2JQMA

Yellow fever envelope protein domain iii nmr structure (s288-k398)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
112
structure length
112
Chain Sequence
b'MSALTLKGTSYKMCTDKMSFVKNPTDTGHGTVVMQVKVPKGAPCKIPVIVADDLTAAINKGILVTVNPIASTNDDEVLIEVNPPFGDSYIIVGTGDSRLTYQWHKEGSSIGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Envelope protein E
publication title Structure of yellow fever virus envelope protein domain III.
pubmed doi rcsb
source organism Yellow fever virus
molecule tags Transferase
total genus 30
structure length 112
sequence length 112
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2007-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2jqmA00
5KVDE 5LBSA 5JHMA 4ALAC 5GZNA 2ALAA 1OK8A 3J2PA 3WE1A 4BZ2A 1PJWA 1UZGA 2GG1A 3UZVA 3N41F 2JQMA 2R69A 4FG0A 3UAJA 2HG0A 3C5XA 3N43F 2JSFA 3IRCA 3UZQB 1TG8A 1Z66A 4FFYA 1SVBA 4X42A 3G7TA 5JHLA 4UT6A 4L5FE 5KVFE 3N42F 3UYPB 1URZA 4UT9A 4UTBA 1Z3RA 3MUUA 3VTTA 4AL8C 2JV6A 5KVEE 2R29A 5AAWC 5GZOA 3C6EA 3P54A 2H0PA 5LBVA 1ZTXE 1OKEA 1OANA 2V33A 2P5PA 5H37A 5AAMC 4AM0Q 3N44F 4UTCA 4BZ1A 2I69A 5IZ7A 3J27A 3N40F 5IREA 4FFZA 5KVGE 5LCVA 1RERA 3UZEC 1S6NA 4GSXA 4GT0A 4UTAA 5B1CA
chains in the Genus database with same CATH superfamily
4K3JL 7TAAA 1JWSB 2HJKB 3TWYA 2J44A 4OBRA 3PDDA 3GXTA 2QHRL 5J6HB 3MRHA 4M7LL 4R90H 3V2AR 2H32A 5EU7E 3HE7D 3KPSD 1KXTB 3KGUA 2VQTA 1DVXA 2WQSA 4RGMB 1YEGH 3P9LB 3VGEA 4OZHF 5D93B 4Z7NE 5FLVA 3MV8B 4NT6B 4UQEA 4LZKA 1A9EB 1WWCA 4OFQA 1U8OA 3HN3A 1EHKB 4FKHA 1CDYA 1FBIH 1G7IB 3W5MA 3B7TA 4UDTB 3V6BR 4AUYA 1XIWD 2WXMA 1YDPB 4C56E 3HG5A 2FX9L 3L3OC 4X4XA 3EGDA 5CP7B 5JHLH 5IT2H 3UTSE 1RLBA 2A0LD 3CZFA 3QFJE 3JUZA 5IB4A 3LQAL 1MKFA 3VFTB 4JM0A 3NRFA 3FTUA 2VB5A 1Q9WB 2BY0A 4XO3A 5FK9A 2I7OA 4Y5VA 4UT9H 2C9RA 4KNUA 5EBMB 4K9EL 43CAB 2QSVA 2DV6A 4JKLA 5EPMB 1TEFA 1NPNA 5EIIB 3VYNA 3T6VA 2C9UA 2KERA 4KRLB 2WUBH 3HR5A 2XI9A 4N9OB 1PZDA 5DD3H 4TXVB 4H8WL 3X12B 3DVNB 4PI2A 1I8LA 2BHYA 4OCWL 2YQ2A 3C09B 3Q1SH 2XN9D 1RAMA 1S7UA 3CPLB 2IQ9H 2H1PL 5DJAA 3INOA 5CR1A 5HY9B 5E4AA 1P4BH 2P8MA 4NKMB 2JI1A 1WDAA 5DJCB 1U8MA 4PVNA 1U8QA 3QWOA 3GXPA 2NUPA 3WEMA 3SDAB 3D85A 3C60C 2WIMA 3TZVB 1ADQH 2VLLA 2XZAH 2Y1YA 3P2DA 1UWEL 1MCWM 1UH2A 4EIUA 4ZMZA 3PREA 4HF5L 4WUKL 5DRZA 4IRSD 3K6SB 3L08A 1J9TA 1D6EA 3DPDA 3GZKA 3EDKA 1FYTB 3IKKA 3KWWA 4MAYB 3MRCA 2DQFB 5CLYA 4LGPB 5IJKA 4WU7B 3VD9A 4QIRA 2J3SA 3TBSA 2VL5A 3WTYA 2V6HA 4HZ1A 4YHKH 2AJZB 1ZT7B 1UUNA 2VR7A 1HH6B 4QHPA 4P4RA 2CDGB 3P11H 4P5TD 1RIHL 2HMIC 5EDXA 1UWGL 2BZCA 4JMNA 3ESNA 1HH9B 2JF1A 1S7SB 1XEDA 2Y6SC 1S7RB 3MBWA 1FO0A 5HPOA 1DBMH 2WYTA 3FT3A 1P6WA 4JRWA 4IMKA 4KDTA 5DMGC 5HD8C 2NY1C 3P1VA 3LOWA 3QSKB 4OFKA 4EN2A 4N0CC 1IQDB 4M7KL 2P5WE 5JPNC 5J56B 1IB5A 2F5AL 3VTAA 4LDCA 3M7FB 4QNPE 5HDRA 4ABQA 3HG0A 2Q3ZA 4Y4KD 2DQJH 4HALA 1UB6A 3QXVA 3D4YA 3RKDC 3B2VL 5TK4A 4CKVX 1P5VA 5JDSA 4QRUB 2K70A 3MRKB 1QFWI 3MRMA 5IMMA 4Z7NB 3L95B 1J1OL 4HOZA 2Y0SA 4ZTEA 4K94C 2RALA 2XKSA 3MLSL 2Y2YA 4XOAA 3RPBA 3DSNB 4Z5RB 2IQAB 3OZ9H 4C56B 1HI6B 3CDGA 1TKWB 5T5FH 8FABB 4P3DA 3UTSB 2DMHA 5LBSL 1MW3A 2Q9OA 3QFJB 5L6YL 4MXWL 1Q0YH 3QJFB 2ICWI 4RAHA 2XZCL 2DMCA 3TWCL 1P9MA 3QJSB 4U6VL 4NM8L 1MFMA 4HUUA 4FYQA 1YQVH 3BYYA 4QHUA 1FSKC 4MQ7A 5F3BA 3L5IA 5IK3B 5J3HD 3KNBA 5FUOL 2WK2A 3N1PC 5EB9A 2SEBB 2QGEA 1XTLA 2WJ7A 1TETL 3QZWA 4MCMA 1D7CA 1FFNB 2XQYK 4E36A 1DVQA 2WC7A 4DK6A 2K3TA 4N90D 3LXBA 3KXFB 5I0DA 3RZCC 5F0LB 3BIBX 2XETA 1GJUA 2CIKB 1WBZA 2Z6FA 3QUMH 1MIML 4FFVC 5E08H 1MDTA 2X4OB 3VXPA 4XN9A 3RG1C 3OKLB 2GFBA 3HPJA 3JWDL 5CJQL 1UASA 1HCVA 3ALXA 4ISVA 3T8XA 2EUZA 2FJHB 1HSBB 3WUZA 5DVNA 4UU9B 3G5VB 5EBWB 3P54A 2ITDB 2XC8A 2DF3A 2CXKA 5ALCL 4TRPL 4YHPA 1SJVA 1K3IA 2PWGA 3Q8BA 4KV5E 1G9MC 3D1MC 5FDWB 5B38A 1K5WA 2AJXH 5BZDB 5DUPL 2ROYA 1SFDA 3MROB 1NPJA 1SF5A 4X6DF 2F15A 3Q2VA 4LSSL 1NMAH 3QZPA 4UMSA 3B37A 3F7PC 2G75A 4UWQB 3RGVB 2M1KA 1MAJA 3T3PE 2IALB 3BLPX 3FQYA 1RIVL 2XG5A 3U9WA 2VN5A 4UTAA 1VADB 5F3FA 4ATTA 4OU3A 3QIBB 1R5WB 4IOIA 4LK4A 1YC7A 4XN2A 5IEKA 3C5ZC 4NUGL 1P7HL 2NY0B 4HWBH 4HFUL 4P46B 5JIHA 2YPLA 1U3HB 4LCWA 4Z7IA 1Y0LB 4XHJD 3SOBH 4XXDB 2QMJA 5IQOA 3VFOB 2ZPKL 2D7OA 3FO0H 1L0PA 2JKSA 2UZYB 4P2RD 2QLYA 3RI5F 6PAZA 3VGFA 1IM9B 4WI3A 1IM3D 1MFVA 3DXAD 1LTXA 2CKBB 5AKSA 5J12B 1T5XB 1JV5A 1NJ9A 1WAPA 3BVUA 3P77A 3IN0A 4XP9H 3Q6GL 5D71H 3V5KA 4AT6A 2R4RL 5A40E 5DJ2B 4UYPA 1K72A 3ZDXF 3FMGH 2ZX9A 2D73A 2E9BA 3R4RA 3HFMH 5FO9A 2QGCA 1FNAA 1OARH 3OG4B 4LDEB 5TFSL 1MFAL 4JPIB 1NIAA 2QHLA 3K6NA 5MP6L 1KWKA 1C5CL 1J1XL 5C9KA 5ALBH 2OR7A 5F8RC 4NUJB 4K5NA 2Z8WC 4QXUL 1OAUL 4HHAA 3VXNB 3A3YB 3FQ2A 3FHQA 5B7EA 2OSLA 4F7TA 2AV1A 1Y6KR 1UHVA 2VIRA 3KPPA 3BFWA 2DPKA 4N9GB 3WMSA 4DO4A 5DYFA 3L7FA 1ZJAA 2ED7A 3KWXA 4JO2H 4NJ9H 3TH2T 2L0DA 4HJJL 3MLRH 4XWGH 1KIUB 3TF7C 1GR7A 2JE8A 3MNZB 2ICEA 3ROLB 4NHUA 2DBLH 4QRQA 3HC0B 5HYIA 5E1IA 3GK8H 3FN0L 4NQDA 5D1QD 5FUZL 3WEOA 5IROD 4MNGA 2FWOA 2VLRE 4R26L 4XVTL 2IAMA 3FSWA 5D7HA 2NSXA 5IB1A 1UFUA 1MW2A 1MRDH 2FIKB 3BOVA 2VERN 3U36B 4JFZH 5BW7A 1EHLH 3HVDA 3B9KC 3QJRB 4WAFA 1FL5A 4POZC 3VMNA 2FR4B 4GKZA 2F2HA 4IBZA 