1BDYA

C2 domain from protein kinase c delta
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
123
structure length
123
Chain Sequence
b'MAPFLRISFNSYELGSLQAEDDASQPFCAVKMKEALTTDRGKTLVQKKPTMYPEWKSTFDAHIYEGRVIQIVLMRAAEDPMSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMCVQYFLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN KINASE C
publication title Crystal structure of the C2 domain from protein kinase C-delta.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Calcium-binding
total genus 20
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 1998-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 1bdyA00
4PS7A 3NZUA 4NP9A 4DNLA 2K8MA 4FLHA 2WXPA 4KITB 2V4LA 1DJWA 2CM5A 2ENQA 2Q3XA 2EP6A 2R83A 2A4ZA 3HHMA 4AOFA 1QASA 2WXRA 3QAQA 1DJHA 4HLEA 3LJ3A 4QJ5B 5CCJA 2FK9A 2RD0A 3CSTA 4WAFA 4L1BA 4FADA 3HIZA 4G11A 4ICWA 5CCGE 4F93B 1DQVA 2NCEA 3L9BA 4KZCA 1K5WA 2WXGA 3FDWA 1E8WA 4FHKA 3ZW3A 4GNKB 3OHMB 4A55A 2CHWA 1BCIA 2WXFA 4PS3A 4WEEA 2ENPA 3RDJA 2DMGA 3TJPA 4ANVA 4EZJA 1CJYA 4IHBA 4ANUA 4XE0A 1DJXA 2N1TE 2WXNA 3QK0A 4Y1SA 5T8IA 3SD5A 4FA6A 3APDA 3T8MA 2ISDA 4NPKA 2X38A 3ZIMA 2WXJA 4PS8A 4ANXA 3PREA 2WXKA 3MJWA 3QJZA 4LT7A 1UOWA 1YRKA 2CM6A 4J6IA 1E8ZA 4NS0A 4FHJA 4DK5A 2K3HA 3ML9A 2ZKMX 4OVUA 3CSFA 3L4CA 2KI6A 5EDSA 3GPEA 4MJJA 5CCHE 1E8XA 1DSYA 5KJ7E 1UOVA 1HE8A 4L23A 3F04A 4EZKA 2A5UA 3ENEA 2ENJA 1WFMA 3L54A 2K45A 3F05A 1W16A 2Q0ZX 4FJZA 1E90A 5JHBA 4BGDA 1TJXA 4AJWA 4URKA 4ICXA 2CHZA 3TL5A 4GB9A 2NSQA 5G55A 1TJMA 2WXOA 2D8KA 3IBEA 3W56A 4F1SA 3APCA 1BDYA 2LHAA 2YRBA 1DJGA 1E8YA 4JPSA 2JQZA 3HN8A 1UGKA 4L2YA 4OVVA 4XX5A 2YOAA 3QR0A 1GMIA 3RPBA 2WXQA 3APFA 3L08A 4XZ4A 4WWNA 4WWOA 5JHAA 4BFRA 4ANWA 3KWUA 5H4ZA 3NZSA 3KWTA 1DJIA 4TUUA 3S2AA 3P2BA 2QZ5A 1V27A 4NPJA 1RH8A 4KZ0A 4QAMB 3F01A 3NSJA 2WXIA 3F00A 4L1LA 1QATA 1E7VA 4FJYA 4Y1TA 4LCVA 2Y3AA 3QARA 5H4YA 1DJYA 2CJSA 3IM1A 3L13A 4FULA 3R7QA 3W57A 4QJ3B 4LDCA 4F92B 3PYCA 3PRZA 1RLWA 2NQ3A 4TS6A 2FJUB 3R7RA 2B3RA 2CJTA 2WXMA 3DBSA 2WXLA 2K4AA 4IQHA 3ZVVA 1DJZA 2CHXA 4HVBA 3PS6A 2WXHA 3L17A 4WWPA 2UZPA 1WFJA 2QZQA 3TWYA 3ML8A 1W15A 3FBKA 4QJ4B 4TV3A 2BWQA 4V11A 5G2NA 1E7UA 1A25A 3OAWA 3M7FB 3PFQA 2DMHA 2CHDA 2Z0UA 3JZYA 3L16A 3N5AA 3DPDA 4EZLA 4F91B 1RSYA 1BYNA 3QR1A 3B7YA
chains in the Genus database with same CATH superfamily
1JPTH 4Z7UA 2RCSH 2DI8A 4ALAH 3ZZSA 4YSQA 3LEVL 3AQXA 2BSSB 3TT1H 2VJ8A 3BUIA 3HHMA 2WC7A 2ZOTA 5AOZA 1JWSB 4APQD 2EDWA 3AG3B 1HC1A 4JY4A 5B1JC 3E3QC 4IRZL 4EUPG 1U92B 4C59B 3QORB 1X5AA 1L4IA 3QDJD 2OPCA 4NO2A 1CVRA 3Q06A 1CE1L 2FO8A 5DJ8A 4PS8A 4M1CC 1L0YA 4B0MB 1DUZA 3QUYB 5FK9B 3FUJA 3H6JA 1F6LL 1G4RA 3LEXA 3DO3A 3ZGHA 4OM1L 2XG4B 1SMDA 3EGSA 2O4EA 3CH8A 4L1HA 2FTAA 4W9CC 4TTDD 2Z4TA 5IB5A 3H4FA 1A1NB 4XNMB 4M93B 4MCMA 4EQ2A 5MEQA 4JFYB 3V6ZA 5B4MC 2D2CC 5IM7B 2QL1A 3JWOC 4D7PA 3LKNB 3C6LA 4N0CC 4TYUA 2L7QA 4OSUL 3BQVA 3LNFA 4AL8C 4CL7A 3GO1H 3B34A 3UCQA 2BIPA 2O6DA 5JR1L 1N6QH 5D2LA 4QRUA 2LTQC 5DD5H 1VRSA 3FOMA 3KPSB 1PKOA 4EMZA 1JGUH 1LJMA 1JPST 4E9VA 1IIIA 5IMKA 4KQ4H 5CZXC 4D3CH 2OSYA 1WBZA 3UBGA 2DS4A 4HXAH 4XNZB 4YUEL 1DTUA 4P4KA 4LVOB 1WEJL 2OJ1A 3BKCL 4U3XA 3TASA 4NAMA 2OXHB 3HNTH 1X5YA 4XP4H 1J7VR 2NY3C 2D4FA 3E9TA 1M6UA 2DLTA 2ZF9A 4NQXA 4O5LH 4GLRH 3TCLA 2ED6A 3PL6C 2FB4L 2DEWX 4Y2DA 1EUTA 3GNMH 2DTSA 2E46A 4RDQF 3C60D 1MUJA 1ZK9A 1OAJA 4WENB 3WDJA 4CRPA 3TJEL 1F6AB 3PPSA 4ZOEA 2GITB 5IUSA 1ZXQA 1XIWD 4XMKH 3F7YA 2KHAA 5JDJA 3BPOB 2X12A 4OLUL 5EBWA 3IAPA 1MEXH 4W9ZA 2NZ9C 1D6VL 1J18A 4NSKB 1CICC 4TULL 5D7JB 2VDPB 3D39A 2FT7A 3VFWB 1FVCB 4G8FB 1C5DA 3V0JA 5E00A 4G7RB 5FCUH 1J8HE 3MA9L 1ZHBB 1F3DH 6PAZA 1YN6A 2BZCA 4P9MH 3U9WA 3WIHH 4NKDB 1MSPA 3MOQA 4PJ5E 3WTWA 1UM6L 4IRSC 3WEXA 1B4RA 4JM4L 4YBHA 4FQ2L 1F3RB 2E0PA 3EYQC 3QRGH 3MRRA 2VC2L 4HIIB 3I74A 1KV3A 3GJEA 4JN1H 1JD9A 5FYLH 5ALCH 5DJYA 2GCYA 4HCIA 4MA3A 1HH9A 2FX9L 1PYWA 2ZWNA 3AREB 1HCVA 1P7BA 3L4XA 1TOXA 3VXSE 2ZXQA 1NMBL 3BZFB 4BK4A 2CO3A 2FHFA 3GPEA 1W0VB 2YGVA 1N5YL 2VZVA 3WFCH 4M7KL 3CXDL 4UDUB 5KJ7E 3LQZB 2JB5H 4DH2A 3Q8EA 4S0TD 3GQFA 1WWAX 1TPXC 2A0LC 3KL5A 3C6LD 5EO0B 4EI5B 3IDNB 3L5XL 1OAQH 1VEMA 4G6KL 4HZ1A 1T5WA 1D5MB 2ICWA 3FT4A 2YC1A 2MKLC 2J8UB 3FH7A 2HN7A 5KYUB 2R39A 3EH3B 1CDHA 2FGWL 5GRVL 3JTTB 4OCWL 1M3IA 1S8DA 3O4LA 4RNRA 5I0VA 3ECBB 4P0DA 1A0QL 5TF0A 5ANHA 4GIOA 4P4KD 3L3HB 1CBVH 1CURA 2FD6H 3DRQB 1SJHB 4L1TA 3MOBH 1BVNT 2J43A 4X4KA 2XN9E 5JA8B 4N26A 3QULA 4NQDB 2WZPA 4QRRB 1N4XH 2H1PL 2R0WL 3L2MA 2WIMA 4MRBA 4QHNB 3HB3C 2GKIA 3GT6A 4Z5RA 3ROOA 1O6TA 5AYUL 2X87A 2K7PA 2YAEA 4Y2DD 5LGYA 4MMXC 3MJGX 5ACZB 5GS2H 2WSKA 5SWQB 3RWCA 2FUQA 2Y3AA 2VIRB 1GGCL 4AYID 4FULA 1XFPA 2M83A 4UT6H 3SE8H 3O3BB 1INQB 4FP8H 1J05A 2MNJB 3TURA 5L88H 2FIRT 4L37A 4HFUH 5B21A 4QT5B 3BHBA 1UCBH 2YPLA 4K0OA 4M7LH 1SBSH 4BSVB 5IMLA 5HHNA 4XTRC 4PRIB 3S34H 4PLNC 1FZKB 3NCYS 4GRLB 1QA9A 5KVGE 1PDKA 4WI0B 5CF3A 4B7IA 1RZ7L 1AIFB 4HISA 3EYOA 4NZDA 1SEQH 3O45A 4LP4A 4MD4B 1FSKB 5ISZE 1U8IB 2IFFH 1VLXA 5JIIA 2VO8A 3MJ7A 3MACL 3V9FA 4ERSH 4UM8A 4HCRL 4RGNC 4ACTA 4YSUA 1B2YA 2H9GB 3QRFM 5AB9A 4XVSL 