2JQMA

Yellow fever envelope protein domain iii nmr structure (s288-k398)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
112
structure length
112
Chain Sequence
MSALTLKGTSYKMCTDKMSFVKNPTDTGHGTVVMQVKVPKGAPCKIPVIVADDLTAAINKGILVTVNPIASTNDDEVLIEVNPPFGDSYIIVGTGDSRLTYQWHKEGSSIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of yellow fever virus envelope protein domain III.
pubmed doi rcsb
source organism Yellow fever virus
molecule tags Transferase
molecule keywords Envelope protein E
total genus 30
structure length 112
sequence length 112
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2007-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2jqmA00
4UT6A 5KVGE 1URZA 2I69A 2JV6A 5LBVA 5GZOA 5KVDE 3UZQB 1SVBA 5GZNA 5KVFE 2ALAA 3VTTA 4FFYA 3N40F 4UTCA 5JHMA 3UYPB 3UAJA 4BZ2A 1S6NA 1UZGA 5B1CA 5LCVA 4UTBA 1Z3RA 3G7TA 5AAMC 2HG0A 5H37A 5LBSA 3C5XA 3J2PA 3N42F 2JSFA 4X42A 3N44F 5IREA 2H0PA 1TG8A 3MUUA 3N43F 3J27A 3N41F 1OKEA 2R29A 4L5FE 3C6EA 3UZVA 4ALAC 1PJWA 2JQMA 5KVEE 4GT0A 4FG0A 4FFZA 1OK8A 4BZ1A 4UTAA 5AAWC 2GG1A 2R69A 4AL8C 5IZ7A 2P5PA 5JHLA 3P54A 1RERA 1Z66A 4UT9A 3WE1A 4GSXA 1OANA 4AM0Q 2V33A 1ZTXE 3UZEC 3IRCA
chains in the Genus database with same CATH superfamily
4OTXH 1VSCA 2WWKT 2ZXDA 3B7RL 5E4IA 3SQOH 1AQKL 3GI8L 3O8XC 4KK5C 3WUWB 2BNUB 8FABB 5J4MA 1Q9OA 4TNEA 4BQ8A 3PNRB 3NSXA 4WW2A 2GAZA 5D96B 4W6XB 2FTAA 1RAMA 1KB9J 1U6AH 5B7MA 2GJ6D 1JCVA 4PI2A 2OYKA 3EYUL 4OLXL 3L3HB 3UFIA 2D7NA 4HLEA 3PWPD 3RGVA 3WTVA 3VFVA 1N2RB 2XV3A 1FVEA 4NAJA 4XRCB 3QCVL 1UKTA 1EXHA 3MLUL 3QEGH 3QHTC 2VLRA 2DJUA 4HUVB 3MLXH 1JPSH 2K4AA 2O5YH 4HKZB 2W60A 1RVFL 3BO8A 4NBYB 3QQ4B 4PPTA 4YOKA 5EO0A 5SV4A 4A2EA 5GZNA 1BD2D 2O30A 3PHSA 3UG5A 2VDLL 3VVVA 2DEYX 4GG6F 1ILUA 4JK0D 1T0OA 3TJHD 3TFKD 5GGSB 1S5HB 3GM0A 1HEHC 1E5UI 2FEDD 2I27N 1KOAA 4U3XA 5IJVB 2JF1A 2YXVA 3MNVA 3QR1A 1NLDH 2EDYA 1AHMA 4PRAA 1UM6L 1H19A 1A7NH 1E9PA 4N0FB 1QYGH 1ID2A 2Y72A 1XO8A 2WWMC 2YSSA 3AS1A 1E4WL 4HGWB 4KNUA 5AZUA 3W11C 4YHZL 3I2CL 3KPLB 1A9EA 2ZCLH 1EUTA 1G9NC 2B2XH 2OMYB 4OJYA 5BJTB 4BK5A 2Y2YA 1ZDSA 1NGPH 1U8QA 5AWNL 5SWSD 2H7WA 3ETTA 3IFOB 1J5CA 1U8CA 3QZBA 4ZSOE 5IK3B 4H2AA 3CNKA 4NXSA 1YAIA 1L9QA 4F2FA 2EC8A 3T3PF 3LN5B 3FN0H 4F33B 1ICTA 2ZG1A 3QHZL 2R1XA 5F9WC 3KXFE 1W6LA 1JPGB 4TUOB 4Y89A 3KJ4B 3LQAH 4F7TB 3BT0A 4MCYB 2ATPA 2CLZA 3WUZA 4A2GA 1H5BA 3T6XA 4XNZC 5E8EA 2HRGA 2BCKA 5EWIL 4ZOCA 3BAWA 1IBGH 3IU4L 5IT2L 4L3CA 1CLZL 2PXYD 1NFAA 2EO9A 4AYFA 2AEOA 3LZRA 4IU2B 1CLOL 1UWFA 1HSAB 3L48A 1Z2KA 1H0DB 5J1AB 2VSKB 3POHA 3CXHK 4FFWC 4XPBL 3KPRB 1YNKL 4XTRD 2R56L 5I1CH 2PCFB 1SN0A 1G6RH 3BOVA 3DO4A 3LRMA 4M48L 4QXTA 5I9QC 5KYXB 1QFHA 4Z8FL 5B38G 2EAEA 2VZSA 4RISL 1ZLVK 3IDXL 3I6KA 1B2WL 3C08L 3VFRB 1J8SA 2DMHA 2FCBA 3DJ9A 2ODIA 2HJLB 1UOLA 3NCCB 4XP1H 3UPCA 1LEIA 3ATEA 3ZO0A 3L7EB 1PLAA 3GJFK 2F74A 1OK0A 2GK0A 1MW3A 2H6OA 5KBDA 2Q7NA 4Y7OC 3QEHB 4LSUL 5D2LF 3EDEA 4BHUI 4G43B 2CWRA 4DGYL 1YEKL 2VDLH 1KXVA 3VI3E 2H8PB 4GQQA 1IKNC 1AQDB 4OFPA 1BBDH 4YHOH 5JLZB 3MOAL 2BVUA 5GZOC 3T8XB 1H9DA 2VDNB 4BQ9A 4NBZB 3VD3A 3CLEL 1EH9A 4GY4A 5CJ8A 4YFEA 5C0GB 4KK5D 1Q8MA 1DCLA 1HQRB 3TFKC 1BXUA 2VGLM 2VC2H 4XH2B 3TJHC 4PJ5D 4XNXL 4KJPD 4BKLA 5IG7B 4RRPG 1ZVNA 2A6KB 2J71A 3T0VA 1G7JA 4L3AA 1MLCB 4JUTA 3IGKA 3U2SB 1I9JH 2DQMA 1U6AL 3US9A 5A6IA 5AVZB 3VWKD 4HWNA 1D7CA 2FQFA 3SQBB 3AXLB 1GMEA 4EXKA 4GMTL 4ZX4A 2R2BA 1KNOA 2VR3A 5D8JH 4G1MA 4P2QB 3V4PB 1WPCA 2OMUB 4FQXD 2EILB 4M43H 3F04A 4ZMVA 1IVLA 1MCDA 1Q9KA 4NUQA 5E08L 5FV1L 3CSPA 4JFPA 1SOKA 1ZTXH 2L7EA 2HFFB 2NPLX 12E8H 3UZQB 3HG0A 4RGOH 3HBQA 2JLPA 1FGNH 2NY7H 5JNYB 1UWXH 1NCDH 4X8GA 2PO6B 4HWBL 1AANA 3BZDA 2EIBA 4IRZH 2IPTL 3K6DA 1QMUA 2UZYB 3LIZL 5G4MA 2J8UA 1BDYA 1G5GA 2FLRT 2IBZX 4OIAA 1XGRA 5GGVY 4BH7B 3VXSB 4EEEA 4LPTA 3SPCA 3W2DL 2JB5L 3I84A 4XBMA 4ZUUB 1ZTXE 2H32A 1HCVA 2QLYA 2PMZA 5DURD 4K8RH 1EZLA 3PUCA 4QXGL 3MFFA 35C8L 3RRQA 3ARQA 4IKLA 5T1DH 3VYOA 4Q8BA 4L3ED 4LSQL 5D7LE 4EF3A 3RIAK 1J8HD 3RL1A 3RUGF 4TTGA 4BFOA 3PQYE 4LXFA 4QO1B 3M1CA 1YNKH 2G5RA 3RTLA 3BVXA 1YZZA 4LDEB 5B8CC 1T83C 4KJYB 1S7SA 3U4EA 4HKJA 4A2LA 4U6HA 5KG9A 3BVTA 4N1CA 3WSQH 1U8LA 1A6VL 5FGCB 2NW3A 1XGTB 2DWDB 5CD3A 1TTUA 1KEGH 3AY4A 1U0QA 4XCNA 1NANH 1TQTA 1IT9L 4H8HA 5KSVA 4UBDD 1BQLL 5FUZH 1IZKA 1XSOA 4IEFB 1UEYA 2YD1A 4P5KA 4MZ3A 4K23L 3HG5A 2V2XA 2ZP0T 1U8OA 1SDDA 4PBVC 5G4NA 3V6ZB 2A77H 3RURA 1LMIA 4HLZG 1CK0H 1PEZA 1JV2A 1Q0XH 2H1PH 5ILTH 4M9OA 3GMNA 3VRJB 3HFML 4PJ9B 4NHCL 2IVFC 4U31A 3QO1B 1Y1DA 3VX0A 5IVXF 1QLEB 3IDUA 4FXLA 5AL0A 4U4IA 4LP5A 5MERB 3HUJB 3P11L 1S9VA 1U93B 5C7XL 5I16B 3PWJB 1J8KA 5GRZA 4B97A 5E4EB 3L5JA 2KZBA 4W9LC 5CJOH 1OARL 2V8LA 4MNHA 4WKZB 5DD6A 1U8KB 4DAGH 1KC5L 3GSRA 1MRCH 3B3IB 4UZSA 5GS2H 4LPYA 1CMOA 3QPXH 3WKML 4HIEB 4YIQB 3VXMA 1CFQB 3VTAA 4A2MA 3VJ6B 2VXVH 5HD8D 2EH8H 1KB3A 3AGVA 2G9HA 5INDB 3HPLA 1NIAA 2AF2A 3OXSB 3MJ9L 2DKSA 3I9GH 2Y6SD 3BGAA 4MNGA 5KYUB 3ZZSA 3S4SB 2ZWNA 3UDWC 2Y1YA 4HXAL 3WAJA 3HG4A 1AQ8A 3UC0H 1EZUA 3MBWA 1TCRA 4P23D 2C1OA 4LARH 1T2JA 3ABLB 5DHVA 4EZJA 3Q8BA 1NL0H 4FG4A 1GHFH 1AZUA 2HJFA 3ZLQC 1FDLH 