1BDYA

C2 domain from protein kinase c delta
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
123
structure length
123
Chain Sequence
MAPFLRISFNSYELGSLQAEDDASQPFCAVKMKEALTTDRGKTLVQKKPTMYPEWKSTFDAHIYEGRVIQIVLMRAAEDPMSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMCVQYFLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium-binding
molecule keywords PROTEIN KINASE C
publication title Crystal structure of the C2 domain from protein kinase C-delta.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 20
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 1998-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 1bdyA00
4XZ4A 4QJ4B 4XX5A 4OVUA 3HHMA 3FDWA 2WXPA 4KZCA 1UOVA 2CJSA 4IQHA 2Q3XA 1QASA 2Q0ZX 2K8MA 2WXRA 2WXMA 2WXHA 3ZW3A 4ANXA 2DMGA 5CCGE 1DJIA 3APFA 3JZYA 4NPKA 4QAMB 4FADA 2YRBA 4G11A 1DJWA 4LT7A 2K4AA 3W57A 2LHAA 4EZLA 2CJTA 4FJZA 2JQZA 1RLWA 3L9BA 4DNLA 2NCEA 4LCVA 3S2AA 4NP9A 4BFRA 4BGDA 4URKA 4OVVA 3N5AA 1E90A 4F92B 2ISDA 1DJXA 5H4ZA 1E8WA 1V27A 2CHDA 2N1TE 2WXIA 4FJYA 4ANWA 3ZVVA 2NQ3A 3MJWA 1DJYA 4TS6A 2Z0UA 4FULA 5G2NA 1HE8A 4PS8A 1YRKA 1WFMA 1W16A 4WWOA 3ENEA 2ENQA 1DSYA 4GB9A 2ENJA 3DBSA 2CM6A 3L4CA 4KITB 1TJMA 2WXGA 4V11A 3IM1A 3CSTA 3T8MA 4A55A 1W15A 4TUUA 3APDA 4WAFA 4QJ3B 2CHXA 1WFJA 2NSQA 2WXQA 2UZPA 3IBEA 3QK0A 1QATA 4Y1SA 1CJYA 2D8KA 3TWYA 3QJZA 3F04A 4KZ0A 2WXNA 4DK5A 1DJGA 3HN8A 1GMIA 2YOAA 1DQVA 3W56A 2KI6A 4LDCA 2X38A 5H4YA 4L1BA 1BYNA 3PS6A 3R7RA 1E7VA 3R7QA 1UOWA 5CCHE 3ZIMA 4EZJA 3APCA 3B7YA 1A25A 3QR0A 3L13A 3ML9A 4Y1TA 4ICXA 4F91B 2WXKA 5JHBA 2V4LA 4EZKA 3NZSA 3P2BA 2WXOA 2DMHA 3OHMB 4L23A 4PS3A 4GNKB 2WXJA 3RDJA 2FK9A 1E8ZA 2B3RA 5EDSA 4NPJA 3CSFA 3LJ3A 4HVBA 4JPSA 4F93B 3OAWA 2CHWA 3GPEA 1DJZA 3PRZA 1E8YA 4WWNA 4HLEA 4ANVA 3QAQA 3QR1A 5KJ7E 4L2YA 4F1SA 2CM5A 3DPDA 3L17A 4QJ5B 1BDYA 3QARA 3L08A 4MJJA 4ICWA 5T8IA 5CCJA 1DJHA 4FLHA 3HIZA 2CHZA 2K45A 4WWPA 2K3HA 4PS7A 2BWQA 4XE0A 1RH8A 3FBKA 4J6IA 4FHKA 3KWTA 3PFQA 3PREA 5G55A 4AJWA 2A4ZA 3KWUA 1TJXA 2A5UA 3NZUA 2WXLA 2WXFA 1BCIA 2QZ5A 2ENPA 4IHBA 4FHJA 4ANUA 2RD0A 3SD5A 4AOFA 2R83A 3RPBA 1E8XA 2EP6A 1RSYA 3TJPA 2FJUB 3F05A 3F00A 4TV3A 3L54A 3F01A 3ML8A 2ZKMX 2QZQA 5JHAA 4L1LA 4WEEA 3M7FB 2Y3AA 4FA6A 1UGKA 4NS0A 3L16A 3NSJA 1K5WA 3PYCA 1E7UA 3TL5A
chains in the Genus database with same CATH superfamily
2IV9A 4JO3H 5FM5O 4C4UA 1WT5A 4QHUB 1SYSA 2QV2A 5T3ZD 5FYLH 2VXSL 2XN0A 4A66A 3VXME 5FUCC 2NYYD 5IWLA 1U3HC 3HS8A 3LEYL 4LCWB 1DQKA 1U33A 1J8HE 2FZ3B 2IBGA 3SY0B 3FB8A 1DVFA 4PP1D 3V6OC 3KPRE 3FSOA 1QBBA 4HEPG 2YD5A 1JCKA 4Q4EA 5EU6E 4BUGA 3ISRA 4RMSA 4HS3B 3I6KB 4WENB 3MJ8A 4FQLL 4PB9L 1MELA 1BZOA 3QFJD 1YECL 4JFXB 3L7EA 4MB4A 4CBZA 2HKFH 3DURA 1DJYA 3KR3L 1DTUA 1LQBC 2OFQA 5BOJA 2D9QB 3AFLA 2DLGA 4L3FA 1KCSL 3ZBMA 4DKEH 1FNEB 1UXMA 1FZMA 2LV4A 3LNHA 5IZ7A 5EUOF 1S9KC 1XFPA 4DFHA 3FUIA 3WNIA 1AO7E 1J8SA 3QS3A 3U0TA 2XFGB 4KJPC 2NX5B 2JTYA 3I74A 4LXFA 2IAND 3U36B 3WD5H 3HEIB 3GXIA 1LYQA 3DLQR 4UUJB 4XNMA 1YPZF 1TQCC 5E5MB 1FNGB 1I3VA 2RBLA 3NCFB 1NUFA 2P48B 4CDHA 1MUJA 1RZKH 5FA3B 5BOZG 3VYNA 1BF5A 2X89A 5EF1A 2BNRA 5BO1H 2YBRA 3K0WA 2HVKB 4N20A 4LSPL 2I7SA 3FB5B 4DP4X 1N6QL 2M1KA 3B5TA 5C09D 2EVIA 3EBIA 3HG1B 2C1PB 4KH2A 3RKPA 1CE6B 1R3LA 1GJWA 4WTXA 2PW1A 5HHPB 4ZUUA 3BEVA 2JK5A 1OAXL 3CZFB 3MA9H 2VL5A 4I48B 1KEGH 3RHWK 5C0EA 5E6YA 1NBQA 2XWJA 5CJBA 5B21A 5AWNL 3AU1A 3B43A 3UTTE 1BQLL 2GHZA 3QO0A 2KLRA 1NBZA 1MCPH 1A64A 2HT2D 4CUCA 15C8L 2HYMA 2A5UA 4Z6AT 1N2RB 4JEGB 1YSOA 1IGMH 2WMPA 4LLAA 3HMXL 5T5FA 4OZIE 3B7UX 5F9OH 4J8RB 4ZPTA 5FYKL 3JBG7 2Q8BL 4UWQB 4X7SL 2PPFA 2PXYB 1MFBH 4W6WB 4HV8A 5EEZA 3FL7A 4FQIH 4PMFA 2NY1C 3V6FB 1FRGH 2VJ0A 3IJYA 4PGZA 1KGCD 2CA3A 4TVSa 4MD5B 5BS0B 4IJ3C 4RSVA 1EGJH 1PKQE 3S5YA 2HWZH 3C5ZA 5C0AB 1L9MA 5JR1L 1OTSD 1PZ5B 5DVPA 1S7VB 3HE7A 3ILQD 4KU1A 4UV4L 4IGBD 4DW2H 4ZQKA 1UEYA 3OGOE 3MUHL 4J3OD 1A9VA 4M6AA 3FZUC 5K9QI 2JQZA 5AOJA 1I7TB 3HBPA 2WOBA 3VTMA 3FB6A 4WFGE 4X4YA 1E9QB 2A4EA 3FFCB 4HIQA 4NNYA 4MSWA 1IBBA 3ZDZE 2JB5L 1KT2B 3CBRA 4JFWA 2MQGA 1KELH 4AITA 2JB6B 4KK5D 1JPSL 1JNNL 3GJFK 4HKBA 5EBWA 2EVHA 1HCYA 4U1NB 6FABH 2DY2A 1ZJBA 5JMOC 3HJEA 3IDXL 3P4LA 3SDCA 5J1TC 1N0XH 3PGDB 4G6JH 4M6OH 1YDPB 2IMMA 3KDMA 1JHKH 2VN3A 4R97C 2C4FT 3L1GA 3WFDH 4ZMNA 3V8OA 3DOHA 2VISB 3N85H 4HIJB 3E2HC 3PJSA 5GGVL 1TF4A 3NEOA 2JKJA 2L0DA 5DRNA 2IWKA 3WFBL 3MRRB 4LLWA 4PG9A 4AKQA 1P4UA 3SCMD 3ARBA 5DZOA 3D2UA 4QTIL 1JNHB 1HH6B 3NT0A 4KGJA 3VWKB 2O6FA 2X4UB 3F6IA 5A2LH 3SN6N 1FCGA 2CKBL 4G42A 2FH6A 2CLZA 5ISZA 3V0JA 3W9EB 3KL3A 1DBBL 4PRDA 2QSQA 3U1PA 2PYED 2HA1A 4YDLB 5K59F 3TURA 3QZPA 4LMQI 3FH8A 2IH8A 2YKKA 3BIKA 4TNWF 5I0XA 1GZQB 2Z4TA 5K69A 3CX5J 5L0QB 3C2AL 3CFNA 2R23A 1G1YA 3PWLA 4HMEA 2J44A 4XPAL 4L2YA 4ZFFB 5IB3B 4LDEB 5KSAD 3WFCH 5CJ5A 2ESVA 4B7IA 4FFZH 3SDAB 4OCNC 4PP2B 4YHYB 5HYJA 2ZKHL 2QKIA 1CIDA 3WS6C 1WEJL 3EOYG 2DMCA 3NJLA 5DFTA 4N2CA 4TM9A 5IB2A 4WW1A 4YE0A 4N9GA 2FYYA 1NFDB 2ZP9A 6PCYA 3MNVA 4ZMXA 4N90D 2R4RH 5ACMA 3ZHNA 4XB3A 4ZG1A 2OTUA 2KQNA 3Q48A 3UG5A 3D85D 3GRGA 3DWTA 3RVXC 4LOVA 4FEIA 1N59B 2ADFL 4L2LA 