4GG6A

Protein complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
182
structure length
180
Chain Sequence
DIVADHVASYGVNLYQSYGPSGQYSHEFDGDEEFYVDLERKETVWQLPLFRRFRRFDPQFALTNIAVLKHNLNIVIKRSNSTAATNEVPEVTVFSKSPVTLGQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTFLPSAIYDCKVEHWGLDEPLLKHWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DQ alpha 1 chain
publication title Biased T Cell Receptor Usage Directed against Human Leukocyte Antigen DQ8-Restricted Gliadin Peptides Is Associated with Celiac Disease
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 180
sequence length 182
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gg6A02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4gg6A01
3KPNB 2DQEH 4N8VA 4KRPB 4G8EB 5TE6H 4KGLA 3T2NL 1PYWB 3CXHK 1FVEA 4W6WB 4OJFL 4D0DB 4EI6A 1RJYB 4JO3L 4GG8A 1C5DA 2EKSA 4R8WH 4WIQA 5EBLA 5FYKD 3ZE2E 4PR5B 1ORSB 4XCNB 4FTVB 1PG7H 4H8WC 1H9VA 4UUJB 4P2YA 4O9HH 3PNWA 3FQXB 4K7PL 1QA9A 5EU6A 3AM8C 1F58H 2IJ0C 4PLKD 3JWDL 1QBML 4I48B 3FFCB 1KT2B 5EN2B 4ETYA 2BP3A 1PY9A 2VIRA 4XP5H 5ISZA 2ATPB 4FQCL 2VLJA 3F6IA 3L5JA 1BEYL 3MLSL 3VU2A 4R7DA 1G7MB 1U2HA 2EZ0C 3V0VB 2G9HA 3QCVH 3VXPB 3T0EE 2JF1A 2IH3A 4JM4L 5CZKA 4PJ9A 1QFUH 4Q2ZB 1CQKA 4C55A 4M5YH 1RJLA 4BFIA 4GKNB 2J7LA 2P43B 1N6QL 4XC1L 3G6JF 4IOFC 3FO0L 2BERA 3CU7A 5GS1C 5MERA 2AQ1A 4F9LC 4J3TA 4LSRL 3ULVF 2BNUA 4HKXB 2O5XL 4WUUA 1D9KA 3SDXE 3WIFB 4QHUA 4ZQKA 5C0CB 1RVFH 3K1KC 4ZAKD 2QKIB 5ILTL 3AGVA 1M6OB 1VGKB 1HWHB 4MD0B 3IT8D 4X6DE 3V4VL 1LO3L 4MNGA 2VLLA 5GS2D 3VI3F 1WSST 3MRKA 4QHNB 4MQXC 4HJ0C 1Q9LA 1RULL 1JTOA 4N1EA 5IHZA 4RMRA 4JFXA 1LP9F 3IDJB 3WUZA 3KYNA 1X9QA 3F7PC 3GFUA 4Z7VE 4L8SB 1AE6H 3MRIB 1IEBA 1YNKH 4DQOH 3K0WA 4E42B 5F1NA 2FCBA 1NAML 3D0VA 4B50A 2NZ9C 1F3JB 2VC2H 5IMKB 3K81A 4TSCL 1JJUA 3T77B 4LARL 4M6NL 5I1LA 2VLRD 1OY3B 2R23A 2PCPA 4YGVB 2P47B 4OJFH 2RCSL 5CCKL 4TNVF 4JO3H 3OAUL 5E24E 2AK4A 3B9EA 4G7VL 1NCCH 2FEEL 5JXEC 2Y6SC 2A77L 5KVFH 4PRDA 5IQ9A 4F58L 1GZQB 1A9EA 3R1GH 4PJCB 3UTQA 1EFXA 4M7ZB 1AXSA 3JWDH 3QJFB 1FG9C 1QBMH 5BZDA 3BPLB 5IW6B 1MJUH 3IJSA 4LQ1A 3EW3B 2ZCLH 4U6XA 5T1MA 4FQCH 1ND0A 2DBLL 1IAIH 3BZ4B 4NRYB 3MLSH 4P2OB 3MFFB 1U92B 1KYOJ 1GPOL 2CO6B 4X98A 5A16B 4CN4A 2ICWJ 3NPSB 3TP4A 4JM4H 5A1AA 1LD9A 1RU9L 4PTUA 2VKXA 2DI9A 1T66C 2WW8A 5EU6D 4ELKA 3RPIB 2YKLL 1KV3A 4FABL 3UTSA 1S9WA 1F42A 4HIJB 4LF3B 3MV7E 1QFWL 4XC1H 3WLWC 2FJGA 2UYLA 3MNWA 2DM3A 2GAZB 5JTWA 2VLJD 4JFHD 3P30L 1TZIA 1EVTC 2O5XH 4GJTB 1QPPA 1SJXA 4HKZB 3WFHB 2B2XL 4G3YL 2X70B 2XKUA 4K9EH 3X11B 5D8JL 1Q0YL 2DLGA 1S7TA 2QR0B 3BUYA 1H3TA 3V4VH 4LLMB 2HMID 4QRPB 3RWJB 2PO6C 1J0KA 2J4WL 4YX2L 3T0EC 43C9A 3BHBB 5DD5L 4PG9A 1ZKAA 3KPSE 4ZTOH 2HH0L 3KYOA 3KDMA 4WUUD 1OP3H 1D9KD 3RDTA 1VEMA 5A2IH 1FYHB 3WSQL 1I8LC 4UDTA 3X14B 5FO8B 3VFWB 4Y8DC 3UTOA 4I4WA 5FDYA 3EOAB 4NZJA 4OQ1A 1UKSA 5J1AA 1IGIH 2QADB 3GJEA 3D2UA 2YOCA 5D1QD 4MXQC 3L5WB 3WLBA 2MOVA 1HNGA 3PWJB 2GTWA 4HFWB 5C2BL 4ONHA 1TNMA 4TSCH 3DPBA 4M6NH 4FFVD 4ZDHA 3FONB 2GT9B 5HHOE 3HNVH 4Y4KC 5T33H 3CXHJ 3UYPA 3SGKA 5CCKH 2RCSH 3QDMB 5C0BD 5BW7A 3AROA 3WS6A 3QUYD 1OLLA 4Q6IA 3OAUH 3MRQB 3O4LE 3BT2L 2OJZL 2XOTA 1CK0L 4KK9D 2DQFB 2A77H 3E8UL 4WI8A 1MFEL 5EG6C 2NY7L 1T21B 3O6FB 4HKJA 1K4DA 2EDEA 2VO5A 2FEEI 2UV3A 3GMLA 4R4FH 1T2JA 4F58H 4C54A 4P49A 2QSCL 1KJ2A 2HLAB 1C8PA 1HK6A 1IRAY 5JLZB 2H9GB 4DOHB 2WWKO 4EI5D 3T0XA 2JJTC 4QHLB 3QA3B 4GBXB 4HIEA 4N0CC 2AK4D 4L1HA 5EU4A 3SGJC 1QR1A 1CICD 2PW2B 1M71B 4JPIB 5EOQH 1GPOH 2IPUK 1ONQB 2YN3A 1R0AL 4YDJA 3RZWA 1FDLL 1BVLA 4FTVE 1RU9H 1T1WA 1F3DH 5HSFA 1PAMA 2HVJB 1YQ2A 2R15A 4YBHA 4OF8A 1YY9C 1KCUH 1OPGH 2EEBA 4OLYL 1I9RL 1ZGLP 4UILL 4DN3L 5HYIA 4FABH 5E9DD 2JB5L 4RAVB 2A9MH 4AIXA 3FFCE 3KYAA 2V2WB 1QSFB 5D7LB 4TPRL 1NEZG 2DYPB 2GFBA 4YDIL 1NBQA 3NOIA 2GI7A 1QFWI 3K2UL 3OKKA 4GLRH 2Z8RA 1ACZA 3OJDA 2Q6WB 2Z31C 4G3YH 1AFVH 4B7IA 3HZVB 1SMAA 2FD6L 4NNXB 1Q0YH 1AGEA 3VH8A 1FYTB 4UOW1 3JV6B 1KJMA 3UTSD 5KBNC 3P0YL 4QTIH 2YRLA 3HA0A 4MXWH 4YX2H 1MHCB 2CK2A 5FDWB 2XPGB 5DD5H 3VRJB 3NGBC 3LS5L 3MLTA 4LLYB 3B8YA 3GM8A 4OZGF 5DEFB 2Y5TB 4EN3C 3ZE1F 3NIDE 1YZZA 4OD3H 5F1SA 2X05A 5C0CE 3GEWB 3VJ6A 3PHQB 5ITFB 3GI9L 2JCCB 3MCLL 3NFSL 1D5MB 4OFPA 1NGZB 5C0DA 4HC1L 1OGTB 3VFGL 4I5BB 1CD1A 4Y4FA 1H0DA 3WFDL 1JGUH 1YECL 3AU1A 4APQA 1JWUA 3EJYC 1Z5LB 3WV0A 1HILA 5AD0A 1CD8A 5LBSL 5DVKA 4OZIF 1VGEL 3RVWD 1QRNA 1WZMA 1U8OA 5HYSG 4O2EB 2WSKA 3BT2H 2F15A 1AD9A 3DGGB 2I24N 4UQ3B 1ZSDA 2AV7B 1CK0H 3JTTB 5EO0B 5C0NC 3D2UD 4B53A 3E8UH 4N1HB 2NY7H 1IILE 1UM6H 3ZZ1A 1HEZA 5B38G 5C8JA 3D39E 2CUMA 2GJZA 4AIOA 5TPWL 1DJSA 2MPAL 3IAQA 4JFED 5TDOA 1F5WA 3QWOA 3BZEB 5E1AB 5KN5B 5DO2D 1ZHBA 5FOJA 5D1XD 1KIRB 2VABB 4I0KA 4U3CA 5FM4A 4MDIB 4P0DA 4BSWA 4K23H 1FDLH 1ORQA 4JEGB 2IALA 2ZUQB 1FNHA 4WO4C 4GRWH 4I8DA 4OLYH 4RDQG 2KUTA 5JPNA 1I3RA 2ADJA 3QPXL 4DN3H 3ULVL 1YN7A 2KZWA 5I1CL 3WE6B 2P49B 3ECBA 5DD0L 1GC1L 3BFOA 1S7UA 4TPRH 3OXSA 1DN2A 4WI2A 4YDIH 3QBTB 3HR6A 1FL3B 2PYFA 3K2UH 2AAVA 4DK3A 5D7JA 4ZFZB 5DEZA 3Q3GB 1TVBA 2PXYB 1P6FA 5FYKL 3U2SB 4PP1C 5HI4C 3BX7C 3PWVB 1P69B 4P59L 