4PJHB 4JRXD 1KBVA 1KXHA 5FHAL 5C9KA 3CLWA 5DO2D 3FCTB 2E3VA 5F1IA 3K81A 4AY0A 2D73A 2R1XA 2W07B 1UXWB 4KHXL 2R4RL 3RNQA 4PRBB 1GYUA 1WS8A 4F15C 3UTTA 3LEYL 4FYRA 3VFOA 9CGTA 1YEGH 3LN5A 3UZEA 3R4DA 3MBXL 3NCXA 2GQHA 3VD0A 5ERWA 4UV7H 2XA3A 4F37F 4G1EA 2WO3B 4FQIH 2W9EH 3RYMA 3EJJX 4A04A 2OA9A 3IJSA 5D7IF 3GB7A 2AJ3A 4N1CA 5GGQH 4C47A 2UXGA 2N1KA 4NZJA 1XX9C 2VXQL 3MLVL 4JQVA 5BS0E 4OZIE 1BQUA 3DX9B 2XIDA 2HVKB 3PHOB 3RX9A 5IFJB 3FQXA 2V2TA 1KXQE 3NCCB 3O4LD 1WFTA 1ZGLP 5BV7H 4H8PA 3VFPA 3SE4A 3H9HA 3O81A 4MFHA 4RMUA 1CK0H 2F5BH 2F7IA 3EDKA 1UB6A 2KYIA 4P3CH 3LIZH 4XPHL 4KO5A 3SY0A 5CCKL 2WXQA 1AXTH 5B3NA 3APFA 2WZPD 5MERA 5GS3A 1OM3L 3GSNB 2ARWA 3NJVA 4QTHB 4ATWA 1LE5B 1OSZB 2FT8A 5GIRA 5FYKE 3FHAA 1RU9L 1WDAA 1TNNA 3QFGA 1CFQB 2KZBA 2Y7QB 1QOKA 1I7TB 1EHLL 4NWTL 5FYJL 3ZKSD 3A22A 4X8CA 2NY4D 5D93B 5E7BA 3C09C 2OMTA 3MV8E 4NN7C 5E7FA 4DP9X 5J11C 2WANA 3EYFA 4XNXH 2XSKA 3AUWB 1QRKA 4PUBH 2EKSA 1MAML 2YPLD 3QUZA 5BW7C 3SDCC 2ESVD 2HLAB 3P0VH 1R1CA 2DQFA 3GXFA 3MRPB 1KB5L 3EGDB 1JGEA 1N7MH 2FE0A 1L7TH 3NPSC 3QIWA 4GKSA 2CCVA 2B1OA 3L3OA 4CVXA 1CD1A 3JZYA 3CC5B 3D0LA 3OX8B 3RDTA 3FT2A 1R6VA 2F08A 3HHRB 2IDFA 3H85A 5I16A 3FT3B 3KVQA 3G5XA 1N59B 3MHZA 5D5ME 4FQJL 1I9JL 3OR7A 5CKAA 1YEEL 1LHZA 3TYFB 1N64L 4XMUA 1DFBL 4I0KA 3HS0C 4G82A 3ABZA 4BFEA 3PWPE 4LSTH 1IEAB 4FI6A 5CSZB 4ODWB 1OGAE 4GQ9L 4HP5A 3VG0H 3UTTD 4UDTA 4XBPA 3O11A 3WE6B 4HQQL 1QRNA 4LEBA 2HMID 1YMHB 2MFNA 2R7EA 5I5JA 1G43A 4MWFA 1BREA 3PREA 1JZJA 4K7PH 5DZJA 4ZUTB 7FABH 5GRYA 2F58H 4E0RA 1HDMA 4LAQH 1R3LA 2X4UB 4UNTA 4X4XB 3GMRA 3IDXH 4L9DA 2AQ2A 4KXZI 1G7JA 4EUPH 3BP7A 3U2IA 5MENA 1SY6L 1H6TA 1YDPB 3DYOA 4PJ9C 3VFGL 4CJ0A 1Q9KB 1XCTA 1M05A 3C5SB 2HLFC 1MCOL 2IH3B 1RMFH 4I3RL 5E8EB 5I19L 4WFFE 3V0WH 4LSQL 1CU4L 3SPVB 4P48A 5J6HA 3GS0A 1G6RB 5TDOB 5GRXG 4ZFOL 1HT6A 5J3HD 1EAOA 1FG2A 3FB6A 3VFNB 2ZX6A 1CFVH 1G0DA 2D3NA 1ZTMA 3QJRB 5ICUA 1XGRB 4AI7A 1XEUA 3IMRA 4YXHL 4RA0C 4UV4H 1FL6B 2Q20A 4JO2H 1OCWH 1S9KC 3CH1B 3BH9A 2OMXB 4I18A 2DN7A 1HS6A 2R27A 3VSVA 3ZKXB 3WEAA 2VL4A 3BVUA 4FYSA 3V7MA 2D0GA 2DQIL 2VXSH 2ED9A 3EJZD 4XNQA 4W93A 5DJ6B 3RVUC 5AG9A 3N44B 1ECZA 4YHIB 5DJ2A 4YWGH 1IGFL 4BQ9A 3QDAA 2OTPA 4GRMA 2F2HA 3FOLA 2EDXA 3EUDA 1NEZA 3E2HB 1GKOA 5DI8B 2QQNL 3QUZD 3UAFA 4KQ0A 4YBQC 1NOFA 4WHYG 2PYEB 1CDJA 3O6MH 4TXVB 2HT4D 5ANMA 5LNGA 3SDDA 3QIWD 2X4TA 3MRMB 2IOIA 2EIMB 4AC4A 3F64A 4XPTH 4FLRA 3IMTA 2BWQA 3A3YB 3RDTD 4FA8A 1LK3H 1MNUH 2BRQA 2V33A 4FERA 1RZKL 4M5TA 1KG0B 2VUYA 4LLVA 1Y6MR 4S1RH 4XNYH 1MI5A 4TNWK 1JZIA 2R9HC 1ED3A 2XPGA 4WTQA 3MKGA 5A2KH 5TPWL 3ULUC 6TAAA 1X6LA 2J12B 1CLOH 3HFFA 4QO1A 3WDHA 5DQJA 2QKIB 3HG1E 3BSZL 5AZEL 1KIPB 2J25A 4XOBA 1Z9LA 1RIUL 4JDTH 4L3EA 1H3WM 2XVBA 5EF0A 3VO0A 1A5FH 3G5WA 3F85A 3P9MA 4TNEA 1QRND 2WINB 4AVIA 4OGZA 1VAHA 3ORJA 4HKBA 1A7RH 1BQRA 1JE6A 4IHBA 3TT3H 4F5CE 3NSCA 4DP7X 3NAAL 4O02H 3WFDL 4BBWA 2KLTA 4PWHA 1E5AA 3L5IA 3ZXAC 4ANXA 4K23L 3JYCA 2ZSVA 1KIRA 4L3CB 4QGYA 4XMWA 1BAWA 4GG6E 4R5VA 3VQMA 1HCFX 3DJZA 5CWSA 1L3WA 1JPSL 4YGAB 5KVEH 2ZUYA 5FFLA 1I7ZA 2HSIA 3DX2A 1OAKL 3FQNB 5I6PA 4IBQA 4BFGA 5IVXB 2HRHA 5SV4A 1A7OH 3DSNA 4J6RL 3RZCB 2EQDA 4EZKA 4FQLL 2NZ1A 3RUGB 4X99B 3WO3B 2VTFA 4AV0A 2X1OA 4CVUA 3G5VA 4JO1H 2WLMA 4ZG1A 3HZYA 4WI5A 5JQ6L 2DJSA 4HEPA 4Q6IA 1ZPUA 3ZGIA 4DO4A 1QMUA 4HJIA 1KWGA 1XTMA 3GUFA 3IBEA 4MSWA 1MCRA 2QADC 4FTVE 2I07B 5AW7B 5EF2A 2BLFA 2ZX8A 3RY6C 3B9KC 4RFEB 1GXEA 1QTPA 1JZFA 2BNUB 3N04A 3SY6A 4GW5B 4JFDB 1KYDA 1P5VA 3MYJB 2XNAB 2WD0A 1Z32X 1S3KH 1AMYA 1TFHA 3HMXH 3P73A 4FRWA 4MASA 2CCWA 3RU8H 4MD5B 3SKOA 5I1DA 1V55B 4TUKH 5JXEC 4R5TA 1SJVA 5BRPA 4X6FB 1A9BA 3U9PH 1GGBL 2BIQA 3E8UH 4QHUA 4IJ3C 3KWTA 4UQ2A 1SOKA 3KCWA 2X1XR 1ZV9A 4Y5VC 3BWAB 2A9NL 4OBSA 1NIBA 1T83A 2BNQA 3BC9A 3HG3A 3CFNA 3DURA 3L13A 5D2NC 5DGQA 4AQEA 2JCCB 1UXSA 1WH0A 1WD8A 3MOAH 3VAEA 4LGPB 3CLFL 3WIHA 1F3DJ 4H0IA 1A3QA 1NM9A 2UY7A 5M95B 2I60H 1RZPA 5EZJB 4OIFA 2VLMD 2V9QA 1YN7A 2DYRB 1Z9SA 3B3IB 4MHHI 2FRGP 4N0FB 5I8CA 4UF7C 3IAGC 4X9GA 4DZBB 3ZOAA 4IGBB 4B41A 4RGOL 4N6RB 1AZCA 3QZOA 4NYLA 4WUKL 1P7QB 3QYMA 1XVSA 1IX2A 1EHXA 1DQKA 2Y5EA 5GXBB 4P05A 5LGJB 2H1LM 1MFAH 4OD1H 1FIEA 2FH8A 1V05A 3UXFA 4S1SL 1AP2A 4GSRA 5LN8A 4NQCB 5KAQF 1X7TA 1G6VK 3QAQA 4L3ED 4YK4B 5EU7E 2QKSA 1N8OE 4Z9KB 2VR8A 3UO1L 4CN1A 4YS4A 4WO4C 3U4BH 1MW1A 3V0HA 5CD5D 5JA9A 2CHNA 1F18A 3ILEA 2QEJA 5DSCB 5E70A 3SPIA 1LGVA 1J10A 3DVGA 2RFXB 4H4NA 4TL5A 5DRNB 3Q2LA 2ISDA 5CZVL 3WL9B 4FYTA 4A7GF 3WN5A 1KGCD 1QPKA 3KPLA 4DPAX 2ROXA 1PCSA 3VQ2C 2WP3T 3DX7A 4LQFH 3HAEA 4XVJL 2KS0A 3VWJB 5CILH 1FVDA 3VRJB 4X5XB 1BZ9B 1UYWL 3DX3A 3O9WC 2Q10A 1H3PL 1M57B 2CMRH 4HAFA 5D8JL 1VPOL 1EJ8A 2ZKHL 4H2CA 2K45A 1VEPA 3QFJE 1Q38A 2AK4E 4U1MA 4PTUA 4POZC 3LZOA 5IOPA 2R23A 2R56L 4R2GC 1AHWC 1RZKC 4PJ6A 3WV0A 5E6SB 5E8DL 3P9LA 1CFNA 2AJYH 5FW7A 1EXGA 4ESKA 2WLLB 4UMSA 1A7PL 2EDQA 5EEVA 4UT6A 5DS8A 3ETTA 4YSSA 5CEZL 3S36L 2IDTA 3N91A 3GLDA 5J1SC 3R0MA 1JV5A 5E08H 3CN4A 2YBRB 4JVUA 4N0RA 4OD3H 4PV8A 3ECWA 2CRMA 3TU6A 1FRGL 1VGKB 1XGUA 2WBWB 4M8UA 4HMEA 4Y4KD 2C5DC 4Y5YB 1FE8L 3MXVH 3FU6A 6FABL 2BOBB 3BP5B 