1HSBA 2PO6C 3HNTL 5C0AB 4L4VD 4GRLB 4XPHL 5INCA 3TN0C 3PWUA 3VI4E 4E68A 2X4SA 4WHDA 1CE1L 4WTWA 1AKJD 3BEWA 1K2DB 3B83A 2XWBA 3OPUA 4XCEB 2OI9B 4NQEB 2X3BA 2VLLA 5EO9A 2Q8AH 4PCKA 5KYYB 3KGTA 2DBLL 2WUCL 4HV8B 4M4RA 3WS6A 3KLHD 2IDSA 4GAAA 1ORSB 1XB3A 1VEMA 1G9EA 4FTDA 3RL2B 3LNFA 1Y07A 5IB5B 1WZMA 2CR3A 4LEXL 1NMAH 4JRWA 2JJWA 4DK5A 3EJTA 1ML0A 2BS71 2W0FB 5E00B 3QEQD 3AT0A 3CG8A 1U8MB 3C5ZB 3D08A 4KMQA 5I76A 1A7QL 4ZOEA 1KEML 4EBQH 4FNLH 4UQBA 1NCWL 2XVGA 2EKJA 4XPAL 5AW2B 5E8NA 1FLRH 3OKOB 1V3JA 1NCJA 3GSNB 2OJZH 1LQSR 4QHUB 5F7DB 1WZAA 4QLRA 2Z4QB 3MJ8A 5CJQL 1UOKA 2EYTB 4HFUH 1ZRUA 3E1ZA 4KK8C 1QHQA 4HAGA 4C56A 2YJQA 5FM8A 3UEZA 5CP7B 4LOVA 3RX5A 2V5MA 3GBML 3LZQA 1J10A 4G9FE 4ELMF 2DMBA 1P5VA 4UU9A 4D9LH 3O41B 4AXWA 4Z77B 3BGFC 1AH1A 3MV11 3FO1B 3OGCA 2L7JA 3JV4B 4JFTA 3FTVA 4NZUL 3VX1A 5J6HA 4W4OA 2AERT 1TVBB 4RFEB 5ICUA 1CD1B 1MIEH 4X8XA 2K7QA 4XE5B 4CW1A 3A4FA 4RGNB 1RK1A 5ANMA 4M56A 4HKBB 4E9YA 3IKCA 4FXKA 1GOHA 2OL3L 4KKCD 4U1LA 4M7LH 1NFDE 5DEGA 3SDXE 5I82A 5H4YA 1NM9A 1NCHA 1JZ4A 4AIOA 1CDYA 1RURH 1IGTB 4R7NB 1I3RB 1X5MA 4F37K 5EIIA 1E7VA 4F58H 3MV7D 1F42A 5HHOB 1A47A 3U6XA 8PAZA 3L2MA 1IAII 2Y06H 1FVCB 2ZSWA 2K8QA 4FQPA 5HYJE 5CKAA 4S0TD 4F5CA 3US1A 5C07E 2X4PB 2PWHA 5EZJB 3MTRA 5ACZB 5HI3D 4LHQB 4G6AD 2R1WB 4M7JL 3K4DA 5EBLB 1IE5A 4MGXA 3SKMA 5E1GA 4F8TA 4IGBA 4BA0A 1UENA 3X3GL 4QRRD 1OAYH 4PW4A 1OAJA 4QOKD 3VUAA 3NIDB 2UZIH 5DZOA 4UT7H 1H6UA 1E4JA 1FNHA 3HI5H 3K6SA 2F53B 3FSAA 3PWVB 1D5XB 3LH9A 4PRHA 3IDGA 2XIIA 4K5PA 2VM9A 5KSAB 4PV9B 5FCUH 3S37H 1OD9A 3K80A 1ZGLB 1R9FA 3IN2A 1KZYA 4L8CA 2GIYA 3QQNA 1MCOL 3TZVA 1I7UB 1YJDC 1RZJL 4IDJH 5D4HA 1BFOB 2CK0H 2BNRE 4ODHH 2IADB 1I1RA 1VKXB 1OEZW 2EDNA 5E2UH 4UV4H 5T33L 2WKGA 1NBCA 5DFTA 4EQ2A 3MAWA 3A24A 3HE6C 2H0PA 4J8RA 4ZMZA 1AZRA 4OCWH 2WLLB 5LAXB 5C07D 4QNPF 1MIMH 1KPRB 4NZTL 3TH4T 3C6LA 1XEUA 1N0XL 4K7FB 1S7UB 3ARED 4HD9A 1MKFA 2CRYA 1DQTA 1WD8A 2JKRM 3QUZD 4X2UA 4MKTA 4ZNCD 3OKYA 2G60L 2MTPA 4HWBA 4GKNB 5CINH 2HLFC 4PTTA 3FFCD 1GGIL 4AK1A 4WUUA 3BGMB 4FLQA 3DO7A 5GJSH 2BW4A 3AT8A 3FRUB 1H8OA 1R6VA 4I88A 4IRJC 3TOPA 2JSFA 3TN0A 2MQ3A 5KOVC 4ATTA 1J0JA 5TDOA 3GHBH 1RJCA 4TS6A 2HVJA 2KDGA 2P5EB 3ZZ1A 1UQSB 3D69B 1WC7A 3F12B 4H5SA 1JPST 3FYEB 2LU5A 2TRYA 5IHZB 2PETA 2XVKA 4JMXA 5AG8A 5I1EL 5LB1A 4S1DC 1P4UA 5HHQA 2IH1A 1JF1B 3JWNC 2BSSA 3SO3B 2DYPA 1T04A 2C4XA 4HD5A 5L2KD 2F58H 2W9EH 3PDDA 4Z3FA 5KW9L 2PP7A 1YEIH 3MLVH 4H0LC 4PHXA 1UM5L 5EU5B 3L54A 3LEVL 4KBPA 4XB8A 4NENA 3WDIA 1C08A 3ZGHA 3ULSA 4CA4A 4LSDA 2JWYA 1BXAA 3H53A 1R47A 4OJAA 2B39A 1M1SA 1OSEA 4Q9BA 4YXLL 3QYCA 5F1IA 2V9UA 1MVFA 2HTLC 4IMLB 3GQFA 2GI0A 3LXCA 2QHRL 3QNZA 3MNZA 3AREB 4UQ3A 4NC0B 2VR7A 2FJUB 3M6DA 2JQZA 2VQ1A 3QDJE 3OX8A 1GHFL 3V0DA 2ZX5A 2HX7A 3RZCA 1JYVA 3GXUB 1PQZA 3M17A 3ZYOA 5KTEH 3H55A 3NRFA 3AS2A 1HH9B 2A3TA 4G8GB 5IR1A 5FECA 4PGEB 4JO5A 1Z32X 5JXAL 1NCTA 5F1SA 5IF0A 3MRFB 1V7NH 5T5NF 5LGJB 1KIPA 3T6QC 4LU5L 2ENSA 3MX0B 5HYQB 2HKFL 3LNIA 4MAUL 2Q86A 1HNYA 4F57L 1ZANH 5ID1B 1TJHH 2BVYA 3MCKB 4P2OB 2BC4A 3V95A 5DHDA 3G5VA 1FAKT 2DF3A 5L2KE 1NH6A 5AKSA 4JRXB 1QR1B 5AVVB 5GS0D 2BVPA 3NCEB 1A3RL 1NJ9A 1SYVA 1UWGL 4IKNA 4KH2A 4O4YH 5IOPA 1OGAD 5KSBB 2WXOA 4JKLA 3WL9A 4A7QA 3BAJA 3D07A 2AJZA 2FBRA 2HAZA 3OKKA 5T5NG 4BSVA 2W92A 4LHUA 3RFZA 4LOUD 3DVNB 3ARBA 1KT2B 2ED6A 5IROC 3VSTA 4YHKL 1YYLH 2R0LL 5AVYB 3CHOA 3FQWB 3U0PB 3WNIA 4WO4A 1VACA 3CQQA 3QRGL 1D5MA 2X2UA 3DSNB 3QUYB 4U1GC 5DQDL 3DMMA 4YHIA 3AVEA 4AUUA 4R7DA 4LCIH 4WNSA 1QZNA 1NC2A 2CDGA 2NQ3A 1YQ2A 2G3XA 4S1SH 5DVMA 3HI6H 5BRQA 2QPFA 1NGZB 5EZOH 1H3WM 1DTUA 1GY2A 2FWUA 4XI5D 5TE6L 4LE8A 3L4WA 2BIOA 3U1PA 4BSWA 1PAZA 4FTVA 5FO9B 3NCMA 4MVBD 2VW6A 4KY2A 1MRFH 3BLKA 3GMRA 2NY0D 4IGBC 3X1EA 2A9NL 3S3BB 4H1LH 4ORGA 4UBDC 5JOFB 4GKZB 3FT9A 5GGRY 4DZBB 3EZJB 2IPKA 4H1LA 4JFED 4LVHC 1X9RA 2X10A 3OD3A 2NRDA 3LKOB 5EEYA 5KZCD 1YMME 2WKOF 2OR9L 2D0HA 4Q4EA 3VM5A 3HFFA 3QUXA 1YEGL 5F3FA 4X4XB 1UJTA 1IQWH 3WFHA 3CH1B 5DK0A 1VFMA 4YO0A 2QADC 1MVYA 3GSWA 5CN1A 3EF7A 3L2LA 5FYKD 1HILA 5D6DA 3OLGA 4ZX5A 4GBXB 4OLZH 4FKHA 3IM1A 1BEYL 1M1XA 4U1HB 1D6EB 3ALWA 1A25A 4W1TA 3LIZH 4HYTB 5FEBA 2BMKA 3F8UB 4NC2B 1ZHLB 5E99H 2F54A 4X0KB 1L9NA 4X9HA 2BIQA 4KX8A 3FOMB 4NCC2 4FI6A 4R4BB 4Q56A 4JDZA 2UY6B 2GTWA 1LNUA 1LO3L 1FZOB 2QQNL 1YEJH 3S36H 1ZAGA 5F1NA 1F4XH 2R4RL 1SOXA 3EOAB 2X40A 1I8IB 4RX4A 3ZTCC 1KGCE 3PAZA 4J12A 4XPFL 1KLFA 3DETC 5KWYC 5B7EA 3QRGH 2NXYC 3FO9B 5KSBF 4NSKA 3QUMH 5DJ8A 4A68A 4QPEA 2C1PB 2KHAA 3ULVL 4G7VL 3QXDB 4MJ4A 4PJCA 5EF2A 5ITBH 3OB0K 3KYMA 1J0ZA 1HHHA 4YHKH 2JKNA 1IIKA 3CVDA 4PWEA 5GJTL 4Z76A 2NUPB 1CBVL 4JDTH 4QTFA 1LEKB 2UV3A 5CEYB 4F7CB 1EHLL 4GKLA 4ONHA 3MBEC 2VJXA 3IJSB 3HBZA 4UIMB 3ARGB 4H1LG 4UOW0 5AOZA 1YNTA 2FSEA 4U3SB 1GKOA 2BSRA 4X5QA 3DJRA 1EFXB 4OKDA 3I50L 3TVMD 3HIZA 3ULVD 2ZP9A 2MQCA 3BXNB 3DGDA 1A22B 2E7BA 3EJSA 3MV8B 1NMBL 3SBRA 3MRPB 3QDMD 2VR8A 1DLFL 4ZUVA 3SDCC 3SGDI 4PVLA 4F5CE 1VEPA 2XXGA 4NKOA 2Q87A 5AYUH 3TWCL 2WSPA 4P2RA 4CVZA 1NPJA 2MNJB 1MCSA 1CICD 5IBLC 4KRNA 3W5MA 4BFFA 1AS8A 3L3GB 5E94B 5IBTL 3ZTEA 2C7UA 5JHMA 4S1QH 4U1JB 2CBQA 1E27B 