4GG6A

Protein complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
182
structure length
180
Chain Sequence
DIVADHVASYGVNLYQSYGPSGQYSHEFDGDEEFYVDLERKETVWQLPLFRRFRRFDPQFALTNIAVLKHNLNIVIKRSNSTAATNEVPEVTVFSKSPVTLGQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTFLPSAIYDCKVEHWGLDEPLLKHWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DQ alpha 1 chain
publication title Biased T Cell Receptor Usage Directed against Human Leukocyte Antigen DQ8-Restricted Gliadin Peptides Is Associated with Celiac Disease
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 38
structure length 180
sequence length 182
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gg6A02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4gg6A01
4GXVL 4NDMB 1CXFA 2O93L 3PQYB 3SJVD 3V0VB 5IROC 2W9DH 2RR3A 4MQSB 3EO9H 1KC5H 1A14L 2LVEA 1TIUA 5CILL 1Y0LB 4JY4A 5I0ZA 3DIFA 1S7RB 3TZVD 1A9BA 5AWNH 3FQUA 2WUBH 4KMTL 4LARH 1FIGH 2ATKB 3ARZA 3DWTA 1S9YB 1ORQB 5JORA 4R97C 3BP4B 4HGKC 3B9VA 2ZCLL 4H1LG 3U1SH 4L4VA 5SX4I 3HNVL 2F54E 4QWWC 1MFAL 1T5WA 1XIWB 1K85A 1K4DB 3I3BA 4HUKB 2R2HA 5DVKA 3CUPB 2H26A 5DK2A 3W9DB 1YJDC 2BNRA 2DL2A 4MCYA 4F37K 3SPVB 3RVTD 1WBYA 1DSFL 1IC4L 4LHJB 2A6JB 1OD7A 4X5XA 3CD4A 3VFUA 1NC2A 2NYYC 3CLFH 4RNRA 3X12B 3DRQA 3KPOA 3HZKA 4P2OB 3MRBA 4NHUA 3BH8B 4ODHL 5E8EA 1XGTB 1KCLA 3VGDA 3SEPA 1OPGH 4KVCH 1FZJB 1D5MA 3CX2A 3GSXA 2Y07L 4BZ1H 1R3KA 1MH5B 1T66D 5I75B 1CE1H 4APQA 5HHPA 1QLEH 1UKSA 3D0LA 3BEVB 3TT3H 2YK1L 4U1KA 2EDHA 3SQOL 4TTDD 2LTQC 4M62H 4RFNB 1C7TA 1NSNH 4HUVB 3N9GH 4PRHA 3OG6B 5F88B 1X5KA 4ZOAA 5C0AE 3WJJA 2V2XB 1VENA 4KI5F 3LD8C 1S9WA 1TNNA 4AENA 1TENA 3P9LB 2PO6A 2R4SL 4JREB 4OZGA 2QQNH 5DFWH 3S5LB 2D9CA 3TYGL 4NN7B 2VXQH 3H3KA 4M1GL 1FG9C 4P5KA 4EUPH 1CICD 3SY0A 1XCQB 4XB7A 5K9OB 4DKFL 4JANA 4ELMA 2P7TB 3VJ6B 4HXAH 2DM3A 2VOTA 5BZDB 5CS7A 7FABH 3F5WB 2V5SA 3MLZH 4PJIF 1T0NA 4JHAH 3CVIL 1H8OA 1QLFB 5C6TH 4ZNCD 3OZ9L 3G5YA 4KRNA 5J6GA 1RULH 4ZMAT 4XC3H 3QFDA 4FABH 3C5ZB 5A2FA 3TLRA 1TZGL 5JXED 4UT7H 3PV6A 4BZ2L 4HQQH 3GSOB 3L3GB 2A77L 3GHEH 2GSGB 4FZ8H 2P8MA 3QRFM 4GBXC 2HTKD 9CGTA 2DOCA 1U92A 4ZSOE 4ZTOH 3CFBA 2X4OB 3TEUA 3AVEA 3FN0H 3VFVA 2H1PL 3LKNA 1C5CL 5GJSH 4FFZL 3LEYL 5CZKA 1RY7B 1WBZB 2X4UA 3OJDB 2R29L 2D7PA 3UC0H 3DSFH 1I1RA 2BZDA 4F15B 2XZCH 3L3DB 3WS3A 1IEAA 1VFUA 3FOLA 2G9HA 2BXZA 2NTSP 2EDYA 3F7PC 1H3UA 3ARVA 1E4XI 1NCWL 3WIFB 4GAJH 5E08L 3TA3C 1CFQA 1SYVA 2AK4B 2YPVH 1N4XL 3MRNB 1HDMB 4ONHA 3FO9B 1H15B 3WKNA 1ZVSA 1MY5A 2I9LA 3MLUH 3MOQA 3I2CL 4P2RA 5I18L 2JF1A 4HUWB 2RAMA 1FVDB 3KLHD 5C0CB 1AXSA 3OKMA 5BO1L 1N64L 3L6FA 3CFJB 3K4DA 3RGVC 4LLYB 1UZ8A 4J4PA 4XBGA 4WENB 4YBQD 4QHMB 4LLQB 3QIBA 2ITDB 5IMKB 3QUXA 4LRNL 2GHWB 4Q9CA 1E4WH 1ORSA 2GW5A 1SBBA 3IDGA 3UBXA 1SJHB 2ARJB 1HZHH 3U7YL 3VFNB 3OR6A 2B4CL 1HH6B 2BNRD 5D2LA 4KVNH 3CZFA 5JOFA 4OBRA 3U36A 1H3VA 4L8BB 5JR1L 1WCBB 1B4RA 1QPXA 2FECL 1K9TA 1FAIH 3IDMA 4NOFA 3C8KB 3HB3C 5GGRY 5TDPB 1U3YA 3U9PL 3FHAA 3RY6C 2R2BA 1IJ9A 3VCLA 3MCLH 1GZQB 1YN7A 1S9VB 3DV4A 4PGCB 5F93C 3SKOA 3VWKB 1QFWH 1DBKH 4PBXA 2FX8H 1ES0B 1MRDL 2XG5A 4AM0B 3VMOA 4Z0BH 1W72B 4KKCD 4FZEL 3GO1L 1T83C 4JM2D 3TO4A 4ORZC 5D1XB 1JMZA 1HYSC 5DJXB 1I3VA 2B1HL 5IHLB 3ARTA 5EOCL 2YWZA 3K2MC 5ICZA 3F7YB 4X7TB 3SDXB 1EZVY 3QFJA 1DFBL 2AV7A 3L1OL 1KTLA 4MJIE 5IHUH 4GG8B 3IFNH 2VQ1B 3L7FB 4LSPH 5GISL 3NFNA 4YHYB 4HG4J 3L7EB 4K3GA 3W0WB 3NACH 4BSVA 4S1SH 4DZ8B 1G9NL 2PO6D 1A1NB 1R5WB 2Z35B 4DGYH 4MNQE 1GOHA 4H25A 4D94A 1A6TB 4OT1L 2GY7B 4WTWA 1TPXC 2O5YL 1DQDH 1V8HA 5L6YH 2ITCA 2OTUB 2OJEA 5LAXA 1I3RB 3UZEA 4LLVA 3D87B 5A2LH 2YHGA 2O5XL 5DQ9A 4KXZI 5DD3H 1JRHH 4M8QB 5D2NB 1MY7A 5SWQB 2NY2D 5E2TL 4O2EB 1DBJH 1P5VA 2EDDA 4K9EL 2QL1A 4QXGL 2PF6A 3QH3A 3IFLL 4NT6B 3WFZA 4KMQA 3QEGL 3SKJH 5EG6C 3DXAB 5JQ6L 4X4ZA 3WCYA 4Q9QL 5E9DB 5HI5D 4PRIB 1NLDH 1OTSD 1RIUL 3Q6GH 3O2VH 1AE6L 4OLVH 4U1GC 5HVFB 5CJXA 3ARRA 2QHRL 3CFCL 3VXMA 2ORBH 4OTXH 3WEXA 1JV5A 5HVWA 4XCCH 4QHLA 4CL7A 3ZHLA 4YFDB 3MGOA 3VXSE 5GS1B 1JWSB 4Z95L 1II4E 3O6KH 3MGTA 1VACB 1A02N 1RZ8A 1X5LA 3OKDB 1U8PA 1FVCB 3BD4A 3I6LE 4WDIB 2JIXB 5B39G 1NMCC 4DN3L 3K8KA 1IILE 3WJLA 2P5EB 3V4PH 4DUVA 3BKYH 5LJYH 2NZ9C 3TN0C 3T65B 1NC4A 2P48B 1QHOA 3BPNC 3QXVA 4D9LH 1A7OH 4G9FE 4XBEL 3G04B 5LQBL 2OL3B 4YXKH 4XBPB 3BGMB 3ULUL 2IC2A 3INUL 4LCCC 1R6VA 1A9EA 3QIBD 4YDIH 4QTHA 4NWTL 3QUXD 1U8QA 1I4FA 1B0RB 5AAMA 1CF8H 4X6DF 2ZNXA 4F7PA 3LKOB 2ESVE 1MCOL 1EEQA 1TQCC 1JTOA 1FJ1A 1RZGA 5C0BA 3UJIL 3IU4L 4U1HB 4X6FA 4KDVA 4GRLC 4NBZB 4N0UA 1D6EA 2H32B 5E2UL 5T5NG 2R2EA 4EUPA 3GBNH 4PY7B 2VLMD 1IEHA 5ANMB 3SGDH 1PGRB 1LP9A 2JCCB 3NAAH 4QGYA 2R0WH 1SJEB 5I2IA 2HT2C 2GJZB 4MCZA 1CDIA 4G8GE 1AC6A 4QRQB 4P9HL 2WBWB 2OMBA 4MS8D 4EJ1C 1GL4B 1OL0A 1BZ7B 2NMSA 4Y5YC 2R69H 3U79A 2EXYC 3Q1SH 4JZNB 4PJ7A 1X5JA 2VDPL 4ZUVA 1JGVL 3TO4D 3MXWH 4LEXH 1OCWL 4J3SA 5C70A 1CG9A 2R1WB 5CBEA 3W9EA 1NAKH 3GI9L 3PWJB 4XPFH 3QFJD 5IEHB 3T8XB 1L4IA 4N0RA 4D8PB 4U1LA 3CDFA 3MYJB 3MA9H 4L4TB 3WN5A 5EOCJ 3UAJD 4OUUA 3PG2A 5DUMH 3BKML 3LEXA 5IFJB 5MENA 3NCJH 4NO3B 4OIIL 3OB0K 4U6HB 4R4NC 4NQSA 1KTDB 1N6UA 