3OPUA 2DZEA 1U8PB 4AYBA 6TAAA 1GYCA 3LPPA 2PWEA 1QFWM 3DLQR 3FAXA 5GRWA 4AQEB 1N8ZB 4G6KL 2VABB 3FB8A 5DUJA 5IMOB 1N67A 5I2IA 1FUNA 4ZTOL 1ZT4A 4XNAA 1QI3A 2HT4C 4PGJA 5AFAA 4Q8BA 2I69A 4WFHE 1ID5I 2IDSA 2ZG1A 2R4SH 1N6QH 4CU7A 2O5ZL 3MR9A 1GJIA 4HK0A 1IKFL 3UG4A 3IGUA 2VYRE 1YEHL 3T3PB 2V3EA 2XA3A 2DI8A 5I73B 1E4XI 4QMEA 4N1EA 1L5GB 4MCYB 2PW2A 2ZAHA 1R5IA 3CHQA 1YNTF 1OALA 2WZ0A 3D05A 3K46A 4XB8A 4ESKA 1DJYA 3IKCB 3O3DB 5F1NB 2Z35B 5GGRA 3EYQD 5I66B 4AEHL 1KBGL 2YUWA 1GZPA 1C8PA 3QJQB 5DVKA 1NMBH 1UZ8B 1Z9SA 3FO9B 4DP5X 1QHPA 2F74A 3KHOA 1RU9H 2EINB 3ZTCC 2MKLC 3DARA 1MAMH 5CLZA 1EO5A 4G6FB 4N24A 4H0IA 2PCFA 3ARRA 4OKDA 2G3MA 1Y18A 2K9UA 3AM8A 1JI2A 4HEMA 4ZOBA 5TDNB 3U0WH 3EYVB 5L0QB 1SDDA 4GUPB 4K2UH 5GZNC 4HS3A 5H2BA 4J4PA 1IBFA 3SO5A 3BE1H 4I77H 4DFHA 3BEVB 4IBUA 1F41A 2VR6A 5ICXB 3IAQA 3L9BA 4OM1L 2WOYA 1OCZB 2E9GA 1JVOA 3F7YB 1CGXA 2AEWA 1KFGA 2KQMA 3B43A 1HS6A 1E2VA 1JWSA 5JPMB 1H3XA 1S5IH 2H1XA 1HYSC 4ANWA 1BAFH 1ODAA 1YEDB 5J6HA 3EJQA 5EZOH 2YKLL 3FTVA 4PJEE 1H6UA 4K8RD 1KXTA 4HFWA 5HHXL 2VZVA 3P9LA 4GAYB 4NQTA 4JGNA 4PJGF 2I60L 1ZY9A 2DQMA 1TPXB 1ACZA 2W0KA 3MV8A 2ZAGA 3QIWA 4NT6A 3SO3C 3R8BB 4FS0A 3U46B 3UYRL 1PU0A 3EYSL 1TTBA 3SB3A 1SM3L 1WAAA 3PIQB 4HKJA 3VDCA 4K07A 3FO1B 4P3CH 3D2UB 3MNWB 3P4NB 4UZUA 3DRQB 4PS4L 2C1OB 4K15A 2I5YL 4NN5B 1VESA 5IP4A 1YVLA 3B6SB 1YEEL 3KMDA 2QQKL 2VLMD 3GKWL 1IFRA 2LE9A 4HKBA 4LSQL 4DGYH 2AXGA 1RZJH 3I9GL 4HT1L 4NSKB 5FGSA 1S5HB 2CBTA 4AV4A 4LSDA 1KCWA 3D6GA 2DN7A 2HLAB 3QQXA 3IDIA 4B5ZA 1YY9D 1SOSA 1ACYH 3ZMNA 3KR3H 4ODSL 4I18B 4J2QA 3RPKA 3ARTA 1PLAA 2AGJL 2J21A 2IAAC 4WLCA 2ZUYA 4LOVA 5E56A 2HWZL 3DVNA 2GQHA 4KDTC 3BAIA 3VA6A 1FRGL 4TPRL 2WBJB 4MMXB 3GNML 2BLFA 1FFOA 1H5BC 1TDQA 2DWYA 1WCBB 2YD0A 2EACA 3V79C 1KGJA 2PCYA 3PJSA 1A7PL 4ONHB 3KS0H 1HOCB 3BSZL 4O2CA 3DTUB 1G7LB 1H3TA 2W59A 4KGJA 1RZKC 1HXMA 3TZVA 2AK4A 1BPVA 3MA7B 1W15A 2RBLA 4P9HL 3GHEL 2DQTH 3FCSB 3QZMA 1RIUH 2P8LA 4BZ2A 3TL5A 1FN4B 4MAYA 1JL8A 4HJSA 2Q8BL 4Y89A 3UBHA 2IIJA 1T22A 4JFDD 3O2WH 4JQVC 1E4JA 3EH2A 5SV4A 3KPNA 4L5FH 4EDWL 3ERXA 4TNWF 2O6DA 1Z9LA 1IL1B 4XVJH 1OTSC 1IGFL 3EJZD 4WGKA 5FYLH 3HS0A 1YNKL 2JJTA 1BQLH 1A2YB 4W1TA 5HJ3B 3UC0H 1ORQA 3VFWB 2CDGA 3EJUA 1TJHL 3M8OL 3CN1A 2I07B 2YGQA 5FIEA 1P9MC 3VM5A 5LXGH 4Y2LA 3QPXH 2YPKA 1FF5A 2EAEA 4JJOA 1OK0A 5HHPA 2XWRA 1A3LL 3UCRA 5JLZB 2CCLA 2GCYA 1ZRUA 4A2GA 2FH8A 3R06A 3ZO0A 2OS7A 5IQNA 4H88H 5ICYB 4A68A 3HNSH 2A4CA 1HXKA 2BX5A 2ZOWA 5K1JA 3G6AA 3T71A 3JXAA 1CFQA 1AO7D 2P1YA 4PJEB 1QSFA 4NO5A 4I48B 2PPEA 2UUDH 5M7QA 4C59B 3L95A 3VGAC 4LLAA 4LFHD 4GP8B 3MMEB 4M7ZC 2K7QA 1X6LA 1H8OA 4CU6A 4A67A 4U3SA 2AQPA 2P5EA 1CVSC 1OPGH 3QFJA 4L9DA 2YHGA 1MNUL 3ULUL 5I5JA 3QJFA 4JHUA 5I1AB 4JHAL 3SPVA 3MV7D 3CH1A 4M93C 2HN7A 2E0PA 1LE9A 2H26B 4XVUC 1FVDB 3JTSA 2MCMA 4JBSA 3VB9A 3H6JA 4PCYA 4XODA 4P99A 4F3FB 3VRJA 4G80B 5EO1B 4B3VA 1QPKA 4LLUA 2AABL 4U1JA 1JYNA 2DTSA 4IBTA 2SEBA 4OZFG 4YC2C 3QUHA 5EF3A 4WWKA 1HL8A 5G4OA 5BV7C 3EH1A 3ZT5A 3L9RB 5FYKE 1A6UH 3KXFA 3VXRD 3VWJD 4FQJL 4XWOC 2ERJB 4ZAKB 1JNHB 2CIKA 2MWCA 4PRAB 5HHOD 3D0LA 4HA1A 1L9QA 2PO6D 3OKLA 4P05A 4WO4B 3TEZA 1D6VL 1VENA 3HBQA 4LAQH 3DTXA 4A7GF 2FJHA 3NYKA 5E23A 2ZKYA 3FTWA 4UU9A 5A7EA 3G5VA 3FC8A 1YUKB 4JFPB 3ULVE 2DQUH 3LDBC 2VMCA 4ONFL 2UWEE 4ZQKB 3AUWB 2Y25A 2IOMA 1FCCA 2A9NL 1ZLUH 5JOEA 3QUGA 2JQMA 4Y4HC 5FDWA 4MVBC 4FN0A 1OAKH 5BZDA 2ATPA 4KPHH 4JM2C 3VSUA 4G11A 5EU6D 5HI4D 5BO0D 2WP3T 2N4IA 3L2NA 1J0ZA 1NLBL 4M1DH 3NQKA 1E9PA 5HGDA 3UZQB 4FI6A 3KAAA 2JELL 2OFQA 4Y16C 2EUWA 2XQYG 1QLFB 2PPCA 2F7RA 3QS3A 4QRRD 2IALA 4DGVL 4HIIB 2FX8L 2XPZA 4QF1A 4LDOB 2PN5A 1JNNL 4LVOC 5TF0A 3QXWA 4E9YA 4EBQL 3QIBA 5AW4B 2NUTB 4P5KB 2NR6D 3TVMD 1EJOH 3Q3GB 4OAWA 5DZVA 4L8BB 2X4QB 1P2CB 3TBTB 3DHJA 4APQA 5I1EH 4FHJA 1KEGH 4NP4H 5EN2B 2JH2A 1CFMA 4AL8C 5CJOH 4YFLI 3SPGA 5IHBA 3BZFA 3VWKA 2QDVA 4LSVL 2CKBA 1GZQA 2VLKA 2GJ6D 1T5XA 2ETWA 3PE9A 4XNZC 3ARDA 3IGAA 4URTB 4G8FB 5CBAB 5DJ2A 1AKJB 4R97B 1L7TL 1MI5E 3QGVA 5I6PA 3F2LA 3V52L 4JQXC 2YC1B 3PGFL 3KYOB 3HZVB 1GS8A 4C57C 1WEJH 3N85H 4JPIA 1OAJA 3WYRA 2P5PA 2VDQH 4LKCB 2WTRA 3REVB 1DQML 2XN9E 1PYWB 2PTUA 3DGCR 1SQMA 1G7JA 2C34A 4PJ9B 3O3EA 3ZTNH 4H0HB 1UD8A 5DSCA 4P4KB 1WAEA 3MZTA 3RE0A 3AG3B 3U1QA 3L1FA 3GIZL 4BELD 1OAYL 5CUSH 2B7DT 4MJ2A 1EPFA 4CC1A 4IBYA 3C6SB 2R0LH 2P8PA 3ROLA 4XZ4A 4XP5H 2BVPA 3FONB 4JDVA 3UMNA 2F8VA 2NY6D 1PFCA 3T65B 2QBWA 4WSKA 1ANUA 1HFUA 1SLUA 3PHAA 2NY7L 4U3XA 4WHYG 3U36A 5IBTH 3HI5H 4XBGA 4H1LH 1BLIA 1X5GA 3JWNG 2EQDA 4QHLB 5DHMC 2FO4A 2B1AL 3I50H 1MELA 3QWRD 1O7DC 2VDMB 3DJSA 1RP8A 2UWEB 1FVCA 1OF0A 2PF6A 2ZQKA 4FXGC 4N87A 4PRBB 4PRPD 5DURB 4AQEA 3LN5A 5KZCD 1ETJA 3D69A 3AM8C 4WNQB 3E1F1 2EXYD 4WNJA 5T33L 4HKZB 5BZXA 3X14B 3BO8B 5AVTB 2QADB 3QS2A 4F5CA 4NIKB 5SX5H 5SWZA 3MLVH 3TBCA 3TESA 1GTNA 1JMZA 4G5ZL 5B3SB 2TSAA 2WWNA 1E4WL 1RULH 5D4IA 4G6ML 3RHWK 5EEWA 2CO6B 4WW2F 1HEZB 5DZAA 5E99H 3S3PA 4D9RD 1T6VN 2V9TA 4OLVH 4X5RA 4YL9A 3HE7B 3KPSB 3HBGA 3S34H 4J3OF 2H2SC 2B08A 2J57A 4JREB 1XZ0B 5AVVB 3X3FH 4X4YB 1QFOA 1DSYA 4KUCF 4PR5B 3UEQA 3IKCA 4R4NC 4RGMC 5DQ9B 5SWSD 1HILA 