ZXBC 5GJTH 1FL6B 5JR1H 2IH1B 1HI6A 1CICB 1I4FB 3TBSB 4YAQA 2DM7A 1J0ZA 2GAZB 1LWRA 1RUAH 2BNQA 1DE4A 3WUWB 2NW3A 1IEBB 3H9SD 5JPNB 5BVJA 1IJ9A 4OM1H 3QULB 3FB7A 4NZTL 1WWBX 1DN0A 1KJVA 4Z0BL 4JR9L 2GW5A 5LQBH 1ZS8B 3VFMB 4M61A 1U3HD 3QEHB 2L0DA 4GG6B 4J8RA 3RGVA 3MUGA 4ISVB 1MCHA 1HEZB 3GZKA 4WW1A 5ESVA 3CLFL 4HC1L 4AEIH 2ADGB 4EOWH 5CEZH 1K3ZA 3KLAA 3S36H 3IJHB 4UIKH 3WFBH 1UWGL 3NOIA 4OZFH 1U95B 2AJ3B 2EE6A 1A6WL 2ADIB 3SEPA 3AVEA 4WFFD 2RB8A 1MCPH 5DHYB 2NY4C 1QEWA 5J1AA 5T5NG 5C0BD 4XP1L 3HZYA 1T4KA 1A6WH 3O4LD 2AV7A 3OAYK 3X3GH 4P9HH 1UWGH 1F02I 1QKZH 2V2TA 3C8KA 4GG6F 5ELIA 3V7AE 4U0QB 1BD2B 4KV5E 1H3TA 1FIEA 1DQLL 3I3EA 4J6RH 3CU7A 1NMCC 2RIKA 1BBDH 2A6JB 4RX4A 3QCUL 1DBJH 4JN2A 4JB9H 5E95B 2APVA 4JZOA 4X8JA 3WYRA 4DW2L 4CADB 1FORL 2YMXH 3EYVA 3MA7A 5KTEL 1Q9LA 2XXMB 5E1AB 2G2RB 1S7VA 1A47A 1H8OA 4PJEE 1CXHA 2DYPD 2I9LA 2W60A 3WNLA 5JW4M 3RL2B 5JA8B 3SDDA 3QAZC 4JFFA 3KAAA 2Q8AH 1N5AA 2XTLA 4ZFOA 5EU3A 1DQQA 3MMEB 2C3GA 1EJOH 1Z0MA 3QEGL 2FJGA 5F9DC 2IJ0C 1EX0A 1I3UA 1IGIL 1OT2A 4M7LT 5I16A 3PGCB 4MXQD 2VDOL 3NCCB 2JB5H 4KJWD 5BXFB 4X7TB 2BY0A 5D7LA 5DJYB 4PG9B 4ZFOL 3ZL4H 5F7EL 3GB7B 1TCRB 3NPSB 2QKIB 4KRLB 3VFUA 3ULUD 3AGVA 5T5FL 3WNKA 3DRQB 4QT5B 2MTPA 3VGFA 2NY6B 1VPOL 4MNQA 5ANMA 2BNRA 1XIWC 5JDSA 4PJCE 4QRUA 4PRPA 2LABA 2XZCL 4PRHB 4MD5B 2RAMA 4FNLH 5E8OA 3KPPA 1ZT1B 1YC7A 1XGRB 2FWOA 2GY5A 3VDBA 3VH8G 3T2NH 1RHFA 5TE6L 4IHOB 2EDFA 1DDHA 1X5HA 3LH2L 5DZLA 5JTWA 3S4SB 4RGNB 3ARDC 1U3JA 3RWCB 2HT3C 4AIZB 4UOW1 4XCYA 5CEXB 5F96L 4FQPA 2X4RB 4XXDA 5DK3A 1JZ5A 2VXUH 1FVCB 1T2XA 2HFFB 1DLFH 4Z7WF 1EIBA 3V95A 1A1MA 4XBGA 4Q9QL 4PLKC 4JDTH 2NY3D 4EIGB 1QRKA 3S7GA 4ODVH 1PKQA 1MWAB 2L4OA 1VFBB 3K7UA 2AK4E 4HZLB 3GMRB 2UY6A 4LLMA 4N1HB 2NY6D 3LN5B 2W0FA 2PW2B 4LIQH 1IKNC 3CVIH 4XC3L 1Q8MA 1I85A 1G7QA 2QQKH 1T0NB 5F44A 5GGQH 3OXRB 1FPTL 1AO7B 1ZHBB 3UTTE 2ED9A 1Q9OA 4OD1H 3EO0B 5HPMB 3QEQD 5F7DB 5EZJB 1KG0B 4R4FH 4WHYG 3TZVA 2L7UA 4G6AC 1Y18B 3UJIL 3NZ8A 1F4HA 3EYOB 1DQMH 3UTOA 5HVHB 3VRIA 1UGNA 1IGCH 5IESL 1BIIB 4QEGA 2J8UE 1TDQA 3WIHL 4KDVA 4RNRA 3QZWB 1DBAH 1GHFH 3GUTB 2Y7QB 4WEBH 2ITDB 4H25B 4MA8H 3MUHL 4PJ7A 2CLRA 4QRSB 2AJXL 3LVEA 1R3JB 3IFOA 1IM9B 4FP8L 3SE4A 3ZMRA 1DQDH 4F8TA 2OZ4A 3X3GL 3LRSA 5EO1B 5EC2B 3RZCC 4PJ5D 2YWYA 5KSBF 3MLTA 2PW1A 5GSVB 4GXUM 5AD0B 2CIIB 2XV6B 5BS0B 5GSVA 1MCPL 4LF3B 5B3NA 4Y5VA 1G7PB 3U36B 5IMOB 5DSCB 4WNQA 2Z92A 4KWUA 3HRZA 1AP2B 5T3ZH 3HZMA 2ZJSL 1YMME 1M05B 1UACL 5CEZE 1HXMA 4N90E 1FLRH 3GNMH 4XPAL 4HWZA 1JMZA 4G7VH 2FX7L 5FKPA 4PJIA 5E8DL 3HR5A 2YD1A 3OJ2C 4R9HA 2H26A 3CLEL 3CSYA 3RRQA 4DKFH 4HULB 4M8QA 3QFJD 5JW4N 1YY9D 4G6AD 5DZOA 4UTAH 3O9WB 4JKPH 1FG9C 3MV9E 2CDFB 4TULL 3U0TA 1FIGL 3ARFC 4RAUA 4QRPA 5FUCC 1L9NA 4N0UA 3GMLA 3KPSA 2BSED 5HGDB 1QO3A 1KB5L 4X99B 3A67H 3TV3H 4JFZH 1WWAX 3E6FA 1ZT4A 4P9MH 3W11C 1NCTA 1YC8A 2AXFB 4OD2A 4GW5A 3IJYA 1CLZL 3BH9A 4MXVF 4XCYB 3TF7C 4KPHH 1FRGL 4LKCB 2FZ3B 2R39A 3JWOH 4DFIA 3UBXG 1A6PA 1TVBA 3MJ8B 4OCWL 3BDXA 4XBGB 2CO6B 4I48A 4X4XB 5IVOA 4YBLB 2XRAH 4XTRD 1DDHB 4ENEC 1ZEAH 3D6GA 3PJSA 4GAGL 1YEKH 3N85H 5D71L 2EXYD 4WY7H 2WINB 1MFBH 4WU5A 4BK5A 1NCCH 1IGYB 4ONGH 4PRHA 4EDXA 2KPNA 3KYAA 5SWZB 4OTXH 4HCRL 5DQJB 5TDPB 1SY6L 1T1WB 2PN5A 3DUHA 3MLYL 2XZQL 2V5MA 5DFTA 2VLRA 1A7OL 2Z8RA 1F90L 4ZUVB 3L3KB 4AIOA 2VDLL 4JRYE 3N1QC 3PDGA 2ILLA 2YWZA 1AGBB 4HWUA 2R9HC 5CD5C 3VG9C 3ZDZE 4TOYL 4V1DA 1TJGH 3GBNL 3VA6A 2JK5A 1F11B 2P8PA 5L7XL 1AGFB 4YAQB 3AC0A 4HDIA 4OIAA 5EOQL 1FHGA 4I0CC 3OKOB 5EUOE 3GI9H 3PWUA 4N9OB 2ZSWA 1F45A 2IAMA 1DQQB 3MMEA 4H1LH 1J0IA 2VZ3A 3ZTNL 4OV5A 2QTEA 2BNQE 4JKWA 3RWJA 3QCTH 4MXQC 3SDXE 1IGFL 3QI9D 1SY6A 5D1QD 5AZ2H 1NJ9B 2G60H 2CK0H 4P46B 3BDYH 1JK8A 3ZE2E 2LVCA 2UWEF 3AS3A 3S37H 3TP4A 5CCKH 3BUYB 4AMKH 1A6ZA 4X6BB 4N8CL 3W9DA 1SJXA 2NY7L 4M8VA 4TUJB 3S34H 2FJFB 1I9RH 1N7MH 3RKPA 4RZCA 1ADQA 3IGAA 4OFYD 3IDYC 3KPRE 4PRNA 3MTRA 1PZ5B 4Q9BA 2OK0H 3O0RL 1A6VH 5I1EL 5GPRA 3RJDA 2V2XA 4PLOB 2X1QA 3UTZA 1NMAH 4NGHH 1QBLL 3BVNB 2AKRA 3RTQC 2XN9A 2OP4H 5TJWK 1A14H 3O2WH 1D5MB 1PEWA 3HPLB 2X89A 5DJAB 4NOFA 4NO5B 4WHCA 1U9KA 4G6ML 4MX7A 4Y16D 