2JQMA

Yellow fever envelope protein domain iii nmr structure (s288-k398)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
112
structure length
112
Chain Sequence
MSALTLKGTSYKMCTDKMSFVKNPTDTGHGTVVMQVKVPKGAPCKIPVIVADDLTAAINKGILVTVNPIASTNDDEVLIEVNPPFGDSYIIVGTGDSRLTYQWHKEGSSIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Envelope protein E
publication title Structure of yellow fever virus envelope protein domain III.
pubmed doi rcsb
source organism Yellow fever virus
molecule tags Transferase
total genus 30
structure length 112
sequence length 112
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2007-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2jqmA00
3N42F 3C5XA 3N43F 2JQMA 2GG1A 1Z3RA 2P5PA 3N44F 1URZA 3J2PA 3UZVA 3N40F 4FFZA 4FG0A 2JSFA 4UTCA 2ALAA 5LBVA 1UZGA 2I69A 5H37A 5IZ7A 4UT6A 5JHMA 1OK8A 1PJWA 1S6NA 3N41F 4UTBA 3WE1A 4ALAC 3VTTA 1TG8A 4UT9A 4AL8C 4X42A 4AM0Q 2V33A 5KVDE 5KVFE 4BZ2A 1OKEA 1Z66A 3G7TA 5JHLA 3MUUA 4L5FE 4UTAA 3UZQB 2R69A 4GT0A 2H0PA 4BZ1A 5GZNA 3C6EA 1RERA 3IRCA 5KVGE 5IREA 1SVBA 4FFYA 5B1CA 5AAWC 5GZOA 2HG0A 3UZEC 3J27A 3P54A 5KVEE 4GSXA 3UYPB 3UAJA 5AAMC 1OANA 2JV6A 5LBSA 5LCVA 2R29A 1ZTXE
chains in the Genus database with same CATH superfamily
3OF6D 2HX8A 2D7TL 1FLRH 1DQLL 1IC0A 1OP9A 2JF1A 3KCWA 4NN5C 2GG1A 1T6BX 4PCTA 3CXFA 4XX1G 3AREB 5KSBA 3T0ED 1EA9C 3O0LA 5CCJA 1ORSB 2QVFB 2YIHA 3ILDA 4LCCA 4KGJA 2F19H 4H25B 4FTDA 4MSWA 4R5TA 3T1FB 3SKNB 3QRLA 4FQLL 4MZRA 5JPNC 3U0WH 2YGOA 5DQJB 4FQIH 2W94A 3FS9A 1PZCA 4L1DA 5AOJA 1A6VL 4H1LG 1H3UA 2DM3A 3ARBC 4I3RH 4KHXL 1OP3K 4KKPA 1I7RA 4NRZA 2VDRH 2JKXA 1QRNB 4LSTL 3Q9PA 1E30A 1YEEH 2EIDA 4RDQG 1Q0YL 1Y1DA 1WWCA 2C1OA 4FG4A 4BA0A 1CXLA 5MHSE 1Z9SA 5C0DB 2L04A 3VNYA 1JCKA 2D03H 5ICZA 3GKWL 1WFTA 5L4JA 2O30A 3E6FB 1KTLA 2AFNA 1O5DT 1URIA 5EIQA 4PJDB 4O2EA 4RCAA 3WHXA 3NUKA 1TQSA 3P4NB 4QF1B 4RMWA 3VXUD 4XGZA 3ZO9A 4JVUA 1SXZA 1RZJH 5B38A 1CF8L 1CIDA 3ELAT 3MRLA 4KKLD 3R1GL 5T3ZE 1N5YL 4UQCA 5J1SC 4GRLC 3T3PF 4U0QB 5DD6B 4XAKE 2A4EA 3LS4H 2MPAH 4J8RB 2WCGA 4ZPTB 2NNCA 1OXYA 3U25A 1ZOXA 4ELKB 5DMYA 4PJ5A 1JWMB 1ZT7B 4JFFB 4KK6C 3L5WB 3WJJA 1YEGL 5AAWC 5AW0B 4JFZH 3FT2A 1EJ8A 2PP9A 3R4RA 2ADGB 3A67H 3QDJE 4HWBA 3K80A 3BEWB 2BPBA 3EFDH 4OLXH 4XE5B 3U30C 2XWBA 1T21A 4I87A 2CPUA 4EKXA 3U7AA 4DKEH 2XQBH 4EI5C 4XX5A 3ZT6A 3SJVE 1NUDA 2VRAA 4W9KC 1G94A 3P4NA 3B5GA 4QF1A 4F5CE 3VXPB 3MRRB 4G6AD 1VZHA 4HJJL 3FN3A 2XWTB 3QXDA 4YXLL 3W9DA 4YHOL 2FK9A 2R59A 3KVDD 4M1DL 5LAPA 1QO3A 4ABUA 4V1DA 1IARB 3V0WL 2K45A 5DWPA 3TA4D 4ANKA 1KJ2H 2WLLA 2HFFB 1L7TH 1VDGA 2IQAA 4U1HB 5CIPB 4YNYB 4KDWA 2Q7AA 1XAUA 3GXFA 4GKSA 4I88A 5E00A 1BM3H 3ABMB 3CVIL 5DC0A 3G6AA 2OMZA 3CNKA 4FTVE 4LMQI 4IM8A 4Y5VA 2M26A 3UZEA 2N3JA 5AQ0A 2Z8WC 1YN7B 4K9JA 4HAFA 4F7EB 5D70H 1XIWA 1K6QL 2JB5L 3QUYC 4EIZC 3NFPB 2WXIA 4B9GA 1I7TA 5K9JL 5C0BB 5DC4B 4ZW7A 3ZBMA 1SYSA 5H4YA 1PTZA 3P30L 4EI6A 3V4VB 1EO5A 1ZVSA 1DUYB 1D2OA 3SDYH 3SPVB 4PVMA 4GBXB 1THAA 4PJ5D 3BLKA 3I6SA 5I1GH 2OL3H 4WIQA 3IVKA 4RBPK 1JWUB 1NC2D 3QPQC 1FF5A 5KVDL 4Y88A 2IH9A 1TF4A 1RY7B 3C6SB 2QLVB 3CXDL 2EIZA 5DD3L 1K2DB 3GI8H 4UV7L 2A6JB 4YNYA 3LOWA 4HWNA 3LB6D 4U1HA 1HK6A 4FXKA 4LBEA 3PFUA 4EDWH 1Q9KA 1WF5A 1JGUL 5JW4M 1WEJL 1BZ8A 2EIBA 4KVNH 2XU9A 4U6VH 3VCLB 4QHKI 3QGVA 1RUQL 3W9EB 1QEWA 1DLFL 2APTA 2ZWNA 2EDBA 4V1DD 5C0BA 4ENZA 4MKMA 4QHLB 4NO0A 4Z0XA 3S37L 3ZPDA 3CQFA 1HINL 4QRUA 3VXMD 3ZYIA 1ETA1 1W72A 1BFVL 2FQDA 4JFYB 3T6ZA 3ZE1B 3TYFA 1VFBB 2EDLA 4JQIH 4L9LA 2AF2A 3KPMA 4L9DA 4FG6D 1E7VA 3SDDB 1SN0A 4F58H 1D5IH 3MLRH 1MQ8A 4CAGA 1DUYA 4QRAA 4RGNC 1SZNA 2F1AA 3FSVA 1FNGB 1F13A 3R18A 4FHJA 4K71B 5I30H 3IJEA 4YJZL 1XIWD 2JK5A 2J1YA 4QCIB 4ODTL 1KB5A 4G5ZL 3QCTH 4BSJA 2CE6A 1NGYB 2DQEH 3DV6A 1KCLA 2N59A 5F7NC 3RVXD 2XV0A 3GZQA 2VM3A 3BP7B 4LEEA 3KJ6H 2HTKD 1F6AA 4Z8FL 4XMXA 3SQOL 3UXFA 5HYQA 3H0TA 4IBLT 4HDIB 2APWA 5FB8B 5KSBE 1K4DB 4I77H 2FH8A 3WO3B 3W9EA 3KPNA 4FFTA 3NSJA 4YSTA 5C6TH 3UYPB 3GRWH 3KPTA 5JO5A 4NAJA 5FO2A 3PWPB 3TN0C 4FYQA 4QHLA 1NIDA 3FO9B 2P8MA 1EHXA 4YDKH 1MPAH 1SHSA 3PAZA 4R9HA 4HLZH 3GSNL 3H7BB 4NRYA 4ZMZA 5I8CB 1AGFA 3MXVL 1AS6A 1QW8A 4NUJA 3SDDA 2H1PL 4EMZA 4O2CA 2V6HA 4BXVA 3L54A 3PJSA 2BOBB 3BE1L 4NO0D 3C60C 1MFUA 1NGYA 1EDQA 3EBAA 1EHLH 5F9JA 3WNPA 4G8GA 4BDVA 1A4AA 5FO9A 1LO5B 4DP7X 3GB7A 4HV8A 4HDIA 1DBJL 4N2BA 3V0JA 3ARRA 2DTSA 4L4VB 1RUMH 1T0MA 1LEIA 2Y1VA 4DP1X 5L0QB 3IMWA 5IVNA 5FECA 4KROD 3AC0A 3GI9L 3UYPA 4LQFL 4NN6C 5KYXA 2IC2A 4ZO6A 1OM3H 3CZKA 4N3TA 2BINA 4ICWA 3S3SA 3ULUH 3FO9A 3GJFB 3C9NA 5DGQA 5I5MA 2R2EB 3H7BA 3VB8A 2B1OA 2EH7L 4HK0B 3S97C 4MQ7B 1A7PL 3S7GA 3PPSA 3ZQ9A 3OKDA 4PJ5E 1BYNA 3ISYA 1BWMA 5LLIC 3ZMRA 4HIXH 1RZKC 2FJGA 3DETD 4LLDB 5JUEH 1HC1A 1ASQA 2CHDA 1FG9C 1S7QB 1YECL 3M8OH 4XVTL 2HT2D 2HT4D 1H6FA 1KC5H 4BD4A 4XMUA 3WS6A 5KN5A 3TBCA 4O51A 4NHUA 3MUUA 1QBLH 4LLMB 3LIUA 5K1JA 4BH7A 1LO5A 4NQQA 5CINH 5ESVA 5AALA 3VFTB 5I8EB 2WQSA 3BN9D 1ECYA 4P3WA 1OSPL 2J4WH 2WXQA 1VIWA 1KUMA 1EQWA 5GS0H 1RAMA 4V1DE 3QAZC 1E2ZA 3L1FA 1J5IA 1XH3A 1TVHB 4LL9A 1K4CA 2ADFL 3L3HB 1ET8A 5C0JA 2VUYA 4M5TA 4ZTPH 3RVVD 