4JZJC 4PJAE 5CD3B 3P0VH 5FXCH 1UM4L 1QR1A 4OQ1A 2VLKD 3O4LE 3QUKB 3C87A 4OZFB 1TTFA 2Q8AH 5EO1A 1MEXH 3W82A 1MOEA 4KPHH 3DYPA 1BFVL 3GUTA 4JCMA 2NLJA 4R0LB 5E2VL 1NCCH 4HGMA 3E6FB 4S2SB 4MX7B 2FLBT 1W0VB 4OD2B 4IDLA 5MI0C 5CJOL 1BIHA 4WJ5A 4OF0A 3MNWB 1AQKH 1FYHB 2PYFA 5FYKH 2DWEA 2V5YA 4PIRF 3MV7B 4OLWH 4YHOH 3TP4A 2B1AH 4ODWB 4MLSA 3ZT7A 5DRWB 1Q9LA 3JV6A 4D0CB 1DN2A 1DVFB 2XA8L 1F8TL 2BRRL 2VL5A 5E5MA 3OKKA 1JL8A 4F33B 1T03H 4GKSB 3VXMD 3VXNA 1U6AL 4NKDB 3TO2B 5HHOE 4ISVB 5ALCH 2OQJA 4G9DA 1R3HB 4IRZH 3U7WH 4AEHH 1N0XH 1IKFH 3B2UC 3X17A 2F8XC 4B7IA 1G7IB 1MPAH 4G8EA 2H8PA 2AXHA 5B8CB 5FM4A 4F57H 2AK1H 3CVHL 1QG3A 1MFBL 3FRUB 3HG1A 4JG0H 2D4DA 4NZTH 5T3ZD 4WO4C 5GGRA 4ZG1A 4MDJA 4TUKL 3V6OE 1LQSR 2NW2A 3N1FC 4GUPA 1NUFA 4WW2A 4XMPL 2N7BA 1EFXA 3CZJA 3KYAA 5JIKA 2Z8VC 2M8XA 3H9SA 4WV1B 3KDMB 2ZJSL 3DROA 1NC4D 1J5OL 4JDZA 3K1KC 4BH7B 1PQZA 1J8HB 1NLBL 4M43H 2GT9A 3MNZB 4NKOA 3RWHA 1P4IL 2EC9U 3KYKH 3UTZA 2OJZH 3NIGF 3UXFA 3J7HA 2XRAL 3HNTL 4UV7L 3S34H 5E00A 1D9KC 5KG9B 3S37X 5F9OH 3QXDA 3RU8L 5SWSA 2ICEB 1CGSL 1TZHA 1YQVL 1CLZH 5C0BD 3MNVA 1C5BL 2J4WL 2L7UA 4PLJD 5DGQA 1U8IB 3ZKMC 3VXQB 3V5KA 3A6CL 2ED8A 4KRLB 2G5BB 4NUJA 1E28B 4WVRA 2VQTA 1OAXL 3ZYIA 4GAGL 1LWRA 1MI5A 1Z6JT 1OAQL 5FYJH 3IAGC 1JMXA 3QHZL 1I8IA 1J18A 3FFDB 1UCBL 1KENH 4DW2L 2AKRB 3ALPA 2JCCF 2CK0L 3BSZL 4K2UL 4R7NA 4KZDL 1AGEA 2DQIH 1P84K 4OZHB 1J1XH 1N26A 3GMQA 1J8KA 2HFGH 2NX5B 1INQB 4BM7A 2G5RA 1PZ5B 1F45A 1RZKC 1W2KT 4K71C 5DS8B 1H9VA 4EQ3A 4NRYA 2R0ZL 4X6DA 1UWEL 5DO2D 1OT2A 4E5XB 5BXFA 4IRJB 2KUTA 1JNNL 4GXVH 4H0GA 1HHHA 2DAVA 4QRSB 1R24A 3IF1A 4XNQA 5GZND 1FC1A 5MEND 1A14H 5DLMH 4YPJA 5CILH 1CE6A 4OKDA 3ZE1F 1WFUA 4KMTH 3EAKA 4BUHA 5J1AA 2BY0A 3GGWB 2IQ9L 4KKLC 3ULSB 5FF6A 5J6HA 4PJBE 2ZCLH 5C0JA 4XCFL 3HNVH 5E6YA 3BDYL 5SX5K 4MXQD 3AS0A 1MFAH 4QNPF 5JW5A 4Y5XB 4WNQB 4JY6B 5EO0A 3M1BB 1BQUA 2HYMA 2ZKHL 3QXUA 4F9PC 3ARXA 2PXYC 3VFMB 4W4NA 2OR9L 2P47B 4XH2B 5IEKA 4OFPA 3EYUL 3MZGB 1DSFH 3SGEH 3N1GC 1CGVA 4BFIA 1S8DA 4ZXBB 5IBTH 4UB0L 1DUYA 2DLFH 1U3HA 1HXMB 4AQOA 2J6EL 1OF2A 1F02I 5E1HB 4QRPA 5SWZE 4J3VA 1NMAL 1QRNB 3MLXL 1BHGA 4BQBA 2XWTB 5IT2H 4JFZH 4L4VB 4YGVA 5EU4B 1YC8A 2Y07H 5B38A 2EICA 1QKZL 3HUJA 4MSWA 3IRZA 5EU6B 5CINL 1MRCL 2W38A 2YK1H 3UPCA 4AIZA 3VWJB 2XICA 4NRXA 2EDEA 3M07A 4HJJH 3SQOH 1ZLVH 2QSCL 2E9JA 5I1KL 1IGTA 2Y36L 3VGFA 4BFBD 2LQRA 2ID5A 2ADFH 3OPZL 5DMGD 1NC2B 1KB5B 4M61A 3HG1D 2VIRB 1MJ7H 3TIEB 4NBXB 4C59B 4NHUB 4LNVA 1BPVA 3BOVA 5I9QC 5IV2A 3F12A 3L5JA 3MV11 1EFXD 2R4SH 1ZANL 1FYTB 4RGND 3M45A 4M1GH 4APQB 3H9SD 1OW0C 1ITCA 2NY5L 4H26A 1I9JL 5DHYA 5GIRA 4DKFH 3ARWA 4CVZA 2XQBH 3HAEG 5AG8A 3SCMC 2CKBH 1F58L 2PR4L 4FXGB 3WHE0 3CVIH 4TNWK 3OZ9H 3QQ9C 3AREB 5HI3C 2CMRL 4YWGL 5SWSD 4CMHB 2JJTC 3FO2A 4PP2A 5JXEC 3QXTA 1MQKL 1TZGH 1LNUB 3B6SA 3BDXA 1T20B 4RFEA 4BZ2H 4OZGB 2V5TA 1M71B 1VFAA 2A77H 2VISA 3RKDD 5BZWA 3UZVB 3QZWB 2UZIL 3C5JA 1RZIA 2UY6A 3IVKB 3PP3K 4UDUB 1MWAH 5INCA 1S7XA 1VKXA 1FE8L 1DDHA 5HVGB 3UYPA 4OLZL 1MVUA 2Z91A 4JANB 1FFRA 1ZLWK 1EIBA 1MI5D 3L5HA 3MRMA 1M4KA 4LHQB 3TNMB 4W81A 5IVOA 2H1PH 1C5CH 3VFOA 4FFZH 3LEYH 4KDTA 3GJFK 1FC2D 5IB1B 4HGWB 2R29H 1BJMA 4MA8L 5H35B 4MD5B 2BXYA 5HHNA 1T1WA 1NCWH 1YMME 4PTUA 2P49B 5E08H 3LHPL 1QVOB 2G2RB 1N4XH 5I1LA 3HE7C 2DYPA 1PZUB 2YUVA 4F7CB 4OZHF 2CO7B 3D39E 3I2CH 2ENYA 5I18H 5GGTL 1OOAA 2EO1A 3MRCA 1GGBL 5EOQL 4D2NA 5BO1H 1N64H 2YD3A 1EHNA 2P42B 3S96A 4WU5B 2X4UB 1NAML 3SDDC 1AD0A 4Z8FL 1AO7A 3HFML 3QXWA 1I1CA 3OKNB 4KDWA 1UWGL 2RIKA 4X8JB 2APBA 2X6MA 1I3GL 3KLSA 4U6XA 3U7YH 5I1AA 4YR6A 3RWCB 5CIPB 2YPKA 4O9HH 3O8XC 5DYOB 3ROLB 3DHJA 4R7DA 3EFFA 3QDHA 5JR1H 3MCKA 4P2RB 4WFGD 2J2ZA 4Z7QE 1KOAA 2Z9TA 3V9FA 5GRXG 4C83B 1CCZA 2X70A 1U3HD 2EDQA 3G6JE 4WWKC 1R3JB 5IB5B 2F9BT 4LRIA 5DUPL 4HZLB 4PRNA 5DMKA 4GKZA 3RWJB 4KJQD 1MRDH 3EJZC 4B0MM 1CK0L 3LQAL 3RZCA 2GITB 4JM2C 4FZEH 1J0YA 3GO1H 2SEBA 5DVOA 2NY1B 5IB4A 2HJLB 1MF2L 2B1HH 5EOCH 4Y1AE 2F53A 1SY6L 1DFBH 3QEQA 2FEDC 3N1MC 2DF3A 3O41B 3L1OH 5HYJB 1QSEB 2FH6A 2XZAL 2ADGA 3ES6A 4FFYL 1EO7A 5CSZA 4KUZH 5I74B 5GISH 3MLRL 3M17B 4GS7C 1YN7B 2EEDA 3MO1B 3NMEA 1ZLUK 4YHNB 4JO2L 2FEEI 2I26N 1KJ2L 3W39A 1IE5A 5F21B 1EVTC 4X98A 1G9NH 4OT1H 3BZ4B 2O5YH 3WFDL 5J4MA 4OCXL 4UNVA 2RB8A 2XI9A 3MA7B 4F9LA 2J5LC 3O11A 4NKIL 4NQEA 4JFPA 3ZE2E 2O5XH 1F6AB 2NY2C 4MA7H 2PTTB 5E2TH 3T4AA 3U4AA 1CFVH 4HW6A 1UXWB 4K9EH 4QRRE 3UTSB 2PTVA 1HXYA 2X4PB 2AAVA 4HIHB 4FQXC 3KPSA 3QEGH 1DQJA 1DL7L 2J88L 2KL6A 1EVUA 3ARBB 5JQ6H 3QUZC 3V7AG 3NN8B 1OTSC 1QBAA 4Q9QH 1RIUH 3HC0A 3MV8B 1FAKT 3HZVA 4LEOB 4NO0A 2AW2A 1AE6H 1EDQA 1R5VB 3ZSSA 2QHRH 2E7LC 3CFCH 4KTDH 1HIMH 1BLNA 3MODL 1GGTA 1KN2H 1U0QA 5DD5H 3EOTL 1CFTA 1HN1A 2HMIC 5E0QA 5F7YC 3V0AC 1XCTA 4GQ9L 1C08A 1EBAA 2YPLA 5BV7B 5FYKD 3QH3B 4PV8A 3U0WL 2XIDA 2FWOB 4F7MB 4OQTL 3WNPA 1IGIL 4HHAB 3EOAA 3E2HB 1ETZB 2BHZA 5KAQG 2DYPD 2IANA 3UP1A 1VGKA 4DN3H 1MJJA 2CGRH 4BH8B 2XTLA 2VXSL 4YHPB 1H0DA 5TGBA 4WI7A 4QHLB 3THML 4XBEH 4LHUG 5LQBH 3FCTB 5C2BL 1AO7D 4CAGA 3ULUH 2C1PB 3INUH 2YR3A 1C16B 4XWOC 1U93A 2Z93A 3GSVA 3RWEA 5M94B 2R9HD 4GLRH 3MGTB 5HGBB 