4GG6A

Protein complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
182
structure length
180
Chain Sequence
b'DIVADHVASYGVNLYQSYGPSGQYSHEFDGDEEFYVDLERKETVWQLPLFRRFRRFDPQFALTNIAVLKHNLNIVIKRSNSTAATNEVPEVTVFSKSPVTLGQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTFLPSAIYDCKVEHWGLDEPLLKHWEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DQ alpha 1 chain
publication title Biased T Cell Receptor Usage Directed against Human Leukocyte Antigen DQ8-Restricted Gliadin Peptides Is Associated with Celiac Disease
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 38
structure length 180
sequence length 182
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gg6A02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4gg6A01
1P9MC 4P5MB 2GIYA 3SO3B 4KQ3L 2AEPL 2K1MA 3DLQR 4KTDH 3IS0X 1IAIM 4EUPB 1D5IH 5F89B 1AP2B 5I8CA 3O6KH 4NBXB 3QZWG 3MOQA 4UINH 1S5IL 1BFOA 1A2YA 5FO9A 5EC1A 5J8OA 4WHYH 3S7GA 1RMFH 4M4PA 5IM7B 4KZDL 5F1NA 3O45A 4JQIH 1AXTL 1RUAH 3NZHH 4Y2OA 4WEUD 4POUB 4L3EB 5A2LH 3N06B 5IJKA 5JOEA 5A1AA 1I3GL 1RUPH 3ZTNH 3TBSA 3KXFE 5JPNA 4WHYG 1F3DJ 2EDRA 3E6FA 1YZZA 3BAEL 4X4YB 2VXVH 3OR6B 4G6FB 3NA9L 3FRUB 2I9TB 4JEGB 3T0VA 5E24E 5CMAA 1CDYA 4FQXB 1GZQB 1RJLA 1X5IA 4XPAH 2FJFB 3ECBA 4QRSA 1UCTA 3IDNA 3RU8L 4PRIE 1I8MB 2VL5B 4N0CC 2AJYL 2DMBA 3O8XA 1MUJB 3PL6B 3KR3H 3UTTB 4DW2L 4RGNC 5I1CH 5HYJA 3N1PC 1FGVH 3TWCH 2A83A 3D25B 1BECA 4HUUA 3I9GH 4R7NB 5CJ5A 1MCQA 3HTLX 2W9LA 5CEZL 4X6CE 1MLCB 3LQAL 3SGKA 3WIIL 4ZUUB 3MA9H 5EO9B 2CRMA 4XNMB 3SOBH 4YC2B 3UP1A 5GJTL 5CJBA 1TNNA 5GPRA 2BX5A 1A3RH 4IHOB 2BY2A 3MRFB 3U79A 3D3VD 3BUYB 3OKKB 5E03A 3PV6B 3LN4B 4JAMA 2FD6H 2H32B 2DBLH 3CDGA 5C09B 5KSBA 5D7IA 1X5XA 4V2CB 2QSCH 1LE9B 5IW1B 1IGFL 2MKWA 3F7RA 4U0RB 3SKNA 5T3XD 4ODSL 2PYED 5IP4A 3K80A 3S35H 1TXKA 4PP2B 4WFGE 3BH8A 4UIMB 5C0NC 4U1HB 2FHCA 3EYOA 5DVNA 1KIPA 3BDXA 1QP1A 3MRHA 4JGMA 2DWEA 2GSIA 2DDQH 4DZ8B 4F58H 4AENA 2EEBA 3LD8C 3MV7E 1QA9B 3B6SA 3BHBA 3VG0H 3MBED 1GPOL 5D1QD 4KHXH 2E7HA 1KYOK 3BKML 3LKNA 5E2UL 3WS6C 3NIGF 1U8HA 2ATKA 1P69B 3KYAA 1KCSH 1NC2D 4NKMA 4PRPD 4PGDB 4RA0C 1MRDL 5E95B 3ULVH 1HEZB 3AS2A 4RMUA 2BRRL 1JZ3A 4KUZH 4LVHB 2FEDD 1BD2B 2Y36L 5IFJA 5SWQA 1CLZH 3VRJB 1D6EB 1UVQB 1MCLA 3GIVA 1MFAH 1I7ZA 4NJ9H 1MAMH 2LU3A 4U1SA 5GRVL 3OAUL 3MFFB 3U9PL 2IC2A 1TCRA 3H9SD 4MS8C 1HXYB 4MD4A 3WIHA 3SQOH 1EBAA 2AK1H 3KJ6L 5I76A 2YK1H 5HYSB 4D0DB 1SJXA 3HI6L 3O3AA 3T3ME 3IS1X 3F8UB 1DBBL 3HG1B 4YBHA 1INEH 2VDKL 3HC4H 5JHLH 4G6FD 5C0AA 4LNVA 3QIWA 1S78C 1CFNA 4LHUA 2C4FT 1HKLL 3HRZA 4X7TA 5AD0A 3TBTB 2IH1B 1DL7L 5KZCD 1CL7H 1QSFA 4QXGH 1QFWI 3D0LA 1OAUH 1R3JB 2D9CA 2DI7A 3V4PH 3GI8H 2X44D 4L8SC 1CDUA 3QQ3B 3NGBC 3NN8A 5F3HA 1YMMD 2A74B 3L9RA 4EN3A 3H7LA 1L0QA 4JHWH 2E7LC 5JA9A 1K3ZA 1N6VA 4XTRC 1RZKL 4JFED 5C3TA 2WSKA 3U4BL 2LABA 1K6QH 3FO1B 5TDPA 3VXRA 3W5NA 4S1QL 1AHWB 5SX4H 1GHFL 2H1PH 3ZKNC 1XF2B 2JELL 4Y16B 1PG7X 2F19L 5D93B 2QQQA 4FZ8H 1T21A 3BXNB 1I3VA 4CU8A 2GK2A 3QIBD 5I66A 5D6DA 5ACLA 1MHHA 1S7TB 4J3TA 3C2SA 5J11B 2EE6A 3OJDB 3GSVB 4QY8B 2J8UB 4C4KO 1B90A 3EYFA 1XMWA 4X7SL 2IPTH 5FXCH 3MUZ1 5C0CB 3MRJA 1A5FH 4J6RL 3SE8H 3O4OB 5JPMB 2BSSA 4MCYA 4F2MA 1CGXA 2Q7YB 2P1YA 5DD1H 5CFHA 3D9AH 4I8DA 2JJUA 4N68A 1FZJA 1T0MB 2F5BH 5KVEH 2FATL 1QTYT 2DQJL 3D2UA 4KRNA 5KTEH 3RX5A 4HBQA 4RFNB 3T65B 4R2GC 1C5CH 3UC0L 4O02H 3BP5A 3CFBB 2BSRB 1FIGH 1MPAH 4FQHA 3DVNB 4YWGH 3DYOA 5D7IF 5KSBF 1IL1B 1JWMA 2FB4H 5I1EH 3CSBA 1G7MB 5F1IB 3T3PE 1XCTB 4E9LA 1J0JA 4KU1A 1EPFA 3I6LE 3T09A 3VXUE 4LLQA 4JFDD 1PDKA 2VAAA 4FQQB 1TJGL 1CXHA 5JHDB 5EA0L 2X4RA 1PKQA 4X4XB 5EULV 2A6JA 5GS2D 4WUUA 3V9FA 4O2EA 3L3JB 5AUMA 5GGRY 1T1WA 3JTTA 1IC5L 3VFOB 1RIUH 2WBJB 4Y5YB 1MFBH 1AGCB 1A9BA 4NM8H 2VR5A 3DUUA 5J4MA 4YX2H 3C5ZB 4HF5L 4LEXL 1ZLWH 1A7RL 1P53A 1KBGL 3OKNA 5T3ZE 4APQA 3W0WB 4D9LL 2NXYB 1N4XH 1UM5H 3E3QE 5EO1B 4UDUA 2NY0C 2IWGA 3MLRH 1HIML 2H32H 5E2JA 4Y5XA 1IM9A 4ZSOB 1FYTD 4PJCA 2LU4A 1RJZA 4I9WE 1A64A 1ZHKB 3HG1D 1H3GA 2XY2A 1J1XL 3TT3H 2RBLA 2E8YA 1MI5E 1S9XB 1OPGL 1YC8A 3M1BB 2Q87A 4HUKB 3PGDA 4NHUA 4HG4K 2DBJA 4LKXA 5ECJE 3SBWA 2OZ4A 4JFFD 2IG2H 3W82A 3IDJB 1GGTA 2F58H 4JQVC 1DLHB 4V1DE 5LAXA 2I07B 2BNRE 4OF3A 2ITCB 3AREC 3WKMH 5A2KH 3ZHDA 1LDPH 1HKFA 2AXJA 5E8PA 4J1UA 3SDYL 4EQ2A 4NZTL 1BQHG 4P4KC 2I60L 3WS3A 3MODL 2IQAB 5FDYA 5IR1B 1SMAA 4PD4K 4OZ4A 4CMHC 1IQWH 1UA6H 3EHBD 1VKXA 3HI5H 4ODHL 1UKTA 1Q9WB 2NTSP 3LKQA 5DDHA 5C6TL 3HE6B 4HS8L 1BX2A 2N1KA 4XNYH 3VFWA 3HC3H 4L8DA 4PJBA 5CKGA 1FO0H 3EYVA 1PW3A 2J6EA 4RFOL 3OAZH 4Q6IC 5D7KD 5ICYA 4JANA 4PJFE 3NIDE 2I25N 2XXCB 5KS9A 1DBML 2BNQD 5B8CB 2H41A 4CN6A 2ID5A 3ARDD 2XTJB 2IALA 3D48R 3QEQE 1HH6A 3QIUB 1FQ9C 3UAJD 1KV3A 3KPPA 2N7BA 1XIWC 3KLAA 4ONFL 2YD1A 3ARFC 4JG1L 1CLCA 3REVB 3S88H 1R5WB 2X4OA 3GI9L 1YN6A 3GJFH 5F96L 3DO3A 1KN4L 4EBQH 3G6AA 3K74B 5JMOC 3BKJL 2ZSWA 3VFPA 3P9MA 1Z0NA 4YDKH 1HDMB 4ZQKB 1OSPH 3GSRA 2VDRH 5HGHA 1A4JA 5DO2D 4TULH 4Q9CA 4ETYA 2NCMA 3GMNB 3KYKH 1KB9K 4MQSB 1YNKL 1RURH 3O6LL 3MBXH 4IRZL 4PJXE 3DIFA 2X05A 5JHDD 4H25B 2VLLB 3U9UA 4WV1C 25C8L 4XHJC 1FAIH 3D39B 3JSSA 3CFCH 