4CN6A 3DVIA 1JK9A 4P46D 5IOKA 4JO4L 3K71B 1BIIA 4R7DB 1I7UB 4M62H 5DUJA 3FU0A 1TCRB 2BNQA 4G6ML 4IK6A 1T83C 5C0CB 1INDH 1XB6A 1BWMA 3CDZA 4WY7L 4RGMC 4RDQG 3S3SA 1RIHH 4M8VA 4M7ZC 2EEBA 1JRHH 1YEGL 1T89C 3ZHDA 4QRRD 3EFDH 4PYHA 4WI5A 3SDYL 4JGJA 2YO3A 1ZT7A 2YUVA 3AGVA 3CTTA 3DGGB 4NO0D 5EZPA 1EWHA 5IV2B 1AR1C 4RFEA 5I0ZA 3DJ9A 5GGSY 1ZHKA 1JK8B 1LDPL 4XCNB 1DHKA 1U6AL 4OFQA 2AEPH 4AQAA 4JKMA 3QIBD 4F15B 3DETC 2FGWH 5CHNA 5ICXB 4Y8DC 3ZX1A 2EE2A 4F3FB 1G9MH 5D6DC 4MGXA 5T1JA 2E75C 1HC1A 3N41B 5EUOA 1RERA 3VI3E 5C2BH 1HL5A 2NY4B 4WF7A 1AXSA 2FATL 2E8YA 4EIUA 1X3DA 5HHME 2NQCA 4JRXB 4QRSB 4X6CB 3JT2A 3J8F7 5C07D 4G9DB 3WJLC 4PJXB 3UEQA 4MQ7B 2X4RB 2YJLA 3RVTD 1A7OL 1DJGA 4FQJH 4YWGH 3PWNA 3GSNH 2OSLA 4OQ1A 4WW2B 3VI4A 4BKSC 1EAOA 3CZNA 1MCKA 4DSYA 5IKCB 3T0DA 3UZEA 3WG7B 5AVVB 1BLNB 1UVQB 4U1JA 4KV5E 4M1CD 4UT7H 5DHXB 4B60A 5CD3A 5FFOA 5KN5B 3DXAA 4JFYA 1MW1A 2HKAA 3BUTA 3ARFA 1X5AA 4HF5L 4ZZFA 2P45B 2NTSP 3UTSB 5DZJA 5C7XH 2R0ZL 3MRCB 4FD0A 4MCZA 4GT7A 4OI8A 5I1HH 2AZUA 4RFOH 1AG6A 4LAQH 4F8QA 1U8CA 1NC4D 4G1EA 5KW9L 1H6FA 3QIUD 2HAZA 4OZ4B 2WQXA 4Y19E 5CN2A 3WELA 3IU3B 4L8BA 4X6DE 1LMIA 1PY4A 3R1GH 2DLTA 35C8L 2Q9OA 1QNZH 1Q1JH 4LVNC 4OBSA 1WBYB 3OB0K 3O41A 1M2VB 1NQBA 2LOEA 5JIMA 4OLYL 3X3FH 4O4YH 2MEJB 4PCKA 3QUZD 4AVIA 1ASOA 4LSTL 3PHAA 4N8VA 4M48L 2DQUL 4QCIA 3HI5L 1WWAX 2R29H 3MGAA 5LBSH 3IETB 2C9AA 4FNLH 1VGKA 2B2XL 2GY5A 1F11B 4BIKA 4DPBX 2EXWD 1Q90A 2ODIA 4K9EH 2EYRB 2NRDA 3O6LL 1ED3B 4UNTA 5D71H 4JGNA 3S5ZA 4JFEE 1UGNA 3PWPB 3LN5B 2V3FA 1OGAE 3VXNB 3VGEA 2AXFA 1FGNH 3U2IA 4H8QA 4OY9A 4XO4A 3UIZA 2DIBA 5LDSA 4U1SA 3GDCA 3L3DA 5D9SB 2R0LL 2IANB 5DSCB 3CVHA 1CWVA 3WIHH 3I75A 3EJCA 3MKGA 4M5TA 4RGNB 4RMWA 5KVGL 3UBFA 1TKWB 1UXWA 4LCVA 4LSUL 1NCDH 4QOKA 1G5GA 1N0LB 3T3MB 3S2AA 1OSEA 1S7XB 2VH5H 4MLSA 1I1AD 3SKJH 3KJ4B 2BVUA 5JIQA 1IQDA 1IAKB 3WSQH 1ML0A 2NNRA 1TJGH 1SFHA 4PJGA 2V9QA 3LSOA 3KLQA 3JV6A 3HRZB 5C09B 4HCIA 1YC8A 1W8OA 3LDBB 3QH3A 2Q8AL 5TDPA 4IKJA 2DYRB 2QVKA 2WY3B 1SN5A 1FN4B 2CGRL 1OT1A 3VFSA 3E0GA 1KMGA 3IDYC 4BK5A 3CSTA 4NO2B 4I77L 1PZ3A 3K46A 4Y9FA 4MAYD 2ZE0A 3PIQA 2BSED 2H45A 2DKMA 1OE1A 1ZY9A 5CLTA 2ZXQA 3X1NA 4PLJD 1A7QH 3FRPB 4N87A 3RRQA 5A2KH 1H3UA 4FQ1L 3MLYH 3L3JB 1LNUA 3MOBH 2QGDA 4TVPH 3R18A 1HESA 5E2VL 3CX5K 3IDIB 2EO1A 3PHQB 4QDGA 4AUJA 1CBJA 1ASQA 1KIRA 3LS5L 5DD0L 3HB3D 5CGTA 3WI9A 1EJOL 4O5LL 1BF8A 4AQEA 5TFSL 1SY6H 3WEXA 2DQJL 1BPLB 1N8ZA 3MLPA 3L1FA 4OGQC 4XZUA 1A6WL 1ZV2A 4QXTA 1RUKH 2F58L 5DYFA 1IM9A 2W88A 1RK1B 3J2PA 2P5EE 1HEJC 3LKOB 4NT6A 5F7LB 3U7YL 4HLEA 5I76B 1M7DB 4GRWF 2MHAB 2HG0A 1W2KT 5BXFA 4W93A 2B4CH 3TVMD 4G8GA 3NPSC 3QNXB 5GS2H 1DQML 3MUGB 1U91B 3PXJA 2DD8L 4FTVA 3RZWA 2WVVA 2Q7AA 1HCZA 3GSNB 5C0IB 3ULVH 2JCWA 4HALA 5JPNA 4GI8A 3NCCB 2VLJB 3US0A 1VPOH 1EAPA 4LHUB 1N8OE 2PPCA 4TRPL 5F7DA 4F8TA 3VXUB 1QP1A 3FQWB 1NCAL 3TZVD 5J3HD 1D9KC 1XB8A 5C86A 2L7UA 4HUNB 4DPRA 1I9JH 3QWQB 3OKDA 2BJMH 2NZ1A 4LPCA 4AJYV 1GSMA 5EC1A 1BAFH 4PY7B 1D6EB 4XP6H 4WU5A 5EBGA 5CJOL 4ADIA 1I7RA 5DJAB 2XZAH 1FNAA 1F3RB 1XEDA 2F74A 4HP5A 5CBEB 3RDTA 3LRGA 3IJEB 1RI8A 3IJ8A 4M9OA 4QAMB 1L7IH 2H3XC 1VRSA 3FN0H 5A43C 4YAQB 5LXGL 1R0AL 4FFVC 3SCMB 1SXSA 2L3BA 2A77L 3A67L 1HZKA 4I8DA 3K2UH 3CZEA 3NGBB 2YQGA 3BP7A 3EW3B 3DIFA 3MV01 3KPSE 4Y1AA 5IMOB 4XRCA 3QDGB 4XNQB 4MMYA 3MRQA 4ONOA 1MFDH 4KUZL 4BWWA 1FH5L 2XZZA 4I4WA 3OSKA 1T04B 2N01B 4HOMA 4KITB 5GSRA 2ZOOA 2OPCA 2Z9TA 3MNZA 3CFMA 4G8FA 2DB8A 5KYUB 3T8MA 4AZUA 2NW2B 2ZUVA 1YYMH 5E70A 1QFPA 4Q9CA 4YSDA 4KROC 1DVYA 1KB5B 2YJQA 1JPGA 3PXHA 3SGEH 4M5SA 4JHAH 1YY9D 5DMIH 1CS6A 4P57B 4XE5B 4Y4KD 4BH8B 5B8CB 3EO0A 3RX7A 5E2WL 5E4OA 2VDOL 1WWCA 5KAQG 1ZHNA 2LVCA 3HFML 3ZE0E 1ZA6B 4K4KA 2V7NB 3SGDH 1T21B 2Y69B 4TNWK 2P24B 3K6FA 4JJOA 1MFVA 2WQUA 5AD0B 3GGWA 4DCQB 3N1QC 4P46B 5BV7C 2C3HA 4R3SA 3QQDB 5INDA 2JH2A 4JPIB 4MJ6A 4PLKD 1D7BA 4JQVC 4HJ0D 4H88L 2ZX6A 4Q6IA 4Y4HC 5HYSB 4HWBH 3VXTB 3AS3A 3MV11 5DZLA 2R39A 1FLRL 1G6RA 2MSPA 5E94B 4EI5D 3LMJL 4HK3N 4ZUWB 3B34A 1HILA 3CC5B 3K3QA 2HRLA 5C7ZA 1PNDA 2P46B 4JO8A 4NO0B 3QXDB 1Q9OA 1QVOA 3EOTL 3FQUA 2YC1B 4D8PA 4MJ2A 4HX1B 1ZVYA 4Q0XH 3QIBB 2EH7L 5I73B 3O2DA 4OW6A 3OXRB 4GSDH 3KPLA 5JPMC 4OGAC 5HP5A 2BY0A 5AAWA 4L4TE 1H3PL 3P69A 2HFEA 2A83B 3DOSB 5ALBH 5GRUL 2X6MA 3RWJA 3QUKB 2GAZA 2Y7QA 1MCLA 4R83A 5I1KL 3IMWA 4LLQB 4RRPA 3WHXA 4UMGA 3G3LA 4X80H 2XJKA 3BP5A 4X2UA 3FSAA 1BVNP 1S2EA 1FFOB 4XC1L 4NUGH 1USZA 2YMXH 5CD5D 3M86A 3QRGH 3IKCB 5MENA 3WTUA 4FMKA 2X3BA 1NCCL 4HQQL 2WQWA 4MCNA 2E47A 5HY9B 5EU3A 1NUGA 4Y4FB 2DQ6A 2K78A 4UBDD 1HNFA 4OFPA 4QHUA 2GIMA 4WO4B 5C0BE 1JWMB 2VM3A 2FAUA 4YE4H 4BELD 1FORL 3OG6B 3M07A 2D03H 5IHLB 2QHLA 3QZBA 1X5JA 5JOFB 4LCWA 5L8LB 4GIAA 3QIUB 3D9AL 2XTJD 3NYKA 2FZ3A 3ZR5A 1JZHA 2ZX9A 4JDTH 4Z7QE 3SY0A 5CKAA 3S88H 1JDAA 3BX7C 4M3KB 4BWUA 2W8CA 5HDBF 1HTYA 4QHMB 2F5AH 4HS3A 5IB4A 2JSFA 4CSTA 3IRPX 3OF6D 1F2XK 4JFXA 4KQ0A 5LLIC 2VDRL 2ZJSL 5EB9A 1VACB 4E42B 3P0VL 2CR0A 3RPKA 1MJ7H 1C16B 5IUCA 4HBCH 3B2PA 5D8JH 3CN0A 5JXEC 1DUZB 4P07A 4GKNB 4XN1A 1FNEA 3N41F 1MRDH 5L2KE 1IC0A 3QWOB 3GXMA 5JQ6H 2ZWYA 3ZE1F 2CHZA 