1N59A 1A7QL 1WCBA 5JHDA 2OR7A 2FEDD 4JN2A 3O3EA 2A83B 3P4NA 2NY5L 2AVGA 4IDLA 2DWDB 4O02L 4YHML 3MXVL 1S9VA 4QWWC 4R4BB 3C8KB 4RIRB 3X12B 1TXKA 5HGBB 3T08A 3UC0H 3MCLH 3NFSH 4JFYB 3D85B 3PQYA 3RGHA 4F33A 3DO7A 4HC1H 5B4MC 4LHUA 2AJVH 3RTQD 4M8QB 4EUPA 3OGCB 1N6VA 3IJHB 4U1IB 1BZ9B 2CKBA 4HS3A 5TFSH 5LBSH 3IVKA 4IIQB 3W5MA 3TBYA 2AJYL 3VFOA 4KKAD 5EBGA 3QJHA 2OTWB 5A2KH 5ID1A 1N0LA 3QXDA 3FB7A 2QL1A 4NC1E 3CGTA 1T1ZA 3FOMB 4Y4FD 4ZFOA 4NBXB 4GAYA 5L2KA 5FA4A 1UXWA 2F5AL 3OF6D 5TPWH 1QRND 4RGNC 4FOMA 1JNHB 5IG7A 1DANU 3OKDB 3QDME 4KRMB 5GZNC 4XP1H 1TLKA 2W60A 3QSKB 1MCOH 3W0WB 1ZGLB 1BPVA 1VADB 1Q72H 2QQKL 1EXUA 2X4RA 2I9TA 4YIQA 3O3BA 4JVPA 1BQLL 3EDKA 3P4LA 1DUYB 5HHXH 5JIHA 3ZT5A 2ZCHL 2VR5A 2C26A 2AK1L 4DOHE 1E0OB 1Z0MA 2ZCKH 5HHMB 1EAPA 2HLFD 1LVEA 2LE9A 4Y1AB 4IHOB 3CMOH 4W4OA 1GGUA 2FJHA 2UZYB 2D9CA 4GRWB 1MHPL 5CBAA 3UTZA 3E3QE 4JO4H 1K4CA 3U4EB 4FQLH 3TPUB 5ALBH 3PXJA 4DGVL 4NO2A 4P59H 5EOCH 3S4SB 3EO0A 4P4RB 4MMZC 1HHHA 3HLAA 5D7LE 2NTSP 4O02H 3W11C 3MXVH 4P2RB 4N90D 1UB6B 1E4KC 1IQDA 1Z9OA 2Z93A 1E6OH 5DMJB 2XFXB 1CFTA 4WDIA 3G5VA 1NBVL 4NKMA 4X0KA 1GXEA 3DX6A 5HYQB 2F58L 2WWKT 1NC2B 5JHDD 4LNRA 3T4YB 5GZOC 3RAJH 1MRCL 1MUJB 3G5YA 1SEBB 2J3SA 3DVNB 2VOTA 5JOPE 1N7ML 2ZG1A 1N8ZB 3HC0A 5D5MA 3OAYH 1YYMH 1PW3A 3OZ9H 3B2UC 3Q6GL 4U6VH 2AJYH 3C2SA 5MEOB 1U8HB 1UXSA 4J1UB 4H0IA 1P4BL 4XNMA 3AY4C 4OUUA 2JCCE 3PQYD 3VXRA 2R4RH 4U1SB 3ZDYF 5DJ0B 1CZ8L 4KKBC 4YUEL 2DLTA 1BVZA 1A1MA 4GXUN 4WEUD 4MCZA 5IFHL 3SCMB 3PABA 4JKPL 2F5AH 2P44B 2XNAB 5KZCD 3SKOA 1W2KT 1ZVSB 4JB9L 4PJ7A 4WFED 3WXVH 5I1AB 5IESL 1IE5A 1ED3A 5BMFL 5I1GL 5BZWA 4F8TA 2X4OA 2DLFL 4TN9A 3MUGA 1T04B 1KJ3L 4KRLB 3TN0B 5T1KD 1IEHA 1F8TL 4ZNEE 3B9KD 1A6ZA 3MUZ1 1NFDE 1SYSB 1WK0A 4G8IA 1T0NB 5D93B 4P23C 1TQCC 2AK1H 4R9HA 5IEHB 4NC1C 2DQTL 3DV4B 4F7PB 2VXSL 4NUJA 4ONFL 5E2UH 5CKGA 3FB5B 1I7RA 5T3ZD 1A5FL 1MHPH 1E28B 1VFBA 4BSJA 5HVHB 3X3FL 1HCFX 5CJXA 4NT6A 3LKNA 1WITA 2B20A 2BNRB 3QUKB 2CIKB 4BZ1L 4HF5L 4Q97A 5JO5A 1T89A 4YO0B 3LB6C 2ZUTA 3O6FC 3BWUC 1Y0LB 4WVRA 3FN3A 4JPWL 4KKCC 4YWGL 3N1FC 1KCSL 1AGDA 2Z8SA 1RK1B 4Z5RB 1JPTL 1BJ1J 5HGHA 5LQBL 1NBVH 1BLNA 4PBVC 4P46C 5E99H 2ADFL 2APTA 5DD6A 5GGUA 4ALAH 4U1HA 5JDSA 1ZT1B 5BCAA 3E3QC 3B3IA 3RVUD 2DN7A 5DDHB 2W0FA 3GUTA 1Q8MA 4ONOA 5IJVA 1KOAA 1I3GL 3ARDB 3HE7D 3O45A 1CDGA 2NTFA 4K71B 4OIIL 5J7CC 3MGTA 3VMOA 4HJJL 1P4BH 4GQPH 5H37H 1OTSD 5I76A 4X4XA 1OL0A 4PP2B 3LD8B 3T3PF 1YMHB 4NFCA 1F4XL 4YUEH 2FLBT 1JI1A 1VENA 3TBWA 3RKPA 3DARA 1UQSA 4ODXA 2CRZA 2NW2B 4XB8A 5F7UA 5CMAB 4JB9H 1R3IL 5JDJA 3OB0H 4PBXA 1V7NL 4KUCD 4X6FB 3OQ3B 1T5XA 1A9BB 4LRIC 4U1MB 5I1GH 2HKHL 3NFNB 3WO3B 4K3DL 5GS0H 4PS4L 4LKXB 4W6XB 4Y4HA 4M6OH 4IMLA 2GTZA 1CQYA 2LFGA 4NPYA 1ZANL 1KJ3H 4QRQB 1F8TH 3HFMH 1DQTA 3NZHL 3VD7A 4W70A 1X5JA 1FNGB 4WW2B 3TVMD 4RFOL 2VISB 5F7WC 4HIHA 4JJ5A 1F4AA 4Z7OE 2DM4A 1XIWB 2Z0BA 2E5EA 3MUHL 2FATL 4LSVL 4NZRH 1S7WA 2XRAL 1EMTL 4JAMB 4IRJC 5J0BA 4ONFH 4CVZB 2ADGA 4XXCA 4P2QA 3QDJD 3L3HB 3F7RA 1IMHC 3LS4L 1BM3H 4WFFD 5E8PA 2VXUH 3MRMA 3W0WE 3N50A 3AXLB 3RIFK 4GUPB 4OIBA 2ZUVA 5D2LB 3QEHA 2OTUA 1EZVY 3OR6A 4PLNC 2YR3A 4BZ1H 1FCCA 5K9OB 3QG6A 4MGXA 4L3EE 2Q86B 2P8PA 4XGZA 4Z0BL 5C9JA 4JREB 3ZHKA 4OAWB 5HHME 1OB1A 2RJMA 4U49A 4YWGH 3OJVC 2WBJB 1ZVYA 3HZYA 4PJDA 3KPTA 4PJGB 1FL5B 1KCSH 2R1WA 5SWZB 3WNPA 1CLCA 1V05A 3E6HA 4RZCA 5D5MF 2AJZB 4JM2D 1XFPA 4PJXA 4TVPD 2ADFH 3VD5A 2XXMB 3AS3A 4KUCF 3SKJH 3V6FA 1HH6A 3OWEA 1DDHA 2CXGA 1UH4A 3QHZL 2J88L 2ZUQC 1KJ2L 2O61A 3KJ4B 3HG1A 4NQDB 1AY1H 4EI6B 4GG8B 3ARBA 3RA7L 1EK3A 1WJ3A 4OIIH 3SQOH 4HJJH 2IADA 3C6LC 1M7IA 5M94B 1CWVA 1LO2H 2X7LA 1TDQA 3C2AL 4X80L 5DVNA 2LU7A 4NBYB 3C9NA 4ESKA 1QA9B 2X4NB 4CAGA 1DBML 1F4XH 4I2XA 1UM4L 2VIRB 3THML 5ISZB 2A6DA 1CR9L 1K2DA 4P57B 3RVVC 4UU9A 1U2CA 3FRPG 4S0SD 1V7NH 4YHPA 4M43H 1AKJA 2IH3B 3MR9A 4K3DH 4PJ9B 1RUKH 1RJLB 1ZANH 4BFIB 4U6TA 2YHGA 5DJAA 1JIBA 3NZHH 4Y19A 4DWHA 4M1CC 4BUGA 5MERB 5SX5H 5FUOH 5HDLA 3BAEL 5DMGD 2BNUB 3E2HC 4PY8I 4JM2F 2NR6C 4LSVH 1FVDB 2XRAH 4S1DD 1YPZA 2FJFA 3GHBH 3HB3D 5EOTB 4C4KO 4ZQKB 5F9JA 1BD2E 3R8QA 2J5LB 4AIZA 4Y4HD 3STZA 4KK5C 1ZLSH 4OUOA 3JZ7A 4L3CA 5L88L 4IIQC 2VLLB 1X44A 4NO3A 3V5HA 3DECA 3ARPA 4KQ4L 3RKDC 4XHJC 3FRUA 5IHZB 3MFGB 2QHRL 2DTMH 4Z0BH 3SDAC 1J10A 2NLJA 4P2QD 1OOAA 1S7VA 2NY6C 4U1NA 4OZFA 5DJ2A 3G6JE 4Y0GA 5HPOA 5C1MB 5F1NB 1F3RB 3ULVE 3DXAA 4H20L 4NN7B 2BHYA 1FE8L 5HGAA 2BNRE 3S3JA 4DVBA 2Y4SA 3C8DA 5I1LB 4JKKA 3TYGL 4AM0A 2Y23A 2R2EB 3QHZH 2W1NA 2J88H 2PCPB 4JHWH 4P9ML 2B0SL 4AQOA 1G7LA 1OD9A 5KJRL 2E6QA 2WUCH 1M7DA 5MHSD 3VI3E 2EXWC 4UNUA 3S7GA 4CL7A 5FYKE 4M1DL 5ADPL 1JGEA 5FUZL 2DQIH 2VL4A 4PRDB 1LEKB 3K8LA 4HLZH 3ZKQD 2E7CA 5IQ9B 4X80H 1BECA 2GJJA 3ZKXB 3BSZL 1S5IL 4Z7WF 1A9EB 3UTQB 1DBMH 1EFXB 4Y16D 5CJOH 1AXSB 3UBXG 1EX0A 1UM4H 2E7BA 3HG1D 2BX5A 2FNBA 2HP4A 4PV8A 1LEIB 3THMH 4U6XB 1CR9H 1ND0B 4GAJH 4JLRB 3ZLQC 1JFQL 3B8SA 4QRRD 4X98B 2ESVA 3N85L 3EYQC 3LHPL 3IRZA 5EZOL 1LD9B 4PTUB 2FX9L 5IROC 2YPLA 1M05A 4FFZH 2VL5B 1IC4H 3UTSB 1S9WB 5E95B 4CMMA 4UBDC 2FJGB 3S5LG 2UYLB 2W9LA 3MNWB 4DVRL 5E2WL 2FX8L 2HG5B 