1LP9F 1MHEB 1RUAL 3QEQE 4OGQC 4CSTA 2X4UB 3FU5A 1EHLH 1Z3GH 4DZ8A 7PCYA 3TIDA 1AXTL 3MRHB 1PKQB 1A5FH 1YQVL 4DNLA 4MMXB 5AG9A 2EDWA 1RZFL 2RCSH 2PYEB 5CLYA 4ESKA 5IKCA 3MV7A 4YSQA 1TTFA 3QUYD 1HWHB 4XNMA 1OB0A 5FHBL 5JA9A 3IJHA 1KCWA 5K1VA 4F7MA 5F97E 5I0XA 1QWHA 1RULH 2IGTA 1G43A 5EBWB 2DL2A 4KX7A 1MCQA 1DLHB 1NZRA 2B5IC 2E86A 2Q76B 4HCRA 4I1RA 4WWKC 2WO4A 1RZ8B 1WAAE 4GS7B 4P2YA 2BNQB 3UBXA 4ENEC 3DIFB 1HYSC 1GAFL 2Y0SA 3H0TA 4RAHA 1N7MH 4YL9A 4KU1A 2I9LB 4HZLB 1A9BB 1GGTA 3BPNC 1JGDB 5CMAB 3WD5H 3H4HA 4FXGB 1W15A 3A4EA 2FX9H 4LLVB 3SEPA 5IJCC 2DS4A 1OTSD 2OZ4L 1A6AA 2O6EA 4JFQA 1W16A 3VFSA 2Y24A 3N9GL 1VADB 5MEPA 1O6SB 3DX3A 4URTB 1PG7X 1ZE3C 5E7FA 3DHMA 4G83A 1JERA 2NCEA 5L88L 1ZSHA 1Z5LA 4YBLC 3SDAD 2HRPL 5DD1H 3G04A 4NM4L 1F90L 5E9AA 3GGWB 5J12C 3THMH 4JRYD 4PJFB 1A7NL 3P1VA 3KLAB 2K3TA 4FQ1H 4XNUH 1P9MA 5E6IC 1JTTA 4TL4A 4YDMA 1R1CA 2JQMA 4MXVE 1MREH 4K5LA 3VFUB 2CGRL 5E9DD 3D4ZA 4NKMB 4HJJH 4OT1H 4YLQT 2JB6A 3MRIA 4MTMA 2N56A 4H8WC 4NPYA 5H37G 1T89A 3QUZB 4LHUD 2W9LA 5MI0C 2X4QA 3OQ3B 5F70A 1G1KA 3GUFA 4FEIA 5HDWA 2E47A 1ADQH 4N2OA 4JN2A 4CILA 2AANA 4OBSA 4S2SA 2IXQA 5D7SH 2Y5EA 3MV9E 1JGEA 1AJ7L 2CSPA 1QEWB 5LGHH 4J3WA 4MXWH 4KHTL 4APQD 3ABMB 3DC0A 1P2CB 4CADA 1M7DB 2C3HA 4ELDA 4WK2B 1C7TA 1MN4A 1RERA 5EN2A 1ZK5A 1KYFA 2FJGB 2VDKH 5GGRA 5M7QA 4W4NA 1GSKA 6CGTA 1IIIA 5B3NA 4WI0B 4GP8B 3UGUA 3TNNA 3E6FB 4HKXA 3NJFA 1RZIA 5I6NA 1X5XA 3VFWA 3ULUF 4JM4H 1LO2H 1OAQH 3DSFL 5LUMA 3Q1EA 4PJ8A 3KH4A 1NPNA 4WY7H 3NFNA 4Q9CA 4N2HA 2DWXA 2PPDA 1UJ3C 4KH9A 1EX0A 3BKMH 1C5CL 5ICXB 4K5OA 2A4ZA 3VMOA 5DVOA 2QHLA 2PKDA 3WE1A 4FQQA 4GRWE 3P3UA 1VEOA 15C8L 2DN7A 2H26B 4B9ZA 3ULVE 4KROD 4TNGA 4XCCH 2E6JA 4YEEA 4Y2DA 3GMMA 3CV5A 2JNZA 3J2PA 1G0XA 4LL4A 2Y07L 2KQNA 5E5LA 3T77B 4O51B 3STBA 1TIUA 1CICB 2WSDA 4AM0A 1FZKB 5D2NA 4Q7DA 5DS8A 4OZIB 1ERNA 4DQOL 1ED3B 1CZ8L 5LGYA 4AL8C 2BOBA 2P43B 3E3QE 5FW8A 4PLJC 2RR3A 3IAQA 4JVPA 2OP4H 5IROD 2AS5M 4PH8A 3WJMB 2N1TE 3FZUC 2DQHL 3ZZLA 2OK0H 4Z0BL 4XMLL 2I9TB 1JWUA 3OC5A 2F18A 1JHLH 1FZMA 3R8BB 4HHAA 1OPGL 3D0LA 4UTBH 4XMVA 4BZ2L 4XPTL 4JANB 4N8PA 3MLZH 4XWGL 4NI6A 2X6CA 1JYXA 3CFKA 4AIXA 1FHGA 2X12A 4YNYB 4WO4D 1ORQB 1KXQA 4M5ZL 5E5MB 1AKJA 4ZMWA 5IHWA 4KITB 3KPOB 1LE5A 3ZHFA 1CYGA 4TNWK 5I1HH 2NXZD 5C0BB 3TO2B 3BN3B 2VDOH 1AQHA 3BX7C 4Z7UA 5D1ZC 1MY7A 3VQMA 3B2DC 2JK5B 2OSLA 4KI5C 2VITA 4WUUE 3CSBA 5IB4B 4NIYE 4N2KA 1Q0YL 2Z0BA 1PD1A 5ITFB 3TEZA 1WTGT 2XBDA 1BCIA 1JFHA 3IMUA 3OV6A 4WJKB 3KYKH 4HS6B 4DCQB 5JYLA 1PF3A 1X6NA 1XSKA 5D7IE 4QHNB 1O7SA 5CNHA 2VAAA 3Q48A 4U3CA 2P28B 2YEVB 2GYSA 3C5ZD 4JZNB 2DYPD 4HZ1A 4JJ5B 2X0WA 1N4XH 4HLZH 5B3SB 5KVDE 4G9DB 2K3HA 4JY4B 4R7XA 1NGWA 5H35A 1YYMH 5F89B 1DVQA 4XHQA 4JFEB 4KK9D 3SJVE 3SDXB 2COQA 3IPFA 4JRXE 4M6NH 1RULL 4R2GD 1G7QA 4G7YH 5FOBB 2NQDA 3QWOB 4LLMB 4UCFA 1CVRA 4WJ5B 2ERJC 1F0LA 1T6BX 2WCSA 1T5XB 1WH0A 5C6TH 1J5OL 1JRHL 2VH5L 3V6OE 1KTKE 1A6TB 4Y5XB 2OSYA 3KGRA 4FX5A 4DP4X 4E9XA 3CFNA 3QFGA 2QQKL 3V5HB 2WKLA 3LNHA 4YHPB 4O2EA 1E9QB 3SD5A 4Z3TA 3RJQB 1VGKB 4JG1H 5IBTH 2CRIA 1JRHH 1QSFD 1AHWC 1NEPA 1Y6MR 3C60B 2B9AA 1T4KB 1FJ1A 1MW1A 4PWJA 1GYWA 2WBXA 4ZK8A 3SYAA 1IL1B 2HG0A 4OCNC 5C0BE 3KGSA 3DJSA 4KHXL 3ZDXB 2X6MA 3Q6FB 1LWHA 2PYED 1D5ZA 2XG4B 3B2UD 5IFJA 5I8EB 5EDXA 5F0MB 3F83A 1XGQB 2GSIB 5SWZD 4PP1C 3LZPA 5FGRA 3SE3C 1NDGA 4HDIA 2CIIB 5F6HI 4HWEH 4LCCA 2Z8RA 4PVMA 2HTKC 3KWWA 5B4MC 5C86A 1LLAA 3PGDA 4QRAA 3S5YA 3KR3H 3P2TA 4Z6AT 1KN4H 4PJAE 1A1NB 3HI1B 4Q0XL 4XAKD 5GS3A 4QRTB 2D4DA 5TPWH 4RFOH 4JFEE 5IGXH 2BSDA 4XXWA 3NIFF 3EJZD 4ZO6A 3ZYZA 2R0ZH 3RGVC 2IFFL 4P5TB 4EUPA 1R17A 1KJMB 1TJIH 4M6AA 5KS9F 2YAQA 1DQQB 1MJ7H 5FO7B 4W9CC 3QEUA 2VISA 5GRUL 1A64A 3X11A 3CZEA 1N19A 1JDDA 5FO2A 4DK6A 1KACB 1H3UA 1RIHL 2JLLA 1JYWA 1OP5H 3QZOA 3ASOB 2XXFA 4YAQB 5LO7A 3QQDA 1GYCA 3AROA 3ZU8A 2HWZL 1BZDA 3BLBA 2FWOB 1KBKA 2IWGA 1JHKL 2NYYD 5D93B 5DK2B 5T3XL 3ZVVA 1O9VA 2VTFA 1QSFA 2EEFA 3BUTA 3GXPA 1VFUA 3S36L 4BDVB 4E42B 3CLFL 4BZ2H 2OP4L 3D85D 1ZVSB 2OZNA 5BZWA 5F71A 1CFVL 5FDWB 1JBJA 1TLKA 1KMGA 2NY5L 2NT1A 4POYA 5KUMA 1S7XA 1J9QA 3BUQA 3DX0A 3M1BB 1WUZA 3QWQB 5E99L 3O6LH 4XR8C 2Y1VA 3DYPA 2IANA 1I8KB 3ECWA 3TZVD 3SO5A 5D2LE 3K8KA 1XF2A 1UB6A 2YRBA 2ZXEB 3L7FB 3RU8L 2ZUUA 3S35X 2JKIS 3OKMA 2W9DH 1TCMA 1I7TB 1HE8A 3FO2A 3MDJA 4ZFOA 2FO1A 4HWZB 3RTQA 3VGAB 4BE6A 4LLAA 4NZRL 1NAML 3WTSA 2AXHA 3FCTA 3Q6GL 2GFBA 4EVNB 3OAWA 1J86A 1TZGH 4NDMB 4ZPVA 4JE4B 4QY8B 1E90A 5I26A 5JQ6L 1CFTB 4JY5H 4PJIB 1JE6A 4OLYL 1DR9A 1HX0A 4HJ0C 1KDJA 2DMKA 1OTSC 1MCIA 1R3KA 2RHEA 3GZPA 4TF4A 3BZEB 4QRFA 1I7ZA 4LL9A 4N0CC 2XWJA 3PJSA 4GQ9H 1A6ZB 1AC6A 1LILA 2DB8A 1MI5A 4EZKA 1H15A 2XWZA 3N42B 2F7RA 5JPMB 5E08H 1X7SA 3BAYA 1OGTA 2JJVA 3TX4A 1A6UL 2EH7L 3EBHA 4IKKA 3HG1B 1CBJA 1JWMB 1WAAF 2WQRA 4JHBA 4L8SA 4Q6IB 4LLWB 3O11B 4DO4A 1AI1L 3BDYL 4I5BB 4K7PY 3TBTB 1KUMA 2PF6A 2D9QB 2QQNH 4P8QA 1QFOA 3JBG7 3BYTA 1A6UH 1CDJA 2EH7H 2ICWA 3DUHA 3VI4A 4U6XA 3SPHA 3BRGC 4F8OA 3NFSL 1HIML 3QIBC 3UCRA 5EUOE 1T7WA 3SGDH 2XUWA 4CMMA 2FB4L 3MRGA 5HDBB 2VDRL 3WFDL 4ZMTA 2QKIB 3KCPA 1BBDL 4WZ9A 2OCFD 3DX1A 3UAEA 4YX2H 4DUXA 3OJ2C 