3D50A 3OSVA 5DVNA 3U9UB 1F58L 5DSCA 2DV6A 4K71B 5L2KE 4GAYB 2BNQD 4BZ1H 1MPAH 3ZYZA 2WXIA 3QUKA 4OV5B 1WBYA 2ZP9A 1R4XA 3H0TB 2V2XB 5EZPA 3SGJC 1NINA 4LU5L 4QNPE 2F7RA 2W91A 2IPKB 5GGSA 3B83A 4A37A 2XIIA 4DVRH 5IFHL 1S7SB 2FJUB 1W91A 2BP3A 1A2YA 5BUGA 3KDMA 4V1DA 2B14A 5ESAA 4YSEA 4Y19B 5I8EA 3GTVA 3FO9A 1M1XA 5INCB 4HSAC 1VFBB 2MEJB 1BWMA 5FYLD 4OTXH 3JWNC 1MJ7L 2CGRH 4PG9B 1YEKL 2EEFA 3WY4A 2GTQA 2Q7YB 3V4PB 1JZDC 3CD4A 4WU5B 1HVXA 1KGIA 5HP5A 3BQUB 1U8MB 5KSUB 4ZTPH 1R19A 4YSAA 1NDGA 1QEWB 1G7MA 1GZQA 4HPOL 3DHMA 3LV3A 4ZOCA 1N5AB 3LB6D 2VN3A 4R96B 1S46A 1TJIL 3VYOA 2NW2A 1XO8A 2ERJB 4V33A 2VZSA 1OGPA 1E3XA 4HUVB 1PF3A 2HFEA 3RVVC 3T0BA 1UG9A 4Y1SA 4RISL 3ZHNA 3OLIA 1WGOA 4XBGB 1HXKA 3O0LA 5SX4I 1UOWA 2YXWA 1TLMA 3NJLA 4QF1A 5F21B 4PRHB 4RBPK 3IS0X 4M1DL 3VFSB 1ZA3B 3FT0A 3LIZA 1W72B 3HE6C 4WFGD 5D96C 4ZUWA 4AW4A 1UWGL 4KAQH 4KRPD 1SF5A 4U31A 3ME0B 5TGBA 2Y9RT 3HHSB 4U0RB 4YDLC 3UG4A 3US1A 2NXZB 4N1HB 1D6EA 3ISYA 4JL1A 5GSVA 1S7QA 5GS2D 1CI5A 3DV6A 3OVUB 5D7LE 4ZMAT 1CVSC 1E6JH 2OMVA 4QXVA 3HC0B 1INDL 3VGFA 2G3ZA 2YD6A 3V6FB 2JQZA 1E9QA 3KYOA 3HN8A 2AJUL 4MDIB 1OAYL 1L9PA 4S1DD 4WUUE 5BQ7B 5BZWB 5ISZA 4AKPA 4JZJB 4KRMB 5HI5D 5JYLA 4HWEL 3LRKA 4I9WD 2FX8L 2E5EA 5EU6B 4P2RA 2IAAC 5C2BH 1OO2A 2AZUA 2Y25A 4Z7NF 2DICA 3TZVB 4ZMWA 2FX7H 4IBUA 2OSLB 4KI5D 3L1EA 1PD6A 3FHQA 1JHKH 2FWSA 5ALBL 2W60A 5CM1A 1QATA 4ISVB 2HKFH 4OZGF 4XXCA 5GGRB 1CF1A 1MQ8A 1U8OA 4J4PC 4XH2A 4V1DD 1KYOK 2NY0C 1S9VB 2P3YA 2BSBA 5HHPB 5DC9B 3L5WA 4LCWE 4P46B 1TJGH 2OMBA 1E27B 3NFNA 3VI3A 2NT0A 4HWZA 5JPNA 2UZXA 4Y4HB 4HH9A 1NDTA 4TQ8A 1CYGA 1KTCA 4WO0A 3M1BA 1RK1A 5E9DB 4JGMA 3UAEA 1FN4B 3ZIYA 3D51A 3S3BB 3R4RA 5EWIL 5BS0A 5JIMA 5EC2B 2NYZA 2MJWA 1E42A 4WHYH 1MRFL 2W0FB 1O7VA 3FONA 4YR6B 3WXWH 4MLIA 2YUZA 5L4FA 2WVVA 1QASA 3G6JE 4OIIL 4PY8J 4MMZB 5JDSA 4EUPA 1XB3A 1AKJA 1M4KA 2WCPA 4NQEE 1BD2B 1UH3A 1NBQA 5EUOF 3G6AA 1IAII 2J21A 1VESA 5SWSA 1WS7A 3X11A 4J2XA 2Y1ZA 1AXSA 2YXFA 4LEOB 5EPMB 3AAZA 3SYAA 3QZWG 2X2JA 3L7FA 1CD0A 5CJ5A 2P8LB 2CBQA 4G7QB 4HBCH 2Q5BA 4MHHG 2YJLA 2FEEI 2RTTA 1CLYL 3ILPA 2V7NB 4OV6F 1C1EL 1I82A 2E27L 2R1YA 4ZJ9A 4DZ8A 1KCRH 4HG4K 5DEGA 2GSIB 4BH8B 3O4OB 4JDZB 1RUAL 3HJEA 2FHBA 4X6BB 3KR3H 2N0KA 3IJHB 4TTDC 1U41A 1A4JB 1KTLB 4UTAH 2X2IA 3ZDZF 3HR6A 3BDYH 2Q86B 2ILLA 1EANA 1IC7H 4HWNA 1ZT7A 2Q1EA 3DPBB 1T04B 5E95B 3MA7B 3MRHA 4F2ME 2ENYA 4Z0BL 2C4XA 2VDRL 4JM2B 1QR1B 2WLKA 4DVBB 2YD0A 3VA2C 3K2UH 4OVVA 5DLMH 1A6ZB 2D7TH 3DJSA 1AQKH 1NAKL 4DIXA 2PWHA 2G0LA 5AKVA 3W9DB 4Y2OA 1R33A 4YHLL 4IIQA 4JMNA 4D9RD 4ABVA 4AJ0A 3VGHA 2XN2A 3R8QA 1Z1WA 4FCHA 2H0EA 1H3TA 5ICZA 4HALA 4PRPB 2I24N 2NY1B 2YR3A 2CALA 2J20A 1HQ4B 3C5ZD 1F2XK 4HOMA 3FB7B 5BO0D 4IDJL 3NCJL 2L3BA 3CFBA 4AQ1A 4MAUH 2VXVL 3QEQE 2YS4A 1AKPA 3PYCA 4L4TD 2F54E 4K5NA 4ZAKA 3QYCA 4WWKA 5AVZB 1CXIA 4FOMA 3QQXA 4QXGL 1T5XB 3RWJB 1NFDA 1E28B 5GRUH 4JRYB 5HGAB 1QTSA 4O02A 1R5WB 1LDPH 1DQJA 4B9CA 2AQ1A 2OZ4H 1SEBB 3SYOA 1KBGL 1YEHL 2C4FT 4H40A 1JN6B 4PHXA 3LD8C 3KM2A 4LCUB 5IT2L 1T7XA 1AKJD 3IJ9A 5EZIL 3ZJAA 1HWHB 1LMIA 5EF3A 1IKNA 4OY9A 3U30C 4K2UH 4LNRA 4OGQC 2OMYA 3DX8B 4JR9L 5SWSD 4YHYB 5CGMA 5TD4A 2A4EA 1XF4B 3VH8G 1MQKL 4NNPL 1Q1JH 2R4SL 3GMMB 2VDNH 1DQLL 3M88A 4PWJA 4XZUB 4FG6C 2JXMB 4M5ZH 2JI3A 1FYTA 3EF4A 1RZFH 4I0CC 4FXGB 3NN8A 3BH8A 3VD7A 5KSBB 2X9WA 3F7LA 2CA3A 2B9BA 2DEXX 1D5BB 1S5IH 1UZ6E 1VSCA 2YKKA 4NRZA 5C6PB 1MLCB 5CLZA 1IL1A 1UJTA 2P5EE 5LWYH 3E80A 4DUVA 3HMXA 1QYGH 4KI1A 5DJZB 2BNRD 3MCLH 1GMEA 4P5TA 4U6XB 5DD0H 2J56A 1JDDA 1WP6A 1VKXA 3PNWA 1ACCA 1XF3A 1KIQA 3GI9L 4OZHF 3ZN6A 5B3JE 1GJWA 4A6YB 5B7MA 3T2LA 5EN2A 2CJ3A 2ZOLB 2X9ZA 4C83A 5C0ND 3C6LC 4NLHA 4Z3IA 1PZUB 2OMUB 2WMPB 1LK2B 5IW1B 1Z0MA 2YQGA 3MUJA 3RKPA 4OF7A 5FGCE 2AXWA 2UWEA 1T21B 2LOEA 4KVPA 1FNHA 2Z7WA 5E2TH 4JHWL 4Y16D 5F9DC 1P6AB 3C9NB 3ATEA 1JRHH 4YFLF 5ID0A 1WITA 2J5LC 4U1IA 4H88L 1GHFH 3Q8BA 2CO6B 1WF5A 3KJ4C 1MJ8L 3ZDYB 4X7SL 2VJXA 1DVYA 4JZOB 4X6DF 4QRPD 2I7OA 5IJBC 5F72S 1EO7A 3RVXD 4P4RB 4N0UE 5HXMA 4F5CA 4Y2DC 3NIFB 4U6HB 5C0AB 3O3UN 1HCZA 1XDTT 4MJIB 4UQBA 4WWKD 1U8NB 1G1YA 4XVOA 2APSA 4UU9B 4EIGB 3NGBC 4JFVA 3UTSA 4ZMLA 4K5OA 3NFPA 4J8QA 5F7YC 5JHDD 1MFEL 4AYSA 4AQAB 3UGUA 3UBXG 1VACB 4HS3B 5C9JB 4KGLA 4CMMA 4PJCB 2F1AA 1IGCH 3SIKA 4AH2A 4EVNA 3V0GA 5CGYD 3EFOB 5DYOB 1XBRA 3D06A 3FAXA 1MRDH 5FO7A 4EOWH 2VN4A 3N0AA 1USQA 2O1AA 4UOW1 4OLWL 2Z8WC 4OZFG 1ZHLA 1IT9H 1FDLH 5C0GA 2E8YA 1FYTD 3WTUA 4YDNA 4PEEA 3MGAA 3IFOA 5DO2C 1AD0B 2E9IA 5DZOA 4IKKA 1JXKA 3CMOH 3SOTA 3VWKA 1BVNP 4Z7UF 3HTLX 3T8MA 5IHZA 4KUCF 5FKAA 1TCMA 1LE9A 1TQSA 4X9FA 5LJYH 3K4DA 1E4XI 5I1IH 5TFSL 3IGLA 1T4KA 1IKFH 3DECA 3W0WA 1NGPH 2ITCB 1KTJA 2VCOA 4YIQB 2CK0L 3WJLC 2MCMA 1ID5I 1HEJC 4NXKA 2C3HA 1G94A 1BFTA 1U93B 3QA3B 4C56E 5SWZB 1DN2A 1BM3L 2FJGA 5H35A 3OKOB 5T1KA 5LAXB 1P4UA 1C08A 2CE6A 2VMEA 5FV2A 1AR1D 1ETB1 5K9JH 4H44C 1DE4A 1SUJA 3VSQA 2Q3AA 5DJDA 1G7IB 1KY6A 2DIBA 4BZ1A 3U79A 2OW7A 3BEWB 4S1QL 4K3JL 2ATPB 4OQ1A 2BVPB 3CTTA 1RAMA 2XWTB 5EDXA 5F0JB 1MCSA 2JLPA 3IJEB 4HU8A 1N0LB 2GW5A 1AR2A 4IKJA 4R8WH 3QB7C 2CLZB 4JLRA 2NSMA 5EUKA 4B5EA 