1SVZA 1EEZA 1CD0A 1IGFL 4NQXB 1RK1A 4U2ZA 5CBAA 3UJIH 3IU4H 4N9GA 5AZ2L 1LO3L 3BVNA 2HJFA 5E2UH 4ZS7H 3I02B 4XP6L 4F8QA 4DN4L 3HLAB 3RUGA 5HGDA 5DTFA 1TITA 3OMZA 3N85H 2JLLA 1HHJB 1XAUA 1BZ9B 3MCG1 4LPCA 4YIQA 1ZT1A 4Z9KB 5E1AB 1KPUA 4JO4L 2CKBA 4TULL 3EJYC 2DQDL 5C92A 4JQXA 4BSJA 1KSRA 3EYSL 2XT1B 1HCVA 2XFXA 3RZCD 1ND0B 4CRPA 2VDPH 1JGVH 3PXJA 1OCWH 4DKEH 3PP4L 3SN6N 1YMHA 4DVRL 4WI5A 3GI9H 2F53D 2CLVA 4HBQA 4N0UB 3F7VA 4DCQA 3TCXA 5DRZA 2R2EB 3QEQD 1MWAA 3OKOB 1I7RA 4ZAKC 4IIQA 3BP7B 4MA3A 3E1F1 3D48R 2E7HA 5FYJD 1ERNA 2J3SA 4I9WE 3BKMH 2EZ0D 3IKKA 1NFIB 5MHSD 4OIIH 3L95A 1CD8A 2CRMA 5I76A 3FB7B 1M1SA 1GXEA 4PJ7B 4P3DB 1ZS8B 2BVOA 4L3CA 1RMFL 4XGZA 5LGJB 2HLAA 1UM4H 5D7IA 1CG9B 1YJDL 5D4QA 4JAMA 3QSKB 1G7HB 4DUWA 1BFVH 3FQRA 5BMFL 3BN9C 1U42A 2V9RA 4P48A 4XX1E 4NNYB 4NQED 2DB8A 4EXPX 1NEZA 3MUY1 3BIKB 4AQ1B 4XX1G 4J6RH 4HPYL 4I3SL 5F6IC 4MD4B 1WFNA 3ARDA 5CJOH 2VN4A 3KPSD 1QHPA 2ZSVA 4D3CL 3V6FA 4MXVF 3DNKA 1LE9A 4X80L 3IXTA 4Y16C 1X44A 3S8WA 2APVA 1L7TL 2XA8H 1F8TH 4KI5C 1XH3A 1PY4A 5HYQB 1RK0A 4NO0D 4KRPC 4X9GA 5J13B 3TV3L 4JRXE 3DUHA 4JHZA 3IAQA 5HSFA 4B41A 1U6AH 1QSVA 4JN2B 5E70A 4O58H 2DKSA 5D7JA 4UNUA 2GFBB 5JIPA 2FSEB 2HP4A 3RA7H 4ZNEA 4MQ7B 1KXTB 3PUCA 4XNZC 5EUOA 3PQYE 1JYWA 3DX7B 1NCUA 3RPKA 5FUCC 3P9WB 4KJWD 6FABL 3IDUA 3G08A 1EGJL 4GKOA 1MFBH 5T1KB 2VAAA 3V8OA 3P4NB 4HKZB 2EH7L 2IAND 3RIAF 4TUKH 5EC1A 1SMAA 4XMPH 3KPMA 5DURD 4CADA 4Z0XB 3LRSA 3BT2L 4M1CC 1HSBB 1G7LB 3VXNB 2ZJSH 2MQ3A 2J1KA 4O4YL 3W5MA 3HI1B 4WHYG 3IDXL 4X4ME 5JW3H 1WK0A 1TCRA 2Z92A 1EHAA 1NLBH 2GK0A 3TCLA 1P4IH 1LO4H 3V8CA 3MBEA 5KSBE 4PV9B 2XRAH 2CDEB 3H3BC 4UV7H 2VXVL 2ZUUA 5E56A 5E99L 1A1OA 1NCBL 4GRMB 4PJ5A 1CGSH 3SGKC 4MMXC 2XPGB 3FB5B 3SOBL 4RMWA 1ZE3C 1GGIL 2VZ1A 2J4WH 3E0GA 4HJGA 3FFCA 1RHHB 3A6CH 2L0DA 3B9KC 3EDDA 1T04A 3WLWC 1HILB 5MERB 1A3RH 2APFA 4WW1A 4L3EA 1P9MC 4ODVL 5I1JL 4GAGH 3BWAA 1V7NL 1BM3L 5DD6B 1OAQH 4NYLB 4OF3A 4WGVB 3QHZH 4PJ8C 5EZOH 3MV01 5E8OA 1UCBH 3REWA 2F8VA 4K7FB 4DW2H 2CK0H 3BSZH 3NVQA 4K2UH 4M7ZB 5DJ2B 4KZDH 2MOVA 5I1GL 3SKNB 4ODXA 4Y7MA 2W1NA 1XEDA 2DBLL 3C09B 1GHFL 4OD1L 2XNAB 2BDNL 3AXLB 3I3DA 3V5KB 2LV4A 2E8ZA 4HIXL 1YY9C 2R0ZH 4EDXA 1UWEH 4M9OA 1UB5A 2DQFB 4X6BB 2EC8A 3FTGA 2NY6D 4ESKA 5IHZB 1RIHL 1BBJB 3CFKB 2KQMA 4KK9D 4W70A 3IJSA 4PGZA 5K59F 3I3EA 2FR4B 4FP8H 1XIWC 1RJZA 1FNGB 3MUGB 3MRGB 1AKJA 2IQ9H 5DMYA 3TVMA 3WFHA 1T22B 2JJUA 3PIQB 2BOBA 1NGYA 3QPQD 4UQ3A 5GSRB 5BRZA 1U91A 2R56L 4I4WB 3HA0A 4UINL 4QRTB 4RMUA 3U4EB 1T5XB 5DSCB 4P2QE 2ZKHH 2X4QA 3GMOA 4J1UB 4M48L 4Z7UB 2OR9H 4PJGE 2NXZD 2YBRA 3EYUH 4ODSH 4P2OC 3U9UB 5DJ6B 2BNQE 3S98A 4I2XA 3O6LL 4UB0H 2N56A 4NQCA 3GMPB 4XP4L 4LSQL 5B4MD 5I75C 4FQCL 1LO5B 4RZCA 1X5AA 1NMAH 5J1AB 3CXDH 4FXKA 3MLXH 4G6FD 1JCKA 1RFDH 1IC1A 3REVB 3WHE1 3GDBA 3GSNL 1SYSB 5BS0A 1ZGLM 1MNUL 4K3EL 3BPLB 3T4YB 3MOAH 5IVNA 4DEPB 5FCUH 3ULVF 4LDOB 1QKZH 2Y7QB 2AK4E 1R0AL 1JPTH 4RFNC 1KIPA 4U1SA 5D7JD 5F9AC 4QOKB 5D7KD 5IW1A 1CVSC 2XQYK 2YXMA 2BY1A 3QRGL 4DQOL 5I1KH 4PP1D 4N90E 4ETYA 5DMGC 1AXIB 5I73B 1WZ1L 3OPZH 4JREC 4Y4FA 4OKVB 4L5FL 4NN7C 1FYTD 4QRPB 4HKBA 2QR0B 3OKEA 1MLBA 4O2FA 4LF3A 3BRFA 2YWYA 3VFTB 1D5ZA 4U3XA 2AABH 5F1NA 4LLWB 1ZANH 5CP7B 2J8UB 4LBEA 2E6QA 4G8IB 1DJSA 3CFIC 4D0DA 4UOJA 3GNMH 2NY5H 2HFFA 1P6AB 12E8L 1I9JH 4Y4KB 4AIZB 3O9WA 4UUJA 4NRXB 5MEPB 3C5ZC 3MBED 1F58H 2V7NB 3WO3B 3KYNB 5GRZA 3F7QA 2RGSA 2CMRH 4WI9A 3UROR 4MVBD 4A6YL 4PJ5D 5E6ZA 4DZBA 3U0PA 4GRWB 4HD9A 4NZRL 3KLAB 3MMEA 3L3OA 4YHKL 2O61A 3FFCD 4X6CB 4ELKA 3RKDC 3RY5A 3PWPE 2UWEE 4KJPD 2UZIH 1IAOB 1K8IB 4L3ED 1FE8H 4PLKC 4OLZH 3SDXE 8FABB 1T1ZA 3P4LA 4NC1E 3DX6B 4F15C 2XKNB 3EW3B 4JFHD 1NGWA 1RI8A 3DVGB 5CZXC 5HPMA 3MLSL 4LVHB 1Q9OA 2AV1B 3QQ3B 4NPYA 3RKPA 4MA8H 3CSYB 4OF7A 3FO0H 5JIHA 2IPKB 3B6SB 3MRKA 4HV8A 5C0FA 2V5RA 2W9LA 2BSTB 5EO9A 1HSAB 3LHPH 2WIMA 5IVXE 1KG0B 3MRDA 4M7JL 4PR5A 4RISL 1MCPL 1B90A 5DJZA 2ARJQ 2AJ3A 3PWUB 1DQLL 2Z91B 2NY4B 4MB4A 5GGTH 3T2PA 5GGQL 4RMQA 3S9DB 4V1DA 1GGBH 1D5XB 5EOQH 5HHMD 3FZUC 5KSAA 5JNYB 5F7HA 1MCJA 1RPQA 1VESA 3CX5J 3Q2CA 5D2NE 4IRSA 3HFMH 4GOSA 1AKJD 5IWLC 3TVMD 4PJEE 3CFDA 2GAZA 4JHBA 5JUEL 3MRFB 1CGUA 3BGFB 2OP4H 4JFDB 5BRZD 2Q87A 2WIIB 3AY4A 4ETQB 4YZFF 1NJ9A 5EDXA 4P46B 4WFED 2CRYA 1I3GH 1V5JA 4M9PA 3RQ3A 4G42B 2EE6A 3RX7A 5KS9A 3EUUA 4PRIE 2BMKB 1SJVA 3BP6B 3VFSA 1PKOA 3FQWB 3ARGA 1KELL 2FGZA 2VNCA 3DV6A 4LKXB 2DMBA 5CKGA 3VWKC 1U8JA 5HGHA 2GEEA 1U8OA 4NQCD 3SDCB 3ULUD 5D1XC 1LEGA 4JRYA 3S4SB 5DUPH 3JWOC 2EXWD 1YQ2A 1NCDL 4W4OC 4DFIA 3K1DA 4EN3A 4YHLL 5BS0D 1CK0H 3LQAH 4ZQKB 5I8CB 2KH2B 5FFLA 4NC1C 2PUQT 2A1WH 2XTJB 4XNYL 4MQXC 5FOBA 1QSED 4XPTL 1HI6A 5DJ0B 3MRLA 2I24N 4YHYC 2VITB 3SE3C 1SY6H 2A6IB 2XZAH 5ISZB 3LZFH 4S1RL 5IQ9A 1A6ZB 1DE4A 2A83A 4FFYH 5D7LE 4ALAL 5IB2A 4XXCC 4Y4FD 1BWMA 3MLRH 4HK0B 5ID0B 4JO2H 2BVQA 2X44D 3WIIL 1KJ2H 5DMKB 3L3JA 4PJCF 4FFVC 2V2WA 3C2AL 1XR8A 5EIIA 2IFGA 5ID1B 1QTYT 5L2KB 3SBWA 2R0LL 3JWDC 3WFDH 4OCXH 1UGNA 1IQDA 2Q8BL 1ZSDB 5T3XE 5HYSB 1S7SB 3VXRE 4IOFD 5D2NC 3BO8A 5DK3A 3HR5B 3D3VB 5EBLB 4M7KH 3O9WD 3RAJH 3VRJA 4KFZC 4Q58C 4NKIH 3FQTB 