3PU7A 5F1NA 1BYNA 4AQZA 1T20A 5D93C 5I66A 1R75A 2YFNA 2MOVA 4JRLA 5FYJU 1QEWA 3K7UA 4HZAA 5F7UA 4D9LH 4BA8A 3PJNA 1UZ8A 1JN6A 3MA9H 5GISH 1IC5L 4WI9A 1Y6NR 1DZ0A 1VFUA 2J4WH 3QQ9C 5JUEL 4Q9QL 5AOMA 2CM5A 5GQBA 3ZKQD 1IGCL 3EO0A 3FNKA 2KDGA 3GS7A 4I0CC 4OVUA 4NZUH 3U79A 2Z4QA 4OD1H 4HXBL 1YHPA 1YAZA 3DX1A 4ZFOL 1E7UA 3SGKC 5FS5A 2P4AB 4HIJB 3L9EA 3N43B 1TJXA 2D3LA 3PPSA 1DBJL 1GGCH 2XN9B 3L1OL 4CSPA 4RAUB 5ICXA 5IQMA 4AWJC 1TNMA 2DQGL 4I85A 3C09C 4L37B 1MW0A 2W60B 2WYHA 4GFXA 4L1LA 4WCYL 1HL9A 2XYCA 3LRSA 4RAVB 1W72L 2CBOA 1ZLSH 2DIEA 4K0OA 3UTTD 5JR1H 1V27A 4PWKA 1E3XA 1VIWA 2QVIA 4JFED 3QIUA 4Z76B 4RMTA 2ZICA 1LO0H 1F2XK 3K71B 3KH3A 3SDAC 1JGVL 2AFNA 1CC3A 1DCEA 1W0WA 4RSYA 3TZVC 4IRSB 2YBRB 2QFRA 4KZ0A 5HVHB 5CXPA 1I3GL 1KPRA 5F9AC 4OZGE 4ZUWB 2KKQA 3WY1A 4F8TA 4JG0L 1TU2B 3FO1A 3D2UA 3MNWA 4NS0A 4XVSL 1LLAA 1U3NA 4MAYC 2XUWA 1KIQA 4PTUA 2DQEH 1DQQB 3NIDF 3TM6A 5FFLA 1WLHA 5C07A 4HIEB 5C0IB 1UJ3B 4P57B 1VKXA 2ZG3A 4CDHA 5IR1B 5C0DA 2HLAA 4DN3L 1BOYA 5T3ZL 1PCSA 3CH8A 4I18A 4XXCA 4EUPB 2BO0A 2VITA 4HS6B 4YBLB 2AJSH 3CFMA 1XGPB 1BIIA 1N2RB 1TOXA 4HUWA 4DPRA 4CL7A 1OTTC 5E8OB 1SEBA 3W11C 2NY2D 3BP6A 3FFDB 1AHMA 2WBJA 1N5YL 1B0GB 1PSKH 2R0WL 4N28A 2DQHH 5EOQH 4ZUSA 5DZJA 2X41A 4ZD3H 3NEEA 4M8QB 1OCRB 3FOLB 4ONHA 3MYJA 2J6EH 5E0FA 2FLMA 1G7LA 2DOCA 3M7OA 4Y5XA 3ENEA 5EU7C 1AMXA 2CK0H 5HHVH 1FIEA 3A6CL 1O9VA 1ZVNA 4KKLC 4U6TA 3DETD 3EH4B 3FCSA 5F71A 5TPWL 1ITCA 4BH7B 5HYSA 2VDOB 5AZ2H 2LHAA 1FN4A 3B9AA 1WZ1H 4Y1TA 2ZWSA 1CZ8H 1T89A 4AGOA 3ZQXA 3FUFA 3ASNB 4EF3A 1G9EA 1AD9B 1WV7T 4F7CB 4N0FA 5I28A 2EADA 4LHUD 2Y3NA 2X6UA 4HUMB 1AFVL 2I07A 2VKWA 1B0RA 4FQ1H 4GKLA 1N68A 4QAWA 3BW9B 2N0MA 5ACZA 1NBVL 4I3RH 5DFWH 5EOTA 5FO8B 2X6CA 3CVHH 3DMMA 2BRRL 4X5PA 2Y5TB 3BWUF 3GPEA 4LKXA 5JLZA 2VC2H 4DAGL 4NN6B 4N1CA 4MZ2A 2A9ML 2BRQA 3C08L 4GW1A 1QG3A 3T4AB 4CMMA 1VF5C 4L8DA 1KYFA 4HC1A 4PWHA 4HS8H 4F24A 3IBEA 3ML9A 1RXLA 3CX2A 5F7NC 3VI3E 3CSBA 1AHWA 3Q6FA 1BX2A 2NXYD 1X4YA 4MSWA 3FHAA 2YUXA 3Q8EA 5J89A 1Q9OB 3I75B 1KIRB 1SMDA 5B1AB 1UXMA 3QH3B 4OZGB 4Y8AA 1AOZA 4ONOA 1OOWA 4U0RB 5ERWB 3PHQB 3M45A 3N1GC 1IUZA 2J8UF 3T2LA 5DQDL 4ZBJA 1A6VH 1UA6H 4FL4B 1KYAA 4F91B 4OGXL 2UXTA 2WLLA 3ARFD 3L8QA 1MCEA 1UADC 2BY1A 4AK1A 1I8IB 4F15B 3TNMA 1LMIA 2X3CA 2NX5D 4TTDD 2YWYA 1JZEA 4G6AC 3EFOB 4PRDB 5T1DL 3VQ2C 1JFQL 1NCOA 1NUGA 4MJID 3GRWL 3W82A 3DX6A 2NPLX 2YZ1A 4LPXA 4NJAL 2CHZA 3TV8A 5I6KA 4F3FA 5EO1A 3NCMA 4KKCC 3CVCA 1S8DA 2J1ZA 3OV6A 3ZYJA 4P04A 3V4VL 3NK4A 3QIBC 3UX9B 1LO4L 2IXQB 4PRID 2VN7A 2B16A 2QTVA 4KRPD 2NY0C 4P46C 1MJ8L 5AAWA 5DRXB 1U3HC 5KSBF 2WXJA 3H0TA 1CDHA 1IM3B 5F7EH 3NZ8B 4JHZA 3L4TA 4HIHB 4D0DB 5GSVB 2WUCL 1AHKA 1NCAL 3V4PA 4IJ3B 4A6YA 1CDIA 2IG2H 2ZJSH 4YE4L 4OZ4A 5AVRB 5J12C 2G30A 2HX8A 1AQ8A 1MZYA 3MACL 2EKSB 3RB5A 1V7NL 1JDDA 1ONQA 3WHE1 1A9BA 1WF5A 2G2RA 1EDHA 3EBIA 1YN6B 4P5MA 4PEEA 5EU4A 4PJ8D 4AY0A 1R3HA 4FKKA 4LOUD 1YECL 4ONGH 5IJDC 1QRNE 3K5RA 1B6DA 4HHWA 4ZFQA 3TA3D 3UIYA 4RRPG 3BN9D 3J07A 3RWJB 3O81A 3T2OA 2IGTA 1RUMH 3DK0A 1E6OH 1QBLH 4E9TA 1XMWA 1J5DA 1KTLB 3J7HA 3U7WH 2HFEA 4UTCA 4YSOA 5I0XA 2PETA 4GKSA 2R9HC 4NWTL 5F7HA 1QR1A 1IZKA 2ZYSA 3K0WA 4ODHH 2YQBA 3ZVVA 3MBEB 4XN5A 4PW4A 5D1QB 4M1CC 4P9ML 1B4JH 1PEWA 3LIZL 4P5KA 3GKZA 1J05A 1R5VB 3WL9A 4ZX4A 4L8BA 3KS0J 1QFWH 5EF2A 2DL2A 1IAOA 2IWFA 2HX7A 1G0DA 5EO0B 1MF2H 3VI3B 4ZW3A 5H35A 3E6HA 5D4QA 4NFBA 5D9SB 2O61B 4U6XA 5ITBL 2VLME 2CHXA 4YDVB 1RZGA 4D9QD 2WLYA 5D7JD 4UT7L 2X0VA 4O5LL 5CBAA 1AKJA 2Y07L 2ZUVA 3UJIH 2K6WA 4PJDF 2YC1A 2QMKA 1HNYA 4B6ZA 5EF1A 3L4CA 5MHSE 1U2CA 1C16B 2C7FA 1JUFA 1OGAE 2FJSA 4LKCA 3LNHA 5AENA 4XCYA 1NC2D 2C7UB 4ZSOB 1YJDL 4FQXD 3JBG7 5E2TL 4CUCA 3WN5B 4WWOA 2UX6A 4V1DE 3LD8B 1FFTB 5CMAB 5DHVH 5KBLA 3TIDB 1N5AA 5F21B 1N59B 1A3RH 2WN2A 2GTZA 5DJ8B 3WFCH 4ENEC 2J1KA 5AW0B 3QAQA 4L4VE 1GCFA 2I24N 4GYBA 5IQLA 5IFAH 3DOHA 1UKTA 3HMWH 3WDJA 4RGOL 1WISA 3UIZA 4HIXH 3GJFH 5I73C 3OX8B 2HH0H 1RUAL 3NRQA 4X4ZA 3HC2A 5LAXA 1V3KA 2FD6L 1BMGA 4X6FB 4XMZA 4FDWA 1ZLUK 4AMKL 1WA2X 1AQDB 4LXFA 4M29A 4XMKH 1KJMB 5JORB 4DKDC 5L2JB 3GSNL 5AL8A 3O9WA 3U9PL 1F4WH 1TZIB 1JFHA 2Z9TA 4NFCA 4JFDE 4N2KA 3ETSA 1N9PA 3AG4B 5FCUH 4JG1L 5JZ7C 1BHGA 1ROWA 3RFZB 1ZKAA 4QHLA 4X9BA 2FLRT 4Z77A 5H37H 4MMZA 1AI1L 1OAZL 3QEUB 4PUBL 2PR4L 1RZQA 3COOA 2X40A 4JM4H 4RNRA 2NYYC 1GTFA 4Z3TA 1AIFB 3WFHA 1HDMB 1WWWX 3QZOA 4U4IA 5L0QC 3CZLA 1QRNB 4OF7A 3X14A 2TSBA 1DJZA 2IC2A 4UANA 4JQIA 4Y5YB 1FVEA 4OD3L 3WIFA 4LASL 1NCNA 1UKSA 5L7XH 3LSOA 1JCKA 1YMMD 4LLWA 3GBNL 1RZPA 5FV2A 3QARA 3O6KL 4WI6A 1I3UA 2CO6A 3MOBL 5JOPD 5DK0B 1KCSL 4GW5B 1UH3A 2UY7B 2WO4A 4U1NB 1M71B 1AO7E 1F4XH 1T1WB 4OLUL 5DMIH 3KPSA 2OX5B 3BZDA 4HMCA 5A7BA 3C6LA 1HHIA 3E0GA 1IARB 3I9PA 1XZ0A 1RP9A 4X4YA 5FOBB 1KCBA 4HWZB 4XMXA 4OJCA 3EG9A 1XGUA 1ZK9A 3NAAH 1RMFL 3WI9A 4M00A 1IILE 4PJCE 1L3WA 1TPXC 2DLIA 3WNKA 4EKXA 1XIWA 4TNEA 5JIPA 1O5DT 5AZEL 3FOMB 1AZNA 2OCJA 1TLMA 1ZHBB 4RISL 4TSAL 1ACXA 4XP6L 1TFHA 2BK8A 2KZWA 2ZYRA 1E5BA 4NN5C 4U1KB 4AC4A 4HPYH 3JWOL 2FYVA 1CN4A 4RZKA 1C9SA 1NUFA 3DJZA 5CKGA 5KN5B 1X7QB 5EZLB 3QO0B 3RNKA 4OF0A 5CZRA 2FX7L 4YAQA 1GZHA 