4FQXA 4NQTA 3C87A 1G9MC 3KYMA 4LCWD 1PKOA 3VGAB 5MEQA 5J1SC 1AKJD 4HULB 1T7XA 4TTDC 1JN6A 4UT9H 3TF7C 4MJIB 3OHXA 3BUYB 4LAJH 5L88H 4BFGA 3F7QA 1A6TA 4MCYA 4FQHA 43C9B 3BOVA 4PJDF 4YH6A 1W0WA 1NMCC 3ULUD 1XGRB 4PG9B 1JV5A 1FORL 3QRFM 2P42B 2PW1A 3KYOB 3KDMB 3HI5H 1MRFH 3RDTB 1OTUD 3RUGF 3SCMC 3HTLX 1MVUB 2WV3A 1PX4A 3BKCL 3EOBA 5F89A 5LWYL 1KCLA 5T5NG 1II4E 5D70L 4I4WB 3TJHD 5J1AB 3GJEB 4K7PX 4DAGL 3WLBB 5I15H 5ERWA 5F21B 2XIDA 2AW2A 5D2LE 4H20H 3O4OC 2UY7A 4ZFOL 4NN5B 4FP8L 4ZDHB 3W2DL 2GHWB 4LPUA 3VGEA 3UMTA 4WTXA 2VLRE 4P9MH 3N0PB 5FECA 2MKLC 1QNZL 2Q76B 1U8KA 4KXZI 2APWA 4Q6IB 4JANA 3RL1A 2MNUA 1FRGL 2AXHA 2CXKA 4PJGE 5D93C 3PWPA 4M1DH 3AVEA 4S1SL 5FUZH 3STLA 1WBXA 1K4DB 1MJJA 4N5ED 3GMLB 3FFDA 3VG0H 3WD5H 5FHAL 2VXQL 2X4UA 5JW5A 2GEEA 4L9LC 4LLAA 1U8IA 4IRSD 3UZEA 4HH9A 4BKLB 1WISA 3ULVC 2R0KL 4HIEB 3HE6C 5EU4B 2OXHA 1JFQH 1GC1C 3ULUF 1CE6A 5DQ9A 4YDJB 1KENH 3P4MA 3LHPH 4D9RD 5EZOH 1BVLB 1LE5A 43CAA 2H2SD 1GIGL 4X7TA 3U36A 1Q1JL 2R0WL 3O8XA 1NC4D 5EU6E 2AGJL 2R2BB 1KC5L 2R2HB 3ZTJH 3RZCB 3ARFA 1F3DJ 4PGEA 2QTEA 4DVRH 3VA2C 5E2WH 2FX8H 5ISZE 3QWRA 2VLJE 1NMBL 3RVTD 5C0RL 3DROB 1JZ4A 2ESVD 2IPKB 3OJDB 2NY5C 4NM8L 1H5BA 5EUOF 1LO0H 4PLKC 3RWIA 5B22A 2YPLD 5HDQL 3MZGB 3IYLW 2ZJSH 1KJMB 3EGSA 3ARDC 3ZTNH 2GJ6D 4K71C 3REVA 1MPAH 3MLTB 5IBLD 3QIWA 4OFKA 4EUPH 2YD5A 1YEIL 2C7UB 2L4OA 3GIZL 4BQ6A 2CKBH 4WUUE 4GG6F 4Z7NE 4EXPX 1FJ1A 3QDGA 3BKCH 5IBTH 2ITDA 1CGXA 5D70H 5FHBL 4XVSH 5C0DB 1RZGB 1GJIA 1U8JA 5IHLB 4JQXA 4BQCA 4MZ3A 2BSED 3SBWC 2GK0A 3NCJL 4MNGE 1ZLUK 1H0DB 3FQNA 3MMEA 4O58H 3AU1B 4APQB 2FR4A 4G8FA 4TQEH 4ZAKC 1HILB 3LKQA 4GW5A 4OLZH 5AD0B 1IT9L 1VPOH 4H25A 4U0QB 4PJEB 1I1RA 4ZPTB 1QNZH 1U8OB 2H2PD 4MD4A 4OLEA 4WW2C 2PNDA 1GOHA 1A3RL 1I9EA 3F7YA 1ZSDB 4JKLA 3S96A 5JOFB 2XXCB 3CDGA 4CJ0A 4S1SH 4MWFB 1HEZB 4GW4A 4QXGL 5C8JB 5FHAH 3ZE1E 2VXQH 1UG9A 5FEBA 2V7NA 5F1OB 3SE9H 5KVGL 1BFVH 2HJFB 4OFVA 4F8QA 3Q1SL 1O7VA 3GMMA 1KB9K 4HT1H 2R0KH 3QWOB 3DSFL 5ESQA 4JFDD 4KDWA 1ZHBB 2AK4E 3MOAL 4U1GC 1NBYA 3PWPD 4ODHL 4OLUH 1EEYA 5FKPA 3TZVB 2DQDH 4BSWB 4HSQA 5EPMA 1WEJL 1PX3A 2IALB 3KGRA 1IC1A 3I6GA 2QQLL 2YD2A 3F12A 4FQQA 4OZ4B 5JIIA 1GOGA 5JPNB 4NZTL 2ADJB 1YN7B 4Q0XH 2NY3D 2AGJH 3HC4L 2Q7YA 1KC5H 3ECBB 2VUOA 4OTXL 4TVPL 2LV4A 3EOTH 5KSAD 1S7UB 3WKML 4P3DA 3INUH 1IM3A 1L9MA 1DBAH 4M6ML 1QUNA 1EEQA 3VFNA 1MELA 4YK4B 1NMBH 5DHYA 5D7JB 2Z8VC 2D2OA 3QUZA 4NM8H 3VFMA 4PJFF 5DMIH 1TVBB 2E8ZA 1N26A 4WY7L 5HDQH 2EE6A 3BZFA 3D25A 4LKCA 1A6WL 2AQ2A 3I84A 4O2CA 2BFVL 3UTSE 3LMJH 5HHNA 4DCQA 4JN2B 1S7SA 2YK1H 3P4NB 4DW2L 1X4ZA 1FL6A 3MRDA 3QWRD 4I18C 1P5UA 2PYED 3GIZH 1S9VB 1D6VL 3HAEH 2J2ZA 4KH2A 3ME0A 1NLDL 4PLOB 5DJZB 3S6CA 4MJIE 5FHBH 5KSBA 3DO7B 4F33B 3TO4D 4LHUB 3NCJH 1U3YA 4EUPB 1BQHA 4M9OA 4WEBH 3QIWD 5HHQA 4PJ9C 1KTLA 5E4EC 1HN1A 2CKBB 4HS3B 3NACL 3QP3A 5IB1B 3U9PL 4PPTA 1IT9H 4PB0L 2XV6B 3EYOB 3V6ZB 3IVKB 2HMIC 3TBYB 4CVWA 3VGGA 3VFOB 3QDGD 1FVCA 1G6RH 5EDXA 5ID1B 1A3RH 3V9FA 3QXDB 1NGPL 2VDOH 4XC3L 1T1YA 1WIUA 4XBPA 1D9KC 3FB7B 5IHBA 4ZFOB 5TF0A 1I3UA 4E5XA 2P45B 3WHE1 5L2KB 3RWFA 1SBSH 1U8QA 5FA4B 1XH3B 2JJSA 1UXWB 1WIOA 4AEEA 1TJGH 1NCUA 1FPTH 4EZMA 8CGTA 3MBXL 5IMMA 4X9GA 4EBQL 4HUUA 4U1LA 3Q1SH 4Y5VA 5D2NA 3JSSA 5E6ID 3WJJA 5IG7B 5D1QC 3MLWH 2F53B 2WUBL 1R3KB 4XVTH 3AUVA 3SE4C 3STBA 2W60B 4OGXL 4D9LH 2AJSL 4ODHH 2DTSA 4FFVC 4YPGB 5KVMC 1WAAA 5D6CB 2I9TB 2X4RB 1PJ9A 3ET9F 5ECJE 1P9MA 3W39A 4YIQB 2FSEA 4LP5A 1JK8A 3QUYC 4OLVL 4NCC1 3CFCL 3EYUL 3JTSA 2XN9B 3P40A 1MI5D 3HC4H 4WWKA 4KK9C 3ROOA 1EAPB 4U2ZA 4WHCA 5LGKA 4LCCA 1A7RH 1HWGB 9CGTA 5KVEH 2AV1A 3VWJA 5HYJA 2FJHB 3U30C 3AREA 5CBAB 3UTZB 3ARWA 4R2GB 4YXLL 5CINL 5J11C 2VLMD 1IBGH 2C5DC 3HMWH 4QRTA 3HI1A 1A6WH 4NO2B 3TA3A 1MJ7L 2BFVH 1CICC 5F97E 5H35A 1FGNH 3OMZA 4OKDA 3U0WH 1NFKA 3UJIH 1PY4A 1HHHB 4IDJL 3HLAB 5FM5M 4ACPA 3L5XL 5DGQA 3MODL 2Z9TA 1CE1H 3JWNC 4WHYG 1NQBA 1D6VH 3QUZD 1QQDA 1FAIL 1IQDB 1CFTB 2OSLB 4WDIB 4Z7QE 5J6HB 1J9CT 5C08D 3G5VB 2R0LH 5HD8D 2IWGA 4AH2A 4YC2C 4X0KB 4F9PA 2R1XB 4X99A 3VGDA 3VWKA 3VI4E 2HAZA 4NGHL 3G5YB 2OCFD 1U3JA 3LVEA 4DEPB 2IFFL 1T2XA 3HC3L 3HAEB 3NACH 3U9PH 1MCCA 3HC0B 4PB0H 3IDXH 3V0AC 1C16A 2M2DA 5FFLA 3EO1A 4PJ8D 1XGUA 4XNMB 5GGQL 4GKSA 4L4VA 1NGPH 3VXRB 4XC3H 2UWEF 1C7TA 3EFDH 3FN9A 4H0GA 4K2UL 1LE9A 1HI6B 1CFQA 4Y2DA 3HI6H 5E5UB 3ZL4H 1EUTA 2OL3H 3EYFA 5CFHA 4PJ7B 4L4TB 4DKFH 1G6RB 1KB9J 1QRNE 3PDOA 1ED3B 1CU4L 2XICA 3BIKA 2W0LA 4X5XA 4R4ND 5GGSY 4OGXH 2X4OB 4X8XA 4HXBH 5FYLH 3WEXA 1NDMA 3RDTC 3UYOD 2NX5B 2X1PA 3RVWC 4V2CB 1RZFL 3GSQA 2J1KA 4KPHH 2CRYA 3WNLA 3V4UL 4RX4D 5E2JA 2RHEA 1JPSH 4OLVH 4G8IB 1RZJL 1MHHA 3UPRA 2DRUA 4U6HA 4C58B 5F71A 2ITCA 2EDJA 4OCMC 3ALPA 4E0RA 4HWNA 2ARWA 5SX5K 1KLFA 4HV8A 4NN5C 3MLYL 1RUPL 5DHVH 4WTWA 3MOQA 1VFBB 4YXLH 1IAIM 4X7DC 4NT6B 4UOW0 3LKNB 3WS6C 4Q6IC 1VB9A 4XMLH 4MAUH 1PDKA 5JO5B 3TV3L 3L7FA 2CGRL 2A2QT 7FABH 4IDJH 2J8UA 1MOEA 1NJ9A 5KG9A 3L5XH 3MODH 3MOBH 4PJIB 5FGBA 1DLFL 1RMFH 1WV7T 4N8CH 1UEYA 4EDXB 1IARB 2BSRA 5AAWA 1FAIH 2KL6A 1AGDB 3ARED 3PHOA 1V8HA 3MJGX 5HGHB 1KLUA 2FECL 3QWQB 5HDBE 1K6QH 1NANH 5C6WH 3TA3D 