2X2YA 1J48A 2LU3A 3WS3B 3VM7A 3NMEA 2R2EA 5D1XE 4PLJD 5EIIG 5JUEH 4PY7B 1S7XA 1SVZA 3NSDA 4H1LG 4MD0B 4ETYA 2AV7B 1EO8L 3LH2H 4L4VA 4Y5XA 3S35X 2RMNA 1GR7A 2CIIA 5D2LF 1ORQB 3W11D 5KEZA 4WU7B 3KM1A 5I15H 1EAJA 1MFDL 1SMAA 2YD1A 3N40P 4Y2NA 3VX1A 1SXCA 1J5HA 4FQXB 4JPWH 1JV2B 1WC7A 3AG2B 1WAPA 2V5RA 3OM3B 4AUJA 5E03A 4ABWA 3CFQA 4E41D 4JFPA 4AITA 3MNVA 2CQVA 4G5ZL 2V3FA 4NOFA 4PTTA 4ZYKB 1KENL 3E6FA 1JK9A 2WGNB 4IQHA 1CDYA 3D08A 1AJ7H 4MBOA 4Y9BA 3HUJF 3N6YA 4A7UA 4AIEA 1SVBA 4HUUA 2YK1L 3OAZK 1CLZH 4RMWA 1U8KA 3MLYH 3DDGA 3CPUA 3QSKB 4OIAA 3T3ME 5T3ZD 3EBAA 4NCC2 3ULVE 4U49A 1KOAA 1YPZA 2NYYD 3BKJH 4P04A 2EDJA 1RD6A 1G1OA 4G8GB 4L1DA 1ZT1B 1F90L 2XTJE 5AB2A 1GVIA 2R83A 2L7EA 4PJ8B 4G80B 1X5IA 1I9IL 2C9SA 3DYMA 4FFVD 5E23A 1EEYB 3KPNB 1UWEL 3UDWA 3VWKD 2WWOA 3LNDA 4BJLA 2C9QA 4MA8L 2XKNB 1U9KA 1JNJA 1HKLH 4PI2A 1W0YT 2ICEA 2OQJA 1JPTL 3W0WD 3UC0H 5JOFA 2RCSL 4ALAL 3UZEC 2HMIC 4Y4FB 5K39B 1QSEA 5CEYB 5C6WH 3TT1L 2DYSB 1ND0B 4LSDA 2I9LB 4JDVB 1EUUA 5L2JA 1MCWM 4KKLD 5DJ0B 1IBYA 1PD0A 5T1KD 1E5BA 3TV8A 1I8KA 1T20A 4JQVC 5ITFB 3FB8A 3Q05A 2VLKA 1SGKA 5C0JB 4HIHA 4YHNA 4FTDA 2VDLH 3PABB 4DOHE 4NBXB 1FL5A 3WUZA 3L9RB 3CHQA 4DEWA 3WNKA 3KXFA 4PGEB 1NC2A 3VYNA 3SO3C 1MN4A 2BIOA 4XMPH 1WISA 4TLSA 3RNKB 2BSRB 5J3HC 3SE4C 3VXTA 4DEUA 4Z7OF 3BDBA 5HHXH 1JDCA 2GJJA 5DD3H 4JAMA 5IEKB 3IDYB 4HKXA 3TIEA 4KXAA 5EEUA 3PPEA 5JHAA 3QJFA 4NQVB 5CSBA 1WFUA 3GGWA 4KK9C 4OD2B 3Q1EA 2OJEA 1OD9A 3BOVA 4TUUA 3PF2A 3UAAA 2JB6B 2WQAA 4KDTA 3GO1L 1N6QL 1H6FA 3Q9PA 5FC9A 5I1GH 5J6SA 3FO1B 5DD5L 1H6EA 1JGUL 1TZHA 5HHMD 4HD5A 2X7LA 3AS3A 4GSXA 5IGXH 4CW1A 4OLEA 4KQ4L 4W9FC 4D3CL 4R4FH 1DBAH 2Z8RA 3IMUA 4HXAL 4WZ9A 3NJXA 4PRDB 2BIHA 4P2OC 4XN5A 2E47A 3DVNA 2HT4C 2WWNA 2NCMA 1CGUA 3HNTL 3LZPA 4XP4L 1V3LA 2WLIB 3AS2A 3QIWC 3U6XS 3L3OC 3MGOA 2JKSA 1FFTB 1CFMA 3D2UB 3F3HA 4O5LL 4NAQA 2L04A 5T1LB 2QQLH 2JIXB 3GNML 4OZ4B 3HBPA 1JHTB 4PJEA 3H56A 3MV9B 5D7LA 3LJ3A 4AIZB 2RD0A 4HOXA 4XMLH 3I6SA 4RBPH 4E9TA 4XMKL 5IVOA 4Z3JA 1RQ5A 4WUUA 1GOHA 3RURA 3QZMA 2H8PB 2X2HA 1CJYA 1MEXL 1XGTA 2DTMH 4XE0A 4LHUB 2JKNA 4AQOA 5HI4C 3VXRB 3V0VB 4PGBA 2Y22A 4L5FE 5LLIC 3CGTA 1QSED 4P5SA 5FCUL 5F93C 3H9SB 4Q58C 3STZB 1EVUA 4KZEH 4MJJA 1CYWA 4P9ML 5CBAB 3WIHL 4OAWA 4CKQA 4CILA 3G08B 4LLWB 4PW3A 1T66D 4ODUA 4QOKB 3U83A 4D0BA 1FNSH 1UFUA 4YEEA 1WAEA 3QRGL 3QG6A 4P23B 3FRUA 2VLKD 2WWKT 1IGYB 3ISRA 2WCSA 3VJ6A 1P5UB 4JN1L 1JNNH 4PSRA 4TNVF 3FQTB 1U4EA 4XB7A 3HC4H 1RZGA 5ALCL 5FYLL 1A1MB 1Z3GH 4PGJA 3M6DA 4FKKA 4LPCA 3KXFD 3O41A 1NC2D 4LLQB 3L2LA 4QWWC 3H3BC 4E9WA 5GGUA 3T2PA 2EDHA 1UZ6F 3O6FA 3AU1B 1F4WH 1S3RA 2FLMA 3A4EA 3GXMA 2MRYA 2DJMA 4PJIA 4IMLB 3WFCL 1Z3RA 1TXKA 4OKVA 2H3NB 3MREA 1T6WA 4U3CA 3PDOB 2JB5L 4LIQE 3MRCA 4YFEA 1G9HA 1WICA 5HYJE 3G6JA 3QS3A 1AC0A 1OAQL 3ARBA 3ARTA 4X7TB 4OGXH 2Y0SA 2JJVA 1ERNA 3S2AA 3C5JA 3CUPB 2E7LA 3QP3A 1WBXB 3FFCA 1QVOA 3P77A 4OF6A 4NJAH 3RJQB 3UEZA 5SX5K 2DAVA 2OZ4A 4ES8A 2PPFA 5T1DH 4QRTB 1YY8B 1GJUA 1BA9A 4BRJA 5HVHC 3UERA 1E50A 1ZSDB 2W65B 1MZZA 3QIBB 4J2QA 4ALAC 2N3JA 1RLWA 3BPNB 3LSOB 1IUZA 1JPEA 1BVLB 2EDDA 4ZSOA 3VRIA 3ZRFC 4PGCA 5HGBB 1CBVL 2FD6L 1IMHC 2ZPKH 43C9A 4D8PA 3MOBL 5F88A 5C0FA 3LMJH 1JWUB 1NLBH 1ZT4A 1ZANH 3SDDC 3FUFA 4HBQA 1H5BB 4ENED 3EJPA 1OTSD 4HFWA 1N4XL 4EKXA 2AEIT 4JFEB 5AFAA 3OAWA 3VD9A 4WK0B 3VD1A 4ZZKA 5FDYA 1HYSD 4K3EH 5FR3A 4HMCA 4WLCA 3MRBA 4H0GA 5JZ7C 3B8YA 2NDFA 2K7QA 1G7HA 5DEFB 4U1HA 1N6VA 4R7LA 2QMKA 4UT6L 3BP4B 3SE8L 4H8QA 4YLBA 4FP8L 1XEDA 4CC0A 2AV1B 5L88L 2HJFB 4B9YA 5DVLA 5DS1A 4BQCA 4HFUL 2EYTB 4K15A 1G9MH 1E2VA 1UCBL 2BK8A 3MLUH 4M7LL 1SBSL 4OJCA 3DVIA 5EO1B 5CHNB 2WZ0A 3S34L 4L9LA 3BGFC 4UUJA 4FNSA 1Q9LB 5E6IA 3NEXA 4DT2A 1F4YH 1SEQL 1G1CA 2B77A 3ZIMA 2IFFL 4M56A 4WI8A 3RPIB 3BAXA 3KDPB 4ERSL 3B3BA 2WBJA 4J6IA 4I48B 5EDSA 3MV7A 1WFOA 3RTLA 3DTXB 1LD9A 1UQSA 4LB8A 1J8SA 2LTQB 4TUOB 3DHPA 2TRHA 3HPLA 4GO9A 3CIAA 4G59C 1B2WH 2ITFA 3HR5A 4GRWH 3IU3A 3OHXC 4N2AA 4BCZA 5T1JA 1GAFH 5KYXA 1JTOA 2OCJA 5J6GB 3IMWA 3FU7A 2WWMD 1YEGL 5DFVD 4Q6IC 1JGLH 1BJ1H 1GC1H 3KPRD 3O6FD 3B2MA 4I4WA 4UV7L 2VLRE 4HAKA 5TQ2H 2KZ1B 4FQIL 2W9EL 4HV8A 5I1HH 4BWTA 1XH3B 3PL6B 3BD3A 4JM0A 3D87B 3X1EA 5GGQL 2ITDB 4AKOA 4AZUA 3K71A 1ZWIA 1TYRA 4KKBD 5AW0B 5F97E 3ARBD 2E74C 2HTLC 1QSFB 1MAJA 5KBKA 4G7VH 5E56A 5H4ZA 1Y07A 3FFCD 5HDRA 5C07B 3BUTA 3QWOB 3FFDA 1DBBH 2I26N 3MRIA 1OHQA 4GKOA 1Y6NR 5BV7L 3X13B 4PB9H 4AENB 2PO6B 4KK8D 1T83C 4UYQA 5TK2A 1MFUA 1CK0L 4GP8B 3SQRA 2F5BL 2N0MA 2Z31B 4W9JC 3WDIA 5B8CB 1EXUB 4KK6D 4P3CL 3LRSA 3LIZL 4L8SA 4H1LH 2RQ8A 4N2OA 4XCEB 2X70B 5DXWA 1AXTL 2EKJA 4A67A 5DD6B 1F4AA 5T5NG 1PLGH 3A4FA 2DYPB 3T65B 1K4CB 2WVSA 5G2NA 4KWUA 2B59A 2JE8A 2NXYD 1I3RB 2GJZA 3DXAB 2COVD 1BJMA 5BRZB 1SLXA 1C16A 2GIXA 4U1KA 5D7IB 5F89B 3IXAB 2JNZA 4UOJA 3V7AG 1BF5A 2ZAIA 3ARYA 3S5YA 2ENQA 2YMXH 3AB0C 3MRDA 1HOEA 2A38A 3TESA 4XNXL 5E1QA 2QLVB 4PUBL 3FYIB 3BW9A 4NUJA 5IKCA 1CN4A 3P0VL 5KYYB 3K2MC 1DDTA 2OYKA 2JELH 3OKEA 3RL1A 1N7ML 1L7TL 3LB6C 1TO4A 3D3VB 1IGTB 1SRDA 3BIKB 3PWUA 3DGGB 3T3MF 3UJJH 1IEBB 5HVWA 4NO5B 1ZMYA 3BI9X 2NQDA 1TTRA 2WBJD 4ZFZA 