3PABA 3QDGA 1RULL 2GFBB 4W4OC 3F5WA 4NP4L 5ISZE 1WK0A 3KHQA 1HI6B 1QSEA 4YHOH 4CJ0A 2NY2B 1DE4B 1AD0A 2VJXA 3C5ZD 1H5BC 2JCCB 4GRWB 4ERSL 2D2OA 3RY6A 4L29B 4WJ5B 1VFBA 1FGNL 1ZXQA 4GUPA 5E9DE 3OJMB 5DD6B 1HQRA 3B5GA 1N0XL 5BV7L 1BZQK 3KLDA 3EYUL 1YQVL 5F7WC 3UBXI 5I17A 4KY1L 4RQQB 1KJ3L 3FOMB 4Z9KB 4NN7C 4RGMC 2NY6B 4NO2A 1RI8A 2VISB 3UTQB 1VGEL 4UI2A 4XP6L 2R2HB 5ERWA 4N0FB 4QXUH 4WRLA 4UDTB 3VD9A 5JTWA 1TNMA 2ADIB 5D1XA 1OD7A 1CN4A 2HT3D 5GRZA 1U58B 1I1FB 1KULA 1ZS8A 1UG9A 4OCXL 3L3IA 3O3UN 4K3DL 2A6DB 2DLIA 3VFGL 3NIFE 1V3JA 5MEQB 5ICZA 4M3KB 3U46A 2R0ZH 1EH9A 1NGWB 4P2RB 1MCSA 3HE7D 3C60A 3FO2B 2A38A 1AQDA 2VQ1B 4JY6A 5IW6B 3LIZL 4NIKB 3RX7A 4Y1AA 5BJTB 5GRYA 3TT1H 3GEWB 3T1WA 3GMOB 5J1AB 2DIAA 3DX7A 4J23A 1EHLH 1H0DA 4ONGH 2Q8AL 4XNUL 3QDMA 3Q6FA 1S9VB 4WHTB 2PTUA 1X6LA 1FSKC 2HN7B 4O51B 4OLYL 3QNXB 1DVFA 5BMFH 1F2XK 3W39B 4LSDA 1S7RA 4NKDB 3V5DB 1X5JA 1JPGA 5K9QI 4G8EA 4XP1L 1XCQB 4CW1A 3SCMA 3TN0B 1P5VA 3H3PL 4TOYL 5FHBH 5JXEC 4DKAA 4XNZC 4DZBB 4KHTH 3T4AB 4PJBF 1WIPA 4H0GA 1YEEL 1WC7B 4G6ML 4HJJL 3DGCR 3EOYG 1LO2H 4F57L 3FN3A 3O3EB 2X4SA 2XZCL 1KCRH 4NQED 5KS9F 2JF1A 3PWJA 4LLVA 4X7EC 5CCKL 1AI1L 1KJ2A 4D2NA 3RTQB 1E6JH 1A6VH 3MLPA 3LKOA 5GRJH 2A0LD 1ZHBA 4WO4B 1XH3A 4JY4A 2BVQB 3KPLB 1YEHL 5I8EB 3TBWA 4X9FA 1EVUA 2BJMH 3FQNA 3P4MB 2AXFA 2BNUB 2YEZA 1P4LB 1CR9L 1WWBX 3QNZB 3BIKA 4K55A 5HJ3A 3EOAA 4KKNA 3VFUB 4QO1A 3WLBB 3B3IB 1NUFA 4LRIC 4WI5A 4F33A 1YY8A 1L6ZA 1JF6A 1NCNA 1VGKB 1IJ9A 4WNQB 3V95A 2DKUA 3O6FD 5I9QC 2NXZB 3L3DB 4LVOC 5GXBB 1EHXA 2C3XA 3AB0B 4N8CH 4JKPL 4X99B 5DVOA 2H9GA 2IPUG 1U8NA 1JI1A 4UQ3B 2NLJB 3MPCA 1S8DB 1I7RB 4U33A 2IPKB 5L6YL 5CSZB 3C2AH 2JIXA 4TVPL 4HFUL 1QFPA 2WIIB 4F7MB 2WIMA 4X9HA 4JM2B 4JRYB 3QI9B 5D7JA 4GXUM 2CKBA 4YGVA 1YEIH 3V6BR 3QPXH 1NMCC 1URLA 4KZEH 1EIBA 3NPZB 4MSWB 4EDXA 2IAMC 3MUY1 4P3DA 5D9SB 1GGUA 1I75A 1KPUB 2UVFA 2D4DA 2YSSA 4HXAL 2VDNL 4NC1E 4HS6B 4H26B 4NDMA 4KPHL 5F72S 4TVSa 2ZCKH 4M61A 5EG6C 1UB5A 4KMTL 1LD9B 4MAYA 3I6GB 4TRPL 3I84A 3CAFA 1TZHB 4NNPL 1H15A 1WZ1H 4P4RB 3LS4H 2VLJA 2HVKB 3DVGB 4M6OH 5D71L 4Q9RL 2YWYA 2P5WB 4GRLC 5IVZA 4ZG1A 4I2XE 5J7CC 2EYRB 1SVCP 5E99H 4EI5B 3BJLA 3MZTA 3WJJA 3W2DL 4I1NB 1HYSD 5FHAH 2NY5H 4JRXA 3BPOC 2H3NA 4KK6C 2VQTA 4MQTB 2ESVA 3IJYB 4IRSB 1Q38A 2DIBA 4NM4H 3NTCL 5MENE 1MFEH 3TO4D 5C0EA 4GRWH 4EKXA 1N5AA 5DTFA 1VENA 3IU3B 4DGYL 2EIDA 2J4WH 3BN9D 4GG6A 4FFWD 4ZTOL 3GMPA 3ARGD 4JDTL 3SO5A 3DO7B 3CVHB 4QHKI 3OG4B 2GJZB 1D9KC 2W60B 4KQ4H 5CEXB 4PRDB 1DN0B 4OB5L 1JHLL 4OKDA 1A7BA 4LLUB 4OUOA 4MJ6A 1WWCA 4PREB 3BD4A 3RKDC 1U8JB 1VDGA 2NY7H 3QJHB 4CADB 1KLUA 1WZMA 1RZ7H 4AEEA 3HS0A 4OKVB 4WI9A 2XYCA 4MJ2A 2BXYA 2VRAA 3MV9B 3BD3A 5IHUL 2OK0H 5HI5C 2P44B 3N9GL 4D9RE 4N5EC 3VXSE 1X5ZA 5D6CA 1PYWA 4HPOH 2XT1B 1WEJL 4OF0A 3EYSH 4B7LA 3H42H 1D5MA 3NFSL 1NFIA 4WTZG 4KRMB 3V7AG 43C9B 3HA0A 1MCFA 4IM8A 2G5BA 4N90E 5ANME 1QKZL 3ZHKA 1SYSA 3MREA 2DKSA 1BFVL 4R0LC 4G5ZH 5GS1B 4ESKA 3HNVH 3BDYH 4K23L 2DJUA 3MJ9A 1E4XL 5FKAA 3VXPB 3MLTA 4JO1H 3SJVA 3S36X 1NCAL 4I0KA 3H6JA 3UJTL 3ILPB 5FUCE 4NC1C 4G8IB 3RWCB 2UWEB 3RDTA 4LASL 1U95B 1Y18A 4H8WL 5AZ2H 2JB6A 1A1OA 1F6AA 2GK0B 1BLNA 5EU6B 1DTUA 3UX9B 2ZOLA 3S5LG 1U41A 4G7VL 3ARZA 4N1EA 4XCNB 4NN5C 1V7NL 1KCVL 2ICWI 4NQDA 4JFPB 1NPUA 4ODBD 1JK8B 3BWAA 1TITA 3TVMB 5I8OH 2N4IA 4AG4H 2D4FA 4CNIB 2WNGA 1RJYB 1G7QA 3NIGE 4N0UE 4QWWC 1QFOA 3IETB 4M48L 1I8LC 1U3JA 3UBXB 2Z31D 3J8F7 5EUOA 1T1YA 4KXZI 1S3KH 4P5TC 1EMTH 3LB6D 1TDQA 1XR9B 4XP9H 5C70A 4PR5A 5DJ8B 3EOBB 5MI0C 2BSTB 3CH1A 3EBAA 4X5XA 1A7PL 5D2NA 5E00A 1JPSL 1JPFB 1N7ML 3PP3H 2W0LA 5TDOA 2QQNL 3QAZC 4MCZB 4QLRA 1NAMH 2AJUH 4GMTH 2P5WD 1IC7H 1NDMA 4NWUL 1RPQA 2NW3B 2DD8L 3MUGA 1X5FA 4XX1E 3M45A 2OJEA 3HI1B 2ARJA 3BOVA 1AXSB 1RZJC 1T80A 4FXGB 2C1OA 4RGNB 1DQTA 1CD1B 43CAB 3PGFL 2WLZA 2W65B 3I02A 5IF0B 1QR1B 4FTVB 4XPTH 3T77A 1A6WH 1NUDA 4K94L 1WZLA 3WHXB 1Z3GL 2FRGP 3PWLA 2PKDA 5IK3A 3VRIA 3S96B 4HK3N 4M9OA 2H2PD 4U1GB 4YE4H 1KELH 4DVBB 1FYHB 2OR7A 3EJZC 1JRHH 2A77L 1T1ZA 3VD7A 1MJ7L 2M8XA 2FJHB 3LZFL 5A3IC 2QQKL 3R0NA 4YPGB 1L6XA 1LEKA 4XC1H 1HINH 3L3HA 2FEEL 4QRRB 1VSCA 5J0BA 5DVMA 2OQJA 4H20H 1NCWL 3MGOB 4O58L 4M7KL 1P6AB 5HHQA 3RVTD 1G7PA 5CZXD 2QJDA 4N8VA 2X4QB 1DEEB 1HILB 2XZAH 4ZFFB 1IGCH 5FUCC 2NY3B 4H0IA 3RVWC 3R8QA 3FQRB 1K8DB 4XAWH 2K3TA 4HJ0D 4YR6B 1FE8L 4KMLB 1FNGA 4U6HA 1CBVL 4PJAB 3V0AC 4RISL 4BYHA 4FQIL 1DQLL 4TSAH 1EEUA 4NQVA 4J4PA 3RNQA 3G5VA 2AXGB 3D0VA 4OLXH 1DSFL 4MDIA 2J7LA 4I3GA 4Z7VA 5AG8A 5J06A 5E8OA 5DLMH 1A7OL 3L7EA 3D3VA 3RPKA 2H8PA 3KXFB 4HWBA 4YEEA 3PG2A 4RWYL 2Z92A 2H6PA 5C86A 4FOMA 5TE6H 3TBVB 5D7IE 5KSBE 4OCMC 1OT2A 4XAKD 1MWAA 3IFOB 5FFLA 3FO9B 4FQ2H 2PYEA 5DHVB 1V5JA 4DFIA 1KG0A 1QRNE 4HC1H 1BWMA 4E0RA 3MNZA 3IKCA 4JO4H 2CLZA 2PW1B 3JWDH 1I85A 1FLRL 3IFPA 4PRIB 4Z7UA 3TYFB 4JFYA 4TUOA 4OLEA 2SEBA 3S37H 4Y0GA 1ZLUK 2FX7H 2EIZA 5LKNA 3WUWG 1A7NH 4AEHH 3GNMH 3MBEA 2GUOA 5D1QA 3LEVH 3TYGL 4DKDC 1DR9A 4N0YL 1CFTB 4UTAH 1P2CA 3GSNH 3O9WC 2KBGA 4UILL 4X6CB 5I0ZA 1JGUH 3KPSD 1P1ZA 5KVMC 1JV5A 2DYPD 1HSAA 2DAVA 4CVXB 4HGWB 5IFAL 1ZKAA 4M6ML 4ZO6A 2Q3ZA 