2FIKB 3V5HA 4QHLA 1FE8H 1K85A 3KXFE 1G7LA 5LGHL 2Z35B 4DTGL 1G7LB 4LQ1A 5D7JB 2EYRB 2ORBL 2DBLL 3SDAB 5MEOA 1X5YA 5KS9A 3O81A 1BWMA 4KKLD 1KIPA 3P4MB 1U93B 1UB6B 4LDOB 2PXYA 3VMPA 4KVNH 4PJAB 1KBGL 1Z9SA 4HK0A 5E24E 1E0OB 4LFHD 1JWMB 4IDJL 1T21A 4OKVA 1R3KB 4LSSH 3V7AG 2M26A 3IS1X 4FFZL 4DN4L 1S7SA 2BFVH 2B2XH 4JO2H 3CX5J 4G42A 1G9NH 1BP3B 1NKOA 4MA3B 2GSGA 1NFKA 2VQTA 4Z9KB 3E3QE 1GOHA 2WUBH 3TCXA 4YHOH 5HGBB 2PYFA 4H0HB 3UROR 3Q6GL 4OFKA 5BVPL 3KPNB 3MZTA 5D1XA 4ZS6D 3VFMA 5GZND 1ED3B 4M4PA 1GGBL 1OPGL 5TE7H 3S8WA 2EYSA 2XYCA 2BY3A 4FQ2H 5C0CE 5EBWB 3TBVA 2XNAA 4FXKA 4L29B 5ILTL 5I2IB 3D9AL 2EKSA 4X98B 1NFDF 2UUDK 3GO1H 4MJIB 2NTSP 2W0LA 1MCQA 4MJ6A 3RA7H 1D5ZA 2ZCHH 3D3VE 5BZDB 1OTSD 3B8SA 4ODTH 4NHUB 1U92A 4JDZB 3ULVL 1AD0B 5T3XH 5IB4A 4YGAB 2C1PA 4B0MM 5DHVB 5FYJU 5I1KH 2CR6A 3MRPB 4ZPVA 4HKJB 2X9XA 1GGTA 5IR1B 3F5WB 4I0PA 5LJYH 2CMRL 2D7TL 4E9LA 3LKPA 5GISL 3WJJC 3ESUF 1KUMA 6FABH 4TRPH 1MCRA 2DD8H 1QFWI 1J12A 4ZD3L 1DEEA 3QA3A 5C3LD 2VISB 4F8QA 4J3OC 4Q0XL 3DIFA 2ZG2A 4FQJH 1KGCE 4YHPB 3AM8A 1E6JL 4J4PA 4Z78A 1A6UH 3T0EC 5EO9A 1KCSH 1KGCD 3S98A 3O9WC 3KGRA 4U1KB 5C0FA 3L3IA 4NC1E 3OAZK 3NMEA 3RUGF 3SE8L 4YDVB 5SWSA 5TGBA 1M7DB 5MP6H 5DRXB 3FO2A 4XXCC 1EDQA 2PW2A 1QR1B 4HPYH 1KSRA 2QADB 3NACH 1WISA 1NAKH 1JGEB 4RSVA 4O5LH 4HFUL 3WMSA 1ZHLB 1YDPB 2NY1D 4KQ4L 2ESVA 4XI5C 3V4UL 2WWKO 1IM9D 1EXUA 3EZJB 3FO9B 1ORQB 4NRZB 1CL7L 2CH8A 4FTVB 1WBXB 3GMLB 3L6FB 4P2CG 4WI4A 5HGAB 5J8OA 2GTZA 2DWEB 4LLMB 5CP7A 2NY6C 3KHQA 1ZT7A 3FN0L 1X4XA 4YC2C 2QR0A 3P2TA 1FVDB 1MNUL 3T3MF 4UTBH 1LO4H 4PV8A 2K7PA 1DJSA 1XF2B 5H8DA 4PLKD 3CMOL 2P5EB 4NSKB 1AO7D 3OBAA 4IBLT 4OFYA 2Y5EA 1TPXB 3C60C 2XNAB 4JO3H 1AXTH 3GMPA 3NFSL 1IGTA 4Z7QF 4YHPA 4CN1A 3WNOA 5DRZB 1CCZA 2IAMC 5A16A 4AIZA 1AXTL 1DZBA 2GI7A 1SVZA 3BP5B 3NIDF 5ACMA 1VCAA 3RL1A 5HYJE 5F1SA 1OARL 3HR5B 4ZOEA 1UM6L 4R96A 3CDGB 1BVKB 4P5KA 5I1IH 4KTEL 5ALCH 5D7KE 2IQAA 3EJZC 1SMAA 5I6XB 2R23B 4YDLC 3LEYL 3EFDL 2Z31A 3FJTA 3IB4A 4POZD 4NBZB 4WTXA 5GGSB 5CZKA 3QCTL 3WV0A 4M1CC 1MFCL 5INCA 4K8RD 1YYML 4EI6A 3AUVA 4L4JA 1RSFA 1WCQA 4JFOB 4BH7B 3MOQA 3RHWF 5BS0A 4QT5A 5I30H 1NUGA 1CVSC 3UZQA 3QUKB 5ESQA 4NM8L 3KXFD 2IGFH 1CDYA 3RAJH 1JN6B 1ZGLB 2IH3B 4L3AA 2V7NA 4OAWA 3QDGA 3VXNA 1UM4L 3V6OC 5CJ5A 4LNRA 4XPTL 1TZGH 3MCLL 2DQJH 6CGTA 2OLDA 43CAB 1ZWIB 2FO4A 2VSCA 1ACZA 2I9TB 5AUMA 4OUOA 1LEKA 3X13B 3BI9X 5HGBA 3IDYB 4N0UE 1QFUH 4LLYB 4HBCL 1DN2A 3LKQA 5GSRB 1AD9B 3MQIA 4TUOB 4Q6YA 3WNMA 4RWYL 4JCLA 4MB5A 2ATPB 4ZFZB 3V4VH 4TRPL 4KRPB 5HJ3A 1OWRM 4KTDH 4PY8I 2AK4B 2F53A 5JW4Q 3T65A 3HZYB 3FQUA 5IQ7L 1XMWA 4F2MB 2CGRL 4OCSL 4KZDL 3BZ4B 2VZ1A 5F9OL 2BC4A 5C08B 4NQVA 4QCIA 4M5YL 4XP6L 4KPHL 2JF1A 4JFOA 2PYEB 3CCHA 1NEUA 3R0MA 1I3GL 4IRSB 4QRTB 3X11B 3DARA 3EOBA 5EN2B 4FQCH 5IW6B 1CGSL 1JHKL 2IPTH 4EVNB 5JLZB 5A2JH 2CLVB 1BECA 2VLKA 2DLFL 3BP4B 5J57B 4K8RL 2CXKA 2JJUA 5E7FA 1XH3A 2F19H 4X4ME 5E7BA 4AYFA 2NXYC 2QHRH 4UNUA 4PB9L 2YD6A 3B9VA 5FA4A 4XP4H 2W0KA 1G84A 4OZHE 3QDGE 4JREB 3DX6B 5C08D 4NC0B 3ZHKA 3U7YL 5EC1A 4NT6B 5DJXA 4WUKL 1ZGLP 1BPVA 2GFBA 4ZUWA 1F3DH 1HK6A 2NW3B 1AR1C 2BNRB 5BVPH 2EH8H 4ZUWB 4KZEH 2W9EH 3JTTA 2AJUH 5BJTB 1UA6L 5D6DC 3H9SA 5LVEA 2LU4A 3JV0A 1P4BL 3ARGA 4BSVB 1ZT1A 2VL4A 2X9YA 4FFZH 3LDBC 2ZJSH 5FCSH 3RY6A 4GMTL 5JUEL 3F6LA 3VD9A 4QKXB 4MNQB 4S0SD 2HH0L 1CS6A 1ZVHA 2NY0C 4P4RA 5C08E 4O02L 4DGIL 3I2CL 4CDHA 1M71A 3VRJA 3MBXL 3UC0L 3WXWH 4L4TE 5D1QA 4YO0A 2Y4SA 1FE8L 3UTQA 3SJVD 1CXLA 1KTRL 1A1NB 1DTUA 3RNKA 5IT2H 3I84A 4GRLB 3FMGL 5F7MC 4ODWA 3DTXB 2WV3A 3RNQA 5B8CB 3CMGA 4G8GD 1H0DB 1NLBH 4K07A 1ERNA 5D70H 1IGCL 3KJ6L 5DQJA 1HSAB 2C26A 3F7VA 3QNYB 3EO1A 4Y5YC 4N0CD 1BD2A 1RUMH 2ZPKL 4RA3A 4IMKA 1ZA3A 4PB0H 5C0RL 1A6TA 3UCRA 4N5EC 2DQHL 3VFTB 5L2KD 3CUPB 3DX8B 4OZ4B 2IANA 3T0EB 5I1LA 2YSSA 3RWEA 4U1KA 3FRPG 5GGTA 4QHMB 4W4OA 3VGEA 2B4CH 3VXOB 4RCAA 4OZIE 1V7ML 5GGQL 4LPWA 1EZVX 1QHPA 2QQKL 3BDYL 5E03A 3OKNB 5I1HL 2E3VA 3OKEA 2W38A 1EFQA 3V6ZA 2G60L 2COQA 3CVIL 4YQXL 3TJEL 1OVZA 3C9NA 2ICEB 4U3HA 4L8SB 4Y89A 4EI6B 2F5AH 2UWEA 3VG0H 4POZC 4N9GB 3UJTH 3BMVA 3VW3H 2DQIH 3GJFB 2A77H 