1M6OA 2JCCE 1AI1L 1BD2B 2J8UF 1P69B 4XAKE 4BQ8A 3LQMA 2X4TB 3RWGB 1WITA 1OHQA 5IM7A 4MXWH 3BYTA 4HWZA 2IAMB 5LBSL 2KZWA 3H42H 2J88H 1CL7I 1V05A 3SDAB 3T04D 3DMMB 1BAFL 4L1DA 4KQ3L 1OB1B 3G9VA 1F97A 1IQWL 3HMXL 4JLRA 4GRWF 5CHNA 1FO0H 1G9MC 4JJHA 3ZZ1A 3T09A 5GS1C 4Z5RB 3VFRB 1JNHA 3MODH 3CU1A 2Y6SD 3DUSA 3BYYA 3TBSA 2EDTA 5DT1L 3EOTH 2P24A 3OR7A 2BY2A 4GQ9H 3T4AB 3MRJB 4D0BB 3D1MC 3QO0B 2VJXA 1NMBL 2EIBA 4QNPE 1WIUA 4RIRB 5I1HL 1HHGA 5IUSA 3U0WH 3BH9A 2JELL 1BVLA 4OQTH 3CSPA 3C6LB 1D5IL 1S7WA 1JHKL 5HDOA 4P5MB 1FFPB 1I1AA 1E27A 2WV3A 3BDBA 1YN6A 3WDJA 2YOCA 3RWFB 2DL9A 2VXSH 3RVXD 4V1DD 1K4CA 1PSKH 1QA9A 5KSAD 2QKIB 1NFDB 1MREL 3OL2A 3THMH 5IGXL 3S36L 1F3JB 4Z77B 1LD9A 2D0GA 3TPUA 5C2BH 1FV1B 3IFPA 5IK3A 3SJVE 4HFWA 1IARB 2YPLB 3NH7L 3QWOA 3FQNB 4QXUL 5CGYC 2H2SD 1FZMA 2D0HA 4J3UA 1FNAA 3D0VB 5FGSA 1WJ3A 3D2UA 1IGFH 2F5BL 3SE9L 1IGJA 1LO3H 1VGKB 2IALA 3ARGD 4H1LB 4DN4H 4PGBB 2IPTH 4Z6AT 3V6ZA 4LCWB 3QIWA 4Z78B 2F54B 5JDSA 5DEFB 2X42A 4JO4H 3D9AL 4JRYD 2OYPA 3BQUB 4TULH 1HINL 2DQDH 3TBWB 4HIEB 1AP2B 4LASL 4EN3D 5CP3H 1RZKL 2CPCA 4O2CB 3G6DL 3QDJA 1NGXB 5J1SC 1LHZA 5CBAB 4PJXB 4DVRH 3IDJB 2QADD 3WE6A 1RIVH 3FT3B 2QQQA 1KBGH 3JTTB 1OSPL 3WDHA 2WWKT 3CK0L 1TJHL 1ZT1B 3R0MA 5IHBA 4Q6IB 2EZ0C 4BSWA 3KYOB 4QHKJ 5FGBC 1CGYA 1J8HE 4FQIL 1RJYB 1NGQL 4S1DC 1T89C 3AM8C 3K3QA 4A2MA 1JPFA 4HWNA 4KXZH 3WL9B 3VFPB 4J3XA 4HXBL 3RDTB 1RMFH 3SO5A 4LFHD 3IJYA 4R0LC 1U8MA 2PYEB 1A6VH 4XP1L 1YJDH 4M4PA 4DFHA 4POZC 3HE6A 3H6JA 5F1KC 1JVKA 1ZK9A 4TUOB 4ZD3L 1GGCL 4QT5B 5C0AB 1XR9B 1J11A 5BMFH 1BX2A 2W0FA 1PKQE 4MJ4A 1BREA 3IFOA 4IIQB 3U46A 1UXSA 1FFOA 5GGTA 2PW2B 4I3SH 2X9WA 3X11A 3QDAA 1DVFC 1CDYA 1T80A 1XGQB 4GJTB 3BKJL 2A0LD 5EZLB 4D3CH 1R3LA 5IJKC 2Q6WA 3D25B 4X80H 5H2BA 3NIFF 1L7TH 1N59B 2CIIB 4EVNB 5F7EL 4JAMB 4JRWA 1FPTL 3PL6A 3TV3H 4XP9L 4K3JL 3PWLA 1Q94A 1ZT4B 4PG9B 3BI9X 3UX9B 1ZTXL 5CJ5A 1L6ZA 1V3MA 3T3ME 1WWCA 2VLJA 5EZJB 1CLCA 4V2CB 1UFUA 5E8PB 3RY4A 2OTPA 3QIUA 5D8JL 3V5HA 3ARDB 3DPBA 1FORL 3QQNA 3EDKA 3BIAX 4NO2A 2VRAA 2V2TA 2HKHL 1EGJH 5DRNA 5FK9A 1A7QL 4F7TA 1UADC 2A74B 4WV1C 5I66A 1I1AD 5DI8A 4MAYB 4ZSOB 1DEEB 3NFPA 3QJHB 1G6RL 1RUML 1BOGB 3VXUB 4ZFZB 5I19L 3O81A 1AGCA 1LGVA 3BT2H 5HDBE 2IFFL 4L8DB 4O4YH 1SY6A 2EEAA 2QLVB 3IDXH 3MJ8B 3C9NA 5KW9L 5JTWA 5F89B 3HC3L 1MHCA 1KCRL 1E4KC 1P2CA 2WWMC 4GMTL 3H0TA 3KPRA 5IMOA 5CAYB 1VEMA 4JJ5B 4ZFOL 4MHHG 4ENED 2VXVH 5E99H 1GRWA 3PDOA 1KJ2A 1NCBH 3D2UD 1UJ3A 2HG5B 1NFDF 1BJ8A 1WV7T 3SOBH 3P77A 1GGIH 4L4VE 3OTTA 2QSTA 3PWNB 1XF5B 3IU3B 4CVXB 2BNRE 4ODVH 1U8KB 5I1JH 2GJ6A 1QNZL 2F58L 1V7NH 2C4FU 3QNYB 1CGWA 1UH2A 1RUPL 2UZXB 3ILQC 3VXOA 4I3RL 4OGAC 1MHHA 4WHCA 2IGFL 2PN5A 4QF1A 3IETB 5INDB 3QDJD 2AQ1A 1U95B 3H7BB 4XRCB 4QEGA 1I1YA 3WIHH 4IRJC 3UTTA 4G6ML 3RTQA 1NCNA 4EI6B 1GHFH 4OD1H 1RUQH 4Q0XL 1YEDB 4AEEA 4HIXH 5GGUA 5C07B 2FGWL 1ZGLA 5E2WL 2DN7A 4XXDB 2FO1A 1FO0A 2NY6C 4HX1A 4NQDA 5C0GA 1RIHH 1P7KB 4KK9C 4PJXF 1N2RB 1FZOB 5J56B 3OG4B 3EBAA 5EOTB 5BVJA 1D5BA 1N5AB 4Y5XC 2ZG3A 4RX4A 2W65A 1YNTB 4PRHE 2A9MH 4N1HB 4KHTH 1CLYL 4OQTA 3MUJA 1EX0A 4L29A 3HI5H 4MJIB 5TFSH 1IGML 4UINH 4PGDA 4ZXBC 4OZGE 2VDRL 4DGVL 2ICWI 3FOMA 3G6AA 1DBBL 1IC5L 1HK6A 5KSUB 1I85A 4EQ2A 3P9MA 2OTWA 8CGTA 4MNQB 3OGCB 3RNQA 4DTGL 3LS4L 1A0QL 2BNUA 3MLTB 3I6GA 3MFFB 5B4MC 2UZYB 1FG2A 4WHDA 4FQCH 1ZEAH 3P0YH 5L88H 3QYCA 3NFSL 4GW4B 5ACZB 3WSQL 3GSNH 3S35X 4GW5B 4M00A 3VWJC 3PL6D 4G6KH 1ZHLA 3TBTB 4MJ6A 2XY2A 2X4QB 5E8DH 5EUKB 5AYUL 1NDGA 1YYML 3KWWA 1I8LC 4FQLL 5CCKL 4HWBL 4FQHA 2AGJL 3L5XL 3QJFA 3QIUD 1KT2A 1S9KC 5J3HD 1RD6A 4MJ2A 1WZ1H 4L5FH 4Y2DD 3U82B 1URLA 4D9RD 4R90L 4OLYL 5CP3A 1KTRL 3ET9F 5SX5H 4MZ3A 4MNGA 1IKNA 5D5MA 2IH1B 2MFNA 3Q48A 1L7IL 3MREA 4PRBB 1N3NB 4LP4A 2JK5A 3GKWL 5IROA 5FHBH 5MEOA 12E8H 3AREC 5GRWA 2XWBB 3TBYA 2YUZA 4CMHC 4ZUTB 1J88A 4P2RE 3GI8L 2J8OA 4GSDL 2NTFB 5SV3A 2AXGA 4YK4B 1IAII 1IAKB 2A6KA 5ESVA 3QR2A 3FT2A 4MVBC 4JFFA 5IW6A 4OLXL 4A6YH 4HKBB 3QI9B 5C2UB 5A16A 5IF0A 4NZRH 1TVBB 1F11A 4JFEA 5BQ7B 4OZIA 4YHKH 3VXTA 1OWWA 1MAML 3MJ7B 1W0WA 5DR5L 4G9FB 5DDHB 4ZUWB 2DQGL 3OB8A 4KK6D 2V7HA 1HCFX 4PRPB 3VGGA 4BKLA 5IB3A 2X4RB 1RVFL 4RGMB 4U1NA 5GGVY 4CNIA 5D2LE 1UZ6E 5DJDB 4F7EA 2GJ6D 3PWVA 4JGMA 5A40E 2D31A 1XZ0A 4ZYKB 2ESVB 5HYJE 1AHWA 4P9ML 4OFVA 3D18B 3MLSH 3S88L 1BFTA 2FYYB 1OGTB 3U0TB 5LVEA 1U41A 3UTTD 1OAUL 1IAIM 3RTQD 4J3OC 4HUUB 1Y6KR 5DJYA 1RU9L 2W0KA 4M7JH 1QEWB 4GXUM 4RISH 1MCPH 3MSPA 3LRHA 1H3WM 1M7DA 5IOPB 1IL1B 3O3AB 4NQDD 5HJ3B 3MV9A 1DQLH 4N8PA 3QDMD 3QFJE 3DJ9A 2FJFB 5GGQH 3MC0A 3R8BB 2GTZA 3OGOE 4G8FA 4MXVE 4RX4D 4WY7L 5GRYA 4GMSL 4K8RC 2IPUK 4X5WB 3LEVL 5HI4D 4BK5A 3D6GA 2BP3A 5ACMA 3UTSE 1EGJA 5JUEH 4PBWD 3GMLB 2GCYB 3RNKB 3RL1A 4TSBL 1G7MA 3QG6B 3X13B 4K7PX 2D0FA 4JZOA 4KK5D 3N1PC 2Z4QB 1WICA 4EOWL 4X4YB 3PP3H 3FJTA 3Q0HA 3MV8E 2VLRA 3BEWB 1KELH 1ZLWH 5KN5A 3EDFA 4FFWD 4UBDC 4Z7WA 5IQ7H 4PJAB 5C0IB 1ZXQA 2VTFA 5HY9B 3GJFH 3WLBA 3WMSA 2HVJA 3PXHA 2NY1C 2EYSB 2EXWC 4IRSB 1NCDH 5E6IB 3GB7B 5FKPB 3CVHB 4YHLH 1FH5L 5ETUB 1P7QA 1W0YT 1EHLL 4XNYH 3IDNA 4GBXA 1IM9B 4IM8A 3UCRA 1ROWA 5KS9B 3B83A 4XPTH 