1MCCA 5TF1L 2VQ1B 4QI3A 2NX5A 3DMMC 4DKDC 3U36A 4XMVA 3CVDA 3EKCA 1V10A 4UUJA 4QF1B 4R26H 5HGGS 5DO2C 4BRVA 3TM6A 4PJXF 4L8CB 3AU0A 5E5MA 4X50A 2H6PB 3QUYB 2OR9L 3VWJD 4NJ9L 5FA3A 4GG6B 1I1AB 4BQ6A 3B8SA 1GC1L 2IGFH 1QTSA 2DJ4A 4P49A 4XN2A 3FB5A 4PJ9D 1YEEH 1LO3L 3HG1A 2C1PA 1QSVA 4PJBB 2APFA 1CLOH 3U9PH 3LPGA 1CE6A 5HDOA 4NQTA 3V0AC 5T33L 2RHEA 3WJJC 5HHPA 1A4BA 1CDJA 1SHWA 3C75A 3CZFA 4O9HH 4I48A 4P5SA 4Q6YA 4UQEA 4DN3L 1I7ZB 4UDTB 5GGQL 4MAYB 3DO3A 1NGQL 2XETA 2VL4A 5BUGA 2LVEA 2VMFA 4MNGB 4XPTL 4BZ2A 4B0MB 5K9QG 1S7RB 5EF3A 3FHQA 3DHPA 1N2RA 2VXQL 3F58L 1RV6X 1G7IB 4O02H 5F1KC 2GIXA 5FUZH 1RUQL 1FFRA 3Q8EA 1UH2A 2WN2A 1IBGH 4J8RA 5SX4H 3WEAA 5JIPA 3OG4B 4P2OC 4MDJB 4POYA 1O9VA 4TTDC 2PXYA 4GKZB 3HB3B 1S46A 2DQDL 3ZQWA 3ZYOA 2NMSA 5LWYL 1QWNA 4OGZA 5E6IC 1CXLA 2IDQA 3HAEH 4NRYB 3V6FA 3DROB 3MCLL 4XNUL 3DSFL 2G3ZA 4OZHB 1KXVC 1UZGA 1O0VA 1Q0YH 1PEWA 1TXKA 4MD5A 4K8RD 4EDXB 5BS0A 5BVPH 5ADOH 3ESNA 3GIZH 3S3PA 5C0AA 3EIFA 1PZ5A 4NRXB 2I60L 1DSFL 1S7VA 4DZ8B 4YHKH 2VMEA 2NY2C 1I7TA 3BAKA 2ZF8A 3UO1L 2B9AA 3MA7B 1ZANL 4KKAC 1A66A 2JIXD 3JTSB 2HT3C 4K3EL 1E9QA 3FFCA 4HPYL 3T3MF 4F9LA 2ROXA 4M1DH 3O2WL 5DGRA 1KT2A 3TZVB 3MLUH 4FMFA 1EAJA 2LU7A 4NC2B 2JB6A 2VITB 2IQ9L 2AF2A 1KNOB 4WRLA 3RWFB 1G9NC 5HHOB 1V7NH 3KVDD 3PGDA 3Q2VA 4IHOB 1YDPA 3B2VH 5T1DL 4NM8L 3Q8FA 5DD1L 5B7MA 4NN6C 3MZGB 2VISA 2BPBA 1PD1A 4BDVB 1TJIH 3GZQA 3MRRA 5J57B 1A1NB 3IF1B 3PE9A 4NBXB 4OLVH 4UT9H 5D7SH 1P4BH 2AI0L 3BE1H 3GI9L 4AYSA 1MCDA 1CL7L 1JNHA 1XX9C 3L9EA 1THCA 1EHLL 5TE7L 1HH6A 5AYQA 1QBMH 1QTPA 3VWKA 2X4UA 4YXLH 4NQDE 4ZMZA 2G9HB 2O5YH 4FYQA 4IRSD 1IBHA 4WFED 3W9EA 1XCQB 1BXUA 4A2EA 4JMXA 1GZQA 2OMUB 12E8H 1H8LA 4PJ5B 2KT6A 1G9HA 3K6DA 3OC8A 1VZIA 1Q1PA 1PZCA 3W0WE 4ZFFA 4N0FB 5IB3A 4WFFE 1ZRUA 4MMXC 3K6NA 5D70L 3U9UB 3W37A 3WNPA 1OGPA 1NEZG 3T2LA 1AS6A 4WUUE 3A23A 4CVUA 3SDAA 4PP2A 1MIMH 2YQ3A 4Y4KB 4YEEA 2DRUA 3MN8A 2WZ0A 5EEVA 5KSBB 2EDWA 1RIVL 4QYOB 1YNKL 5D1XE 5AW0B 2D7MA 5DHEA 4H8WL 4JDVB 1LE9A 4NWUH 1WWWX 4OCYH 5L4MA 2YD0A 2AKRB 1N59A 1KN2H 3O0RH 3KBFA 4KTDH 3B2UC 5DFVC 4R7DA 1I7UA 2FHFA 1OAKH 4NM4H 1TCRA 2CDEB 2LTQB 5C0CA 1RP8A 3IYLW 4JFVA 4X9FA 3NIGE 4ZAKC 2GCYB 1UA3A 5JIKA 2ZUQC 5IROD 4NQCB 4G8AC 1XF3B 3RY5A 4EI5B 5GRWA 5TD4A 1MEXH 4L1SA 1U3NA 1HHHB 3GMLB 5LQBL 1OSYA 5AZEL 2BH0A 4YQXH 2CH8A 3DGGA 3P2DA 4UQDA 5T1KD 5IV2A 2Z8VC 3O3DB 1AQKH 5I0YA 2NNFA 4FG2A 4AGPA 1SF5A 1JK8A 4XCNA 3DK0A 1OLZA 2UUDH 3DTUB 4AGLA 2EUZA 5ICXA 2F6AA 4F3FA 1XGTB 1TZ8A 3QJFB 1RZPA 4DWHA 1J9QA 2KS0A 2W60B 4MWFB 1K2DB 4TVUA 2X2UA 5BUPA 4FG6D 4JRXA 2F08A 1TG8A 3CGTA 4QRSA 4X6CA 5B1JC 4K5MA 4NPYB 3BUPA 4G9DA 2UYLB 4YHLH 3SIKA 4PJXA 2MFNA 4MQ7A 3ZQXA 3F12B 1TJXA 1NWOA 3CPUA 5DGQA 3RVVD 4W9JC 1BYPA 1Z3GH 4DKFL 4WW2A 4MBRA 5IKCA 4HGMA 1QSZA 1BLNA 1UVQA 5GRYA 4WNQB 5KN5A 4HSQA 2OAAA 4ONGL 3ULAB 3ZTDC 5L7XH 3NCYS 5H94B 5JQIB 1UKQA 3LPOA 2IEPA 4BSJA 4EXKA 1UD6A 3ARDD 4IRJD 5F9DC 3QI9D 3UTSA 3MRCA 2Q3XA 3OZ9H 4M1GL 4GKSB 1ZLWH 2P52A 3U9WA 4K73A 4U7KA 4UQ3B 4HBQA 4M6ML 1ZGLB 2KPNA 4X8CA 3LH9A 4OZ4A 4DFIA 2XTJB 3O4LB 4FN0A 5FKPB 3IU3A 3L9BA 4JHUA 4YBLB 3R4RA 5F1NB 5CINH 1KJVB 4ZFQA 4WI4A 3BKJL 3VW3L 1WBYA 3BUYB 4LOUC 1P6FA 4EQ2A 1M2VA 4HSCX 3BLKA 4RWYL 1NL0L 3QR2A 1A3QA 4F7CB 3TN0D 5KZCD 2GQHA 2F5BH 1XVSA 1DBJL 1Z9SB 2OMVB 5DQ9B 2FUQA 4M4RB 3WY3A 1JZ6A 3IETA 5F7MC 2VW7A 4NQXB 3VYPA 1F11A 3GLAA 1SQMA 1EERB 3D39A 2YS4A 3N9GL 2EYRA 3D3VB 1ED3A 4NWTH 3GRWL 5EFIB 3PWPA 3UBGA 3LN5A 3VXNA 1OAQL 2DTSA 4LSRL 3QAZC 1N68A 1CJYA 4FFZA 5ANMB 3LNGA 3WYRA 3ROLB 5DHMC 3H7LA 3LIZL 3RPIB 3IMRA 1A7NL 5D9SA 1I9RL 1B2WL 2IANA 4WKZB 5DSCA 2JLPA 4KRPD 3GHEH 4JJ5B 1HL8A 3UAAA 1TKWA 3ULVF 4E9XA 3APCA 1N0LA 3FW6A 3MRMB 1S7XA 3WFZA 3MBXH 3UAEA 3RGBA 3QA3A 4ZMTA 1IAKA 3NIFB 5HGAB 3CFJB 2TSBA 1EUUA 4I1NB 4R9HA 4MB3A 4W6XB 4NN5B 4DETA 3TYGL 1PBYA 1N3NB 3QWNA 2BY1A 3HRZA 4PJ7B 4JPSA 5C09A 4EN3D 4AE0A 2QTEA 3A6OA 2WLNA 1XGYH 4PSRA 3PJLA 4XXCA 3GJEB 4KOCA 1EEQA 1FN4A 1F6AB 4P3CH 5AB2A 1WA2X 4JR9L 1EANA 1EBAA 4FE9A 4NO2A 3LRLA 5T8IA 5C0NC 4Z7WF 2PP8A 1B2YA 4F20A 4D3CH 3FRPA 3NN8B 4JRYB 4JHBA 5IM7B 1PYWB 5C9KA 1A6UH 3RILA 3C5JB 5I75C 5I8CB 1QRKA 3IN2A 1R5IB 1VFBB 3L3JA 4V2BA 1F4WH 5F3FA 5FWQA 1MLBB 8FABB 4EF3A 5E1HB 3IDIA 1FHNA 4KI5F 3PHQA 2WCSA 1XDTT 3OKNB 1LWHA 3POCA 1BD2D 4OBRA 4V1DD 3LZQA 4Z7UE 2DH2A 2AJUL 3PAUA 4DP1X 4JLRB 4QJ4B 3QCUL 2ZAGA 5DC0A 3U0WL 3RU8L 1RK1A 4IBQA 2GTWB 3LKOA 1XSJA 1TETH 4G8EB 4GYBA 4KBPA 1RZFL 4HIEB 1M7DA 4PM1A 3ZXAC 5I76A 4PFEA 4FQ2L 2MHAA 5CJQL 3RA7H 1DJIA 3AMLA 4NZDA 3HW7A 2YQ2A 3QNXA 3MUGA 1U91A 4TULH 1HQ4B 3GSNA 4ZS6C 4PJIE 5C0IA 8CGTA 4HJJL 2NR6C 3AC0A 4EIGB 1WJ3A 4TSAL 2H4EA 1QUNB 2JIXB 2VLJA 5I0DA 1HZHL 4LHUA 4PD4K 3SQRA 5GS0C 3VXUA 4NZRH 3FQWA 4PRPE 3FUFA 1W80A 4IDLA 5D72H 1G6VK 4M6NL 2E8ZA 1OT2A 5AYUH 4Z0XB 3KE0A 2X12A 3D5OF 3AW5A 4PY7A 5K1NA 3QE5A 1T0OA 1RPQA 1D6EA 4I87A 4X9GA 1ZCRA 4XNXL 3Q1EA 1PG7L 1SXCA 3IJEA 1NC2B 3UYOD 4G43B 3RUGB 1U3YA 5T3XE 5DK2A 1HYSD 3BAIA 4JM2D 3WIIH 2X4TB 3KHQA 4R4FL 4KTGA 3BPLC 1ZIBA 3SCMA 4KQ4H 4Z3TA 4HLJA 1BGXH 3X13B 1A7RL 5D1QE 4FP8L 5C0RH 4ALAL 2H5UA 1JDDA 