3RFZA 4G8GD 3RU8H 1E5CA 4PRPB 4MQ7A 5EU7C 3ATBA 1HNGA 4XTRD 4TQEH 3TA3A 5IJVB 1SLVA 3MV9D 1LMIA 3T4AB 5BVJB 4L8SA 3D33A 5CN1A 4PBXA 2YZ8A 5AD0B 1ZLSH 1ILUA 4Z0BH 4GAJL 1AGDB 2PYED 4KQ0A 5C0EB 1NCDH 5GS3A 1CGXA 5I15L 2C9VA 2P5EA 3LXCA 3IAPA 3D9AH 1FJ1B 2WOYA 3WGVB 1KEMH 3IFNH 5K1VA 3X3FL 4ZXBC 5A2LH 3EXJA 3NFNA 4PJ7A 5DJCA 4UQBA 4FKKA 1A14L 4WFFE 5E6SB 2EEBA 5DRNB 2PPAA 4IRSB 2IBZY 3JWNC 1G87A 4K94C 3J2PA 1WFOA 4NQSA 1JXGA 4PR5A 3ARFD 1TVHA 3CZSA 2GHWB 2FX9L 2XZZA 1YN6A 4DJMA 3ZX1A 1I8UA 1WG3A 4G43B 4EPSA 4M4PA 2B1AL 3F7YA 4ZMTA 1TZGH 2NXZC 4HOZA 1TQCB 4FZEL 1KFAH 4Y16C 4R0LB 3BPOB 1GRWA 4FJ6A 1CGSH 1A0QL 3CK0L 2Y06H 3T3MB 1DVQA 2FATL 3T4AA 3V8CA 4H0LC 5I6LA 4TSBL 4W9DC 5C0BE 2IV8A 4YQXH 5D96B 5J56B 3UJTL 3STZB 3K6SB 4JUSA 1AGDA 3B34A 1ZWIB 4R3SA 4AVKA 5ID1B 4P2OC 5EU5B 3ARVA 2VC2L 4HETA 4DW2H 2I07A 5FW8A 4KXCA 1FJ1A 3TT3L 1TETH 1Y1UA 4WUUB 5CP7B 1P7BA 4FJZA 2C3XA 5FYKL 3KWUA 3TA3D 3ZUNC 1G7MB 1UCBH 4QHPA 1U3HA 4ZUVB 3DO7B 3K5SA 4GAGL 3TS8A 4XPAL 3MLSL 5TE4H 1E5AA 1HAUA 2FWOA 1X7SA 2G2RA 4Q9RH 4GSDH 4ZOCA 3D69B 4YSEA 4FI6A 1OAKH 2DM7A 4JANA 2Z0BA 3CHPA 2P5ED 5K59E 4JDTH 4OLZL 1GJIA 3S37X 5FEBA 3HC3L 1A6ZB 2WNWA 3QUKA 1G7JA 5IMMB 2YXVA 4B27A 4BFBD 4W9LC 3SDAB 4XNMB 1IQDA 1XF4B 3PGCA 4WTWA 2XXGA 3GMOB 1TTRA 1LM8V 3G04B 4ZDHA 3HG2A 3Q2NA 4ZNCD 4TUJA 4NOBA 5F1KC 1YEFL 1ZWIA 3FW6A 3STLB 1OSYA 2CIKB 3DUSA 5EU5A 3K72A 4LGPB 3HB3C 5KSAB 1OAJA 1SVCP 4P9MH 2Z93A 3HS9A 5AB1A 4HFUH 4BZYA 1QWNA 2WSKA 4WGVB 4XN8A 1AQHA 5CP7A 3O9WB 3BLBA 4WUUA 3SN6N 2BNUB 4X4KA 1FYTB 1FHGA 2YK1L 1ZGLM 2CXKA 2CM5A 4OJYA 1UACH 3VA6A 1KIUB 5FDYA 2DJ4A 4G8GE 2I26N 5AW6B 1MW3A 4XBEL 4X4XB 1P7QA 1KXQA 3RVWD 5E2VH 3DMMC 3C5SA 4XB8A 2EACA 1R0AH 1Y6KR 3PABA 2Z35B 2UZXA 1U3HD 2B4CH 2QQLH 4N22A 3NJKA 4K2UL 3P1VA 1A25A 1HI6A 1XCXA 2SEBA 4XNMA 5AVYB 4GAYA 3ZR5A 4FG0A 5F7KC 3HR5B 2X5PA 3MUY1 2IGFH 3PE9A 3MODL 1IBHA 3AY4C 3GM8A 4MZIA 5KSAA 1MFEL 4OFDA 1BX2A 4D8PB 5ABDE 5EF3A 2YD2A 2P47B 1V5JA 2AAVA 4KUZH 1FDLL 3TNMB 5I16A 1H3WM 3NEEA 3TIDA 1PJWA 1DQDL 3KL3A 3ZTCC 4XCYA 2F58L 5F1IB 2AQ1A 4WV1A 4HHGA 4XN5A 2BHUA 2Y5TB 4F1SA 1WUNT 4MX7A 1QYGL 4JPWH 3RL1B 5D8JL 1UT2A 2C7UA 3QXTA 4X4XA 1CXKA 4GUPA 4M00A 5DVKA 4EZJA 5K9QI 1WV7T 2LHAA 2YC1A 1GMIA 1XCQB 3FFOA 5JW5B 2P3YA 4L4VE 3JZ7A 4LARL 3RDTC 1FV1A 5DF0A 3QXAB 5GZNC 5IVXB 1AQDB 2NR6C 4RRPG 4WNQB 3UJJH 2FUQA 4RWYL 1PMYA 3ABZA 2D7TH 4LP4A 1QSFB 4N8VG 1J9SA 4UU9B 5C0AA 4YSPA 3R0NA 4MYWB 1A1OB 4MGXA 3A24A 1P7QD 3VD2A 3F5WA 3CVHA 3MC0A 3FJTA 4FQLH 4P8QA 4UQ2A 3E8UL 4EUPH 1P5UC 1NUGA 4NWUL 4Z7OF 2X44D 1A6VH 2YRLA 5CR1A 4KHXH 4OF5A 3IPEA 4KVCL 4G11A 5AG9A 1BF8A 5MEOA 1IGIL 4P3CL 1PKQA 5HI5C 3RVTD 4HUUA 3ECVA 3ESNA 2OQJA 2P5EE 4G7RB 4M1CC 3KWWA 4AQZA 1Q0YH 3RL1A 3EJRA 3FQ1A 5BPPA 3GXNA 3T0BA 2JMRA 2OMYA 4TUOB 5D1QA 3VXOA 3AGVA 1IU1A 2CLRB 2NX5B 5JW5A 4PJ7E 3GKWH 1KYAA 4UZUA 5DJ6B 3NIDB 3HPJA 3NOIA 1ES0A 2DWTA 3O3BB 3TBBA 5BXFA 3CWGA 3MUHL 2XWCA 1YMHB 4GSXA 5KS9F 3UABA 3BVVA 3G5XB 3JWDC 1S7WA 1S7XB 1P1ZB 4UU9A 3DDFA 3VSVA 2AXGA 5HHOB 3MCKB 1A1OA 4X5RA 1CF8H 2IEPA 2ZICA 4R26L 4TQHA 3R1GH 1N5YH 2NY0D 1S46A 1FIEA 4G7YH 4IU3B 1A47A 1QUNB 3LJ3A 2BP3A 1U30A 2H0EA 1BVZA 2F15A 4QJ5B 3R19A 2IDFA 4UNVA 3RY5A 5C0AD 2WLHA 2K6WA 4R2GB 5CBEB 1FNEB 3GS4A 4M8QB 4F2FA 4FQPA 2W88A 5E5RB 1ZTMA 3BH9B 1K3IA 2ADJB 2FECL 4XB7A 5IP4A 4K8RH 3IMSA 3JWOL 2XWRA 3U83A 3BQUB 4XBPB 1AQMA 4MXWL 3RGVA 5DRXB 1BDYA 1XH0A 4Q6IB 5DHMC 1M6UA 3L9YA 2EICA 1JF6A 1F11B 4B97A 2F53B 4HJJH 3DYPA 3EGSB 1S7XA 1ZV2A 4YXLH 5D1QD 3K0WA 1LWRA 3CBKB 1X44A 4M1DH 1LJMA 2WKGA 3PXLA 3V0WH 1YNKL 5TGBB 5I1DA 3TH3T 4P3DA 4KITB 4YK4B 5GS0D 3VRLF 1FVEB 1TNMA 3FCBA 4HLJA 5IM7B 4JMXA 1UC6A 3ZR6A 2LLGA 2FO4A 1ROWA 4OKDA 3NSFA 3UG3A 2G5UA 2HMIC 1K6QH 2JB5H 1WWBX 4EKJA 1KIRB 3BZFA 2ED8A 4WUUE 3EFOB 4FZ8H 2JB6B 5K9JH 1JF1A 2YPVA 2PO6C 2YD9A 3DK2A 3I9IA 2O4EA 3KYNB 3P30H 1PEZA 3CC1A 2K3HA 2VXQL 3BQUA 3G5YB 4XBPA 4Z1PA 1YZZA 2O61B 1B4RA 4PVNA 5BJTA 1ACXA 5AZ2L 4Y2NA 1Z32X 1BPVA 5C86A 4ZS6C 4X7TB 1EJ6A 3G3LA 1AHWB 4RX4D 3LKRA 5DURB 1N18A 4KRLB 4UB0L 3EGSA 1KXQE 3HG3A 1S7SB 1QFUH 1U8HA 5KVDH 5AW1B 3L13A 2OR7A 3CXDH 2FEDD 4R4ND 1NCTA 5DD3H 5HHQB 3QULB 1HXMB 1FCCA 4ZUSB 4DP2X 1FVEA 3MNZA 2G9HB 3RGVD 1JGUH 2Y36L 1WEJH 4BXSV 2UZYB 2GABA 3F7VB 4H26B 2IADA 5DLLA 1P7KA 1WA1X 4ONFL 1F42A 3L3IB 5K39A 5GIRA 3QI9C 3WJLC 1DLFH 4HGMA 3GPEA 1G6RL 4UUJB 1IFHL 3L1GA 5IFAH 3EFOA 2RGSA 4APQB 3S37H 3AU0A 1GCFA 3MJ9L 4LASL 5D1ZC 1HINH 4TOYL 2FYVA 3KYNA 4FLOA 1BFVH 3S96B 1CLYL 3L9EA 1L9NA 2KI6A 1MAKA 1OT2A 4NJ9L 2J2ZB 4LIQL 4X0KB 5JXEA 4MAYC 4U1JB 4HSAC 3MV8B 4YHPA 2E7DA 1KFGA 3V6BR 3ULVD 4QTFA 4EQ2A 4X0NA 5D7LA 3DYMA 1ZGLB 5I17B 2NY5C 3A4EA 3BFQG 3WEBA 4W9EC 4ODTH 4G5ZH 1SJVA 4C47A 2QQNL 3R0MA 2GIMA 5CMAB 2NY1D 5EUKB 3WMQA 3PP4L 4WHCA 2UXFA 1INDL 2G4EA 3DLQR 3LEVL 5ENWB 5IJKA 4Z8FH 4HT1L 1U3YA 2UWEB 2EE3A 3LN4A 3SQOH 5C0AE 3GSXB 2WQRA 2GITB 2WVVB 5EO9B 3KYAA 1V8HA 3U4KA 3LZNA 4G2AA 1ZGLP 1JGEA 3FF8A 2FCBA 3CZLA 4IIQA 4U4IA 4GW1A 1IB5A 2TSAA 3TM6A 5G55A 4R4BA 5KBPA 4AL8C 1A9VA 2ED7A 5FWQA 3FT4B 3S96A 3DUHA 3MXVH 5F6HI 2J2ZA 1PKQE 2FYYB 3EKCA 2H1PH 4NT6A 5HGGS 