4HKJA 4BH7A 1YNTB 3D18A 4NC2B 2R1WB 1YN7A 2YUVA 3DBXA 5EUOB 3VFVA 4D0DA 3ZTJG 5FO9B 4UT9L 5IB4B 4GW4B 5TF1H 3QQ4B 4PRDB 4WI8A 3M17B 3RWFA 2X4NA 1OTUC 2JLLA 2CDFA 1PLGH 5CJQH 4LLWA 4KDTA 4BQBA 1JTPA 5GHWH 1WK0A 4FQHA 3C60D 4P49A 4NOBA 2IBZX 5ECJE 5F93C 3QFJE 3AXLA 2YPVH 5E99L 4ZAKA 3ET9F 3HS0B 3SKNA 4ONGL 4Y4FD 4PRHE 1F3JB 3G08A 1FYTB 3P4OA 1INQA 3VD3A 5IM7A 3R06B 1MAJA 5FUOL 1FVEB 2OCFD 4PJ9B 5F21B 3NFNB 4ZXBB 1OTUD 4GAGH 1TXKA 3KPMA 4ZUSA 1TVHB 1TNMA 4KKCD 2HVJB 3S88H 4WNQB 5GGTL 1RJZA 4ZSOE 1QFWM 5MEPA 3N9GL 4NN7B 3HHRB 2HFEA 2DM2A 4V1DE 4XCCL 4XNUH 5C0AD 4F15B 1N6QH 3U0PA 1T7VA 2E7MA 3NCBB 5HSFA 3CDYA 3CFCL 3HKFA 1X5JA 4JJ5A 2VDOH 1U8KB 4MNGE 1A1OA 5LBSL 5C0FB 3NCYP 3O9WD 1H3VA 4OD3L 4U1LA 1EEYB 3WD5H 4GKSB 3C6LB 2YUWA 2AEQH 4J3UA 5GIRA 3PE9A 2X2YA 3UBXB 5JQHC 3L7FA 4NQDA 2VDPH 4YHNA 1H3WM 2BOCA 4KI5C 5DTFA 4PRID 2FD6H 2BOCB 5SV3A 4N5ED 3QDJE 4MD0B 2A74B 2O5YH 3KWWA 4JM2B 1G0XA 3CD4A 4GUPB 4R7DA 4JB9L 4U6XA 2HT2D 2FX7H 3QRGL 4P0DA 1A6ZB 1ORSA 1ZLWH 4P5TA 1VADA 4PJGE 4M6ML 1ZOXA 4WUUE 1AY1H 2XKSA 3U7WH 3QHFH 4TNVF 3E2HC 1A7NH 2XWTA 1NBQA 4F9PC 4K71C 3P9WB 2DQCH 1WBZB 3SHSA 1HYSD 3D39B 3B2UC 3BPCA 4U7KA 1FZJA 3RDTD 3JXAA 4K9EC 2DLGA 3CXHK 4YBQD 4UT6H 3DUSB 1QSEE 2QSQA 2VXSL 3QQ3A 4XC1H 1JUFA 5LG1A 2FBJH 3PDDA 2VDRH 1TVHA 5ACZB 1R24B 4ETQB 5ACZA 4M62H 2MCG1 3TIDB 1LEGA 1R0AH 5JIKA 1Z5LA 4AEIL 5KSBA 4MZ3A 4M6MH 3QISA 5DO2C 1OAUL 1QQDA 1ES0B 4JY4A 3M8OL 5TF0A 2EDNA 1DBAL 1BOGA 1HZHL 3K8MA 3MNZA 2HKHH 3QWQB 4U6HA 2F5BH 1T20A 5HHOB 1AHWC 2ITCB 4LQFH 1J8HE 4M6NH 3EYVB 4Z6AT 3B6SB 1NQBA 5C70A 5EBMA 5ENWB 3OKKB 2YA1A 5K9OB 2F74A 2WSKA 5T1MA 5FB8B 5IVNA 1RUAL 1NGZA 1F6AA 3K74B 3PGFL 2H2SC 1RZJC 3ARRA 4UU9A 2P47B 5KS9F 1N5YL 4TSAL 1BZ7A 2YHGA 4NM4H 3SDAA 4JFEA 1A2YA 5JORA 4JFHD 5D8JL 4CAGA 2OS7A 4XP5L 3QUYA 4U1JA 4OB5L 4J4PC 3LKSB 3T4YB 4MQSB 1I8KB 5GGTH 3LKSA 3SJVB 3BAEH 4LLVB 4EVNA 5JLZA 4Q9QH 3L9RA 2O61A 1KENL 5IJVA 2NY5H 2DLHA 5H94B 4JFQB 4PJ8C 3O4LB 1AKJA 1B0GB 4AY0A 3CNKA 4W4NA 4PJBB 1L6XA 5AYUH 4OLVL 4OLXH 3HR6A 2P24B 3FT4B 3IGAB 3QO1A 4ZSOB 2XZAL 4F7MB 1JZ6A 1NFDA 1MHEA 2DIBA 3EDEA 5IOPB 2B7DT 3N1FC 3WFCL 5K9KA 1CFQA 1HWGB 3DTXA 5GHWL 2FX8H 3GJEB 2UZIL 2Y06L 4AH2A 1ZHNB 1Q9KA 4PTUB 2XTJC 3HNVL 5DQDL 2V5TA 3MUZ1 4C56A 4OIBA 4GT7A 4OV5B 5T1KD 1IEHA 2AV7B 1SM3L 1I9JL 5SWSE 4Z7VB 1H8NA 4P5TD 4BELD 3FB6A 5F8QC 1NSNL 1BJ8A 5L0QB 2ARWA 3ZKQD 1U8HB 1MCBA 1KXTB 5FO9A 2HLAB 3PGDA 3RVVD 3LQAL 2Z92B 1WWWX 2XWTB 1NBVH 1YNTA 5I1HH 4ORZC 3QUZD 5DRNB 4LAJH 2Y36H 1EJOL 4PLJD 3D5OF 1RULL 4Y4KA 1BJ1J 4LDLB 3W81A 4P5MB 3QEHA 3S5LB 4PGEA 1JPSL 1MELA 2EEDA 5C0DB 4GS7B 5ANME 1X5LA 3BEWA 4I4WA 2H1PL 2IMMA 2ZPKH 4PGJA 1HIML 3NZ8B 5CD3B 1OAKL 2B20A 3GMOB 4J3XA 4LSRL 5DJ0A 5HDBE 2DYPA 2RFXA 5DD6A 3RP1A 5AAMA 5A2LH 2ZSVA 2A6IA 4HV8B 4S1QH 5HDOA 4Y2DC 3GHEL 4UV4L 5LWYH 2OL3H 3W39B 4OCMC 1LO3L 1FL3B 4QTHA 2F8XC 3U9UA 4OFVA 4C55A 3BIKB 1XGPA 4FXGA 2WQ8A 1QVOA 1ZA3B 3FONB 3W82A 5TDNA 2IADA 5DD3L 3V6OA 4QOKB 3TC9A 3CFEB 5ICYA 3TFKC 4NN7C 1L0QA 1RFDL 1KXQE 1CDHA 1H0DA 5FYKE 5HGAA 4YNYB 4ZNCD 2DQGL 4EUPH 2NY3B 1A1OB 1RUKH 3HB3C 1NC4D 4XVJL 4M43L 1QFOA 4UQ2B 5BMFH 4X5LA 1CN4A 1P1ZA 2A1WL 4GSDH 5FIEA 1U58B 3SDAD 4QRQB 2G5RA 1GXEA 3NCEB 4O2FB 5LXGL 3ARFB 5EOTB 4HFWB 3U6RA 2R2BB 1R5VB 2E8YA 3C6SB 1OW0A 3KR3H 1FAIH 4FZEH 2NY2B 3C5ZB 4D8PA 1JPGA 2EC9U 3O4OC 3MV8B 5AUMB 2AAVA 3VGBA 2FGWH 4WUKH 2VXTH 3PV7A 3VWJD 5LQBL 1PG7W 2PUQT 3MFGB 2P49B 2AV1B 5L8JB 4JM2C 5GRVL 1IBGH 2ICWJ 2LAAA 2VDMH 2APWA 2EH7L 2QHRL 4XP9H 4LSVH 3RVXC 3WD5L 3O3BA 4YFDB 2XG5A 4Q6IC 1EHLL 4CU7A 1KELL 5DO2D 2OBGA 2YD5A 4X9BA 4PJ7E 3NABH 2X4NB 1BF2A 3RVTD 1PG7L 3MO1B 1ZVSB 1ND0B 3FCTA 3X3FL 3FTGA 3DSNA 3PABB 1ND0A 1FAKT 2DI9A 1CQKA 4J23A 4LCUA 3OL2A 3HC0B 4PREB 4OLUL 3TLRA 25C8L 1X4YA 1FO0H 3MREB 1G7IA 1Q1JH 3BN3B 1UM5H 1RJLB 1BFOA 3O2DA 2EEBA 2R15A 4TVSa 1NC2A 1EEZA 3FT2B 4M7ZB 5CJXC 4F9LA 2W60B 2IG2L 4D9RD 4OJFL 1H3PH 4LCYA 3UPCA 4UINL 1DP0A 2GUOA 2FJGB 3QNYA 4MA7L 1JI2A 2E7CA 4NNPH 3A6CH 4XPTH 1DFBH 5CJOL 4JO1H 2YSSB 5FUZL 4LASL 1CR9H 3QCVL 4ORGB 2G2RA 5L6YH 5IJKA 4IRJB 3ZT5A 3E6HA 1IGJB 1KG0A 2X4TA 3D39D 