1CXIA 5DD6B 3C8HA 4Y89A 2LVEA 3OSKA 4JY6B 5IK3A 5JDSB 3BIAX 4NKQB 5JHDE 1NANI 4NIKB 5E5MA 5J13C 2IFFH 4U33A 2W0FB 4V1DA 1KF9B 3GUTB 4NHUA 3O45B 2NTFB 3RNQA 1DP0A 1CF8L 5EO9A 1I7ZB 3MGTB 4FFWD 2FEDC 1J8KA 4B7LA 2H1PL 4PUBL 2ZSVA 3D6GA 3QXUA 5D7KD 5I76B 3P9LB 4X4XB 4MJ4A 3L5HA 3MV8A 3PQYE 5F8QC 1OWWA 4K2UH 5EO1A 2GSIA 2H26B 3ZYOA 3TBWB 1UQSB 4IOFD 4ODXB 3IAGC 4AZ8A 4G8GB 1NUFA 1J86A 3SKNA 3BRDA 2OP4L 4XNQB 1MFNA 4I3GA 4ORZC 4RFNB 5EBMA 4P4KA 4WFEE 3E1F1 4PTTA 1T5XB 5AWNL 3CLFL 1UJ3A 4KC3B 4RMSA 4L4VD 1YY8A 5DJXA 4UIKL 4IMLB 2GTZB 1JPGA 3CJJA 4LLVA 4HPOL 4NPYB 4MA8L 1HKLL 1D3CA 4YNYA 4LIQH 5E08H 3G6DL 1OW0C 3S35L 1H3VA 4KKAC 2OL3B 5AUMA 5L2KE 1BBJA 4OGZA 3BWAB 1U8LA 3MX0A 4HJ0D 3SDYH 4CN6A 4HS8H 2WAHA 3GRWA 4UTBH 3AS0A 1MFDL 4PGBA 3U9UB 4DZBB 2CH8A 3QHFL 1A3QA 5CBEA 1KB5A 4QOKB 3IU3A 4PJ5B 1JPFB 1S7WB 3QIBA 4R90L 4Y4FC 4ZS7L 2ADGB 4UI2A 4APQC 3H9ZA 3TIDB 3U6RA 4CGTA 3ARGA 1RUPH 2EIZA 2CMRL 2X4PA 4OZFH 1A7PH 4HH8A 4IMKC 5B39G 1QBLL 1LNUA 3PL6A 4HIIA 4ODSH 3QEHB 4Z7UF 3OKLB 4Q9QL 3OR6B 2C4FU 2P8LA 2YPVL 3QG6B 3LH2L 3TV3H 1GGBL 2QLVB 2XN9E 1NCDL 3IXAB 1I1FA 4XGZB 1JRHL 1AGFA 3LQMA 5BOPA 5C9JB 3DV6A 4HGWA 4NWTL 1OB1B 4ZUVA 4NCC2 1E6JL 1AXTL 3ZDXE 3VD4A 5F3HA 4HK0A 2FHFA 3E6HB 1WF5A 5DI8A 4PJXB 2HLFC 4QTHA 1ZHNA 1A6AB 2XTJD 3GB7A 4U31A 3V6FB 4J2XA 1HH6B 1CDUA 3F5WB 1DDHB 3JV0A 4C83B 5GS2H 4KI5D 2CKNA 1QTYT 5MENA 5I8EA 5DTFA 1OARL 4DKEL 1I4FA 5FCSH 1J0JA 4G9FD 5F7FA 3ARBB 2W0PA 2XQYK 1CF8H 3W81A 3RU8L 4PGJA 2IADB 1M7IB 2H1PH 5DMYA 1JHKL 1IVLA 3W9EB 2JB6A 4Z76A 4XT1C 4YK4C 3RHWK 1INEL 2V5YA 4HG4J 1NGQL 3WLWD 3UYRH 2P24A 4G42A 4M5ZL 2A6DB 2FL5A 5ABDE 2OP4H 4UU9B 5D5ME 4G6MH 3L3KA 4JFQA 3CLFH 1VA9A 3MR9B 5BRZB 1BQUA 4YE4L 2F19H 3SDCA 4GKOA 2VXTL 3U46B 4UIKH 3B5GA 3FQTA 4PG2A 3VXRE 4WW1A 3QNZA 1HKLH 1FN4A 3G6DH 1RJZA 4F7MB 3T0ED 3DMMB 3PDGA 4Y19B 1AGBA 1R5WA 4S11A 5J12C 2ARJB 5CP7A 3RY6A 1X4YA 4PJ7E 2QHLA 3I6KA 4PY8J 2HN7B 4R90H 1YPZB 2FJFB 2NXZB 2NYYD 5F9JB 1RUQH 4AY0A 1TZHA 1Y6MR 4ZS7H 4AIZB 4KI5F 2FWOA 3A6OA 2J8UF 1LEGB 4S0TD 4MXQD 1WFNA 3LZFL 4P5MB 1DCLA 3V5HB 4Y88A 4Q9QH 4LU5L 4GO6B 3ZE0E 3I2CL 1ROWA 1JNLL 1GGBH 5CUSL 3LQZB 1MJ8H 1NCDH 3S37H 3QIBD 1NKOA 5B8CA 2CLZB 2V2XB 1MREL 4NWTH 4MD5A 3WO4C 5CJQH 1X7QB 1E6JH 1S7VB 1XGQA 1MLCA 1JRHI 4OZFB 4LLUB 5CS7A 5DJ2B 1B88A 4KROB 4PJBB 2P5EA 3EFFA 1KPVB 4UZGA 1OCWH 3MCKA 3PL6D 1AP2A 4UT6H 1JNNH 2JK5B 3DXAB 4G6AC 2Q8BL 2DQUH 5HGAB 3MUJA 3AAZA 4DVBB 4TVPE 4F80A 3RNKA 1IAKA 3TCXA 5IKCA 1G7LB 1OARH 1YC7A 2ZP0T 3U79A 2MCPH 4UNVA 3C60A 5KSVB 5FGRA 1M7DB 4IS6A 1NKRA 3CFEB 4Q7DA 3JWOC 3BXNA 3RU8H 5E8EB 4P3CL 3QQ3B 3BEVA 4G8EA 4YHYB 5I2IA 4RA0C 1JGEB 1JHKH 5CLTA 2YA0A 1PYWA 2ILLA 2IF7A 3SY0A 1RJYA 3EJJX 4W4OC 2BNQA 1INEH 5K9QG 4ELMA 4PR5A 1AQKL 3AMKA 1WBYB 1WFUA 1WC7A 4TRPL 1X5AA 2V2TA 4TOYH 3Q6FB 4PV8B 2HFTA 4UUJA 3GNML 5C6TH 3FHQA 5BO1L 3SDXF 1L0YA 3CIQA 1KLGA 4L8BA 5ESAA 2XG4A 4FQPA 2EIDA 3FQXA 3QI9A 1IZJA 3AMLA 3OKOB 4I48A 2AERT 2VLKA 4YE4H 2VXTH 1ULVA 2YPLB 5DK0A 2ATPA 1M05B 1CGVA 2YA2A 5FGSA 5CZXD 3VGFA 2DIJA 5FF6B 2MSPA 3ZT7A 2XKSA 5I30H 3VXPA 3DYOA 4HGMA 4I3RL 3D9AL 3MTRA 4FQXB 4U1JB 4Y5XA 4ZXBA 3MRHA 4KTDL 3MA9L 2HFEA 4PJHA 5DUBA 4EOWH 5A2JH 4DEPC 1KN2L 3DNKA 4Z7VF 5T5FL 4BUHA 1XGPB 3VW3L 1VHPA 4A2LA 4JZJA 5E7BA 4JVUA 5IBUG 4G9DA 3TT1H 1HIMH 2D7MA 3VRIB 1A6TB 4MCYB 1K9TA 3KPPB 3LZFH 1W0WB 3WIFA 2VITA 4LU5H 1FFOA 4WTZA 3I2CH 3VFSA 1JNLH 4RSVA 4JZNB 1I8MA 5KVDH 1VGKA 5AAMA 3BPCA 1UZ8B 4BYHA 5FGCB 3MRJB 1YNLL 1QZ1A 1LILA 3T0VA 3DIFA 5JPMA 2V6HA 3QCUH 5D72L 3EOBB 5F89B 5D96C 4P2QE 3KPSD 1HXMB 1E4JA 3H7BA 5IEKA 4FG6D 3NFPB 2PETA 4Y5YB 3V4PH 4FXGB 1DQML 4CKVX 2CPCA 1AR1D 3V52L 2D7TH 1UGNA 2H32A 1BIHA 4UAOB 5F7NC 5J06A 1SY6A 5FECB 4ZO8A 4E42A 2RR3A 4NP4L 3RJQB 3VG9B 2NY0D 4JANB 1F3JA 5E00B 5JXAH 5IMKA 5CD5D 4PJDE 2ICCA 4CMHB 5ETUB 4P3CH 4G6FD 1WQVT 3STLB 1WBXB 1MJJB 4YGVA 3FFDB 4PJXE 3MRNB 5JW5B 1MCHA 2HFFA 3VXTA 2DQJH 1U8IB 5D71L 1AQKH 3LDBB 4TRPH 1KIPB 3UROR 3P3YA 3HG1E 5CJXC 3GNMH 3N9GL 3ARZA 4ZO7A 3C60D 5BO1H 3FL7A 5MP6L 3GBML 4ZFFA 5FO7A 5HPMB 4M48H 1T89C 5CD3A 1GZQA 1CE6B 1RK0A 4PJCA 2C3VA 3P4MB 4KRPD 3QJFA 2WBKA 1LE5B 3CZJA 4HUXB 43CAB 1VESA 2WLYA 1OAQH 3MO1B 4X7TB 3U36B 4BZYA 1F00I 5HI4D 3O8XB 1ZAGA 3O2DA 5L2JA 3MFFA 2Y72A 4N8VG 5CEXB 3ARFB 4PGEB 2EEAA 4I2XE 4FTVD 4I3RH 3D9AH 1BF8A 4KTDH 1AI1H 1H5BB 3RWIB 3BYTA 1L7TL 1IC5H 3FB8A 4AQ1B 1KN2H 3FFCD 5DJ6A 3TT3L 3U0TA 3TC9A 4ZOAA 3MRLA 4DZ8B 4Y19E 3QIWB 1DEDA 4HUWB 5JW4R 2QR0A 4LLMA 4QHMA 3U1SL 4QRPA 1YPZE 3UPCA 1P84J 1YNLH 1FJ1B 2Z91A 3OB8A 3NIFF 3BHBA 4XNYL 3QDGB 1ZOXA 2ITDB 3QFJB 4LIQE 1NEZA 4XNXL 5HYEA 4P48A 2C3HA 1FC1A 4E41A 4S1DC 3HB3C 2AXFA 5C0CD 1QBBA 3FQNB 5EULV 3MMEB 4JO1H 2FR4B 3FB6B 1GHFL 4G8FB 3CDFA 4Y4HC 3V52H 3X14A 4CDHA 1KN4L 3LKQB 3VFWA 3SGEH 1NCBL 1P4IL 1MFAL 3EOAA 4NP4H 1W0YT 4U05A 5F7EL 3O3DA 5GZND 3JXAA 2BHUA 3RFZC 4HFWA 1DEEB 4PIRF 3C08H 3CDGB 4ODUA 3FONA 1JZ2A 1LHZA 3SDDA 1WWCA 4GW4B 4YDLB 1HE7A 5IQ7L 3DXAE 5EU3A 4XXCC 1OAKL 1ZTXH 1TQBC 2AJXL 3T65B 4ZUTB 2FZ3B 4PRAB 2YD8A 3GMMB 3TLRA 2DQFA 5JW3L 2G5BA 1INDL 1WTLA 1T21A 1NDGA 5ESQB 5I6XC 