4XP9L 4KKAD 2F74B 1PL3A 1SQ2N 4PJCF 2FBJL 5D1QE 3RL2B 3QS3A 4YFLI 1ZA3A 1WC7B 5I17A 1ZGLA 3S8WA 4F8QA 2BSRB 2FLMA 4OKVA 1VFMA 4PREB 4OFQA 3BXNB 3DRQB 1JGDA 4RMBA 3GTVA 4JHWL 5EUKA 3UTQA 4YSAA 3L7FA 5DUBB 3FZUC 4G8AC 1OF2B 1ITBB 3A5VA 3FT0A 3PCYA 4IRJA 4N0FA 5B21A 3QZOA 4BFFA 3TH2T 3RZCA 1DBJH 3GSXA 4GXVH 2W9EL 3QG6B 5T5NF 4NC0B 1O75A 1QMUA 4FQHA 1MHPL 3O8XB 4M6AA 4Z3FA 3AG1B 3CMGA 3OKYA 1MCWW 3LHPL 2YAFA 3VYOA 1UWXK 5J0BA 4H8WC 4HUCA 2WBJB 4MASA 4PI0A 4CN1A 3U9PL 4ZFFA 4PP2B 2ODIA 3BVTA 3CLFL 5KVEE 2EH7H 3HUJA 4HLZG 4PTUA 3IT8D 1A7PH 4IHBA 3HI1A 2WINB 3TURA 3GHBL 1DBBL 3EJTA 4LBAA 4QHMB 5CCHE 2ZUQB 5ECGA 4NZ8A 1CZ8L 2CUMA 4ZG1A 1YECH 3IDGB 4XVTH 4P2RB 3NIDE 3BXNA 3VH8G 5IMOA 2G3NA 4Z7WA 5J9PA 4JPKH 4MYPA 1ZANH 2NQDA 2BWIA 4DF9A 4JJ5B 4AMKL 2H0FA 5SX5H 1OSPH 3QQNA 2KHAA 2ZTBA 1DJYA 5SV3A 4P4RB 4W4NA 2ZG3A 4BQ9A 2OSWA 1FPTH 4M48L 5E7FA 4QTIL 3HAEH 3RVUC 4QTHA 1Q9LB 4W9CC 1CO1A 3TF4A 3B37A 3EOTH 4PP2A 4DVRL 4IRJD 5IQNA 5E5MB 3MNWA 2ZOKB 3ULVE 3M1BB 3RZCD 2XXCB 1TQWA 3MA7A 4HK3J 2A9AA 1R3IH 4QHMA 1IGTA 3FFCA 1E5ZA 3FQXB 1VERA 3QDAA 3QQ9D 4GAJH 3ZTDC 2ADIA 5FC9A 1S5HA 5LAXA 2J8UA 5INCB 2HLAB 1L6ZA 1HCYA 3BUIA 1NWPA 5I15H 5DUML 3MMEA 4I0PB 2DIEA 2AJYL 2NTFA 1J05A 2JLLA 1R19A 3WUZA 3MYZA 1UXSB 3X3FH 4JJ5A 1A4CA 1KPVA 1N0XL 3RWEB 1NM4A 1YPZA 5E8DL 3QUZA 1VGEH 4QRPB 5D6CA 3HBQA 3KG5A 3CCHA 2KQNA 3I6KB 4FMVA 4P4RA 5ITBL 4I2XB 1CXFA 1WZLA 3HMXL 1J1XL 1GGIL 4JCWA 4C57C 1QHPA 2FX9H 4FDWA 2VDPB 5FKPA 3H9SB 1HQRB 1IKOP 4FFVD 5FFGA 4TF4A 2B1AH 5TPWL 5EFIA 4CDHA 5IKCA 4DUWA 1DN2A 3Q9QA 4DZBB 3REVB 5HHVH 5I73B 4ZMXA 4FZEH 5E5MA 3MO1B 3F7PC 3CUPB 3M1BA 1JMZA 3QORB 1A0QH 4OT1H 4PGBA 3CK0H 5BO0D 3OHXC 3PFQA 1MCOL 2FATH 4H13C 1NBYB 4PW9A 4TSBH 5E51A 3ZDXB 5JPMA 1WA0X 1KPUA 1KOAA 3W39A 3Q48A 3UJTH 3MROA 2VT0A 1PQZA 5H2BB 2ZJSH 5IQOA 4HBQA 1OQXA 2VC2H 2XKSA 3C8KB 3QEQA 3AW5A 1KN2L 3SDXF 3J7HA 5FYKH 5D7LE 5C71A 4HH9B 4P4KB 1RK0B 5FR3A 1UOVA 3HW7A 3PP3H 4TRPL 3FFCD 4LHJB 1XCTB 2ATKA 5MI0B 5JZ7C 2FECI 2CRZA 3FAWA 3I75B 3MLSH 2ZOTA 2X6CA 5TH2B 5BMFL 2QGCA 5LJYH 4IW4C 4P5MB 4WAFA 3K2UL 2CCVA 2WXFA 1FYHB 3QIBA 4UT9L 2VQ1B 4JHZA 3FT3A 2HSIA 4OD2B 1IC1A 1IGCL 3HC3H 3I3EA 5A2IH 2OZNA 1YJDL 3QUZD 2FUTA 2CGRH 3V5HB 1QI5A 1VGKB 5AOLA 4ZW5A 1QD0A 1JV2B 5DCCA 3ZN6A 2PCXA 3GHPA 2OX5B 3MNVA 3WTTA 1E9QB 1HJCA 1BECA 3VX0A 2EXTA 1FZJA 1YEFH 2A6DB 4JPSA 5EMYA 4WO0A 4YSOA 1HCFX 1M05A 8CGTA 4MXVE 3FU5A 3OPUA 3MV8E 5J89A 1KJVA 4OF6A 1BIIA 3V0VA 1UQSA 3EOAB 2ZX9A 3I3DA 1SEBA 2H3NA 3AQDA 4KZEL 4QUOA 3RFRA 1F1GA 2YK1H 1XCTA 3KPQB 3P4OB 1DLHB 5GJTH 2ZSVB 2OYPA 4ZI8A 1GVIA 4WW2F 3X17A 4GYBA 5IB1B 4XBEH 3QEQD 3CX5J 2E9IA 4HUNB 2NY6C 3US0A 1HH9A 1M2OA 2P5WB 2C9AA 4NNYA 1T6VN 1FL3A 1RJZA 2DL2A 3CIAA 3P02A 2A1WL 4N9OB 3FCUB 5JNYB 3GT6A 4FHBD 4NPJA 4Y1AB 1W0WA 4HX1B 3VQ2C 5JR1L 5L8KB 1EXHA 3V5HA 4MMZC 4K2UH 1VGKA 2ED9A 3ZZSA 3OKNB 2BSSA 5KYUB 1GOHA 1KYDA 2IPUG 3FB7B 1WWWX 1NCWL 2IWKA 4AW4A 1IM9B 3WN6A 2A6DA 3HUJE 3GSNA 3QIBD 4LL4A 4ZYKA 2W0LA 3QEUA 5JQIB 4O02L 1MFEH 3CX5K 3EGDA 3Q6FB 3OJDB 2Q7NA 1RU9L 4XC1H 1TMQA 1HCZA 4TLSA 4WI0B 1NDGA 4UQDA 4R7NA 3F7KA 2Q3AA 4X7CC 4O9HL 5FOBA 1DQDH 4F24A 4TS6A 2MNWA 2F58H 5SV4A 5DJ8B 1YEHL 3FCSB 3RWIB 4HKXA 4E9YA 2JELL 1QYGH 4Z7WE 3ZDYF 5KOVC 1FNFA 1BZ7A 5D8JH 5D7JC 2VOTA 4M1GH 1AZUA 5DJ2A 3SO3B 1AP2A 4KV5F 4L1BA 4U1GB 4S1QL 1HHKB 2G5BA 3CFMA 1AGBB 4LARH 1BVNT 4IKLA 5IEHB 5JNYA 3LQMA 3T8VA 3L6FB 2OM5A 4Y1AA 5ID0B 2QADC 4JVWA 3LQAH 1ONQB 4L29B 5IBLC 4RWYH 3O6FA 2AQQA 3RJDA 1BQHG 1DQQB 1R9FA 3NJIA 4NM4L 3TZVA 1IM9A 3C2AL 2E9JA 1A21A 3EH2A 3U2IA 2C9PA 2CWRA 1ZSHA 4KMQA 4RFEA 5LNGA 4HSQA 4X6CF 3E8UH 2W9LA 4HUWA 2GUOB 2J21A 4S1SL 3FFCE 5HHMB 1BEXA 1OWRM 4KY1H 4WI0A 4MNGB 2ESVB 5BZWB 2Y5QA 1XTLA 1EBPA 4AQ1C 2AI0L 1PJ9A 3BRDA 4KVCH 2J8UE 5DJ8A 2FSEB 1UJTA 3CDZA 3P69A 1KT2A 3MRPB 1B2YA 4JRYB 3CFTA 4P3CH 1MWAA 4TVPL 4ELMF 3L3KB 3O81A 4P23B 2MTAA 5DTFA 1JPTH 3CVDA 1GTFA 4I89A 4A55A 3X2QB 1YPZE 3GBLA 5DS1A 5FFOA 1IJNA 3MOQA 4FULA 2YD4A 3H42L 3NSDA 4LVHC 5E2TL 1CFVL 5ID0A 2YUVA 2A73B 2F7RA 2AMUA 5CXPA 4EBQL 3RA7L 1DZBA 2AXWA 2BIQA 5L4MA 1R1CA 3VQLA 3H9HA 1CLZL 2BOLA 4R26H 1VSCA 2EZ0C 1AD9B 5HGDB 2GJ6D 3HHSA 4IBUA 2ZYRA 2V5SA 1G1KA 5E6RB 1X7QA 1ORQB 2XA8H 2H3KA 2ESVA 4MNGA 4NXKA 1J5DA 5BZWA 3DGCR 1RIHL 1DCLA 3O6FD 1G5GA 5D72H 1BVKB 2HN7B 2D7MA 3QEQE 4FN0A 2E7LC 2OTWB 4IEFB 4X4YA 4ATTA 2J6EA 3GGWA 4QNPE 4ENEC 5AOKA 3BGFB 3BWAB 4TPRL 3BKCL 5AW9B 4DPAX 4E5XB 5IUCA 3WDHA 3AXIA 4R8WL 4MJIB 4UTBL 3HOGA 3JWOH 1A6UL 1XZWA 3IDNA 5CIPH 1N8ZA 2GTWB 2GSIB 4MXWH 3S5LG 4YLBA 3U1QA 4A68A 2DQGL 2AERT 1NLBL 1JD9A 1PZAA 2XRAL 1EUUA 4RAUA 4JFUA 3WNJA 4WO4C 2KMWA 4JCLA 1VESA 1EZVY 2W95A 2PW1A 2BFVH 2X38A 4JZNB 1YNKH 2KLTA 1D2PA 1A3RL 4QYOA 2DH2A 1XGYL 1AHMA 1U8PB 2YRPA 4N1EA 4AQ8C 3ZDXE 5D5MA 3V4VH 3ESMA 4D7PA 5GHWL 3ECWA 1WLHA 3ARDC 2ZAHA 5AVQB 1N6QL 1O9ZA 2HN7A 3AG3B 1U2YA 1AXIB 4YEFA 1EHAA 4UDUB 2OTWA 2N0MA 3HE7A 4IEFA 5J4MA 1RZKL 5HP5A 2XVKA 4C8XA 1B6DA 2CO3A 1OOAA 2A38A 1W80A 3W37A 4UZSA 1MH5B 5ESQA 1GZQA 1T7YA 3Q06A 4MJIA 3V7AE 4KOCA 1RXLA 2YOCA 1IBYA 1INQB 5GPRA 2QPDB 3O41B 3PWJB 1F1DA 4UB0H 4YPGA 