5HGGS 3WNNA 5F6IC 1YNTA 3A0OA 4L8SB 3RJQB 2OLDA 3PHSA 2J88L 4BSJA 4P23C 1VEMA 3QUXC 4JZNA 4GAGL 3EO9L 4ZOAA 1T66D 3H9SA 4BH7B 5HGBA 2EYSA 4MDJB 2BMKB 5DGRA 5B4MD 3RUGF 5F7HA 2EXYC 5DA4A 1UB6A 1XT5A 4FQ1L 2CLRB 3DMMD 1QLRA 4OZIA 3QRFM 1NUNB 2QTEA 1GGBH 1XZ0A 2FYYA 3GIZH 1A3LL 3CCHB 4PJ8C 3VCLB 5DXWA 5C0AE 3MV7B 2WV3A 4LGPB 1N8ZB 4RDQF 2YPKA 3L6FB 3IDYC 1R0AL 3HC0B 2WMPA 3QUMH 2JTDA 4QHKJ 4A6YH 4YHYC 3OX8B 1G9NL 4PRNB 1MRFH 3B43A 4X0KA 4XCEB 4NGHL 4X98A 3NBNA 15C8H 1K5NB 2X4NA 1B6DA 3KWWB 2NY3D 3PJSA 4FQCH 1BZ7A 2AKRB 3ZYIA 3V6FB 5JA8B 5I1IL 4GBXC 4PGZA 3MLXL 1EGJL 5LCVL 4JFEA 1YNLH 4RNRB 4PJDF 4R2GB 1Q9KB 2W9DH 1B4RA 5D1ZB 2XG4A 5AZEH 1YEFL 3HLAB 4JDZB 4GRMB 4XP5L 4NT6A 3X11B 4LCIH 3RX8A 3OF6D 1HSBA 4U6VH 1NBVH 1P84J 3JZ7A 2WW8A 3QIBA 2W91A 1CGSH 4XVTH 4OTXH 2JJSA 3DETD 2D03L 5E08L 5A2FA 4C54A 3VU2A 4X80L 1GJIA 2GTWA 2O61A 1T04A 4RBPH 4PJIB 1JGEA 4ZUVB 2EE2A 4OIIH 4FZEL 3RVUD 5FYLH 2W0KA 3CNKA 1RUQH 4QOKA 1PLGL 5DFWH 1JHTA 3RVXC 4JHAH 4JPKH 4ETQB 5D70H 1B6UA 1ZA6A 4MJ4A 1J8HE 4NRZB 1BBDL 3H9YA 1KTLB 1YYLL 2CDEA 3KHOA 3RL2B 5C07A 4NKIH 5IVXF 2X4TB 4U1LB 1ORSB 1DQDH 3STZB 1S5HA 1TZGH 3QDJB 5LQBL 2ADFH 1IC1A 4KTYA 5IMLA 1JMXA 1T2QL 4OGXH 4QTIL 2AXHA 2ICWB 4L8CA 4KWUA 5CUSL 2AW2A 2V2WB 1JI2A 4HXBL 1A1MB 1OLLA 1KXVC 1VFAB 4JGJA 5CP7B 3DSFL 3ZO0A 2IADB 2ICWJ 4R96A 1NC4A 1TJIH 3LSOB 1U93A 1WAAA 4X7DC 4PJHB 4O5LL 4ZUTA 1CE1L 1JP5A 5SX5K 4Z7UF 2RGSA 3LS5L 4XP4H 1PKQE 1TCMA 4NHCL 4OF6A 1MEXH 1PFCA 1FVDB 3FT3B 4U3XA 3TIEA 3O2DH 4PJ7A 4ODWA 4OZHF 4QKXB 3DROA 5LWYL 2BHYA 2YOCA 1MCPL 4BQCA 2AS5M 3ULVD 3CXHJ 1P4IH 4ISVA 3LH2L 4HHAB 1RHHB 2EEDA 2R2EB 4M7JL 5EFIA 4JRWA 2J8HA 1J05A 4P4KB 5DJ2A 1QFWM 2DWDB 3IVKA 1EZVX 1U8PA 2EDOA 2F53A 1Z5LB 2GSGB 1F45A 1S9WA 4RMRA 2R4RL 2PO6D 4WY7L 4TPRL 3AXLB 2Q6WA 3VJ6B 3MO1B 4UV4H 1XGPA 4HPYH 2CJUH 1CI5A 3CSYB 4YBQC 5ADPL 4Q2ZB 2V17H 4HIJB 2EC9U 1DBJH 2VLRD 1XGTA 4QRTA 4Z95L 3VXMA 5KSVB 1DBAL 2QQLH 4QGTA 3GK8L 4K3JH 3FONB 1I3RB 1Z2KA 4JFFA 3MRKA 5E6IC 1QBMH 1U8QB 1T1XB 2JJTA 3LPGA 3RHWK 3R0MA 4AIZA 1MVUB 3IXAB 1NEZB 4BK5A 2E9JA 3JWNC 1XIWB 1NKOA 3ARFB 4XI5C 1F8TH 3EYQD 5FV2A 1Q72L 4GKOA 3BZEB 5FCUH 5F3BB 4KI5D 4LRNL 4E41E 5HVFB 1N6QL 4LKCA 5JUEH 3LN9A 3HAEH 3I6KB 4HLZH 4LOUD 3OXSB 5I1JH 4HIXL 4BUGA 5C0IB 5MEPA 4Z7WA 3RWFB 3VI4F 3LEYH 2Q8BH 3A6BH 5EBMA 1ACZA 3C08H 4YUEL 1HZHL 2D9QB 3HAEG 5IT2L 3RI5K 4PJBE 3FB5B 3RGVD 5DT1L 3HUJA 1YN7B 2C9AA 3DJ9A 4M1GH 1FFQA 4WV1B 4XC3L 3KPRE 4WUKL 2BNQA 2ZOKA 5KS9E 2PETA 4L4TD 3MYZA 2BVYA 2PR4L 1FORL 3ARDA 1ZA3B 4MAUL 3WN5B 4NUGL 5BRZD 4JFQA 2YMXL 4JO2H 3R06B 3QHFL 1MI5B 5TE7H 3S34L 4JQXC 1MHPL 3BPCB 1QQDB 2KQMA 1EFXB 4W4NA 1XF5B 9CGTA 3Q0HA 1UKQA 2XWBA 3QDJD 4ZS7H 1H5BB 5ID0B 3NZ8B 1JZ2A 1SBBA 3UJJH 2CDGA 3V6ZA 3U6RA 4V1DB 1EEQA 2VXQH 4YGAB 5F7MC 3ET9F 2BNRB 2ZUXA 3N1GC 1CLOH 4TN9A 1KPVA 4G80B 4KTEH 1OGAD 4PJ5D 5FM5M 4NZRL 3TPUB 2FJGB 4DKFL 3RWGA 1CVRA 1IAKB 2F54E 3ZDZF 3WJLA 5DWUH 2C1PB 5TQ0H 4APQC 4ELKA 5L2JA 1W72B 3PUCA 1FNEA 2VN7A 2FGWH 2DM3A 5ALCH 5I19H 3MRRB 1HK6A 2YPLE 4TTDC 5HDQL 5J3HD 3B9KC 4NZUL 4LSSH 2GTZA 5GHWL 3TJEH 5EH1A 4JJ5A 4P3WA 1IE5A 3GMRB 5C3LD 3T1FA 2IBZY 1MFDH 5EWIH 5I75C 4PJFB 2XQYG 5JLZB 5EZIL 1WAAF 4HIHB 1UFUA 4GSDH 2XFXA 2WINA 3IAQA 4XVJH 4MJID 2FR4B 4P2QE 4U6TA 2CR6A 5CILL 1L7IH 5CZVH 1A4KB 5IB5B 1RZKC 5JQ6L 3LV3B 5EOTA 2HWZH 1OOAA 1NFKA 2VH5H 2XXMB 2VIRA 1KN2L 1TZIB 3KYOA 4HK3J 4MQXC 2B1AH 3WV0A 4YHIB 3M07A 3O11B 2CLVB 3MROA 5HHXL 1OGTA 3LRSA 1RK0A 3RA7H 4LP4A 2VDOL 1K2DA 2XOTA 4YHKH 1M05A 3BGFC 5FM4A 5IB1B 4HGMA 4GMSH 3KPOB 5I1HH 5IMMB 5MHSE 1IVLA 4G3YL 1AFVL 4U05A 2XRAL 3PWPD 2AJVH 3LKRA 3WKNA 2OL3B 1DEDA 4PJ9C 5GS0L 2Y4SA 2EIEA 2EICA 4NO3A 5C6PB 5EOQH 3CSGA 2Y5TB 2DQEL 5GGSA 5F1OB 4PJXB 2BCKA 3D87B 3ZKSD 4FABH 2XI9A 1N0LA 3JWOL 5L2KA 4X6EB 1I4FB 4XNZB 2B20A 3CFEB 1D6VH 4F3FB 4TQEH 1KLFA 4NO0D 3BT2H 5DD3H 5ISZB 4MXVF 1R5IA 1EAPB 3HE7A 3WIFB 1S7VA 5HI4C 1DFBH 1VEPA 5JW5A 2AABL 5FCSH 1B88A 3VMPA 4UB0H 3V5KA 1HOCB 3U7WH 4Y1AE 4UT9L 3EO1A 3QR2A 1EO8L 5E9DB 4HIIA 3QUYC 3GSXA 3MRNB 1A9EB 1VERA 3IDMB 4RRPA 5DZNA 5KANI 2NY1C 4ENED 4XBEL 3I2CL 5T5NF 2X4PA 4AY0A 4OLZL 5JXAH 2P5EE 4S1RH 2AQ3A 5T1LD 3BRFA 1ZAGA 4LSQL 1Q8MA 1XGQB 4M1DH 4LEOB 2AGJH 1NFDA 3QUZD 4H1LB 4YAQA 5C8JB 2R0LL 5GGTL 4Z76A 5EN2A 2D7TL 4ZFOA 1OTUD 4XXCC 5I9QB 5CSBA 4I0PB 1INQB 3HFML 3P0VH 5F7DA 2BDNH 4CVWA 1CE6B 4NQEA 4YNYA 1JHKL 4IOIA 2VDMH 1E27A 5HYIA 1CK0L 1FL6B 1ERNA 3IDXH 1QNZH 4WTWA 2GT9A 2PXYD 4MD0A 4NNXA 5F1KC 3LN5A 3IFNL 4R4ND 3QG6A 3MCLL 5GSVB 5JOPD 5DHYB 3TCXA 4MHHI 4LLWA 4OV5B 3RWJA 3MZGB 2VN4A 1WZKA 1NMCB 3FZUC 2R1YB 3KYMB 3E0GA 4G8FA 3DXAD 5J6GB 3SY0B 1TQCC 3FQTA 3MOAL 1LK2A 4XWOC 5ITFB 5GQBA 5T3ZH 5IQ9A 3OZ9H 3O6FA 3OKMB 4WW1A 5JW4Q 4OAWA 1AGEB 5ESQB 3BGMA 4K2UL 4LCCB 5FA4B 1NCCH 2R9HD 3IU4H 1NGPH 4FG6C 2HMID 1YMHA 4LPUA 4GRLB 4LPTA 1HCFX 2WZPD 5HDLA 1QLFB 1DCLA 2HTLC 3UDWC 5CD3B 1E6OH 5IROA 1ADQA 3VWKC 4GW1A 2VLKA 4HKBA 3WNOA 4ZD3L 1CF8L 4ORGA 1U92B 4QHUA 1UJTA 3UZQA 5FB8B 3GGWB 1WBXB 4YXLH 5HVHC 2DIJA 1G6RB 4LSRL 1K4CA 2VDQL 3TNMA 3TZVC 1DANU 5FK9B 5I15H 3ZL4L 1KB5B 3FHQA 2X5PA 1IFHL 