3FO9A 3GBMH 3G9VA 2F9BT 3H2WA 1XCTA 1EEYB 5FKPB 4ETQB 3K8MA 5IT2L 2HLAA 4ZUWA 2VWEE 5MEPA 4NQEA 5JLZA 5F88B 1AD0A 1F45A 3I6GB 4D9RE 4LLWA 2EECA 1ZLWH 1T5WB 4QHLA 1N2RB 2IBZY 4GBXA 5I71C 1T0MA 3ZHDA 3GMRA 5HYSA 5HYFA 4Z6AT 4YXHH 1M71A 3I75A 1TITA 2Q7YB 5I1JL 4CU6A 2VSCA 5GRUL 3FMGL 5C07B 1IM3B 1I8KA 2HVJA 5CP3A 3W11D 1LK2A 1GH7A 1X5XA 2FBJL 5DHYB 5ESVB 4LDEB 3VFMB 1QO3B 2ESVE 1HYSD 1L7TH 2I07A 3SO3B 3L6FA 5FO9A 1BFOA 1QSFA 2V2WA 3BZFB 2YPLE 4LKCB 5IB4A 3DX8A 3ARBC 4P2OD 2F54A 1P1ZB 5HHNB 4NQXB 3L3OB 4DCQB 3CZFA 2CSPA 3F62A 5H94B 4PB9L 2HRLA 4HKBA 3KR3H 1LO5B 3MV9A 1FL6B 3HZVA 3MRDB 4OGYL 2QSVA 1FYTA 5SWSA 3WBDA 3JV6A 4ZSOB 4ENED 4XNYH 4AENB 4HUMB 4NNPH 5GJTL 1HHKA 5ITBH 1RAMA 3LEXB 3L3GA 5KSBB 4Q9RL 5I73C 1CFNB 3T3ME 4ERSL 3BN9D 1OAUL 2LAAA 1GHFH 1KTLB 2H8PA 1G7IA 4UV7L 3B5TA 3VE0B 2R69L 1NCBH 1P4IH 2D03L 1MFAH 2ZNWA 1PG7W 2EYSB 1IKFH 4QRPD 3ETBF 1OGTA 3WUWG 5F7EH 5FGCE 3RVXD 1FVCB 3ULUC 3VXNA 4DFIA 1W72H 4IJ3C 1U3ZA 1T1YB 3UJTL 1MCKA 3VDAA 4XBPB 5KTEH 1CVSC 2NXZC 4M02A 1A2YB 1OTUC 1U3HB 3HMXA 4M7KL 1QHOA 4G5ZL 5LG1A 2GUOA 1OAKH 4O2EA 2DDQL 4PJCF 3QXAA 5IMMB 4UV4L 4S1QL 1QFOA 2GK2A 4HUUB 3TJHC 4U1LB 2AV7A 3D48R 1EZVX 4GQ9L 1R24A 2QADD 4Y5VB 3GRWL 5D2NB 1EERB 1MCNA 1RZJC 1KB5L 5L9DL 4LSPL 5I1DA 3BVNA 4EQ3A 2HWZL 3T0BA 3NCMA 3OKMA 4RRPA 3W39B 3QDMD 4LAQH 3FT4A 2FSEB 2DMKA 4YJZL 4NC2B 3BZEA 1DBBL 1HSBA 1JK8B 5LKNA 5KN5A 5F9WB 4KUZL 3GKWL 3D5OF 3JTSB 5H8DA 4KROC 4XBEL 1FFPB 4WWKB 4MDIA 5I1JH 3ROOB 3FMGH 3O6FD 4A6YH 3K74B 4LCCB 3EDJA 4N5EC 3VD9A 4GMSH 2FBJH 3Q5YA 3C09B 2AV1B 1EJOL 3VWJB 5HYJB 1JZ5A 5DURB 3AREB 5M95B 5SV4A 2EC8A 4FQ1L 4OFDA 4X6EB 3FQUA 4QRTB 4GBXD 3HI1B 5AZ2L 2EC9T 1Z0NA 1KELL 1FL3A 1RI8A 4M4PA 4XAKD 5H35B 5K9KA 3IDYC 5DYOB 2IMNA 2VWEC 4ZFZA 2PXYA 4PRHA 5F7DB 2H2SC 4OGYH 1NBZA 1D5ZB 4LVOC 1QQDB 3HRPA 4F7CA 3GM0A 2BY2A 5D7LD 5GJTH 1QSFD 3BPNB 4F15C 4AH2B 5IHUH 1T2QH 2X1QA 1P7HL 4Q9RH 2W91A 3VWKB 4O4YL 3RVTC 4DTGL 3VFVA 4YLQT 1CL7H 2VDKL 4ERSH 1OAUH 1MIMH 4PBWD 5IR1B 4RIRA 3BDYL 2BVOA 2UZIL 1FYTD 4UMGA 3SGDH 5TGBB 1F6LL 5J1TC 1P7KA 4LPYA 2O26U 4M93B 1C16B 4OCXH 3V8CA 1PZUB 2CDEA 4S2SB 2DKSA 4M8QA 3ZHLA 1MAJA 3QDGE 5ADOL 5IBLC 4AEIH 3VH8G 1S7XA 3PP3H 4GKSB 4U1IA 1LO4L 4L4VB 5I9QB 2FGWH 3T1WA 4LASL 3KJ6L 3UJTH 4NUGL 1S3KL 5GRXG 3WDHA 1G9EA 4XTRC 4ZUUA 4NJ9H 4ZFGL 1U41A 1CFQB 1VFOA 4Y2DB 1XCQA 1S8DA 2DDQH 5D7SH 3EYFB 4UV4H 4S1QH 4EKXA 4KMTH 3HPJA 3GRWH 5KS9B 1W72B 3FOMA 4LSDA 1KB5H 3BE1H 3DVGA 2V5SA 2XZZA 3RIAK 3BIKB 5E8DH 1YYLL 4X5XB 1A3LL 4D0CB 3WEXB 2NW3B 4OI9A 5EZIH 2E3VA 4ODVH 3RWDB 2RQ8A 5CGTA 2H2PC 1JNHA 1DBBH 3OKDA 4XPBL 3D69B 3GKWH 4X6CA 4XBEH 2R39A 4OFIA 4U6HB 2ITCB 3KYKL 5C7XL 4MHHI 3HNSH 4FFYH 4E0RB 3HUJA 4MAYA 1T03L 4NSKA 3PUCA 3D3VB 3IRPX 3H0TB 4HV8B 1EJOH 1RZIA 1DUYA 5T3XL 4JZOB 3WNMA 4FQ1H 3K4AA 4D94A 2EDDA 4HMEA 3MYJA 1ZHLA 2X89A 5KANI 2VLME 1B4JL 1A22B 3O6MH 2VKWA 3MLZL 5AZ2H 1JGLL 1KELH 3ELAT 4Y1AA 2XTJB 15C8H 1E4XL 5IWLA 3U0PB 3B2VL 5DUML 3L7FB 4A6YB 4GOSA 1Z9MA 2LU4A 1NJ9B 5KG9B 1SEQL 5C07E 1RZKL 3RIFF 1U36A 1UKTA 2Z92A 1KCRL 2BSRB 1DSFL 3KNBB 2NY3C 5IB5A 2JCCF 1KLUB 4P4RA 1U8PB 2GCYB 1JTTA 5DZOA 4O4YH 3SKMA 5IK3B 1MCSA 2N1KA 2X9XA 4P2RA 2VDKH 2FO1A 3DWTA 2XWJA 5E5MB 4R97B 3QH3B 2PXYD 2G5RA 4K94L 3NCCB 2UZIH 4V1DB 2ZZUT 1H8SA 3O3UN 2BY1A 3EYSH 3RNQB 4RGOL 1CGWA 2F5BH 4GW1A 5HYQA 4X9HA 1NC2A 3ARFC 4YBQD 4FZ8L 5D1ZA 2ZSVB 5ADOH 1ES0A 1LO4H 4XP9L 5CEZL 5D9SA 3KJ6H 3DVNA 3P4OA 3MV8B 5KSBE 2DLEA 4HWZB 5EO1B 3VXMB 5DR5H 2GSIB 5LJYH 2A73A 1Z3GL 5D7IA 3IFOA 3SKNB 4RMUA 5DQJB 3DHJA 3FT2A 3D85D 1MEXL 2GIYA 4WGVB 4U1SA 4P4KB 5GRJL 5DJ0A 4FQIL 4YDKH 1QSEB 4H1LG 4K3EH 1UJ3B 2MJWA 5EZJA 3BRFA 1YYLH 3QIWC 3PGDA 1KTRL 5DLMH 1A3LH 1YY8B 1OM3L 5DJXB 1JPGB 3GIVA 3L1OH 4LLVB 1ZVSA 2YD6A 1GCFA 4CADB 4X9BA 5DGRA 1BBJB 3I9GH 2I27N 1U8LB 4GRLB 5CBEB 1KB5B 3BKML 3IU3B 4JQXC 5DA0B 1RY7B 1T04A 3GMNA 1UA6L 3KYKH 5D2NE 3TN0A 2AABL 2PUQT 3PV6B 3O2WL 4U0RB 4X7EC 4XNZC 3LEVH 3UTTB 3MLUL 1SYSA 3U6RB 4WGWB 3ARGB 5T3XH 1Z6JT 1T0NA 2X4PB 2GY7B 3GHEL 3MC0A 3U4AA 4MLSA 1WAAE 4HIIB 5E6IC 3MLZH 1JGLH 2P8LB 5GS1A 1E4XH 5HGGS 1ODAA 5EA0L 3W0WD 5DUMH 3ZT6A 5E8OA 3DX9A 5KAQF 2AI0L 3MPCA 1PBYA 3DV6B 1KEML 3IFLL 4HGWB 1RZKH 4ZUVB 1E4XI 1SY6L 3CPLB 4HWUA 5F9DC 1DSFH 3S34L 4L4JA 5HYJE 1JZ8A 4HK0B 3EJZD 1F4WL 2X89D 4YO0A 1CD0A 5HHMD 4QTHB 1WT5A 1ZHNB 1O0VA 4NQCB 4Y1AD 3P9WB 1Y0LA 2P48B 5C0IB 4ZPVA 2FH6A 2NCMA 1RK1A 1GRWA 5MENB 5FK9A 4K94H 5I8EB 3DBXA 2APFA 5F44A 2O5YH 4XX1G 1JHTB 2B1HL 4RGOH 4JKWA 4OD1L 1A1NB 3FCTA 2DF3A 2BDNL 5C0FA 5LCVL 4BQ8A 1ZT1A 3EYQD 5TE6L 2DQEL 3LQAL 4S1RL 1KCKA 1IGJB 2JB6B 4PJAA 4Z76B 5CEZH 3N1PC 5DDHA 3NCYP 3CVHH 4KJQC 4P2RD 3QUZC 4Z77A 2YPKA 2CDFA 3QZWB 3WN5B 3O2DL 3LEYL 1Z3GH 1PG7L 4Z7OF 5GS3A 5HD8C 3TBVA 3NN8A 2FL5B 1MEXH 2QSTA 1NC2D 4O2FB 3H8NA 5GRJH 3L3KB 1F58L 1YMHA 5JHLH 3QUXA 4AK1A 3SDCB 4Z0XB 2P7TB 3LKPB 3O9WA 4L4VE 2NW2A 1YDPB 2BOCA 4UT7L 3QNZB 1FN4B 1IAOA 1RJZB 2BVYA 2HT3D 4X6FA 4AT6B 3QCVL 1BQSA 1AGBB 1GGIH 1R5WB 4PJ8C 5CP7B 3GSNH 1QFUL 2NY2B 4BELD 3GSRA 1D5IH 4M5YL 1EHNA 1JUFA 3B9VA 2W9DL 3K8KA 5DK3A 1UA6H 1CXEA 1TZHB 