1FG2B 1UJ3C 5IMOA 5LBSA 2R29A 3QDGA 3X14B 3K1KC 4XNQA 4HK3J 4IRSB 4I85A 3LXCA 4QD2E 1GCYA 4YSPA 4XMPH 1A4KB 1E4WH 2I24N 4YUEL 2E27L 4ZDHB 3QAQA 4Y5XB 1T04A 3E1ZA 1PU0A 1QBAA 2ZUWA 5KYUA 1OAYL 2K6ZA 1MZYA 3SJVE 2NW2A 4XCCL 1DJHA 4OZHF 3IFOB 3ARUA 3TBTB 3NCWA 1KB5A 1XTLA 2VDPB 4MDIB 1N18A 4AEIL 3ZOAA 4ZNEA 3ULUE 3WIHA 1BOGB 2GJ6D 5GRJL 2KC0A 4BH8A 5B8CA 2EINB 4M7LL 3NP3A 4YX2H 4S1RH 3QEQD 1E8XA 1MCOL 3AZUA 3MV7D 1CBVL 2A9CA 4Q8BA 3TA3C 2FEEL 4O51B 2PUQT 3V0WL 5I9QC 1TZGL 5IQNA 5I6XC 4HUVA 1MDAA 1KBKA 1ZA6A 2FX7H 5BNXD 2V7NA 1T21A 3FXIC 4XBGB 2P24A 1IE4A 1MPAH 4TSCH 3WTVA 2OK0H 3ARRA 1JZ5A 5JIIA 5IQ7H 3GHBL 2VJ8A 5AD0A 4CC0A 4HHWA 2P9RA 3UGUA 4DCQA 2CMRH 4P46A 3JYBA 3QQDA 5DMKB 4RZCB 4JPIA 3T3PE 4GPVA 4OF7A 3S34L 3VSQA 4ODXB 1PSKH 4HT1H 5HYSA 4H4NA 3VXTA 3BUIA 5B7EA 4E5XG 4XP9H 4LNRB 1EVTC 3EGSB 3GXUB 4XO3A 2XWRA 5E94A 4G9FA 1YEKH 3AY4C 4ZUWA 3D2TA 3SPVB 2VLRE 3CC5A 1IEHA 4S1DC 1CFBA 1DQJB 1R5WB 4NO0A 3QXDA 1MCWM 1SN0A 5T1KB 1MJUH 2ORBL 2YC1A 5DHVH 3V55A 4IS6B 4HX1A 3BIAX 1MJ8L 3K4AA 4ZMYA 3LHPH 5KOVC 4Y0GA 3I50H 1DEDA 3EHBD 3QIBA 2H2SD 1DBAH 3N44B 1IAMA 3ZKMD 3RZCD 3OXRA 2F1BA 1PPIA 3LRHA 3CWGA 3F7YB 1QR4A 4FKEA 5CSGA 1DVTA 3O2VH 1MG3C 2A83A 3DOSA 1V3KA 1QBLL 3FUJA 4JFHE 3QUKA 1RK7A 2YFNA 4KJYB 4RSYA 1I9EA 4LLQA 4GQ9H 1BX2B 4DGIH 2DOCA 4J6RL 3S37L 3C60B 1KLUB 3HA0A 1FFOA 2IPTL 3ZTEA 4X9YA 4WI6A 3VA6A 2DQGH 2DM4A 4OLXH 3B9KD 3NZSA 3IKCA 1CGVA 1Z32X 5KSBF 1E40A 3U4AA 1ZDQA 2VR4A 1KCVL 3GMPB 3LQAH 3BSZL 5HY9A 1OP3K 3GZOA 2WQSA 1NAKH 3FSVA 2JKLA 4Y4FA 2DLFH 3ZDYF 1P6AB 1KTRL 2M8XA 1HS6A 3LD8B 3MBEC 3HI6L 3ARDB 2EJ1A 3E8UH 3QI9B 4IRJB 1IKNC 4PS4H 5D1QC 4ACPA 1WC7B 4WO4A 3NACL 1JWMA 2E9GA 2ADGB 3HPJB 4GIPD 3BH8B 1T7ZA 1RZ7L 2LAAA 4QY8B 4RCAA 4WWPA 1ETZB 1VFAB 1TU2B 1FGVH 5JOFA 3BISA 3QIUA 1PZAA 1A4JB 1SDAB 1VAHA 3QFDB 4OKVB 5KSVB 3WE6B 4I18B 5HI4C 1N19A 3KXFB 4UILH 1F41A 4GAJL 3KBEA 3VSTA 3EJYC 3QJXA 3FJTA 1COBA 4K5NA 1DQTA 3D25B 1G7LB 4AV0A 4LQFH 4WHTB 5D2LB 3U4BL 4AWJC 4QHMA 3KGRA 4HEPA 4BFBD 3ULUC 2AJYH 3KVPA 2FEDC 2HLFD 1CI5A 2NW3B 5KZCB 2HT4C 3IWUA 1FL6B 3NIDE 1H9VA 4WTQA 3N43F 4OT1H 7FABL 1VACA 4PRAB 4E42A 1C16A 3PWUB 1CDBA 4HXAH 2CO1A 4ZTEA 3ILPB 1REIA 3RBSA 2XV3A 4GKNA 3T0ED 2QQNL 2GVYA 4ZS7H 4MZIA 3MJ9H 2G60L 3FAXA 1PDKB 4IMKC 4Z95L 3QWOA 4LARH 5MHSD 2VR5A 5FYJH 5K93A 3VFNB 1VDGA 4NIYE 4ENEC 2VQ1A 5AW2B 3KS0H 3WTSA 4H1LG 3VA2C 5BCAA 3BT2L 3NK3A 4PJ8C 4QF1A 5DRWB 4KRPB 1XD1A 3CZSA 4L8CA 3Q2WA 2H6PA 2MOVA 3QUYA 3RFRA 3SQBB 4F92B 4GG6A 1I1AA 1IAOB 1U3ZA 2ID5A 5DD5L 4LPUA 4AX3A 3FU8A 2UY6B 5HHVL 1P5UC 4QHLB 1ZE3C 5GIRB 4UANA 2JKXA 4EN3B 1JDCA 4HAFA 4MA8L 4PJBA 4ABWA 1TOXA 4Y5YB 1GL4B 5KBDA 5GGRB 4LL1A 4K71C 2XCMC 3L5IA 1NCNA 5DURD 1W15A 4JN1H 5DZVA 3MQIA 4PJEE 2J8UF 1I7ZA 4FI8A 4HWBA 4JDZB 3HG3A 3CMGA 3IBEA 4MAYA 4UDTA 4BQBA 2BSEA 5EN3A 3QHFL 3VDAA 4JUTA 3PCYA 1CTOA 3BAEL 2NY5H 4IBYA 2AVGA 4MNGA 2CA4A 5ECGA 3SE9H 4Q9RL 3GTNA 1WH0A 4WWKC 1S7RA 3P4NB 1L0XA 2WVTA 4YIQB 4Z0BL 1G7IA 4Z1PA 4G3YH 2D3LA 1JZIA 1E2ZA 4MQXC 1IGTB 2FO8A 3CVHL 4Z78B 3OBAA 3DX3A 1MNUL 2C8NA 1OM9A 3AREA 4MDJA 1DBKL 1E3XA 5DXWA 1DDTA 2Z7ZA 4GKZA 4NPJA 5KUMA 2G2PA 3TFBA 3U6RB 2XA3A 3KEHA 5T3ZE 2J73A 4KJWC 4KNSA 4NRYA 4UZUA 4F1SA 1EHKB 2R0WL 4OZHA 3SOBL 3T0VA 1BM7A 3GD1C 3L4YA 4H8VA 1QMUA 2V17L 5IBLC 4Z7OE 4OD2B 2A6IB 2MPAL 4FQCL 5F7EL 5H37G 2Y6TE 3UTZB 5L0QC 4NRXA 2VIRB 4HWUA 4ZFGL 1TZOA 4DZ8A 1P7QB 1J0JA 4QPEA 5I1AB 3ZL2A 4FS0A 2NUTA 4PB9H 5DWUL 1O75A 2YA2A 5GHWL 3ARGD 4MCMA 3MA7A 2Q7YB 5ENWB 4Y2DB 3U79A 1XIWC 4XNDA 3HBGA 3QFJE 3JTSA 1IB5A 4IJTA 2CR3A 1F6LL 1KCSH 3TZVA 3A4DA 2HFTA 6CGTA 5A2AA 2D0GA 4Y2NA 2R9HD 3HUJB 3SZKC 3ZT6A 1XBDA 4Q7DA 4H13C 2VITA 1KNOA 3PXLA 5IVXE 4PJ7F 1KN4L 3RWFA 3W82A 1X9UA 5HHOA 1IV8A 1R4XA 4U4IA 5ITBL 1I8LC 3WO3B 3BQVA 3MNMA 4IHOA 5F21B 4PRBB 3QUGA 1AD9B 1UCBL 1OAUH 2J6EA 2Y24A 3QDJB 1I1FB 4L3ED 4BDVA 4JM2B 5C97A 1A1NA 3IF1A 4LSPH 3FRUB 2D0FA 3NEEA 3OAYH 3WMQA 4ZZKA 3TNNB 4P06A 2C3VB 2Z8SA 1TQSA 4OD1L 2O5ZL 2Q1EA 4MJIE 2YPVH 1E50A 4I3RL 1MFUA 2G9HA 4AYID 4F2MB 3QHZL 4GUQA 3VGAC 4MBOA 3C8KB 1XCQA 1OP5H 4ZBJA 1QLEB 3P4MB 1RQ5A 2OMUA 1AKJB 4K7PX 4PJ5A 3CC1A 2IFGA 15C8H 1KEML 1X5XA 4PCSA 4X6FB 2D3NA 3BN9C 1HX0A 4JY4A 4N0FA 3VSUA 5GGRY 4Q2ZB 3U9UA 1ZMYA 3UJJL 3EOBB 5FYKH 4A7TA 3BLPX 5ACZB 1CI3M 2Q8BH 4X7SH 1E30A 2F7PA 2AGJH 4XMWA 5BUAA 4Y4KA 1NEZB 3IGUA 3BGMB 1UWXK 4PREB 2VN7A 1A7PH 3MV7B 5PCYA 5KSBA 3BWZA 5TJWK 2VDLL 3GSVB 4QYOA 5JA9A 4MJHA 4K7FB 3H4FA 1ZV9A 4ZUVB 3SE3C 5F2FA 2WXJA 4JDVA 3B9EA 4UINH 3K6SB 4HVBA 3EO9H 1T66C 1F0LA 3OR6B 2WLLB 3MLZH 5AOLA 4P48A 2AKRA 1KGCE 1J9CT 2X1QA 2RACA 3ULSB 5JR1H 1KYFA 1I3GL 4LGSB 3WAJA 5AL8A 4UV4H 5F9JB 4JANB 2CO7B 3MMEB 1LEIB 2KL6A 4ZOBA 3SYOA 3I85A 2CDEA 2IDFA 2K45A 2N0MA 4FNQA 4OSUL 1NMCC 4NZTL 4Z7VE 1BJ1J 2GCYA 4KQ3H 1F5WA 4UQIM 1T2JA 4NQCA 1XF3A 3D33A 4EI5A 4K3HA 2JCCF 3TO2B 1OCCB 5KVFH 4GO8A 5I19L 5E4IA 1HHHA 3GMLA 2Q87A 4XO5A 4JKNA 4RIRB 3SBRA 1ANUA 1JPSH 1JNNH 1WAAE 3O3DA 4PP1C 1T6WA 1K85A 5LG1A 2LU3A 3QISA 4ELKA 3EHBB 1MG2C 3SBWC 3RZCB 2WXPA 4AY0A 1XGTA 2DV6A 4E9VA 1JF6A 1FUNA 4XX1E 2XLLA 2YD7A 4BCXA 2VC2L 5I5JA 