3VXNA 3O81A 1H3VA 4M43H 4YHPB 4PRHB 1W72H 2JJWA 4WDIA 1MNUL 1R3IH 4NOFA 2H26A 3SDDD 1MCDA 4HK0B 1NAKL 1K8IB 5MERA 1OAZH 4LPYA 2VLJE 2E8ZA 2W59A 3FQWA 5E5MB 4ODTH 1CICC 4Y4FD 3MLYH 1YEJL 1FH5H 4WGWB 2Z9TA 2IAND 3MC0A 5D7LD 4X9IA 4C83A 6FABL 3SKMA 3TA3D 2ZUVA 2MQ3A 3V0WH 4TSCL 2VABB 3TO4A 8CGTA 2AAVA 5DC9B 2Y25A 3E8UL 1K4DB 2ARJQ 3MUHL 4DGVH 1RFDH 5IBLD 4AH2B 2P8PA 3ES6A 4P99A 5DD0H 4U49A 3BP6A 2YD5A 3GMMA 1T6WA 2HT2C 5T1KD 2KQNA 3QYCA 4KV5F 2UYLB 1ZT7A 3MXWH 2B2XH 4HWZA 3JV4A 4K7PH 1UH4A 4LCWA 4PGCA 1KEML 3TIDB 3BMWA 3QULA 4R0LB 4QYOB 4MX7A 1FL5A 5F7EL 5C0BE 4KUCD 7FABH 4YDLC 5F7LB 3LEXB 5GZND 1EA9C 4I0PD 1P5UA 3KLSA 2UZIH 1CXKA 5HHME 3BQUD 3EFFB 1AC6A 3ZE1F 5HPOA 5JNYB 1M71B 1JGDA 1NFDF 3MV8B 4NN5B 5C0FB 1T0NB 5BV7C 1FFOA 2DQUH 3V5HA 4AEIL 3SGDI 4I2XB 1W0YT 2O5YH 3D85A 5DK0B 3PIQB 1EO7A 4J8RA 3MNVB 1CXLA 1BVKA 1DUYB 5I1LB 1QPPA 4ZPVA 1RZ8B 4IRJC 3RWIB 5MENB 4HV8A 5KVDH 4Y4KD 4P5TB 3SGJA 3BKYL 3BP7B 2EYTB 3FT2B 3MMEA 1QFUH 5MI0B 3SDXA 3V4UL 4ZUWA 5BZWB 5TF0A 12E8L 1BVZA 1IMHC 5GZOC 2AK4D 1ZHNA 1C1EL 4X5WB 2HAZA 3VE0B 2AV7A 1JNLH 4PRAA 2XKNB 4P9HH 5IB4B 5F7YC 2R0WL 4WEMB 5I30H 3NCJL 3QAZB 5I1GH 5F7KC 4P46C 1I1AA 4TVPE 1PZ5A 1Q9OB 2XQBL 5CJQL 5TQ2H 4G6JL 5I8KH 1PX4A 2WUCH 5ID1A 4OLWL 5BO1L 4U6XA 3DRTB 4JB9L 4NQDE 5GS3A 4WI7A 3SDCB 2H2SC 4Y88A 4HWUA 3UXFA 5HXMA 3P9LB 5C0GB 2PCPA 2WWKO 5FO7A 2Z31A 2YUXA 2BOBA 3VXSB 4DN3L 3R1GL 3O2WL 4RAUB 2APXA 4Y4HD 5EU4A 1S7UB 4DN4H 1WFNA 5FGCE 1JWSA 3MGAA 4YHLH 5CINL 3FFCD 4YHZH 5EZOL 3L5HA 2G60H 4PRHD 3FOLA 1DQJB 4FFYL 3SE4C 4JM4H 1FNHA 4BZ1L 5D2NE 3GM0A 5DUPL 5ANMB 3NCYS 4QRQA 3RHWF 3WSQL 5IVNA 5I74B 4MMXC 3RUGE 3CUPB 3QO1A 4R7DA 5H37H 1UQSB 1NGXA 5CHNB 3D18B 2AV1B 3CFIC 3MA7B 3X14A 5CEYB 1SEBA 4G6AD 4HCRH 4OCRL 1BQSA 5IG7A 3Q1SH 2E6JA 2VR9A 3AAZB 4UU9A 5D2LA 2A6KA 5DJXA 2XZQL 1TJHL 4UINL 2VC2H 4GQ9H 5H37G 4Z7OF 2BSED 4J3OC 3P11L 2YBRB 4LF3B 2CMRL 4ZXBC 4J3WA 1YEGL 3ARVA 1C8PA 1J9CT 1U8MB 4ZNCD 3A6CH 3RI5F 2WAHA 3MNWA 3RWEB 1RMFL 4N0UB 3VGAC 4Z77B 3SDAA 5C9KA 2IBZX 1JGLH 2A2QT 1CCZA 3BGAA 2DQFA 3WFEH 3ORJA 4HS3B 3VFMB 3ZSSA 4PV8A 4QHMB 2OR8A 3MRCA 1KJVA 5CGYC 4NYLA 4PJDE 4ZDHB 1RUPL 3ZTNL 4WWKB 2R23A 4R26L 5DRXB 1T7XA 3B9EA 4JPVH 1MHCA 4YH6A 2XN9A 5FV1L 4M6AA 3O3DB 1P7KB 5I2IA 3MV8D 2VDLL 3RIAK 5SV3A 3WFHB 4YBLB 1NCDH 4Z18A 5I8CB 4YHMH 1I8IA 5FUZL 1J87A 2HLAA 3CPLA 1TVDA 1ZTXH 1Q9LA 1P84K 4FS0A 3ZYZA 5FDWA 4LPCA 5IMKB 3LHPL 4XBPA 3DI2B 2DQGH 5F1NB 3V4VL 1JTPA 1XGUA 5IVXE 1OAQH 3T0BA 5JORA 2APBA 3ARBA 4OFDA 2WBWB 5DURD 5DJCA 4JCMA 3D3VE 1DBKL 3ZT6A 3S9DB 5IGXL 3I3EA 3TBSB 5JPNB 5F9OL 3S3JA 3E6FB 3E1F1 2JB5H 5I73C 5IMOB 4IDJH 3T0EE 1U3HC 1LP9A 4ZAKD 4LPXA 5DRWA 4MNQD 4LL9A 1OARH 4F7CA 3H3KA 3PQYE 4GS7B 3MX0A 1RJLB 1YYML 1JIBA 3P30L 4QRSB 1NLDH 3IDNB 1AJ7L 3OG6B 5H94A 3VFTA 1KTDB 3AMLA 4Z7UE 5DRZA 3FT4A 1Z9LA 3CXDL 1W0VB 3O8XB 3GJEB 4ZO9A 4N8VG 3O4LD 4LSTH 4XGZA 2DMKA 4FQJH 4OZHE 5IB3A 3W9DB 2DQDL 3PWNB 1LEIB 4P57B 1SBSH 1V3LA 5A2JH 2FH6A 3KPSA 2EDKA 5ILTL 5I1KH 1PQZB 5AYUH 2AERT 3ARRA 4UZGA 1GAFH 4PRPE 2FDBP 3IDYB 5SWSD 3G5XA 3S4SG 3T0DA 4Z6AT 1DLFL 4HWBH 3BO8B 1N2RA 2A6IA 1FZKA 1M7IB 4JG0H 1QO3A 5KSAC 1A22B 2DQCL 4XCFL 4P9MH 1KLGB 3U0TA 3CDGB 1FFNA 3T2NL 2MJWA 5D7IB 5KSBB 4OCWL 3H9SE 4RFEA 3ZSTA 4HZLB 1XGYH 4NC2B 1EEYA 3SKNB 1QRNB 2HRPH 2V7HA 5HHOA 5INCA 2ICEB 4B41A 1CGTA 2Z93A 2P43B 3FQXA 1BFTA 4KH2A 4UT6H 3UMTA 5DUML 3KPQA 3EYOB 4JN2A 1T5XA 5DGQA 1IGYB 1KPRA 2AEWA 3MRHB 2DWEB 2M1KA 1MFCL 4AENB 4U1JA 4Y2DD 5DJYA 5B39G 2ILLA 1NGQL 2HFGL 3BVNA 1H3TA 3RGHA 3RWHA 4F9LA 3S3SA 1JPST 4X8JA 3Q48A 4OJFH 3QCVH 5T1MA 1AGDA 3LPFA 3QRGL 3U4EA 2IH3A 5JHLL 2ARWA 5GSRA 3N85H 4H8WC 2ATKB 1F90H 2W9EH 1YMME 5L9DL 4C56A 3NABL 1ZK9A 3VI4E 2FO4A 4M00A 3QPQD 4M6NL 3RPIB 4I4WB 3U2SA 1W0WA 3T0EC 2VLMD 1X4ZA 5SWQB 1J5OL 4GLRI 3Q5YA 5BVPH 4EVNA 3MRIA 1I7ZB 3UO1L 1Y6NR 3OF6A 5JZ7D 2ZUUA 2KKQA 5E2VL 2VITA 1N3NA 5JIPA 3GO1H 4U1SB 5F97E 1H9VA 2IF7A 2NR6D 4MD4B 2AJ3A 3RZWA 2NZ9D 5I76B 1RZIB 3HNSH 4OLUH 1IGML 1MCHA 3MBEC 5EZJB 4G9DA 5D1QC 5D8JH 3O3AB 4HWEH 1JWUA 3D69B 2FX8H 3HZMB 3ELAT 3VMOA 4GXVH 1E0OB 4QRUB 5C0AB 5DJDB 1BEYH 4P48A 3QIWB 3WFDH 4KKAC 4LHUB 4W6YB 3SO3C 3U1SL 3ZDZE 3HRZB 1EX0A 4FP8H 3D0LB 4ZFZB 1C08A 5H35A 2GQHA 5HHNA 4IEFB 4JFZH 4XNXL 2E9IA 2C4FU 4M7LT 2G9HA 3NN8B 5F3HB 5GISH 4PJEA 4L9LC 5HYJD 3L9RB 4EN3B 2GY7B 4MXQD 4K94C 1MSPA 5D5MF 4OFYD 3X17A 2DS4A 1T5WA 1S7XA 4JFDE 3G5YB 1JNNL 1WAAE 4X6FA 1RHFA 4PB0H 5T33H 3S35X 1AH1A 5FYJD 1UJ3C 1TENA 3WXVH 5I66B 1HYRC 1MHHB 3MJGX 1UT9A 1Y0LA 3H8NA 4F7EB 2IQ9L 2AJZA 1BGXH 1A7QL 3MRJB 4NKQB 4UT7H 5JIKA 1GVIA 3IFLL 4FFZH 3MGTA 2VYRE 2BSSB 2HVJA 5JR1H 4F2MB 1CG9B 2AEIT 3NAAL 4KKBD 1LO3L 2JE8A 3SGEI 2MCPH 3K8MA 5DJ6A 5LBSL 2ERJC 3MYJA 1HXMB 1MCKA 4NM8L 2PO6A 4PJGA 4PFEA 5E7FA 1FYTE 2VE6A 2X70A 3D2UB 4OGYL 2J12B 3HG1E 1WCBA 4KVNL 3K2MC 1N4XL 4M7ZB 2VLRA 1KC5L 1BM3H 1X6NA 2QSQA 1OAXH 1OM3L 2R39A 3QIBC 3IXTB 3OBAA 3I75A 3UEZA 4MXVE 4H5SA 4JFFE 3M8OL 1X7QA 5E94A 1YEKH 2EE3A 3LAFA 4LLQB 4RGOH 4D0CA 4QHNA 3PE9A 1CD9B 2X4RB 1PKQB 4CAGA 1AQKH 3P2TA 4CKVX 1G9EA 3LKSB 3OHXA 4UQ2B 5DYOA 1QEWA 4O2EB 1T1WB 