2WQAA 3AQZA 5ICUA 2AS5M 1C12B 4HJTA 3QWQB 1NGZB 1ZV5A 5IZ7A 1IKFL 1CPUA 4N9GA 3VAEA 1HH6B 1HU8A 4JZNA 3GMQB 3QNXB 5AW3B 1OT1A 4KI5D 2CNYA 3CMOL 3LXUX 1TPXC 1S6NA 2VLJD 2YGVA 2PYFA 4EOWL 3JVGC 2O93L 2Y36H 4XCCL 2ZSWB 5TF1L 1AZVA 2X4SA 2YAMA 3IXAB 3JV6A 4QDGA 3KCPB 2ZXWB 1G5AA 1PFOA 1HZHH 3GIZL 5H37G 2ICWI 1IFHH 1OCWL 3O6ML 1R4XA 5EIIG 2HWZL 3MJ9H 4LASH 1LE9B 4TOYH 1HWWA 1CLYH 3SODB 1R33A 4NJ9H 5CCKL 3D18A 3WENA 4GXUN 3QPXL 3FQUB 1BWWA 1I1AB 3L95B 3UP6A 3HN3A 2BMKA 3EHBB 3PWJA 3D52A 2AJ3B 1H9DA 1JXDA 2I60L 3HE7D 5L88H 1C12A 3MLXH 3NK4A 1H6EA 4OV5B 4U1NB 2XVBA 4XPBL 2QQNH 1E4XL 3CDGA 4MD4B 1Z9PA 2WLMA 5FYKD 4Y1AE 3QNXA 2ITCA 2X42A 3PP4H 3FMGL 2CRMA 4H5SA 1INDH 3BP6A 3HBZA 4K07A 2NT0A 3AXHA 3I3BA 1ZKAA 3WHE1 5M95B 4QRFA 1BD2D 3E0GA 2XYCA 4WI2A 2A4CA 3IXAA 1L9MA 4AYEC 1W16A 1R3LB 3SD2A 3FB8B 1A1NA 4UILL 5TFSL 1QLFA 2NNFA 2X40A 2LV4A 3PP3K 3WCYA 4AVHA 1P9MC 2F54B 3FDWA 4XNYL 3W56A 3DVGB 1TQBC 3UAJA 1NPJA 5JYMA 2EVIA 3BWZA 2XX0A 3SE4C 3BT2H 4XP9H 5BVPL 5FPIA 3ABKB 2KS0A 1YQVL 3L95A 3VFVB 3KPLA 2WVUA 2AJ3A 2FBJH 1MJ8L 1FBIL 4JY6B 1KZYA 2WQVA 3SOBL 3VO0A 4NBXB 1SN2A 2FJHB 3C5XA 4RNRB 4U1NA 4JE0A 1TENA 4JDZB 1Z7JA 3NGBB 1NWOA 3DDGA 2L8AA 3L5HA 4JHWH 3T08A 3GJFH 4IOFC 2WLKA 4K23L 4ZZFA 4JFPB 4MLIA 4WSKA 1J5OL 2EVGA 1HE8A 1E27B 2W9EH 4G9DB 4XODA 3FPXA 4OCXL 2YUXA 3VI4A 1MHPH 1CT8A 3O2WL 3LHPH 2HJKB 3BDBA 1QSVA 3Q3GA 3OMNB 5DJ0A 1DQIA 3VUAA 5EF2A 4XWGL 3FB8A 3Q05A 1HJBC 5HHME 1HSAA 1NSNL 2BZCA 5F96L 1MHCA 4MNGE 2ESVE 3HRPA 3QZWG 4MCZB 3AB0B 3U9PH 3CLFH 4H0HB 2I24N 4R5XA 4KJYA 4XH2B 3QK0A 5T5FL 4Z77A 3ETTA 1DBBH 2X0UA 2PWEA 3RI5F 1H9VA 1T3FB 5E8OA 3BH8B 1LXMA 4WWOA 3ML9A 4JY6A 1CZ8H 5D6DA 4HALA 2FL5B 4NHCL 5BW7C 4AH2B 4KI5E 3D8MA 3UBFA 1PLGH 1U58B 1YHPA 3MLPA 3VYPA 2CALA 3RWHA 1S3KL 1WBZA 4UV4L 2K4AA 3UAJD 2VM4A 5I5IA 1NKOA 4Q8BA 5DJZB 4CJ0A 4YXKL 1HEJC 2WB1A 1A22B 2YOAA 4B9FA 3FO1B 4I0CC 2P42B 2R2BB 4AMKH 3V55A 4K5OA 2AJXL 3L9BA 4ETQB 3VWJA 2VTFA 2BY2A 5CGMA 5JHDB 3SY0B 3MLTA 1PD1A 3BVWA 4JQVA 4M8RA 3T4YB 4D94A 4M48H 3SPGA 2B08A 2HLFD 5DEGB 3APMA 3VFPA 5CEZE 5D5ME 4RSVA 1QLEL 5JORB 3E9UA 3BC9A 5IGXL 1QNIA 4XH2A 5DJAA 3ECQA 5B7MA 3MRIA 5DRZA 4E0RB 5E1AB 1J8RA 4XP6L 1OK0A 2EIMB 3WMPA 1AAJA 4B9JA 4C4KT 3B83A 4IKJA 3C09C 4MJIE 3RYMA 3I84A 3TFKC 2V7HA 5TTRA 1UXWB 3DIFA 3WJMB 3RIAK 2VDPL 3BO8B 3J07A 5DUMH 2AJYH 4RGOL 3RNKB 3L3DB 3FO1A 5F7LB 3DXAB 3MRQB 3BGMA 2R2BA 3FB6A 4J4PC 1JZFA 4R96B 3U9UA 4OZIF 1N0XH 2C1PA 1IE4A 4ZTOL 2ERJB 5E8DH 4K7FB 5GGVL 1LO0H 3NA4A 1F4YL 5FM4A 5HGBB 3T0EC 1KNOB 4N2LA 4RISL 3AAZB 4OZFB 1N6UA 3HMXH 1J1XH 1GGIH 3NYKA 4N86A 5DEGA 1JNNH 3DUUA 5JHBA 2QQQA 3HLAB 4I5BB 4ZK8A 1F3DJ 4I0KA 3A4AA 3WFDL 1QI3A 4FNQA 4FQXA 4J6IA 4A2GA 3HA0A 3H4HA 2Y7SA 4JO3L 2VRQA 2EH8L 3SCMA 1A4KA 5D4IA 3NCWA 1MCOH 2ROYA 2Z8VC 1S9VB 3WS3A 2OR9L 1RZ7H 3PUCA 2EUWA 1ZS8A 2IDTA 3ZKNC 3QJTB 4L05A 4CGTA 4MDJB 4QY8A 4YOKA 2VXQA 4DAGL 1KN2H 3DX3A 4Y8DC 3ZE2F 3QC6X 2R27A 1QW9A 5EOCL 3RDJA 4F1ZA 2C3VB 3FU8A 1C08B 3MLZL 1L9OA 3AZUA 2CGYA 4K7FA 3QIWD 4TRPH 2J8HA 2FIKB 3DJ9A 2WTOA 1YNTF 3OKMA 1CDCA 3UADA 5BMFH 4KKLC 3AAZA 5HYSA 2R9HD 5DS2A 1VADB 2A9NL 5I9QB 4HGWA 4PJFF 1MCDA 5FS5A 4L8DB 2ID5A 3K2UH 1OAQL 4X4ZA 4UT9H 4G80B 4I5BA 1TYEB 4Y7MA 3ARPA 1IGCH 3TPKA 4ZFOL 4WDIB 2FHBA 4GMTL 2ZOWA 5FIEA 4ZD3H 1YJDH 4Y4FB 4FJYA 5C0GB 3FPYA 3IDXL 3FO2A 5ADPH 4GG6F 4PS3A 1G6RA 3WLBB 4UM9A 3OAYH 5HDBB 4PBVC 2F1BA 5DJDB 4CVXB 3FQWB 1P0SE 5AG8A 1OTTD 1B4LA 3RWCB 1E9PB 3L9RB 4FQXD 4CJ1A 2G4GA 1H6UA 3KYKL 2DLTA 2WXHA 5IOPB 2BY1A 3MX0B 3SCMD 4G6AC 4ODWB 5I23A 4KZEH 5D7KD 4LE8A 5I19L 4ODXB 1Z5YD 4D9QD 4CUCA 2FIKA 3W2DL 2YA1A 3RJOA 1UOWA 2IO5A 1T4KA 2APBA 2Y2YA 3F7LA 1NGXA 5DEZA 3RB5A 1KCVH 1KIPA 4HUVB 3O4OB 8FABA 2CD0A 1T1YA 2OMUA 1D3CA 3S9DB 2QKIA 4TNWF 1LQBC 4ZO7A 2UZIL 2A1WH 5DMJB 2Z1KA 3IN2A 4ODHL 3VI4E 4M7ZB 4Y4FA 5C0ND 5JR1H 3DI2B 5K9KA 2CSPA 1AKPA 2PCFB 3EW3B 3VTAA 4DO4A 4YHIB 2BSED 4AXWA 3H56A 2NY4C 3AM8A 3U6RB 3TEXA 2F54E 5A43C 3II2A 4RDQF 5DJDA 1WIPA 4V11A 1KGCE 2WWMD 1RHHB 3MBEB 1G7QA 4MRBA 5JOPD 2Q8BL 2BOCA 3CFNA 3CZJA 3JV5A 4O02H 4NKMB 1XBDA 1ZLVH 2DEXX 3CN2A 3KPRD 3RWCA 1RU9H 4OB5L 3AUWB 4KVPA 4LPUA 4JO8A 4JM2B 1NCOA 2ROXA 3MX0A 1MLBA 1J0ZA 4ODWA 5F88A 5FO7B 1J0HA 1WZAA 5AYQA 4XOCA 4O9HH 4NLAA 5CR8A 2BS8A 3TBTB 4UM9D 4LLYA 1TFHA 3MRJB 1YEHH 1M7IB 1FFTB 3FU3A 3QRGL 5C08A 3P0VL 2CHNA 4H8VA 3D50A 1DE4B 2DWSA 2ZNWA 3IE4A 4H1LB 5KYWA 3MRBA 4HUVA 5F8QC 3LB6C 1WIOA 2YQBA 3TCXA 4PGDB 3X1BA 3NG5A 1PY0A 1AH1A 4P46A 1T66C 4POZD 2JH2A 3LN5A 5I2IA 1A5FH 1IGJA 2LQRA 1I8KB 2OTPA 1Z5LB 1TIUA 3OR7A 3LNIA 1KCWA 1S3RA 4ZAKA 1E4XI 3PWPD 1MRCL 4UI2A 3CN3A 1KBPA 4IJTA 1MZZA 3HN8A 4A1RA 5ES4B 1I1YA 2X4RB 3P9LB 1NEZB 5J13B 4GQQA 4NOFA 3W11D 2CDEA 2DW5A 1GGCL 1CI3M 4FG6C 4CILA 3DTXB 3T3PE 4G1MA 3PL6C 1AD0A 5AB9A 4S1SH 3EO1B 3F12B 2YPLD 3OMAB 3QJSB 3FHEA 5GRXG 1LD9A 4PJ9A 1VCAA 1BMGA 3B5TA 5I28A 2A77H 1JYWA 4Q2ZB 4TVPH 4ZQKB 3IGFA 2OW7A 3QIUD 4WNSA 4YLCA 2W0FA 1DE4A 4HH8A 4NS0A 3RVXC 1QX1A 4BK8A 3CFDB 5JIIA 1BQ5A 3VFNA 3BDYL 3GUTB 1JHTA 3PF2A 3VG9C 5DK3A 3RX5A 5I0YA 3NIFF 1QSEB 2V9UA 3H3BC 4N0CD 3DYOA 4YBLC 4PLKD 4Y89A 3H42H 