7FABL 5CO1A 3BSZH 1M2VA 4QTHB 5GZND 4Y4KA 3OBAA 1A4KB 1H8NA 1MHHA 1NGYA 5C08E 1XH2A 3DUSB 5TK4A 1YEWA 3VM7A 2B1OA 1J0KA 3KPNA 5FYJD 5ESAA 5FGBC 5MEOA 2J6EH 4QGTA 2P45B 2GK2A 3CCHA 3D2UA 4XN5A 5JHLH 4P5TC 3LRGA 3VW3H 1NSNL 5D5MA 1DFBL 5HYSA 4MAZA 4PS7A 4OFIA 4AT6B 1GW0A 1S9YA 4K3HA 2VXQH 4OZ4B 5AKTA 4OFQA 3LQZB 2PPAA 4Y4HA 1WCBB 3V9CA 4MJIA 3QZWA 2P3YA 3OR7A 4A6YB 1E28A 1XQ4A 4PWFA 2BP0A 3QS3A 1FSKC 2P52A 4QXUH 3QIBD 3KYOB 3FQTA 3VRIA 1R24B 5IQNA 3PLYA 3WBDA 1XR9B 3OF6A 4AYDC 1XH3A 4XNYL 3S8GB 1W80A 4LQ1A 4WUKL 1IBGL 2DM2A 4XWOD 1GC1C 4NQSB 5FUCC 3NEXA 1QO3B 2C3VA 3CFIC 2CR0A 3MJ7A 4LP4A 3SQRA 2IAND 3L5XH 1N6QL 3IK2A 4M93C 1MNUL 2H2PC 1FNLA 1QLRB 2AMUA 4LOUC 5D1QE 1ASOA 1HT6A 3CIQA 4JBSA 4QHLB 1XD1A 3CIAA 3D5OF 4ACPA 4JFFB 3STLA 3DV4A 1Z9NA 3DX9B 4H8PA 5GIRA 3RVVD 2A6JA 4QRSB 2YO3A 3H9SD 3IB4A 1SFHA 5DD5H 3AB0B 3QXAB 1K72A 5D1ZA 2ADJB 4JQXA 2Y9RT 3H2QA 1MCCA 3MROA 2C9UA 5KW9H 4A37A 1TQSA 4R97C 2VLRD 1BFVH 3BD3A 4FJ6A 4H2CA 2GTQA 3WTXA 1ZVHA 1PFOA 4NOFA 2I07B 5DWUL 4U0RB 1AOZA 3VFTB 2J8HA 1FSKB 1N3NA 3EGXB 4L18A 3KWUA 4G6FD 4LLUB 1FZJB 2WY3B 2P5EE 4JEGB 1VZHA 1AZNA 2N3JA 4GSDH 1N67A 1QYGL 1TJHL 1X5JA 5DHEA 1MJJB 4LPXA 1RZ7L 4OCSH 1O9ZA 1WFOA 4K71C 2HKFH 3NIGB 4X98A 4P46C 4ODTH 3RUGE 5HJ3B 4LT7A 3P69A 4Y7MA 5IFAL 1J1PH 1BVNT 2EXYD 4YH6A 5I30H 4N2IA 1WBYB 5CGYC 3RVVC 3NJMA 4ZMPA 3ML8A 1RSFA 4PS4H 2LLLA 4APQB 1QFUL 5IVZA 2BDNH 1DQLL 2MIZA 4G2AA 4OIIH 5LBGA 1A1MA 2XA3A 3REVB 4F8PA 4M8VA 3BSZL 3CE1A 5D7LD 4D7PA 2ZSVA 3C5JB 2FATH 2MQGA 3TBSA 4EIGB 3BP4A 2XV0A 4XHJC 1XL4A 2X28A 5IB3A 3O3BA 4QRRA 4Q89A 3I75B 5AOJA 5F7FA 4XNDA 1J48A 1MFEL 3DVGA 4MFHA 1WZ1H 3DSFH 1FE8L 3GTTA 1NCDL 1KIRB 1CGYA 2WQUA 3WY4A 4KKBC 5DEFB 4X80L 3FF8A 2HXAA 3DOIA 4NHUB 1FL3B 4ZXBD 3FB5A 1JHTA 3U83A 3JTSB 4B96A 3GF8A 4CMHC 2PW2B 3CFQA 2FNWA 3D7PA 3QDHA 2O6FA 1XIWB 2BIHA 1AMXA 2EZ0C 3L4YA 4WUKH 5DUPL 3CVHA 5EEVA 4P3DA 1CPUA 5JTWA 2XU9A 2V5TA 2Y22A 1XCTB 2H2PD 5IM7B 2C9VA 2KMWA 5D7SL 2G75B 2WXQA 2NY2C 4BFBD 5D2LB 1ZGLM 1BVZA 1V54B 4UQ2A 4J4PC 2NZ9D 4GPVA 1VFAA 1DJXA 1UT1A 1W8EA 2BOCB 3RWJA 1LL1A 3VFPB 3EZ8A 1C12A 3D3VD 1TQWA 4HISA 3PABB 4MA3B 4WEEA 1U8HB 1MRDL 4LHUG 5IBUG 1HHJB 2FLBT 3V9FA 2J6EA 3NJIA 4MXVF 1NCIA 4NZRH 1SJEB 1PZ5B 4KFZC 1AYRA 3D25B 1K4DB 5JPNA 2EDHA 1NTDA 2NW2B 3K46A 5C0JB 3WXWH 4ORZC 5IMLA 2MKWA 1RCYA 5AW5B 3FT3B 3ELQA 4DW2L 3E38A 1KY6A 4GRMB 3R4RA 4HIJA 4UTBL 2IPUK 3F7YA 4GAFB 4JMNA 3VDBA 2CIKB 4NP9A 1UCBL 1PKOA 4TUKH 5EOQH 2Q7YB 4RAVB 4PJEF 3D4YA 2DQHH 1UD4A 3IAGC 5E4OA 5F7HA 4P4RB 1ZOXA 1QSVA 3GIVA 1BMWA 2H32H 5LLIC 2OM5A 2OZ4H 4NQCB 3O6FB 4PBXA 2BIPA 5DO2C 2ILLA 1CLOH 4JFYA 2NMSA 4MNQD 1DL7H 3Q2CA 3AFLA 4CNIA 5ABAA 4JW3A 3SYOA 1E30A 2XETA 3VFNB 1SBSH 3UYPB 1N9PA 1XH0A 4XP6L 4YS4A 4EZMA 3LB6C 2CQVA 2R23A 5LJYH 5DDHA 5FW7A 2B0SH 3HI5L 3SJVD 2VRQA 3RJDA 1A8ZA 1A7OH 4Y4FA 2CO3A 3MV9D 3QIUA 4NT6A 3OJDB 1YSOA 2HT3D 1EEYA 3ASWA 5HY9A 2Z3FA 3QHZH 1W0WA 4AGLA 3JUZA 3Q5OA 1AR1B 1GYAA 4Z0XB 1PFCA 5FYKU 2WWOA 1A2YA 1S7RB 3L4XA 4MNQB 4RMTA 3WNJA 4YE0A 3WEOA 2OMVB 5E2VH 4YR6A 4Q0XH 1A3ZA 3GXNA 3ROOB 3KZ8A 3QI9C 3FKUS 5DC4B 3X3FL 4O9HH 4MJ5A 1RUAH 3VFMB 4AJWA 1U42A 5GS1A 2V7NA 3BAXA 1IE4A 1XZ0A 3GZQA 2Z35A 2Y2WA 4NUMA 2CGZA 1I8MA 4Y1TA 1I7RA 1HHGB 2PTTA 2BY2A 4FZ8L 4UQEA 1J5IA 5IZ7A 1NMBH 3LPOA 1SOQA 4ODTL 2E46A 3K8MA 3KLKA 4HUXA 3A0OA 4KO9A 4FKEA 4WV1A 4KNSA 5EEUA 5CU9A 3PHQA 3QAQA 4PRIB 1IFGA 3B2VH 3MOBL 1ES0A 3N1MC 1A4JA 4PY7B 1AD0B 1OAXH 3EJZC 5AUMB 1ZY9A 4X7SL 2IAMC 2ZKYA 5F7LB 2MSPA 3GRWH 1FFNB 1TEFA 2L3BA 3O9WC 4YWGL 1VB9A 4WQOA 3CDZA 3SDCA 2WOBA 1BF8A 4FFTA 4QF1B 4QYOB 1MF2L 3VO0A 3L9YA 4I2XA 3WYRA 4D8OA 2E9JA 1BD2E 3MBXH 4YXLH 3S3DB 3DBXB 3M45A 1R5WB 1ZV9A 4O5LH 4FA6A 4YDJA 1S78C 3LH8A 3JVGA 4GAGL 1IAMA 2EDTA 4KWUA 1E6JH 3SPJA 1KGYE 3DIDA 4H26A 4B60A 4PJEB 5T3XD 4HFWB 5AW6B 1JPFA 3VXUA 3V7AE 1KN4L 2NY6B 2BCMA 3GTNA 5IWLC 4NRYA 2Q8BL 3LKSA 2V2WA 2IV9A 4JZJB 1EZVY 4PW3A 1Q4NX 3BLPX 2VXTL 2N7SA 4QRPB 4A39A 5J6GB 1IGML 4L9LB 4NNYB 1RHHA 5GJSL 1O7DE 5I73B 2BY0A 4D0DA 4BEIA 4MA8L 3VQ2C 3KYNB 3HLKA 2EVHA 5D1XD 3VFVB 3F7LA 4M5ZH 2HKAA 4JL2A 1LD9A 5DFVC 3D4GA 1N7ML 2EDBA 1LO4H 2MOQA 2WTPA 3MRLB 4HUVA 1CTNA 3NZ8B 3BPNB 2A77L 3FB7A 2VC2B 5DZAA 2Q8AL 2HT4D 4NOBA 5GGVH 1K5WA 5EO0B 1SMOA 2EUWA 1EBPA 1JZJA 4NZTH 4Z7WF 5CD5C 1MDTA 4JO1H 3ZIYA 3FCBA 5IQOA 1RV6X 1S5HA 4JG1L 3KM1A 5T1KB 1RP8A 3QJXA 1PD0A 3MYJB 4X6CE 1BQLH 5IJVA 2A9AA 3U6RB 3KLHC 4IDLA 2J55A 4PRAB 4GMSL 1RUMH 3P4MB 3BUBA 3T0WA 3CFMA 3NACL 3C75A 3GBNH 1KEGL 1YQVH 2CO6A 3K1DA 3C60C 2OMYA 1Q1PA 5BJTA 3SDDC 2DWSA 4R4FL 3MODL 1OHZA 4UMGA 1AR2A 1UH2A 4CAGA 2HPOA 1XAKA 3JTTA 5F9WB 3QUXC 4KZDL 3SOTA 1G1CA 4JM2A 4MS8C 2ITCA 2DPKA 1ZT1A 4Z5RB 5IK3A 2CGYA 5I6LA 4FZ8H 5FKPB 3NSJA 4KDTA 1AI1H 3BDYH 3LXAA 3QFJD 2R1YB 4B9FA 4F33A 4WGWB 4G70B 4HUCA 1YUKB 1EHXA 1YNTF 3WIHA 1MHCB 1QR4A 2FIKA 3FQNB 5G4OA 4GSUA 3X3FH 2A6IA 2E56A 3BD5A 2BVEA 4ZTOH 4ELMB 4QJ3B 4IJ3C 5E2TL 5E8EB 1BD2B 1ETZB 3OKEB 2BCKB 1F18A 2WQSA 3FUFA 4I18C 2TSAA 3OMIB 2J88H 5ERWA 4PGCB 1TTCA 3P9WB 4QHMB 3MLRH 1VHPA 2ORBL 4IU2A 5DZVA 3WTTA 1I3GL 4OSUH 2NXZC 1TQBB 2VMEA 3R06A 4X5XA 3QUMB 