3JTTB 3M17A 2IGFL 4KDTA 1PGRB 1T7VA 1BVLA 3ILQC 3G9AB 3MCKA 5I6XB 5ITBL 5KVGH 1GOHA 3DUUB 3IJHB 3KS0J 4HD9A 5CAYB 1NMAH 2KZWA 5JW4N 4AK1A 5ABDE 2ADJA 3OKNB 4APQB 4JZOA 2X10A 3MQIA 3U83A 1CGYA 1LO0L 3PHQB 1TFHA 3F7QA 2ZCLH 4JZJC 4RMTA 3RGVA 4PJAF 4G42A 4X4ME 1JGVH 3RVVD 2GW5A 5D7KE 4KKCD 3B9KB 4S1DD 4DWHA 2BNQE 3CMOL 4RX4A 4LQFL 1IGIL 4OD1L 5BRZA 4R4FH 1WBYB 5BZDA 5FYLD 4L1HA 3RAJL 2DI9A 3QIWD 4LHUD 4L3EA 3ZTJH 3PGDB 5I75B 1QSFD 4LKXB 1EBPA 2JLLA 2NX5D 4ZOEA 2R15A 1FCGA 2NW2B 3OR6A 3VXOB 3Q6GH 2B39A 4A2LA 1ZMYA 1IT9H 5LAXB 5F7NC 1KNOB 1OGAA 1GGCH 4NBZB 2QR0A 3ZTJG 3LRGA 1UEMA 2DJSA 2JK5A 2AEPH 4FQXA 4KQ3H 3LY6A 1LE5B 4ZPTB 5E8PB 2FJFA 3AM8A 4JKMA 5I1AA 3VXRD 1I8MA 4IJ3C 4KROB 5E2TL 1HHJA 3OGCA 5F6HJ 3MRLB 3N0PB 5JHDE 3BGFB 3PL6A 3UTTA 1S5IH 1TTFA 1I9JL 3SE9L 4OZ4B 4PBWD 3SGDH 5DI8B 1O7SA 1LGVA 1KEGL 4ZTPL 4JO3L 4PLKC 4WU5A 3LKQB 3O0RL 5DDHB 4PJ9B 2CO6B 4KZDH 1BX2B 1UADC 3MBXL 4R7NA 4Z8FL 1IEHA 1AXTH 4PJBB 1QLEL 3EYVB 1MLCA 5ICYB 4ZUUA 5EO9A 3CFCL 5KS9B 1DQMH 1KF9B 1NDGB 2PYFB 1A1NA 1JJUA 5EDXA 3KPPB 3NA9H 3DUHA 5DMYA 3KLAB 2YRZA 2X42A 4IHOA 3OKKA 2FBJL 3ULVF 4ODVL 2X4OB 4WW2F 5MP6L 1YN6B 5DJ0B 1CLYL 2EKJA 2H32A 1AHWC 3H9HA 3RU8H 3VFSA 3G6AB 2OR9L 2AJYH 3QSKB 5EUKB 3KDMA 4DW2H 2ZSWB 2HFEA 3P9MB 5D93C 3VFPB 4X4ZA 5GIRA 3GSRB 4Z0BL 2F54B 2BZDA 5J11C 5J56B 1A4JB 3SE3C 4PYHA 4HMCA 2OL3L 4KGLA 1X9QA 5E2WL 5CEZH 3U9UB 3LQAH 1QA9A 1SQ2N 3CSPA 3WIIH 4HEPG 4WUUD 2N56A 3PABB 3C6LD 2FWOB 5GJTH 3LOWA 1R24B 3F5WB 4JHZA 3T04D 3DNKA 1Y6MR 3UAJC 1K85A 5IHBA 4NUJB 2UY7A 4KV5E 3L95A 3QXUA 3E2HC 3I50L 4RFNC 3FN0L 2CRZA 1HEZA 1UGNA 2MSPA 3DRQB 1VFBB 3SKJL 5DC0A 1FC2D 1UVQA 1IKFL 4KI5F 1IGFH 3L5IA 4P3CL 1F4YL 4ODSH 1IM9D 5LVEA 1KGCD 4F8QA 3ZYJA 4S11A 5DO2C 1ZV5A 2R2CA 4WI8A 4XTRD 2OBGA 3MFFA 1FO0A 3ZE1E 3MRDA 1KCUL 1L4IA 3QQNA 1EJ6A 3QUZA 1HXYA 1NFDE 1SEQL 2D31A 1PZUB 3ZKND 1DQQA 5E7BA 4BQ8A 1U2CA 4R97C 5HYSA 4D0DA 4PJIF 2WLYA 4I77L 1PKOA 3G5ZB 4G9FD 1GPOH 1REIA 4XVUC 2VKXA 3BKMH 2VQUA 4ELMF 5E2UH 3DX9B 2WBJC 1RD6A 4S0TD 4OQTL 3GJFA 2YD9A 3O3BA 3L3IB 2PXYA 3C5ZC 2IH1A 1MRDH 2V6HA 5ICZB 1R3JA 3CX2A 2BRRH 4NQTA 3U46B 2X7LA 4W6XB 4KROD 3WL9B 5F7UA 2Y36H 1T20B 3KS0H 1L7TL 1Q1JL 3OKLA 3VA6A 1CXIA 3C60B 2A74A 3O2VL 4JY6B 4Y1AB 3DXAA 1ZOXA 3VXQB 2O5XL 3OAUH 2HJLB 3DX7B 3U9PH 1H0DB 2UUDK 1MJUL 4Z7NF 3OV6A 3KJ6H 1N26A 1OW0C 3KPMB 4AJ0A 4PJHF 5HHVL 4ALAL 5L7XL 3HI6H 3BXNA 1S7RB 4M02A 1S7TA 1JPGB 4RRPG 1DBBH 3SKOB 1CFQA 4FQLL 2VDKH 2HT3C 5C0CA 1FPTL 4WFFD 4TNVF 1J18A 4FQPA 1HKLH 3HR5A 3TGXA 2QADD 1DL7H 1EVTC 2V2XB 3G9VA 5DS8A 2ICCA 2DJ4A 1JF5A 3HE7C 1MOEA 1KJ2B 2A9ML 4F15B 5IOPA 5ACZA 4IS6B 2EDTA 3HMXL 4YJZL 1G6RL 1RZKH 1BJMA 1GRWA 4JFXA 3U4BH 1G1YA 1I1RA 3TBWB 4S1QH 1KB5L 1GHFH 3DVNA 2YEZB 3VGDA 1E4XI 1IL1A 1LILA 2JELH 3BIKB 5TF1L 3SDDA 4YDLB 2F19H 4C58B 4CVZA 4IDLA 5B8CC 3EOAB 1G9MH 3H7BA 3AC0A 5H8DA 3QDGD 1ZLVK 4JREC 3V6OE 4F33B 3VA2C 5CJXA 5GRXG 4XXDA 5CBAB 1FP5A 4Z5RB 1YY8B 4X7SH 1QSED 2BRQA 1VPOL 4Z7OE 4J6RH 4PLNC 1V05A 2IANA 5D7LA 1UWXK 1S9KC 3TA3A 1T2JA 5CS7A 5BV7B 2E3VA 4I5BB 1U8NB 3VFOA 4Y5YA 1AGCA 5FHAL 2JIXB 2FATH 1MRCL 3MLUL 3F7VB 2DQJH 3ARED 3GBML 5IIEB 5D72L 4LNRA 4IRJB 4BKLB 4ZUSA 2GJJA 3P77A 3W0WA 2V7NA 1KOAA 2CKBB 5EO1A 4X8XA 4YGVB 1J1PL 5SWZD 3CVIL 4J3XA 5EBGA 5ESVA 2ZWLT 2A9NH 1SVZA 4EDXB 3ULSA 1TVBA 3UYPA 4P3DB 3VD3A 1AKJA 3VW3L 1X5LA 1ZSDA 3UTPD 1FN4A 5D1XD 3CC5B 4NDMB 1V7ML 1WGOA 4P46B 2YPVL 1TJGH 2I26N 4M61B 2OMBA 3O6FC 4MAYB 1H15B 2VLJB 4YXHL 3VXUD 3IDJA 4NWTL 1DLHA 2X89A 1IC5H 2I07A 4HH8A 4MNGA 5KVFL 2DQIL 1RVFL 3EOTL 2ITCA 5I0DA 2H3NB 1F4XL 4PD4J 3BD5A 4HF5H 4LEXH 2B0SL 2ZG1A 5C7XL 1A7RH 2KH2B 1BJ1H 1KBGH 5JDJA 1X5HA 3R4DA 4U1MA 4D9LH 5C0EB 4NCC1 1N5AB 3HMWH 4GLRH 5SV4A 1U42A 2NY6C 3QDMD 3OQ3B 1HIMH 5GS0C 2V9RA 1IBGL 1DVFD 2HP4A 4F7TA 3QXDB 3GMPB 5B3JF 4JCLA 2J3SA 1Q9WA 1PX3A 3HE6A 5T3ZD 3P73A 4LDEB 4JKWA 1J1XH 5C0BB 2XZZA 3SCMD 3H0TA 1OPGH 1SYVB 3VD5A 4F7PA 5BS0D 4XHJD 3V6OC 1KLUB 4OFIA 1DANT 4JRYE 1U0QA 2DMCA 4AIOA 1AE6L 3QIUA 3WBDA 4Y19D 2Z35B 4PV9B 3REVA 4Y4HA 5D6CB 5DF0A 3SDYH 3GSUA 4NZTH 2YRLA 1JYNA 2I60H 3FFCA 3ESUF 1FV1B 4O2CB 3UROR 1D5MB 3ABZA 3MODH 5HPMB 1II4E 2O5ZL 3ARGC 3VGAB 2RHEA 4ZQKA 4QXWA 4PB9H 4EOWL 4ODHH 5C6TH 2V5YA 1KENL 3LQZB 4HS8H 5DMIL 3GMNA 4AQOA 2P5WE 4H25A 2VLLA 1E4WH 4RFOH 3QQ4B 4AYFA 4OSUL 3SJVB 1J86A 3RZCD 3D39A 3RNKA 1DBMH 4B7IA 2B4CL 3RDTB 3B4NA 1Y18B 1HI6A 2JB6B 3RTQC 3MLSL 4KVCL 1D7FA 1A1OB 4ONFH 1F6AB 1BLNB 3GSWB 1JYWA 4JG1H 2ZOLB 1TETL 4XPBL 4K9EL 3TJHD 3TP4A 2Y5EA 1G7IA 3GI9H 5DC4B 5F96H 4ONHA 4NQDB 1KN4H 4JY5L 3SGEH 4X6DA 5D7JD 3BWAB 3QEQD 2MHAA 5DD6A 3BKJH 3QT2A 5DJZA 1G7QB 3OAYK 2P24A 2YN3A 5B38B 3HZVB 3GMQA 4R8WL 5EUOB 1T1YB 4EZMA 1HHKA 1BBJA 5GGVY 4RQQA 1YNKH 2OX5A 3O6LH 4IRZH 3FQUA 3CH1B 1E4KC 5IHZA 2NXZC 5JIHA 3QQ9C 4X5XB 25C8H 2GJ6A 5FEBA 1Z9SA 3IDIA 5D2NB 5E00B 1RK1A 3AB0C 4WTZA 1WISA 4N0FA 5TDOB 1RULH 2R29L 2N7AA 4H20L 4NP4H 1AO7D 1ZGLM 1EHNA 4Z0XA 3VH8B 1NDMB 1A21A 3RUGB 4BSVA 3MUGB 2OJEB 2A6DA 4JRXD 1RIHL 5JXED 1YECL 4JM2C 2ESVD 4ERSH 1FGNH 5E8NB 4PYGA 3RIFK 1N0XH 5BV7H 3T77B 3FO2A 4BFGA 1YQVH 1UZ6F 