3BESR 4F33A 1BG9A 1L4IA 2YOCA 4Y9FA 2FQGA 3NJHA 4POYA 1OAXH 1JHKH 4I18C 5E95B 2B4CL 4K23L 4N25A 1IC7H 2DMKA 2QDWA 1JPGB 3QHZH 5HGGS 1MCSA 3KCPA 2GBVA 1N4XH 1G84A 1UB5A 4CSSA 3B2DC 3MRBB 1A8JH 2YUZA 2RFXB 4U2ZA 4RZCB 4KC3B 1FGNH 4XNMB 1EMTH 3VXRE 3ULUE 1FPTL 2WBJC 3OPZH 4MMXC 2W60A 2V5TA 3GZOA 1OTUC 4NQXB 3SDCD 2XVGA 5AKVA 4FCAA 4KY1H 5D7LE 4BFFA 4KZDL 2IH3B 5IBUG 5BRQA 3FU8A 4R90L 3WFBH 3WAJA 4IRSA 5MI0B 2VOTA 4QTHB 1KPUA 1YEGL 3L3IB 1CXFA 3LTVA 3NN8B 1ZOXA 3ZK0A 2VQ1B 5DEGA 3FSVA 4JFDB 1CG9B 2XY2A 4Z95L 4TUKH 5CD3A 4FA6A 1FBIL 4HUCA 1CGSL 5DRWA 1DQQA 1UKQA 5BO1L 1XWVA 5AOZA 4HIEA 2IF7A 1F3RB 1NDGB 4MD5B 1CDGA 5C0IA 3TN0D 2L04A 5JHLL 3PFQA 4P5TA 2I26N 4LCYB 4U33A 1JWMA 4MHHG 4AJYV 4PJIE 4ZS7H 2A7BA 2VZOA 2Z8RA 3MUGB 1TFPA 2B1HL 4PW9A 2NQ3A 5HVFB 3ILPA 3WCYA 2ARJA 4UT9L 4LL1A 2ICCA 4EOWL 1DBAL 3D51A 1J9CT 1E4XH 1LGVA 3DBXA 3RNQB 3P4OB 1N2RA 2D7QA 2ZX6A 3MV9D 2NW3B 2HTKC 5BUAA 3HHRB 4BFKA 1J12A 4Y4KA 1NM4A 4ODUB 3IVKB 2LLNA 4HJ0C 3V5HB 2PCPA 1AO7B 4XNXH 3RI5K 4S0TD 1NA8A 1PX3A 1UVQA 3S88H 2MQCA 2X4TA 1WJ3A 4MA7H 2Y7LA 3U7AA 3TJPA 4M02A 1OP5H 2G9HB 4X7CC 5DJDA 1K4DA 4S1DD 5JOFB 1I1AD 4JKWA 3VB8A 1NAMH 2R8SH 2WXKA 1TXKA 4J3OH 4Z1PA 2CDFA 3VXTA 1AG0A 4OCYH 2EDYA 5CP3A 1JD9A 3DHUA 3K2UL 4F1SA 2W9LA 3MCLH 3J2PA 3MV7B 1IQWH 4HISA 4MJ6A 1Z9OA 2EXWD 4O4YL 3ZE0E 5F1IA 4UNVA 4N8VA 4XAKD 2A2QT 3NOIA 3OGCB 4LVEA 4FTVE 3VFGH 2XFXB 3WD5H 1GC1C 2GTWB 5IW6B 1NGZB 1ETA1 3CHSA 4HJGA 4F9PC 5INDB 4Z7QE 5DK3A 1NOAA 2NT1A 3ISWA 3BI9X 4YK4B 2CGZA 4KK9C 1DBML 5JO5B 3NA9H 4Y2OA 2E8ZA 2OMWB 3O8XB 4OIFA 3VXRB 4JGJA 5ICZA 1UYWH 2OXHA 3BQVA 3G04A 1MFDH 4Y4FB 4DP8X 1C7SA 2JIXA 2ERJC 2FZ3A 4FQCL 4ZAKC 5D7LB 3ZDZE 3IGLA 2CG9X 1EBAA 3B1UA 3OBAA 4WO4C 4E9XA 5FR3A 2CHDA 1BFTA 3I75A 3ZRSA 5L4FA 1DO5A 2ORBH 4PRPE 5GGUB 4I2XA 2OCCB 3QH3A 4OZGA 1GMEA 2J1WA 2CPUA 4AQAB 1CFNA 5ERWA 5E9DE 1DJHA 4U4BA 2BW5A 2HKHH 3TOPA 1O75A 5GS0C 2R1WA 3OZ9L 1PZ5B 1WD9A 4JAMB 4YH6A 5T5FL 2IAND 2A4ZA 1I8IA 5CGYD 1INDH 2CLRB 3F84A 4QTFA 2R2CA 4XHQA 4IU3A 2F1AA 2ROXA 5FGBC 3RX8A 4PJIB 3V0FA 1AVAA 4BFBD 2ENPA 4TVUA 3HZKB 1RK1A 2MHAA 4WI0B 2B8OT 3VFMB 2OP4H 3PXLA 5HBBA 2A99A 2WCSA 4RMWA 5FCSH 3FUIA 2JB5H 2PYFB 3E38A 1CMOA 4UAHA 2DWDB 2KLTA 3RDTB 4AMXA 5ESAB 1L6PA 2YSTA 4M61B 2MFNA 3EOBB 4PSPA 1WA1X 5SWSE 1XZWA 4ABWA 2W0LA 4GRWF 5KVGE 4P2RA 4P23B 3LN9A 2HJLA 3SKNB 4QRTA 1TQVA 4Z6AT 5TQ2L 2OYPA 3QAZB 3BH8A 2JTYA 2BJML 3DXAA 3NZ8A 1CTNA 2BP0B 3QUML 4HIHA 1XD0A 2GJ6B 2UYLB 4YWGH 3BJ91 5JW4Q 3QR0A 2HFGL 1N12A 4TULL 4CILA 1HHKB 2XY1A 2CMRH 3CD4A 5BZWB 1Q1PA 3SJVD 1KJ2A 3X3GL 1W16A 3L7EB 4R97C 3I6KA 4CNIA 5LO7A 4XI5C 1GSMA 5D1ZD 1QZ1A 1VAHA 4HEPA 5B8CA 3QDGD 2BIHA 1IKOP 4GW4B 5IJCC 3RVXC 3G5XA 4QWWD 1FE8H 2XWZA 4NAMA 3ZE0B 4F58H 2JKWA 3RWJA 4M43H 3LS4H 1PQZA 2EDKA 4FTVB 2FNWA 1QUNB 4PJ9C 4AV0A 1T7VA 1NMAL 4BFOA 3MLZH 3MDJA 2P7TB 5TE6H 2DD8H 4AYFB 3S35X 2ZUWA 4Z7QB 3GIVA 3VI4A 2C3HA 4E9QA 1RFDL 3AQDA 1CBJA 3EFDH 4Q52A 4FHBD 5D1QA 2NY6B 2ZP0T 3S36L 1BQHA 5IROA 3WY2A 4XMWA 4X7FC 4XP1H 1R5VA 1BXVA 3WOVA 2JCCA 1FV1B 4BCZA 4JKNA 3CN0A 4HWBL 2O5YH 2OMXA 1QSEE 5EO0A 3SOBL 4D0BB 5AD0B 1MCQA 5D7IE 3FBQA 5BZZA 3MSPA 4ACTA 4YOKA 4OV5A 2O61A 4ZW7A 2BOCA 1DFBH 4FABL 1WZAA 2WBWB 3IU4H 4K5PA 1OB1B 1SEQH 4PRPB 2E56A 3ULVC 3GSQA 4JFXB 5D71L 1JPSH 1Z9MA 3SY0A 3KLKA 3HG1E 5K9QG 5E9DB 3RX9A 4KJPD 1YCSA 2VXTH 5C0JB 4ZZFA 4Y19E 3HFML 4H40A 4L8SB 4OCXL 4OQ1A 2A3TA 2VDKL 5C08E 1R9FA 1U8CB 1EZSA 4N2FA 4ZSOA 4TUOB 1ZXQA 5ALBL 2QADC 1U8NB 1CFVL 2AITA 3BH9A 4YS4A 5CMAA 4QOKD 3TIDA 1N59A 1VJSA 1I9EA 3MXVL 3SQOH 4B53A 2PABA 3NACL 1J5OH 3T1FB 4I13B 2BSRB 4IK7A 2YD4A 4JO2L 5CEYB 3OX8A 3MREB 1HL5A 1E0OB 3EZJB 4O2FB 3HE7C 1G1OA 3JZ7A 3BPCA 5SWSB 3WKYA 4NO3B 4Z7AA 5IJVA 4FLRA 4JREC 5GZOC 2YRBA 3GK8L 4IKKA 3WIIH 1AC6A 1X5LA 1KJMA 1UWXH 2XWTB 1JZ3A 5LB1A 3S0PA 5DHEA 1TZIA 1XIWC 3MRGA 1ZA6B 1JPTH 3GMRB 3QI9D 4L05A 4XCFH 4TNWK 4JFZL 3AADB 3GLEA 1GL4B 2NXZB 4N2OA 5IEHA 2Q87A 4AIOA 5F7DB 2BP8A 4DIXA 3UP1A 4ALAC 2PP8A 2VDPH 3H55A 3QUXD 3V6ZA 3CZJA 1BXXA 1A6AB 1O6TA 4Y5YA 1F4HA 4FJZA 2F53D 1FJ1B 4IU2B 4LARL 4Q9RH 1K6QL 4FOMA 1DUYB 4GNKB 1J9QA 1L0YA 2DQCL 3FT1A 2IH8A 3N0PB 1N6QL 5GHWH 3ZR5A 3LQAC 3NH7H 4R7LA 3WJLA 3IJHA 5MEPA 4J6IA 3L3DA 1A02N 1T0NB 4XMPH 2YLHA 4E5XG 1EBPA 5DZLA 3I84A 2BY2A 2J55A 2OX5A 4LT7A 4AYMC 4P06A 5IHZA 4PJFA 1KB5A 2ADIA 5FOBA 4F7MA 4TOYH 3P73A 5CSZA 4H8WC 4IRSC 1SLXA 3FHEA 3NCBB 2ZKXA 1USQA 1YPZE 1QSEB 5HVHC 3D4GA 4B9FA 2FWSA 3UYPB 5D7IB 1IBBA 2VO8A 3EOTH 3TBWA 4F20A 1W72B 3HE6A 3D4ZA 3IEAA 1QKZL 5AW7B 3RAJH 4DETA 3OHXB 1A1OB 3ES6A 3CZUB 1WC7B 2H6PB 3F83A 3IB4A 1UJ3C 3WLBA 3PWLB 2COVD 4P5TC 3U0PB 3GJFK 3HG1B 3NJGA 2WNKA 4YIQB 5AVSB 1X5XA 1X7QA 5EZLA 2B2XL 4Y19B 2ZKHL 4I9WE 2ODIA 3U0WL 4Q6YA 3TS8A 2K6YA 1XB8A 4YBLC 5F7KC 4I77L 4X5WB 2ISDA 5T5NF 3MLUL 5AOLA 1JHLH 3RUGE 4GQZA 3WSQL 4RZCA 3H8NA 2QVMA 3ILEA 3VXMA 4OZFB 5IB2A 5JA8B 4A7TA 3LRGA 4B9JA 5AAMA 3R4DA 4Y4KC 2WXLA 3I6GB 3OKKB 4PCTA 3FT9A 3ZPDA 5IZ7A 1BAFL 2IH3A 1TEYA 5EZOL 5I17B 3GXIA 4KI5F 1SY6A 4D0CB 3L3IA 4H2AA 3JWNE 3NCYS 5C0GA 3S4SA 2V0AA 2Y1ZA 3CC5B 4P3CL 5KVMC 4NBYB 4LHUB 5A2FA 1OL0A 2ICWJ 