5A3ID 3TEUA 1KJ2A 2I26N 2QSVA 3QUMH 5D93B 4FRWA 5FDWB 1GZPB 1SEQL 4JO1L 4F7TB 2VB5A 5IK3B 3UJTL 5F7UA 4HIJB 1HHHB 4L8BB 4X5XA 5IHUL 3SCMA 1FZMB 2DQTH 5B39G 2E27H 1T5WB 4BK4A 4EXKA 3PWNB 1GVIA 1VFBA 4ZDHB 4H8WH 4M5ZL 3EFDH 1CDJA 4EI5A 4EI5C 3UTTD 5HGHA 2OL3A 3M1BB 2YK1H 1ZLUH 5DHYA 4CN6A 3ARDD 2HN7A 4PGZA 5AZEL 3EGSB 4LGSB 5FGCE 5GRUH 2JCCE 4Z8FL 1DSFL 2LU7A 5DHXB 1JNJA 4F7CB 4X4MA 1CLYL 3MJ9A 4PJIE 4PJFE 3BO8A 1G0YR 3I85A 3GMOA 1WICA 1XGPB 4RAVA 4PJGB 4X7SH 3IFLL 4DK3A 2HRLA 3H9SB 4PJXA 1NLBL 4YDJA 3RVWD 3Q2CA 1AHWB 3MV9A 3F6IA 2ZUSA 2YPLE 5C92A 1T20B 5ETUA 2F74B 4UTBL 2BSRA 4D0BB 4HJ0D 2K3TA 4LL9A 2Z93B 4I1NB 4NUGL 4M4RA 5I75C 3MBEB 3OZ9L 4WI6A 1VGEL 5GRWA 4ETYA 3QI9C 3FO1A 3LKOA 1ZSDB 3MBXH 4PS4H 4CN4A 5D7LB 4DGIH 4XNZC 5DWUH 4NHUA 1OQOA 3MV8E 1T0PB 1PDKA 2LTQC 4IOFC 5CUSL 1FL6A 4XMLL 4DUWA 3QG7L 2QQNH 1BM3H 5HGHB 3V4UH 3E8UL 3QG6A 1BREA 1ZT7B 2CKBH 3V79C 4FZEL 4PY8J 5C6PB 4ELMF 1CL7I 3BW9B 5IMLB 1OAQH 2IQ9H 4K9EL 5BOZG 1P4IH 5HYFA 3K8LA 5TDOA 4NO2A 5GS1A 2IAMB 1HHHA 5CD5D 2LE9A 1QLEL 3O8XA 2Z31C 4GS7C 1CK0H 4LPYA 3SDDD 3MRQB 2CKNA 1IL1A 3AB0C 2V2WB 3WXVL 2UZYB 1IAIH 4LMQI 5CBAB 1ZLSL 1UZ8A 4PGCA 3KWWB 3PL6B 5IWLA 1FO0B 5HYJD 2QQQA 4LP4A 3QIWC 4ORGA 3ZLQC 2F19L 4AH2B 3TYGL 2VXVH 4JRYA 1B6UA 3Q5OA 1T1YB 1XF1A 2EXYC 4PJFB 4U7MA 3L5JA 3W2DH 5L2JB 1JV5B 1MJJA 2DL9A 4X80H 5BV7L 5GS0D 1A3QA 3KLDA 3LOWA 4TNVK 1MHCB 2GUOB 4LCWE 2IBBA 4HGWB 2R2HB 1EO5A 2A9MH 1FFPA 1I7TA 2HJKB 4QNPE 5IEKB 3NZHL 4X6EB 3V8CA 1PYWB 1NC2B 2V5YA 3HC4H 4KI1A 4XH2B 4KAQL 5D2LA 2V6HA 4I48B 2V9QA 5C0IB 3L3DA 2XACC 5K9QI 1FQ9C 2R69H 1OSPL 4LKCA 2J4WH 1NC4B 1T1XB 1QSFE 2ERJB 4WHDA 3LZFH 1VFUA 4NFDA 5HHPB 1B9ZA 2OJZL 3MJ6A 1KJVB 1ZVYA 3ARFD 5C9KA 1RUQH 2GJ6A 4M6AA 3E6HB 3PV6B 3NGBC 5J6HB 3ESVF 4MYWB 3MLVL 4R4BA 1JZ8A 3MLPA 1YN6A 1X9QA 4WFFE 1T6WA 4HF5L 4NBXB 1EPFA 5JHDD 1Q0YH 5T1LB 5K9OA 1YQVH 2PTUA 3BUYA 5EBGA 3CFKA 4R2GB 4ZXBA 4HH8A 1JIBA 1UM4H 4JVWA 4LBEB 4YC2B 1WZ1H 4CU6A 5DQDH 5DI8B 2NXYD 3FAWA 3QXDA 1II4E 4XMLH 1RUPH 4NQCD 4U1NA 1I4FA 1T5XA 2Y6SC 1MREL 1QOKA 1GL4B 4YEFA 4FTVA 2ZOLA 1VFOA 1FV1B 2E7HA 4RBPK 4NHCH 3WFCH 3MGTB 3GJFA 2DBLH 3QIBA 3QIBC 3VDAA 1A4KA 4L4TB 1S5HB 3J7HA 2JK5B 1Q0XL 4LOUC 5EC2A 2EYTA 4QRQA 4QRPE 5EUKA 1ZVSA 2Q87A 5GRXG 2D0HA 5DT1H 3UYRL 1OLLA 3UEZA 1H8SA 4ZUVA 4QYOA 2IF7A 1KENH 2D03L 2MQ0A 5EA0H 1YPZB 1R5WB 2ICES 3IFLH 2P44B 1TJHL 5INDB 5FYLD 5J6GA 4WW2B 4LDEB 3P0YL 4OB5H 1J0KA 4PV9A 1XGYH 1W2KT 5JOPE 3NFSH 2YBRB 1IC7L 5I0ZA 5GXBB 1FC1A 4YWGL 1WTLA 1FNEA 4HGWA 4JPKL 3ARTA 4MS8C 1YMHB 1G1YA 3QZWA 1RZ8A 1CFNA 1B0RA 2BY1A 1J8HA 4CL7A 5F70A 1JV5A 1MJJB 1QRND 2F54B 1QTYT 4UV7H 5D6CB 4K2UL 1MNUH 1ZK9A 3NAAL 5CBEA 4XAKD 1U0QA 2QL1A 4LLQB 1IRAY 3DX8A 1JNLH 1S3KL 2A6DA 2NXZC 3CUPA 4YXKL 2VAAB 3P9LB 2ZCKH 4JJ5B 4N0FB 3RU8L 2WIMA 3Q1SH 2RQ8A 5J06A 2B0SH 2VE6B 5E2VH 1EEYA 3QR2A 3BHBA 3G6DL 3VDCA 3O8XB 1U8KA 2K7QA 3DI2B 3ROLB 3VGHA 5HHQB 3QUML 4JPWL 5JHDE 3UPAA 3REWB 4WFED 1LNUA 1U8NB 1QFHA 1KCVH 2HG5A 1QZ1A 1DFBL 5FUZH 3LB6D 3MLUH 5C9JA 1P84J 4Y0GA 4IOSD 5D7SH 4BQ9A 1V7NH 4MJID 1A5FH 3G5ZB 4OCLC 2VXSH 1BJ1H 4XC1L 1RU9H 3SQOH 3ECBA 2B1AL 4BYHA 1MFNA 1UXSA 1J5OH 2X42A 1H3PL 2LV4A 4HV8A 5IBTH 4Y2DB 4XMKL 4PJXB 4WY7L 2YD2A 4CVUA 12E8L 2HTLC 4U6VH 3KPPB 1I7RB 3ZTJH 1XZ0A 5KOMC 2Z8SA 1OGTB 5GISH 4DKAA 2R0KL 2D0FA 4OT1L 4P23C 2X4QB 4NQCE 3VFSA 4QNPF 4P59H 4X5WB 4OLUH 3DRTA 1K8DA 1YN6B 3QRGH 3X14A 3BIAX 3QI9B 2NY4B 5EBLA 3CSPA 4DJMA 1YNLL 5ADPL 3ILQD 1I7ZB 2FR4A 4MD5A 4CUCA 1WEJH 5E6ID 4P2QA 4HLZG 4PD4K 5F3HA 2YR3A 4D2NA 5IROC 3L9RB 2O61B 2DOCA 5MERB 5FK9A 4PJ7F 3BP4A 2PXYB 3PGCA 4A6YL 1CBVL 4P57A 3OAYH 1RIHL 5DS8B 2YXMA 4HIJA 4L8BA 1R5IA 5D2NB 3W9EA 4ZO6A 5E2UH 3REVA 1INDH 3D3VB 4UNTA 5LBSH 3MRIB 2VKWA 2YD3A 2EDOA 3SDDB 1TZHB 2LU3A 3ARDB 3GGWA 4TULH 1JWUA 4PJFF 1IEAA 1OHQA 2YA0A 2Y72A 4HAFA 3EYOA 4JAMA 5D1ZC 4JQXC 4R8WH 3QWRD 2MCPH 1Q9LB 5IHZB 4UU9B 1TPXC 1H5BA 1UZ8B 1YY8B 1PY9A 4WI2A 5T1MB 1FAIL 1UEYA 4PBVC 4L3EA 4Y4FB 3TN0B 4BUGA 2CLZA 1NJ9A 3GIVA 3LN4B 3LHPL 3QIUD 4I8DA 3P9MB 4M48H 2A2QT 3EJYC 4U6VL 2IFGA 3AREC 4CVXB 1AR2A 4LOUD 4MWFA 4M43H 2HMID 3ARQA 