5JW4N 4XCYA 2CLZA 1XF3B 1YY8B 3P11L 1U8NA 2WINA 1CZ8L 3B3IB 1CFNA 4NBYB 3VXME 4GFTB 4ALAH 3PHSA 1J05A 2ARWA 3U7AA 3MRRA 1AGFA 3WIIH 4Q6YA 3EOBA 3TA3A 5HHOB 2GKIA 2D2OA 3VH8A 3OHXB 3LSOB 4R6UA 5EU3B 1BFOA 3AROA 4MB5A 3WIHA 1QLRB 2R0LH 3DGGA 3O3EB 4I5BA 5DRXA 3EO9L 4IOFC 2EE3A 2Q8BH 1KEGL 2F19H 3BXNB 4GH7B 3TF7C 5IR1B 4GW1A 1FIGL 3HI6L 1MCWW 3U2SB 3RGVA 2CDFA 4HIIB 4CN1A 5TDNA 1AI1H 5EN2A 3T0BA 4MJ5A 3ARBC 5C8JA 1JUFA 4JFFD 3RHWF 2BSSA 1QZ1A 2FHBA 2XKSA 4QWWD 5LBSH 3BZEB 4JFED 3ZE0E 1VCAA 3T0WA 5L2JB 3DUUA 1KLUB 1P6FA 4KU1A 2NY0B 1BAFH 1T3FB 4KQ3H 4RRPA 1LO2L 1IQWH 3HMXH 4C58B 4N0UE 3GSWB 4U6YB 1GPOL 4ZUUA 5BV7C 2NYYD 4KGLA 5F7MC 1M6OB 1JFQL 3MLVH 5C6WH 5DT1H 5T3ZL 4EUPG 3E2HC 1IEBB 1ZLUH 2XWJA 3WO4C 1HHIB 1CT8A 1A6AB 1TJIH 5I1HH 1T83A 2JELH 1QLEL 2O5ZL 5F8QC 4PJ7E 5T5NF 1HKFA 4ZS6C 3GSNA 5FHAH 1N0LA 4WGWB 4AYFA 2ZOKA 4LCUA 3C6SA 3P73A 3MV9D 2NNAB 4OUOA 1P1ZA 1PG7L 4M3JA 2X4SA 1Z2KA 1JZ2A 2C3HA 3WUWA 2WBJB 3HS0B 4OLUL 1NUDA 4NQTA 5I8KL 3S36H 3BIBX 2Y5TB 1I8MA 2C1OB 1E0OB 4C56A 5MENE 3NH7H 5TQ2L 1KIQA 3IXAA 3ULVE 4QXUH 4YAQA 2QSVA 4X0KA 3OQ3B 1U8HA 1ZT7A 1SEBA 2FJHA 3PJSB 4M7LT 5JHLL 3EYQC 2F5BH 1JWUB 2D4FA 1JK8B 5AAWA 2VLRD 5CSBA 3CGTA 3LCYA 1EAPA 4NKMA 1NANI 4IS6A 3JV4B 3FB8B 3NABL 5C6TL 1RULL 2ZPKL 1UENA 2AXFB 1NEUA 4HK3J 4PJBB 1BECA 3EYVA 2KKQA 4ZPVB 4PYHA 5E4IA 4UT7L 3D9AH 1CDJA 1CXHA 1UACL 1HINH 2VDML 5LCVH 2Q7YB 1KYOJ 2EDOA 2CIKB 4LASH 4QRUB 4MDIB 1Y18B 1NBZA 1RZKH 4U6TA 4PJAF 4A6YA 1P7QD 5I8OL 2JB6B 4GBXD 4JFXB 1P4LB 1MIML 1TXKA 2E8YA 3GKZA 4XVJL 2BOCB 1MJUL 5SWZB 3DX9A 1RQ5A 3CK0H 1TJHH 4QHUB 5JMRA 3QIWB 3L3HB 5JPMB 5JDSB 4JDVA 1JZ8A 4EIGB 3IT8D 4R2GD 3T1FB 1NGQH 1ZAGA 2OSLA 3CC5A 3T77A 3NCCB 3FONB 3TA3D 2PW1A 2VN7A 3C8HA 4O5LL 4JPIA 1S7UB 4NRZA 1G7JA 4XP1H 3EYFA 5DEGB 3TN0A 4TQEL 3KXFB 4XCNA 4ZD3H 1EERB 1T21B 4F58H 1F13A 3AAZA 2MKLC 3ULVC 2VUYA 3H9SE 3LB6C 3RGVD 3LN4B 1HOCA 3PABB 4LCCA 4PFEA 4HKXA 1VADA 2DM7A 4W6XB 5HHQA 43CAB 2DWDB 1AGBB 4P4RA 1E4WL 4UI2A 2OI9B 5F7DA 2X4NB 1MAKA 2AS5M 3HAEB 2N1KA 5J13C 2EKSB 4GRLA 5J9PA 4O00A 1W8OA 2VDNH 5CUSL 5AG9A 1LO0L 1FAIL 1GZPA 4YO0A 5F7EH 1FPTH 1Z5LA 2M26A 3QWRA 5EA0L 1CFBA 5F7FA 3ZDXF 3MCLL 2YZ8A 5FDWB 3C08L 4XWGL 4TRPL 1CFSA 1ZTXH 4RAUA 3WNKA 3TWCL 1QFWL 1YUHA 4U0RB 2FX8L 1UXSB 2MHAB 2F74B 5FUZH 4Y5YA 3O4OB 1MCNA 5D8JH 3UTQB 3IDIB 3LQZA 3GJFA 1FORH 2FCBA 4I48A 4CDGC 3RX5A 1NAMB 4QYOB 1HYSD 4JDTL 3FO1A 4K3DH 3QNZA 1A7QH 2FBOJ 1M7IA 3TFKC 3ZTJH 1TVHB 4U1MA 5ITBH 4KUCF 1U8LB 3VXSA 1G6RH 5JMOC 1ZWIA 1RUMH 3F6LA 2Y5EA 3QXAB 5IHUL 5EZIL 1JWMA 5I19H 2R0KL 2IFFH 5B39A 3T0EB 3VXPA 3TJHC 2BC4A 5FA4A 3NACL 4Z7UE 2VLJB 1FFNA 1XGUB 4WUUB 5KZCB 4ZFFA 4KTEL 1YMMB 4ZO8A 5I0DA 5ADOL 1T4KB 4DGYL 3I84A 1ZV5A 4C56D 1KCRH 4N8VA 4GMTH 4WI3A 4JZJA 3VFWA 3ALXA 2GY5A 1FVEB 1T6WA 1OY3B 1I7UA 4R3SB 5JO5A 1FL6A 2C3VA 2FLRT 3UTOA 3ARYA 5JDJA 1HQRB 1GJIA 1KJMB 4XNXH 4R96B 3LKPB 3GHBL 5IBLC 2R4RL 2ZCHL 4HDIA 3H9HA 2UUDK 5LGHL 3VGAB 5EU5B 4ZUSA 3CPLA 1DBJL 43C9B 1WC7B 1UCTA 2WK2A 4QOKE 5IG7B 3C9NB 4M7ZC 3QBTB 3SKJL 3RI5F 2AEPL 5BCAA 4L8CA 3F7RA 4I3RH 2X7LA 2IMNA 3C09C 3W11C 3KPRB 2IGFH 3DURB 3FKUS 3Q6GL 2AEWA 2CO6B 1KPVB 3O2VL 3BJ91 4PJBF 1EEYA 5D9SB 4OLVL 4P5TB 2PTUA 4QRPE 2W60A 3OX8A 4HS3A 1Z0MA 3ZHDA 1KFAL 4G6MH 1G6VK 2FX7L 4JFQA 5DUBB 1EO8L 3G6JB 3CCHA 1QQDA 3DSNA 4CDHA 2J8UE 5DJCA 4GAYB 3HUJE 5E2WH 5ITFA 5T1LB 3OWEA 3HMXA 2VYRE 4HKJB 4CN4A 3LDBB 5KJRL 4MNHA 4QCIA 5DQJB 2FBJL 2EYRA 4WO4A 3PHQB 4J8RA 2DLTA 2Q20A 1CLYH 3CFEA 5AD0A 4GRWE 4EKXA 2NZ9D 3TN0D 1IGMH 4O51B 4PPTA 4X6CE 5JPNB 3ILPA 3F58L 4D9LL 5CEXB 4DGVH 1H5BC 1U58A 1DBBH 1BVZA 1IC5H 1LK2B 1W72L 2DTSA 5L9DL 1FNSL 3O4LA 1J86A 4HX1B 4YDIL 1AGDA 3B5GA 3JWOL 2IADB 4GG6A 3FRPA 1CF8L 3LS4H 3B43A 4Y0GA 1A0QH 1D9KA 5C1MB 5IMMB 2BX5A 2D9QB 3O6FB 3R1GL 3C8DA 3NPZB 4DEPC 5CEZL 2ZP0T 1UT9A 4GRLD 2APTA 2DQEL 1CTNA 2H6PB 1HEZA 3RIAK 3O3UN 5F9DC 3MRHB 5FAAA 1TFHA 1FLRH 2XKUA 4XMKL 1KIUA 4UQ2A 1ZVHA 1AR1C 2HN7B 2HT2D 1OARL 3PHOB 5C86A 4LNRA 4QRRB 5AYUH 1WWWX 1FZKB 5I73C 1P53A 2ZOLA 5CCKH 3V52L 2R69L 4HWBH 1F3DH 3Q1SL 3L5XH 1MAJA 5EBMB 2EXYD 2N4IA 2MQ0A 4KKNA 1DLHB 4PTTA 2EECA 4LVOC 4Y2DC 5MP6L 3U30C 3BPCB 3JWDL 5GHWH 5DK0A 2D3VA 4R90H 4XPFL 4PJHA 4OLYH 4FHBD 3VXSD 5FYKE 2YEZA 3AU1B 1UVQB 1ZHKB 4Y4KC 3MA9L 1QSFA 1LE5A 1WWBX 1L7IH 1C5DB 1NBYB 5T33L 2M1KA 4OZ4A 5D1ZA 3GKWH 4RMTA 3NCJL 2NW3A 1AQDA 2VE6A 2B7DT 3I6LD 4M8VA 5CGTA 4BYHA 5K9KA 4CBPA 3QJFB 4R4ND 3OJ2C 4XHJD 4LDEB 5J11B 1DBML 1NDMA 5FO8A 2FL5A 4H0IA 2EIZA 3QNXA 1YPZA 1RUKL 1JN6A 1QSZA 4OLXH 1RZJC 4MD0B 4MWFB 1IT9L 4Y4HD 4LHUB 1FN4A 4YBLB 1MAMH 2BVPB 4F9PA 3NTCL 5DR5H 1V3KA 2PXYA 2DQGH 2WUCL 3MREB 1J0ZA 1TMCB 4X4XA 3GIVA 1RUAH 4NSKA 5DHVH 4OV5A 4LVHC 4AT6B 5EC2B 2FZ3A 3GJEB 2DKMA 3BUYA 4XNMB 4YHOL 4XPGH 5BJTA 3BRDA 5ISZE 4KROB 4P9MH 3HCVA 1OD9A 4ZDHB 1ONQA 1J87A 5JQHC 3S88H 5I6XB 2A73A 5EPMA 5CEYB 3H3PL 4YNYA 4EDWH 4G8GD 4Y8AA 5IVZA 1DN0A 4HAGA 2FHCA 5D93B 3D85B 2OL3L 3CDGA 4MQTB 5ALCL 2FNBA 1VHPA 3RWIB 1F6FB 1S7TA 2NY4C 1A1MB 4IRZL 3U7WL 4NCC2 5EIQA 1RU9H 2B2XH 5L2KE 4WFFD 3B2UD 1MCLA 1WBXB 4GQPH 4Z7QF 2F53E 3D3VE 3OXSB 