3GMMB 3F6LA 2BS8A 3L3HB 3KHQA 2DDQL 2XWJB 4JKPH 1HX0A 4MD5A 5PCYA 1A6ZB 4NKDA 4LCYA 4NUQA 4X6EB 4Z0XB 1KYOJ 5JW4R 5HYQB 2NTSP 1R3JB 1RZJL 2FO1A 4XR8C 4P2OD 3QHFH 5F9OH 1N0XH 1OCWL 3AU0A 3C75A 3DX2A 3MUGA 2NTFA 3FDWA 2D8KA 3GT6A 5J3HC 5D2LA 2OMZB 2Y5EA 2NY5L 2XKUA 4LQFH 4XB7A 3P4OA 4U1GB 4F8LA 5AEAA 2XV0A 4FZ8H 3UPAA 2ENSA 5F6HI 2WY3B 4NN6C 4QR7A 1VFMA 1AGBB 2NMSA 5EZIH 5CNHA 3PS6A 4HCRH 3DVGA 4ZPTB 2BSBA 2Z31A 3V5HA 1E28B 2XNAB 2VSCA 3H9YA 1AO7A 1O6SB 1R46A 1S9WB 2NXYB 2V9UA 2X44D 3BZEB 1OXYA 4FQHB 4G9DA 2J5WA 1A6WH 2G9HA 4A63A 5ANHA 3BVDB 1JXKA 1W8EA 1IFHL 2DKMA 3KBEA 1E43A 3A67H 1YPZB 2X1WL 2O6CA 2DKUA 1FQ9C 1NFDE 3UTPD 3WBDA 5EU3B 2V9RA 3H3KA 3SE3A 1DQJB 1EO8H 3I3BA 4CC4A 4U0RC 2H47C 4FD0A 2IGFL 5KW9H 3B3BA 2E7LC 1KXHA 4DN4H 1IGYB 5GJSH 4FL4C 1GC1H 3HUJA 5EOCH 4BE5A 1UZ6E 2YD1A 1BBDH 3MV7A 3DRTA 2X2JA 3JWDC 4F15C 3PQYE 2YSSB 1BQLL 3OGCA 5B3JE 3EYUL 4TKWA 2XFXA 4FCHA 3LYRA 5FWRA 5IW6A 3T3ME 1THAA 2X4RB 3V0VB 1ZVSA 4PD4K 5TH2A 3L3JA 4WTZG 1VEMA 1BXAA 1RSFA 2IMMA 4YXKH 3ZL4L 4U0QB 4KRPB 4J3BA 4H0LC 3VX0A 3G5WA 3VWJA 4M56A 4S2SB 1I8MB 3X13B 1N0LB 5HHOA 3WHXB 4H88L 2GI0A 1MFCH 1N3NB 3HNSL 3LNIA 2PO6A 1I9RL 5DS8B 4ZXBB 1WHOA 3MRRA 3N1QC 4XO5A 5FYLD 1MCKA 3G5YA 3MRQB 3U30B 4OZIA 3HVNA 5DMGD 2AJ3B 4LCCA 3QG7H 4JN1H 3GC3A 4MAUH 3QBTB 3SBWC 4IJ3C 5GS0H 2QFPA 3GO1H 3SE6A 4X8XA 2GVYA 2I85A 4XPFL 3KBFA 4UCFA 3LIUA 5C0NC 1I1RA 4XNYH 3PWPE 5EBLA 4FMFA 5E6UB 1PZ5A 5EU6A 3TA3B 2W65B 4RMRA 3BVXA 1FL6B 1FFPB 1NFIB 1QMUA 1ET5A 1YMME 2CLRA 4JZOB 4ODBD 1BWWA 5FOJA 4HMDA 2JJSA 5FW7A 3VDAA 4QRRA 1Q72H 3HZKA 2CU9A 1MJUH 4AGPA 4WI0A 2YPVH 1LO5A 2DBJA 3VFMA 1MWAH 3VD5A 5FECA 1L9OA 1WT5A 3BQUD 3NRPA 3CXHJ 4KJYB 2NR6A 1U2HA 1S2EA 3TVMA 4HP5A 5A2LH 4M61A 3MBEC 5D1QC 4PP2A 3EOBA 1MEXL 2EIBA 1E6JH 4YGVB 2Q86B 3UFIA 2N1KA 4NPYA 4OY9A 4R83A 5BUGA 3PGDB 5B7FA 1A6UL 1ZSDA 4LQ1A 3CFQA 4KXCA 5F44A 3MX0B 4FZEH 2GJ6A 5DEFA 5IFJB 2HPOA 1QR4A 4Y2DB 4G9FD 5BZWA 5KYWB 3CDFA 1UA3A 2Y7QB 4HV8B 3B1TA 1P7QD 3RZCD 4CMHB 5I0ZA 3GMOA 5JYMA 4KK5C 5CWSA 2D31B 1A1NB 1NC2B 3LPFA 1MFUA 1EVUA 1R3KB 4FQXB 5HVWA 1UQSA 3F12A 4E9RA 2EIEA 4Z7VE 4NNXB 3NSDA 4BKLB 2KUTA 3NDZE 5DK2A 2IDUA 3QE5A 3SD5A 4KKAC 3WN5C 3LD8C 4S10A 4NNPH 3U4EA 3T3MB 4JZJA 5TQ0L 3EJJX 3TEXA 2O26U 2ZX7A 2GSGA 1BFVH 3WIHA 3WUWA 4KVNH 4H8QA 5FHAL 4CVZB 3WAKA 3TO2A 3CFDA 3EYQC 1JGEB 3W0WE 5K9OB 4N3UA 3FN3A 5GRXG 2A83B 5I1EL 5AD0A 5E5UB 1WAAF 1JWUA 2XXGA 5F89B 4RIRA 1ZA3B 1EFXD 4NRXB 2VH5L 3QWRA 3QPQC 4GQ9L 3RFZC 1OB1A 4TQEL 4AG4H 1F4AA 3RTLA 1GA2A 2ZXGA 3POCA 2UZPA 5CJXC 2DYRB 2PR9A 3MCKA 3BYTA 4XP4H 3B5GA 4IKNA 3PWPB 4UM9D 3W3BA 5CKAA 3C87A 1HSAB 2X4UB 3GSNB 4L8SA 1L9MA 2QGBA 1PDKA 3ESMA 3HAEB 1YMMB 2VDQL 4Z7OE 4JDZB 4Y5YC 3SKJL 3CFBB 2YQGA 3NFNA 3OKYA 4DNLA 3RL1B 5KUMA 1IX2A 5C3IA 4PJCF 3T1FA 3ZUNC 1ZTMA 1HNFA 1U95A 1S7VA 2GJPA 3RKPA 3WJLC 1EZVX 1PAMA 4IEFB 2Z93A 3MREA 4TV3A 1MREH 1EA9C 4K8RC 5BVPL 4PSRA 4K3JH 1A3QA 3ILQD 3FUEA 3NP3A 4W9LC 1BG1A 4AJVA 2NZ9D 2CLZB 4JJHA 1CF1A 2G2PA 1FNGB 2QHRH 2YFOA 1M7IA 1ZA6A 3NABH 4GRWH 4FNLH 4PJXA 4K73A 3MN8A 3ECWA 3GM0A 5DJXB 1XSIA 2VDNH 2YD8A 5DJYB 4XAKE 3I50L 1WTGT 5BS0E 2V7NB 1PFOA 4BM7A 4OGAC 4KQ0A 1S9XA 2X4SA 4MCZB 4XPTL 3IPFA 3L4ZA 2DWTA 4ODXB 4MA8L 4AEEA 3N9GH 1TVBA 2R29A 1ZHLA 3Q01A 4Z7VB 3AU1B 2FNBA 2IO5A 1FJ1A 2X42A 4POZD 5DI8A 1DUYA 5IJBC 2X53A 3C6EA 1ASQA 3MLVL 3UYOD 1HU8A 2E9WA 4QRPD 4PWIA 3UTTA 4K9EH 3LKOB 4J3VA 1RULL 5DLMH 1B90A 2OJEB 1I8KB 2V33A 2VR3A 3SDCB 1T5WA 1IRAY 4JFEA 5AAMC 4H8WH 5E99L 4X5XB 5HHQB 3D39A 3S3JA 2H1PH 3S34L 1TZGH 2AJUH 3VSQA 3T6ZA 2Z65C 3ZZ1A 2B59A 4NQUA 3S5YA 2RCSH 5MI0C 5FFGA 2HVKA 2ITEA 3G9VA 1QBAA 4O58L 3AACA 3II2A 2AK1L 2H8PA 3G6DL 4MNQE 2W07B 1EHXA 2XWBA 1G9HA 4TN9A 2PWHA 4AQ1B 1QQDB 5K59E 2GJRA 3EJPA 3VW3H 2FGZA 2XTJD 1A4KA 3MA9L 3OHXA 3EJZC 3LXCA 3NMEA 4HF5H 3FT4B 4WUKH 4OW6A 4D7PA 4JRXD 3ROOA 1VPOL 3PWLA 3ABLB 1A0QL 4XO9A 2GI7A 4Y9GA 1LE5B 1JG9A 4P9HC 4PREB 1JYXA 2ZX8A 2KL6A 4TUJA 4B95C 4Z7OB 3CIQA 1UWXK 2V17L 2N0KA 3CUPB 3K8KA 2JI2A 1JZJA 1RIHH 2GJJA 4BSWB 1UWGH 1P0SE 3UZVA 3OB0H 5AW1B 3D7PA 3AG2B 5I1KH 2HG0A 4NENA 5GRZA 3BD5A 3O11B 3K6DA 4PV8B 3I6GA 1RZ7H 3OKKA 5GZND 2Z91A 2AP2A 4ORGB 5K9JH 5C0BD 2DWXA 1I1AB 3W57A 5FO2A 1LO0L 5AL0A 1BQKA 2BSDA 5EUOE 4NHCL 2N1TE 4G43B 3L45A 4JRYD 3B2VH 4I1PA 2V9QA 3CAFA 3UTZB 5M95B 3W5NA 1LP9E 3SE3C 4EMZA 2J2ZB 4CC4C 2DMBA 5HHNA 4LHUA 2DQEL 3P2BA 3BHBA 1A6ZA 4X6EA 5KAQF 3MLSH 4GQQA 4FG2A 4Q6IB 5I1CL 1SHMA 2YGNA 1DVYA 5JIMA 2JV6A 3FB6A 3ET9F 1OSPH 5JNYB 3H2WA 4PWEA 3VXSD 5L6YH 2MQ0A 4MXWH 2WQXA 2OMZA 5K39A 3HHSB 3TWCH 2AJSL 4YK4C 3TYFB 2R23A 5H37G 1IIKA 3SYCA 4YN3A 4G1MB 3IWVA 4ETQA 1DVTA 1F0LA 3O8XC 5AW3B 4TSBH 3ULUC 4ZPTA 4XH2B 2GABA 2IPKA 3LEVL 4Y4FC 5F7WC 1E28A 1NCTA 2HVBA 4XMUA 1G9NH 3AG1B 5FUOH 3RWCA 2XRAH 3L6FA 2XFGB 2BOLA 1H19A 1TETH 2EDRA 3TCLB 1M2OA 1RPKA 3O2DL 1KBKA 3OKNB 4RFOH 4LCCC 1XR8B 3ARGD 3EO9L 3OKEA 4FFZA 4POUB 1G7HB 4W9FC 5C0AE 2CK0L 3L48A 4PGDA 3GXFA 5I6LA 2L7JA 2K6ZA 3Q06A 4GT0A 3K6FA 4JANB 3JWDH 1SN2A 3ARFA 2XXMB 3HTLX 3JV4B 3O3BB 4GQRA 5CJQH 2VRQA 3VJ6B 4MYPA 2YAFA 1IGYA 1OP4A 3BAYA 3LZPA 3MLTB 4LLMA 3PWNB 