3S8WA 3SCMD 3VFTA 2CLRB 4BJLA 3MLUH 1NUNB 1FLRL 2FWOB 2QEJA 4NNYA 4GRWF 4M62L 2Y25A 3CUPA 4XZUA 4P5TB 3GHEH 1XIWA 1CGTA 2W92A 1IL1A 1A0QL 3FRPA 5CIPA 4JAMA 1XGTB 3K4DA 1UWXK 4R4NC 2WWMC 1J1XH 3N06B 5B8CB 3TN0D 1VEPA 1KEMH 3AXLA 4H88H 2DMCA 1ADQA 4GUPA 4W6YB 1X4XA 1SY6H 2UUDH 3KLDA 4JG1L 2JJSC 1TJHL 1T4KA 1XGQB 3BD4A 1MLCB 3V5DA 1UWEL 1X5LA 3S34H 4EDWL 2P5EB 3MCKB 1AP2B 4XMKH 1BVKB 3PJSA 1TETH 2L0DA 2PO6A 4OAWA 4HFUH 4LSQL 3AAZB 2V5MA 2XTJE 4F3FA 1JGDB 2WBJA 4TUKH 1SJEB 4NC0B 3RNKB 3IXTA 1IAKB 4KI5E 5SWZA 1T6WA 2CO7B 2J8UE 4OM1L 5IKCB 1P9MC 2AJZA 2BNRD 1I8LA 5F9WC 35C8H 2NZIA 4OD1H 3MACH 3BXNB 2BDNH 4WWKC 5LCVH 3O6KH 3BEVB 3LQAH 4Q9BA 4S1RH 5I2IB 5C3TA 4OM0H 3S35X 4NQDA 1QEWA 4WU5A 3SY0B 3C09C 3CFIC 4PGZA 3UXFA 3VWJC 2BNQB 3RY5A 4ELMB 1NCCL 3AREC 3O2DH 3LEYH 1WC7B 2V2TB 3HR5B 3U48A 5TF1L 3VXSA 3LV3B 4RNRB 1ZA3B 4V1DE 5KVFL 1DBJL 2ICES 1KLGB 4L8BB 2OTPA 5ESAB 5FM5O 3TA3C 3OG6B 3UDWA 2Q87A 1RHHA 1BOGA 3QI9B 3NCEB 2IANA 2X4NA 4R3SA 3R1GL 3QQ4B 1FNEA 2YD9A 2VLKB 3DJ9A 1MJUL 3CVHB 5DK0B 2BCKB 2ZCLL 2DL9A 4P57A 1JZ6A 1IAIL 2RBLA 4UT7H 3MV8E 3ARDD 2VSDA 4NN6C 4LRNL 4FFWC 4Q58C 2IBBA 1ZLWK 3M8OH 3IDGA 3BPNC 4Y5XB 2GYSA 4ZXBB 4F9PC 3MRHB 5I17A 3VWKC 4XWGL 5A40E 2HFEB 4FMKA 1WICA 4PJHB 5DUBB 5EWIL 2W9DH 3QG7L 1EUUA 2BOBA 1NAKL 3UBXA 1FLRH 2SEBB 3C5ZA 4JZJB 4M62H 1YJDL 3ILQD 4G9DB 4M93C 1A0QH 5FXCH 2BZDA 1FVDA 3I6LE 2AEWA 3GSNB 2VITB 5EOTA 2FYYA 2OI9C 3B43A 1FFOB 4K9EL 1MIEH 2FRGP 4TSAH 3VFSB 2I60H 5I9QC 4O51B 1I8MB 5K33A 5DC0A 1X5YA 3U7WH 3BPCB 2BJMH 1FNSH 4Y2DC 3V7AE 5JPMB 3DIFB 4JG1H 2OBGA 1TJHH 5CLWA 5E8NB 1S7QB 1UWEH 3S5LA 4EDWH 1FHGA 4ZTOL 1XIWD 3QDAA 3H7BB 5IEKB 3FKUS 4HIXH 4DUXA 1C12B 3CDYA 5KW9L 4MLIA 4WUKH 4LSQH 5I74B 3HMXL 4MA1B 2H32B 5EFIA 4JDVA 4I0PA 4OM1H 1IGIL 2CUIA 2G2RB 3VFRA 5HI5D 3HS0A 4LSSH 3QB7C 2HT4C 2DJSA 3ARSA 3MSPA 5B21A 4KHTL 1I1AA 5HHVH 1JF1B 4KMLB 2R2EA 3HNVL 3RWGA 5T33L 2OZ4H 5K59E 5C3LD 2HFFB 3QT2A 2WBJD 3VXTB 3LKSA 3ZSTA 3BP5A 3CFDA 4KJYB 5SWZD 5MENE 3B9DA 1XF4A 5TF1H 3IFPA 3LPGA 1DBJH 5HVGB 1LEKA 4R4FL 1CBVL 2XTJC 4ZFFB 5FO7B 1ZEAH 4GKZA 4D8PB 5CD3B 5CP3H 1RK0B 2VQTA 2C3VB 4YFDB 4KI5C 1EDQA 2VE6A 3EDFA 4NQDD 2ARJQ 5FGBC 4GXVH 1LEIA 1DQQA 4JLRA 5L2JB 4EIZC 1N5YL 5EOQL 4HAGA 4LRNH 4WW2F 5FYJU 4QKXB 1IAII 3BYYA 2XWTA 1CDYA 4XWGH 1IGYA 1KCUL 1OPGL 5EWIH 3QG7H 2VL5A 4KZDL 4NBZB 5GJSH 3FB8B 3DI3B 3WIIL 1YEKL 1MWAA 1NAKH 2A9ML 2R8SH 3H6JA 4JE4B 5DJ6B 4HCRA 5ISZD 2HG5A 1VERA 1YJDH 3DTXB 4NDMB 3U0TB 4DN4H 1BGXL 5D2LF 3MRLB 3T1FB 5HY9B 2PN5A 3I50H 1AFVL 4PJ9D 3K3QA 1DTUA 5JA9A 4MJIA 2H6PA 2GITA 3HRZA 1S9KC 5EIIA 4I3SL 3EKCA 4FXKB 3QR2A 4QHMB 4QTIL 2Z91B 3WYRA 4MXWL 4LCIH 4PJGF 1XGRA 3M07A 1NEZB 1FNLA 4MJ2A 4P4KC 3MA7B 5GS0D 4E41B 2NYYC 2AXFB 2X4QB 4OD3L 5KW9H 1MVUA 2DB8A 3HMXH 4QRSA 4BH8A 4YAQA 1G9NH 5J3HD 2VRAA 1HH9A 1JHLH 3O3DB 3WL9B 5T3XE 4LCUA 4DKDC 3NA4A 1JGUL 3S36X 1WZ1H 2YN5A 3BH9A 4KHTH 4ODUB 2P5EE 4JQVA 3DYMA 1MCWW 1NEUA 2B4CH 3QIBC 2BSSB 3SDDB 1BP3B 4U0RC 5EU3B 2Q76A 3PP3K 3TESA 2XWBA 2BC4A 3BD3A 1IC7H 3ARGC 5F6HJ 3NIFE 4NWUL 4I0PD 2Q8AL 4JPVL 2YUZA 3PL6C 2G5BB 5GRYA 1NDGB 1UM6L 3FO9B 5IMOA 5L8JB 1CBVH 1XCTB 4ZUWB 5MEPB 4NQEB 1V7ML 4QO1A 4RMWA 1AD0B 3KG5A 5FKAA 5CGMA 4LLWB 4BKLA 4WFGE 1FC2D 1UEMA 2H45A 4JFFA 1T0MB 1B9ZA 4CBPA 3GMRB 5HYSB 1N5YH 2BNQE 3VA6A 3I75B 3QIUB 1G0YR 2EKJA 4ELME 5AYUL 4K23L 1I8KB 1NUGA 3TBSB 2RIKA 1LK2B 4Z7NF 1QHPA 5B38B 1KG0A 1QBAA 4OCSL 1EFXD 2D3VA 4KZDH 3BQUA 3BIBX 2LTQC 12E8H 4P3WA 2R2BA 2I07B 3ESVF 2R2HA 1YEKH 4JDTH 3WIIH 5CEZE 3L6FB 3RZCA 2IQ9H 5FO9B 2VLKE 1BFOB 3SHSA 5IB4B 3DX8B 1BGXH 2F54B 5GRWA 3DROA 5JNYB 2IPKA 2VXVL 3CZFB 4R7NA 1ETZB 4HKBB 3SO5A 3MV9B 2VQUA 3FO2A 5C71A 4WI4A 1J88A 4GLRI 1XEDA 5SWSB 4JRYB 3KPRA 4BM7A 4I3SH 3PHSA 4PJHE 2X1XR 5CZXC 3T8XA 1JE6A 5HBBA 4OT1L 1XMWA 4MNHA 4BQ9A 2VZTA 1HHKB 2CRIA 4ZODA 4KV5E 3L3GB 2IH1A 3VCLA 3FQWB 2WNGA 2MKWA 3I3EA 2C7UA 3GO1H 5C0JA 1JYXA 1S7RB 3NAAH 4LFHD 2P8MA 2VAAA 4MNQA 3SDCC 2H8PB 1G7IB 3WFZA 4PG2C 2IC2A 4MJID 3UC0L 1N5AA 2KQNA 1RZGA 2AJVL 2NY4B 2Y5EA 1I75A 3VXNB 2ED9A 1KFAL 4M9PA 3EIFA 1UCBH 3LN5A 5CAYB 5TFSL 4L8DA 3RDTD 2KKQA 3WCYA 1L7IL 3CFJB 1CLOL 4PJEA 3BP4A 1NGYA 4ZPTA 2GUOB 1J87A 3BEWB 4X6BA 5DFWH 1UKQA 3QXAB 4PY7A 4NWUH 2P5WB 2Q8AH 4JRXA 4O5LH 5JOFA 1R24B 4JPVH 4FG6C 4MWFA 1YEEL 1JWMA 5C9KA 5HTSA 1WCQA 4OZHA 5IVXA 2W9EH 5I1DB 1AR1C 3PE9A 4RGMB 3BVNB 3UO1H 1V7MH 4ZNCD 4YR6A 5B8CC 3OKMB 2XY2A 1U42A 1DQJA 2HJFA 3N1QC 1VSCA 1H3GA 4OLWH 3FT4B 1HINH 2IMMA 1HSBB 3OTTA 1HZHH 2CIIA 2NY0C 4XP1L 2CUHA 5CD5C 1WTGT 1MCOL 3TZVA 5AYUH 4BZ2L 3FAWA 1Q72L 4C56A 3QYCA 2D0HA 3ARQA 1FV1A 3P0GB 4OZ4A 1Z2KA 4JG0H 4M3KB 2BSTA 1GVIA 3MYZA 4OCSH 4J3VA 5SWQA 5HHXL 4PJCE 1RZKC 4ZD3L 1QG3A 1FH5L 1IEAB 3FQUB 3QAZB 3ZMRA 2ZCKL 4UOJA 3ZSSA 4HBCL 4ORGB 3C60C 5K9KB 3VFPA 3CMGA 25C8H 3CMOL 2VXVH 3BGAA 3J8F7 4ZYKB 4KRPC 4LVNB 4JO4L 4PRHB 1NBZB 1XGYH 1SM3H 1AO7A 4FQLL 5ALBL 3L3DA 5EOCL 4U1KA 4OT1H 4F7CB 1J5OH 3NIGE 3RZCD 3QUMH 1K8DA 4U3HA 1E27A 3L5IA 5E4IA 3IS1X 5I1EL 5L8KB 3CCHA 4YGAB 3QI9C 1J8HA 3P0VL 5A43C 3VFVB 3KPMA 2B8OT 1E6OL 2IAMA 5ELIA 2BVOB 2XI9A 1KXTB 5ACZA 