4CU6A 3QJFA 2AANA 2OW6A 4L4VD 5GGVH 1B4RA 2W60A 3ZW3A 4PCYA 1IGYB 4MWFA 2IAMD 3WFBH 1K2DA 4KKBD 2YEZB 3I3BA 4KDWA 1KTKE 1EAQA 1WFOA 3BDXA 4KVNL 4NPYA 2UYLA 4DNLA 3F12A 3KMDA 4E9RA 2YOCA 4AQ1B 1DQDL 1F90L 4ISVB 2CKBH 1X5IA 1JZ8A 1TZHB 3S3BB 1G6RL 3OMIB 2Z4QB 4WNQA 2IF7A 3L95B 1X5ZA 2PYEE 1ECZA 3C2AH 4E9WA 4EPSA 5H94A 4FAAB 3HKZA 3VRJB 4MRBA 4AM0Q 1THAA 4MNHB 4DT2A 5L88L 5DWPA 2ZYRA 2VZVA 1YCSA 4L5FH 4WV1B 2J8UA 4Y16D 1OHZA 3I6LD 2UY7A 1JV2B 2PN5A 2YD9A 5CLZA 4GKSA 2X1OA 2XICA 4K3GA 2XU9A 2A73B 4G7VL 3SYAA 1ROCA 5F6IB 4PRID 3QG6B 1ZGLA 4Q89A 2D4FA 1KB9K 1ETB1 2EILB 4HFUH 3O4LA 3NCBB 5FKPA 2YXWA 5F1NA 1X5MA 1EV2E 4UT9A 4NJAH 2OYLA 4N90E 3BUYA 2YRLA 1FBIL 3FQRB 2HT2C 2XV6B 3P0GB 3Q43A 3WBDA 2J2ZB 5E2JA 2NT0A 4L23A 4OZGE 2ADFH 4QEGA 4QNPE 4F7CA 4JO4H 3M1OA 4PRHB 4F93B 3TJEL 1TTRA 1Z9SA 2OMVA 2X9ZA 2RFXB 4FMVA 4G6MH 4M4RA 5DQ9A 5EZIL 4NQXA 4BZYA 4WY7H 4QT5B 5DO8A 4EMZA 4ZMWA 4WSGA 3NRQA 3D3VA 1JE6A 3EFFB 1IQWL 3QARA 3IMSA 4NP4L 1TJHL 2X2JA 4MS8D 5DJ2B 5DC9B 4HPOL 4KXCA 5EFIA 4N6RB 3SDYH 3FBKA 2X2HA 4QRRE 1IMHC 5ANMA 3QJVB 3ROLA 5DT1L 4FA8A 1E2WA 4XN4A 4N0YH 4WKZA 5E51A 1OTSC 4QLRA 4IBUA 4P5RA 4NAQA 1U6AH 5A7EA 5AYTA 4JJ5A 4OR1A 4IGBC 5FYJU 4FQXD 2O72A 4J3OC 1SXNA 2OL3H 1P0SE 2IFFL 3KAAA 3MRMA 1C8QA 2D7TH 3A4FA 4XVTL 3FSZA 5HGAA 5FDWB 1OL0A 1MCWW 3CFJA 2V33A 4RZKA 3WY1A 1XL6A 3JT0A 1MRFL 3K6OA 3FU3A 5E9DD 1N3NA 3BUDA 1E4HA 1OGTB 1EZLA 2K8QA 4PJ7A 4OI7A 1Q9LB 3KW8A 1U3HD 2NY6D 3KL5A 1XO8A 5EO9B 1JNLL 3MV8B 3GJEA 1F6AA 5C07E 1G7MB 1A7OH 4KK5C 5KVEE 3POHA 5CM1A 1P2CB 4MKTA 4MA1B 2IOIA 4FJZA 1O9ZA 4EVNB 5JHDD 3NN8A 1YY8B 1ZLSL 4JRYA 5IM7A 5FCUH 1PYWA 4LF3B 3SQOL 3CVBA 2BVYA 4N0UE 2NNCA 3C5JA 2DBLL 1A6VH 4OD3H 4ZO6A 5I8CA 1R5IA 1VFBA 3GBNL 1QFWI 2H0PA 2BY2A 1MLBA 4HF5H 4TPRL 4WQOA 4XNYL 8FABA 1IFHL 5SWSD 3KZ8A 5JYMA 1DN0B 1TLMA 3OKNA 2J5LB 2R0ZH 1GGCH 1ICTA 2A0LD 2DWYA 1W8EA 3N42F 3QJHA 4JLRA 5D96B 1QFUH 3EGDB 1VCAA 3GKZA 3H9SD 2JJSC 4HHAB 4J8QA 4XP4H 2GTWA 4KJPD 2RTTA 4G8EA 1ADWA 1HL4A 1YYLL 4HIEA 5J6HB 3MCYA 2WM0A 1KGJA 1CLCA 4DK5A 4GSXA 1OAJA 2B5IC 4OLYH 4YDZA 2ZUXA 3T08A 5CEZL 4LSTH 1XF5B 4N1HB 1HQ4A 4M48H 4YNYB 5KSAC 3FU5A 1PFOA 3MLWL 3HI5H 2DWTA 1NICA 5HVWA 2B2XH 1QUNA 2JIXA 4BZ2L 1KY6A 5AZ2L 2WLKA 3LXUX 1J05B 3O6LH 4G2AA 4DGUA 1EO8H 2F54D 1JGUL 1FP5A 1TTBA 4M43L 1ZLVK 3ARZA 1AJ7L 1F3JB 3ESPA 4Z0XA 2BIMA 3HS0C 1SOQA 2H6UA 4IBLT 3IFNH 3EJZC 3CAFA 1EMTL 2CG9X 2R0LH 3LXBA 3VVWA 3NUKA 4FLHA 1AE6L 1P7BA 2FJFB 3HIZA 4PJDE 1S7TB 5KVGH 1YMME 2MCAA 3CFDB 1NC2A 2JCCA 5J06A 4G43A 4LNVA 3RUGA 5EN2B 3ET9F 4LEEA 5DLLA 2QMKA 1XT5A 4L3EB 1CDYA 2ICWI 1MFCH 4TV3A 4PWGA 2X4TA 3FYIB 1UTDA 2P8LB 5E08L 4M7JL 4XTRC 3TYFB 1J1XL 4HISA 3QQNA 3X13A 2XV2A 3BHBB 3L3HB 2H6OA 1MW0A 5AVXB 2NY1D 2Z31C 5CFHA 2GEQA 2K9UA 1KUMA 1FG2A 1YEWA 4W4OC 2CGRH 1MREL 4OCXL 4M61B 3OPZL 2YD2A 3X14A 4I77H 5ICYB 4IRSA 5ABDE 4NKIL 4FGMA 3QXAB 5CU9A 3UAFA 1A4KA 1OEZW 2PO6D 4QIRA 3TEWA 2NXYD 4ZDHA 5C08E 4Y5XA 2OYMA 1OTTD 2WN3A 2EDNA 2P8PB 3B8YA 4UI2A 3SKUD 5HVFB 3GSQB 2DF3A 1Y6KR 3IFOA 3C09C 3TBTA 3O9WD 5E2VH 4PJCE 3RY6C 4MDIA 1IC4H 4KOBA 3ARWA 3FCUB 3TCTA 1BOGA 4KKPA 3LS5H 5DD0H 3RL2B 5ADPH 1EJOH 2OL3B 4O5LH 3V5DB 3ZDXB 5TFSH 1OF2B 3NJHA 4EKJA 4O51A 1DJXA 3RVTC 2LU5A 1UZ8B 1KGUA 5AL0A 5G2NA 1T7VA 3U7YH 4NHUB 4DKAA 1IJ9A 4DP6X 3RX8A 4XBGA 3KPNB 4M1CC 5F7WC 3ZE2F 4HD5A 1SXBA 3P9LB 1DQMH 2DQTH 3L3GB 4WHCA 1HL9A 3LEVH 3TXAA 3L3OC 4RZCA 2DD8H 3FT2B 4JFDD 1KJ2B 1GIGL 2YA1A 2XN9D 3H85A 6PAZA 4ODXA 1YZZA 3UO8B 4HK0B 5LBVA 5IROA 1RIUL 3EZJB 1AO7D 4LNRA 3EGSA 4E5XB 1BPVA 4TRPH 3ZN6A 4LIQL 1NCAH 1A25A 3SPVA 3MROB 3GO1H 5A40E 1DQJA 1R5WA 4PJAB 5T1KA 1RZGB 2IO5A 2OSYA 3O6FB 3D51A 3L45A 1LE5B 3MYJB 3N1PC 1R3HB 3QUZC 3FFDB 1SJEB 2LLGA 3PRZA 4Z77B 2WYHA 3FOMB 4MFHA 3F7YA 3WUWG 4JCLA 1OE3A 1QSFD 4K3JH 1TQTA 1TENA 3KCPB 1SJMA 3F7KA 4BV1A 5LXGH 2IAMB 2EXWC 3DHMA 4NZUH 2GC4C 4J4PD 3MFFB 4JG0H 4LU5L 4KJYA 5HGBB 1U92B 2A77H 3A67H 1BX2A 4P59H 5LN8A 3ZSTA 1KEGL 3C60A 1PY0A 2YD4A 3OLGA 5H37H 5KVDH 1PX4A 1CFTB 5D93C 1YNTB 4KKRA 3O3UN 2Q86B 1MCPL 5FECB 5F97E 5F9WB 3S8GB 4KUZH 4NGHL 2EVGA 4Z18A 2IWFA 3RVXD 4DGWC 4MXVE 2BVOB 3HZMB 2G3XA 3CHQA 2CBQA 4P2AA 4XZ4A 3GMPA 4JFOB 4A67A 4DO4A 3QC5X 4LQ1A 1TVHB 3T09A 3L8QA 4UAOB 3ARDA 3IE9A 3QI9A 3ECWA 4Y16B 1WC7A 3CZJA 5E4EB 3TX4A 5K9KB 4N8PA 4C4BA 2ADGA 3HPJA 4CC4A 2JWYA 3BH8A 5E2WH 4QY8A 1ETZA 4PRIB 1VFAA 2VDOH 1TU2A 2ZOUA 5D5MF 4EUPH 3ZMRA 2X28A 2NCEA 2VMCA 1A4JA 4GRLC 3QFDA 4OKVA 4P23C 2ZCHL 5FXCH 3WE6A 5KSVA 4I18A 2ALWA 3KXFA 4JZJB 1HEHC 4DW2L 2FR4B 3D18B 1U95B 2NY0C 3D25A 3FU9A 2OXGB 3H9ZA 1CXHA 4WHTA 5D2LA 2OMNA 3DJTA 4WFGD 4JQIA 1PY9A 4QRPD 2NW3A 1YRKA 2ICES 1FL6A 3RVWD 2AAVA 2EO7A 1JGLH 1NKGA 5HJ3B 1HFUA 2BDNL 4PRAA 2QDVA 2WXGA 3THML 3PWUA 2V2XB 2VTFA 1FLRH 3VMPA 3L4XA 3ILPA 3H9YA 3LMJH 1E4XL 3FF8A 1PDKA 2DQHL 3QCVL 3UP6A 1VA9A 3VFNA 4BXSV 1BZEA 5KUKA 1UXLA 3EOTH 1N0XL 4M6OL 3GZKA 2I5YL 3PV7A 5GS1C 3TVMC 5DRWA 1FIGL 4H1LB 2EH7H 3E80A 4L8SC 2X9WA 4B97A 1MNNA 3SQBA 2HH0L 1YPZE 4QXUH 4RDBA 1IAOA 4GNKB 5F7AA 4KKZA 4I1RA 2HUHA 2HPOA 1SBSH 3IFPB 2UY6A 3T2NL 4QHLA 5E9DB 5GRUH 5GIRA 