5AW8B 4FE9A 3HN5A 4X7FC 1ASOA 1OCOB 2AXJA 2J57A 2GC4C 1YNLH 1GS7A 1QO3A 4I13B 3K0YA 4MJ4A 4XVTH 2XLLA 2CJUH 1Y1UA 4LSTL 1BZEA 1GOFA 3P40A 3RIAK 3VNZA 4TQHA 1DBJH 4P5RA 2WHVA 3VDBA 3VG0L 2HG5A 2BJMH 5I74C 3BVNB 2PXYC 5GGVH 4KRPC 5AW9B 3PWJA 2YLKA 1E5CA 2IIJA 4HPHA 2JKWA 3D4YA 4XODA 2Y1VA 2B0SH 1C12A 1HILA 4K7PL 4PMEA 4BXVA 3U6RB 7FABL 4XCNA 3HB3B 2F58L 4U3SB 4B3VA 1U4FA 3EJTA 2VZUA 2AEWA 2OAAA 4LAQL 2G75A 4O2EA 4F7PA 3IDXL 2EIBA 5EV7A 2NNCA 4TSBH 3TN0D 3CFJB 4KUZH 4LBAA 4BQ8A 1TQVA 3IKKA 1P4LB 2VL5A 3T8VA 4GQQA 3RL2B 2XZCH 5D6DA 4ZUUB 1GOGA 1PLAA 1D5ZB 1B3JA 4QHLA 5ECJE 5F1NB 5JOPE 1DVTA 3MUUA 1RMFL 2I27N 1IARB 3PG2A 4FQCH 1PNCA 2LV4A 3V0WL 2HPTA 3VFTB 5IV2B 1WPCA 3IB4A 1E30A 2W0PA 3VRLF 5DHDA 5BXFB 4BGLA 4YDJA 4WW2F 3V9CA 4ETQA 4Y1TA 1Y0LA 4U05A 1CFVL 1GW6A 4DO5A 2W92A 2CLRA 4K94C 4KI5C 4TVPE 1BFOA 1FFRA 2HPOA 1RP8A 2GTZA 4JO2L 1OCWL 1BZ8A 3RGVC 1DVZA 5JHDE 2V9UA 3ECUA 2DMKA 1ADWA 3L17A 2XWJB 5DFAA 5HYSG 3MLRH 2EE9A 2VXSL 3H2QA 4UNUA 3TIDB 3WO4C 4YWGL 5C86A 5C09B 2ZCKH 2WSPA 4XHQA 1GW0A 4EXPX 1JWMB 5HHQA 1KLGA 3FRPG 4DNLA 1I7UB 3QDGB 2AJZB 3WGUB 1I8MA 3L3KA 4TLTA 4CU7A 3Q8AA 2EINB 4IRJB 3ZQ9A 4M43H 4HLEA 3O6ML 2C26A 4HS8H 5BOZG 5I26A 3FCUB 3QZWA 3L6FB 1E65A 3B2UC 3GFUA 2BP0A 4JEGB 4XPTL 4XBEH 2XQYK 5EO9B 4LFHG 4HC1A 3QO1A 1X5FA 1LK3L 1MNUL 1EDHA 1UM5H 4GEJA 4GBXB 3TWCH 4Z76A 4W9IC 1T6BX 4XNYL 4S1RL 4AYMC 2AAAA 1HIMH 5JW3H 4HJ0D 1A3RH 1YRKA 5DMJB 5F9JB 2AMGA 2P9RA 1NJ9A 3ZBMA 4JS7A 2J8UE 5BV7C 5I6LA 1YHPA 1CLOL 4I5BA 3P0YH 4QXTA 4WFEE 4P57B 5ETUB 5J8OA 5L7XH 1I8IB 3KCPA 4PJAA 4IEFA 4JDTL 4FS0A 3RVTD 3SKJH 1A5FL 3EUUA 3WIIH 2E9GA 7PAZA 3RPKA 5E9NA 2FZ3B 4KTGA 1JYNA 1A7RL 1ZS8B 3TT3L 3MBWA 5TE6H 2F9BT 4O02L 2CDGA 2V6HA 2CR6A 2FSEA 1DQDH 1F86A 4GUPA 4NQDE 2O61B 1L9SA 3F58H 3SJVD 5KBLA 3SN6N 1ZLSH 3DIVA 5BRQA 2ATKA 3HLKA 1FUNA 3PLYA 2VERA 4MNHA 3ARZA 3RHWF 5A6MA 3WUWG 1U2YA 3TBWA 5KVEL 1HH6A 4Z7WA 4U6VH 4ZS6D 4E68A 4W1TA 5AVWB 3SZ6A 5IQOA 1KELH 3PWLA 1A7OL 1GPOH 1G7QB 1MWOA 2CO7A 3EYVA 2IPUK 2VDPH 3K1KC 1YA5A 4XO9A 5HHVH 4KKCD 3OG4B 4JO1L 4NKMB 4X9HA 5JNYB 2O26U 8FABA 2B5IB 3DHUA 3DLQR 1LEIA 1MREH 1H15A 2ATAA 2B1HH 4PRIE 4FL4B 3DDFA 2XKSA 3M17B 1K8IB 1ETZB 2PMZA 3E9UA 4TRPH 4FLOA 2ZE0A 3SKMB 1GGTA 4XXCC 1S3KL 3HMXL 3VM5A 1KPUA 2C1OB 1S7VA 1TVHB 3DBSA 2X0WA 4KK5D 3RU8L 4G9DA 4LAJH 4NZUH 5J9PB 2CBMA 3OR6B 4M9OA 4TUKL 4PJHE 3Q6FB 2W9DH 4A68A 5C71A 1XBDA 1A21A 1A6VH 5F70A 2EYRA 5EOTB 3U9PL 1RXLA 3E8UL 2ZAHA 3I9IA 1JAEA 5F96H 1AO7B 4I1NB 1FZMB 4EZLA 4KI5F 5IHUH 3B43A 4J3OH 3CZSA 3O3AA 3NRQA 1MKFA 1R24A 4PRNB 1CXEA 1IGJA 4F7MA 2ZXGA 1WZAA 1NC4A 1SN5A 4O58H 5GS1B 2CLVB 3MOAL 2H32A 3VH8A 2CUIA 1UD5A 4D0CB 1ZIBA 1DANT 3PGCA 2I60L 1AANA 3LRGA 5L0QC 1PFOA 1BIIA 1CDUA 2VNCA 5IF0B 2HVJA 4RQQB 2Y4SA 1YSOA 3VGDA 3GBMH 4AV5A 3OJMB 4AVJA 3FKUS 4FX5A 5LXVA 3VFUA 2WKOF 3VACA 3P2TA 4ODXA 1L9NA 4BUGA 1Q0YH 2HJKA 4WNQB 2HLEB 5AVQB 4OD1L 1MFAL 4FHJA 3BN3B 4ECNA 3ZE0F 3G5YB 2AXGA 2EO9A 2XWEA 5D4QA 3DBXA 4MX7A 2NUTB 3U4BL 3S2CA 4RAUA 5EOQH 3ESVF 3CU7A 3SQOH 2J5WA 4F7EA 1RHFA 4D7BA 4PJXA 1DDHA 4G8IB 5I76B 2B1AH 1EFXB 1UHVA 4LCYB 1EEZA 5I75B 2GG1A 3AGWA 4NFCA 1CFSA 4NRYA 3D18A 4LQFL 5C0NC 3MGTB 2OCFD 4JO8A 4YDMA 1H19A 5CILL 4PJDA 1PZ5A 1MIMH 5D1ZA 3IVKB 3OMAB 3RGHA 3WBDA 3FAWA 2CMRL 3T8XB 5EN3A 1CZ8H 1GGUA 3HI6H 2YJQA 4NQUA 3H42H 4IIQC 4UT9A 2IANB 5E5MA 4NFDA 2BCKB 3DVFA 3TVMB 2ZYSA 2ALWA 4MCZB 1U8JB 2ZCHH 1F3JB 2QQQA 1Z5LB 3FU8A 3VGAB 2PW1A 3ARRA 3P4MA 4DUWA 3UJIH 3ARDA 4M5SA 2AJYL 3QFDA 1HQRB 3LN4A 3Q1SH 3FQWA 3IDJA 1HL9A 4AQ1C 1ZTXH 4YGVB 2ZONA 1XR9A 3VFVB 3P4NA 1NGXA 1S7UA 4RMVA 3RVXC 5E08L 4XI5D 1S2EA 4OD3L 3UBXA 4ZAKC 1NM4A 4WWKC 3FTXA 4HG4J 3MXVL 4V11A 4ZMTA 4TPRH 3KW8A 2Z0UA 3RWFA 2WIIB 4JBSA 4BDVA 4BZ1L 1MPAL 3NZUA 3QQ4A 4KJQC 4NN5C 1NC4D 3ZTDC 4OZFA 4HZLB 4OCSH 4PRAA 1RVFH 2J71A 3VI3F 4DVRL 1DQQA 1J12A 1OCZB 2AQTA 1WA2X 1IM3D 2CU9A 5DJCB 1IKNC 4MDJA 4M61B 4S2SA 3WLWC 2CH8A 4DQOH 2V0AA 1Z9MA 4WVRA 3ES6A 1LO5A 2HH0H 4I3GA 3I6LD 5DA0B 5KS9F 1PY9A 3KHOA 3N06B 1N8ZA 4OTXL 3T71A 2GK0A 2CGRL 1G5GA 1MCBA 1RZ8A 1QABA 2GBUA 3LKSA 2IPUG 5HYJA 4AGOA 1KB5B 1ONQA 1AC6A 5CIPH 3BUYA 1Z9OA 3GSNH 1BJ1J 4PIBA 5D1QD 4M3KB 1TDQA 5E8OB 4ZTPL 3BPLC 2DLEA 4O4YH 1NEPA 4RWYH 4B0MM 1T1WA 2QADB 3KH3A 3DUHA 3GSQB 5CGTA 3B9KB 1JGDA 3ROLB 3MO1A 1A47A 1BHGA 2ARJA 4NUPA 2YD2A 4IHOB 3H6AA 4N2IA 2GJ6D 4GAFB 4P5TC 2MHAA 4GO8A 4JJ5B 2O72A 4F8QA 4ZFGH 3TL5A 5B1BB 5CJOH 3EJRA 1AR1C 3EYUH 4IJ3B 5I66A 4WFHE 2WV3A 1IAOB 1IBZA 5SX5H 1R5IB 1FGVH 1BXXA 5K5YA 1Z5HA 2A6KA 5D1ZD 5EIIA 4H1LA 2BSDA 5D2NB 2JJWA 4G8EA 4KAQL 3QI9B 1UJ3C 1SN2A 2PYEE 5AAWA 2J1XA 3KWWA 3WNNA 1T22A 4BFJA 1QBAA 1CIUA 1MJUH 2KPNA 3MJ8A 4HEMA 3EFFA 4PLJC 1KBBA 3HG0A 3K72A 3L9EA 3RWEB 2QZ5A 3ARDD 4ELME 3APNA 1OAXH 1E6JL 2GFBB 1JIBA 2QPEB 1QD0A 3MNZB 1M42A 3MNWA 5FUCC 3RFZB 4YPGA 1AQDA 4KC3B 1KY7A 5GSRB 3OMIB 1XAUA 2QTEA 3Q5TA 3V5DB 4ZFOB 1URIA 1I85A 4D2NA 1ROCA 3T0VA 3D85B 4TQEH 2GHWB 1G4MA 2JJSA 4NZFA 4LPXA 5B22A 4YFLI 2GSMB 2GTWA 4JFFB 3VFRB 3FT9A 4ZX4A 4WJ5A 5C2BL 2YQ2A 4WO4B 3OKLB 3MLTB 1QLFB 2FX7L 4AMXA 4ZUSA 3QQ3A 3TV3H 1JHKL 1HL5A 1Q9OA 