2NX5A 1FI8C 1SJEA 4IS6B 3ZT7A 2OPCA 4XRCA 5CS7A 5HI4C 1RUQH 4JFQA 4MJIA 3TJHD 3WGUB 4TRPH 4L8CB 3HC3L 2EIJB 1KGCD 3WFZA 1OK8A 4CSTA 1VGKA 3JV0A 3PWVB 4I3RL 1M53A 2E75C 5DUPH 1G0XA 2Z7YA 1F1DA 3LRHA 2GITA 5C6PB 1YNLH 4PRIA 1OTSD 1KT2A 4XAWL 3BDYH 3RDTC 4B5EA 4FXKB 5A43C 1XGRB 2JTDA 5IOKA 2Y9RT 2VAJA 4S2SA 4A2DA 1XF5B 1PAZA 1RIVH 4P23C 1NCIA 3GLAA 4Z7UA 4NNYB 5DS8A 1DEEA 4PRHE 3QAZC 5G5DB 1XGYL 3WEBA 5DLLA 2WW8A 1CI5A 4UINH 1SVBA 4XC3L 4NUGH 5IM7A 4HFUH 5EUOB 2BVOB 3PWJB 2P48B 5J6SA 1URIA 3QXAB 4WUUA 3FFCD 5D1ZB 3QR2A 3BUYB 4PJ8A 2KLRA 1LP9B 1FG2B 3OTTA 3IAPA 3G5ZB 4H5SB 4EKJA 1JIBA 4FXLA 3AGVA 2F53E 1A6VL 2NNFA 3OLEA 5C1MB 3QUMB 2EXTA 2R4RH 1EAJA 1FFPA 1SHXA 4JZOA 4TNVF 2D0FA 2Q76B 4XBEH 1JZ4A 5ADOH 4JY6B 4EN3A 3T0EE 1P7KB 1M3IA 5C8JB 1MFAH 2F7OA 4WJG3 3FULA 1C5CH 4Q2ZA 4M62L 3DUUA 5BQ7B 1CXEA 4IDLA 2MJWA 5L2KD 4QXUH 1OAUH 3GSWB 4EVNA 1U8HB 3E8VA 1RJZA 3ZKSD 3N42B 2WQAA 4UQ2B 5DFTA 2NY6C 1E30A 3IFOB 2Q86A 1LK2A 1TMCB 3H9HB 2BY3A 3D09A 3QDAA 3GHBH 1A6TB 1LEKB 3PGDA 4HJJH 2X89D 2WXIA 4O02L 1NCJA 3KBHE 2Z92B 3GEWB 4PIBA 5MENE 1CT8A 3CXDL 1EAPB 4W93A 1DJIA 3MX0A 3PGCB 5F7EL 3MRPA 5FUZH 1JGLL 3NFPB 2VXQL 4GQPH 4GRLA 2LR4A 4UQ3B 5D7JA 5C0AB 3VMPA 1E9QA 3HHMA 4R26H 1I75A 2R59A 5D4HA 4CVXB 5LG6A 3GXNA 3OAYH 5DUML 4F7EB 5KYWA 2ZJSL 1HQ4A 2Y7QA 4HV8A 4Y7MA 5I8CB 4UUJA 1JNJA 1LNUA 1I7UB 1C8QA 4J3SA 4XWOD 1A4JB 3ZHNA 5CCKL 2CLVB 1XQ4A 1NC2A 4FQXA 4L8SC 3MLPA 3HZMB 3F04A 4ONGL 1PG7H 4Q9BA 3MPCA 2XN0A 2WMPB 1ZIAA 4MKMA 3UCQA 3S9DB 3IDMB 4LHQB 4LO9A 1IEHA 4J3OG 3BIAX 2R56L 3EFFB 4G6KH 4UQ9A 1QW8A 4AV5A 3DKHA 3IETB 1QBLL 3H9ZA 3QUYD 4PAZA 4ZTOH 3F05A 1YYCA 1ECYA 5GS2H 1OO2A 2O5ZH 5IWLA 3IMTA 1IKFH 4ODHL 2ESVD 3LMJL 3NCWA 5J1AA 1ESOA 1QVOB 5I1IH 3UTQB 1LYQA 2FYYB 4Y16D 2CCWA 2FJFB 5EFIA 4JFOB 3FT2A 4JE0A 5CLXA 3N6YA 3U6RA 1Z66A 5MEPB 4PRHB 1C12B 4UOW0 2D3NA 3SDDB 4ZI8A 3WS3B 4G8IB 1S3RA 4N2IA 1YMHB 1ZA3A 2XN1A 4BFNA 3G7TA 3KPRA 1INQA 1OEZW 1NOFA 4HGWB 5I1HH 2E6PA 1M05B 5IVZB 1DUZB 4PJ7A 3U25A 4KHTL 1NSNH 2A6JB 3QUXB 3VFRB 4AEHH 4FQPA 2NXZC 4U6YA 5D2NA 3F5WA 3BAXA 4K7PX 5IW3A 1A66A 4GAJH 3UJIL 1UUSA 4YEFA 1DQIA 2EDBA 1XF4A 5E2JA 5EOCJ 1U3JA 2XA8L 5HGAA 2X4UA 2Y36L 2F53B 4BV1A 1E5AA 1T1XA 3S3DB 4WY7H 3VD0A 2X5PA 2L7EA 3U7YL 3HAEA 5KANG 5KG9B 3D18A 1LD9A 4NM4L 1MVYA 3IN2A 4Z23A 1SDAB 1RJCA 1WVZA 3ECVA 1S9VA 4NC1C 1KGWA 4JGMA 4PGEB 3T0EB 3AW5A 2XWDA 4MQSB 3RL1A 4KOBA 5KTEL 2WLNA 1T2XA 1Y07A 1A65A 1BF2A 5K9KB 1NEZA 4Z3GA 2EO7A 4LOEA 5IFAL 1BVZA 2P28B 4IEFA 1WG3A 3N41B 4OM1H 4KTEH 4WF7A 2HH0L 4QGTA 2Y7SA 5JA9A 4HUXA 1BF8A 2OM5A 1XR9B 3RA7L 2EIMB 1BQ5A 1M9WA 3UTPE 1G7MA 4UDUA 4M4RA 4AX3A 1FNGA 2IBBA 5MENB 1U2YA 4X8JA 2QPFA 3V9EA 2DH3A 2JLLA 2PNDA 3D30A 4MDIB 4HZLA 3AJ7A 5FCUL 5HHXH 2I60H 2V5YA 3OHXC 2M8XA 4NO0D 1K8IB 5F7AA 1S7TB 1NDTA 3RWFB 3UYRH 3Q2CA 2W5PA 1QNIA 1U93A 2VCOA 5A1AA 4PS4H 4RX4D 2I5YH 4Z7WE 3WTVA 1UGNA 1PJ9A 1DLFL 1E42A 1WBXA 2EE6A 3MLWH 3GKWH 2YJLA 4LSQH 3IDJB 3GS4A 3AUVA 3EO1B 3U0TB 3I9GH 4HT1H 5EU5B 3FTGA 3N5AA 1P4LB 3N2JA 3N1MC 4GG6A 3NSYA 5L7XL 1BEXA 1X5JA 2H1LM 3BPOB 3LKOA 2BNRD 1NCCL 4EIGB 1U8LB 4L4TE 5K59F 2AGJH 5GGQH 1F6FB 1FZMB 2HWZH 2LFEA 1MH5B 4X5XA 2D03H 5I5RA 32C2B 1FRGH 4Z3IA 4TPRH 1SMOA 1BECA 5LGKA 3LAFA 2GPZA 4F7PA 1AGEB 3VRLE 5KS9A 1BIHA 3VFNA 2GBAA 1IKNA 4L29A 2W07A 3OKOB 4HOXA 5E24E 1F5WA 5B1JA 2X4PB 3TN0A 2YUVA 5AVUB 1HHJB 3GHEH 4N86A 4HPYL 4P2OB 3LNDA 2X70B 4IIZA 3TTSA 2VO5A 3ETBF 4Z78A 3VGGA 5HI5C 1DTUA 4XN1A 1TTFA 1FC1A 1MHPH 4ZUUA 4OCSL 1W0VB 4KX9A 1IGFH 1TQTA 1OAXL 1KN2H 1RQ5A 1YNKH 3JTTA 3MV9A 4P5RA 2YAEA 3WJMB 3QQ9D 1DN0B 1FL3A 4OZHE 1TJHH 3M8OH 3QHZL 4U1GC 5G4NA 1LO2L 4IQHA 4ZMWA 1N4XL 2CGRL 3IMBA 5HJDA 1NICA 1NFDF 3TIEA 1EMTL 5B39G 3O11A 1NUNB 5K93A 4KXAA 1A3LH 5EULV 4JFTA 3CDZA 1IE5A 1AR1D 2DLGA 1CE1H 2NXYC 1A7RL 4WKXA 4G9FE 1ZIBA 2F54D 3STZA 1UENA 1CD1A 2D7NA 3UAEA 5HDQH 5CGBA 4X9GA 2J56A 5LWYH 1PIGA 1JF6A 5AALA 5LCVA 3DGGB 3VNZA 4WU5B 1DDHB 1CGVA 3ARFC 3PUUA 4IBVA 1GYVA 4Q6KA 5GGVH 4AVHA 2EEXA 2IDTA 3SDAD 1KCVH 3C5SB 2IADA 2APFA 3O4LD 3O41B 4TTDC 4BZ2H 1AQKH 5IMLB 5FFOA 4WDIA 3RVVC 3RWDB 4YL4A 3TBYA 1NKOA 4N85A 1ADQA 3D33A 3WHE0 1HJCA 3E1ZA 4Z7WB 1K2DB 4WI4A 3VMOA 2AQNA 5ID1B 4UV4L 1IZJA 1N10A 1YEIL 2DLTA 3MKKA 4ZS7L 4XOCA 1FYTD 4PJ5A 1TTGA 1EO7A 5D7KD 1MNUH 4XNUL 5E7BA 3ULUH 3I02B 3HHSA 2BVQB 1N18A 4RRPM 3MJ7A 2PYEE 5DUBA 3QW9A 2E4FA 3M88A 4KRPC 2YA0A 2H9GB 3CFKA 3KVQA 4L4TB 2QQLL 4PJHA 3OMIB 5C0RL 1OSZB 1CXKA 3POHA 4M8UA 3V0DA 1WFMA 3MXWL 4PG2A 4ZXBC 2E7BA 3WDHA 3CIAA 3TCLA 3S88L 3U30C 3D87B 3OZLA 4BH8B 1OTTD 4LLVA 4N6RB 4JFFD 3OR7A 2CGYA 4FQJH 1NAML 2R8SL 2W1NA 3AXHA 3GMLB 3INUL 3JWNC 3MZGB 1J5IA 2L7QA 1JNLL 2C9SA 2BHZA 4JR9L 1H0DB 1D6VH 2A6DA 2IANA 5GPRA 3VJ6A 1AC0A 3FH8A 3OB0K 2EDNA 3PWNA 1HWGB 3TA3C 1CLVA 4MQXD 4MHHI 4C54A 4ONFH 1IQWL 2XWEA 2Y5QA 3CE1A 4KKLD 1NCHA 4OFIA 4EXKA 4L8CA 2A9NH 4JPKL 4OB5L 5FM5O 5C0FB 3BQUB 3VFGL 3GXMA 3DC0A 2P46B 1R3LB 1AMYA 4ZMVA 4FKEA 1TTRA 4OZHB 1NLBH 2HJFB 4I4WB 3UTSD 2VMFA 2ZOLB 2BNQE 4KUCD 4LSTL 2JELH 4J8QA 4DKFH 2XKNB 3VXUA 4QLRA 3G9AB 1MHCB 3TFKD 1D5ZA 1BD2E 1XF5A 4P5SA 4L0YA 3P4MB 1N6VA 