4F7EB 5C08A 4UDTA 1KNOB 4F57L 4XVUC 3VU2A 3BGFC 1EUUA 3G6JF 3DHMA 3OKYA 4M5ZH 1VERA 3ZSTA 1QOKA 2IQAB 4P46C 4WY7H 1UB6A 5JLZB 4GMSH 5CWSA 2I07A 4HUXB 3OKLB 5AUMA 5FYJE 4OV6F 5IFHL 4UIMA 5MHSE 3X3FH 2Q86A 1OW0A 4TSBH 5FKAB 3JTSB 1T1XA 3G5ZB 4ODUA 1H3GA 1G6RA 3WXWL 2X10A 3SDCC 4WIQA 2RFXA 3O4LD 2OJZL 1I8KB 3SCMA 1DQQA 4ZO7A 4FFWC 5H94B 4PJFB 1Q9WA 5ESAB 3S34L 2L4OA 1D9KD 4QXWA 5C09A 2HWZL 4HS6B 4G8FB 4PYGA 5C0NC 2JJTA 4FOMA 2CLRB 2XTJC 3ZKMD 4RQQB 4ZFOA 1IGYA 1QO3A 4LSVH 2P8PA 5HYIA 2ZSWB 1BJ1J 1FH5H 2Q7NA 1P4BL 3QDGB 5I8EB 4NQVA 1EHLH 2BVUA 1S7VB 1QFWM 3EYOA 3QT2A 3B8SA 3GRWL 3P11H 1G7QA 5B3NA 4WU7A 3ZE2F 1CZ8H 4ODTL 1YDPA 4U7MA 5IKCB 4WTZG 2PCPB 2DQIL 1SBSL 2XN9B 4RCAA 2FJGB 5IJVA 2HFGL 1FL5B 1JRHI 3KPLB 3BD5A 4JRXB 4EI5B 5JHDA 2YPLE 2VLLB 3HPJB 1N8ZA 3HE7A 2B8OT 5ERWB 2VERN 1QSFD 3DRTB 2WWKO 1Z9OA 1AC0A 4OAWA 5E94A 3BP5A 5D1ZD 5KVEH 1KEGH 5DLML 4HUMB 1LEIB 3HRZB 2VWEE 3EZ8A 3NCMA 4Z7NE 3HI6H 3HPLB 4X99A 3STLB 3ESVF 2IAMC 1I9EA 4L9DA 4LCIL 3SDDA 2YUWA 2HT4C 3Q6FA 4KKLD 3LKQB 4LCWE 4E0RB 3MX0A 1TZIA 3SDAC 5F9JB 3DMMC 3MRRB 5KAQF 3D5OF 3WXVL 2GTWA 3GSUB 3VH8B 3SKUD 3L9RB 3UMTA 1BFOB 2PXYD 1AY1L 3O8XA 3EO1B 5IMLA 5C9JA 5KSBB 5D6CB 1R3IH 4PJXE 5IBTL 4WHTA 1T6VN 1LO2H 5FO9B 2NY3B 2DLFL 1JF5A 1MHEB 1GPOH 1AHWC 4WWKA 1JF1B 2ED9A 1U9KA 3RUGE 1JFQH 2A2QT 5TDNB 3C6LC 5IT2L 4JFZL 5T3ZH 5JA9A 2EIEA 4CJ0A 2IH3A 2N7AA 4NO5B 1JNLH 1N7MH 3ZYOA 4GKNA 4JM2A 1AH1A 2FO4B 1JHLH 4OCRL 3G5VA 1KTKE 2O5ZH 3J8F7 2LU3A 1I7ZB 1T0MA 2H9GB 2OR8A 5ENWB 3KNBA 3WNMA 3VGBA 4KV5E 2PYEE 4P2CG 4HJJL 1G7PA 4X6EA 1K8DA 1GAFL 4JY5L 1JGDB 4LGRB 3OSKA 5EBWA 3O3BA 2DJSA 2ADFL 5C08D 1PG7H 1CI5A 4HH9A 5K9JH 3RPIB 4N5EC 5HDQL 1MJ7L 1WAAA 1X4YA 4HWBA 1ZHNA 4OLUH 3IDYB 2R1YA 3SGDI 3P0GB 5I8KH 1UH3A 3D39A 1CT8B 1F90H 5KVFL 5TQ2H 1YEEH 2VWEC 3B9AA 4KKAC 4NIKB 1KLGA 5JHLH 4U1IA 5AZEL 1KPRA 2XQBL 4XCEA 1MJ8L 4JM4L 4OGYL 2CKBL 4W6YB 5DHXB 3O3DA 3FQXA 3SCMD 3UDWC 4LKCA 4M02A 3C5SA 3BQUC 3L5IA 3NABH 2ZPKH 5A3IC 3QQ9D 2ATPA 5HI3D 5C09D 4U1JA 4LLMA 3ELAT 2HJKB 3H7LA 4PREA 4NCC1 1KJVB 1O0VA 4FQXA 1MLCB 2Q1EA 1CIUA 3EGSA 2VDMH 1UACH 3F62A 2EYTB 1I8MB 3E3QE 1J12A 1DLFH 15C8H 1NEZG 4G43A 2ADIB 5HBBA 4P2QB 1L0YA 3QUZA 3IXAB 2R23A 4PJGB 1DANT 2CKNA 1MWAL 1I1FB 1U8HB 5I8OH 4X7CC 3I75B 2BNQB 4RAVA 3SDYL 1UKQA 3EZJB 2E7LA 2Z8WC 1MIMH 4Q6IC 3PNWA 1CDBA 3VXUE 2H41A 1PW3A 4XVJH 1Q9KA 5DQDL 4ERSL 3DX8A 2VKWA 5DHVA 3T3PE 1MJUH 1OGAA 4LMQE 5I1CL 4G6JL 4O02L 2P5WA 4E41B 1S5HB 2AP2A 3RDTC 2BSED 1A4KA 2W0LA 4BZYA 2MKWA 1FFQA 4R2GC 5D7KE 3BN3B 1RJLB 1C7SA 4LK4A 5EUOE 3LKRB 4ZOBA 5FECA 4NJAL 3V79C 5JHDD 1JIBA 4Z7VA 5F6HJ 3HE7D 4NHCL 4O5LH 4YDVB 4YX2L 1L0XA 1VFBA 5FO7B 4N0YL 4HMCA 5FGCB 5I15H 5ALBL 3UTPE 4TQEH 2GQHA 5HYFA 3G5XA 4JHWL 1F4HA 4P4KB 4E42A 4FTVB 4XPHL 4Y19B 3SDDD 5E7FA 1HWHB 3FT4A 3KPPB 2XV6B 2NR6C 2IBGA 1X7QA 2P4AB 3VE0B 4FQQA 3JVGC 3M8OH 3ORJA 3IB4A 2E6PA 4M6NL 1JGEB 3DYOA 4FG6C 2VDKL 4O9HL 5KANI 3QUMB 4P57B 4XVSH 1YEFL 3IKCB 3BISA 3O8XD 4PUBH 3DI2B 4PJ5E 4XZUB 2D7OA 5CUSH 1KB5L 1LO0H 4YLQT 5DXWA 5GSVA 1WLHA 3AMLA 5EA0H 4KJYB 1A4JA 4WWKD 3C08H 5C07E 4XWGH 4TRPH 4M93B 4H5SA 3TWCH 5I16A 5GRVK 3TT1L 4PRDA 2OMNA 4L3EE 1JPSL 5FOJA 3EJZD 4JB9H 1A6PA 4M6AA 5TQ0L 2F15A 5KSBF 1BIIB 4MAYC 3PWPB 2UWEB 2ZUYA 5DWUH 3D69A 1YZZA 1MUJB 1Q72H 1RSFA 4N8CH 3O0RL 4JDTH 2YMXH 4YPGB 4JFOA 3W81A 2B4CC 5I17B 5FEBA 4LQ1A 1F4WL 2FEDD 4TSAL 1X5ZA 3STZB 3HZMB 4UTBL 4POYA 4NUGL 4ZAKA 3DTXB 5EZIH 4KUZL 1KIRA 2GSIA 2R0KH 2CUIA 3TIDB 4PY8J 3V95A 3O2DL 1JHTA 3ZHKA 1CFSB 5KSVA 2BY3A 5TH2B 5LWYL 3U83A 1F4YL 3X14B 4KTEH 4L8SA 4Y5YB 5ADOH 4JFYA 3D39D 2IMMA 5IVXB 5JZ7C 5GS2H 1XF4B 3MR9B 4F3FA 2VLKA 1EXUB 3FO1B 4YHIB 5F1SA 5C7XH 3ECBB 4PD4K 3I6KB 2YN3A 2Z31B 4LVEA 3V5DA 1EV2E 4PRAA 1RURL 3GHBH 5DJAB 2R4RH 3F6IA 1ZWIB 5BRZE 2ZCHH 2X9XA 2P8LB 4BUGA 3ALWA 1IM3B 4MA7L 5LGHH 4WFEE 2C7UA 1ED3A 1CFVL 3VXPB 4PJEB 4OLEA 4G80B 3CSBA 1DBAL 1FFNB 4HULB 2DIAA 3L3KA 5F3HB 4FQXD 2X41A 2AEPH 5E95B 2DJ4A 2DQTL 4HMDA 4I2XE 1CGTA 3QUZD 3L3IA 4P49A 4NQCE 5IIEB 2V5MA 4Y16A 2GUOB 4QHNA 3KPQB 1T7YA 3A6OA 4LLUA 2D7QA 4YHZL 1KFAH 4KTDL 1HQ4B 2FX7H 4OGXL 1HIML 5T1LD 5BS0E 1EO8H 1KN2L 5FA3B 2ZUXA 1IBGL 4LPXA 4K94C 4MA1B 5DD5L 2DMCA 1OGAD 1IFHL 4PJGF 3U6RB 2P5WD 2HMID 3LV3B 4RMVA 1MCHA 3GMNA 4ZPTA 1OVZA 4K8RL 3QUYB 4Y1AD 1V3LA 1XF2B 1CD1B 5KJRH 5ICXB 2HFEA 2DBJA 4L8CB 4PJIA 4XTRC 5D1QA 3SGEI 2DLGA 4NNXA 2FBJH 2FIKA 1WUNT 4QKXB 4P3WA 1NBQA 1WT5C 4LCYA 1JPGA 3JUYA 4QTIL 1RZFL 1FL3B 3QA3A 3KYMA 4Z76B 2CGRL 2A6DA 2CQVA 4KGJA 3HZYB 3K4AA 1XGRB 5D7LB 1I7TA 3F58H 1A2YB 4I0PB 2Z0BA 2UYLA 3QEUA 4PRPE 1W72H 2W92A 5ITFB 3O6FD 1FNSH 5CFHA 3O2WL 5L9DH 2KPNA 1WTGT 3JWOH 4XWOD 1OAYH 3ARFD 1QYGL 4MB3A 3DBXB 1M05B 4P23B 1T1YA 1BJ1H 3GK8L 4N0FA 5CLTA 3R1GH 2EYRB 4WO4B 3SGKA 4DWHA 1MFDL 5CEZH 3VXRB 3MROA 1WFOA 1K2DB 2ICWB 5ICYB 3PGFL 4IEFB 2G75B 2X1QA 4ZS7L 2DQEH 5TDOA 1BVKA 3SE4C 5IP4A 5AD0B 4LSRH 3LN5B 3B9KA 4WUKL 4HWUA 1V7MH 2R1XA 5TJWK 3N85L 1OP9A 4IDJL 4XMKH 2B20A 4PB9L 1P9MA 1OARH 1NGZB 5MEQB 3MUZ1 2YD8A 3DO7A 1O5DT 4YXHL 1CQYA 3EJYD 3EO0B 2QEJA 1MFNA 5DA0B 2VABA 1JP5A 2EKJA 3V52H 