2BVOA 4Q74A 5J13C 3ILDA 2HKFL 2VE6A 1ZPLA 3U7WH 3ZKQD 4WJKB 1YC7A 2EP6A 5GJTH 1MF2H 5E4AA 3UL4A 5HJBA 1REIA 3OLDA 4X0NA 1NFDF 2VLRA 2B7DT 1TJGL 5PCYA 4KZCA 1G6RH 1P1ZB 1TF4A 4OJYA 1EIBA 3FSWA 4FFVC 3PUUA 3RDJA 3VW3H 3RFRA 4MB3A 3CFKB 3FQUA 3E1ZA 3IGAA 2F53B 1WZMA 5EA0H 3MRFB 3MSPA 3VWKC 5F6IC 3Q6GH 5D9SB 4LLAA 2GBAA 2CM6A 2EEDA 1JK8B 3WXWL 3IN0A 1AHWB 3DX6B 3FSVA 4G42B 2NZIA 3NK4A 4BKLA 1YYLH 3TLRA 4HKZA 2D03H 2Q6WB 4Z7NB 1DVUA 4JFDE 4L23A 4PJFE 2IADB 5K33A 1CD9B 3K4AA 3EJSA 2OZNA 2QJDA 3WMPA 4OZGB 4OUUB 3BUDA 4KH2A 2BSSA 5LVEA 2COQA 3J07A 4HBCL 4NWUH 5IK3B 1DUYA 3BAEH 4PGDA 4XO3A 4JL2A 5MEPB 1KCRL 2G4GA 3QORA 1I1AA 3QR0A 4MBRA 3EO1B 3FO2B 5BQDA 1BECA 2JCCE 1V10A 1TUPA 1I8AA 4GUCA 2Y7LA 5F7DB 1CGWA 5T3XE 1KMGA 2O30A 3KR3L 3TXAA 1JP5A 4ANWA 2HA1A 1BZDA 2QR0B 2BC4B 2VM4A 4RIRB 4UTAL 3BDYL 1KEGH 2HT3C 3U2SA 4EF3A 1IC7L 2OXGB 3HBQA 5I1KH 2UWEF 3IMBA 1SXAA 1L0PA 3L3IA 1HHKB 2VN7A 3B2DC 5EUOB 2DQCH 2AXFB 4CADA 3PY9A 1U8HB 1V54B 2EXSA 3K2UL 4IBLT 1FH5H 5DLML 2D7TL 5IM7A 4M02A 1AQKL 1KPRA 5FECA 5C0CA 4NQCE 3UADA 1IM9B 3ILQD 4OT1H 1NCNA 1LP9E 4M4RA 2NOYA 2XXFA 3KPSA 5KVMC 5FOJA 3VU1A 2WYZA 1HHJA 4PREB 3RLSA 3TEUA 3W82A 4ZD3H 2CUHA 3VTAA 5I6MA 5INDB 4KITB 4MAUL 3KYMB 5E5LA 5H2BB 2XXGA 2LLGA 4WTXA 5EEZA 4M8QB 4DF9A 5CCJA 5IJVB 1PKQA 5DK2B 4UAOB 3ZDZB 1EDQA 3OG6B 1U2CA 5AAPA 2E7MA 2ZXAA 3RI5F 1E9PA 4LRNH 1S7WA 2WQ8A 1J1OH 1TETH 1B9ZA 5GRUL 1GYAA 4MZ2A 5D96B 3UDWC 3LN9A 2WQUA 4H7VA 2G2PA 1LDPL 4CGUB 5E94B 1F6AA 2BVQA 3X2QB 2OZ4L 2GITA 3PGDB 1LEKB 2J1WA 1NBZB 2YSSA 4PP1C 4B9PA 3QQNA 5AVRB 5AW4B 1YMMA 5HTSA 3WI9A 5EF1A 3ZDWA 1X5JA 3GXNA 1SLUA 1V7MH 1Z6JT 1EGJH 3BDXA 3BLPX 4K2UL 3TA3A 2EYSA 2H6PA 5CD3A 2EXYD 4LOFA 2EUWA 1Q1JL 3F05A 2V5YA 2VDNL 4G8FA 3DNKA 4ZTEA 4QEGA 4M5ZL 4P5MA 1RZFL 2VAAB 4G9FA 3T1FB 1HAUA 1WGVA 5CINH 4NKDA 4YSDA 4ZTOH 5T3XH 5CEXB 3CN2A 1S5IL 2R0LH 5FS5A 3WJMA 4UQ3B 4NQSB 3R19A 3QORD 1I1AD 3KPPB 3CU1A 5JXAH 5LWYL 1DBMH 1JCVA 4QCIB 3V0DA 3VXUD 1QYGL 1Q9WA 2PCXA 5IG7B 3AJ7A 4OW6A 4F7TA 3DGDA 4ZXBC 3MCLL 5DYFA 3BP6A 1I9EA 4XT1C 5DD0L 1WZKA 3RWDB 2FEJA 2CDEB 3IPEA 1BQHB 2H6OA 4Y19E 1INEH 4W6XB 1PJ9A 4QRQA 2R2BB 2QDWA 3CPLA 3B1UA 2DOCA 3ZTJG 3KVPA 1PW3A 5IB3B 2XWBB 3O6KH 3T4AB 4UDUA 3DJTA 3LQZA 5TDNB 2OL3B 4QJ3B 2FJFA 3QCTH 4YSTA 3T08A 3ZO9A 4X4YA 4PVNA 5C0CD 2DH3A 3QXAB 1TSRA 1BXAA 1NCGA 2X2UA 3IDNA 5E2TL 5I6XC 1NLDH 4Y88A 5G5DB 1HU8A 2Z92B 4J1UB 1JRHL 2WY3B 3CN3A 1ZGLA 1F00I 2A9CA 4OIBA 1DCLA 5KN5B 1FL3B 1WG3A 1GHFL 1ORSA 5IMOA 2IV9A 3ECBA 4X4XA 2GAZA 3ULUH 4N3TA 2YAHA 3L3HA 5AVUB 1U3ZA 2C9PA 4APQB 2NUPB 2WQVA 1EZUA 3QR2A 5J57B 2LQRA 3UTZA 1HYSC 2ENSA 3QDJB 2VR5A 4OZHB 4QRRA 1PZSA 5K9KA 4PRHE 1SDAB 3MUGB 1S7TB 2GUOB 2R1WA 3AABA 2Y6SC 3VGBA 5SWQA 1YPZF 4YSPA 1OGTA 4QHMB 5EU4B 4ANUA 1N18A 3ZT5A 5MI0C 3QO0B 1INQA 4WRLA 4F8TA 4W70A 3F84A 1IGCL 1YMMD 1IBGH 4RLDA 3TA3D 2CNZA 1MRDL 4EOWL 4CVZB 1TSHA 4WI0A 5K1VA 3T0WA 1A6UH 1NZRA 4HZAA 4KO9A 4MD4A 1IT9L 5DMGC 1FDLL 3EG9B 4JVWA 4WI9A 4G9FD 4X6DB 1XHHA 1WTGT 3CMOL 3D2TA 2EDKA 3FUEA 2G3MA 3BEVA 4MYWB 4FFWC 5AENA 1BAGA 3RZWA 4HUXB 4NDMA 4PJHA 2MCPH 1XGZA 3FQ4A 1MVUB 2N56A 2BDNH 3OBAA 4XNUH 5I1IL 3UBHA 1PVHA 2OYPA 4L29B 3SOBH 1IKFL 4AW7A 4S10A 1NGPL 2X3AA 3O6FC 4X8XA 4X7CC 2A6JB 4MQ7A 2YXVA 2DQJH 1X3DA 5CJBA 2C1PB 5EBGA 1XGYH 1TQTA 2NY6C 3V4PH 3VI4A 5AD0A 1TR7A 4G6JH 3LKQB 4RFOH 3OKKB 1CICA 2X5PA 1WTLA 4HK0B 5CZKA 5JIQA 4X8JA 3C60B 1L9RA 1RURH 1XF5A 1M6OB 5K9JL 1IZKA 3ARBC 3K6NA 3CFUA 3K8KA 5E9DE 2E7LC 3H7BA 1OALA 2AP2A 2GIMA 1XIWB 5E1AA 2B39A 4OGAD 3RJDA 2YA0A 2IDSA 1H3XA 1OQOA 3LKOA 4Y7MA 4R8WL 4IRSA 1B0GB 3WIFA 2V3EA 2DQGH 3PAUA 2Y3NA 4LCCB 4KK8C 2P80D 4GUOA 4Z7UB 3B5TA 5KTEH 1N2RA 5JUEL 4HJGB 4UANA 1TIUA 2PCYA 2C9AA 4NOBA 1TFPA 3LH2L 1BD2E 1AGCB 3AWEA 3N2JA 1L9TA 3CSBA 5I15L 5HDQH 1AVAA 4AYBA 4NC1E 1FCCA 4JPSA 4OCLC 4ELMF 4U4IA 2A74B 4JPWL 1W72H 2FL5A 3UTPE 5DHYB 3CXHJ 1K85A 5CIPA 3QDMD 4KVCH 4NO2B 1GY1A 5EZOH 1LE5A 1OSZA 3FCGA 3L4VA 5JIPA 5D4JA 5B4MD 3HE7A 5DJ8B 4MNGA 3AMKA 1DUZB 1NIDA 1T2JA 2BCMA 1NFIA 2Y7QA 1AJ7L 4N0CD 3TBVB 4B9IA 5J1TC 2BXYA 4Q7DA 3LEXB 1JCKA 2CHWA 3TNNB 3EGSB 5IR1A 1CLZL 4U1LB 3MLYL 4L9LC 4RDBA 4UQIM 2F61A 5E6IC 1BOGA 3WS6A 2YFNA 5IB5B 5CZXD 3BKJL 4YPJA 3T5WA 3TO2B 5BVJB 1ZOXA 1J9RA 4XWOD 3V6ZB 4PJEF 2DM7A 5KZCD 5IIEB 4GKLA 3WTYA 2Q8BH 3MRPA 2WBJC 4HDIA 3C6LB 3E6HA 3OXRA 1OSPH 2Q7NA 3IDIB 4ANKA 2XBZA 4OQTH 5AB1A 1RPUA 5D2LB 5FAAA 2WN3A 4QRUB 4GT0A 1J88A 3S3DB 4X5WA 3FOMB 4R3SB 2CO1A 3KPQB 4OH2A 3MRKA 4MZIA 5C08A 4ZMOA 1WBZB 4WEMB 3FUMA 3LXAA 3OC8A 4LSVH 4P4KB 4WHCA 1HKLL 3I6GA 1KIUB 3UC0L 4PRPE 12E8H 1ZVSB 1OSEA 2XJKA 2PPCA 1QLEH 3HUJB 2QPUA 4JFQB 3QNXA 3RTQC 1T0NA 3FW6A 4L2YA 1P4BH 2XHNA 4NQXB 4N22A 3WE6A 2NZ9D 3B5HA 1CICD 4Y2DB 5GRZA 4R0LC 5GGSY 4ZX6A 1AXIB 3M45A 4PJFF 3NQIA 1MUJB 4B95C 2NY2D 4CU6A 4M00A 2OR8A 3NGBB 5IQ9A 2G2RB 2WNXA 4ZT1A 2X4UA 5F0MB 2DDQH 1KXVC 1RIHH 4R7VA 2VDLL 1AIZA 3ETBF 4FNUA 3V52H 4I3SH 5M7QA 3F7YB 4JRYE 4WDIA 4MKTA 5EBWB 4IRSD 2EEXA 3O2WH 2FJHA 4PJIF 3GKZA 4I2XE 4XMPL 3EYQD 1QPXA 4XPAH 4WSKA 5HYSA 2Z6FA 2QHRH 5HHXL 5DD3L 1T1YA 1C5DB 3SQBB 2BOCA 3DRTA 