1UYWL 2FX8H 3GSXB 1NGWA 1MFDL 1T0PB 4EIBA 2BSSB 2MRYA 2H6OA 4L3CA 4XZUB 2EJ1A 4B3EA 5ADPL 4G9FB 4LPTA 4BZ1A 2Z7WA 5ABZA 3EDEA 2FJUB 5ILTL 5D7JC 5CEXB 3SJVA 2BVOA 4WSJA 4BYHA 3N40F 4Y2DC 1P7QB 1E8ZA 2QKIB 3QXAA 2HKFH 1MFEL 2P44B 3HPLB 3WV0A 1P7BA 4IBQA 5D1ZA 1Z3GH 2WWKO 1FFQA 1FG2A 3QDGA 1CS6A 1TVHB 1SYSA 4QHNA 4CMHC 4EIZC 1XVSA 3NZUA 1MCBA 5FA3A 1ZT1B 1UEMA 4FA7B 4FQXC 4AKQA 3EGSB 2BIMA 4OLWL 5ES4B 1ZS8B 5F6IB 1L7TH 3KPOB 2Q76A 2NNAA 5KJ7E 1FH2A 3PGFH 1UG9A 2VUYA 3H42L 3VH8G 3LB6D 4R5XA 1UXWA 3S7GA 2OP4L 3V6OE 1DQMH 2BS71 4XT1C 3IGFA 3M1CA 2BNUA 3O6LH 4YSDA 1T21A 1M6UA 2PYEB 2XBZA 2DMGA 5J13B 3ZKMC 1HKFA 4E5XB 3H3PL 3IFOA 2BOBA 3FO2B 1YJDC 4QT5A 5C0CA 1OAYH 1A6TA 1LEKA 1XCQB 1I4FB 3B2UC 3BVVA 3RGVD 5D5MA 3PP3H 5INCA 2KZ1B 2UZIL 3SYOA 1C5DB 3TT1L 3WKQA 4KKCD 1XH3A 2XTJE 2C9XA 1AZUA 3A4AA 4UOJA 3NFPA 3CSYB 3ZDYF 1BLNB 3MLYH 2CK2A 3NT0A 4JRXE 2RACA 2BVTA 4NWUH 2DS4A 2P5WD 3JT2A 4X5LA 5CU5A 2OXGB 4J8RB 2YKKA 4OJFH 2ED6A 2NY0D 1ZTXL 4P46D 3ULSA 2NY7H 5I8CA 5FB8A 2Z34A 3DROB 1U3HD 3V6FA 4DJMA 4LP5A 1VFAB 1A4JA 5E00B 3DX9A 2BWDA 1KJVB 4K4KA 1KLGA 1OIOA 1OQXA 3STBA 2B1AH 2ZTBA 3UACA 4AJ0A 3O0LA 5C71A 4JFSA 1IM9D 1F3DJ 3S37X 1QO3B 2BIPA 3B5TA 4QOKA 2R1XA 1FE8L 2WMPA 3Q7JA 1R33A 1YEJL 4OIIL 5EWIL 4LEEA 4D94A 2BXYA 2XV3A 4AIZA 3IFPB 2A6KB 4MJJA 4W9CC 4ZS6D 2ADJA 4HW6A 5T33H 1QLRB 2OTWA 5TE6L 3P69A 4PHXA 4NGHL 5I1GL 2WSKA 2K78A 5KVEH 2HFFA 3VGBA 2VM4A 3OAWA 2M2DA 1L0XA 4WHDA 3U9UB 4AUUA 2BNQB 2R0KH 4JHVA 4WGVB 2V8LA 1G6RL 2EC8A 2BSEA 2VDQB 4FAAB 2XXFA 4G6MH 3ZDXE 4NPJA 3ZTJG 4ES9A 4XP1L 5F9DC 1TCMA 5EO9A 2CHWA 1A7OH 4UM8A 2HRLA 3EUDA 1HWHB 5EUKB 5FUCE 4ANVA 3QI9A 2JQZA 4WI7A 2X2HA 2WZ6A 4G8IA 4IMLB 3WG7B 3RWIB 1YMHA 3L3GA 4Q74A 3CQQA 1U8IA 4RESB 2O6PA 1Q9LB 2WCGA 4M1CD 3E9TA 2EIDA 4G1EA 2X9ZA 2A6JA 3QUXA 3IU4L 4GS7B 1PX4A 4HCIA 4K3EL 3R1GH 4FLSA 4HULB 5EZJA 3PDOA 2HRGA 4TSCL 2GKIA 4B9CA 1S6NA 1M57B 4PB9H 2PW1A 1E40A 3KDPB 3QUKA 4IM8A 4WFGE 3C9NB 4N5UA 2K4AA 2IWGA 3QHTC 5JUEH 4Q9QH 3FRPA 4QRPB 3T0XA 3ETTA 2GAZB 1QYGL 1HIMH 2EDDA 4HXBH 4PGEA 1SVZA 2YZ8A 3JWOC 4YSQA 1EAQA 8CGTA 1F86A 5E2WL 3SQOL 3WTSA 3SDCC 2GHZA 3L1OH 1XXFC 3OAYK 3OC5A 4L0PB 4B7IA 3Q8AA 1KXQE 4R7NA 2DQGH 4WJ5B 5ANME 1TUPA 2MNWA 5C3TA 2P24B 1CCZA 2B4CC 3O45B 4HG4K 4UBDD 3UJJH 4QXTB 4LSRL 1OWRM 3WIAA 4J28A 4KTDH 3BUIA 3DBSA 2WVVA 3ARED 3NJIA 4FJYA 3KEDA 3SOTA 3RU8H 4NKOB 3UC2A 1BGXL 1IKNC 3EH5B 3KH4A 1J9SA 2XTJB 3GHPA 1JGVH 3DUSA 4CU8A 5HP5A 2J73A 3GDCA 4MDIA 3ZZSA 1NIFA 5AUMA 4JRXB 1IAIH 4X6DB 3MRJB 3FQWB 4X8CA 3LJ3A 3TN0C 1I3GH 4YDIL 1OF2A 1OHQA 2VDLL 2CO7B 3BP7B 3RWFA 5K9QI 3ZTDC 3OM3B 4JG0H 4XVSH 5E5MA 3ZGIA 4AIXA 2VDPL 4X8GA 1UT2A 4OLYL 4WHTA 4UTBA 3IMVA 1UD6A 4B9IA 2Y24A 4Q9RL 1I31A 4YHIA 2TAAA 1XCXA 1P4LA 4DN3H 1HC1A 4AW4A 5T3ZH 2WLMA 2QZ5A 4YHNA 1XF2B 5LN4A 4W9GC 2BSTB 5M94B 2WGXA 2MNJB 1MLBA 2NYYD 5GHWL 4PHZA 3CDYA 2IBZX 4LRIA 1J88A 5JQIB 1VHPA 2NY3B 4MD0A 1PCXA 4KNTA 1KOAA 2HRPL 4J1UA 1XF3B 32C2A 2FIRT 2B3IA 4OVVA 1K5NA 1I1AC 2FEEL 4I0PD 3ZDXB 4B9PA 1I3VA 1BQUA 4L3AA 1AGEA 3D3VA 3SBPA 3PWUA 1V3MA 4RGNE 2P3YA 5T1MA 2Z4TA 4K3DL 3N1FC 2LV4A 2I9LB 1RK0B 3IJYB 3VH8A 3ZIMA 3VQ1C 1EEUA 2OLDA 1Q9KB 2X4PA 2YQ3A 3QC6X 4CGTA 3A6CH 5I5IA 3Q5YA 5KYUB 1NBYB 5HDWA 4U1HA 1KG0A 2VLRD 4BGDA 3NIFF 3ZJAA 4Q6IC 4W81A 3VXSB 4JEGB 3N91A 4UTBL 3QCTL 5CINH 3HRZB 1II4E 3MRLB 5L2KE 1W0VA 5C9JB 2QLVB 4HXAH 5AOKA 4KQ3H 5L4MA 4PP1D 4E42A 3FU7B 1AFVH 1DN0A 3BVNA 4PJGE 4OSUL 4JLRA 1Q94A 3CCHB 3BUBA 1S7WB 5DHYA 1QPPA 1UACH 2R1YA 1R24A 2BRRH 2GG1A 2VE6B 4KQ4H 5AVQB 4DQOH 3RWEA 4DGUA 1LWJA 2Z1PA 5ANMB 1WFOA 4DAGH 4QHKI 4YLCA 4FG4A 3ARGB 4IOFC 3AXLB 3C08H 4WGWB 4O51B 5IFHL 3ARYA 4M9PA 3IE9A 4OI9A 1A1MA 1MCPL 5HDBF 3Q9PA 3FTSA 4JPSA 2HCZX 2AQRA 3WE6A 2A4EA 1ZLWK 2J5LB 1SHSA 4A2EA 2NSMA 1CQYA 2JB6A 3DGGA 3OMZA 4WU5A 4W4OC 4JG5A 4XN4A 1B4RA 4PU2A 4NDMA 3QDJA 1S9YA 4I1NB 5AW6B 2QL1A 2WQ8A 1SMAA 1XFPA 1GS6X 1SJXA 4JKPL 3UGEA 2WLZA 4HX1A 4IOSD 1KIPA 4YPGB 3RGHA 5I6XB 1OGTB 2XU9A 2GTQA 2XX0A 1SBSL 5E8NA 1K2DA 5DQDH 1S46A 3DIVA 2WXHA 1N0XL 1NINA 4OGXH 3GSRA 5C09D 1N8OE 3FB5B 4QO1B 3VI4F 2ESVE 1F90H 5A2KH 2VQUA 1JFQH 3VTMA 4NFDA 4FZ8L 3EGXB 3LEXA 4WKZA 2H9GA 3OAUL 4NJAH 1D5BB 5EORH 5I0VA 2JCCF 5EZIL 1O7VA 3BC9A 4WHYH 4M7LT 1EGJA 1A47A 3FQRB 3V4VH 3PL6B 5JPNA 2FQDA 3RIKA 3ZMRA 12E8L 1A6WL 3GDBA 4C8XA 3QCVH 1KC5L 1MJ8H 4AVIA 2HTKD 3FFCB 5FKAB 4KZEH 4RDBA 4RGNB 3A67L 3X1EA 4YZWA 3SE9L 2HT2C 4U1LB 2VM9A 4WWID 1FNEA 1H0DA 5D1ZC 3KPLB 4CVUA 2WUCH 3RY6C 2APSA 2OL3A 4E0RA 1BZ8A 3L5JA 4N3TA 4FRWA 5D96B 4YE4H 1S3KL 2HPTA 5KW9L 3FQNB 5GJSL 3MACH 2F7IA 2ZNWA 1V7NH 5KSAD 1DBKH 4YMPA 4FNRA 2OZ4L 3LRMA 5IG7A 1BQSA 2BMKB 5F88B 5E8EB 4B27A 4EZMA 3RIFK 4A66A 1X5YA 4HAFA 5C0FA 3BQUA 1YECH 3EYOA 5FKPB 5L2KB 2ZG2A 4Y0GA 5T1JA 5E5RB 4N2EA 5E6RB 1T1ZA 4FQ2L 4GUQA 4GP4B 1GGBH 1AY1L 4OZHA 4PJGB 2HJFA 3MVSA 4ZYKB 4F57H 1JZFA 2XKNA 4S1QL 2A77L 4PIRF 4WV1B 1MHCA 2X12A 2VUKA 3HMXA 1NBZB 1RZ8B 2QV4A 3P4MA 3CK0H 4JN2B 4QYAA 4NWTH 4TVSa 3VAEA 1JBJA 1ZWIB 3OZKA 4NUPA 3F6JA 1F1GA 4XZUA 1Q38A 4KK9D 5KSVB 4PRNA 4ZNEE 3QZNA 3QG7L 4NBZB 4YQXH 3UBXA 2BVYA 2C1PB 3RZCA 4MAUL 3CSPA 