1UB6B 2H47C 4EN3A 2P42B 3NG5A 4AJVA 3K8LA 1XAKA 5I1KH 1JZ2A 4PLOB 4Y5YA 2E7LC 1WUNT 3V2AR 5J3HC 1U3HB 5GGRA 1DSWA 3WO4C 3WEOA 1BDYA 1TYJA 5EZLB 5AVZB 2AK4B 4WEUD 1CMOA 5DJ8B 3Q5TA 2J21A 5C8JA 4JDZA 4HEMA 4WI7A 5G55A 1M71B 4KO5A 2WB7A 1HINL 2ZOWA 2A74C 2PETA 1FV1B 4GXVL 4WI2A 3P4NA 3MRKB 5EV7A 4PEEA 3EGXB 4YIQA 1FC1A 2WJ5A 4KMTH 1MSPA 1IGTA 3FOLB 3LV3B 4Z78A 1HCFX 5TTRA 3GEFA 1AQMA 1AXTL 2XG5B 1FORH 4AH2B 3PABB 4LE8A 3U6RA 1A47A 3VRLE 5KS9F 4JHWL 5I1JL 1PLGL 1NCBH 5T5NG 1GGIH 5EZJB 3D9AH 3GHPA 5ID1B 4OD2A 2A6IA 3S3JA 1N5YH 3LB6D 3UTZA 1TQCB 1EJ8A 3P1VA 1LMKA 1P7QA 4PWHA 1D7FA 4XBEL 1GZHA 4E9LA 5I1AA 1INDL 1A1MB 1WZLA 3CDYA 2Q7YA 1YY9C 5ENWA 3VXRD 4Y2DA 3UDWC 2ZJSH 2AQTA 1UASA 3P0VH 4FULA 1VB9A 2XPZA 4R7VA 4GBXD 5EORL 4CVZB 4FG0A 3HUJA 4AXWB 3BKYL 5TF1H 1AHWC 2AEPL 3D69B 4UZGA 1I1YB 4TUJB 4PJFE 4S2SB 2VN5A 4M3JA 1ACYH 2UZPA 1JI2A 4GXUN 3P30L 4HETA 2VDOB 1QEXA 2IDUA 4PRBA 4NJ9H 1AD9A 4IIQC 8PAZA 1JVKA 4PLKC 5HHMD 2X9YA 3D0AA 3ECQA 3QDJA 3IJSB 1I1FA 1NINA 2BZDA 2CALA 2VZOA 2ZG3A 4JM2A 3CHRA 3MR9B 3L13A 2G5UA 3FRUA 5IREA 2VZSA 5E7BA 1LO3H 3TNNA 3D52A 2C3VA 2BLFA 1S7UB 4XMZA 5T33H 5ITFB 3VH8G 1H8NA 2NY1B 3GI8L 3GSNL 2OI9C 4AKPA 3V9FA 4UM9B 1CZ8L 4F2MA 4DN3H 5HPMB 1XBRA 4IJ3B 5GGQH 2I7OA 2P47B 2XPGB 3C8KA 2PO6B 3P4MA 1NGQH 4LL4A 1NPUA 1M42A 2CBMA 5K59E 5F93C 1AKJA 4XPTH 3R8BB 3V5KB 3ZHFA 3MJ9A 2NLJB 4X6FA 2ZXGA 4AQZA 3EYOB 5GQBA 4Q2ZA 3F58H 3VXMB 4RFOL 2QPDB 3EOBA 3WEBA 2VKWA 1G4MA 3T0BA 5ACZA 4XGZB 2F7RA 1J5OL 1NEZA 1J8HB 3BGMA 3N3EA 4PREA 4CRPA 4ODTL 1LXMA 2DQDH 4W4NA 5AAMC 3OZKA 1G9EA 5LWYH 3GSVA 3GMQB 3KPRB 1ZOXA 4K7FA 1XGPB 2LQRA 4ZUVA 1QNZL 4IYKA 5EU6B 3MCLH 5CD5C 3DSFH 4YSUA 3K6SA 2KDYA 3HHMA 3OR6A 2WLLA 2H0JA 5HSFA 2VRKA 1WTGT 4O4YL 4G8IA 3ULSA 2WLIB 3IU4L 1M57B 3KCWA 2I60H 1A6AB 1DSFH 3LS4L 4X7TB 5F9JA 1ROWA 2W65B 4JANA 1FQ9C 2CO7A 1EFXD 2R29L 3E2HB 3MMEA 3NCYP 4FNLL 5CCGE 1LEIA 4UBDC 1A1OB 3BVWA 1G7HB 3TCXA 3SKOB 4RA0C 3UO1H 4S0TD 5D71L 4FFVD 1RLWA 2B16A 1NBYB 2E6QA 1AO7B 4KXAA 2BIPA 2F1EA 1Z2KA 1FGNL 1ORSB 3TO2A 2ICEC 3OJDB 3RWHB 5DHYB 3UG3A 1KB5L 1WS7A 4RIRA 1I85C 2IQ9H 3JWDC 4NQSB 1KF9B 4IKIA 3TEUA 2PWHA 4OCWL 3CVCA 2OCCB 3LX9A 5E6UB 3SKJL 3MV9D 5GZOD 4FC3E 1G0XA 3H9HB 2B3IA 4CGUB 4KROD 4OF5A 2F8VA 5T1DH 3RZCA 5DD1H 1BVOA 2G30A 3VMOA 2WP3T 3HE6D 1IGYA 4IK7A 5CLYA 2YEZA 4GLRH 3C2SA 2EDMA 5AW8B 3GI9H 4GEJA 1CL7H 3K8MA 3UTTB 1EHLH 3U2JA 4AKOA 1XZ0B 4AQ1A 2VLLB 1NTDA 4ISVA 3CX2A 1TZHA 4A7GF 3BQUC 4F7KA 5IMMB 3DKHA 2V3EA 3NCJL 3QSKB 3ATFA 3ZDXF 2FK9A 5JMRA 5JLZB 3QEUB 2Z4QA 3FT4B 3CMOL 4WFEE 1R1CA 4JFSA 3L95A 1I3UA 2UZYB 4H25B 4TVPL 5EZOL 4OZIB 3VWJC 5GZND 3VRJA 2X09A 4YFLF 4MNHA 2Y1ZA 1FH2A 3M1BB 5D70H 2CCWA 4J3XA 4PJ9C 4XVJL 4RGMB 3L9YA 4WV1A 5FR3A 3BW9B 1JV2A 1CD0A 4M7ZB 2Z34A 2A73A 5D7LE 5FGBC 4YBQD 3JTBA 3QG6A 1RIVH 1PKQB 1AR1B 1AGEA 5T1LB 2B4CL 2YXMA 1MLCB 1R5VB 4YSSA 1BF2A 5JHAA 4YL9A 4AW7A 3FQRA 4BK8A 5KVEL 2J2ZA 3I02B 2JE8A 4H20L 3DJRA 4KJQD 5I6PA 3ULVL 2E5EA 3QJOA 2YPVA 4YS4A 3RNQB 2YUZA 4PRHA 2FB4L 1KIQB 2EEDA 4HC1A 2RFXA 3GS0A 3ZDZB 3PG2A 5C3LD 1UD4A 4U33A 4QT5A 1T0PB 3ECVA 1JOIA 4FCHA 1GAFL 4ZOCA 4GQQA 5GGTH 2E9JA 3EFFA 5E5LA 1I9JL 1RJCA 5DJ2A 4EEEA 3TOPA 4N6RA 5FFGA 4WI3A 4LRIC 3HC3L 3NPZB 1DO6A 5AZEH 5LQBH 1UT2A 4K8RC 3ZL4H 4I0KA 4ELMF 1E5BA 4ZFOB 1JPFB 2D7PA 4J3SA 1JVOA 3RGHA 2ICWJ 2AJXL 3W3BA 3G6JF 2WSPA 2WQVA 3FN0L 3AM8A 5DHDA 2IGTA 3I9AA 1BECA 5FDWA 2Y3NA 1HE7A 3IXTB 1EZVX 3T6ZA 3AG4B 5HDQH 4PWIA 3UPRB 2XOTA 4C56E 3GMNB 1OGTA 2Z7WA 4TNFA 3SO5A 4B5EA 1Q9LA 4JFFD 5BQDA 4LVEA 4YGVB 1WISA 5EO9A 1CG9B 2HRGA 3MV8A 1EA9C 2IADB 2OR7A 2YAQA 1MWAB 2AJ3B 1G7MA 3S35L 3T77B 1P2CA 3TWYA 4JM4L 4DKFH 4OJAA 2WK2A 2CKNA 3AUVA 4LVNB 5ALCH 3DIDA 2EVJA 4EVNA 2CO3A 4XO9A 1YY8A 2ZYIA 5E2TH 2DIEA 1I1RA 1YYML 1NBVL 3Q2CA 4LF3A 4G83A 3PL6D 3P77B 4ONGH 4R84A 1CURA 3MDJA 1FNHA 2VYRE 2EEAA 4JHAL 5DMIL 1X5GA 1SJXA 5MEOB 1KLGB 5ESAB 2NXZD 1AQ8A 4HJEA 1DN0A 2KPWA 2MQCA 3V0HA 4HMDA 3VXSD 1J5IA 2CCLA 2A6JB 1V3LA 4M1GH 3MFGB 1ZA3B 4NI6A 5HHNB 3EGDA 1ND0B 1MFMA 2E4TA 4KUCF 4EQ3A 3N50A 1TEFA 3DMMD 4WSJA 4HWZB 1ITCA 1VGEL 4YLCA 2O6CA 1CF1A 3T1WA 5J6HA 5DO2D 3BKJH 3VW3H 4GRWE 3T04D 4BFIB 4UQCA 3BZEB 1DYZA 3KYKL 2DI7A 3V8CA 1KJ3L 4OFKA 4OFVA 1WG3A 1XF5A 4YHML 4YNYA 3EAKA 1ILUA 1DBJH 4MCYB 4ZO8A 5EOCJ 2ITCA 2Z91B 2C26A 1ZJAA 1KULA 1KYUA 3N9GH 3GNML 3PGCB 4NQED 1J05A 1J5DA 3F7QA 1WS8A 1E9OB 3GRWH 3P02A 4CSZA 1SXZA 5BV7H 3IDYB 5AENA 4CJ1A 1F3JA 4J2QA 4RISL 3QZLA 1OAQH 3N6YA 4LSRH 1WF5A 3FQ4A 3LIZH 3VD2A 1I9RH 2BVQB 3DDFA 4GSDL 4L4TD 1KYAA 5LNGA 2FJFA 2GIYA 1S7TA 2LHAA 5I74C 4X4ZA 3V4VB 3VI3B 1VIWA 3B5GA 4GT0A 2QELA 3E6HA 3UAJA 4B9GA 3CFDA 4RMTA 5ALBL 5HHMB 3DV6B 2K9FB 5EN2A 5IJCC 2X1PA 4O2FB 2JTDA 4L3EA 5C6PB 4TTDD 1MVUB 4YVNA 1E90A 3TYGH 5I6OA 2DQFB 1MIEH 2P8LA 3TYFA 5E6ID 4D9QD 3BHBA 3L3HA 4PLNC 4KXZI 3L5WB 5IQLA 1C1EL 2X2IA 1BJ8A 1INQB 3NH7L 4M61A 4MHHI 1R46A 5ICYA 3DGCR 3K0YA 3QXAA 2QADD 4Z7IA 3NPSB 1Q38A 2GI7A 3OHXC 4WJ5A 1PEZA 1BQHG 1H0DB 1LK3L 1IC1A 4JPWL 2P8PA 1EXHA 2BP0B 2B39A 4XN9A 3GSQA 5CZRA 2ED6A 2HP4A 3BAWA 4X5XB 5JW4M 4QXGL 4YK4C 5DQDH 1NMAH 2DM2A 2D03L 