4HX1B 2XFXA 4L8SC 3RWGA 5TDOA 1G6RA 4GW4A 2OK0H 3C8KA 5ECGA 2XQ0A 3ML8A 3O0RH 2QSCH 1NGWA 3NDYE 5DZ9A 1ACZA 1UOKA 4NP4H 3FRPA 2NNFA 2PTVA 3HA0A 4NQQA 2VR7A 1XGRA 5AZ2H 4JRXB 3PAZA 3A23A 4ODSH 1FL6A 2KKQA 5I1GL 4NP9A 1UOLA 3S8FB 1WCBA 3MRRB 2XWZA 2OMXA 4F7KA 4NC0B 4AVHA 3COOA 1IILE 2X10A 3HE7D 3GJEB 5KSBE 5IGXL 4MAZA 5DJYB 2EH8H 1VENA 1CG9A 2GCYB 4MA3B 3NCMA 1HH9B 4R4FL 1PYWB 1AGBA 5CU9A 5E2JA 1DBAL 4I0PB 2ZXEB 1VF5C 4XN2A 2DM2A 1LP9F 4ANVA 3CVIH 4FA6A 2QSQA 4ZUVB 4E42B 1TITA 1UKSA 2WTPA 1ZLWK 4Z7OB 5EBMA 3KYAA 3LVEA 1H6UA 2QQLL 3KS0H 4LT7A 3B5GA 3QG7H 3VMPA 5IW6B 2VWEC 3S6CA 1T5WB 1AS8A 2ICWB 3FT4B 5I17A 2YC1B 3I2CH 1KULA 2P52A 2YPVH 1DYZA 4XMLL 1O9VA 1J0JA 4G7YH 2GJ6E 4QRFA 1S8DB 2DM3A 1UVQA 3O4LB 4RNRB 5C08D 4HXBH 3SSGA 2Z9TA 2CUAA 3K7UA 3TFKC 1RIVH 4FQQA 5LAPA 5J12B 2PWFA 4DJMA 4YLCA 4HK3N 2DTML 3KVDD 2OM5A 3RVTC 1KSRA 2WQSA 1DFXA 3A5VA 1A6PA 2WN2A 1P53A 1IC5H 3WUWA 3QNFA 1WQVT 4DKAA 1KIPA 2GY7B 3AT8A 3W56A 3EW3B 4HAGA 1FO0B 1GL4B 1AI1H 4Z5RB 5BW7A 2Z3FA 3ROOB 2WINA 4KZEL 4XTRD 3M1CA 4XWGH 5HHOA 2XBTA 4PJ7A 3EH1A 1N26A 4XNBA 2TSBA 2K6ZA 3IJYA 3RWCB 3TBYA 3OAUH 3NIFE 4HJTA 1JG9A 5C0AE 3H3PH 4MJIE 1FNSL 3VB8A 4ZS6C 5D6DC 3WFHA 2NY4B 3OPUA 1VHPA 5DHVA 4LHUG 1J05B 4LHQB 1E5UI 4RGND 1JNNL 4PB0H 1KCWA 3HC4L 5DRXB 2DRUA 1Z3GL 1SZNA 5FGSA 1I7RA 3BHBB 3X12B 2YPLB 4TNWF 1AHKA 4KKCC 5JLZA 4Q6KA 5IVXA 2ESVB 1QBLH 4HGWA 1QA9B 4F37K 5KSVA 1W9XA 3EYOB 1F4WL 2O6FA 3ZU8A 4PJCE 3RUGA 3O45B 3LH9A 3QPQC 4K7PY 1R3IH 1EH9A 2WXMA 4K8RH 2LVEA 1VA9A 3FH5A 1NANH 4KKZA 1A7QH 4RDQG 3ZTJH 4KK5C 4JG9A 1LILA 3BVTA 4GLRI 2LFGA 4OGXL 2P48B 1XQ4A 5F1IB 2XNAA 2YWYA 4NJAL 1J5DA 2NLJB 3J2PA 3MCYA 4IOIA 4MD5A 3LZLA 5T1DL 4ADIA 1DLHB 2Y5QA 1OE3A 1CGVA 5A16A 3T0EE 3UTTB 3VFOB 4ODTH 3ZE1B 4LFHD 4PJ9A 3RJOA 4MCYA 1EGJA 4MS6A 3L4TA 3GMLA 2ZPKL 2EC9T 4W4OC 5ERWB 1CDCA 4F8PA 4IMKC 4G1EB 2NCEA 3LMJL 1NLBL 2B16A 1ZANL 3LAFA 5F0PB 4YDVA 1Q1PA 2XWXA 4EZJA 3IJSB 1SN0A 4OFPA 3UMTA 3GB7B 4QHPA 2AJ3B 3GBNH 5C92A 5SWZE 4H5SA 1KFAH 2JQMA 1D7FA 3TNMB 4K3EL 4WI4A 1XMEB 1X5HA 2Z35A 4KMTH 3TO4A 1JPFA 1IVTA 3TA4D 1DJSA 2K3HA 1KACB 2ZQKA 3PWVB 4DHLA 3FQXB 3ECQA 4YJZL 3NJFA 1G9ML 3PXJA 2VUOA 1NCUA 2P5WA 3MLUL 4L0ZA 3AS1A 4TNGA 5F9WC 1UB6B 4G71B 3K6IA 1S9WA 2H0JA 3TEXA 4X98A 1MWAB 1TJXA 4G6MH 3B2PA 4NQCA 3SY0B 4ICXA 5LHDA 1F4YL 4JPKH 2NY7H 1QR4A 2D8KA 2CSPA 5GIRB 3SDCD 1BDYA 4JFHD 2YRBA 1SHMA 5HHOD 3ZZ1A 3U1SH 1SFDA 2YD4A 2CGZA 1LWJA 4ZS7H 4U1SA 3NIDF 3CFIC 1B2WL 5FDWA 2Q76A 2P8PA 4G6AC 3EYFB 1GAFL 1VFOA 2EKSB 3ZDXF 1X4XA 1OLZA 5FM5O 3QUZB 3WNJA 2DQFB 3VRJA 3REVA 3WY1A 1JGLL 1GC1L 4U2ZA 3KYKH 1BZ9A 2D9CA 4WI7A 4YHKH 1JGEB 4CVXB 1UACH 3FUIA 3ARGA 3QIWB 4A39A 5IOKA 2VQTA 5TQ2L 4LLYB 4LLUA 5I1HL 2P8MB 3ZR6A 5GISH 3T2OA 3D0LB 1R9FA 4G8GE 3RDTB 1GRWA 3FT2B 1Q0EA 3WFZA 5T1MB 5HSFA 1CO1A 5LKNA 2IEPA 5AUMA 5CLTA 5I16B 2XQBH 4MJ5A 3G5XB 4FZ8H 2UXVA 4HIXH 3OR7B 4G7VL 4XI5C 2WLLA 4WWID 4XN7A 3TP4A 2G60H 1DBBL 3UX9B 1HZKA 1BX2A 5GS0H 5IBTH 2WM0A 5HYQA 4U6YA 4CMHC 4PB9L 1CQKA 4UDTB 1QFUH 4XBPB 3O11B 5AL8A 4PJ9D 3Q48A 1QRNB 3BYTA 1ET8A 2A9DA 3PHQA 2HLFD 2R7EB 4Y5YA 4MXVE 1J1PH 4F7CA 4MWFB 5K59F 2BOBA 3BP5A 3U9UA 4G43A 3SE3A 4FADA 3SBPA 4E0RB 3S88H 3JTSA 1PLGL 4P06A 2YRLA 1R3LB 4FHKA 3PQYE 3N55A 3VD5A 3GMRB 2ADFH 4WEEA 3ABLB 1T03H 3H0TA 2V2XA 1G7JB 4OB5H 5FV1L 4DGWC 3W5MA 3TO4D 4EAEA 2AI0H 1T89A 2YKLH 1S7SA 1M05B 4OLZH 1EERB 1UD6A 4ONHA 1EXHA 4XAKD 4XE5B 2YMXL 4MDRA 4C56B 2VUKA 1ACXA 5E8NB 4ILDA 5EIVA 2P5WD 3RVUD 4KV5F 3FB6B 3L7EB 5KSAB 4M5YH 1OAUH 2Q7YA 3V4PA 3UZQB 2JELL 4FNLH 4NENB 5DCCA 3BX7C 3C8HA 2EVIA 3BH9B 4I18B 3UJJL 3CVDA 4YBQD 2P24B 2WXOA 1NCDH 3STLA 1FFPB 5AW6B 2QGEA 1MCLA 3BKYH 3ASWA 5D1XB 3S3JA 3VXUE 1YNLL 5DURD 1DQMH 2WB1A 1HHGA 1T1XA 4JFXA 4K7FA 4GRMB 2Q87A 2P26A 4XVTL 1J9SA 5IHBA 1RJYA 5I8KH 3L81A 1AFVH 2CJUL 5MEOA 1YEWA 1NEZB 5D1ZC 1DBJL 3OMNB 3AMLA 3LZRA 1KUMA 4XBGA 3JT0A 4BFRA 3DOIA 2BJML 3ET9F 4XAWH 5GGVL 2YUVA 4BRVA 4PRHA 5ANMB 3ULUD 4FCAA 4NM4H 5A40E 4ZNCD 5KOVC 1BG1A 2XC8A 3ARGD 3DUUB 3VFSA 1ZA3A 1R75A 5BCAA 2B0SL 1W72A 4LKCB 1PZ3A 4Z7WF 4JY6A 2VDKH 3FTVA 1XT5A 5LNEA 1V8HA 2IF7A 3ARDC 4NIKB 2WTOA 3UTQA 3HNSH 3QUXC 4LLVB 3IYLW 4TSBL 4KUZL 3BZ4B 3T3MB 1ED3B 2XPGB 2AMUA 4PJGA 4OLXH 1NPUA 2XZCL 3S36X 1MG2C 3MV9E 3SCMB 1G9MC 5HYEA 1JTPA 3ZRSA 4FQCL 4Z3GA 3HC0A 1JL8A 4NM8H 4MDIA 4L3EB 3U4KA 4KBPA 2AHIA 2XVKA 5BZWA 5M94B 4HK3J 4XPFH 4JGUA 3P9MB 2ZWSA 1TVBA 4HKBB 2TSAA 2W95A 1MLBA 3VXRE 4YHOH 3ZHKA 5EU6A 2ZOOA 2C3VB 2XRAH 4OQTA 4MA7H 2H26A 3H9SE 1A4AA 5HJ3B 1KIRB 3TZVA 5I2IA 2WZ5A 3CVHH 3U4EA 2DPKA 1ZV5A 2OSLA 5CWSB 2FR4B 2YXMA 3MLRL 3C6SA 4ISVA 2CNYA 2VXUH 4JE0A 4QOKE 2WXNA 2UXTA 3II3A 4NPYA 4OI9A 1MG3C 3DSNB 2IWGA 4JFUA 2ZCKL 3ZQXA 1LO3H 3RX7A 2WXKA 5FM5M 1I3GH 2QGDA 2FWUA 1GC1C 2LE9A 1B90A 3QEGH 3HZYB 1I8LA 4XXWA 4DCQA 4AYFB 5A2FA 5KSBF 5DMIH 1KLUB 1CD8A 1UT9A 4M43L 4HS8L 3UZVA 2BSCA 1ZVNA 5DJAB 4AIXA 2FIKA 4LP5A 4WW2B 1WD9A 1P5VB 5JHLH 1BFSA 3F7QA 4XBEL 2P28B 1R3HA 2W0FA 4YR6A 5DRZA 1D9KB 1VFAB 1UM5L 3TWCL 4YDKH 2LABA 3SKOB 2I5YH 5I1DB 2AQQA 4UZUA 5IFAH 1UWXK 1KT2A 3SGJA 2K8QA 4MMZA 1A9BB 1HIML 