2YD7A 1KTJA 2A6IA 3S5LB 1TVHA 3QRLA 1BZ7A 3V4PH 5LXVA 4DZBA 4ZAKD 2AJVL 2PPFA 3AQXA 3QT2A 4X9FA 4X9HA 3ME0B 4XNYL 1T0MB 2MQGA 5DGQA 4G7VH 5K1NA 3OXRB 3FQUB 4O5LH 1AIZA 4NKQB 4K94L 2Y07H 1WFTA 1QWNA 5DYOB 1CLOH 5FF6A 5I6OA 2VSKB 1YUHB 2DM7A 5F9JB 3QUYB 4C47A 3PNWA 3SDXA 3WEXB 4A7QA 2ZF9A 2X10A 4FC3E 5C70A 4LNVA 1EEYA 1NBCA 1MJUL 1QAWA 4RMBA 3UG5A 2EABA 3OSKA 4CAGA 4DPBX 1PKQB 1YJDH 1MWAL 5GS0D 2ESVB 5E2TH 3CVDA 2EC9T 2QVTA 5ELIA 4UNIA 1JHTA 1AS6A 2IPTL 3T8MA 3M1OA 4L48A 3OJVC 4RQQB 4PJFF 3RPIB 3RTQB 1CPUA 1E6JL 2AS5M 1NIDA 2Y23A 1XSJA 1I4FA 1RUAH 1EFXA 3LZFL 5TK2A 5E94B 3RIAF 4MD4B 3SDDC 2D4DA 2FD6H 3C5ZA 3P9MB 4IBLT 4AMKH 3CSYA 2QSCL 1BLNA 4X4ME 1ZHKA 1DJGA 1Q0EA 1XO8A 1TCRA 2OXGA 1MCDA 1BZEA 1S7XB 3GSNH 4NRYB 1CDJA 3QUXC 2AQQA 4DZ8A 2YD9A 5C6WH 3DROA 4UM9A 1IIIA 3NG5A 4MJ5A 2V37A 3T77B 1NTDA 1F3JA 1SUHA 4WHCA 3U4KA 1ZXKA 4YSSA 4EDXB 3OLDA 4Y1AE 1HKLL 3HA0A 4MB3A 3KPMA 2ZYHA 1AI1H 3OAZH 4HPHA 4BXSV 2PR4H 4LBEB 3H7BA 1V55B 3IMRA 2D0HA 2ATKB 4AXWA 4YGAB 2FQEA 2OBGA 5E2VH 1KULA 2DB8A 3B7RL 4OQTL 3T0EC 1G9ML 1RVFL 2LU7A 5AWNL 3TO4D 4EI6B 3F7VB 2B39A 2R2BA 4R7DB 4QXGL 5FLUA 4OD3H 3L16A 4LASH 1QACA 4NZJA 1BFVL 2KPWA 3GBNH 3U9UA 5ESQB 1E27B 3O6KH 5KBPA 3MOBH 1SYVA 4PJ9D 5LVEA 3BWSA 2BC4B 3CZNA 5DHVB 3MAWA 4XOBA 3SKUD 4ZUTA 5EUKA 1ES0B 5F3HA 4P4KD 4WEUD 5I74B 2CNYA 4ODWB 2VJ8A 2Q6WA 1WFNA 1EERB 4GP5B 3PAYA 1F6AA 1Q9LA 2P9RA 3O4LE 3X11A 4DH2A 3GJFB 5ENWA 3FK3A 1FZOB 1PLBA 4R2GB 1EZVY 4TSAH 4RISH 3QZWG 3VDBA 5D7KE 3QORB 3C9NA 9CGTA 3JWOH 4NOFA 4ZO8A 1NGPH 3AVEA 5D2LF 5FO7B 1FGVL 2KI6A 3IU3B 3ATAA 3K4ZA 5LGJB 4PFEA 2OQJA 4QRPA 2F8OA 3I3DA 2GAZA 1LK3L 2BNRB 1M7DA 4H1LA 2ZOUA 3PP3K 3OR6A 1HOEA 3V0AC 3VRLF 2EDTA 5I75B 3B8YA 5DURD 3L13A 3BPOC 4BUGA 1TZAA 1OLZA 2B4CH 4OF8A 3D25B 3V6OA 1X9RA 2VUOA 4K23H 1FORL 4C83B 1M2VB 3EDDA 4ERSL 1RUKL 1XGZA 4PTTB 4BHUA 1JGDA 1MCOL 1ZANL 2MH4A 1QD0A 3AS0A 4MA3B 1BQRA 5A16A 1FPTH 1MZZA 5IESH 3LS5L 2EO1A 3ZZQA 2G3XA 4BUHA 1XGQA 1BVLA 4DT2A 5B38G 5IUSA 3DYPA 4KZDH 3OF6D 1BSIA 1R6VA 4ZW8A 1GYWA 4FHKA 3NABL 4YHLL 4FNLL 4X6DA 5ID0B 3HUJF 4ADGA 2NDGA 5D72L 2BERA 4G8GA 2VDNL 4ZW6A 5GZOD 2H3NB 3QNYB 4P2OC 3OGOE 2KHAA 1UOLA 4Z95H 4E41A 4ZFFA 3DX0A 3VE0A 2IH1A 1CGSH 3LKQA 4JFWA 5BRZD 4Y1AB 5BO1H 5DU7A 4AM0A 4FG6D 3Q2NA 4NQCE 4PGCB 3JVGC 2MNUA 3FN9A 3N9GL 1YSOA 5F6HJ 3WENA 3MYZA 4P2CG 3K8MA 3O6FD 4IHOB 1QRKA 5IGXL 1G7PA 1MVUB 1AGDA 4AH2A 2KMWA 3CFEB 4M1GL 5C2BH 1MI5D 2B1HH 3HI1A 3I85A 2BSTA 3IE4A 3SKMB 4OD2A 4BZYA 2WVSA 3QQ3B 5GZNA 4EOWH 5DLML 1DBAH 4UB0H 4NN7B 5C0BA 2DWEB 1AR1B 3U4BH 1RZJC 5MERB 5DJ6B 4NQED 2BH0A 4Y2NA 1E3ZA 4HUVA 2F54B 2KPNA 2CIIA 5B1KA 3UXFA 4OZIF 1W0YT 1NGYB 3H9SD 3QQ4B 1EFQA 3AMKA 3C2AL 3QNXB 3QXTA 1TZGL 2AJUL 4JRYA 1A3ZA 2R69A 3TA4D 3I6LD 5A3ID 1F11A 2F1EA 2RCSL 3HN5A 3B83A 1NOLA 2XPGA 4JO5A 5FM8A 1RK0A 3EJCA 5HYJE 3ARUA 3O4LB 4G72B 1MHHB 3VW3L 1WBYA 4TNVK 4MGXA 3BIKB 5KYUA 5JDJA 2EDMA 4GG8B 4X6CE 4DUVA 1H15A 1LEIB 5B22A 1P1VA 2AEPL 5F1OB 5JHDA 4GLRI 3QJHA 1AYOA 5AB9A 1M56B 2OTUA 3F8UB 5E8PA 5DMKA 3VXSA 5CHNB 3ARVA 5KVDL 3BRGC 4PBVC 1YEFH 3K2UH 1EZUA 2HUEA 4F9LC 3LZNA 4KUZH 4WIQA 5C9JA 4OGYL 3BXNB 4O4YH 1UXSB 3HLAB 4OCNC 4PJAA 3C8HA 5TGBB 4ELMA 1PY9A 1ZDSA 5FA4B 4FLHA 3OJ2C 4BBWA 2Y22A 3CCHA 3VFUB 4G83A 2LAAA 4OJDH 1G4MA 2Q7YB 5J8OA 5I1KL 2FSEB 5F2FA 3NIDE 3VD7A 2Q3XA 3L5WA 4D8OA 1RZ7L 3ZRFC 4B0MB 3KGTA 4YSTA 4AZ8B 2R7EB 3ARGA 3MRFB 4JFFB 3MC0A 5K9JL 3T4YB 4DCQA 2R69L 3PABA 1H5BA 3RWGB 3I6SA 3P4LA 3QXDA 4DWHA 4FQCH 1D5XB 5ECGA 2XVBA 2XIIA 3FUMA 4KO9A 3C8KB 3CQPA 4YO0B 4GUOA 2R2EB 2VN6A 4FF9A 2H2PD 1BOGB 1RZIA 5KBNC 1XB6A 1OPOA 2J6EA 4P2AA 4YX2L 2AV7B 2R2HB 2ZT9C 2IVFC 4WW2B 1MPAL 5CP3H 2ZUQB 1OLLA 3QUZB 4LCUB 3UOAB 4DEWA 2G60L 3FQXB 1NAMB 3OWEA 4JQVA 4MWFB 3RJOA 4NQCB 1G1YA 2COQA 3BQUC 3WTWA 1OSPL 5JHBA 2WSDA 4QO1A 3VU2A 4I0KA 4GSUA 3D85D 2IFGA 4DW2L 2IDFA 1T4KB 3HFFA 1WTLA 2PTVA 3OKMB 3ARXA 1F56A 1KCKA 3PXJA 4KMQA 5AOIA 1JRHH 1FO0L 4TSBL 5E6ID 3CMGA 4LEXH 2AMGA 3RP1A 1FZJA 15C8H 1G9NL 1EEZA 2XRAL 3QEHA 1EIBA 2CALA 4HH9A 1C7TA 3STLA 1ED3A 1BYOA 1XTMA 3CVHA 4RFOL 4PQXA 1MG3C 3FFCA 3OXSB 3ZE1F 2DWSA 5TQ2H 2IEPA 3VM7A 2BJMH 2QKIC 3R18A 1DSFL 1RZKL 1AP2B 5DTFA 2VDRH 5BVJA 2DJ4A 2OYMA 4JUSA 3KPLA 3MUY1 4DERA 3BPLB 2HFGH 2EZ0C 5GSRB 5I8KL 2X7LB 4KO6A 4TULH 5HYJB 1ZGLB 4GJTB 4R0LB 5IIEA 5F97E 3ELQA 1B9KA 3X3GH 5C3LD 1J8HE 4H25A 4R5VA 5F6IC 2WBXA 2ZCKH 4X6BA 1RUQL 1J0JA 5F88A 2TRYA 5FWQA 5EC1B 3CQFA 4BQCA 2A74B 2DQIL 5L2KA 3TFBA 5I8EA 3UG3A 4DTGH 2GK2A 2QPUA 1NWPA 1GPOL 1HHGA 1W2KT 4JFYB 3Q13A 5H94B 1QNZL 4ZYKA 1XX9C 5J13C 3BGFB 1YNLL 5B3NA 3BDYL 3QJZA 3RYMA 1V05A 4YDLB 4JN2A 1RFDH 4AKPA 3NIDB 2J8UE 1K4CB 5KYXB 3S36H 3HC4H 3BP5A 1T03L 2FTAA 2P5WB 1OKEA 2CDEA 4PJXF 4UINL 5PAZA 4G2AA 43C9B 3MNDA 3JV6A 3GD1C 3IBOA 2PWFA 3LKRB 3FF7A 2V2WA 2AJYH 2LLGA 1QA9B 3S5LA 4CW1A 2OAAA 1DVUA 4HJUA 4FABH 2E3VA 3DHPA 3ME0A 1UWFA 4OFVA 5KOVC 5J6GA 2W0FA 3OXRA 5DR5L 3FQUA 4A7UA 1OP3H 4KFZC 1I9JH 3U2SA 4APXA 3V0JA 1P1ZB 1PX8A 3HW7A 1NAKH 1E5ZA 4XBEL 4OFYD 4YHYB 5EF0A 5TDPB 3QUYA 5KSBE 5ADOL 4JZNB 4OCXH 1VCBC 3KDMA 4Y4HA 3E2HB 2VDKH 5GS3A 5C0ND 3LKPB 1PKQA