1RI8A 4MQTB 5GPRA 1OF2A 5AAWA 2HG5B 4L48A 1X4XA 1OPGH 4ZFZB 1FYTA 4MAUH 1KGUA 5E6ZA 2OL3A 4RA0C 1PTZA 2WQVA 3EOTL 2A9CA 4N8VA 4KZDH 2DIAA 1ZS2A 2HJLA 1V7NL 1F4YH 4Y9CA 3D85B 2QR0B 1XF3A 2GC4C 3LTVA 1HN1A 4L0PB 1HQ4A 4RX4D 4F7PB 2EVIA 4IBQA 1QPKA 4AKOA 4HK3J 1ACYL 3O3DA 4JG5A 4W9EC 3ESVF 3G5XB 2WM0A 2IFGA 3FTWA 2CLVA 4IHBA 4OCYH 3MRBA 4OLZL 5JLZA 4LB8A 1X9UA 1H3XA 1PGRB 3CXDH 4Z95H 3VE0A 1Q0EA 2R9HD 4RAUB 2CJUH 3BEVB 5F7WC 4HJSA 2BNRB 3RTQD 5IG7A 3D12B 2LHAA 1G7JB 3THML 3T3MF 4B9GA 3F5WB 2BX5A 3P4NB 4YUEH 3NZSA 3VG0H 4OH2A 3T0EB 4AVJA 3F00A 2Y5QA 3BKCH 4FQCL 1Z0NA 3SQBA 3AXLA 2OR9H 4DT2A 4X7DC 5HDQL 2WLHA 3C60D 1KNOB 3AABA 1BBJB 5EZIL 2FQDA 1ZSDB 1NC2D 3HC0B 3MYZA 3UIYA 2HKHH 5D7JB 2XVLA 2OCJA 3L16A 4ZPTA 3ARRA 1MCPL 1PX4A 4JFPB 4XPAH 4YPGB 1R0AH 2A9NH 1NWOA 5EU6B 4WNQB 3L3DA 2A0LD 2P5WA 1ZV2A 2A74B 1MRFL 1KIUB 4EPSA 5BRZB 1Z66A 4OJDH 3ELAT 1AG6A 4NAMA 2GEEA 3IU4H 5IT2H 2FEEL 5JIQA 3RDTD 5BQ7A 4GS7C 1DN0B 3ZDZB 2H6PB 5I17A 3ARTA 3FCGA 3GLEA 1ID5I 2XCMC 4HIHA 4WGVB 1FFPA 3CU1A 4YBQC 5K9KA 4PVNA 3WFBH 1KWGA 2WTOA 4J1UA 1F2XK 1GZHC 4KHXH 5EA0H 4TTDD 5ENWB 1L7IH 3QVAA 2IH3B 3SPVA 3GO1H 3MFFB 4DO5A 3TGXA 3GLZA 4L29A 1P53A 3TIEA 1A5FL 3NIFB 4HBCH 3RL1B 4JZOA 4L4TA 1FH5H 4XB7A 5CJXC 2G5UA 1WS7A 1BHGA 1GGUA 2R39A 1NGPL 2FHFA 1J5OH 1BAFL 4ODUB 4WI5A 2FJFA 2XNAA 4JQVA 1S7SB 4KJYA 5D7JC 1AGBA 1RIVH 3EO0B 3X1GA 5DJZA 2NW3B 4BFNA 1YJDL 4ZMLA 1OALA 5I71C 3VWJA 4L4VB 5DTFB 4GSDL 5ACMA 3TF7C 2V3FA 4D8PB 1E9OA 1KYAA 4IEFA 2A9BA 3UMNA 3V6BR 4PQXA 2EDLA 4ZAKA 1BYOA 2HRLA 1QUPA 3NA4A 2UY7B 3VH8B 1ZIAA 3L3KB 1U8OB 2YD5A 4HIPA 2BFGA 1BG9A 2WO2B 1EANA 2IG2L 1MNNA 4JO4H 2IV8A 1UZ6E 1PLCA 4LAQH 5BV7C 1FNSL 3GMNB 4NB7A 4UINH 3CFTA 3RWDA 1EMTL 1IM9B 3A23A 1RUPH 3QP3A 4PG2C 3QUML 2EYRA 3H2WA 1T2QL 4I77H 2IIJA 3ME0B 4L3EA 4K7PL 3WN6A 4URKA 2DQJL 5FA4B 5I16A 4PBDA 4HT1H 5ALBL 3PWNB 1M3IA 1GW6A 4G11A 3WAKA 1DEEB 4MNHB 4OF8A 1F4WL 1R46A 1JPTL 2L0DA 3MLZL 1XMEB 3Q2NA 4CVXB 3UTTE 2EP6A 3SCMB 2YD0A 3M07A 5JYMA 4HIEA 3KWVA 3R1GH 1S9KC 3BESR 4JCMA 2ESVE 3WJLA 4ERSH 2ATKB 3BWAB 3HZKB 1JXDA 3VJ6A 4R6UA 4HUUB 4I0PD 2ERJB 5CBAB 4AQ1A 4XN1A 2M8XA 3QR2A 4NJ9L 5INDA 3VGFA 4E2OA 3HS9A 3OXSA 1VAHA 2CCWA 1DUYB 2EKSA 2A7BA 4TUKL 2C9RA 5JIMA 1B0GA 2J57A 2QZ5A 3QUGA 5AYUL 3C09B 4YDKL 4AQOA 4AL8L 2ZG2A 4CJ1A 1MH5B 1V55B 4M8RA 2YGQA 3DHPA 2F6AA 2CRZA 3RPBA 1HSBB 1VA9A 2XPGB 2ICCA 5C0AA 1K5NA 3PWUB 1B4RA 3FTGB 5EFIA 1JI2A 3T3PB 5A2IH 5FO8B 4NFCA 1FA4A 1QVOB 1PD6A 1I3UA 4N4YB 3QNFA 4YDVB 3VXUE 3W2DH 3P9LA 1SRDA 3U9UA 4G8EA 5C0CE 4ZX3A 3KXFB 4FFVD 1OHQA 3IGUA 3WIAA 1SVCP 1C5DA 3T08A 1T21A 1G87A 4NERA 1AY1L 1S7TA 1OGPA 3QEGL 4JFXB 4G6JL 4BWUA 4LL1A 4ODVL 4PLKD 5A40E 2NY7L 4XBGB 3ARSA 3ARDD 1UATA 3GIZH 4PJDE 5GISL 1Q94B 2EACA 5IQ9A 5DXWA 2Y1ZA 3FOLB 2COVD 2UX7A 4R0LC 5DF0A 1YUHA 2APXA 4AG4L 1ZHBA 1U8MA 3MUGA 1QTPA 3P4LA 2XVBA 1IBDA 2D3JA 4E0RA 2PTVA 3CWGA 4LVOC 1K8IB 5DI8B 5HGHA 4OTXL 3GSNA 4Q74A 2UZXB 2WUCH 1JPTH 3S37L 3LHAA 3E9UA 1JZ6A 4OQTH 2Z4QA 3MJ8B 2BVOB 1JGVH 2YQ3A 3GRGA 4JN1L 2OYPA 3SCMC 1OZUA 2WTRB 4MXWL 2WIIA 3BGFB 1I85A 2CPUA 1F3JB 1NICA 2RBLA 2KERA 3HAEB 4I9WE 3A6CH 3VFGH 4C56B 1NDMA 4F15C 2WC7A 5GISH 4TSCH 3WNMA 2DLIA 1UACL 1P5VB 3MRMA 4M8QA 5MENA 1MWAA 3UYRL 2IBGA 2OQJA 4RFNB 3RWGA 1DANT 2MWCA 4KGLA 4NKDA 4OT1L 1TVBA 1ZVYA 4RFEA 4HUWB 1O6TA 1CD1A 4X5WA 1QKZH 2YA2A 4UM9B 4F57H 1YEGH 4TM9A 2DLHA 3IFNH 3NMEA 4FHJA 1JSYA 2OCCB 4QCIB 1HZKA 1RK1B 5IY5B 5FUOH 2LFEA 4MZIA 2CO2A 4QJ4B 3D3VE 4HKBA 2W07A 4PB0L 4GRWB 4RWYH 5IHUL 3IKCB 1F90H 2ZP8A 4FXKB 4PV1C 1QX1A 1G6RL 4IBZA 4C58B 2WQXA 1CL7H 3FQUA 1X9QA 3BIAX 4AL8H 2P49B 4DAGL 2D7QA 1PL3A 3WU1A 3DTDA 4FHBD 1NFIA 1JS4A 1T1XA 2Y6TE 3AC0A 3LSOB 4NKQB 2ZCHL 4OCMC 4XB3A 5C7ZA 3PDGA 3QAZC 3GHPA 5AVXB 2ZSWB 5HJGA 5IEKB 1FH5L 1EDQA 4Q9QL 1GMIA 1WEJH 1E3FA 5F7EH 4GP4B 5AW3B 3ATDA 4UV7H 3BZFA 2QHRH 2X4PA 1JZ8A 2WGNB 4KJWC 1IBYA 4MMYA 3TYFB 1RJLA 2KDYA 4KQ3L 4NZDA 5EBLA 4R4ND 3BE1L 2BFVH 3QJUB 5J13C 5D72H 4U1KA 4YSOA 1W8OA 1NUDA 1BQUA 3L17A 5EIIG 4G6AC 4MQ7A 1DUZB 3JT0A 3PE9A 3SCMD 3T0EE 1MNUH 3ZMRA 4DKDC 4X6DB 3QIWA 1CT8B 3UJTL 5DURB 4MD4B 1RZKC 2WINA 3BIKB 5IW1A 1D5XA 4XAWH 2BJMH 4NKIL 4PRHB 4PJ5E 1EA9C 1DQDL 3VQLA 5GRJL 5LCVA 1RFDL 5I0ZA 2ZCHH 2VDPL 3ECUA 1PS3A 2KPNA 1JFQH 4JREB 4RGND 3TBWB 2OXHB 4ODBD 1AIFB 1LVEA 3I6LE 1T1YB 3V6OC 1UD2A 4L1TA 3PF2A 2IADA 1VKXA 3M46A 1OL0A 4JY6B 2JXMA 3EFDH 4UT9L 4LEXH 1S3KH 5H4ZA 3X12A 3QPQD 1P7HL 3IFNL 2WLJA 3O3AA 1HXYA 2WLLA 4LVEA 3MGTB 3VGHA 2YBRA 1J12A 1X5IA 4ES9A 4ZFOL 4HJEA 3L3OA 3WN5C 2JKTM 1S7UA 3DPDA 3SGEH 1MF2H 2J1YA 4Q52A 2AAVA 4EDXA 4X4MA 5JUEL 4XMTA 1IC5H 1U8JB 3OAYK 2L7QA 4XCFH 2R4SH 3LKNA 4BH8B 4QWWD 1WAAA 3K2UH 4JDEB 3EGSA 4TSCL 4YHNB 1UC6A 4PJXA 3EOBA 3HNSH 4XVJL 1HDMA 5C0IA 1GZPA 4LO9A 3T0ED 3PYCA 1I4FB 1PIFA 1XGUB 3EJYD 3GKZA 2ZKWA 4W68A 3EO1A 1WC7B 1RU9H 3FONB 1M71A 4M6NL 4XBPA 2YAOA 1WZLA 2DYPB 3VNYA 3I6LD 1PBYA 1T04B 4WEMB 3T0AA 3QO0A 1BA9A 2ODHA 4NWUL 2BNQD 2WXJA 4MJIE 1U8IB 3RI5F 3ZKNC 3T65A 2P8LB 3CVBA 5B8CB 1BIIB 3ULSB 4LPVA 3T2LA 3UBXI 1Y1UA 3MA7A 3L9RA 3OPZH 43C9A 2X4RB 4HVBA 3RVTD 1PZ3A 2HVKB 1FPTL 