2LAGB 2PTTB 4HWBA 5CGTA 2DQGH 5I6XC 4YR6B 4Y8DC 3THML 1CIDA 1NMBH 4FFYL 1EBAA 2H32H 1LO5B 2YPVL 5D2NE 4PJAF 1T80A 1S9VB 5EU6A 3BKYL 3N1GC 1A3LL 3NCJL 2YPLD 2PXYD 3NIDE 5FK9B 3FN3A 1VHPA 4Y4HC 4XNZB 1CGVA 2YRLA 2W65A 3WN5A 4Q74A 4X6DE 5MI0B 5B3JE 3S5LG 3MRRB 5GGVL 1RJLA 3EDFA 2A0LD 3MREA 1A2YB 3DUSA 4XCEA 4EIZC 4KXZI 2ICWI 3KYKL 1AQDB 3WIHH 4S1QL 5IB1A 4ISVA 5BCAA 1RK1A 4LAQL 2O5ZL 7CGTA 1RHHB 4U2YA 3H9ZA 4PJDB 2YN3A 2XQBL 1J05A 4JQXA 3L5XH 5DJ8A 5EFIA 3FQRA 1ROWA 2Z31B 3Q1SL 1AGBA 5DD1L 4ZYKB 5IQ9A 4PJGF 4XNYH 3RKDC 3BN9C 3L3KA 2APTA 3RGVB 3TJEH 5J3HD 4YXKH 5IJKC 3QT2A 2J8UB 3IXAA 4F9LC 1HQRB 3VXTB 4XC3H 4JJHA 1CICA 3DX6A 4HK3N 2YD8A 4MQXD 3PQYB 4FQXB 3EHBC 4RRPG 3QXTA 3MA9H 3CZFA 3P4NB 5DD1H 4Z0XA 4TNWK 3U6RB 4HG4K 3LMJL 2IALA 1Q9OB 1T5WA 1AI1L 4PJCF 3B2UD 4P9HC 3MYJB 1HYSC 1YNKL 1FZMA 4ZQKB 4NPYB 1U58A 5L88L 3S6CA 3MNWA 3MNVA 1E4WL 2XN9D 2O5ZH 5I8CA 3T0AA 4R4NC 2BVPA 3H6JA 1S7XA 2OI9C 2XZZA 5CIPA 5E9DE 1XF5B 4ZG1A 2NMSA 1I8IB 3CDFA 4F37K 4LVHB 1XF3B 4HGMA 1YMMA 2ESVE 2GHWB 2PYEA 5K33A 3U0TB 4PJ5E 4FFWD 3QAZB 2EIEA 4FG6D 3BQUA 1A02N 2BVTA 1YEEL 1Y6NR 1T7XA 1YA5A 4FABH 1NMBL 5DJ2B 1Z3GH 4XCFL 3ROOA 3IKKA 3WLBA 2NZIA 4LGPB 4R7DB 3HZVA 4F15C 4I18A 4TVPD 4PJ9A 3NGBB 1HXMB 1U42A 3P9LA 1U8LB 1M7DA 3LKQB 5BW7A 4H8WC 3GJFH 2EO1A 3BE1H 4HIXH 1I1RA 2BOBA 2YC1B 4ZPTA 1LK2A 2BVQB 3V0WH 5ESAA 3QFDA 2OTWB 4HG4J 2WLYA 3QJFA 1T89C 3D85A 2VO5A 2CJUL 4R3SB 1YJDC 1HN1A 3VI4E 4M3KB 4OZHB 3RWIA 2HWZL 5IQ9B 1F6FB 1GZQA 3OWEA 1MY5A 1CLZH 3BPNC 5I8KL 5LCVL 5F9JB 4PJCB 1F58H 3MRDB 5I1AB 3DUUB 3BUTA 4PIRF 1G7PA 2BCKA 3OKDB 3GMMB 3O6ML 2EIZA 1OGAA 1CU4L 4TN9A 4RGNC 2J4WL 4UDTB 5E9DD 2VABA 3O8XD 2Q3ZA 1UB5B 3O3EB 2R29L 3WJLA 2H9GA 1B2WH 4GXVL 2LVEA 4JEGB 1ZS8A 4OLEA 3KG5A 5B8CC 3KLHC 3OJMB 3OKEB 1OY3B 1BD2D 4YX2L 1C8PA 1ZV5A 2HKHL 4IIQA 1TJIL 1P4LB 2P4AB 5D9SB 4C83B 4KK8D 2WBJA 2IANE 1OAUH 3QNXA 5E8NA 4OCSH 4KZDH 1JZ3A 3G5ZA 1MHEB 4HX1A 4FQHB 3BKMH 2DJSA 2QR0B 5EU5A 4AQ1B 2P5WE 2P8MB 4Y4FA 5DJCB 2AXHA 4O2FA 1QLFB 4XTRC 3W0WB 1GGYA 4X4YB 3ULUH 2NXZB 1HHIA 1ONQA 1WT5A 1QSFB 3UDWC 1BQSA 2GITB 5D7SL 3CFBB 4CMHB 3CK0L 4YBLC 2ED8A 4JAMB 2GJZB 3KJ4B 4RA0C 1A7NL 4HCRA 1TZHA 1XF3A 1AY1L 4AJ0A 4GLRI 4PGBA 3KPTA 4WEBL 4HIHA 3RAJL 1ADQH 3CX2A 1FNGA 3E8UH 5GS0L 2DQDL 2JCCA 5CBEB 2A83B 4WI5A 5IEHA 4G5ZH 2FH8A 1ZLWK 2G9HB 3MLRH 3D85D 5I30L 4Y19B 4IHOA 4XNXL 1S7QB 3MLSL 1BAFH 3QDHA 1P7KB 1MH5B 4UUJB 2KBGA 2MSPA 2UVEA 5CHNB 3SDXF 4OM1L 2P43B 1QBML 2ZNXA 1VGEH 2AEQL 2W1NA 2MNUA 3OZ9H 3HUJB 3L3HA 4C56D 3B5TA 3PHOA 1IQWL 3LAFA 5FYKD 4OFPA 1N0XH 1D6VL 3RWGA 3BZFA 1RK0B 3VRLE 4TPRL 4PRNB 5KVEL 4WRLA 1G7HA 5DHVH 4DGYL 2OR7A 1U41A 3RNKB 4F7PB 5DHVA 3SGDH 4X7SL 4XCCH 3WDHA 4OZGB 5JPNA 3RWJB 5DEZA 1D5BB 4TUJA 1JGVL 2P5EE 1CGYA 1X5KA 4HXBH 3MRBB 4PJBE 3RVTC 1TJHH 1A4KB 3OF6D 3QG6B 2P1YA 5I1GH 3O4LE 1A3RL 3Q5TA 5EWIL 2CLVA 1DSFH 5CEYA 1F3DJ 1KLUA 3CMOH 3IXTA 2EECA 3UYRH 4UT7H 1PQZB 2VXUL 1LO4L 5JNYB 3EYSH 3SKJL 4OCYL 4KROD 5JNYA 4U6YB 4JRXA 1J18A 4GBXD 3TYFB 2GT9A 4CRPA 1JUFB 2HFTA 4JLRA 4XX1E 3KXFB 2OYPA 4HS8L 8FABB 3VXUE 3QUZB 3WFDL 4OZIF 2XY2A 4Q6IB 4JANA 2BJMH 4OLYL 2BHZA 1CL7H 5J0BA 1JGUH 3MV9B 3D48R 4EJ1C 2HT4D 4DCQA 2ADJB 4P2OB 1JTTA 4ODXA 1GOGA 3K46A 5IVXA 5K93A 4NQEE 4GO6B 2O5XH 2VDQH 1FZOB 2CDEB 3DX9A 2NZ9C 3O11B 4NRYA 3HAEA 2FNBA 1LDPH 1YY8A 4NCC2 4LASH 2FL5B 3BYTA 3RDTA 5IW3A 3SDAC 2DQIL 3F7QA 2Y5TA 5B4MD 1HHJA 1UWEL 1KCSL 3LSOA 2VH5H 1A7BA 3IRZA 4MNQD 1D9KA 3JZ7A 1FL5A 3VFGL 4HIHB 1IT9H 2FEEI 4UAOC 5C07B 2CRMA 5EZOL 3HPJB 3KLAB 4OJFH 3TM6A 3U0PB 3U79A 2EEAA 2E7LC 4M7LL 1IGIH 4U1LB 3LZFL 2DQFA 5HVWA 3MJ7A 1JZ7A 1XR9B 1YEFH 5KS9B 4I9WE 4QGTA 3U0WL 3RQ3A 4N8VB 1PY4A 1KFAL 3A6BH 5M7QA 4LKXB 1J10A 2CRIA 1GZPA 1MRFH 3CJJA 4OD2B 4KVCL 5DC9B 1L7IH 3KJ6H 3GIZH 1FO0A 3O9WA 1PG7H 4RISH 3MUGB 4HKXB 5KANI 4UMGA 5J9PA 4ODXB 1U8OA 4Y2DA 4R96B 3BP7B 5IIEB 1BBDL 1NGZB 2LFGA 4XAKE 4WUUB 4JHWL 4X4YA 1ETZB 3W5MA 3PXHA 3T8XA 1KPRA 4WI7A 5D7IE 5DYOB 1FG2A 1QKZL 3B3IA 3U2SB 1YEHL 1FDLL 3D9AH 4YEEA 3G08B 2NX5B 3MRNA 1AO7E 3JWDL 1MRDH 5IFJA 1S9YB 4CW1A 2ZG3A 3G6AB 4X9GA 3L3OB 5E2JA 2R1YB 1ZLSH 4CJ1A 