4M6AA 1WWAX 1P7KB 3OR7A 5DJZA 4OI7A 5FB8A 4EQ2A 1YQVH 2J12B 2CDEB 4QRPE 1HKFA 3RAJL 1EPFA 1KFAH 1S7XB 1MCIA 1S9YB 4ZXBC 1A14H 5IB1A 4NHCH 4H8WH 1L7IH 4P46A 4ZUUB 1B0GA 1YYML 4OGAD 5FYJH 3EYOA 1CLOH 3V6ZA 4OQTH 3OZ9L 4E41E 4U6VL 5K9JH 1XCQB 4HAFA 1S8DB 4RMQA 4XP6H 1FLTX 1P53A 3A6BL 4HDIA 3L95B 1XR8B 2N56A 2EICA 2YXMA 2R4RL 3DUUA 3HPJB 4F7TA 1Q0XL 2JIXA 2ICWB 1SYVA 1YEEH 3DVGB 3Q48A 1F4HA 2ZPKH 4MVBD 4APQD 1XH3A 4Y8AA 4LMQI 1IKNA 1CLYL 3OGOE 3WXVL 1OVZA 3JBG7 2F53A 1OT2A 1R3KA 3KLHD 1EO8H 4PLJD 4X6CB 1MAML 4LDOB 4YPGA 2M1KA 4BZ2H 1IM9A 4WU7B 5D6CA 4J3OC 3HUJB 4MAYB 4NSKB 1GSMA 3KPLB 4MA1C 1ADQL 1CCZA 1RZIB 4Z7QF 4MA7L 3ULSB 3TWCH 4L8SC 4RBPH 2XN9A 3KXFA 4JHAH 5C09A 4ZD3H 2E6PA 3MV11 4NQEE 3MYJB 1FH5H 1ZHLB 2E6JA 3MBEB 1OD7A 4HBCH 3VI4F 1ZHKA 4MYWB 5E2UL 2ENSA 4HEPG 4PRPB 2D7OA 4FQJH 4XAKE 3TZVD 1XF1A 3X17A 4WENB 3RGVA 1XF5A 3O41A 2KDGA 3PP4H 2Z92B 2NXYB 3MNZA 4KRNA 3S97C 5ICZA 5IB5B 3VRLE 4MQ7B 1TFHA 2UUDK 1EFQA 1QSFE 3DURB 2K7PA 5I1EH 2R29H 3B6SA 1U8NB 3SKMB 2W0KA 5D7JD 2F54E 3EBAA 3P0VH 4XRCA 1HYSC 4M7ZC 2XWJB 3VMNA 3BPLC 1NCNA 2OSLA 5J6HA 3MV9E 2FLRT 3FTGA 4XB7A 1Y6KR 5TH2A 3VXUA 5EIQA 4Z8FH 4PJEF 1FYTE 5SWSE 3QUMB 4RISL 5E99L 4LVHB 2R1XA 4P2OC 4GW1B 5I16A 4ALAL 3NPSC 4IEFB 5D1ZB 1P4LB 5KSUA 1ES0B 4I9WE 5D9SB 3HAEA 3IKCA 3P4OB 1OLZA 5C86A 1J8HD 1F4YH 1TJIH 5L7XH 1QSZA 2A73B 2ZNXA 2ERJB 2AJ3A 3W9DA 4HWBA 1DQDL 4ENEC 3A6BH 5D7IB 2HJKA 5GGRA 4XVUD 1J1OL 3IFOB 3FT2B 1AQDB 5DRXB 3K2MC 4R6UA 5MI0B 4LHUD 1Q0XH 4L8CA 3RHWF 1ITBB 4TULH 3BN9C 1QLRA 1HI6A 4KI1A 5EZJB 3X3GH 5J8OA 2X2YA 3PGDB 2EO1A 3C6LA 5E2TL 3GIVB 1MCEA 5IP4A 1CLYH 4L4TA 3TIEB 1Q9OA 1OF2A 1G6RA 2BY0A 1BQHG 5FIEA 5FOBA 3RVXC 4CVUA 2Q20A 5CSBA 1OGAA 5CIPH 5GS0L 1AIFA 3MLRL 5HI3D 3WDJA 4M6OL 1EA9C 1MAMH 1Y18A 4PD4K 4XCEA 4XPTH 2CJUH 3GMNB 2A9NL 2JIXD 3OKYA 2NX5A 3WFCL 5L2KD 2NY1B 3HFML 4LSUH 4YDVA 4LCYA 1G7HA 4U7KA 3SKUD 1ADQH 1NGXB 4MA7H 1B6DA 1REIA 3HKFA 1YNTB 1LDSA 5HDBF 5DJ8B 1OHQA 4S10A 2QADC 5F7KC 1PQZA 2MQ0A 2FX7L 4NZRL 3SJVA 2F53D 4YFLI 4G6AD 5GS1B 3RWEB 5E8OB 3DX9B 1BM3L 2VXUL 4IRZL 3PWUA 4HMCA 3SDDC 4PV9B 1HHIB 5JW4Q 4JY4B 2OXGA 1BIIB 1CLZH 5FA3A 3S3SA 2N7AA 3RI5K 2XN9D 2ED8A 1M1SA 1UH3A 5GQBA 5EUKA 1CTNA 3QEQA 4AL8H 4HBQA 1MCFA 3IF1A 4PJIA 4FNLL 4ZPVB 4EDXA 4YEFA 3RL2A 4XCFH 4R2GD 3L3JB 5FK9B 1C5BH 3DBXB 1VFMA 4PRHE 3SDAA 4GBXC 4KAQH 1D5XA 5B39A 4JFZH 3H9SA 4RISH 1G84A 3SKJL 1IZKA 4JY6A 4HZAA 3FCTB 4MMXC 5C0FB 1WIPA 2D0GA 4PJAB 3GMOA 3FQRB 1AY1L 2AEQH 1CDBA 1KIQA 3MJ8B 3JWDC 5ACMA 2DQHH 4LEXL 4Z77B 2YPKB 3EDEA 2CDFB 2YC1B 3SQOL 1QYGL 3WNNA 1I7ZA 1DQDH 5EIVA 1J1OH 1ACYL 1EEZA 1UB5B 3TBVB 3NN8B 1LO2L 4WV1A 3HZKB 3P9LA 4RFEA 5IOPB 5EC2B 5J56B 2VDRL 1F13A 4M7JL 4KTEH 3ROLA 4XPHH 3QUXB 3BD5A 2H26A 4DUVA 5JR1H 4WI3A 1AJ7L 5E2TH 3O9WB 3LN9A 4G8GA 1HOCA 1MWAL 5IM7B 4WCYL 5T1LA 4F7EB 2BOCB 4XNQA 4HCRL 4K7FA 3CSGA 5I1IL 1IAOB 1PSKL 4X4YB 5HVFB 5CGYD 5BS0A 4M43L 1YJDC 3WJLC 3UBXI 1V3JA 3MLRH 4IBLT 3VXRD 3GSRB 1RUKL 1WLHA 3IDNB 1IFHL 1JUFB 4PGCA 3O3AA 2A9NH 2QBWA 2V5TA 4K9EC 2VH5H 1IQWH 3WFCH 1CDHA 3VFTB 3ZDXF 2OL3A 1EHLH 4MJ5B 3LRGA 4NNYB 1DLHB 3BWAA 1TZGH 1DQLH 5EBWA 4CU8A 3CUPB 4XZUB 1NL0H 5FUOL 4L4TD 2XA8H 5HXMA 4DZBA 3U9UA 1IL1B 3I85A 4QOKA 4PJ5A 2NY4C 5TQ2H 1JPFA 2FX7H 5CIPB 3QO1B 3GHBL 1RQ5A 1I1YA 5A2LH 4KKLD 3H9HA 5JOEA 4E9LA 3TIDA 3VMPA 4X6CE 3IDMB 1ZLSL 4IRZH 2NX5D 2FO4B 2DJ4A 3HUJE 1T4KB 3V5DB 3OKLA 3MZTA 4LK4A 2BRRH 4PRIA 4KQ3H 5CWSA 5EC1A 3HCVA 1QKZH 1JZ7A 3IXAA 1JWSA 2DTML 3PJSB 3MCG1 2PO6B 4OF5A 4FNLH 4Y1AE 4KGJA 5DHVA 4ONGH 4F3FB 4BSVB 5IVZA 2EEDA 1OP3K 3IXTB 4XWOD 5JW4M 2JELL 4GRWE 1TVDA 3O6LL 1MQ8A 5INCA 4NKDA 1A6AA 3IU4H 1F2XK 4KDTC 3F5WA 5DT1L 4C83A 4JHWL 1I7TB 1HQRA 1YMMA 5GGRY 1QEWB 4WU5B 4LEXH 4G80B 2WUCL 4P2RE 1NFIA 1OAXL 2X42A 1QYGH 4X6DB 4F2MA 3VXSB 4Y4KB 3QAZC 2MWCA 4PJ7F 4OCRL 1ACYH 4EEEA 2AJUL 3MGOB 2DQIL 2W59A 3W9EA 4M00A 4OKVB 1RHHB 3VXQA 1BOGB 2VDRH 4M7JH 4J3XA 2IANB 4J4PA 4R3SB 5BV7L 4IOIB 1FNEB 4U2YA 2CR6A 5CJOL 4LVNC 3T0AA 3BRGC 2PXYC 3QEUA 2QV2A 1AJ7H 2X40A 1DVFA 1MWAH 2W65A 4WCYH 4GAJL 2OQJB 2FHCA 4HCRH 5I1IH 1PSKH 3ZE0F 4YBQC 2QQQA 1N3NA 3IDGB 5F72S 5BRZA 5D7IE 3JV4B 4G7YL 1K3ZA 5I17B 3U46A 1FZJA 3V6BR 4PD4J 1IFHH 5ACLA 4FFZL 1IC4L 5F1IA 3MLPA 5DD3L 2BOBB 4F7MA 2DWEB 3DMMA 3UBXB 3C5ZB 3OPZH 4G8GD 2ARJA 1BJ1H 2YSSA 1L6XA 1EGJH 3WHXA 4KHXL 3WKNA 2HN7A 5JIKA 1MFCL 2FYYB 4NZUL 1UACH 3QNYA 5F7LB 4OV5A 4UT9L 1LEGA 2J8OA 4LMQE 3ZKMC 1LP9A 5E03A 2YEZA 4PJIF 1FFNB 1F97A 3PGCB 3RPKA 2Z31B 4K3JL 2W07A 4P5MA 1B3JA 4DUWA 1MY7A 5L8LB 1H3WM 3S5LB 1PGRB 5DJCA 4QF1A 3LQZA 4QOKD 4PJ5D 3HI5L 1MRFL 2CLZA 2V2XA 1JYNA 2BVPA 3QXWA 5FYLD 1X7QA 2C3WA 3NGBB 1YN6A 1PG7X 3EHBC 5EFIB 4LLUA 4JFOA 4JDVB 4I0PB 4PJBA 5LXGL 3MXWL 2JELH 1KPVA 3VFRB 2XQBH 3MV7B 2JK5A 3O6LH 5I15L 3HS0B 1NH6A 1CIDA 2VJXA 3DLQR 2IPUG 1PEWA 1I1AB 4D3CH 3L3IA 3QULA 5DT1H 1CN4A 4Y2OA 3RWGB 1KTDB 3VFUA 5B3NA 4MHHG 3T0DA 1BZ7A 1KYOK 1RFDH 3LKSB 5KSVA 3BP5B 4R26H 5LAXA 3CFDB 3RWHA 3CFEA 4JHBA 1OAXH 1QPXA 3EJZC 5E8EA 1XF4B 3QQ3A 3IFPB 1C1EH 1L0QA 3CFKA 4OCRH 2AJUH 3UZVB 5CILH 4CVXA 3VG0L 3WD5L 4GKZB 4NJAH 2ZOKB 