4IMLA 2IWFA 3MRQA 2BXZA 4DEUA 2HSIA 5C0AD 3IRZA 5G5DA 4ZS7L 43CAB 1SHWA 3AG2B 1GCFA 1SLXA 4FERA 3CFUA 3CZLA 4ZTOL 3B8SA 5JHDD 1R3JA 4PJBF 4JFOA 1TZGL 4BSJA 3OR6A 1PQZB 2G60H 3M17B 2W5PA 5BOPA 3TNMB 1HH9A 3Q6GH 1KCVL 1R5IB 5LXVA 2H0FA 3N55A 2BK8A 3IU3A 1FV1A 3P77B 4PLNC 5DJXB 1XIWC 4KQ3H 5IF0B 1KYOJ 3RVWC 5AW1B 1QG3A 2XIDA 2K78A 3FMGH 3HG3A 4Z95L 4OR1A 1B2WH 2BXYA 2ZX9A 3EG9B 1EFXD 1WEJL 3NIDF 4EZLA 1UT9A 1IKNA 1TYRA 3T2PA 5CFHA 3BKJL 1S8DA 4M48H 3O6LL 2OR8A 4HG4K 3K72B 1A6VH 3MRJB 1QR1A 1KPUB 4K8RD 2BVPB 4OB5L 2XKNB 4JAMA 5EPMB 5IOPB 4HW6A 2WWKO 4NC1E 5KSBA 2WLIA 2XBTA 3V52H 2BRRH 2E9IA 3TO4D 2EDRA 4QRPE 4J28A 1CFNB 3CLFH 4AZ8B 4KV5F 5KVFH 4XGZB 1KT2A 5F3HA 2FRGP 5IB1B 1IMHC 5FUOL 1PNDA 2XWTB 3OZLA 3OHMB 4AENA 2XQYA 2VLKD 2KBGA 4L9LC 3FQWA 4UT7L 1H3TA 3U0PA 2O5ZH 4XC1H 1VACB 2BRQA 1TJMA 2R29A 5T3ZD 5I1GL 2H45A 4K8RL 5H94A 2JKLA 2OXGA 3IXTA 3DMMB 4C56E 3N85L 3ZE2F 4YHYC 1RY7B 3E9TA 3ZHLA 4YBQD 1SY6L 3UZEC 4UINL 4XPGH 3EYSL 4EJ1C 2JE8A 4FFYH 3NCJL 2CNZA 4MA8H 4AMWA 4X83A 2D2CC 1RK0A 3GUTB 1JVOA 1UXSA 4R0LA 5FO9A 3K74B 2AKRA 1S9WA 1A3QA 2JCWA 4O2FA 3GMRB 4HK0B 3DARA 4XNQA 4IMKC 4MHHG 4UIKH 5CFAA 1V10A 3LZFL 3UROR 3OPZL 3QJSB 2DM3A 4GLRI 3S8FB 5I5MA 2ZUTA 1M2OA 2YFOA 1UB5A 2FNBA 2FLMA 1NCOA 1YJDH 1KLGA 1EAPA 3EFFA 4UANA 3IRPX 2WSKA 3QDMB 1CF1A 1UFGA 2E9BA 5D70H 3QUXB 4BK4A 2DQFB 3TT1L 1CXEA 4X8JB 1MCJA 4OFVA 1CJYA 3NP3A 4D0BB 5DUBB 3BWSA 3CH1A 3MSPA 3FFCB 2QPSA 2EXWD 1S9XB 2JKSA 1H8SA 2DJMA 4JE0A 4F80A 4Z23A 5DUJA 1YCSA 1EVTC 2DY2A 2NR6C 3T4YA 1WDAA 4B53A 2LVEA 3F7PC 2I26N 4JPSA 4WW1B 4YWGH 4GBXA 2ICEC 5E9DB 4MAYA 5ECGA 1M1XB 4WU5B 3QJHB 3HJEA 3MJ9H 4PGDB 4U6TA 2BMKB 2HMIC 4G7YL 1WIOA 1OAXL 4I85A 1MI5E 3GM8A 4GFXA 4L4TD 2F54B 3N43B 4DERA 3GS0A 3RNKA 5KVGH 2LW3A 5EC1B 2E7LC 4FC3E 4JR9L 5CSZA 2UY6A 2GTWB 3DGGA 4JQIH 4PJ5B 3IDMA 1F97A 2XDHA 4C54A 1SXSA 3VI3F 5BVJA 1YG9A 3BUDA 3C5SB 5CCGE 2ARJA 1ONQA 3C6EA 2W38A 2VR4A 4P5RA 5L88H 1AFVL 5CJOL 3EOAA 1I8IA 4NCC1 4WEBH 4RISH 2VE6B 1MFVA 2AVGA 1KCSL 1IGMH 2CA3A 1BJMA 4ENZA 4POUB 2F54D 4OLEA 5HGBA 2LOEA 3GNML 1IBBA 2Q8BH 5DFWH 4PG2A 4O9HL 2WGXA 3LKPA 2ZWZA 4XAWL 1TTGA 1SF3A 4WEBL 2VL5B 1U3HD 3T0EC 1JMZA 1GS7A 1OP4A 3SDYH 3KYMB 1YMMA 1MFAH 2FGWL 2V5RA 1EXGA 4XPGL 3S3PA 2VDPH 2GTZB 3HZVB 4WI8A 4YHLH 4YK4B 4Z76B 1OCCB 3EYFA 2EO7A 5T1LD 3RDTA 5C09E 1W72A 32C2A 1LEKA 2OTUA 5EUKB 4YC2C 3OKDA 3VD9A 5CEYA 4F7CA 3C9NA 4BGDA 1JNHB 3O6FC 2ZXQA 5KJ4A 4BQCA 3IJSA 3CSYA 5HGAA 3RWIA 1ZKAA 4DN4H 4RZCB 2C9XA 4I77L 4JPWH 4F7EA 2E7CA 4FEMA 5F8RC 2V3EA 3B5TA 2ITDB 4K8RC 4BBWA 1T5KA 3FN0L 4AQ8A 2CDFB 1QTYT 4IIQC 4UYQA 4N5ED 3V0VB 4MDIA 1YA5A 4N1HB 3QE5A 1LM8V 3ZE1B 3B7SA 5KBLA 1WF5A 4EI5B 4L0ZA 4A2FA 5JPMC 4P2RB 4DKFH 4JFDB 3ARZA 4F9PA 4OZGA 3I9GL 4L5FE 5T5FH 5JW3H 2G4GA 5TGBB 4G59C 5TE4H 4U1JA 4UM8A 1SXZA 1UASA 3I2CH 1JDAA 4BUGA 3TIDB 1N5AA 1DJIA 2WHVA 3K91A 3RYMA 1IC7H 3DX2A 3QORD 4MMXA 2YPKA 2X9ZA 4BJLA 3FUIA 5LBVA 2PYEA 4TVSa 3MV7B 1U91B 4V33A 4X4YA 4QXGH 4QDGA 4NQXA 5FCUL 2FQGA 4FCHA 5LBSH 3NCBB 1Z6JT 4XNMB 1LK2B 5HDBE 1USQA 4U0QB 4GO8A 3RI5K 4BQBA 1OAKH 2VDQH 1QKZL 4N90E 4LF3B 1NCNA 4YSCA 4FN0A 4WEUD 1T6WA 3ZSTA 1P6AB 4YVNA 5MEQA 3Q8CA 3A6CL 1RJZA 4XZUB 5FKAB 3H0TB 1NBYA 2WZAA 4G5ZH 1A9BA 3I6GA 2OTPA 2MQ0A 3ZTJH 4EMZA 2YPLB 5AOKA 3BVUA 4PJDB 3LPPA 3SGJC 2ESVD 1HZLA 2Y06L 4G82A 1A6AB 3TTYA 2OMTA 3IYLW 4XC1L 4JDVB 2G3NA 3EYQC 2WXHA 1O6SA 1IEBA 4KROC 3VXOA 3DX7A 1JIBA 3S96A 1Z5LB 1URLA 3SDDB 5KVFL 2CKNA 4J4PD 5D93C 1ACZA 2YARA 4N2NA 1D2OA 1INQB 3AM8C 5DHMC 2IH9A 4PJFA 1OD7A 4X4KA 4Y2LA 3KLAA 5CLZA 3QK0A 3COOA 4XO9A 4ODVH 3ARFC 5FHAH 2WP3T 5I6MA 4PR5B 5DRWA 4M3HA 2APFA 1SJXA 3NACH 3VFUA 4OF7A 3H3KA 1LO5A 1KPVA 4ABWA 2HLAA 1VGEH 1QFWI 3FF7A 1B0IA 4H0HB 3FCSB 3ZXAC 4B3VA 4M6OH 2YKLH 3CN0A 1NAMH 1J05A 2BSCA 4DGVL 2MHAA 1I1AD 4XI5C 4XP1L 4Y4HD 4OGAD 2IXQB 4J3SA 3L6FB 2ROYA 3T8VA 2JB5H 4PG9B 1QEWA 4APQC 3BP6A 4ZD3L 3W39A 5IESL 3OHXA 1RK7A 4HX1A 4OCSL 1ROCA 1HKFA 3OZ9H 1QUNB 5TH2A 5CBEB 2FJGA 2A9MH 4KJPC 5GGRB 1FC1A 3MQIA 2K45A 2F7OA 4ALAC 1DVYA 5I8OH 2FIRT 4WI0A 4M3JA 5F2FA 3NJHA 1FNEA 3GSOB 3TNNB 1XF4B 5DJ6B 2I7OA 1A9VA 3VXPB 1HK6A 1KFGA 3E2HC 1NIBA 1HOCB 2YXWA 3RUGB 4GUCA 1BQHB 1E5ZA 3NFNB 5BUGA 1JHKH 5D8JL 2VZ3A 5F7UA 1E0OB 1YEFH 3AGWA 2XACC 4A66A 4U6YA 5GRUH 2KZ1B 5DJDA 5GRVK 1O6VA 4L8DB 3O9WB 1QPXA 1KJ2B 1SF5A 5KSUB 4Y88A 2BHZA 2GVYA 5HYIA 5GGTA 1I1AB 3FH8A 1B3JA 5F7EL 5BZZA 1GPOH 2ZWYA 4MS6A 4ZSOB 3LEYL 3II2A 3V4VL 1G7HA 2VR6A 4M61B 4W9GC 4Z7QE 2P5WE 3M7OA 1QRNA 4XCFL 5HDOA 1FZKA 2J1WA 5D2NB 3FU8A 1G4RA 4M3KB 3UBHA 5AAPA 4S0HA 4AGOA 2R0KH 3UC0L 2IG2H 1ED3A 1QFUH 1A3RH 2HYMA 1QEXA 1W0VA 2GSGA 3X14A 3QORA 1TSRA 1F6LL 4UM9D 1JN6A 3TM6A 2DLTA 1LWJA 1TSHA 4NFDA 3FQ1A 1IC7L 4PHZA 2LLNA 4OF6A 3T6WA 3RGBA 1X7QB 3HUJF 2K4WA 4GSXA 1FG2A 1QQDA 1FCGA 1JWUB 5BNXD 5HJBA 1S3KL 1MAKA 4HHAB 3UTPE 1MZZA 3K5SA 3D0LB 3FN9A 1DFBH 2AJ3B 3QI9B 4LIQL 4Q2ZA 5I1CL 4WSJA 5D1XA 4PD4K 1L0QA 3T09A 1XCQB 1E2VA 3PIQA 4XWOC 4DKFL 3WDHA 3NCYS 2FT6A 2O5YL 4U1NA 4X6CA 4RMRA 5HI5C 5AVQB 3GBLA 2X0UA 4YNYA 3MLUH 5DRZA 3SJVA 1FUNA 3B2MA 1ORQA 1QSEB 4PS8A 5E5MA 4WW2F 4S1DD 3VDCA 