5SWQB 4KGJA 1EJ6A 2VXTL 4JG0H 4M1CD 4M6OL 5HI3C 1BGXL 4ODUB 5ESQB 5BOPA 3T1FB 4EDWH 3ZSTA 4P5TC 5D7LD 1CK0L 2I27N 1QLEH 1TNNA 3VJ6B 3WFBL 3ARYA 4S1RL 3QWOA 1MCSA 2VLJA 3ZE1E 2AGJH 4HC1H 3DSFL 2DS4A 3CLFH 4HWBL 2BFVL 1OAXH 2W07A 3RBGA 2YD4A 3KYOB 1BX2B 2IAND 5LXGH 1HSBB 1GJIA 1NGXB 2W9EL 1WZKA 5D1ZB 1G6RL 4OBRA 1KBGH 3NIFF 5CUSH 4HJJH 4RX4D 4M6OH 4GG6E 4OI9A 3ULVE 3CVHA 3ZT6A 1BIIA 1MCDA 4LHUB 1XF4A 4GBXA 1NFDE 4NZTH 4F33A 5HYJB 4HH9A 3MV7D 1OM3L 5I1LB 4N5UA 5KBNC 4LCIH 3OKMB 3BH8B 4QHNA 5EPMA 4WI3A 1MH5A 4UUJA 8CGTA 3UJJH 2RCSH 4G6MH 5EZJA 1OWWA 1KN4L 2GK0A 5I8EA 4W70A 4DVBB 3O2WL 3RPIA 1T03H 4GUPA 5GRYA 3CXDH 1JHKH 3A0OA 3PF2A 3VI4F 1QBLH 3ETBF 4OZGF 5HI5C 5ABDE 1JL8A 3T08A 5FO8A 4JZJA 5DEGA 1SBSH 3SE9H 1Y0LB 1CICD 1F00I 1QNZL 4E41A 2VN7A 1FLTX 5KOVC 3O3UN 1S5HA 2QSTA 1TETL 4ELME 1T0NA 4IRSD 4LPTA 1CFSB 2NY5C 3HUJF 2BVPB 2B5IB 2VZUA 4NQTA 3RPKA 3FO9A 2UYLA 1EFXA 4M9OA 3SDXB 5SX5H 5GS1C 1DANT 1Z0NA 1LHZA 1QA9B 3R4DA 1OTTD 2WMPA 4H8WL 4M5ZH 3D0LB 4XXDB 3QIWB 1NBYB 4X8XA 5A3IC 1MSPA 3ZTNH 4S0TD 5CFHA 2XPGB 1D5ZB 2VH5L 1D5XB 1UWEH 4M3JA 3MCLH 2M8XA 5IFHH 4AK1A 1KCLA 4JN1L 3TCLB 4Z78B 5IFJB 2J8UA 3IXAB 2HFFA 1SJEA 1J11A 1SM3H 5C0CD 2VDQL 1EEQA 1MCOH 5BQ7A 2MWCA 3B9KC 4OSUH 4JM4L 4F9PA 4TOYH 1Z9LA 1J1OH 2E6JA 4POYA 3FQWB 3FHQA 5T3ZD 2Y6SD 5T1LA 3HE6A 2ARJB 2BVOA 5L2KA 2UZIH 4I5BA 1HINL 2XXCB 4I77H 5BRZA 4ZXBD 4G9DA 2GJ6B 1GIGH 5IBLD 3OXSA 3MRPA 3N50A 3MXWH 4ZPVB 1VB9A 3UAJD 3JVGC 3TJHC 3MRRA 5AYUL 1IC4L 1YN7B 4HWEL 1C5DB 2D4DA 3EO9L 1ZA6A 4X7TA 4MAYA 1MQKL 5I1IL 4GJTB 4GQPH 3T3PF 4X9HA 4IS6B 4CGTA 3I50L 2XRAL 2Z0BA 2X9WA 1MCFA 1P7QD 3VFUB 2M2DA 1KB5B 4MJ6B 4J3TA 2HT2C 4XT1C 5EN2A 4UI2A 3WL9B 4R2GC 4JHBA 3BDBA 2QADC 3IVKA 3HG1D 3MUY1 3TZVD 2XTJE 4OZ4A 3T0EA 4Q7DA 3P9MA 2NNAB 4DGYH 2BXYA 5C0CB 4HC1A 2ITDA 3PL6A 4H25A 2GJJA 1G9ML 4TSAH 4LPUA 3CXDL 3JWDC 4GLRH 3A67L 3ULSB 4ZPTB 4DVRL 1OP9A 5EO0A 4A2MA 4H1LB 2BSSB 3HRPA 3NFPB 4PTUA 4O9HL 1WGOA 3R0NA 3TWCH 5E94B 2VITB 2XA8H 3ZYIA 4S10A 4ODHH 2VZTA 5B22A 2J6EL 3CH8A 1JE6A 5GS0C 5LGJA 1QPPA 1WAAE 1PKQB 2N1KA 5C07D 4Z95L 4EXPX 2E9WA 5FFLA 3V4PL 3HI5H 3OGCB 1YEGL 2YPKB 1BWWA 3JV5A 2BNQD 2VLLB 3AROA 3HC3L 4D9LH 3M07A 2IEPA 2XKNA 3NH7L 4WW2C 3NN8B 4E42B 2Q3AA 3I6KB 5DUBB 5E8PB 3QDGD 1MWAA 4UOJA 4KHXL 1NBZA 1I7ZA 2FR4B 1REIA 5HDQH 4BSVA 2FBJL 3SPVB 1X5ZA 3G5YB 3O41B 5IMMA 4M7ZC 4H5SA 5MERA 3ULUL 4YDJB 3MOAL 5KVMC 4BQCA 4ZD3H 1XGTB 4L3ED 2JTDA 2ADGA 4KXZH 2DM4A 5KSAB 1CE6A 5C2BL 3UTPD 6FABL 4D0BA 3H9YA 4TSBL 2YXFA 4PJXE 5FGBC 3U7WL 1NCNA 1JRHL 5DR5L 5TDPA 1P9MC 2ERJC 3STLB 4EUPB 2NY0B 3LEVH 2VLKB 2WM0A 1LD9A 2C3VA 4TVPL 3BWAB 4RISL 1I7RA 4ZYKA 4YX2H 5C9JB 1KTDA 4PLNC 3FFDA 3EOTH 1U8QB 5I18H 1JF5A 4J12A 5HI3D 3CSBA 3SOBH 1MI5A 5CAYB 4EQ3A 1MIEH 3WN5B 4F7CA 1KFAH 3A6BL 5CP7B 1B2WL 1Z6JT 4DN3L 3PL6D 3I6GB 3RA7L 1KPUB 1SYVA 4KHTL 4ZS7L 3QH3A 2NYYC 3EGSA 5CEYB 3GO1L 2XPGA 5FYKH 2BZDA 1ZLVK 3LKRB 3T04D 2K1MA 5DFVD 5E08H 3SDYL 3WLWD 4FFVC 3WS3B 4P2RB 5FYJE 2NW2B 5TE7L 5E1AA 1UXWB 4N0FA 4NQXB 2XTJD 4PJHB 4X99A 1J8KA 4POUB 4MJIE 3BZ4A 4FQXD 1VFAB 1KYOJ 1TTFA 3V5DB 3WIIL 1F5WA 1ORSB 3TESA 4P23B 4RFEA 3MV9D 4JO2L 4DKEH 3L3HB 4E41B 1QR1A 5IHZA 1IGYA 4LCYB 2A73B 3KYNA 2J88L 4FXGB 4M03A 2AJSH 3KHOA 5HVFB 2JKXA 1MHHA 1CTNA 4XWGH 3NPSC 1KCRH 5EZLB 3BIBX 3RVUC 3WFDH 1AH1A 1N59A 1U3YA 2P5WA 1YEEH 2XA3A 3LH2H 5JHLH 4KMTL 3CX5K 2XZAH 4ZTPH 3QXWA 1DQJB 3UTSB 1J0HA 5CJBA 1KXVC 3RIFK 4YDKH 4Y5VB 2AK1L 3F12B 1NCBL 2OTPA 3MRJA 3GKWL 2IC2A 2WZPD 4IOIB 3ZDXE 5L88H 1J0YA 4GRWH 2CUIA 4EN3A 4Z7WA 4K3DL 3DJ9A 1N64L 1VGKA 5FYLE 3OKKA 4NP4L 5D8JH 3S35X 3ZL4L 4PJ9D 5ESVB 1YEDA 4PJ9C 5T1DL 2R2EA 2HAZA 4HX1B 4M8QB 3GBML 1HYRC 5I19L 5L2KB 2H6PB 2BVQA 4HUNB 3PWPE 1IAIM 4RMVA 2B4CL 1IGFH 4NN5B 1MPAL 1NUNB 5HHXL 3O6FB 5EIQA 3LS5L 3O6FA 3KDMA 4G8FB 2EDEA 5TFSL 3BD4A 1OP5H 3HZVB 3LN9A 3GMQB 3KYMB 3HMWH 3WUWG 4R7NB 3KNBA 5C09E 3GI9L 2OM5A 3HN3A 2PYFB 3ROLA 5HHQA 1G7QB 2DQDH 1HH9B 5GS0H 3B9EA 3BGFC 1C08B 2FX9H 2FHBA 4N0YH 2YA2A 3GBNH 4L8CB 1J1XH 2HG5B 4YBQC 4XBPB 3QXVA 4PJBA 3VWJC 1KIRA 5BO1H 2CDGB 4KJQC 1JPST 2X1XR 2BRQA 1BJMA 2VDLH 4X6EA 3BSZH 