3KLQA 1WO2A 5E2TH 1CFVH 2GSMB 2JIXB 3MLUL 2O6EA 3GS0A 3B9KB 4P0DA 4EBQH 5C08D 3HZ3A 3NFSH 4F8NA 3U0TA 5DQ9B 3MGAA 4QLWA 4BELD 1MNNA 4KO7A 2QDVA 2O5ZH 3RY6A 2HKHH 3U4EB 1SN5A 4HP5A 4P46D 5F0JB 2OYKA 4AV5A 5I1KL 1IMHC 1AR1D 4KPHL 5HJDA 2P80A 1NL0L 4AYBA 5ACZB 3MCLL 2LW3A 2NLJA 1T1ZA 4D9QE 1D5BB 4MDRA 1KLFB 2IALA 1RIHH 2PPDA 4XHJC 4APXA 5C09B 1U4FA 4ZAKD 2G3XA 3PPEA 2IANB 5FM8A 2O5XL 3GJFK 3MJ7A 5I1IL 1KXHA 1UKSA 2DBJA 3NRQA 5G4NA 2A2QT 4KH9A 3NA9L 4L9LC 2PMZA 1SY6A 2E8YA 3LNGA 2QQKL 1QWHA 5E94A 5FHAL 3MGOA 3BKCH 3CSBA 4Z7QF 4UZGA 4J3UA 5DRWA 2JQZA 4R8WH 1R5WA 5BOJA 2E3VA 4CC0A 1A6UH 3FBKA 4MMYA 2UY6B 1WT5C 4PJ9D 1WZKA 5I76B 4NFCA 3ZTNH 3QAQA 2DF3A 2X4OB 1NLBH 3BHBB 3PUUA 5JOPE 2XRAH 1EZSA 1SEQH 3CZUB 3CZNA 2CZNA 3HJEA 4C83A 3F6JA 4D7BA 3GXMA 4IOIA 4QRRA 5JPNA 1KTBA 1A3RH 1DQVA 1AG6A 1DUZA 1XGYH 3TTYA 4HLEA 4KNSA 5LGJB 4PMEA 3DETC 3CFBA 2ZF9A 4YAQB 3GTNA 3DPBA 3ARBA 5GHWH 5C09A 3F84A 2IANA 4AEFA 1S9KC 3SKMA 3FOLB 1YDPB 1F6FB 2QGEA 4LIQE 4BQ8A 1OKEA 4M93C 4P5KA 1MCJA 3OKOB 1X7TA 4HCRL 4O2FB 4PV8A 2P4AB 4XMZA 2Z92B 3TP4A 4TTGA 3BN9C 2DIAA 1NUNB 3AT9A 3M88A 2ZXEB 2R29L 4OCSH 2XNAA 3KPSA 4XZ4A 3LCYA 3KD4A 4B96A 1PZ5B 3QJQB 4QJ4B 3N55A 2BRRH 4N2FA 1GC1C 5DZNA 2OULB 1CGWA 4Y19B 3UAEA 4BFOA 3UTZB 3E2HC 3FN9A 3QH3A 3RVVC 2VXUL 1JFQL 4A37A 5HYEA 1IKFH 5I0DA 5DVLA 5LXGL 4G6ML 4BFRA 2WGNB 5LNDA 4XTRC 3INUH 2OV0A 4QHNA 4Z5RA 2L7EA 4GRLA 2JXMA 4HW6A 4YO0B 5EZOH 5ICXA 2HFTA 3CMOH 4EOWH 5HDBE 4RGMB 1Y0LB 2DYPD 2NYYD 2R4RL 2EVJA 1CD1B 4XCCH 3BKJL 1I75A 5TF1H 4CN4A 3OHMB 3DK0A 2VDLB 3TPUB 4Z3TA 5CF3A 2ICWJ 2RAMA 1YDPA 3QR0A 3F01A 2OXHB 5J6GA 3H54A 4AEIL 3GIZH 3QUYB 1OCWH 4QRRD 3O6MH 5AAWA 1CXIA 1OARL 2HWZH 4IHOB 4Q4EA 1MDTA 2Z92A 3QXUA 5HJBA 3BMVA 5JW3L 1Q0XL 1OCRB 1VZIA 1BQRA 5LGHL 2LLLA 3ARBD 3QPXH 5C08E 4EI5A 3WUWB 2WSPA 4GMSL 4I3SL 1P4IL 3ARFC 4M8UA 4NYLA 1ET7A 3QJUB 2I60H 5E2WH 4YX2L 5EB9A 4D9LL 2EYSA 1WBXA 3QFJB 1URZA 4H0GA 1UENA 4KQ3L 4WJ5A 2Q6WA 1XF2A 3AGWA 1E4XH 3EOBA 4FYTA 5CEYA 4PJEF 1FUNA 4OLWL 3TC9A 1SQMA 3SO5A 3FMGH 5SWZA 3NCEB 5EBMA 1RZJC 3KPSD 5JQ6H 4GB9A 4GI8A 4J1UA 4KAQL 5DD5L 2I9LA 3I50L 1U42A 2DAVA 4LSPL 3TPUA 3ZL1A 1TCRB 2EIKB 2LTQB 1QA9B 2UXTA 3QZBA 5J1AA 3GZOA 5KYNA 4JGNA 2V37A 1K8IA 3L8QA 4UILH 1U8JA 5TFSH 3L4ZA 4N25A 3VFSA 4GRLD 1ERNA 2IMMA 5C97A 2BVOB 4LLWA 4OGQC 5AVZB 1IT9L 1FNHA 4H40A 3WUWA 3O4LA 1I7UB 3EAKA 1YQVH 4I18C 1JGLL 4N90D 1WAAF 3QWOB 1Q94A 3RTQB 3SOBH 1FBIH 6PAZA 5ACLA 1X5HA 2E7CA 4ANWA 1BZ9B 1KWKA 2LVCA 3BW9A 1DBAL 1SJHA 4JG1L 2FX8L 1KZQA 4PJGB 1HNFA 1SGKA 1ZPUA 4JR9L 4H2AA 43C9A 1G7PB 4MMXC 2OMVB 3L4VA 4K23H 4PSRA 4F15C 4EI5D 4AIXA 1J5OH 4MA1C 1NOFA 2V5MA 2L4OA 3B8YA 1C8QA 4PJIB 1B0GA 4OCXH 4XBGB 5FHBL 1T5KA 2GIYA 2XQ0A 4M4RB 2IVFC 3O2WH 4DGYL 4KO9A 4A38A 1EJOL 4XWGH 1NSNH 2XUWA 5F96H 3SE6A 3TN0B 2FE0A 3WO4C 3ILPA 5SWZD 4HKZB 1HFUA 5I66B 3QYCA 5D1XC 5FFLA 1IV8A 2MNUA 2VL4A 3SYCA 1SJMA 5T5FH 4FQQA 5KANI 1XD0A 5AW2B 1I7UA 1QBBA 5CD3B 2ILLA 1J5HA 2ZOUA 4IRZA 1ML0A 1JPFB 4KMTL 4E9WA 2VH5L 3OG6B 3FBQA 4Q0XH 3RVWC 4A66A 3K5RA 4NHCH 1V3JA 4JJHA 1ILSA 4Y2OB 1FZMB 3C60B 4PVBA 4UV4H 2Y24A 1L5GA 5CU9A 5ECJE 3UMNA 2WBKA 3B3BA 2OMVA 4N8UA 2Y69B 2NY3C 3O4LD 1G43A 4V2BA 2YD3A 2AJXH 4OH2A 1XGQB 2JFCA 4QXTB 2SODB 2R23B 4AYGA 1ZLVK 1R5IA 1S9XA 3D87B 3FQ4A 4L48A 4QRRE 5BQ7B 3QPQD 4XAWH 5F0MB 3RUGB 4L4TB 3MRFB 4XPFH 4K3HA 4N0UA 4UTCA 4ZTEA 1ZK5A 4QI3A 4AEHL 3KHQA 1WAPA 2DM2A 5C09E 3FQNB 4JFXB 5D4QA 2IANE 3CE1A 4OQTL 4Z7NB 3OLIA 4HHAB 1NFDB 1Q9OA 1TOXA 3JYBA 3WG7B 5CD3A 3GBNH 4FD0A 5GGUB 1MCRA 2NCMA 2X4UB 4F9LC 1TU2B 2K9UA 3COOA 1T03H 1VFAB 1VEOA 5LCVL 3ZMEA 1WITA 3GSUB 1FZMA 2Y6SC 4UTBA 1KF9B 1ZIBA 2VDPH 2CO6B 1HOCB 4LVNC 1J10A 1HSBA 1HHJA 4RGOH 4B95C 2AJZB 3GK8L 4TVPD 3V4PH 4YZFF 4RGND 1USZA 3WYRA 2X4PB 1XGQA 5GGVH 5I1EH 1F4YH 2NY2B 2MCPL 4RISH 3QAZB 4X8CA 4LVEA 1AKJB 3MRFA 3LNDA 3R4DA 1OPGL 2JWYA 3ZIMA 2BK8A 3CXHJ 5L4FA 1NGQL 1T7XA 5JHLH 5JOFB 4HHAA 1NGWA 3RVTC 4XMVA 2H0PA 1NH6A 2EH8H 4JO3H 2WKOF 4F80A 4OFIA 4RDBA 3ZYJA 2OR9H 1SVBA 5FLVA 3I9GH 4Z7VB 3QUMA 2XYBA 2BVQA 3SZ6A 5LGYA 4PJBB 4JKKA 2D9CA 2Q76A 4TVUA 3D85D 4ZUWA 3GSWB 4DAGH 3E6HA 2HRHA 32C2B 2AJZA 3ZW3A 4JLRB 5EOCH 4ZXBB 2KLRA 3BWSA 3MLZH 2EDHA 2EE6A 4WWPA 1KTDB 2AQRA 3WKML 2A9NH 2NY0C 5DZ9A 5SWZE 3GMMB 3BCFA 1OAQH 2I5YL 4ZOAA 3CVBA 1ADWA 2A7BA 5E99L 4HMEA 4Y16B 3N42F 4GMTH 3ULUC 2JKLA 3BP5A 3NEOA 4OTXL 3P77A 4NO3A 1NJ9B 3B2XA 4BQBA 2P5PA 3CN0A 1JSYA 3IDXH 2X10A 3SD5A 4K3GA 4FA6A 4LCIL 3UO1L 4R7LA 1YLBB 4YMPA 5DFAA 5AKVA 5E4IA 2CR3A 1MHEA 3F85A 4P2OB 4E9RA 5FDWA 3LPGA 3O4LE 5MEPB 3SKOB 32C2A 3KYKH 4WNJA 4V2CB 4ZXBA 2C5DC 3FONB 5E0FA 5EN2B 3OJMB 4NO2B 1S78C 1A3ZA 4KGLA 1DBML 2FZ3B 1KTDA 3T0DA 2MCG1 3IJSB 1F56A 2G5RA 5GS0C 1UM4L 2Z91B 2P9RA 4G8FB 4TLKA 4XNZC 1JZIA 2DQIL 2QTEA 4F57H 2UZIH 3HKZA 4W70A 4ODHH 1MRDL 1T0NB 3S3JA 3F7QA 2VZUA 2FLBT 3MJ8A 2PXYB 1ETZA 5C3LD 4HUXA 2DMHA 1A2YA 5IESL 1HWGB 3KH4A 4HIHB 5AVSB 2E75C 3DC0A 2Q8BH 5C0CA 1DVZA 3HB3B 1FFPA 4UT6L 3E38A 5FYJU 4OGYL 3UTPD 1LO4L 4OB5H 4RGNE 4N8VB 1K5WA 2WXPA 5B1KA 4Z7OE 4PY7B 3FONA 2AV1B 2EUZA 1HN1A 4A6YL 1TZOA 4K5MA 1ZVYA 4NO2A 1T20B 1V7ML 