4AMKH 2Y1YA 4P9HC 3FCSB 3ESMA 1EUTA 3HC2A 4Y19B 3RL2A 4IRZL 5JHBA 4KX7A 2OL3A 5E9NA 1A2YB 5F0PB 3V5DA 4X6DB 1WFNA 1D9KB 1BD2E 2J3SA 4V1DE 1SOSA 1OF2A 2J6EL 2XZQH 3QCUH 4JDTL 3RVVC 3GS7A 5K1JA 3S88L 3U0WH 1A8ZA 3TBBA 1BQKA 1UZ8A 1U8PB 4PQXA 3ARXA 4NHUA 3ZZSA 1RZFH 3KWVA 2PWDA 3KPNA 4FQ2H 2N4IA 5CJQH 2F5AL 4N2IA 1IBYA 1V3JA 2JKRM 4GMSL 4U6VL 3CN1A 3P9LA 3PNRB 3VYOA 3L3GA 3NOIA 4LASL 1EFXB 4WHYH 4LRNH 3FT2A 4XE0A 1KJ2A 1N5AB 5DD6B 4F9PA 2WLMA 4X5LA 4IRJC 4JFEB 1JPTL 4DUXA 3NSCA 4HJJH 1IUZA 2EDEA 4HK0A 3CFIC 1OGAB 3WLWD 5L2KD 5FYLE 3RIAF 1HZHH 1ZD6A 1ZTXE 4W9GC 4E5XA 4PGDB 1NANI 5JQ6L 4FKHA 3VFGL 3P3YA 3MROA 4N9OB 5HYQB 4M6NH 3TPKA 4PJAA 4EN2A 4NFDA 4CSPA 1RZGA 3O6FA 3ELAT 4NC1E 1XF2B 3STLB 2EIBA 3MYJA 1QQDB 2X5PA 1R3HA 4DHLA 1PG7H 2CJSA 3L5HA 1HHJB 2GBTA 1EDHA 3FFDA 1SJEA 4Z77A 3TN0C 4KROB 4LMQE 5DMYA 3FOMA 2WXRA 2I26N 4MAZA 5D2NA 2AVFA 1YEEL 3A5VA 4AQ8C 4BA8A 2P3YA 5AB0A 3ZLQC 3KCPA 3U9PL 5I15H 1CLOL 1JCVA 2XX0A 3BZDA 3Q8AA 3WTTA 2IAMA 2WBJD 5EEXA 3NA9L 4GFXA 3FTWA 2ZAIA 1TTCA 5EIIG 3MFFA 5HGBA 1OP9A 1U92A 2G4GA 3T65B 4F8NA 3VDBA 1GH7A 3CCHB 5HI5D 4FP8H 5SWQB 2EUVA 1NGWA 2P80A 1ZHLB 3VFWB 2EDDA 1YNTA 5FECA 3P73B 1QOKA 4KI1A 2XXFA 1MFNA 1QD0A 3ZVVA 1LP9F 4YUEH 4IOSA 1HE8A 2E27H 2VR8A 5HDLA 2BVOA 3HZMA 2ZICA 2HX7A 1S78D 5BV7B 4JFOA 5FUZL 1OAYH 1UURA 2B77A 2RH0A 4K23L 4XCCH 3M8OL 1TVHA 1T7YA 1F3DH 1CB4A 3AT9A 1Z9MA 3DX8B 4AEIH 1J87A 1JIBA 3DX9B 3MRIB 4FXGC 4Y16A 3S2CA 5K9KA 2EVFA 5GRJH 2P5EB 4M7LH 4I89A 2GJ6E 1X7SA 3FN3A 5DUPH 4PRIA 3BI9X 3PUCA 3QEQE 4L1BA 3V0WH 5ADOL 5KBLA 2E7DA 3VXOA 2GTQA 3B7YA 4CMHC 1DBMH 5C8JB 4JZJA 2BFGA 3D1MC 2FR4A 4PGJA 3D18A 1U95A 2WZ6A 5DU7A 4GY4A 1JP5A 3NDZE 1O6TA 2OXGA 3Q9PA 1HAUA 4NX0A 5JPMB 2OM5A 5HDBE 3MO1B 4A37A 4M8QB 4I0PD 1ZIAA 4CL7A 2BM3A 5E6SB 4DEPC 3JVGC 5HPOA 3OAZK 5HJ3A 2VXTH 3QR1A 1WITA 4KY1L 5B3NA 2WCPA 2X87A 2BWIA 4M1DL 4OQTL 3QWRD 2V9TA 4DO5A 1CD1B 2V2XA 1QFWM 4OIBA 5GXBB 1KBWA 4P4KD 2ZUSA 3DTDA 4TL5A 1VADA 5E99H 1F8TH 2DTML 4FHJA 3ZE1E 1V7NL 2ORBH 4FFYL 5IBTL 4Y89A 5IUSA 5D7IB 1MJ8H 1SM3L 5LUMA 1B88A 1A02N 1R17A 3FO0L 4H1LA 3WL9B 1EDQA 3L4WA 5J6GB 1LM8V 5KJRL 1KGXA 3S36L 4OLVL 5D7SL 3IFPA 3WIAA 4RMVA 5I5RA 5JOPD 1MHHB 3KYNB 4MZRA 3F85A 1G9NH 1UB6A 2GSIB 3JWNE 3QNZB 5F3HB 5FUOL 3KPSB 5D4QA 4OZIF 1Y18B 3SYCA 2XIDA 3NESA 4YXLL 1U3HA 3D07A 3PUUA 4GH7B 4WI0B 1OWRM 4HOZA 4NC1C 3S37H 1WBZB 1OAZH 4PYGA 5EZLA 2AK4A 4I3SH 5DJ8A 1CGTA 1T2XA 3SGJC 3BRGC 1UWFA 1F4XH 4IDJL 4HDIB 4R2GC 4NN7C 5E5RB 3V6OA 3VD5A 1SYVA 5LO7A 3W0WD 3KDPB 1M71A 1FV1A 2Y2TA 3QCTL 1UFUA 4RMQA 2K4WA 3MRKA 1KCVH 1L3NA 1DEEB 3BSZH 4PJHE 2VDQH 4BINA 2EZ0D 3EGXA 4LBEB 4PIRF 1HYSC 2DDQH 2C5DC 5D1XD 3FOLA 2Z93B 3AABA 3HI6H 3ZE0B 3NACH 2L7EA 2XG5A 3QUXC 4AH2A 1NCJA 2X70B 3AWGA 3PABA 3TBSB 2IQAB 4K7PY 4ERSH 2WV3A 3ISYA 4AYBA 1J0HA 5EZJA 1TQUA 3WXVL 3M17B 5M94B 3DMMB 5ID1A 1KPRB 3IMUA 1KN2L 1GYVA 3O0RL 4C59B 3D39E 1DZBA 4GAJH 1S8DB 4MTMA 4KHXL 1CT8A 5F1IB 3VD1A 3JUYA 5TQ0L 5I24A 2WPGA 1H3VA 3CN3A 2B7DT 3LYRA 1N12A 4JFTA 5H37A 1ZLEA 3U4BH 5JZ7C 1A1MA 5SWZD 3TBYB 1UH3A 1TYEB 2V4LA 3L4TA 2N0KA 1OWWA 7FABH 2Z1KA 3FTZA 2X7LB 1NKOA 4FOMA 2JKIS 1KZQA 2YD1A 2ZCZA 4XOAA 5FGCE 4LPVA 4CVZA 1F1AA 1RLBA 2G60H 4Z95H 2B59B 3T0EE 5C0ND 4AXWA 5A2JH 1SEQH 3T5WA 1DVQA 5MHSE 2ZYHA 3D69A 5IB1B 1I1YA 4TUJA 3BT2H 4S2SA 2V5RA 4L4TB 3ZKQD 1TNMA 1TDQA 1Z3RA 3V4UL 1KTCA 3CU7A 2DPKA 5JORB 5DD5H 1OZTG 4RGOL 3ZQ9A 3IJSA 4YDJB 4P2OB 4K8RL 4DOHE 5HHVH 3ABLB 4FYSA 3NJMA 3ZY7A 4YHLL 4OU3A 5H2BB 4MA8H 1IAII 1VF5C 3NJIA 3T4AC 4DP8X 1S7UA 5E6IB 1PLCA 4HJ1A 5ITFA 1X6LA 3FN9A 1OM3H 2OZ4H 3VH8B 4UM9A 2TSAA 4TQ8A 1AHMA 5HPMA 3GXFA 2EE9A 5AQ0A 1FFPB 2XPGA 5DMGC 2WXHA 2PO6A 2X10A 1A65A 1AHKA 1PZ2A 2IMNA 3BAEH 4ZUSB 3ZKMC 3V5KA 5KEZA 4Q9RH 2K4AA 2NLJA 1ID2A 3EDDA 4ZS6D 3T0AA 2NY2B 5C0BB 3ABKB 3EYOA 1IFGA 3JWNC 3OZ9L 4Z0BH 3BSHA 2LLLA 2FQEA 3O4OC 3VXMA 1D5IL 1J86A 5ESVB 1WAEA 3CVHH 4XGZA 4OGYH 1ZS2A 1JGVL 2EXYD 2DJMA 2Y2WA 1DBKH 1J8HA 4QXWA 2CAKA 5LNDA 4Z7QB 2N1TE 2BZCA 2O6DA 4XNZC 4E41E 2HMID 1BREA 3GMQA 3KPRA 3LNEA 4QAWA 3OLIA 1XGPA 2DWSA 1ZKAA 2CDGA 2WHVA 3F6JA 4UAHA 5EU6A 2R0WH 1GMEA 4NC0B 3SOBH 4I2XE 4NHCL 5J12B 2V17H 3B9KC 1O7DE 4PIBA 2MPAH 4FQCH 3LEXB 5D7HA 5F7EH 2WLIA 4AIEA 2F5BL 1A6AA 3PDDA 4ZFGH 4NN6B 4OM0H 4X7TA 3I6GB 2Z8RA 2W65A 4KKNA 3GIVB 3QXTA 4FQPA 2KZBA 4DP7X 1A1OA 1G7HA 5DWUH 2VMJA 5GHWH 1LGVA 2NNXA 5L2KB 5EEYA 2GUOB 3PV6B 1NBYA 3FQNB 4GOSA 3VI3F 1FO0H 1HQRB 2YPLE 1OB0A 1ORSA 3BC9A 1Y0LB 4K5OA 2VDQB 2VKXA 3OJDA 3RWHA 5DHYA 3WKQA 2VDPL 3SODB 3MZTA 5EU5B 3R0NA 3ZUNC 1CE1L 2ADJB 3F7LA 4NQSA 1KN4H 3FCBA 1S5HB 3MUJA 3WNNA 1L9OA 2VLKD 3DSNB 3RWIB 4RBPK 3H9HA 1C08B 1U2YA 2HLFC 4KV5F 4MRCA 3II1A 3UYPB 3AG3B 3EBAA 4MMXB 1AI1H 1UCBH 2F53E 4KGLA 3ZKNC 5A6IA 4WIQA 1DJSA 5IHUL 3C6EA 2OJEB 1KOAA 1ZT1B 1A3RL 2APSA 1XGYL 4OI9A 5I6NA 3WS6A 2UZXB 2QZ5A 4NYLB 3G9AB 1M9SA 3IJ9A 3T0EC 1FYTD 3H42H 4OD1H 3UTTA 4DIXA 5CEXB 2O5ZH 1XZ0A 1NCTA 2VLLA 4I3RH 5IMMA 4JCWA 4U1MB 2YPKB 4NENB 2YUXA 1PG7X 4F37F 2AFNA 4X6DF 5JLZA 3QEUA 2YZ1A 3FT4A 4OZIA 4H25A 2UZYA 2P8MB 2BVTA 1URIA 2ZWLT 4EOWL 1W9XA 2BP8A 1WRFA 