1PYWB 4PJ8A 3NA4A 4PJ9B 3L5WB 2OM5A 5GRUL 3EFDH 1AIFB 1TLKA 1R5IA 2YSSB 4DKEL 5GJTL 3MACH 3IGAA 1X5FA 5MP6H 5CJQH 3JWDH 4LVNC 4NDMA 3QULB 1NUGA 4ZODA 2MPAL 3PQYA 1FNEB 4AH2B 1Y0LA 1T7XA 4PG2C 3MRPB 2UWEF 4ZAKD 5KVDL 1X5HA 2ATKA 5T33H 1S9YA 1ORQA 4YK4C 2ZUQC 4ZOEA 3BP4A 3SDXF 4P9HC 3P4OB 3ZO0A 4RGOL 1K5NB 4XHJC 3QI9C 1XIWA 3BW9B 1K4DA 2EDBA 1DBMH 1UQSB 2HVKB 3CUPA 4G6AD 1FIEA 3WFEL 5CD5C 3W9DA 3MJGX 1RUKH 3DVNB 4JVPA 2VZVA 3SPVA 4Y4HC 3NIDE 1C12A 1IT9H 4RGMC 2A6JA 1WWAX 2H2PC 2Y4SA 3BN9D 4R8WL 2NCMA 5GZOC 1G9MH 1ZLVK 1NH6A 3EDJA 5IVXF 3OAUL 5E24E 3WHXB 3NTCH 5BV7L 1MCEA 1J1PL 1AJ7L 2WUCH 4X7SH 4J6RL 3SJVB 4Y5VB 3X12A 4F2MB 4P2OA 2RHEA 4G7VL 5KS9E 4ORGB 4Y89A 3ZKXB 3BH8A 4H8WC 1AQDB 35C8L 1TETL 3TZVB 4NNPH 1XGTA 4PGEB 5K93A 1FZJA 4GAFB 3BHBB 1MH5A 2VR4A 1NDMB 3TBVB 2DI9A 2I60L 4OI9A 4U7KA 1N6QL 2FL5B 2DLEA 4Y16D 4URTB 1YPZB 4KI5D 1PX4A 3H3PH 3BEVA 4PJEF 3LIZH 4KRPD 2Q3ZA 4PLNC 1RZ7L 2VAJA 2OL3H 4LAJH 2C9AA 3QO1B 4O58L 3R06A 4IOIB 4HUVA 4N0CC 3RA7L 4KTYA 2OR7A 3SKMB 2V2XA 1MCBA 5FM5M 2XA3A 3RWDB 3PDDA 4LMQI 1EH9A 1ZA6A 1KCVL 3P9LA 3N0PB 2WM0A 3S5LA 1JZ4A 5D1QD 2APWA 1SMOA 3KAAA 4OB5L 1C8PA 2FECI 5LKNA 3CDYA 4YDJB 3QHFL 1XCQA 4I9WD 4PJDB 5K9OA 5IFHH 3JXAA 2P7TA 3QEHB 5FUOL 3VJ6A 4DOHE 4GT7A 4M1CD 5BZDA 1Z9MA 4RMRA 3ZDXE 3F5WA 1KUMA 4R26L 2GIYA 1MVFA 1BQHB 5JW3L 4OM1L 2EDLA 3WXWH 3UPRB 2CUHA 3FB6B 1LO4L 3KHOA 3C5ZA 4LFHG 4CN6A 3OBAA 1XGYL 3MRQB 5E6IC 3GSOA 3L3GA 2HWZH 1S5IL 4XPBH 1EHXA 3O45B 2B0SL 3C60B 1A7PL 3GMRB 4BQ6A 3B9KD 4UILL 1PKQB 3T2NL 3V0WL 3WLWD 4C55A 4DVBB 1A3RL 2X4OA 3PGCB 2JJSC 1P4BH 2AJUL 1CICB 3DETC 3ISWA 1WBZA 3OJDA 3PGDB 1HHKB 1G6RB 3GMMB 1GGUA 3L3DA 3GRWH 5EZOL 4H20L 4PJ8D 4OZFH 4ODTH 3WIFA 2VXUL 5TF1L 2AK4A 1WIOA 3MRNA 2FIRT 1X5GA 2VL4A 1SBSH 1HDMA 5FB8B 7CGTA 4AL8L 3FO9A 1H15A 1MCQA 1JTTA 3WFCH 4HT1H 5GGSB 3RX8A 3PQYD 4HUWA 3NZHL 1FVDA 1YY9D 2AJZA 2BCKB 1UM5L 5C0CA 5JW4R 3RBSA 3VA6A 2ZUWA 5E8NB 3A0OA 4UV4L 3CFJA 1WVZA 5D1ZC 3ZYJA 3HC4L 4LLYA 5D6DC 1BQLH 3P30L 2HH0H 3NZ8B 3V6OC 4QHMA 4LLQA 2ITDA 3T08A 4ZOCA 4CW1B 2WP3T 4FP8L 5IMKA 2CD0A 1JGLH 1XIWD 3PDGA 4LCIH 1FNLA 1SJHA 2ARJA 4QY8B 5IWLA 3VFNA 5IJVB 1HH6A 3QWQB 3GSQB 2NY0C 3NCFB 5J8OA 4L8BA 3WXVH 5BOZG 1WCBA 3ETBF 3C8KA 5TDPA 3OXRB 3GSRB 4NQUA 1OAKH 1AY1H 4ODSL 1GZQA 2JE8A 1S9VA 4P2OD 4PGCA 5KVMC 3VWKA 4HLZH 4JY4B 3DIFB 1ES0A 1A9BB 3RJQB 3FQUB 2VMFA 2AJXL 2X40A 4AM0A 4CJ1A 1W72A 5F7UA 2QBWA 5JORB 5D1XA 3CXDL 1N6VA 5DJXA 1DZBA 1RFDL 4OBSA 4W4OA 2DQHH 3F7YA 4X7TA 3SDXA 3MOAL 1T5WB 3NGBB 5FCUL 4R9HA 2R2HB 4OCRH 1JPTL 2H26B 5DK2B 4GG8A 4KZEL 1WQVT 2BNRB 4MCYB 2VQ1A 3L7FA 3AS3A 4GLRI 1BWWA 1AXTL 2WBJC 4FMFA 1WBYB 3SE3A 3L7EA 2Y9RT 4L9LC 3T2OA 3W0WA 2RBLA 4X5XB 1BEYL 4WHTB 4NZUL 4Q9BA 1GAFH 4JY5H 2APXA 1CD9B 3MXVL 1TNMA 3KXFE 1GSMA 3VFUB 2Z35A 4RNRB 1R5WA 4XXCA 5HDQH 3DRQB 3KPOB 3HZKB 1DP0A 3MRBB 1A6TA 4HUNB 1GOFA 5E8EB 2OTUA 1EPFA 4KWUA 2AABL 2JKXA 1D5MB 3GSXB 4TVPL 3OAZK 5KVFH 1R3KB 1I3RA 2XACC 4UAOB 5HHPB 5HTSA 4Q97A 3GNML 3D0LB 5GGSY 4M8QA 5D2NA 4U1KB 5SWQA 5AZEH 4WEUD 1OQXA 2DDQH 1MJ8H 4JM4H 4OGYH 3FMGH 3C5ZD 4OCSL 4NT6A 4PJDF 1X4ZA 1Q0YL 1IGCH 5DZLA 4PRHB 1ZKAA 5EBWB 3DXAA 1JYNA 3BE1L 1QBLH 4GS7B 1Z3GL 5E9DA 1S9WB 4PRIA 4HPOL 3VI4F 4AENB 1KXVC 1F3RB 2PO6B 5GS2D 4P5KB 1F5WA 3VD3A 3SY0B 5I30L 4ELMB 4PLKD 3SDYH 3VRLE 2D7NA 1VPOL 2CRIA 3QCVL 5GS1A 5L8LB 1JWSA 1I9IH 5C9KA 4RDQG 1RAMA 1T0NB 3MJ9L 4NC2B 1I9RL 3C5SB 5DQDH 1EA9C 4ERSH 5CZXD 5I1CH 1VACA 2NY2B 3G5YB 5J6GB 4G6JH 4O02H 3T0EE 2AK4D 3QFDB 4XAWH 3OKDA 3FO0L 2VLJE 1FVCA 4PREB 4WUUE 4WDIA 2JIXA 4JKPL 4B53A 3PV6B 3RHWK 2P5EA 2VC2L 4NJAH 3K46A 3S3JA 3WBDA 3T65A 4N90D 5C0CD 4NHCH 2EDJA 2P8MB 4YX2H 4YH6A 3G04A 2OL3A 4D9RE 4XBPA 4BQ9A 4N0YH 1U92B 3BGMA 3QHTC 5ALBH 3CFBB 3VFVB 1VEPA 3LKNB 4LOUC 3FZUD 4JHWH 1B0RA 2OI9C 4XPHH 3T3MF 3LKOA 2OP4L 2DD8H 1FHGA 4U1HA 3WS3B 1IEAB 3FOLB 2G9HB 1CFQB 1SYVB 4N5UA 4PY7A 3VMPA 5ANMA 4Z7VB 4M6NH 3KPRE 4ONHB 2JCCA 2VDKH 5F44A 1ZVSB 1YEFH 1AD9A 1SJEA 2GJZA 2I9LB 2NXYB 4UTAL 4QRQA 1KB5H 2FDBP 3VWKD 1OTUD 3MTRA 1BZ7A 1J0HA 1AXSB 3OKMB 5HDBF 1TQBB 3O4OC 3B5TA 3L6FB 4LP5A 4JZNA 4I77H 1UZ8B 5D1XD 1U2CA 4XBGB 4ONGL 3TT1H 4FQ2L 1A7NL 3QIBB 2R1WA 4HF5H 1JPSH 3QUXB 5TQ0H 2GJ6E 1ORSB 3CMOH 3OF6A 3PWJA 2A1WL 4FQQB 5IEHA 1VFOA 3IDGB 3UBXB 3T8XA 1IZKA 4D8PA 5CEZD 3X3GL 3MYJA 3O0RH 4MQXD 4PB0H 4L4TA 4U3CA 3OR6B 3ZT6A 4M6ML 5D2LB 3CZFB 1B88A 3T0EC 5JOFB 3U36B 1F4WH 2I5YH 3I9GL 4TOYL 4TSAH 3UJJL 3W0WD 3IDMB 1FRGH 3LZFL 4NO3A 4UTBH 4NUGH 4UU9A 4Z7OE 4U6HA 2R2BB 1KTDA 1MCCA 3VCLB 2V17L 3O2DH 3DV4B 5CD3A 5FGBA 3SKOB 4CU8A 3GRWA 2HRPL 5LWYH 5I16B 1F4YH 4LPUA 1T89A 3QUKA 3AM8A 4OZFA 5C3TA 4FFVD 5TF0A 2DTML 1IAMA 5F72S 1NCTA 2Z31D 3TO4B 2FD6L 4R0LA 1KN4L 2VDLL 3E6FA 1YEJL 5ICZB 4MX7A 3VGAC 1W0VA 4OD2A 5FYLL 3QFJB 4M7KL 4UNTA 1RURH 3RAJL 2AV7B 4M6OH 1T7VA 1KTLB 5DJ8A 3MNWA 1CR9L 1CN4A 4FMKA 5BW7C 3MV7A 3RVWC 3WV0A 3DXAD 3NFNB 5T1DL 5CKAA 3ABZA 4ODWA 3LS5H 4MXWL 4BK4A 4BJLA 5KSVB 1DBAH 5E9DD 5DRWA 4PRID 3V7AE 4D0CA 1DVFA 4HCRL 4BSVB 2COQA 3H42L 4P5TC 2MMXA 1B0GA 3AS1A 4F33A 2DQTH 5GRJL 4H25B 5IJKA 4GKSA 2ZCKL 4NKDA 3TO2A 3JBG7 