5HJDA 3KPOA 3DMMD 1GIGH 1FORL 2Z8WC 1LE5B 1P7QD 4I0PC 3FU3A 4EN2A 5C0BA 5DQ9B 1I8LA 3WFBL 3ULUC 5D4QA 3DROB 4Z7UB 1CUOA 5DS1A 3W82A 1A7OL 3O45A 4A55A 2VITB 4UILL 5FFGA 1TTAA 1JZIA 3DKHA 5FA3B 3PREA 5GGVL 3AU0A 2SODB 1KJVA 1U3JA 4KDVA 1JZ2A 2HFGH 5FAAA 3MLTB 3IVKB 4OQTA 3FU7A 2XWDA 3FYIB 4PP1D 3H9SB 2PABA 3LEVH 4J3VA 5B1AB 2VAAB 2DW5A 4JZNA 3QFDB 4QRQB 2ITFA 3VH8G 1BG1A 5T3XE 5F9DC 3VD7A 3O81A 1V27A 1PZCA 2QPDB 3E7JA 1FFQA 5F89A 3DV6A 5HTSA 4Z7OF 4GW1A 4IOIB 2I7SA 2CDEA 1RUKH 3RIFK 4DP5X 4PVBA 3LPFA 2MPVA 4LNRA 4WGKA 3QT2A 1HTYA 4LLMA 4WJG3 4WJ5A 1OCRB 2JCCE 3BH8A 1DQVA 4G6JH 2ZONA 1MCPH 4F7KA 1YNLL 1WBXB 4C55A 3FAXA 2C5DC 2X44D 2A9ML 4XMPH 4HXBL 2ZG3A 1QD0A 1A6TA 4Y5XA 4EI5D 5FF6A 5LXGL 2XWEA 4C56D 4YDLB 2VXQL 3D0AA 1VGKA 2CLRA 3PXHA 5F7MC 4I0KA 3OMNB 1HKLL 4MAYD 25C8L 5C71A 4Z18A 4WV1C 1T4KA 4PRDA 1IL1A 1FYTE 3II3A 5GS0C 5I0WA 3PV6B 2Z31B 2ZT9C 2OK0L 3Q6FA 4OY9A 2WN3A 4OI7A 2UWEF 5D7LB 3HCVA 1SMDA 2JH2A 2VAJA 4DF9A 5IFJB 1CWVA 2X42A 1XGQA 2GSIA 1IBFA 1YN7B 2IQAA 3D52A 5EUOA 3G5ZA 3G6JB 4ZXBA 1NDGB 4HDIB 2DYRB 4FA8A 2OMXB 4RDQF 4HBQA 4B3EA 1IRAY 4QUOA 3DYMA 1RZJH 5J3HC 2RAMA 3ORJA 2EIMB 4A7UA 2N4IA 3MGOA 2XV2A 1G0DA 3MRCB 3U36B 1F4YL 3EW3B 2DD8H 5TFSL 2QGEA 3CHRA 4A63A 1INEH 1H6TA 3EOTH 1K8DA 4EUPB 1Z9SB 1GC1H 1ZT7B 1OCZB 4UIKL 5JXED 4X80H 1E3XA 1C8QA 4JX0A 4CUCA 2EE9A 3BPCB 4HH9A 4R3SA 3TP4A 3TTSA 4Y5YB 2XZQH 1G7IB 5I1AB 5I5RA 2FYYA 2WMPB 3DXAB 3RVXD 1RIHH 3WUWA 1MFEH 1PY0A 3NZUA 4B7LA 4LP8A 1Q9OB 2WYZA 3CU7A 3VQ1C 5E2TH 4WW2B 1I3GH 4OSUL 5ID0A 5SWSA 2VC2L 2X4OA 2FWOA 4FMVA 1WFMA 4IGBD 1MEXH 3CLEH 2Y2TA 2GG1A 1YN6B 4AVHA 1UUSA 2CK2A 4BDVA 4E42A 4E9WA 1BM3H 4EUPG 4MMZA 3L3HA 3IN0A 5M95B 2XN1A 4DN3L 4MD5B 5E0FA 2ALAA 4HUKB 1N2RA 3SE8L 4L3EE 4Z3IA 4DGYH 5IFAH 3MACL 1S7XB 4LESA 4TXVB 2VRAA 2VLRB 3PHOA 2W60B 2EUZA 2IANB 3FFOA 4X6DF 4Q9RL 1W6WA 5GSVA 3CFCL 3D39D 3BZ4A 3GC3A 3CJJA 5FWRA 4K3JL 3H9HA 3V52L 4CGTA 4ONOA 3P9MB 2IDTA 5IB2A 3RTQB 2XTSA 1KCKA 4OBRA 4R4FH 1CYWA 4EVNA 1L7TL 1Y18A 2X4NB 1UCBH 4R96B 5C09A 4AEIH 1Q9WB 4HEPG 1B0RB 3CZJA 4RSYA 2BY3A 2YRZA 1E5CA 3SSGA 4PREB 3QAZB 4L37B 2X1WL 3HB3C 1R3KB 3N1FC 4LCWB 4Y9GA 5B39B 5GS0H 3BZEA 4NJAH 3VD0A 2ZUSA 5IHBA 2FJSA 2C34A 3IFOA 4HEME 3ZSSA 3ZE2E 1A6ZA 1MI5B 1SHSA 1NKGA 1P1ZA 3GFUA 4HJGA 1H15B 4GW5A 3LN5A 1VCBC 4TNFA 1OGTB 5TF1H 4AWJC 4I0PA 4H44C 1MJ7L 1SXCA 1CN4A 1YEIL 3MLVL 1JPGA 4LLWA 4TUOA 1S4IA 1X6LA 3WUWG 1MFAL 2FGWH 4IS6A 2NY0B 2FX8L 3TBTA 4MJID 2CLZB 3WKYA 3KCWA 3L9EA 5DJCA 3QYNA 4J6IA 3KW7A 3VXRB 3VXQA 1WSST 3VI4B 2EEBA 3SDAB 1QI5A 3QQ3A 5EOCL 4H8QA 3DURA 2FZ3A 1OANA 2PP8A 2W91A 3QEQA 4RFNC 4AYFB 5HDQH 3VWKA 4KZEH 2QKIA 3KCPB 2E27H 3ZHKA 2YHGA 4Z7NF 5I1DB 2EDXA 3GMQA 4TQPA 3HB3D 1M2VB 4JFHE 4YUEL 1AGFA 5CINL 1NGYB 4A2HA 4AUYA 3DUSA 1J1OL 1WLHA 2XICA 3RIAF 2VUKA 3QPQC 4G8IB 4TNVF 3QORC 5T1KD 5C9KA 5FHBH 3VB9A 1TOXA 3I6KB 5EG6C 3L81A 4LSPH 4E9QA 1NOLA 5CLXA 2WBKA 1MIML 1XCXA 3N1GC 4QNPE 2R69A 5C0CD 3HNSL 3GMPA 3HNTH 7FABH 4KAQL 2F74B 2WWNA 1WCBA 3R0MA 5F7YC 3I9PA 2VJ0A 4WI2A 3W81A 3ZE0F 3HZMA 1E28B 4KKCC 4NI3A 2BP0B 2MOGA 1FFOA 4XO8A 1NC4B 2H8PA 1L7IL 4WWID 3T8XA 2NY4B 2LU4A 2QTEA 3KPMB 5A2JH 3SZ6A 5I5IA 4LRIC 2XY2A 1HQRA 2C9SA 3AUVA 1E6OH 4RGNE 4BKLB 2Y07H 4NQSA 4LEEA 2FT8A 3MJ7B 2CM6A 3QZWG 3VXTB 3GI8H 2VZ1A 4PWGA 2ZJSL 4K9JA 2NTFA 1QLRA 3O2DL 4GQ9L 15C8H 4TLUA 2R2BB 4X9IA 4P2QA 3V4PA 2DWTA 5ADPH 1Q0YH 2A6JB 1Q9KB 1BQ5A 4QRUB 2EE3A 3QXAA 5ETUA 1KENH 5FGCE 1C5CH 3BKML 4R83A 3ABKB 3S37X 2V17L 4AQEA 3VGAC 2QGDA 4M1DH 3HLAA 4FYRA 2XZQL 3PQYB 1UEMA 2J8UB 4Z7NB 4ODWB 5K9JH 2BINA 5JQIB 4BH7A 5DVKA 3FT2B 3MRNB 4LLUA 4I1NB 3O0RH 1INEL 4L1SA 5L8LB 3OGOE 2H4EA 3GJEA 4DKAA 1N6QH 3ILEA 2W95A 4ZUUA 4CC4A 2OL3H 1BVOA 2DD8L 3WEMA 5CHNB 5CUSL 9PCYA 1BLIA 3O6MH 5E1AB 5HJ3A 3O0LA 3TA3B 5JZ7D 2UVEA 1PIGA 4PRHE 4J39A 3JWOL 3RAJL 2YA1A 4H0GA 1YEEL 2D8KA 4GI9A 4TVUA 1CFVH 2QSTA 4LEBA 3SN6N 1I75A 2NNCA 3GBNL 5IVZB 4Y4KC 3MRRB 5D96C 3LAFA 3RHWF 4K55A 3ZYIA 3C5JA 4HKJB 4XP4H 3AU1A 5IB3B 4LSQH 5IEHB 3O3BB 1XGTA 2DWDA 1UWEH 2CUMA 4QRRB 5BQDA 5CSBA 3ATFA 4P23C 1MRDH 1GXEA 3B43A 3VW3L 5ABDE 3WIFB 2YRLA 1FNFA 3DK2A 1KIRA 5CIPB 2AI0L 3CMOL 2J6EL 4WWNA 5DEFA 3SGJA 3ZBMA 5DO2D 2ZD0A 2Q9OA 1SJHB 3BW9A 3RGHA 2AEWA 3FB5B 5BRPA 3H7BA 1KTDA 5TK2A 4POZC 5K1NA 3LN4B 1SDDB 1OSPL 1U4FA 3UAJC 3U25A 3B9KB 3KPPB 3BFOA 4FNLL 4CN4A 3CVHB 4UNIA 4B9PA 2PN5A 4KTEH 3VRJA 5TE7L 1XCTA 3Q7JA 4JN1H 2BZ7A 3B37A 3NRPA 5B39G 5LDSA 4RGOL 4E41A 3S3CB 5MERA 3FHQA 5GQBA 1S9VB 1U93A 1VFAB 2EADA 4PJXF 3BT2H 2DLEA 3RWJB 4NQEE 5L2KA 3NG5A 3EGDA 3K5RA 5CZVL 5D55A 5I74B 4WKZA 5DD6B 4GNKB 1WZ1L 3B3IA 1IAKB 5SWZA 1HHJA 2V9QA 1JV5B 4LOFA 3ESMA 5H2BA 4YN3A 3RY4A 4BXVA 3L1EA 1SJEA 3P3RA 4B95C 5I19H 2JQAA 3RNQB 2B5IB 1RQ5A 3NJVA 1FE8H 2G9HB 1AY1H 4I7ZC 2OX5A 4G7QB 4GRMA 1W9XA 1L6PA 1IX2A 5KYUA 1VRSA 2D0FA 1UH4A 5KYWA 3F7YB 3VGDA 4EOWL 4LKCB 5JR1H 4NN7C 5FK9B 2EO1A 4BINA 3MU3A 1DSFL 3IFLH 1QTSA 2C1OB 4JVWA 5DHVB 5DVLA 2BDNL 2B7DT 3O6FA 3O4OC 3HS0C 2A6DB 4YDNA 4FQ1L 1VERA 5DUML 2VABA 1K2DA 4UF7C 5DGRA 3IDXH 3VFNA 5T3ZH 3GS4A 2AQQA 3KG5A 3BVWA 3GJFA 4Z8FH 2VR5A 5KYYA 3U79A 