5GS1A 3KLAB 3QRGH 2FEDC 4R4NC 1K8DB 4FOMA 3KYMB 1IFRA 1A6TB 1KXTA 3D39A 4PJCA 3KDMA 3UIZA 5E4EC 1TQVA 4G8FA 3UTSA 3CC5B 1BZQK 3O3EB 1JK8B 2ZKXA 3GSRB 4OAWB 1T0NA 3VD7A 4L8BB 2DMKA 4Z7UF 1IL1A 1D6EB 3N06B 4Z3IA 5D55A 4J2XA 4N0UE 3QJVB 1EEZB 3C5JB 1MRCH 3PGDB 2PCYA 4BQ6A 1XR8A 3P2DA 2VR4A 4HIHA 2QZQA 4JPIB 1DVSA 4IKIA 4KNUA 3D51A 3UEQA 4KK8D 4AVIA 1GGCH 3WFBH 2Y1AA 4IDJL 1JFHA 5IB3A 2NXZD 1KSRA 2FVNA 2ZOOA 2BS71 3FUNA 1KBKA 4R7XA 3ZLQC 3L1OL 3U1SL 4JFOA 3FUEA 4NQDD 2NNAB 5HYJB 2DICA 3LTVA 5ERWA 3V8OA 1KGXA 4LVOB 1CXEA 5C0CD 1A6TA 2VCOA 1NBZA 1NKRA 2Z31D 5DYOA 3NJNA 3DMMA 5IK3A 4E41B 1JK8A 3PWUA 1TITA 4L8BA 1BOGA 4M3KB 3MLUH 3WEXB 2RQEA 3II3A 1D6EA 2MPVA 3PNRB 3IU4L 1LILA 1DVTA 2WYHA 2FTAA 1CQYA 4LSRL 4LDEB 3D39D 4JKNA 1DVFB 2E4FA 3LRMA 4IQHA 4JPIA 5FM5O 3V4UH 4D0DA 4Z7NE 2G2NA 5LQBH 4B50A 3FU9A 2H32H 5HTSA 5FK9A 4KPHH 3DJTA 1NL0H 3VRLE 4BSVA 4RWHA 4JFDA 2EDKA 2O5YL 1C5DB 3C8HA 3MCLH 4I1RA 3OGOE 3VRJB 1UZ8B 1WS7A 4ECNA 2IFFH 4NX0A 3VXTB 2D31B 5D7SL 4M9OA 4P2RD 5HYJA 4NQTA 1PG7L 1DO5A 2O5XH 3MV7A 2IPKA 5I1IH 1OIOA 3TIEA 3TONA 1FO0B 1BBJB 1TLKA 2QQKH 4YHKL 4JRXB 5FHAH 3O2DL 1TTBA 2QEJA 2TAAA 2XV3A 2ZYHA 4HSCX 3GJEA 4PVLA 3RDTA 3UPAA 4N85A 5GZNA 1TTGA 1RERA 1C1EH 2NR6A 4IOSA 2QVTA 4QYAA 1JPEA 2YUWA 1TJHH 3A47A 3QVAA 4L8CA 4U6TA 3UPRB 5JOEA 2B4CC 3MRGB 1WCQA 2V3DA 1F41A 4FXGB 1V3KA 2E6PA 3UTPE 5DDHA 4ZSOA 5IJKC 4Y5YC 1JVLA 5EU7E 1OSZA 1X5LA 5K5YA 1A9BA 4X7SL 2X70A 2WXOA 3DMMD 1P5UA 1RZFH 3EGXB 4M5YL 1NCBL 3HG0A 1L9RA 5F7WC 4RZCB 1K3ZA 1UZ8A 4JFWA 4PHZA 1P53A 3OKLB 3MA9L 1S5IH 4Y2DB 3VXTA 5J12C 1SHXA 4HK3N 3T2OA 3FF7A 2X6AA 3IJ7A 4U1IB 4WENB 5IIEA 1WFUA 5BV7B 1U8IA 1GGTA 2R0KL 5D2LB 4JRXA 4HCRH 1XHHA 4GO9A 4JFDD 2KC0A 1U3NA 3LRSB 2R29H 2ZCHL 1OO2A 1UKTA 3JWNE 4NM8L 1U8CB 3LKQB 3S88L 1I3UA 2YPKB 3BISA 3G5VB 3N44F 4PG9B 2WZPD 3SDXA 3TLRA 5C3TA 2H9GA 3X13B 1U93B 2DQUL 3SPCA 3MOAH 4JDEA 5DU7A 3VYNA 3IEAA 2VXUH 1E8WA 2DEWX 4XP5L 1JFQH 1ID2A 4IRJC 3L17A 5LXGH 4G6MH 1IC7L 2BSTB 1LLAA 5IHZA 2IXQB 4I48A 2R69L 3TV8A 5FUCC 3ECUA 2WYIA 4AIZB 3QZLA 3Q7JA 2PWDA 4IOSD 2R4RH 3DHMA 3ALWA 4DCQA 4QLRA 3QDMB 4JZOA 3BKJH 4J39A 3AWGA 1DEEB 3KHOA 4AQEB 4F2MB 2YMOA 5C0CE 2X6VA 4K3DL 4U1IA 2JKJA 2H8PA 3BPCB 1B0RA 4AEIH 4S2SB 1NMAH 1S7UA 3CHRA 4PRHB 1AOHA 5ESAA 5FCUL 4LL1A 2XC8A 4EI0A 2IPTL 2OW6A 2OK0L 1Q0XH 5JDSA 4O58L 2VN5A 5LGHH 1MUJB 1AXSB 1U8CA 2FH6A 3A4DA 4PG9A 3X13A 3VW3L 4XRCB 1P4IH 2IH3A 1X4YA 5DR5L 3D39E 4HJGB 4PW4A 4PJCE 5HI5D 4YX2H 3OD3A 4M1CD 3QR1A 4D9LH 1ZMYA 1ZK9A 4LNVA 1N59A 4AJ0A 3UTSE 3DX6B 1FAIL 4POYA 2BHFA 3BFOA 3LMJL 3PHQB 5CGTA 4KQ3H 1T04A 4IBWA 1UOKA 4OLWH 4RFNB 1UD2A 3I02A 4WW2A 3TVMB 1WFMA 1IBBA 5CLZA 4UTAH 4KAQH 2IBBA 5DD5H 2QV2A 1NIBA 3FB5A 4YR6A 2Q8AL 3QDMA 4YHYC 4LSPH 3WNMA 1DEEA 4U0RC 4RSYA 1A7OL 2NZIA 2E74C 3RBSA 2MNJB 3UPCA 3BPCA 2W0PA 1U95B 3C6LD 1H5BB 3D2UA 1SUHA 3AU1B 3VG0L 5DEFB 2KZWA 2ZP0T 2Y7QB 1VACA 3OSVA 3Q2WA 1RUPL 4M8VA 1P4LA 5F1NB 1TZIA 3ROLA 5DO8A 2PO6A 5J6SA 5D1ZB 1I8MA 2OP4L 4UIMB 5E6UB 4CDGC 4HA1A 4J5VA 2GFBB 1TLMA 2D9QB 4MD5A 4OCMC 4NQEB 3S4SB 4NQCB 1IT9H 1BHGA 4XNQB 4U4BA 3H9YA 1D9KB 3FUKA 4Y4KA 2AQNA 1DJIA 4ZMYA 1XFPA 1SBSL 5C2UB 4K8RC 1TJIL 4XRCA 3EUDA 3POCA 4LNRA 1JGLH 1GSMA 2ITDA 5E95B 2G0KA 3BZ4B 3O0RL 4YGAB 1W6WA 3IXTA 5IW1A 1T2QL 1XF3A 1DBAH 2K6ZA 4JG1H 4UYQA 2LLNA 2YARA 1UUNA 4HU2A 1YMMA 1ZTXE 3ULUF 3L2LA 4ZX6A 2D8KA 4XI5C 1D5ZB 4RIRA 4WCYH 3A3YB 3DVFA 4N2CA 3TEWA 2CKBA 3VH8B 3VDAA 4F7MA 4NZDA 3WAJA 4PBWD 4PD4J 4DP5X 2HRLA 4CVZB 5FHBH 3CU1A 1TEYA 3NK3A 4EDXA 2P26A 4NKIH 1E8ZA 2BNRB 1EVUA 3QI9A 4KUCF 5GGTL 5IROC 3KVQA 4PCYA 4ZO9A 4GRWF 1TKWA 1EJOH 3WAKA 5DEFA 5AAPA 1GY2A 4JFDE 2Y7QA 1XXDC 3QEHA 1OVZA 1XL6A 5HDQL 5ISZB 2DWDA 4UIMA 4E42B 4JM4L 3ORJA 2FBRA 3S4SA 4X5XB 5AOZA 4NQEA 3PWLA 5HYJE 1GYAA 4Q9CA 3WTYA 3MV7E 4HVBA 3DX7A 4MAYA 4X6CA 1U8QB 5E70A 4PD4K 4RAVB 3L7EB 1A7NL 3DVNA 4KMTH 4PV9A 2VH5H 3ZHLA 3D2UD 3D0VB 3IGAB 3VMPA 5T1KB 5IB4A 2XN2A 4JHVA 2D0GA 2P49B 3BESR 2PO6D 5HGHA 4ELMA 2F8OA 3BH4A 5EZLB 3DA0A 1WYJA 3GBMH 1FFOB 2V9TA 4HGKC 2IBZX 4Y4KD 3N0PB 3QYNA 4ZS6D 4NI3A 2Y7MA 4M6NL 2J5LC 2QL1A 4Z76A 3PAYA 2AEPL 2HJLB 4LSSL 2VR7A 4ZSOE 4YHYB 4LFHG 3TBWA 1C5BH 15C8L 2NPLX 2H32A 2XQYK 1ZPLA 2H1LM 1UXLA 4LKCB 4U33A 3M86A 1YMMD 3NMEA 4JZJC 2AK4A 2UX7A 2X2HA 1TT6A 3E8VA 4AEHH 1I7ZB 3HI5H 2N7BA 4KRPB 5CS7A 4JB9L 2ENSA 1W91A 4OQTH 3CSYB 4A04A 43CAA 2QPFA 4FFYA 5C8JA 1PF3A 4KTEL 5E6ID 3HZMA 2WANA 4ESKA 3T5WA 1A6AA 2LE9A 4MJ5A 1JNJA 4J3OG 3L7EA 3QDGD 3U6XA 2UX6A 1NC4B 2ORBL 3H53A 3QI9D 1JZ5A 4H20H 4JRXE 1AZNA 2QTVA 4I1NB 4GO8A 2OJEB 1NA8A 1XQ4A 1MELA 3IGAA 4OZFH 5T1KA 5FCSH 4BFGA 4CU6A 1MNUL 4AT6B 3QO1A 1E28B 5IW3A 4CADA 4G6FD 3BAEL 3SDXE 4JO2L 4OZHB 3R06B 4DPCX 1FFOA 3GK8H 4MAYD 1UH3A 2GI7A 1MCWM 2HJFB 9PCYA 3N5AA 1RZQA 1ZHKB 1OB1A 1P5VB 5I71B 3QISA 2BZDA 3DARA 2MCPH 3ZE0F 4PJXB 5AW5B 4LHQB 1MIML 5I1LB 1JYXA 3GZPA 4DP9X 2WQXA 5KEZA 2Z4QB 4MNQB 1M9SA 3FTXA 4G3YL 1I7ZA 1JHKL 1OPGH 4LDLB 4X98A 3TNNB 1H0DB 2Y3AA 3LZOA 3H2QA 3CSYA 1DZ0A 1NGQH 2I9TB 1XGZA 3ZDWA 1F86A 4BEIA 4HZLB 1NC4A 2BIMA 2F5AH 4P5TB 5T1LB 4YFEA 2KZ1B 1F3JA 1EGJL 4HCRA 2I69A 