3IKCA 1KJ2L 3MLYH 5TQ0H 4FOMA 4H1LG 5D1ZD 2MMXA 2I07A 4XP1H 3RUGB 3OKNA 4GRWE 2I60L 2EO9A 5C0IA 2FEDD 4O02H 2VYRE 4KGLA 5IFAH 2NR6C 3VRLF 2IBZY 4U7SA 4OZIB 4MJ5A 2HH0H 5D71H 1T1YA 3FO2B 1PZUB 3B2VH 5JUEH 1I7TB 2HJKA 1UVQB 5CSZB 1FGVL 1ZEAL 5I66B 4UILH 4RZCB 4WW2A 2VQUA 2WIIA 1ZLUK 3TFKD 5BS0D 4RMRA 5FA3A 4QXGL 2AJUL 1T2QL 2F53D 1TJIH 2ZNWA 3S96A 5B8CA 1VFAA 1WCBA 3V0VA 2OI9B 5FYJL 2XOTA 3MBED 2YKLH 1DEEB 3GRWL 5D1QB 3IAPA 4Y2DD 4LU5H 2E7LA 3VA2C 3VJ6A 2XQYG 1PQZA 4Y4KB 4PJ8A 2IBGA 3QUZA 3ULUE 4W6YB 4K8RH 3T2PA 2DMBA 5DVKA 4YXHL 4HGKC 4LU5L 3AMLA 32C2A 1E4KC 1ZMYA 3KYOA 5E1HB 5DURD 5FGSA 5HYSA 1BQUA 4P2RA 4KKBD 1RZIA 5I2IA 4KJYA 1RZIB 3RIFF 2UZXB 4TUKL 4NKMA 5KVDL 3H3BC 5I16B 1YPZF 4UZGA 4L3CA 3TBTB 2VUYA 2ZSWB 1NGYA 3CLEH 1OP3H 3MRKB 3SKNB 1OOAA 1N5AB 4ZFOB 2WBJC 3CVHH 5CIPH 1TTGA 3OQ3B 3VFOB 4CBPA 5FO7B 2MQ3A 4C56B 5KSAC 5DI8A 4TQEH 5EORL 1ZE3C 4QXWA 2DI7A 2CLZB 3GIVB 5GQBA 4I2XA 3WIFA 3P77A 4M1GL 4KUZH 4QLRA 4LEXL 3WJLC 2D3VA 2GK2A 4JFQA 4HBCH 1Z3GL 4XCFH 2X4UB 1QFUL 3MV8D 3K4DA 2XICA 4DOHB 5E99H 2GQHA 2YUZA 1V7NL 3ARZA 1KJ2H 2YRPA 3BSZL 4BFGA 1DBKL 5CSBA 5FYLL 3ZYJA 1K6QL 4PJGA 3CU1A 5F3BA 1S7WA 1EVUA 4G8IA 1B0GA 3BFOA 4XBEL 1MFEL 1KB9K 4G8IB 4MS8D 3KPRD 3ZDXF 4QRRD 4UT9H 1HH6B 4JRXD 1FP5A 2IGFL 3OR6A 4XVTL 1G7MA 3CFBA 3VXMA 3T4AA 4APQB 3O45A 5I1JH 1G7MB 2R4RL 3OB0H 2OZ4L 3STZB 1TQCC 5T1KB 2Q6WB 3T65B 2FATH 3IJHA 3NN8A 3BMWA 1Q72L 3VG0L 3MA9L 1EK3A 1BZ7B 1PW3A 4JQVC 5HHXH 4XPHL 1JPFB 4MVBC 3KYNB 5K59F 3GM0A 1OLZA 4JO4L 1CDBA 2AKRB 4MCYB 4F2MA 4HXAH 1FFNB 5I9QB 5T1LD 2FLRT 4HQQL 5ALBH 3N1MC 3P77B 3PIQB 5D9SA 4FQ1L 4L3EE 4JPKH 3UPRA 3CGTA 3I3DA 5D5MA 3GMNA 1AD9A 3GSQA 1LO0L 1I3VA 4RFNC 1MUJB 4QF1B 4QHKI 4YFLI 1PBYA 3BT2L 3L5XL 5C0BB 2OZ4H 3VFOA 1QACA 1AP2A 4MAYD 1GPOL 4JO3L 3I9GH 3GKWH 5L9DH 1QEWB 5J1AB 4NO3B 1R5IB 3DPBA 2CUMA 3F58H 2BNUB 3FFCA 3GKZA 4YDKL 2QLVB 1DLFL 1D7FA 1LEGB 2VZOA 5E2TL 3PWJB 1Y6KR 1VEMA 3MLTB 4NKOB 4DUVA 1ZANL 4PRDA 1MEXH 4W6WB 4NRXA 1A0QL 1U8JB 4OF0A 3PABA 4G6JL 4DK6A 1K6QH 4XZUB 4RDQG 3VU2A 4JG1L 4P2QB 3ARPA 3NCJH 5IMOA 1A3LH 3VI3E 1KB5A 4FMKA 4KMTH 3IFOB 2JB6B 4XNMB 1OP3K 1JF1A 4GG8A 3RKDD 2WWKT 4G43A 4ZO7A 2PO6C 5BRZD 5KVFH 2H2PD 3ULVC 3ZT7A 3BRGC 3EOAA 1RY7B 1EO7A 5KW9L 5DD0H 5DZNA 5JXAH 3RX5A 5FA4B 2JIXB 1ACYH 1CWVA 1XCTB 5D7JC 4TSCL 2VR4A 2OMNA 4JDVA 1EAJA 2BDNL 5F6HJ 1Q0YL 3WIIH 1RZ8B 3O6FC 5FKAB 5EUOF 5LAXA 4WFHD 2AJYH 3HUJA 4ZAKC 4HF5H 5D1XC 2ED7A 2EDBA 5ID0B 2ICWA 1E6JH 4UQ3A 4PG2A 2VRAA 5F1KC 3FHAA 4FQJL 2OJEA 4D0CA 4JRYD 2CXGA 4Q0XH 2WANA 2W9LA 1HSAA 1KIRB 3ARFA 4PRAB 4WGWB 1JNNH 4OLZH 3VFWB 2VLLA 1IC1A 4P23A 3ARED 2X1WL 1FJ1B 4BH8A 1S5IL 2Q8AL 2QHLA 5IK3A 4A6YH 2WBWB 1CBVH 5KVGH 4KI5D 4XB8A 1HILB 4HUKB 3WLWC 1WF5A 1JI1A 4KAQH 1BQLL 1GC1L 3WS3A 4A6YB 4YO0B 2ZCLH 1NCWL 4LVEA 1N3NB 5T3XL 3MLWL 5DMYA 2X4OA 5IHBA 3JV4B 2C4FT 3L3IB 3PXJA 1JRHH 5DR5H 5TH2B 3ABZA 3QNXB 4UILL 4NZDA 2IALB 2E6QA 1PX3A 5TQ2H 3FFCD 2BXZA 2PTVA 2X4RA 3MFFA 3IF1B 4IOFD 5F89B 1B88A 3UO1H 3EZ8A 5C0ND 4NN6C 3HS0A 4WWKD 4FQ2L 1GAFH 4GKNB 5HYJA 3DO7B 1N6VA 1XGQA 4HLJA 1BFOB 1YEIL 5IB3A 4NN5C 4F57H 4PGEB 3S5LA 2J7LA 1NAMB 2XIDA 3J8F7 5F7LB 2E8ZA 3OPZH 4I0PB 3SDCB 2IFFL 5SX4I 4MAYB 1A64A 5EOCL 4NWUL 3MRGB 5EO1A 4GXUN 5EUKB 1HCFX 1WAAA 4QRUB 5HHPA 1J1XL 5KSAD 2HFGH 3TNMB 4YLQT 3MO1A 3TT1L 4OF3A 1V3MA 2CKBL 1EEUA 2OTUB 2I5YL 2EC8A 1DUZA 2XFXA 3VGGA 3LEXB 1I1AC 4MAUH 4LK4A 3DUUA 1U8MB 2J6EH 2PR4H 1G9EA 4MDIA 4PTTA 2B0SL 2N56A 3G6AA 2ORBH 2XKNB 1XGUA 4HS6B 4M1DL 3PWJA 1U8LA 1S7UB 1HKLL 1ZKAA 3QNZA 2ESVD 4RNRB 3LB6C 3ES6B 3QFDB 4HT1H 5DC4B 2O26U 5DLMH 5IIEA 4YWGH 1IC7H 4O2CA 1KLFA 1IE5A 1XGYL 2CKBA 1N64H 4J1UB 2H3NB 3H7BA 4K3DH 1KN2H 1BFTA 4YPGB 1LEKB 1C1EL 1HHGA 1NGPL 1TFHA 1V8HA 1EA9C 4MB3A 4DEPC 4GKOA 5J9PB 4IM8A 3L7EA 5GJSL 4HT1L 4BH8B 4L1DA 4WVRA 1URLA 1AGEB 4N0CC 3C60B 3GSWA 4K94C 4K3HA 3NIFE 3FN0H 1S78D 4ZNEE 4JY6A 4PP2A 3S9DB 4JPVH 1UEMA 1F42A 2EXWC 4YHLL 5CILL 4MDJB 4PRBA 2YZ8A 3EYQD 5D2NA 5EU6E 1P2CA 2QV2A 5F1IA 3STLA 2CIKB 4AZ8A 1SEQH 4WGVB 3BPLB 2A6IB 3UAJC 4QO1A 5H2BA 3MX0A 1T0MB 2KZWA 2WAHA 3DIFB 3CFIC 3R1GL 4GQ9L 4HW6A 