3AG4B 2R0KL 4HV8A 1ORSA 4WI4A 4Y4FB 5A7BA 2HT3C 3BQUA 4MJ6B 2NY4C 3OJDA 2EDQA 4WTXA 4X7EC 5F9AC 4I87A 4M62H 4PJGE 3FJTA 5I5JA 3R1GL 4GUOA 1NBVL 1UZ8B 4DVRL 1CBVH 5E00A 4OGYH 1MAML 3C5ZA 4XN9A 4W9DC 1MFCH 4GW4B 2OMVA 3NOIA 4HJ1A 2B77A 2CKBA 3HR5A 2F5AH 3UG4A 1LP9B 3UGXA 2CO7A 1CGTA 4X6BA 5B21A 4F24A 3B8YA 4GUPB 1F11A 1RH8A 3CMGA 2V7NB 4W9IC 2B0SL 3W38A 4K23H 1DVFA 1E2WA 2GJ6B 1A4CA 1O0VA 2C9PA 3AADB 4RQQB 4AC2A 2F5AL 3OLIA 3MXVL 1SBSL 2ZX6A 3RY6C 1TJIL 4HOXA 2EYTA 4MAYC 2XSKA 4JHZA 4OLVL 5IGXL 1A7BA 1LJMA 1SUHA 4NZJA 2HFEB 5EOCJ 3UGEA 4YZFE 5C8JA 1A7RH 4PRIA 4MB1A 1YDPB 4F27A 4AXWB 4Z77A 1J88A 1FP5A 2XOTA 2DQCH 1UA6L 1NFKA 4YHZH 2LVCA 3P0VH 4HF5H 1WT5C 1ZLWK 5J6HB 2EVGA 1TT6A 1FFNA 2WZ5A 3MV9A 3QIUD 4LLQB 4PRPB 1SVBA 4DGIH 4JGUA 4DW2H 3DETD 5E51A 3CDZB 3HHRB 5HSFA 2BP8A 5IVXA 4MLSA 4FQXA 5I0YA 3U7YL 1E8WA 4HCIA 2PLTA 4XN4A 2I60L 2ZOLA 3O8XD 2EE2A 4M8UA 1IQWL 4TUUA 4OUUB 1EJ6A 2YD8A 3BHBB 1COBA 3U0WH 5J11B 3OWRA 2V3DA 4M5YL 2FB4H 4J2XA 1I3RA 5EIIB 1JXKA 2JI3A 3FT4A 3CLWA 4HAKA 1G4MA 4MNQE 1AQMA 4F1SA 5HGDA 3KDPB 3NZHH 3ZPDA 1FVCA 1LO2L 1OAQL 4WU7B 5IJKC 3LX9A 2AJSL 4OD3H 3VXUB 4LSTL 5ANME 2E4FA 5BUAA 3GSQA 2R1WA 4QRPA 3RLSA 2PWGA 4NCDA 4UQCA 5J6GA 1DVUA 4L9LA 4P05A 4IGBB 3FK3A 1YECH 5GRVL 2ZWSA 4D0DB 1BQKA 3KYNA 3UO1L 4HIXH 1A6PA 1F4XL 2M1KA 5BS0B 2D9CA 4UZGA 4PGBB 3K6SB 3FPYA 2ZF9A 3PWVA 3QRBA 3NZ8A 1R3LB 3FB7B 4UQDA 3IDGB 3IDJB 1ZHKA 4PV9A 2YEZB 1MXDA 5HP5A 4NM8L 2BP3A 4L8CB 3QZMA 5KANG 5CGYD 5I28A 1MPAH 5T1KA 2WLYA 3GIZL 3IKKA 2R0LH 3TZVB 2Z92B 3W0WE 2ZAHA 4ZG1A 3QUYC 4ELME 2VLJB 2BHUA 2ZXGA 4HJJL 1BFOA 1KV7A 5I15H 3P4MA 5JDSB 3KBEA 4OIIL 5B22A 1J8RA 4U7KA 4ZFGL 5JO5B 1F4AA 2P42B 3B2XA 2CMRH 5J12B 4PM1A 2CKBL 3Q2WA 4JFZH 3RX7A 4A7SA 3V6FB 1TPXB 3W57A 1KPRA 4RRPA 5DZPA 4N2LA 4K7FA 3JTTB 4ZW6A 2V0AA 5SV3A 2DQEH 3MZTA 1VDGA 2H3KA 2Z4TA 1BQHG 2ZUQB 4JM2B 4XMLH 4ETQB 2DQCL 2TSBA 4Z5RA 4LU5H 3WS3B 4OU3A 4LFHD 5FKPA 3A4AA 5CP3A 4AW7A 2D2OA 4LASL 1B88A 3F6JA 4U6VH 4XCYB 2ZKMX 3FRUA 2J1XA 2IAAC 3TN0B 1MHCA 2RGSA 1KELH 4N0CD 5TDOB 4P9HC 1U92B 2HVJB 2P5EA 3LH2L 3DTUB 1IGFH 2E7HA 3D69A 3UPRA 4V2BA 1UJ3A 3U1QA 3UG3A 4ELMA 1RP9A 5EWIH 4B9YA 5HHQB 3UX9B 2BSSB 2W1NA 5ERWB 1FC2D 4LSRH 4PGCA 2FH8A 1REIA 3GBDA 4S1SL 4ZUTA 4QHMA 4RNRA 3SZKC 3MUZ1 1MAJA 4XNBA 1XCWA 1BGXH 1C08B 3EDDA 4OGXH 3MNDA 3QUMA 4QJ5B 1AYOA 1N12A 1LTXA 4GAJL 4WFGE 1SEQH 2W65A 1EEUA 1AOHA 3W1ZA 1YYCA 3AT9A 3PJLA 4ZFZA 1QW8A 3OKLA 3NIFE 4M62L 3CBJB 5F1IB 2YZ1A 1BAWA 1FNSH 3HKFA 3QNZB 1BZOA 2FE0A 3CDCA 4X6EA 3AREA 2G2PA 1Z1WA 5E4EC 3SYPA 5EBMA 1CD8A 1D5BA 2H2SC 2QR0A 4Z7UE 4FQJH 4ZTPL 3U30B 1WGVA 2FECI 1J1PL 3RZCB 1HQ4B 4BELD 3IEAA 2HZHA 4F7PA 4MCZA 1QNZL 1C16B 3O6FD 1EERB 4LHJB 2AV7B 1PDKA 2O6DA 3IDYC 5IR1B 1CXFA 3NABL 3HE6B 2CLVB 3ILDA 2X4TB 3VXMD 2XKUA 4XO4A 3MRBB 1E4KC 2NR6D 1KIPB 4WI6A 4AK2A 2H47C 3GWJA 4RAUA 1X5FA 4GKOA 5LWYL 4CU6A 2ZYRA 3BEVA 1DJYA 1J0IA 3MX0A 3LVEA 1DBML 3VB8A 2Q86B 1X4YA 4I4WA 5DJ0A 5ID1A 3U2JA 3MCKA 4QLWA 3P4NA 1RUML 1CDCA 3F64A 3G5VB 5BO0D 3OKNB 3T0EA 1DYZA 4OCWL 1J0YA 1PZDA 3HAEH 2MCG1 1SYVB 4TVPH 5TD4A 3F2LA 2EDFA 4HBCL 4OZHA 3SDXF 1B6DA 4KAQH 3ULVH 1ZGLP 1YC8A 2D03H 3QIWC 4KXZH 2AJZB 1PYWB 4BSVB 4ODHL 1CQYA 2YAHA 3CHSA 4Y2NA 2ZE0A 4X4ZA 3RFZB 2K7PA 3NPSB 3P4OB 4IDJL 4PLOB 1MCWM 5D70L 3TT3H 1N4XL 4YPGA 3AQXA 2VQ4A 4TQHA 4W9JC 4V11A 5EU6A 2ZCZA 3VWJD 2P5WB 1MW0A 4FHKA 1LO4L 3DVFA 4LDCA 4WO4B 1D5MB 1NIFA 2AGJH 1NEUA 2WVVA 2WNXA 3DSNA 5BQ7B 2E7LA 4YHIB 1FNGB 4TVPE 5HHXL 5I17B 4GAYA 4ZMNA 4YMPA 3P0YL 3PHAA 1YVLA 4HIHB 3RB7A 1EK3A 2R69L 3A21A 3G6JF 5JOPD 5K9KB 5B3JE 2VDOL 3ZDXF 5IMOA 1Q9LA 3RB5A 5ENWA 3KH3A 4BSWB 5DQJA 2PNDA 4JCLA 1BEYH 2IH3A 3HN5A 3OAYH 3OB8A 3RG1C 2YUXA 3HMXH 3LMJH 3W5NA 2YC1B 2HKHL 1GR7A 1YRKA 3C2AL 4Y9BA 4BUQA 4PJ8D 5H37A 5C6PB 4JKNA 5E70A 4JZOB 4GXVH 2H1XA 4L4TB 3ET9F 4KTYA 1XTMA 2BY1A 2AZUA 4PD4J 2EJ1A 4Y4KD 4DVBB 2VIRB 5FC9A 1BIHA 4NGHH 1NGXA 3S5LA 2FJFB 3BP5A 1T03L 2UVFA 4O02H 1AGBB 3QISA 5DJZB 4GH7B 3B7TA 3EDJA 3VWJB 2NZ1A 1N8ZA 3N91A 1YEEH 2F61A 3V4PL 4BIKA 1QFWM 4H88H 4L4VA 1ZJAA 4TRPH 1CD0A 2QEJA 3RAJH 3WFDH 1D5RA 1GYUA 4S1QL 3RVWD 3KPSE 2MPAL 3FSVA 3O6ML 1UOWA 4JPQA 1HHIA 3VH8A 2C8NA 5E5UB 3NFSH 4CKQA 3P54A 1HL8A 4N8CL 3V55A 3RPIA 1LEGA 3IF1A 1QLEL 3G6DH 4Y16D 1C7SA 2IANE 4FLSA 3RWDB 1D7DA 2ZOUA 1YY9D 4R4BA 4U1GB 4JDZB 4PJBB 2OMZA 1UZ6F 4F8QA 3I50H 5KSAC 2KKQA 2YOCA 4JJHA 4UUJB 1RPQA 1FZOA 3WEXA 5EZLA 4JRYA 3AS0A 3FN3A 5FA4A 4P59L 3APNA 4R9HA 5FYKL 1TF4A 3UO8B 1BPVA 1FFTB 2HT4C 5KS9E 1DEEA 4XBEL 4QEGA 4ZS7H 4JFFD 3C8KA 4CVXA 1TETL 3IE9A 4IRZL 3QWRD 3FO9A 2Q1EA 2YXFA 5DHYB 5MHSE 4M9PA 3QIWD 4ES8A 2P24B 1GGBH 1TU2A 4PB9H 3WIIH 1XAUA 1PKQE 1NCWH 4JY5L 4JQIA 2OI9C 12E8L 4OZFH 5G55A 4OLWH 2ZJSH 4MKMA 3K7UA 4PJIF 5BMFH 2DQDL 2EIKB 5AW8B 2YD4A 2WBJC 3MJGX 1DUYA 2EKSB 2AV1A 3HC4H 3TV3H 4BK8A 5IW3A 5I1LA 1QP1A 5HHMD 1DL7L 4XNZB 5C08D 3S88L 1XR8A 3DJZA 3ZKSD 4U3SA 5BS0E 4O02A 1NBQA 2YAPA 1S7QB 4K2UH 1SOSA 4KKNA 2ADGB 1RU9L 1BREA 2PUQT 2XPGA 4AYMC 4KXZI 2MFNA 3FTGA 4RMWA 4JUSA 5EFIB 5FO8A 1QVOA 4BE5A 1JD9A 3B6SA 2MNUA 2RH0A 5EV7A 3DX6B 3A6OA 3GRWA 5CR1A 1UT2A 4LCVA