5FYJE 2J3SA 2AK4D 3GUFA 4MS6A 1XH2A 4AT6A 1N5AB 3BVDB 4XP1L 4IU2A 3HNTH 3OGCA 4NAQA 4DTGL 4GW5A 2JTDA 1RSFA 5EO1B 1UATA 3IJYB 2BC4A 3I6LD 4NO5A 1QFWL 1MFCL 2HJFA 1JXFA 2CJUL 5CSBA 4D3CL 3CH8A 3DOSA 4MCYB 1TTCA 2NXYD 5AW8B 4AQAB 1XSOA 4PJ8B 3WKMH 5I74B 2H45A 3FAXA 2QVMA 2Q7YA 4URTB 4X42A 3JZYA 2W9DL 3TO4D 4S0TD 1LP9B 1KENH 5FF6A 3FZUD 1PGRB 3QDME 1H0DA 5E99H 3O6FC 2J5WA 1J8HD 4LCWB 4OBSA 5KTEL 4EAEA 3MYJA 3HE6B 1GZPB 3V0DA 3QQ3B 4OTXH 4RESB 2F7QA 2XFXA 2DLFL 2WJ5A 3JBG7 3OHXB 4N8CL 4GFXA 5EBLB 5EUOF 4L18A 1UADC 2ZG2A 2VABB 1M7DA 2VLLA 4LCIH 4GINA 4J3BA 3UO1H 1GIGH 2ITEA 1LL1A 4LSQL 2Q86B 4RMQA 3U4AA 3UZQB 1I3GH 2NNRA 3GXPA 2YD1A 1GPOH 3LIZL 2ZOLA 1ETJA 4GT0A 4ONHA 2JJTC 1G7HB 5L4IA 4UOW1 4FYSA 2F1EA 3LKSB 1KBWA 2FJFA 2H26A 5EO1A 7PCYA 1TQUA 3EFFA 1MVUB 3ZDZB 3EH3B 3BKYL 4Z7IA 2OTUA 1GOGA 2WTRA 2AABH 3NACH 1FL5A 3RKDC 1YMME 2R8SL 4X6FB 5K1NA 1EAOA 1H3TA 2X0VA 3S5YA 3ZDYE 4TULL 4NEHB 4KFZC 4KZDL 1UM4H 3WSQL 4JAMB 2AJSL 1LP9A 4KV5E 2HVJA 3P54A 4IS6B 3MV01 5F72S 2WZ6A 2DQIH 3UTTB 3C5ZB 3FSWA 1HKFA 3GMLB 3ZRCC 1GZPA 1MRDH 2FRGP 1GSKA 3OHXA 1DJHA 2BP0A 2E8ZA 2R2HA 1A4JA 2YEZB 4DERA 4IMLB 5IESH 2V3EA 1UASA 1K5NB 4NQEE 1FFNA 4H1LH 5E2UL 3EYFA 5DK0A 4F7TB 5IEKB 4LCUB 1CUOA 4UT6H 4LEXL 4X6CE 1LO4H 3QXWA 4TQIA 4PH8A 1HL9A 1Z9LA 4FEIA 5L6YL 1QPPA 4KNQA 1MI5B 3EO0B 3L3GB 5D71L 1OALA 3BCDA 3BZ5A 4A6YH 3EZ8A 3OKEB 2UYLA 1AR2A 4DKTA 3F62A 1ND0B 2A9BA 1RPUA 4BSWB 3OL2A 3QQDB 4UOZA 5DUPL 3R7RA 2V2XA 4ELME 4Y1SA 2AXJA 2Y1YA 4G9FB 4ZOBA 1XB8A 5I26A 1N10A 4KI5C 2MQ0A 3APFA 4PWKA 3SE9L 3SYOA 2G3ZA 1GS8A 3SYQA 4RZKA 1D7DA 4DVBB 5GRVL 4AI7A 4HZ1A 1S9YA 2QR0A 2WLIB 3UBXB 2BWQA 3GMLA 3PRZA 3IKCA 3P3RA 4HWEL 1FP5A 3B5HA 5T1MB 3WFEH 3EO9H 1HS6A 4JM0A 1CTOA 2GVYA 3DBXB 2AK4E 2F19L 1U21A 3GWJA 3U0WL 2QSTA 1IQWL 3PQYD 3IBEA 1UJ3B 1UFGA 1I9IH 1SLXA 1W15A 3A6BH 4TV3A 3US9A 4EVNA 4LCUA 1AO7B 3I6LE 3WLWD 2YFOA 4B9PA 2GJZB 1R24A 4JN2A 2OSLB 4F9PC 3BIKB 3EO0A 25C8L 2FT7A 2UUDH 2XQYG 2A99A 4HWZA 3L1OH 3U1SH 2B0SL 5CSGA 3EIFA 4HAGA 5GZOC 3D25B 3LQZB 1IM3A 5HPMA 2D03L 2QLYA 4MJ6B 1AXTL 1T5WB 3I9PA 5D7JB 2WP3T 4D0BA 2DJMA 5F3FA 1CBVL 1ZDQA 2VISB 1XZ0B 3UBXA 4QD2E 4DQAA 2CHXA 4U1MA 4WFED 2XXFA 4EN3B 1D7BA 5SWSA 4I7ZC 4AW7A 1L3WA 4HS8L 3N50A 4MA3A 3IPFA 2QADB 4MMZA 1RZJL 5T1MA 1YEKL 4C59B 4JX0A 1HHHB 2OMTA 3IU4H 4B3VA 3MUJA 2IMNA 4P5RA 1GL4B 5MENA 3BVUA 2EQDA 4LSRH 1Y18B 1FO0L 4ELDA 3TGXA 2I85A 1BQSA 1AO7A 3GF8A 1CYGA 3FTVA 4RLDA 5J6HB 1BBDL 1Z5HA 3BIKA 2O5YH 3BUTA 1DYZA 5CJXC 3LPOA 3DGGA 4AQ1B 1E4KC 5D7SH 4ZPVB 5LCVA 5L2KA 4E9VA 4MQXC 1C8PA 1PG7H 1RQ5A 3FKUS 3V5KA 1KPRB 1LWJA 2A74B 3HC2A 3B9VA 1MZYA 4JNXA 4NAMA 1DFXA 4X8GA 4J3VA 3MRNB 4DGWC 4HKBA 4YHKH 3GXTA 4WGWB 3O2DH 2B5IC 2ZP8A 4FFZA 2CRYA 3VFMB 5GS2H 4Z9KB 1ET5A 2D7NA 3Q1EA 4PG2C 4PJHB 2WBXA 3IU3A 1G9EA 2XG4B 4S11A 3HTLX 3D3VB 1T89A 1NTDA 1IM3D 1I1FB 4NGHH 4OZIA 3Q8FA 5BRZD 4F91B 3CFQA 4AVJA 3WI9A 2FGZA 4AENB 2EDDA 4AQOA 5I1AB 5BV7L 2NY6D 3FU7B 4GRMA 2FIRT 4PJAF 3T8XA 5E24E 2DQHL 4X7SH 2GTZA 3DX4A 1CCZA 1I85C 2EEFA 5J6HA 2A9CA 1SXBA 5SWSD 1NCBH 5EC2B 4E5XG 5ALCH 2WYZA 1N19A 2A83A 5M94B 1Z2KA 2H2PC 1L0XA 2J1ZA 2K9FB 3CHSA 5D4HA 5MEND 1UHVA 3AMKA 4JHUA 2BFGA 1KPRA 2V4LA 4TL5A 3V4LA 4MDIA 1OWWA 1IIIA 4NQVA 4LF3B 2XWZA 3QC5X 5CJ5A 2EDTA 2ZCHH 3AREC 2WIMA 5KVGL 4NM8H 3B7UX 5GGRY 5LVEA 3S88H 1NFKA 5L2KD 2XG4A 4ONGL 5LBSL 5HXMA 4AY0A 1R47A 2DQUH 1DANT 2VDLH 3VXRB 1LP9E 2BZ7A 3TV3L 2WXLA 4LPCA 5PAZA 4QRTB 4XP5H 1GGYA 3NJLA 4X9HA 2ZWZA 5FA4B 2OJ1A 1YNTA 4EDWL 3KWXA 1IC7H 3SE3C 3X1NA 1J0JA 1T0OA 4PJFA 2R69H 3FQRB 5GSVB 3VXSA 1LK2A 2P24A 2QZ5A 1LO2L 2YHGA 5LGKA 3ARDB 3IK2A 4NENB 1R3HA 4Y4HB 3ES6B 2NW2A 4K3DH 5C2BL 3IDUA 4JQIL 4GG6A 4UNIA 5FCUH 3VSQA 1SJXA 4XE0A 4F58L 4WFEE 3F00A 4XVUC 1GYCA 2IPTH 5AAMC 1W8OA 1EEUA 2B9AA 4O58H 4LLVB 2IAAC 3QZPA 3Q6GL 3VW3H 5L2JB 5EC1B 2WQWA 5EBWA 2B8OT 5JIKA 2PLTA 1FAIH 4WO4A 3RNQB 3LMJH 3KYOA 1JF5A 3VVVA 4ZMAT 4JY4A 3N1MC 1KGJA 1ZRUA 3FU0A 5F3HA 2D3JA 1C7SA 1TPXB 3ARGA 5GSVA 4AQ8A 2WW8A 3KLDA 4OF7A 4JQVC 3EF4A 3NIGB 5D7IF 2Q8AH 3GRWL 4XNDA 5A3ID 2HTLC 5KWYC 3ARDA 4NENA 3W57A 3FQTB 1A7OH 2OZ4H 1QVOA 4LP8A 1H15A 3ES6A 3MUGB 2E56A 3GMNA 2AITA 2EILB 4UT6A 2HVBA 3VG0H 2WUBH 4GP5B 1RJYB 4A6YA 1IEAB 2XG5B 3GTTA 3QIWC 5AOMA 3VXSD 3KLHC 1DJGA 2J55A 5HSFA 1BLIA 1SBSH 1TJIH 4GEJA 1V3LA 2P7TB 3JWOC 4ONOA 4PWEA 1XD1A 2K0RA 3PNWB 1EHLL 1E6JL 1JGVL 3UZVB 1BZEA 3O0RH 4NCDA 4E2OA 4LHUB 4P2QB 4ENED 4GAAA 2W60B 5SWSE 3NJGA 4A2DA 4Q9QH 4HISA 1J1OL 3BAYA 2FGWH 1FC2D 4PRIA 4HD9A 4BZ2H 1HXYB 4JG0L 3SIKA 1QFPA 2N7AA 5DZOA 2XN9A 1OM3L 2RJMA 3NIFB 3E3QC 4HJ1A 1RPQA 1WD9A 4NB7A 4Y7OC 3ULUL 1U92A 5EU4A 4WO4D 3KPOB 1OTTC 5GGTH 1AO7E 4U6YB 5CBAA 1IEBB 2H1XA 2YSSA 3B9EA 4FQXC 2H2SC 3EDJA 4CMMA 2XKUA 5B1CA 5HDQH 3CHQA 4HIXL 1IZKA 4JM4H 4PPTA 2XPGA 3ARGD 5L2KE 2NRDA 4Y9EA 5DZLA 2H6PB 2V5RA 3BVNA 1R3JB 4YXHL 4PV1C 5F7UA 1U8LB 3GO1L 1TVBB 1A7NH 1YUHB 2JE8A 3CFCH 4OIBA 1Z1WA 4ZUUB 4AZ8B 2XICA 4Y5XC 1A3QA 3GD1C 1SDDB 4PFEA 3LRHA 3CGTA 4LHUA 2XCMC 1JWSB 5JMRA 5E08L 2X2IA 3L4XA 2E0PA 3HHRB 4K9EL 3D4CA 1NAMA 3NJVA 2B9BA 3IDMB 3L5XL 4OZIE 5F7FA 3VFUB 3VWKB 2JTYA 