4YIQA 3PWLB 3W5MA 4L3AA 4AL8L 5KJRL 4E5XA 4XZUB 5TPWL 1F58L 3VRIB 4KY1H 1CGVA 1KJ3H 3EUUA 4MA7L 1HWHB 1S9VA 1T1ZB 1MCBA 4NFCA 2HN7A 5EU6E 5CIPB 3QNXA 4PS4H 1IKNC 4XAKE 1VGEH 2XWTB 4XP6H 4MNQA 3EZJB 5D5ME 4PJDB 2WWKT 4IIQA 4OZGF 2OQJB 4OFPA 4EI5C 5HHQB 4BSWA 3TN0A 3GMLA 4YO0B 1FVEB 4OCXH 1SJHB 4K3DH 3QG7L 1WUNT 4DZBA 1WIOA 3VFGH 4IRSC 3T4AA 1MCOL 1WC7A 1QRKA 3O4LA 3O3EA 4U1KB 1FZOA 1T89A 4GG8A 2BVPA 4Q0XL 1F3JB 4U6HB 2VXTL 1ITCA 4NO5A 3CJJA 3LIZH 5LG1A 3L3OB 1NBZA 4WO4A 4LHQB 1KXQE 3KPLA 4NQVB 4NRXA 5I8EA 2H2PC 3RNQB 3C87A 3D0VB 1RIVL 4XNUH 1OB1A 2BNUA 3FJTA 4MDIB 5FYJL 4JDVA 3QNZA 4OLYH 4BH8B 4D9QD 5IVXB 3S97C 1AIFA 3SJVD 2FO1A 1J0KA 3BPNB 4Z7VB 3VFUA 3WLBA 1RQ5A 3CFJA 5E8OB 5EU3B 2YD6A 3RDTD 1X4YA 3D3VB 1EFQA 4OCYL 4PTUB 2H8PB 4XP1H 2C3VA 2Z92B 3FMGL 4I18A 3H3PH 2CH8A 4TOYH 4LLDB 1MWAB 3U36A 1YEEH 2PYEB 1KG0B 4G6MH 4HJJH 3TNNB 4HJ0C 1OP9A 4X99A 4F57H 2RFXB 2ZPKL 2XZCH 2CLZB 3L7FA 5IB2B 5CCKH 4F8TA 1AI1H 2VERN 4M1CD 2IPKA 2V5TA 3QUKA 4U2ZA 4Z7UB 2WIIA 4TUOB 2XNAA 4Y2DA 4YDIH 2SEBB 5GS1C 1VEOA 1YEHH 4U6YB 3QI9A 5KG9A 4KK9D 4OZHB 3IJSA 3MBEB 5D1QB 4MGXA 4GT7A 2YKLL 1CR9H 4MSWA 4X6DF 3U4AA 5IWLA 5D9SA 2J2ZA 1UWGL 1HNFA 5DSCA 1RU9L 1P1ZB 1NC2B 1MH5A 1KPUA 1IM3B 1D9KD 4PRPB 2EDHA 2I9LA 1JFQL 2EH8H 3PDOA 2BC4A 4H26A 5DK3A 4WTXA 5FM8A 1OTTC 1LD9A 1YPZA 3I6GA 3PV7A 4UNUA 5D7SL 1YNTB 4PJAE 2J5LC 4L4VD 1MF2L 4JN1L 5FYJU 5DMGD 3UTSD 2CK2A 5IW3A 5TDNB 3DVGA 4L1DA 3AY4C 4JKPH 3TVMC 1OD9A 4L9LB 2BXZA 4JZNB 4L5FL 2EYRA 3H9SB 5HGBB 2EYSB 5GRVK 4TVPH 4HFUH 1ZLSL 3WE6B 5HI5D 5C08A 5FGBC 1M1SA 4KC3B 1UB6B 1N6UA 1KIQA 3WIHL 1OWRM 4LLMA 4OZIB 4P0DA 1I7TB 1UJ3B 3EDJA 1MCEA 3IU3A 4I3SL 1XZ0B 2FYYB 5E8EA 3CVHA 1RZGB 2GJZA 2W60A 4P2CG 4PRDA 5KZCB 4MB4A 4HXAH 2VDNH 4KPHH 4LLUA 3GDBA 4X0KB 3SKUD 3B2UC 4HC1A 3WUWA 2ENYA 3RFZC 4TRPH 4X98B 2R0KL 2AEQL 4NNPH 4CADA 4MD5A 3F65A 2ERJB 1BZ7B 1YMMB 2WUBL 4HEME 3VWJD 5D71H 4G8GD 5C0RL 4Q9RH 4OKVA 1PG7L 4ODUB 1EV2E 4OFYA 1T66C 3PWVB 4JFEB 4K8RD 1L0YA 4K7FB 5GGVL 3W2DH 5B4MC 2EDWA 5AYQA 5CZKA 3G6JF 3QWOA 4NPYA 2OMNA 3DMMC 3NTCH 4J4PD 5JW3L 4U1GC 5F8RC 1HSBB 3QIBB 3MRMB 4PP1C 3GSNA 4DGYH 2C26A 4EIZC 2GTWB 4ZTOH 2O61B 4JDTH 1T04B 3S37X 2DN7A 4LLYA 3V7MA 3GRWL 3ULVE 3L5WA 2MQCA 1S7SB 5I18L 4OB5H 4H88L 1JHLH 1M6OA 1JHTB 3OKEB 4AT6B 2NY3C 2CDEB 1P4IL 5BQ7B 5CIPH 5C07B 1NANI 4G8IA 4OCNC 2P48B 2UWEA 4PJGE 1U95A 1S5HB 2FECL 3AFLA 4RDQG 1E4JA 4MWFB 1GH7A 5IHUH 2C4XA 1M7XA 4MA3B 3N9GH 2K7PA 3P3YA 4L8CB 2FL5A 3WDJA 2VLRE 4JZJB 2DLHA 1WEJH 5A16B 4WEBL 4UV4L 5FF6A 3K0WA 4PG2C 1U8OA 3C09C 2VZOA 1HHIB 4JFDB 1DBJL 1S7WB 1U93B 2Z4QA 3DBXA 3QUMA 4A6YA 3RVUC 4ZMAT 4XMPL 1LO5B 2EEAA 1QKZH 3K4ZA 5GRUL 1BFVH 1CQYA 5BVJA 5DJ8A 3TIEB 4K23H 3EW3B 2BSTA 4YPJA 4KI5E 1E4XH 3WD5H 1R3KA 2OP4L 5A3ID 1NCAH 4ISVB 3UJTH 3BZ4B 1KXTB 1R5VA 1AGBB 4LASH 1FFRA 4H8WH 1NUGA 5EFIB 3MLWL 2XKSA 2D7NA 1J05B 4G7VH 5DJ2B 4IJ3B 4OZFH 3IVKB 4PJIE 4OD2B 1V7NH 4FXGA 1U8PB 1IQDB 2F53B 2G2RB 3VGFA 1YPZF 1KCVH 1S9WB 3RVWD 1JNJA 1FYTB 43CAA 2Q6WB 4ELME 1CZ8L 4X6BB 2P7TA 4L4TE 5F70A 1QR1A 4FTVA 4M48H 4OI9A 4Q74A 3ARXA 5EIIB 5BRZE 4URTB 1XGTB 4QRTB 3VXMB 4OZFG 2YA0A 1UXWB 1S7QB 3VFNB 3MACL 1ZHLA 4WVRA 2WP3O 1A14L 3S96A 3QDJE 4DEPC 2NNAA 3MRKB 4JFFB 2QHRL 2NX5A 5DR5L 2OZ4L 1UENA 1A7PH 1CFSA 4AIZB 4YPGA 4WW2C 3B5HA 1JPSH 4O2FA 1N7MH 2QQNH 4QRRA 1OGAE 4PJ5E 2ZUQC 3ZT7A 2MNUA 1J0ZA 3BZDA 2CR3A 3MGOA 1F13A 4NWUH 1JMZA 2DD8H 2HJFA 4Z7NE 2X4QA 2EZ0D 4HKJB 1HILA 1NMBL 2PW2A 4EUPH 4PJHE 2R8SL 2EC8A 1K8DA 5HYEA 1IAOA 3QA3B 3PGFH 5MEPB 1OAKL 3P4NA 3ETBF 4CDGC 4K94H 4QCIA 3HCVB 1Z3GH 3INUL 5DA0B 4EUPG 1F3DH 5I19L 3O2DA 3UYOD 4QOKD 2BNQB 1BQLL 1T3FA 1KTRL 2XPGA 2J6EL 2A77H 2EDNA 4POYA 1MJ7H 3ARDB 4U31A 1YEDA 2IFFL 4MJIE 1FFPA 3LZFH 4JFQB 4MYWB 2QQKH 4LIQL 3TPKA 2VL4A 4GFTB 2C3WA 1I1YA 3WS6A 1CFVH 3HPJA 3O9WD 5HDBF 5L8LB 1G6VK 4YDJA 5C07D 2KZ1B 2D0HA 3EYQC 4PIRF 1WWWX 4JFOB 3KXFA 3E2HB 1NCWH 4O58H 4M7KH 4U1NB 4KI5C 5C71A 5D1ZC 4L4JA 3JUYA 3V6ZB 3TBVA 3U6RB 1L7IL 5EC2B 1LMKA 3FO9A 5KOMC 4NQSA 4LOUC 2ORBL 1B2WL 4P23D 5CP3H 4UBDD 3PWPE 1FE8H 1CDJA 4HIEA 4ELKB 5L2JB 4PRIA 5DMKB 1NC4D 1CBVH 1FNEB 4RISH 4CMMB 1DUZA 3RGVC 4FQIH 1DQLH 4XPHL 2X1PA 4R97B 2AJVL 2F8OA 1GZPA 3C6LA 1DSFH 3IYLW 2AJXL 3O6ML 4NRYB 3T1FB 1LK3L 4XNQA 4X6CA 5TE4L 3U0WL 1BP3B 3MLZL 1A7OH 2DL2A 1MCJA 3S98A 4XBGB 1H8OA 3BW9B 3HAEA 4RWYH 2WINB 5E6ZA 3BH9B 3MRBA 4RZCA 2F53D 1MY7A 3BJ91 5EOTB 1UYWL 3X13A 1C12B 5I16B 3RIFF 2FHBA 2CGRL 2E7LA 2OJZL 1P7QD 3WNKA 1PSKL 3MROB 5ENWB 3BEWB 1XF4A 2C3HA 1RK0B 2GI7A 4MDJA 2BMKA 1K2DB 3VXMD 2CLRA 3OWEA 4M93B 1F11A 4G9FA 3LKRB 3CMGA 3CDYA 4L3CB 3TYGH 1GYAA 4N0YH 2CK0H 3BISA 3CCHA 4EXPX 3VCLA 2BCKB 4UILH 2F74A 3GHBL 4OBRA 5L2KB 1N8ZA 3L6FA 3U7YL 5IFAH 3OX8A 1Z6JT 4FNLL 4M6MH 5JOPE 2CIIB 1J88A 3GSQA 5GS2H 1BHGA 4R6UA 1R5IB 3HE7B 1S7VB 4FRWA 5B3JE 2J88H 5JW5B 3V6FA 3QNYB 2G75A 4GAGH 3EO9H 3DXAE 1Q9KA 4R3SA 3EO1B 2LV4A 4HIIB 1GCFA 4YQXL 3GSXB 4JDZA 3CLFL 4GRMA 2PF6A 4FQ1H 1QG3A 1QSVA 2X4PB 4JREB 4AMKL 4EXKA 3QFJD 2ZG3A 3T4YA 1NFDB 4LBEA 3QEHA 5T1DL 4YAQB 1TQBB 1UXSA 1EXUB 1C16A 4Z76B 1ETZB 5EN2B 5HSFA 4ZFOB 