3ZKMD 3BQUD 3SO3C 1NEZG 5EOCH 3ZE0E 3QIUA 4M7KH 1YQVL 3Q6FB 4FMFA 3HLAB 3I75A 3RZCA 2AI0H 1G1CA 1FNAA 4RGMB 3DNKA 1Y6MR 3DRQA 4JFPA 1EUTA 2JJTA 2G5BB 1CE6B 4HCRH 4UINH 1NBZB 4MSWA 3BGFB 1CF8H 2ITCA 4I9WD 2BNQB 3WUWA 3N85L 3DLQR 4H5SB 1MCWW 3RWDB 2R1XB 2Y25A 1HI6B 1S9VA 5EU6B 2CMRH 3GSRB 3QUMA 1F97A 4JLRB 5IMKB 4LNVA 1OTTC 4H0GA 4U4BA 3I6KA 5DUBA 5ID1B 4U1SB 3X3FH 4GMSL 3O3DA 3TBVB 3SDXA 1SBSL 1SEBA 4TUOA 5E5MB 3SE9L 2ZG1A 3ULVH 3DWTA 4Y5XC 2YRZA 2MQCA 1GGUA 1LO5A 4NYLB 2EXWD 3RBSA 5KVGL 1KB5H 3RWGB 4WTZA 4NQED 2R8SH 4QHUA 5GZNC 4MD4A 4AM0A 3VWKA 4DGVL 5GRJL 3FQXB 3LPGA 1CXEA 5FO8B 1AFVH 3S96B 1OB1A 4QXUL 3IJSA 5C86A 3OJDA 3VXUD 3HZKB 4Z7VF 5EIVA 2FGWL 4YHZL 4R90H 2C9AA 4TTDD 2NLJA 3K1KC 2A83A 1UB6A 3ZHDA 3W5NA 2DWDA 3SGEH 1N8ZA 3VXME 4RMQA 2DQFB 4HBQA 3FQTA 4TSCH 2AJ3A 4HWBH 5CP3H 4EBQH 1C5DA 43C9B 5INCB 3NIGF 1UJ3B 5FCUH 3HI5L 1ZHKA 1FFOB 1TCMA 1EO8H 1FL5B 1GGCL 3MCG1 1JVKA 2WUCL 4XVUC 2I07B 4XVJH 4ZUUA 1ZTXL 5IR1A 4HAGA 2FLBT 1R3LB 4I5BB 2XA8L 3HAEB 4PJBF 1UZ6E 4XPBL 3RY5A 4Q9RL 1LE5A 1PKOA 1U92B 1XZ0B 3IDJB 5DFVC 1FDLH 4A2LA 3QUZC 5GRVK 3B6SA 2CKBB 1OGAE 4DVRH 3MGTA 1ZANH 2NX5E 4IRJA 3D69B 4F58H 2NYYD 5HHOA 1LO3H 3T0WA 2CR3A 3F58L 5I1CL 3MRCA 3UYOD 2R0ZH 1GHFL 5CGYC 4C83A 4CW1B 1ZLVH 3O8XC 3WIFB 3EYFB 1IKFL 4MQ7B 5ENWA 4PV8B 1SYSB 1L7IL 3MGOA 5C0AE 5D7IA 3O0RH 7FABL 3KS0H 1WITA 5HDLA 5J56B 2GCYB 4U6YA 1RURL 3CAFA 3OX8B 4L4VD 3T8XB 1JGDA 4ZAKB 5ICXA 1RJYA 4JFDA 2AERT 3MJ9L 2OR9H 3D18B 4ZODA 1QYGL 2AQ3A 2Y36L 5AD0A 5FHBL 1CF8L 4YUEH 3TIDA 4F3FB 4JO4H 4WO4C 2BVUA 5J7CC 4GAJL 5I1AA 1B6DA 4LIQL 5C6WH 1GIGL 3T0BA 2EZ0C 2H8PB 2NCMA 3VFGH 3PWPD 5JOPD 3C5ZD 3EDKA 4UDTA 1M7IB 1NANH 5E4EC 4M7KL 1G7JA 2IMNA 5I71B 3CFDA 1I9JH 4JCMA 4L4VB 4PY7A 5KSBE 3NTCH 5EULV 4XWOC 1BEYH 2ICEA 2VAAA 4YDIH 5TGBB 4L8SC 3FQXA 4JY5L 3QRFM 3IYLW 1SBBA 5D6CA 4G6FB 1EGJL 5CP3A 5A2IH 4RFNB 2NZ9D 3PNWA 2NY1C 2XZQH 3HZKA 1AO7A 4MJ4A 3MRQA 4QYOB 5D2NC 5H35B 5FUCE 4OTXL 2DMCA 1H5BC 3UTSD 1IM3B 3VXUB 4NQXA 5F6HI 2H2SD 4G6KL 2EC9T 2R2BA 2W0FB 4HUXA 1T83A 4HMCA 5JMOC 4WTWA 4UBDD 3RTQB 4GW5B 4HIIA 4E0RA 4Q6IA 5EZIH 1WTGT 5EB9A 1IAMA 5F6IC 1U2HA 1WIUA 1I9IH 4OKDA 1WZMA 4OCWH 1RIVL 1NLDL 1KPUA 1SYVB 5DURB 3TZVC 3L3JB 4JRXB 5TPWH 2QADD 1TENA 2X10A 3SKMA 1A7PL 3UTPE 4OZGE 4U1GC 4XRCB 4NM4L 2A6KB 1FYTA 4JFZL 3BKCL 4K3EH 4U1MB 3RWCA 2BSRB 1EHLH 2DDQL 3VXTA 5HYEA 3CSYB 3QEGH 4EN3D 1QHOA 5EG6C 1FC2D 4MZ2A 3HCVA 3HE7D 1ZSDA 3S35L 5DJXB 1K5NB 4OIIH 1FIGH 5D7IB 1M05A 2BSTB 3BWAA 2PR4L 3H9HA 3UMTA 1LE5B 3Q48A 4Y1AA 5KTEH 4XNXH 3F7RA 1NCDL 2SEBB 3S3PA 3QPXH 3RGVD 4BQ6A 2F8VA 1M4KA 4JVUA 3BZEA 2ATKA 4HZAA 4PJAA 2PXYC 5K9JL 5SWZA 3PHQA 4NO0A 1ADQL 2EIZB 4LCWD 5BRZE 3L3DB 4HMEA 1FLRL 3GNML 3B9KD 5KZCD 1S7SB 1AXSA 4BFEA 2HMIC 3T0VA 4S1RH 4XZUA 1MVUB 1OAYH 2IFFH 4P9HL 1J05B 4PYHA 2VDRL 4EDWL 2VNCA 4F80A 3RVXD 5IEHB 2Z91B 4JG0L 2GYSA 5C0JA 1MCEA 2GIYA 4P46C 3M1BA 1SJHB 1P7QA 3V6FB 3RL2A 4Q97A 1YEHH 2OMBA 3CCHB 2VKXA 4NO5A 1NH6A 1S9WA 3BKML 1DQDL 4LCCA 1N4XL 5HHOD 3RIAK 4W81A 3QHFL 4X6FB 5I74C 3R8QA 3QBTB 3GSNB 2A9NH 3GJEA 5LWYL 4N0UB 2PTTA 2BRRH 2F53B 5DJ2A 4DZBB 4ZFGH 1IMHC 1MHHB 2YD7A 1NCWH 2O5YL 3WNNA 4YZFE 4HPOH 2FSEA 3VWKB 2GTWA 2QBWA 4G3YH 3U48A 5E00B 1UH4A 2QQLH 1HXYB 2I9TA 3VRJB 3S35H 2Q6WA 3VD4A 1CDIA 3BRFA 1F2QA 4LFHG 3D0VB 3PWVB 3KLHD 4OLZL 1NGYB 4Y4FC 1RMFH 4P4RB 1IAKA 2J8HA 5C0CA 4HUVB 3RWDA 1A1NA 1CZ8L 5JR1L 5EZOH 2NY3C 3V7MA 3VXNB 5LCVH 4GRWF 2EZ0D 3AREB 2QSCL 2AEWA 2DLEA 5B3JF 2MHAA 1D5IL 2MJWA 4EUPG 3G5VA 3KPLB 3ALWA 3MPCA 3GHBH 3UZEA 3IU4L 4X6CF 1T66D 4RMUA 3UTTA 1MOEA 1NLDH 2NY2C 1F11A 3LV3B 5DVNA 3PHOB 5GRZA 2AK1H 4ZO9A 1RAMA 5F3HB 1NANI 3OXSB 1FCGA 4TYUA 2R23A 1EAPA 2C3VB 3IFNL 4ZOBA 4EQ2A 4OZHA 4OLYH 2AV1A 2BJML 5GGSY 4GG6A 2ZUVA 3GSNL 4U6XB 3MODH 5C8JB 5JHLL 4AL8H 4ODSL 3HUJE 1AQDA 4KY1H 3O6KH 1F4YH 4OCYH 2KDGA 1NBYA 3QIWA 3EYSL 3IF1A 5F89A 1CXKA 1OAZL 1U91A 4MJ5B 3PWNA 5GIRB 3UBXA 5AAWA 1ZHBA 4CKVX 3DETC 1AGEA 1ZAGA 5L9DL 4OCNC 5I1GL 4KJWC 3SPVA 2HN7B 2NXZD 4Z5RB 4IJ3C 1CFSA 2DJ4A 3KPSB 5T5FH 1AI1H 1N3NA 1R5VA 1HHKA 4OCRH 4M93C 3D0LA 5E00A 5FDWA 2NR6D 4I3SL 1D5IH 3D39A