1EVUA 1D5RA 2YGPA 3UACA 1T83A 3M1BA 2QJDA 2OTPA 4ZAKB 3TPUA 2ZUQB 4K2UH 1LJMA 3BW9A 2EICA 4XN5A 3VB8A 1ORQB 4GINA 4PWKA 3WEMA 1T89A 4CGTA 2WAQA 2RMNA 2EH8L 3X1EA 1TETL 1PKQA 4NNPL 3LRMA 4LSSH 1CLYL 1Z9LA 1XGQB 2VB5A 4GAAA 5E2UL 3UTPD 4ZMVA 2A6KB 3AQYA 1LQSR 3RA7L 3BWAB 5T1LA 1RPUA 1MLCA 5FFLA 4KTEL 2WANA 1R5VA 4P9HL 4U3HA 4HPHA 3CVIH 1XEUA 4TULL 5IB5B 5BZWB 1MKFA 3BYTA 3I02A 2DMBA 4G9FE 1PX8A 1K8DB 5D6DA 4PI2A 3RNQA 3GK8L 1KIQA 3VJ6B 4D0CB 2X4PB 2IH9A 5CEYB 2X9XA 4FNPA 4PRPD 1NZRA 2WLJA 4W9KC 4W9IC 2MKWA 3H3KA 4NZTH 4NZRL 1XQ4A 2A9NH 2V9RA 5IHBA 3QRFM 1M6OB 2F8XC 5F9AC 4YXKH 5D72L 2OJZH 1IGJB 3WJLA 4UZSA 1KFAH 5AYUL 3ZRCC 1AIZA 1KFGA 4F8LA 3ETTA 4P04A 4N24A 1MHPH 5M7QA 1GA2A 4DJMA 3HNTH 1O7DC 3TP4A 4FNSA 1YQVH 1ZHBB 2UWEF 4LCCC 3FAWA 3LZFH 3MCKB 1BMGA 4UTBH 4Y7OC 1JPFA 2DQEL 2I9LB 4ZFOA 2SODB 5T3XD 3H2QA 1E42A 3OAZH 5GS0H 3L4ZA 2JKWA 3FUEA 3BZ4B 3NSXA 1BG1A 4NO5B 3FTUA 3ARGC 4P2QD 2CQVA 5D1QD 5F0LB 4AC4A 3IXTA 3GPEA 4J28A 4KQ4L 5IP4A 3UPRA 4L4VE 4LSQL 3GMNA 4BQ9A 2B1OA 3DGDA 2ZXCA 4NQDB 4RX4A 3TJHC 1IE5A 3O8XD 1N4XL 1K8IB 4LCUB 2ZP8A 4XXWC 4NXSA 1IC7L 4YGVA 3K91A 4JQIL 1CG9A 3NEXA 4F7TB 2IADA 1DQDH 1F90H 3MRLB 3T77A 2HLAB 1UM4L 3SJVD 4WGKA 1FO0B 3BEWA 3W0WB 1JYVA 1KYOJ 4Q4IA 2EP6A 4Z7WE 1WGVA 2VSKB 3L5XH 3N0PB 4WUUB 3P77A 3ULUD 3EYFB 4OM1L 4GAGL 5L4IA 3MXVL 5MEOA 5AAPA 1KLGA 5ESAA 5D1XB 2EYSB 4KI5E 2A6JA 3GQFA 3DYPA 2FYVA 4ODSL 1ZA3A 3I6LE 3S37X 1S7QB 3KLHD 2FX7L 5HHNA 5EH1A 1ND0A 2FSDA 3P40A 3QAZB 3PU7A 1V7ML 4QMEA 1MPAL 3IAPA 3JZYA 2O30A 4MAUL 2QEJA 2XFXB 2CLVB 3IJ7A 3LH2L 32C2B 1RJZA 2CMRL 1OIOA 3Q8CA 1X4ZA 1IJNA 4UNVA 3LVEA 4BFIA 1FBIH 3BZEA 1UUSA 4GS7C 3NIGB 1PSKL 2IBZX 3IMBA 1L0QA 1IM3B 4CDGC 4XP9L 4MCYA 3TJEH 3FUHA 5EZIH 3WN5C 2ICWB 2VLRD 4LAJH 3NRFA 2Z91A 2H1PH 1KWGA 3PGCA 1RZJC 1IQWH 4GJTB 5E8PB 1H3GA 2CRMA 1TJHH 1W6WA 1E9OA 1OCOB 1ZAGA 3H1ZA 4Z3FA 3L4CA 3NJVA 1ACXA 4MHHG 4AVHA 2EDRA 2HTLC 3DX7B 2B9BA 3GTVA 4A04A 4LCIL 1A6TB 2BMKB 5DT1H 1GTNA 4AMXA 4GXUM 2FBRA 4N2EA 2BVQA 3V4VA 5MP6H 3VI3A 5I75B 2DJUA 2X42A 2IFFH 5GJTL 4XAKE 5F6HI 3DV6A 4BM7A 4MQXD 4XVTH 5A6MA 1GXEA 4ICXA 4O2FA 5E1QA 1UWGL 1MVUA 3EJJX 4GQ9L 4JVWA 5SX5K 3HLAB 4PS3A 3TH2T 4AT6B 2DQFA 3U30C 3RX9A 1CGUA 5E9DE 4RETB 4LZKA 4PBXA 4S1SL 2HRHA 4N0CD 1M6UA 3UGEA 1JNLH 3F7PC 3L5WA 5HJBA 4P2RD 5H35B 3MI6A 1JTPA 5IBLD 3X11B 1ZTXL 3JSSA 1CDIA 5B1CA 4WHDA 3L17A 5GGTA 5KWYC 1GGYA 1WD9A 1M56B 4P5TD 3DUUB 1PZDA 1ZLSH 1H15B 2Z1PA 4JFPB 2VUOA 5JHDE 3RNKB 1H0DA 3WFHB 4J3TA 2BP0A 3E8UL 4KVCH 3DI3B 4PS4L 3BIBX 4RNRB 1R9FA 5LCVH 4M8RA 3K6IA 2DAVA 4TPRH 1XIWD 4XNYH 1IFHH 4X5XA 3R8QA 5L2JB 2HJLB 4KKBC 3FCSA 5SWSE 4Y19A 3L81A 4APXB 4R7LA 4BWTA 1A2YA 4X6DA 1E27B 3P0YL 1D9KA 4BFKA 3TO4C 1GGBL 2R7EB 4RAHA 5E0QA 4G6FB 1X5FA 4WFHD 3EH2A 5FIEA 1U8PA 2Q6WB 4LSVH 3H9SE 2IBBA 3LPFA 1PAZA 1K9TA 4OJFH 5GGUB 4LQFL 1U0QA 2W07B 5JW3L 4X4ME 4NPKA 3JZ7A 5I28A 1EFXA 3NJJA 5CEZH 4WK4B 4J2XA 1N5AA 3L3KB 4KI5C 5DD6A 2CCVA 4D0DB 4JFEA 3MLWH 3P3RA 1QLEL 2ZPKL 4HXAL 3BPLB 4P8QA 1OGAA 4DGVL 2G5BB 2J1XA 1PFCA 4BZ2H 4ZS7L 5AZ2H 5C0DB 2YK1L 1KTBA 1JV5B 4PGDA 2WVUA 4I3GA 4TKWA 1JGUH 1G5AA 1UJ3B 2NPLX 3OAUL 3ULUH 4M43H 1EBPA 3OLEA 5HYQA 2F54E 4TNVK 1AJ7H 2BX5A 3BH9B 2BSRB 1LTXA 1B6DA 3APMA 3ARQA 3D0LB 3LQZB 3CBJB 1XF2A 3STLA 2ROYA 2JJVA 5AVUB 1QQDA 4ETYA 1EMTH 3HNVH 5E00B 4JPVL 1P7KB 2VLKB 1HHJA 3DJSA 3BN9D 2NYKA 2WKGA 3LKRB 1ZEAH 5B39G 1CUOA 1MW3A 2IPUG 3L48A 3FFOA 4X5QA 4WTZA 4YC2C 5J56B 1SOKA 3OX8B 3F65A 2AC0A 1CDGA 5DS1A 4EAEA 2XWBB 2G75B 5E08H 3T65A 4MS8C 3TA3B 3WNOA 1J1XH 3CCHA 4G7YH 4BRJA 2F7IA 1CICD 4HGKC 5SWQA 1MY5A 2EIMB 1YYCA 1UM6H 4WEMB 2YBGA 1ZHLA 3VFWA 4Z5RB 3B83A 3P73A 2B1AH 3T1FB 4DERA 4NKIH 4UQBA 1XF4B 4YDMA 4OV5B 2JVUA 1KG0B 4FQXC 3GRWA 3QNFA 4JQVA 4Z7UB 1KYOK 1RUMH 2QQKH 1ECYA 1SXAA 4DP0X 1FAKT 4Y4HA 3DX8A 4ICWA 2RIKA 3LIZA 1AZNA 5FHAH 4BZ1A 1Z9PA 2IOOA 3ZDYE 3P3UA 3MRIA 3DX9A 1CXEA 3P54A 4GEIA 5LAXB 1MZZA 2P5EA 1SHMA 2NY6C 1QRND 5CCKL 2HFFB 3BVDB 3U4EB 3UIYA 4POUB 1SUHA 2OMTB 3QEGH 3B3BA 3FTXA 1BFVH 2EABA 4K5LA 3T0WA 1A0QL 4F33B 3RG1C 4OZFH 4XP1L 1SVZA 5DJCB 2BS9A 4PJIB 5FO9B 3TBWA 3ROOB 3Q6FB 4KO7A 4XNAA 4PVNA 5JUEL 5JPMA 1UA7A 3MO1A 1NAML 3KYOB 4M8QA 5JNYB 3ATBA 1GIGH 1R3JB 2DEXX 1INEH 4TYUA 1CPUA 4PRPB 1HI6B 4JFDE 1UB5B 2VUYA 2XN9E 1CQYA 1OARH 2A0LC 3V6ZB 1RIUH 1CD1A 3TBVB 3U0PB 1EEUA 1SJVA 5DRXB 3UMTA 5I8EB 4LIQH 2FQFA 4OFYD 1YLBB 4UOW1 1ASPA 4U7SA 3U48A 1O5DT 2W91A 2YZ8A 5LGJB 4D2NA 1RPKA 3QZOA 1E3FA 3E8VA 2YARA 4MXQC 1OAUL 3RIKA 3WL9A 2BVPB 3FSWA 2ZOKA 4TLKA 2YGOA 4X7FC 3VI4F 5J6GA 3P9MB 4PS8A 4IMLB 3MBEB 3S8FB 5HYEA 1VFMA 5D1QB 1MHHA 4HOWA 3KYNA 2KDGA 2UVFA 4X8JB 4MJID 4W81A 4X0KB 3QNZA 1QSFE 2GSIA 5E5UB 3FO2B 3QXUA 5F3HA 3KPSA 2GEEA 3VD3A 1Y18A 4LU5H 2Q5BA 2YPVL 2FCBA 1MHEB 5EWIL 4WI0A 1YN7B 3EBHA 3M45A 5DK0B 1WBZA 3RI5K 4HC1L 1R33A 3MVSA 4GQZA 4KDVA 1JZ3A 3QG7L 4HDIA 3H53A 4JO5A 3SJVB 3R7QA 1DVXA 4NGHH 2XRAL 2BXYA 1TR7A 5HD8D 5A6LA 2O4EA 2F1AA 4YZFF 4LP4A 1BOYA 1DEEA 4PU2A 5C9JB 3DHJA 4LBEA 3W5NA 2AGJL 2IPUK 1QR1B 2GITB 5LGHL 3EF4A 2BINA 1JGDB 4N2FA 2Z93A 1A7PL 3RTQC 3WAKA 5TQ2L 4DK6A 3QXWA 5JXEA