2E6PA 1R0AH 3GM8A 1G9NH 3ULUD 5HYSG 3IU4L 4NGHH 4NQEB 4LMQE 4YNYB 4D3CL 2X1WL 4IOIB 2Q86B 2QLVB 1E27B 1EAJA 4B5EA 2GT9B 5I1IH 4MD0B 3STZA 1KJ2L 3MLXH 1EGJH 5LCVH 4NQXB 3E3QC 3QG6B 3BP4A 4JJHA 3T0XA 3IRPX 3VFRA 1OF2A 1YEFH 1YDPB 1IEBA 1JF1A 3OXRB 4ENEC 1A1MA 4XP5H 2WK2A 3P4OA 3QWRD 2E27L 5CP7A 3EDKA 5TGBA 3WN5C 1N64L 3FQTB 2D03H 4NCC2 5E08H 5CEZD 3LDBC 3QUZC 5IBUG 4X80H 3LSOA 1LK2B 5EO0B 2ZJSL 5F93C 1RSFA 3O6FB 1GGYA 1FRGL 1OTUC 4WW1B 4FZEH 4H0HB 5DQDL 2IANE 3EKCA 5D7LE 4UV7L 1NCBL 5ETUA 1PLGH 4EDWL 3AVEA 1FVDA 3FT3A 5E6ID 3BRGC 3MRPB 1BBDH 5AWNL 3REWB 2VZ3A 1YYLH 1CTNA 3P4LA 4MB3A 1WWAX 4NZDA 5B3NA 1F6FB 3DGGB 2DLFL 3WO4B 3AREA 2PN5A 2R2EA 1R3LB 4DUWA 5LQBH 4HKBB 1T2QH 4QTIH 1WFTA 2E7BA 4XH2B 5SWZA 4S2SA 5CUSH 1ZLUH 2XA8L 5DD5L 1GC1L 4G43A 2GSGA 3JUZA 2CKBL 4HXBH 4PRBB 2OSLB 2DLEA 3TNMB 3VJ6A 3MO1A 3DSFH 3UTOA 3FO0L 3GB7B 3WDHA 4PJCF 1FC1A 1CS6A 5KSVA 2ZNWA 4O5LH 1CE1H 1UM6H 2EECA 4GAYB 3LS5H 4WDIB 5L2KD 4Q6IA 2FLBT 4K07A 1I3RA 4NHCH 1P4BL 3VXUA 4BM7A 2R9HC 2HMIC 3FQWB 1B9ZA 3BUTA 4M9PA 5LWYH 1MCPH 2W1NA 2MTPA 3IXAA 1BPVA 4XWGL 3W9EB 1UZ6E 1XIWA 2BVOA 1X4XA 3LH2H 3ARFA 3ZE2F 4C83B 3NCYP 4JR9L 4M7JH 3TO4B 3EDDA 2E6QA 3PGCA 3I6KA 4PY8I 2CXKA 3MRQA 3ES6B 3B8YA 2R4RH 2AK4E 1T4KA 3ARGB 5CD5D 4OZGE 3GMMB 4WY7H 4TPRH 3TV3L 5C0IA 3L1OL 1ZT7B 4HWZB 4B53A 4LCWB 2Q1EA 5ADPH 1XR8A 1QBAA 3TC9A 1KT2A 1G0YR 4X9GA 1EUUA 4Z95H 2X40A 1DBAH 3SDDC 1YN7A 2D7MA 2P46B 3LCYA 2BFVL 3ZMRA 4WV1A 5BS0A 1JNLL 3GK8H 4OCLC 5C0DA 2HA1A 4P9HL 5GGQL 1ZA3A 3CIQA 4MNHA 4W4OA 4Y4FC 1MI5A 2D0FA 4Y19A 1ED3B 1Q0YL 1YY9D 4P2OD 1KFAL 3BPCA 1QQDA 4ZYKA 4I0CC 1JGDB 1XF5A 4QHLA 1Q72H 4KDWA 2VZVA 1GGIH 5E8DL 2FCBA 1H5BA 4N9GB 3EFDL 4LRNH 3U0PB 1N6QH 4XB7A 3QCUL 4V1DA 3FFCE 5IBLC 3D85B 5MEOA 3HR6A 1QBLL 4PRHE 35C8L 4G80A 4DFHA 1BVKB 3OJVC 3TPUA 5FKPA 5IUSA 1G7HA 4ZPVB 5F88B 3S36L 4HIXH 2A1WL 1B4JL 5GJSL 4HV8B 4OT1L 3OMZA 4E41D 5I71B 4YFLF 1W72A 4RA3A 1VFMA 4YHLL 3AS1A 5L8JB 5DFVC 2B1HL 3BE1L 2G60L 4YUEH 1HZHH 5IT2H 3MMEB 1UZ8A 5GZNC 4ZUWB 5DT1H 4OQ1A 4OGAD 3RZCA 3F6LA 4I0PC 4DTGL 4XC3H 5FO8A 2AV7B 2R2BB 2V5RA 4M62L 4WUKH 1AR2A 3MJ9L 4PRAB 32C2A 2DRUA 2NYYD 4ZO7A 2VR4A 4Q9QL 2PR4H 1FORH 2FX9L 4MAUH 3W11D 4NUGH 3GMRA 2YMXH 3BQUC 3CU1A 1GOFA 4JVUA 3QHFH 1WTLA 1PZ5B 3S34H 2MQ0A 1MIEL 1ORQA 1MHPH 1X44A 2VTFA 4MLSA 4PJFA 5KOVC 4NKOA 5DRNA 1SMOA 4HIHA 5ID1B 2EDBA 2VLKD 1AR1D 4U6XB 5F21B 1T7WA 2L4OA 3QEQA 4X6DE 1O5DT 3E6HA 2RAMA 2PCPB 5FO7B 2Z31B 4NZRH 2BOBB 1GXEA 4DKFH 4GH7B 2VC2L 3W81A 4Y4KC 2CLVA 3O11A 3ROLA 2DM7A 3Q5OA 3FB7A 1JWSB 1FL3A 1AGFA 4KRPD 3CH8A 5SX5H 4GAJL 5IB1A 1VHPA 4KJYB 4OI8A 2FNBA 3HNTL 4XPFL 5HDQH 1JGLL 3MV8E 4NZUH 4LCCC 3QO0B 4K7PX 4QRPD 4QRQB 5GHWH 5BXFA 4M03A 3V7AE 1AO7A 4KJPD 4PJXA 2I24N 5HD8C 5FUOL 3HZKB 5EZIH 5JXEA 1RZFL 2CUIA 2HLFD 4WCYL 4X6EA 1HN1A 2K9UA 5ISZA 3FAXA 1SEBB 5IESL 1UC6A 1EAPA 2WWMD 5CILH 4XMKL 3WIFA 5CLWA 3IT8D 4UU9B 1D5ZA 1FNAA 5JQ6H 1U91A 4LSUL 2A6KB 5DJXB 4F9PA 1KN2H 1G0XA 1HOCA 2L7JA 1NL0L 4LCWD 5HHXH 1WSST 2VDOH 5E9DA 2DM4A 2HFTA 3MNWB 4LSVL 2RJMA 1A9EA 3IDMA 3N1MC 1OLZA 1U6AL 4G3YH 1AFVH 3SDAB 4GKSB 2XRAH 2DQFB 4BZ2H 1WITA 5GS0H 2HTKD 4ZFGL 1KJVB 3MXVL 4NYLB 5F9WC 3K8KA 4C55A 4YFEA 1CL7I 2DQEH 2R23B 1OAYL 4LPVA 2XV6B 4C57C 3G6JE 1MHCB 4EJ1C 3JWOH 1OL0A 5I2IB 1QFWH 2F15A 5H2BA 4MLIA 4ZNEE 4G6AC 3O4LE 4HT1L 5HHPB 1G7JA 1CE6A 1CU4L 3D85D 4MMZC 1EJOL 1EZVY 5M95B 1T03L 2AABH 4HDIB 1I8IB 3MJ8B 4XVSL 1M7DB 1VADA 5SX4I 3CPLB 3UPRA 4K8RL 3WNPA 1Q9LB 2NY4D 4JLRB 1B0RB 3VWKD 4UT9H 3C8KB 5FDWB 5GSVA 3TLRA 1B0GA 2QEJA 3MTRA 4XBPB 1CXEA 1FIEA 4J3SA 5SWSE 5K9KB 3WFBL 5EOCL 1RY7B 4RCAA 4Y89A 4P5KB 3KYMA 1XGUB 2IAMA 2LVCA 3I2CH 2BOCB 3CLEL 4OLZH 3TZVD 4RMSA 5JORB 4LSQH 1I1AD 3QXTA 5ITFA 1IAMA 5LXGL 1U8LA 3ZDXF 5GGTH 4HWBL 2D7TH 1AGEA 5ESQA 2J5LB 4HCRA 1LP9B 2P5ED 5D5MB 3HFMH 4POZD 4R4BA 1EHAA 3IDUA 4AIXA 1WIUA 1MWAL 5T3XL 4F7CB 2EDFA 3ZE0F 4GRLA 1JHKH 3K3QA 1CK0H 5H94B 3GKWL 5DRZB 4P49A 3NCBB 4PGJA 3FT4B 3IFNH 3MCLH 3WNLA 4XGZB 2H45A 3BIAX 3MOBL 3WDIA 5HTSA 1UEYA 1KJMA 4M8QA 3Q5TA 2W0FA 2HT4D 3KPSB 4MQ7A 3MOAH 1D9KA 5KSUB 2DYPB 4I48A 4QXTA 3QZWB 5EB9A 4Q7DA 2EH7L 2VDPL 1NGZB 4YHPA 3G5XB 1ZVSA 4QTHA 4WI2A 1NLBL 2BVUA 2ZZUT 2VLME 1YPZE 4L4VA 4ZAKC 3UTSA 2A6IB 4NQCD 1QO3B 4IIQC 1T83C 4K2UH 3TFKD 4IMKC 3SDCC 4LDLB 5AAWA 2VXSL 4UUJA 2HG5A 1FFNB 1N59A 3WFCL 1IC4L 3WHE0 4RFEB 1KSRA 3A67L 1BOGA 1EEYB 4ZD3H 4W6WB 2V7HB 1CF8H 2VABA 3DMMB 4XPGL 3KYNA 1S9YA 2Z93B 2ZSVA 1J0IA 3FQXB 1JVKA 3HZYB 4G6KL 4TSBL 1QUNA 3KPQB 4AH2A 4LSRH 1T5XB 1KPRB 3SDAD 2D7OA 1YA5A 2VDQH 4LCUA 4PY8J 4GG6F 5I74C 3ZL4H 5DJYB 3NOIA 5J89A 2L7UA 4TUJB 3U82B 3RWHB 4R0LA 3X3FL 4QYOA 1IFHH 2FX8L 4KMQA 1CT8A 3FB8A 2X4UB 3HB3D 2XN9D 2B4CC 4QEGA 1MNUH 2YRPA 3OR7B 1AGDB 4IBLT 1V3KA 2IH3B 5GSRB 1NAKH 3IB4A 3C9NB 3VWJA 4HUXA 5FYKD 3C5JA 4G8GA 5BW7A 1XGRA 4K9EC 3QXVA 5HYJE 2F8XC 2WM0A 4M7LL 5F9JA 3QEGH 2AI0L 3EFFA 4HX1B 5JNYA 1OP5K 3U2SB 1WT5C 1M71A 1W0WB 1YEJH 3UYRL 1UCBH 6FABH 5FA3B 4EVNB 3S4SA 2P45B 4TSCH 2YD2A 5FYJE 4I2XA 3RWDA 3X12B 2VITB 2YHGA 3E8UH 3G04B 2H2SD 3MNVA 4YDVB 5HDBE 1OSZA 3C09B 1I8LA 5I1LA 1G7LA 2AJ3B 