5IWLC 1AH1A 5BV7H 2MHAB 1VCAA 2VE6B 1MF2H 1VEOA 1RIHL 1WBYA 5H2BB 5I8KL 3Q6FA 1VKXA 4PJAE 1INQB 1DQQB 2B1AL 5DJYB 5DS8A 3ARBD 3UP1A 1TTFA 4PRNB 5CJ5A 2D4FA 1KENL 3OKOA 4G7YH 1ZXQA 5FCUL 3WFBH 2XWTB 5DRNA 1IGYB 5EU7E 3QCTH 3RWCB 5FF6A 5DD3H 2CDGB 5HHOB 1MWAB 1S78D 4WO4B 4U1JA 1ITCA 1RHFA 4KHXH 4LVHC 2ORBL 4XMPL 1XF3B 1ZT7A 1MFCH 3LSOA 1LO0L 4NZUH 5D1ZC 5BRZD 4D0BA 1XGPA 4XI5D 4HJGB 5J6GB 1MHEA 2H6PB 2GITB 3HRZB 5EIIB 1MQKH 2ZJSL 3ZTNL 4JO2L 3VRIA 2HT3C 3DMMD 4K3JH 1OAYH 3KPPA 4Y19D 1MPAL 1EH9A 1FFRA 4JZNA 5MI0C 2CKBL 4PJXF 4XPFH 2NXZD 1UZ8A 2E9WA 1YEDB 3V0WL 3QQ9D 3MRJA 5E2VH 1CG9B 4QRSB 5IBTL 3OBAA 3TCLB 4BH8B 2R9HC 2VDLL 4YAQB 4I18A 4XVSL 5LXGH 1HXMA 3MXWH 1HH9B 5DXWA 1XAUA 1A4JB 1DUZA 3NFPA 3IDIB 1V3KA 2JLLA 4Y5YA 4FHBD 4LCUB 4FXGA 4O58L 3BH9B 1SJVA 2G75A 2GKIA 4ZO6A 4UINL 2JJVA 4TQEL 2DMBA 2YMXH 2ADIA 4OLZL 3P9MB 3PGFL 1LDPH 1VPOL 5ID0B 3TN0C 2NY1C 3UPAA 3ZDZF 2XWBB 2BC4B 2DI7A 3P11H 4QXWA 5E00A 4L3AA 4KROD 2EE3A 5ETUA 4G6KL 5I66B 3ARTA 5SWZE 5I19L 1G0DA 5J57B 2PKDA 3DXAD 3TNNA 5IMOB 4XHQA 3MRNA 3LCYA 2X6MA 1TTGA 1HQ4A 2FHBA 3HN3A 4JCLA 3SE9L 4OBSA 1BFVL 1RIHH 5FKAB 5I8KH 2ICEB 4JFPA 1KIPA 5HVHC 2J6EA 1WUNT 4HT1L 4JFFB 4NQDE 2B1AH 3VXOA 2A74A 3E6FA 2WINB 3GSOA 4GMTL 5HPMA 8FABA 1PKQA 4OLUL 2NPLX 5E94A 2DQDL 1I85A 1XZ0A 3VXSE 4RGNB 4HEME 5FCUH 1WT5C 4HUXA 5GSRB 3MO1A 5BV7B 5D1QA 1DANT 4XAWH 1YPZF 1KG0B 4HUKB 3A0OA 3SE4A 2BXZA 3BQUB 3F58L 4Q0XL 2IANE 3QO0A 1EBPA 2C4XA 5CEXA 1MCQA 3EOTL 5DRZB 3TYFA 1FGVL 2CLVA 5I1KL 3INUL 1DBAL 3V6OA 2X10A 5C0BA 2ORBH 3QUYA 4RBPK 4XMPH 4YHOH 1J7VR 4R7NB 1OWRM 4HHAA 1QLEL 2JJWA 4KVCH 5DMIL 1FFQA 3FO2B 1HHGA 4DGIL 5A3ID 3F7VA 4OZGA 4YHKL 4BH7A 5ENWA 5IB3A 3KPRB 1KBGL 3TNMA 3D39B 1U58B 3T8XB 1J11A 4JO2H 4MNHB 4TUOA 3LMJL 4DZ8A 3T2NH 2YK1L 2A6KB 3RQ3A 4PJBF 3CLEL 4FQXD 4EI5A 1KPRA 2IH1B 3VCLB 1KCVL 4DKAA 5C0JB 5EU7C 3LD8C 4HUWA 4XTRD 1CICA 1FIEA 2P8MB 2R0ZL 2VAAB 3T09A 3QUXC 1KSRA 4MNQB 4ODTL 3V0WH 4WHYH 2EH8L 3O9WC 5C0GA 3QFJA 4HWBL 1N5AB 2VDLH 3QEGL 4OZIA 6FABL 3ILQC 5IB2B 4K7PH 3MRPB 4UNTA 5E9DA 4D9QD 4WEBL 3FB6A 3MRCA 3K4ZA 2F8VA 2EDOA 3KHQA 4UINH 1RZ8A 3LN5B 3PGFH 5EZLB 4L8DB 1BEYH 1MY5A 2M8XA 3BP4B 1NGYB 1RV6X 3BO8A 3U7AA 5IF0A 4X6BB 1G6RL 4WTZG 5EB9A 4PY7B 3KWWB 1IGCL 1GAFL 4F37K 2APBA 4W81A 2VDOL 4I1NB 1DEEA 2P46B 3OAYK 4G6KH 1XIWC 4JRXB 4TYUA 5GPRA 4CNIA 5I19H 5D6DA 3MLVL 1UVQB 1JWMB 4POZD 1N6QH 1SBSL 1MSPA 4FZEL 4OZHB 5IVXB 3FO0H 1J05B 1TJGL 1FPTL 4YR6B 4LSRH 3T65A 4ZUTA 2VAJA 2FZ3A 4PRAA 3S98A 1DQJB 2OMNA 5DD1L 1A21A 1GL4B 2FB4L 4KK8D 4OF7A 3WUWA 5HI5C 3MLWL 5CSGA 1W8NA 2CIIB 3RIAF 4XVTL 4RAHA 4KKNA 1SVCP 3WIHA 3P77A 4GMTH 4D9LL 5ILTH 2ZUUA 5SV3A 4ETQA 5EU5A 4JDZA 4LDLB 5F7MC 1YEGL 4MQTB 5F88A 1LO3H 4C56B 4JREC 1FV1B 1T5WA 1N2RA 1ZA6A 2MCG1 2YUWA 2BSTB 2WBJC 4NO0B 1IGTA 5SWQB 1DN0B 3F58H 3SQBA 1RULH 4H26A 4RA3A 3NZ8A 1FGVH 5I1KH 5C07A 3T3MF 1A7RL 2AXGA 3VFPB 3MRBB 5KVEL 5ESVA 5BQ7B 1QO3A 1QLEH 1FP5A 4P23B 1CD9B 1TQCB 4DGIH 3KJ4C 2JJUA 1IBGL 1CFSB 2AKRB 3CH1A 2GY5A 3HMWL 1NAMH 3MGAA 2VDQL 4K8RL 1T7WA 5CZVL 1AO7B 2R56L 1KBGH 3I3DA 3O8XD 5CJ8A 2WQRA 3L3DB 5FYKU 4U1KB 1P1ZA 2V5RA 1FGNL 4LARH 3ARFD 3U0WL 1K8DB 4NQXA 2RFXA 3L3OA 3UJIL 4RQQB 4LOUC 1E27B 5H94A 4JFEA 3CLEH 1LO5A 4XVJL 2FH8A 1DR9A 1KCVH 3LY6A 1CE1L 3UDWC 3CCHB 1UWGL 1J8HB 4G7VH 3KPMB 1CGYA 2R0ZH 4ZSOA 5D1XA 2IAMB 4ODTH 4F57L 4P5KA 2EH8H 4AENA 5ACZB 2R0LL 4QYOB 5CEYB 4HWBH 3OR7B 3DHMA 3QEGH 1JCKA 3LEXA 5FB8B 6FABH 1SQ2N 4X8JA 3N1MC 1CFNA 1WGOA 5J9PA 4N5UA 2F74B 4GRMA 2HTLD 3VE0A 2DBLH 4P46B 3NCFB 3IDXL 1B0GB 3ABZA 2EYSA 4XCYB 2VZSA 1TCMA 1A7BA 4WI6A 1A4KA 4HDIB 3C5ZC 2A6JA 3QFJD 4JGUA 1IGCH 1GAFH 5EH1A 3DUUB 2YD1A 4G43B 4Z78B 4F7TB 3EFDL 5DK2A 2YKLH 5GS0C 2JIXB 1SYVB 3MLVH 2HRPL 1A2YA 1QFWH 1U3HA 3HI6L 4FZEH 2J5LC 3ARUA 2HVKB 3BGFB 3ZL4L 2VMFA 2OL3L 3P30H 4DKFL 5J3HC 5DD1H 2FB4H 2B2XH 1QD0A 2ZKHL 2X1OA 5D8JH 1OT1A 4HXBL 5FYLL 2B5IB 5ICXB 3MRGB 3GSVB 1YEFL 3IJYA 1IGFL 3OB0K 1IM9B 1YEGH 4OF0A 1RSFA 2X4TB 3EOYG 1G9ML 1GOFA 4XXDA 2J4WH 4XNUL 3RTQA 4KPHL 1JPSL 3KXFB 5C09B 4I0PC 2HH0H 3RY4A 1FFPA 4DFHA 3Q5TA 2EXYD 2YD4A 1TTUA 1CXLA 1OW0A 4JFFE 3CU1A 1ZHKB 3WSQH 4NN7C 4TNWK 1I1AC 4ZOBA 1RZ7L 1MH5A 4ODBD 4QNPE 3RGVB 2PF6A 4X6EA 1XF5B 4K8RH 3O41B 1QP1A 4RGNE 5CZVH 2VDQH 1YUHA 2R56H 5C0AA 4IRJB 4XMLL 3MNZB 2FDBP 5A2FA 4MAUL 5C2BH 5ICZB 2HT2D 5DYOA 3OF6A 1KXVC 7FABL 5C07D 4XVJH 4IMKA 5F7DA 3BP7B 3MOBL 5EOCJ 3B6SB 1D5ZA 3ZKXC 1RMFL 4N8CL 4KJQD 1UWGH 4XRCB 1ZT4B 4YHZL 2OJZH 5DMKA 1NAMB 2NMSA 4WHTA 4F57H 4JGMA 5GRVL 1MFEH 3FTGB 5TH2B 3CD4A 3VXUB 1R6VA 1K6QL 1NFDB 3KPRE 3L9RA 5I16B 4ZG1A 2QSCH 3EYVA 3QRGL 2IFGA 5JUEL 5IR1A 4ZUSA 5KSUB 3IKCB 5TGBA 2R4SL 5JZ7D 3NCBB 3V95A 1R0AH 4S2SA 2AJ3B 3W9DB 1LQSR 4MNQE 2HJKB 5GGRB 2C3GA 1I9RH 4UILH 3MREA 3VGAC 4L8CB 2HRPH 1QLRB 1WFTA 2JB5H 4WWID 4MX7A 3C6LB 2B7DT 2B39A 2VR9A 4J3WA 1XR9B 1Q9OB 4AEFA 1OF2B 4PJEE 3DETD 5KS9A 5FOBB 4LVEA 5E6ZA 1W72A 3UZQA 4HUVB 2ZKHH 1OGAB 5C2UB 3L7EB 1AIFB 2FD6H 4N0UB 2WWMD 5CSZA 4D0CA 1Y18B 1YEFH 1IGFH 4JRXE 4XCEB 4FQ2L 2NW3A 5IIEA 2OM5A 3RWDA 3P0YH 4LIQL 5E08L 1U3HD 1G9MH 4XNUH 4YDVB 3G04B