4ISVA 2ITCB 3BPOB 1KJ3H 2RJMA 2OJEB 1E4XL 5B3JE 2DMKA 1FO0L 3ESUF 3HTLX 5LAXB 4YHZH 1GCFA 1G7IA 4OGXH 4LLVB 2LAGB 1IBGH 4OZGF 5DQ9B 3QQ4A 5H37H 1IFHH 3BMVA 4K8RH 1LDSA 4NFDA 3MZTA 4ELMF 2JIXD 4EEEA 5CIPH 1KCUL 1SQ2N 2P5ED 4D9QE 5A43C 4QO1A 4WV1A 5HHXL 4LLDA 3LH2L 2CXKA 1F4XH 5AYQA 3SHSA 4QTIH 1RZFH 1KV3A 4BH7A 5KTEL 3AB0B 1J8HA 5FIEA 3MNZA 3VXMB 4N1CA 4MNGE 5A2JH 1PSKL 2UUDH 3WEXB 1JV5B 5D5ME 2R8SH 3GZKA 5KG9A 3O6FC 3MGOB 4LQFL 2ICEA 3O2WH 4LGSB 1E4KA 3ARFC 5T3XD 3VXRD 2R15A 1QYGH 4I18C 1U8IA 5CGYD 3DVFA 3JV0A 3VXQA 1RZ8B 3GK8H 1UEYA 2G5BA 5CZVL 1U8PB 1MFDH 2AI0L 1E28A 3WS6C 4L4JA 4XAKD 4LIQL 3PGFH 1U36A 2CJUL 2KBGA 4WUKH 2IPTL 4YFLI 1B3JA 1VB9A 4OZIE 1NC4B 3FFDA 4P59H 4IDJH 3VI3F 2HLFC 4PB9H 2AKRA 4JKKA 4YXHH 3KPNA 1A9EB 4OZHA 4QTHB 2NX5A 1INQA 5ADPL 4LU5L 1U8QB 1I4FB 5TE6L 1PZ5A 5GRUH 3OF6D 5DS8A 4L3AA 4F7PB 4UT9L 4CU6A 2UVEA 5GJTH 1FJ1B 1RZGB 5C0BB 4OD3L 4L4TD 4K7PY 4E5XA 4IRJA 4X6FB 4XNUL 4ZTPH 1DQML 1RIVL 1D6EB 3ZT5A 2WAHA 4QRSA 2MPAH 4XMLL 4EUPB 2OLDA 1KBGL 3LRGA 1LP9B 1A21A 1C1EL 3VG0L 5KVDH 5I2IB 4MCZB 2VDQH 3OAYK 5J11C 3GGWA 1NGPH 5D2LF 1UZ6F 3ULSA 5C6PB 4KKBC 4S1DD 4RGOH 4L8SC 5HDLA 5JOPE 4PJFE 4Y5XA 4AY0A 4JY6A 4ZUVB 3ARQA 3RI5K 1PEZA 3RVUC 3M1BA 1A6VL 4G6AC 4YBLC 5DD0L 5F8RC 1A7RL 3WFEH 5DGRA 3VFMA 4POZD 3K2UL 5CBEB 3W9EB 4XH2A 1QBML 1PFCA 2LVCA 4ZXBA 4U1LB 4R8WH 3KG5A 4NM8H 3WN5B 3OAUH 5BV7H 1J1PH 1HXMA 1AJ7H 2VDOH 3QDGE 4GO6B 3MV7D 3VRIA 4OUUB 3OJVC 4KROC 4M03A 1UWXK 3LEXB 4X9BA 4G7VH 1QRNA 5MENB 2MCPH 2XWTA 1QP1A 35C8H 1TETH 5I6XC 4G5ZL 1DVFD 2VLRE 4NQSB 4U6VL 5EU4A 4Z7WE 1NQBA 3OV6A 5D93C 2I60H 1QR1B 1OAZL 1N6QH 2XN9E 5EU6A 5EO1B 1C12B 3WDIA 3VWJA 1RZ7H 3GUTB 2NLJB 2XXCB 4FQ1L 3QB7C 4RWYL 1JJUA 1KB5A 1I8LA 2VIRA 3TIEA 4WJ5B 1GIGL 2PYFB 2DWEB 2ZUSA 1KCVH 5D1QC 4LPWA 1FYTA 4P0DA 4OB5H 4IHOA 1Q9LB 3JV6B 5DD1L 3QHFH 1OM3H 2VL5B 3BMWA 5E5MB 3RRQA 3GM8A 3OKKB 5FUOH 1J8HD 1MCSA 2OQJB 4R26H 4FXGA 3R06B 5C3LD 4G9DB 1JI2A 4PD4J 2B5IB 4U2YA 4HBCL 4OM1H 3AREA 3NBNA 3VH8G 4G8EB 2OZ4L 4HSQA 2H8PB 2WWMD 4LSDA 1LNUA 1VGEL 1XGYH 3O2DA 1ZA6B 3C60D 2EH8L 5IBUG 4XPAH 3HG1B 3WNOA 1T20A 4JGJA 1M71A 1S5IH 1F2XK 4OSUL 2WSKA 5GGRB 2YD6A 3QZWA 4MDJB 4TNVF 4WEBL 4WCYL 3IVKA 4UDUA 2B0SH 4S11A 1J1OL 2NW2B 4GUPB 4WW2B 4KK8C 1A7PH 1EFXB 1M7XA 5HGAA 4RGNB 4UT6L 1AFVL 4UILH 3T2NH 3V0WH 3H9SB 3DROB 3BD3A 3TNMA 2AJUH 5IB1A 4JDZB 1PQZB 2MJWA 4HGWA 2V9QA 4OI7A 2GT9B 4NKOB 5H35A 3RWHB 1EK3A 4MD5A 1S9XA 3ILQD 4OGAD 3UTZB 2ICCA 4H20H 3W2DH 2I9TA 2NX5D 3MJ6A 2AEIT 1GOGA 4EI5C 5E00B 1JZ3A 2VXUH 3OJMB 2X05A 5TF1H 1QVOA 2G2RA 3QXDB 4RRPG 5SWSB 3VDAA 1TZHB 3KJ4B 1LMKA 4AL8H 4H88L 3WIHL 3MNVB 4IRJD 4F7CA 5JIIA 1RUQL 4U7SA 3ZE0F 3NZHH 3T0AA 1UM5H 4NUJB 4HJ0C 2ERJB 2PKDA 2VR5A 4UV4H 4WU5A 3ULVH 3S3PA 3HC4H 1T7WA 3CH8A 4ONFL 1MI5B 3P30H 4OCWL 2BK8A 3OKNA 1I8IB 4UZGA 1KLFA 1EJOL 1HH9A 4X8JA 4FQJL 2A9ML 1LP9F 4R7NB 5DFVD 4KHTL 1AGEB 3RWCA 5CIPA 1CXLA 3GMQB 3HI5L 1L0QA 5DYOA 5TFSL 3ROLA 3QP3A 3WUWG 3BUTA 3UYRL 4NRYB 4C56E 4ZXBD 2NY3C 1A3LH 4PJ7F 2AJZB 4X6DB 4OGZA 2EEBA 5BXFB 4C83A 1HHHB 1R3JA 1R24B 3IF1B 4XNQB 1MCFA 5IB5A 1QRND 4HZLA 3RWJA 1CE6B 4L4VD 5J57B 2AJXH 2GITA 1KGCE 1ZEAL 4XT1C 3P0YL 5L88L 5FF6B 5J6HB 1OLZA 2HJLA 4IOSD 4E41E 1CGXA 1INEH 5C0JB 4PBVC 5EU6D 5JW5B 4M1DL 2EDNA 4G6KL 3VWJD 5FDYA 5EO0B 2E9WA 3O41A 2MCG1 5HYJA 3DVIA 1QSEA 1W8NA 5E8DL 4KZEH 3FHQA 1PY9A 5IEKB 1AXTH 1NC2D 3M17A 3MO1A 4YHNA 4BFIB 1S8DB 5D71L 2WZPD 3IDYC 1BEYH 2X89A 4NZUH 5FGCE 3EJJX 1DUYB 3VD4A 3ROOA 1CXKA 1U3HB 3MXVH 1OF2B 1T2QL 4A2LA 3IYLW 4FTVE 3BZ4A 4Y19E 4APQD 3MLPA 4YGVB 3MA7A 5KOVC 4TVPH 5B38B 3HUJB 5IESL 4MSWB 1AR2A 2YRPA 1A7BA 5FHBL 1F6AA 4PRHD 2PTTA 4AIOA 3ARED 1UG9A 3B5HA 1NUNB 1UXWA 1MELA 3UTSA 4NGHL 3K81A 2X4PA 4OCSH 1IGTB 4HIHA 2X9YA 1Q0YH 4IJ3B 5GS0D 4M61B 5EFIA 4CUCA 3BE1H 3JSSA 3ARBA 3VD5A 1Z3GH 3NN8A 1S3KL 2EDXA 2CRZA 4HPOH 3TESA 3MV8A 5IV2B 3F12B 1A6WH 4AIXA 4LEOA 1R5VA 2HT3C 4K94L 3VDBA 3LOWA 4H26B 1CXEA 2PNDA 5I30H 5DHYB 5GIRB 3RJDA 1U3JA 4CVZB 1VPOH 3QCVH 4WW2F 3SE8L 3MJ9H 2FWOA 4X5LA 4F7MA 1I9RH 5GGVL 1JBJA 4HHAA 1ETZA 3FO2B 4PP2B 4NN6B 3GFUA 5EH1A 3A67L 4JKPH 2VC2H 4RFEB 1G84A 4BH8A 1VFAB 2VISB 5BZWB 3C5JB 5SX4H 1RZIB 4YHPA 5DA4A 1PX3A 5HHVL 4DK6A 5INCB 1S7XB 2ILLA 1VKXB 1DDHB 1MIEL 4P4KC 1MVUB 4P3CH 3FCTA 2YC1A 2C1PA 4U0QB 2FATL 3MRMB 2A9NH 4HAFA 1C16A 4UOW1 3VFOB 2BVEA 4DK3A 1ZVYA 2HRLA 2ZNWA 5HGBA 4J23A 4K8RD 4NQXA 5LG1A 4YE4L 5HHNB 1T1WB 4YC2B 4PTUB 3I02A 2NXYD 4P2RD 5I1LB 1ADQL 1BOYA 3HLAA 2DYPB 2W07A 1HHJA 1BZ9A 2X1XR 1JI1A 4N8VG 3NPSB 4LSTL 5E1AA 4M93C 4UTAH 5IQ7L 1OTUC 3KS0H 4J4PD 4UBDD 3MRCB 4DAGL 5TPWL 3KVQA 4LLAA 3S96B 1ND0A 4Q2ZA 4J3WA 1AD0B 4M7LL 1AO7B 4Z7UF 2NY1D 4I8DA 3K4ZA 3RVVC 2BSRA 4ONGH 4F8TA 4FQ2H 4DKDC 1A7NH 1FGVL 2ZZUT 3NA9L 1ACYL 3KPTA 4JO1H 3ZLQC 5HYJD 3X3GH 4U6XB 1P84J 3OKOA 5I1AB 4YR6B 5LXGH 4XHQA 2YPKB 3BP7A 4M6MH 1AD9B 4R7DB 3EFFB 5CJBA 3MCKB 4TOYH 3I9GH 3UJJH 1NFIA 4HWEL 2Y06L 1LEKA 2X89D 3FB7A 2X70B 4GRWH 4OFYA 3SGJC 4P3DA 1ZS8A 2V17H 5LGJA 3WD5H 4WFFE 1IMHC 2HRPH 2YUXA 2D7TL 4PRNB 2CR6A 4GKZB 5J0BA 4XVTH 1RZJH 3RZCB 2DTMH 2Z31C 5DVMA 1G7HA