4U1IA 3NMEA 5T33L 2MFNA 2DM2A 3ARBD 4P5TA 4WWKC 1KEMH 1EEZA 3CVHH 4G9DB 3RY4A 4YXKL 1JWUB 3FT2A 3B5TA 5HY9A 5F7EH 3WCYA 5BZWA 1C7SA 1T22A 2WQRA 3B8SA 3VE0A 3STLB 4BQBA 4QF1B 2XKNA 4LAJH 5EORL 2F5AL 2ZKHH 1JNHA 2ADGA 3IDGB 4YBLC 3F12A 3QPQC 4LK4A 1C08B 5H35B 5B39A 2RCSL 3DV4A 1UACL 1IEAB 5GGSY 4IMLB 1BAFL 5JZ7C 3LMJL 3TF7C 4AEIH 2XTLA 4JHBA 2DF3A 3B2VL 1NJ9B 1WLHA 5C2UB 5CGTA 2NR6C 4GQPH 4DQOL 3RL1B 1T5WB 1PD6A 3VXSA 1S7XB 4OGZA 2NZ9C 3QHZH 3UJIH 1LDSA 5IJKC 2LQRA 1W8OA 2AP2A 1MLBA 5EUOF 4ZXBD 5LGJB 3BKYH 4DEPB 1I9IL 5C1MB 1Y0LB 3V4UH 12E8H 3V79C 2AJZB 5FOBA 3RP1A 1C1EH 2Y6SD 3BKCL 4WW2B 5ANMA 2R0WH 3ZKMD 4CUCA 3NCJH 3MGTB 4GS7C 2ZUQB 2HVJB 3QJFA 5IQ7L 2PUQT 2XQBH 3CUPA 5CJQH 2BHUA 3O8XC 3MYJB 3QXAB 4OLWH 5IEKA 1JPTL 4LMQI 2AV1A 4GKZB 4MXQC 3MA7A 1CIDA 2CRIA 2PO6B 5HHOD 3WYRA 4PJGB 4JB9H 2HJKA 2X70B 4TVPD 4RAVA 5INDA 2DKMA 1CDCA 2RB8A 1WCBB 4M5YL 2VLRB 4DN3H 3R1GH 3O2WH 5FYLE 4LF3A 4PPTA 3SGKC 3ZHLA 2LFGA 5CINH 3UTZB 1QSFE 3O41A 4FN0A 4KRLB 2X1XR 2OTWB 4H5SB 5EZOH 2FZ3B 1X7QB 5E94B 4N0UA 2NX5E 4FFYH 3BEVB 4D0CB 2IMNA 2X9XA 3OPZL 4BZ1H 1ZWIA 5DUPH 4QHMA 2ICES 1J1OL 2VXUL 3UBXG 3WSQH 4C56D 2EDQA 4KKBC 1ES0A 2HKHL 3OHXB 5DRXA 5J1SC 4OM1L 3VXRE 3M17B 1P7KA 2Z8VC 4HUVB 3ALXA 1BVLB 1A6AA 1WQVT 2DQHL 4AM0B 4OCRH 2B5IC 2UZXB 3BFOA 1ACYL 3F7YB 3K81A 3WFHA 1CDBA 3GBNL 2ADJB 2OYPA 4CN1A 4JZOB 4OF5A 2XZQH 3DUSB 3GZKA 1TJHH 5F1SA 1SY6A 4P59L 4KJWD 3RGVB 3P11H 4G42B 2CMRH 4U2YA 5LGHL 5HBBA 1YEGH 5IMKA 4ELMB 1F4WL 3MRGB 4L4TB 2Q3AA 2R1WB 1OP3K 4AZ8A 1U8KA 2LVEA 5BRZB 3DV6B 5BZDB 8FABB 4NSKB 1I7UA 3O9WA 4JPWL 3PP4L 2IBBA 1HHHA 3C8HA 3F58L 4Z7VF 1DQML 4R26H 1NBYA 5IMOA 3ZKQD 3ULUL 5IFHL 1OGAB 4PJ5B 2VDLH 5K9QG 1I1CA 1PVHA 2QR0B 4P23A 5KSAD 4FFVD 2JK5B 3ARYA 1HHGA 3QUXA 2R56L 4HAFA 4TYUA 3HPLA 5I1AB 1MQKL 3WHE1 1KTDA 2P8LB 5FUZH 1HHJB 3OGCB 3OB0K 1W0VA 3GJEA 2DQTL 3RVVC 4KKCC 4HQQL 4LSPL 4S1DC 2MPAL 3LHPH 4WUUE 3W9DA 4WU5B 3NA4A 3PWNA 5T5FL 3V4VH 1LEIA 1FZMA 4P57A 4PUBL 1IARB 3QIWC 4TUKL 1RUKL 4PJ8A 1PQZA 1RUML 2Y07L 3L3GB 1DBKH 4BK4A 5K9OB 5IGXH 4O4YL 5F9OH 2IEPA 4HZAA 3D5OF 4E42A 4MJIB 5DQ9A 1A1NB 3IGAB 3BO8A 2OTUB 2PNDA 1M7IA 3ARSA 4EN3C 2P42B 1LO4L 1BF8A 1SJEA 2ZP0T 4HKXA 1KGCE 4PJCE 5DHVH 1KLGA 1WBZB 2Y1VA 4GBXA 1P7QA 1X5AA 1YYMH 3P30H 4DKEH 1BFSA 4NN6B 3LKPA 1AJ7H 3H9HB 1MIML 3VFSB 3WXWL 2WP3T 2J1KA 3NFPA 3T0ED 2RQ8A 2APFA 4HZLA 3CXDH 1MJ8L 1MREL 1QRNA 3KDMB 3KNBA 1NQBA 2HFEB 3CK0L 3J7HA 2ICEA 2MKLC 5GIRB 2ITDB 3PWPB 4W70A 3PQYD 5D6DC 2FGZA 2ZCHL 1VB9A 2D7QA 1PJ9A 4G9FE 2DQDH 4Y5VA 1NGYA 4MJ5B 4OZIF 4KK5D 1CD8A 1IGYA 4WFED 3PWUB 2YZ8A 3SPVB 3ZE2E 1FVCB 5ILTH 3MLVL 4RIRA 1BQHB 3BZFA 4PGBB 3FHAA 1FJ1A 3K2UL 3ALWA 2R4SL 3Q3GA 4NO0B 3CZJA 3JTSA 1DLFH 4PTTB 2GEEA 4J12A 1QYGL 4Z78A 3L95B 4KKAD 5HGDA 2DQCH 1JZ8A 4C4KT 4XCFH 4OV6F 3RPIA 4I4WA 1XFPA 2O93L 2Q7NA 4M7ZC 3T2NH 3NACL 3V2AR 1AD9B 4OCWH 3OGOE 2QKIA 4R90L 3IKKA 4HLZG 5T1LB 4RX4D 4LIQE 5DUMH 1DN2A 1FO0B 3QFJA 3MRDB 3LDBB 3QUZB 4MXWL 5J1TC 1MFCH 3S3PA 4WFFE 1QOKA 1RZIA 2D31B 4L3ED 1DQQB 4WU7B 1ZEAL 5EZJA 1NGQH 2HFGH 3C6LC 3D69A 3BSZL 1ZGLA 3HZMA 4ZFOL 2HH0L 5I6XC 5EZLB 3QRGH 3BESR 4QRUA 4KKLD 5DJDA 1YQ2A 1IAIL 3GJFB 3O3BB 4PLJD 1XF3B 3T08A 4JGUA 5L9DH 2PXYB 3NABH 4FQXD 4ZFZA 4KK8C 4M6NH 3ZKXC 5EU5B 2X7LB 1A0QL 4OCSL 3V52L 3DURB 1J5OH 3G08B 3AMKA 4Y5XC 1GIGL 3PL6D 3UTTD 3OKLB 3L5XL 3UO1H 4HFWA 3QWRA 5IBUB 5E2VH 3WLWD 1U8IA 3DXAB 3QDGE 2I5YL 4WHCA 2EE9A 2R69L 4U3HA 5J12B 3G5YA 3ZT5A 1QSEE 4PBXA 3SBWC 3MJ7B 1IGMH 4GW5A 1AY1L 1G9ML 1MCIA 4X7FC 1ONQA 5E6IA 2V2TA 4F7EA 1CFQB 5IKCA 3GRWA 3VGBA 4JKLA 4PJ7F 3U1SH 4L8BB 4MA8L 3HR5B 1N5YL 2VUYA 5GGUA 1CG9A 3T0WA 5AAMA 4M5ZL 4DGIL 4KROC 1LVEA 5C09D 5DS8B 1J8HA 1ADQL 4XNXH 1YJDL 4FXKB 3BPLC 1ZT1B 1FG2A 5SWZE 1ZVYA 1HXMA 3ILQD 5IOPB 4D8PB 5ACZB 1ODAA 2G5RA 1IGTA 3C6SB 4JFXB 1BIIA 1VACB 3UTPE 3V0VB 3FFDA 4J3VA 4KXZH 1JNNH 2Q20A 1TPXB 1UWEL 2A9NL 4ODXB 3SDDB 3EGSA 3IXTA 4CVZB 3H7BB 3I3DA 5BOZG 3KLHD 4RMWA 1FNSL 2IQ9H 4O00A 4XXDB 5I1DA 1Q94A 4LGSB 3TO2A 1A7QH 4Y4FB 3LVEA 2QADC 3QCTL 4JQXA 3IFLH 2IANB 5D7LB 4LU5L 4XRCA 2DTML 5C2BL 3NAAH 3TA3B 3LKSA 4UQ2A 1LO3H 2CSPA 1BD2D 3MJ6A 5LBSH 2C3GA 3QDME 4S10A 1VA9A 2YA2A 3L5JA 2X41A 5EBLB 4D0BA 3IJHA 5T1KB 2FSEA 4UTBL 4OGYH 4LNRB 3FTGB 4ZUSB 1OTSC 3P77B 2V7NB 4KVNH 1P6FA 3BYTA 1KC5H 3HMWL 4Z7WF 2YC1A 1JRHI 3PHQA 4K3EL 5ESVB 1C5BL 1OM3H 3ULSB 3P0YL 1TVBB 1EO5A 1AKJB 3B9KA 5CWSA 5BS0E 3HUJF 3M8OH 2CKNA 4PLKD 1ZSDB 1FN4B 1WBYA 3BQUB 3H3BC 4Y19E 4P2OA 5FGSA 1H3WM 2NTFA 5IHLB 4PGEA 2CIKB 3RY6C 3C5SB 2NW2A 3VXOA 2IGFH 1TTGA 2JJVA 3ULUF 5ITBH 1FDLL 5KW9H 3PHOA 1KNOA 4MNGB 3K1DA 3EJYD 3QDHA 3KJ4B 2HKFL 1JCKA 5DEFA 4U0QB 1LE5A 1MHEA 1NEZG 3CU7A 4G7YL 4ZPTA 1IGJB 4HJGA 4S1SL 4OUUA 4E41A 4Y4KB 1A6TA 4U1MB 5DQJA 3ZDXE 1INDL 1ZANL 5IBTH 3MRLA 1LO0H 2XWJB 4Y16D 2AK4B 3NFNB 3X3GH 4OZGB 4F7TB 4PB9L 5DI8A 5E1AB 4XCCL 2Y7QB 1A6UL 3ZE0E 3CMOH 4PJ9A 1CD0A 3P73B 4LQFH 5D1XC 1IGIH 4OD1H 4OM0L 1ND0A 5M7QA 5C0CD 3ZZ1A 4B50A 3RAJH 2YA1A 3H0TB 3Q2CA 1R3HA 1E4WL 2GAZA 5IV2A 4F7PB 5JO5A 3KPRA 5DEGA 4X9BA 1NCTA 1OCWL 1IRAY 1H3PL 4EI6A 1NDGA 2PYFA 1HCVA 3C60C