5JW3L 1A3RL 2MOGA 5IHWA 4QHUB 4Y4KB 2WYTA 2DBLH 3IBOA 3ABMB 4UQ2B 4X2UA 3P0YL 4FHBD 5EPMA 2NTSP 4GKNA 3AQYA 5L7XL 2J8OA 2BNQB 2P8LA 4AQEB 3DURB 2V2WB 3SKJL 5MHSD 2OSXA 4MS8C 2YA2A 2UYLA 4X5QA 3VXQA 3WIIL 1YY9D 4PJXF 4CSSA 1UXSB 4A7TA 5AAWC 3E7JA 4KOBA 5E1GA 4MZRA 2HFFA 5TE6L 2UY7B 3EOYG 1WRFA 1IZJA 5C0RH 2WW8A 2APVA 1VADA 1DQDL 1ZD6A 2N7BA 3GXDA 4GSDH 1IAMA 5I8CB 2GT9A 2GSIA 3QEUB 2ZOWA 4HMDA 4JFEE 3A6CH 4PJDF 1ZLSL 5H4YA 4JDZA 2NXZD 1NEUA 2EACA 4FC3E 4DP0X 1QTYT 2F8VA 3HRZA 3M1OA 2ZTBA 5AOKA 1CCZA 4U6VL 4PBXA 1KELL 1KTLA 1GPOL 3AB0B 1I85C 3ZVVA 1CBJA 2VDPL 3BRGC 2L4OA 3W5NA 1AP2B 3I02A 1NL0H 1MHEA 1IGMH 1W15A 3MA7A 3BYYA 5HHVL 1ID2A 1L9QA 4R4NC 2EDLA 5CO1A 4AEIH 4AE1A 4LGSB 1FLRH 1MREL 2B2XH 1BGXH 2DMHA 5CUSH 2B1HL 4WGVB 4DVBA 2C7FA 2ZXWB 3RVWC 1PAZA 2W59A 2X89A 1A6ZA 5DRWB 4GSQA 4I88A 4OM0H 4JKPH 3VG9C 5EU6D 4TRPL 3W9DA 5DC2A 1KJ3H 3KLAB 4C54A 4DEPB 3DVGB 3HE6A 3KS0J 1EZLA 3TZVD 1BQSA 2YPVA 4AT6A 4NZUL 4POZD 1VCAA 4PRPA 3RWIB 3WN5B 3VD2A 4H25A 3KPLB 2OTUA 2W9DL 1L9OA 1BZ7A 2G3XA 4R2GD 3LIUA 3DX7B 3F7VB 1A6VL 4DWHA 2WVTA 3DETD 3HAEB 3U46A 1NMCB 1FVDB 5C6TH 1IFHH 4UINH 4DP4X 5F96L 5IZ7A 7TAAA 4JDEB 5IHUL 1M7XA 3SDAA 1NA8A 4JHZA 3NJHA 1PCXA 2XYCA 4GAJH 4HUNB 4U1MB 4PTUB 4O58L 3CK0H 4EN3C 2R23B 4X5RA 3F8UB 4GRWF 5E2UH 4N5ED 1ECYA 3P9LB 2X1PA 3VXPA 4DKEH 1SHWA 4EZMA 5DS8B 2L8AA 5JHBA 2EADA 5KVFE 2EXYC 3IS1X 3GBML 1QSFE 4PV8B 1AY1H 4L4JA 4UQEA 1WE5A 1XGUB 2FEDD 4KVNH 4B9JA 1Q0YL 2I85A 1USZA 5C07E 5IQMA 5ID1A 1XF4A 2X41A 3E1F1 1JERA 2X4SB 4DW2H 3CSYA 3RKDD 2AERT 4ZW6A 4LRIC 3QORC 3QUKB 1DEEA 1I1AC 2R2HB 2X4RA 2WLZA 3DOSA 3CVCA 5EOQL 4RSVA 3SQOL 4U1JA 3S0PA 3BZ5A 3TJHD 3NZSA 4EXKA 4P9HH 2AQPA 5IB2B 1A2YB 3ZRCC 3KDMB 4V1DB 5ESAB 3ZL4H 5DT1H 1XH1A 5I8EB 2B1AL 1UXLA 1M1XB 3GKWH 3NSJA 3DXAE 4X7DC 5BRZE 3N3EA 1CF8H 4U6XA 5D7IE 1FFNB 4D9QE 5CMAA 3IDGB 4M93C 4PCSA 1XB6A 1F1GA 2YPKA 2ADJA 2FSDA 1MIML 1QHOA 2ZOLA 3B6SA 3F7PC 2BO0A 1OK0A 1CZ8L 3S5LB 1CMOA 3HI6L 4K9EH 1NDGB 3H42L 1ODAA 1G7MB 1GZQB 3SE6A 1V3KA 1LK2A 5IW1A 3LV3B 4PLKD 1BM7A 2VMDA 2AVFA 1RSYA 3NH7H 1KYFA 2Y2WA 3ZE0B 2ZCHL 3FN0H 2NW2B 1CL7H 3D3VE 3OJ2C 4K3HA 3HE6D 3UJIL 1MCPH 2IWFA 2GEQA 2VGLM 2HFEB 4YNYA 1ZLWH 3TCTA 3C9NA 3HZKA 4AGMA 1YUKB 3Q1SL 1KN2H 2XWDA 1KGYE 1ZTXL 2IGLA 2IDUA 5BZDB 5JPMA 3GUTA 2CO6A 1K8DA 5DK0B 4XRCB 3U6XA 4QF1B 3QJUB 4M8RA 1Z5YD 3WMSA 3IWVA 1JGIA 1T0MB 1SJMA 4JZOA 4ZPVA 3ZYIA 5KAQG 2YRPA 2MPAH 4P4RA 3SDAD 4TPRL 4ZUWB 4LCIH 4U6HA 3G5ZA 5C0AA 1J0IA 3BAJA 1NGQH 5TGBB 4FFTA 2DBJA 1U8NA 4RMQA 4YO0A 2E6PA 5EZLA 3T0AA 4XCCH 4UU9A 4DP8X 5DHEA 2AAVA 2JK5A 5I1EH 3LS5H 5GSVB 4OCSL 1MIEH 1S7QB 1RVFL 4DGIH 3DV6B 2HTKD 1HWGB 1KF9B 1RL1A 2XX1A 4MXVF 2OMVB 5C9JA 3SZKC 1IQDA 4DQOL 4PJCA 1G0XA 1E9QB 3KYOB 2HH0L 4HHWA 4MCNA 3QCVH 3KAAA 4ZX3A 1N67A 1SDYA 3EFOA 3VTTA 2XTSA 3MV01 4HUWA 4E5XG 1ETJA 2NY0D 3OAYH 2JI1A 4FKHA 1JMZA 5L4JA 1OSYA 4IBVA 3GSNL 3L4YA 3MFGB 4O4YL 4Y1AA 4RWYL 3MR9A 2CD0A 1UD3A 4J3VA 5IJDC 1ZHNB 3RILA 3AT0A 1MCQA 2W60B 3C5ZB 4ABUA 2RBLA 4XZ4A 1T1ZA 2WVUA 1JXFA 3GMPB 1D5XA 1R3JA 1KJVA 3UGEA 1P4IH 1K6QH 4UMGA 1UH2A 2JJTA 1U3HA 1MDTA 3L5WB 2FJSA 4L4TB 4ZFGL 1QG3A 5AZUA 3NFNB 3VI3B 1T7YA 2FGZA 4HWZB 5CJOL 3SE9H 4FQPA 5JPNB 1JYWA 4HH9B 1P1VA 3EYUL 5CEZD 4J3OC 4X6CA 3F6JA 1RK1B 1DVFA 3MXWH 1ODUA 1SMOA 4RCAA 5C09E 3WFEH 5I73B 1FGVL 3I3BA 3IFPA 1QKZH 3OKOA 5JW4R 4NQTA 3BISA 4CAGA 3KGSA 5KS9B 3QDGE 4OGAC 1F11A 2D4DA 5FKPA 3P1VA 3KEHA 3IKCB 5BUPA 4XR8C 3G6DH 1G7IA 1BBJA 3O3DB 2ATPA 2WVVB 2BVPA 4M6MH 5E8PA 4ZX5A 1MJUL 3PWNB 4EUPB 5FO8A 1AKJB 3HEIB 4M7ZC 3CFTA 4MJHA 1G5AA 4CNIA 4UB0H 1OAXL 5SWSB 3Q3GB 3X11B 3FFOA 3O6LH 5DR5H 4DAGH 1BIHA 2YAPA 4NGHH 3L7FB 4BFIA 1HHIA 4MD0A 4OCRH 4O2FB 5J89A 5C8JA 4P2CG 1ORQA 4Y8DC 3SKUD 2RACA 1NIEA 4TQEL 5IB1A 3ILPB 2QELA 3FJTA 1BQKA 1ICTA 3ZUCA 2OBGA 3ZTCC 2R1YB 1WHPA 4DZ8B 2CDFA 1PBYA 3EDJA 2D7MA 4PH8A 5I18H 4R7DA 2H4EA 3ECVA 4C4BA 4KKQA 3CQPA 4LSPH 3TV3L 3SBQA 2BNRB 3GSRB 1IJNA 3ALPA 3X1NA 5JQHC 3DO7A 2E7BA 4ODHH 3U7WL 2C34A 5GJTL 1MF2L 2EICA 4K3GA 4XWOC 1ZT7B 4B50A 3WNPA 5I24A 3G9AB 3MRHB 3J27A 2CK2A 4GRLC 1OK8A 5EC1A 4EE2A 1G6RL 2G5BB 5F8QC 1FSKC 1PY4A 3VW3L 1ZT1A 4BFKA 3UJTH 5EA0L 2XOTA 5D55A 1TJHH 2JFCA 1OGSA 3Q6GL 4G80A 4IIQB 4Y16B 5FEBA 1DLFH 2VT0A 4Y1AD 5D70H 5ICZB 1HXYB 1EEYA 3KPNA 1SLWA 3D09A 4NO3A 1YYLL 1JS4A 2EEAA 3FN9A 1IJ9A 2VN5A 2D03L 1JNHA 2XXMB 2CCLA 2XKNA 5DC0A 1FV1A 4O51A 2PR4H 3REWA 3CFBB 4AQ1B 4OLVH 2HWZH 4GG8A 1U3HD 5L4MA 3N1QC 4QRPB 4YZFF 2DLFH 1HSBA 4Y4FA 5GS0D 3FSOA 2YBGA 2X4QB 3GMOA 1RULH 1NBCA 3GZKA 4NWUL 1DVFD 2PW2B 3B7TA 3KHQA 2NY2C 5D7SH 1EK3A 1WV7T 1NFDB 1XCWA 3BAEL 4ODBD 1AO7E 4N1EA 4NUQA 5JHDB 2HVBA 1J0ZA 3D9AH 3GSVB 3P9WB 1SQMA 1T7ZA 2JH2A 3QJOA 1DQJB 3IGFA 4FG6D 4OR1A 4X9BA 1CTMA 4FNPA 3CVHA 4FZEH 2Y72A 3PABA 4A2HA 3GS4A 5K9QI 3QZPA 3QNYB 3L9RA 1Q94A 4R6UA 3F12A 4Q0XH 5ACLA 4LNRB 2OMYB 2NPLX 1KEGL 2UY6A 3IETB 1QPPA 4EBQH 2QSTA 5C7XH 3SDXE 5I1KL 4PS7A 3TCXA 4HULB 2IFGA 4N2EA 4WTZG 1TENA 2DQEH 4LP8A 4HA1A 3WJLA 2DQCL 1FYTB 3GEWB 3MCG1 3NN8B 3BH8B 4NQVA 1FH5L 3KJ6H 3FB5B 4MNQA 3GLZA 4ZFFB 3HE7C 3MX0A 2JB6A 4Z7AA 1DQVA 3QAZB