4FCHA 5C9JA 1FAKT 3S3DB 4M6NH 4C56A 4Z7QB 1XH1A 3OVUB 1VKXB 5SWQA 2AEPH 1C5CH 4LSSH 4DP8X 3UMTA 2BSDA 5DK2B 2ICEB 3LZFL 15C8H 3K2MC 3MZGB 2R7EB 3P3UA 4GKNB 5I6PA 1BEYL 1IEBA 2HFEB 2YLKA 3OAZK 3SDCD 2CK0L 3BIAX 3S5ZA 1PLBA 4YDLB 4K71C 1P9MA 3N40F 1G7LA 1KCSH 3EDFA 1ZSDA 4OJEH 4QT5A 4XR8C 1JV5B 5MERB 4DK3A 3HPLA 4PRID 4JB9H 2PTUA 1FVCB 5GGSB 2H6PA 1EFXA 1JDAA 4IGBB 4TQPA 4CNIB 3SE4A 3KNBA 5EEVA 4KTEH 1KACB 2XN9D 1E5YA 1WWAX 3ATAA 3LKNA 2CIIB 3IFPA 4ABVA 2HAZA 4DGVH 4PRNB 3L3OB 1WVZA 3OXRB 3WTVA 2EEDA 3D9AL 1E2WA 4I4WB 4ZZKA 1MNUH 4ZMNA 1UFUA 1UB6B 3Q1SL 1DN0A 1BZDA 1RJLB 3T77B 2JJSA 3BAEH 4DO5A 3ZE2E 4LCVA 5T3XL 4OZGF 2DI8A 5KZCB 1AC6A 3SJVB 3WY2A 2AVFA 2EDMA 2IAMA 1WAEA 1CU4H 5C0FA 3P73B 3W11C 2X2YA 5DK2A 5F9DC 1MIMH 1ZT1B 3U46A 2C9XA 1YY8A 1I3RA 2R7EA 2X3CA 3X11A 2UUDK 4KKBC 1TZGL 4PJFE 2Q5BA 3VXSE 2PKDA 1ETB1 1N9PA 3VU1A 3HR6A 1JHKH 4JFEB 1JV5A 3L2NA 5JW4R 3AM8C 3DV4A 4YEEA 1QFHA 4H8QA 2BM3A 2UY7B 3RBGA 4C56D 3QIUC 3GSOB 4WK0B 1N0LB 2WNKA 1UOLA 5J11C 4GG6E 3W82A 2PTTA 3WL9B 1IFGA 3HMWL 1T5XB 5AUMB 1EGJH 3O3AA 5CP3A 2KDYA 4AM0B 5BW7A 3BP4A 3C09B 1TETL 5DHVB 4OZFG 4YHML 3FXIC 4M7KL 4N0CC 3RGBA 1D5RA 3T77A 3RPIB 1HHIB 1WCBB 3EYVB 5L0QC 4ISVA 4DTGH 1EFXD 2VLRA 2XWJA 4G7QB 3T71A 5J5EA 1QFWH 1MFCH 2E46A 1VEPA 2CJUH 3T6WA 1KYUA 1KB9K 1OAKL 2Z34A 2L7JA 4LESA 3T0EB 1CE1H 4D3CH 5HGAB 4AGQA 4XX1E 4J3XA 1KXVC 1AR1C 4R7VA 2HUHA 3U48A 2W9DH 5F9WC 3QNYA 5HVFB 4TSCL 2GC4C 4JFEA 4YFLF 5HHXL 4GOSA 4OI8A 1CGUA 4ZAKC 2MKWA 5KTEH 2YAQA 1TNNA 3FOMA 2IAMD 3HC0A 1A3LL 1OGAA 2DLFH 4N8CH 5IFJA 1QLRA 1U8NB 1G9ML 1CTMA 2CO4A 5E4AA 1FNAA 1TO4A 2WVTA 5IW6B 3JV4A 1T5XA 1EXGA 4LSQH 4PGCA 1N2RB 2NUTA 1UVQA 3H85A 2PWFA 4OLEA 4PU2A 1HHIA 4PJ9C 2QSCL 2OMWA 2QV4A 2ZZUT 3T65A 3POHA 2DLEA 1SLUA 1ZY9A 3MR9B 5D9SB 5HVHB 1QQDB 3OF6A 4J4PA 5I6OA 1HEHC 1NOLA 5IR1A 3BKYH 2BP8A 1W0VB 4A7QA 3QG7L 3CSPA 2V2TB 2R8SH 2BCKA 2CHWA 1UB5B 1OE2A 1SOXA 5DEJA 2I25N 1A6WL 4PRIE 4IMKC 3WSQH 2B4CL 2AJSH 2Q0ZX 1CFNA 2Y2TA 4GIAA 2VLRD 5IT2L 2DLHA 2X12A 2XN9E 2DKSA 1SDYA 4PJEA 4DFIA 1JRHL 1OCCB 5KSBB 1X5AA 2IGFL 5AB0A 1WPCA 2HRPL 3UBGA 1FH5L 2BIHA 1JBJA 4MSWB 4OFPA 2EDEA 3IAGC 4GJTB 3BUYA 3R7QA 2R39A 1ZV9A 3FSAA 1CVRA 5E2UH 1RZIA 2CGZA 4LEXH 4GKZA 1L0QA 3SYAA 4JHBA 1I7RB 3FTUA 5L6YH 5HJGA 3VXUA 1OGAD 3FTZA 4M3JA 1QR1A 3RIAF 3D12B 3TJPA 2WV3A 2BIOA 2RALA 4TNVF 5DUPH 3BOVA 4R0LC 3BPOC 1UB5A 5ICZB 4PAZA 1KTLB 1WAAA 3SE9H 1OB0A 4O2EB 3C12A 3WHXB 2NYYC 4C56E 3NIFE 1JHLL 4J4PD 2JJWA 4XGZB 2BXZA 4HWEH 2CM6A 1NPNA 4XMPL 4DGUA 2XA3A 4PJDF 1MAML 5B38B 3MRLB 1V54B 1BVLB 3ARWA 4CC4C 1X5JA 3F58L 4JG9A 3UYOD 1IQWH 4Y9GA 5IJCC 1HOEA 5D1ZI 2WM0A 4P06A 3MRKA 4RMVA 1ZT4B 3QR2A 1TEFA 1XR9A 4BHUI 3VI3E 3OXSB 1IAKB 25C8H 4PJ5B 4JDVB 4UIKL 1DVUA 1NEPA 2JNZA 3M1OA 2B0SH 2DM4A 1NC2B 2FR4A 3OLDA 2VDOB 2ETWA 3FT2B 5CJ8A 3SE8H 3ZT5A 3Q5OA 4MB5A 1AXTH 5E03A 2XWBB 1T21B 3ZKND 1HTYA 1CBVH 1B0WA 1FZOA 4IBYA 4OJDH 3VGGA 1NEZG 3EYQC 4HULB 4Z7QE 4LGRB 3MBWB 2R0WL 2MWCA 5D4JA 1JI2A 3QXDB 3UYRL 4HS8H 3UL4A 5GRWA 3W9DB 1YEKH 3NJXA 4MNHA 1QO3B 1DQTA 4V1DB 1J5CA 3MXWL 1BVLA 3O9WC 2BVTA 4HC1L 1YJDC 1YG9A 2WLLB 1SUJA 2DKMA 3LZLA 4N5EC 2IQAB 4OCLC 3VXMB 4BZ1L 4EEEA 4G7YL 1WFJA 1FO0H 5D7EA 4GKSB 5E00B 1B90A 1KY6A 1ADQA 2OMZB 3G6AB 4YDVA 3TL5A 35C8L 1PZUB 1ZT4A 4J3SA 4Y5VB 4ABWA 3GZKA 1BBDH 2X9WA 3OXSA 1IAKA 3O2VL 2B14A 2P1YA 4JDVA 2CA3A 1XIWB 1YQ2A 1MJ7L 2EEAA 1NC2A 1USQA 1AMYA 1I7TB 1IVLA 2MKLC 1I8IA 4URKA 4HQQL 4K8RL 1SYSB 3BUBA 4ZW3A 4EI6B 2VLRE 1BM7A 3FTYA 3K7UA 1F8TL 1Z66A 1ZVSB 1KLGA 1OAZL 3CAFA 3MBWA 4L5FE 2PF6A 2PP7A 1M1XA 5ALBL 4YBLB 6FABL 3IVKB 1LDSA 3N43B 1YA5A 4ZMVA 4IBZA 3QUXD 2VIRA 2Z9TA 1XBRA 2EIZB 4UNUA 3NCJL 4KTGA 2VZ3A 4HS3A 1E2VA 4JFEE 1G0YR 5E9DA 4HJUA 3VXMA 2XZAL 2YGQA 3QO0B 4FXKB 4LBEB 5BV7H 2VL5B 3BKML 1JTPA 1Q9KB 3JTTA 2DQHH 2ZKWA 1OGAE 3L4CA 3T8MA 2QSQA 5IW6A 3VGHA 2W07A 3FUDA 2XZQL 2AKRA 3PL6A 2GJPA 1YC8A 2ATPA 1N68A 2P48B 1QEWB 3WKYA 4C4UA 2AQPA 4GQPH 4OLUL 3HZKA 2C8NA 5FYLL 1DVXA 1PD6A 2NY4D 3D07A 4FZ8L 3N42B 4JO5A 4NO0B 4Z0XB 1KY7A 2J8OA 4PRDA 5DA0B 1UD5A 4QRUB 2WKOA 3LEXA 1W72B 1C16A 4XWOC 3FCGA 3TYFB 4L9LB 5A7EA 3KPMB 4BKLA 3PV6B 3LSOA 5GRUH 2EO7A 1T2XA 5ANHA 4XCEA 3GKZA 3JUZA 3C87A 1R75A 3T0EE 1BSIA 2HLEB 3ZE1F 2K4WA 3IJEB 4B7LA 5KVGH 2XIIA 5HY9A 2JK5B 1QFUL 1UEMA 3CHXA 3MOBL 1KB5B 4KROB 4ONGH 5LBSH 1EAPA 4JKWA 3QJOA 5E8PB 3DV6B 3F6IA 4EQ3A 3TV3H 3GMPA 2H7WA 4G8EA 2H3XC 3NSCA 2VSKB 1UWYA 3K71A 3O45A 3G6JB 3KXFA 3QO0A 5C9KA 4JO4H 1F6AB 3BSGA 4HJSA 3IFOA 2VL5A 3LZQA 4PJEE 5HYQB 3H0TB 4DEPC 5DFTA 4ABQA 1T66D 1SFDA 4N2IA 1PEWA 1Q90A 1OPOA 3RY4A 3KPNB 2AV7B 1CGYA 2C7FA 2JKIS 4YE4L 1LO2H 5DJYA 5JO5B 4MAUL 1CS6A 5IFAL 5BOPA 1YYLL 4CA4A 5D93C 4DOHE 3BIBX 2P8MB 3LIZA 3GLEA 4Z3EA 5E9DD 5AKRA 5C2BH 4GI9A 2OBGA 4X5LA 3B2DC 4NRYB 1MG2C 1AGFB 1QEXA 4NUJB 3O6LH 3VXUE 3PV6A 3X12A 4OLYL 3I74A 2HVKA 1D7FA 3PL6D 5LDUA 5IFHL 4L1SA 4O2CB 2DQ6A 1B0IA 3VTTA 3LNFA 2JJUA 1WT5A 3Q6GH 1ODUA 3PJSB 2OSXA 4GG8A 1WAAE 4MQSB 5E8PA 5KW9L 1WJ3A 1HZKA 5F9JB 1WZMA 2HT3D 4G8GB 2IOMA 2AJVL 3G6JA 4JN1L 4N28A 2PWGA 4BDVB 3ZRSA 5FO9B 2CR6A 3GB7B 4HV8B 2WO2B 3U0PA 2ZXAA