2JQMA

Yellow fever envelope protein domain iii nmr structure (s288-k398)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
112
structure length
112
Chain Sequence
MSALTLKGTSYKMCTDKMSFVKNPTDTGHGTVVMQVKVPKGAPCKIPVIVADDLTAAINKGILVTVNPIASTNDDEVLIEVNPPFGDSYIIVGTGDSRLTYQWHKEGSSIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Envelope protein E
publication title Structure of yellow fever virus envelope protein domain III.
pubmed doi rcsb
source organism Yellow fever virus
total genus 30
structure length 112
sequence length 112
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2007-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2jqmA00
1OKEA 3C5XA 3N44F 3UAJA 2V33A 3G7TA 1Z66A 1ZTXE 4AL8C 2HG0A 5LBVA 5IZ7A 4X42A 4UTAA 4UTCA 1PJWA 4UT9A 5JHMA 1Z3RA 2JV6A 3MUUA 4BZ2A 2I69A 3IRCA 5LBSA 3P54A 3J2PA 3N43F 5JHLA 5H37A 3N41F 2H0PA 3UYPB 4L5FE 2R29A 4FFYA 3VTTA 1SVBA 4BZ1A 3WE1A 2GG1A 3UZQB 5GZOA 4FG0A 3UZVA 5KVDE 5AAMC 1UZGA 3N42F 5GZNA 2R69A 4ALAC 1OK8A 1RERA 3N40F 1TG8A 4FFZA 2ALAA 5IREA 1URZA 4GT0A 2JQMA 5AAWC 3C6EA 5KVFE 5B1CA 2JSFA 4UT6A 1OANA 5KVEE 4GSXA 5KVGE 1S6NA 2P5PA 4AM0Q 3J27A 4UTBA 5LCVA 3UZEC
chains in the Genus database with same CATH superfamily
1FN4A 2EIDA 4U1HA 5F96H 3KH4A 3TA4D 5GGRY 3GYRA 4UV4H 4UYPA 4RH4A 3QR2A 1A02N 2ZPKL 4N20A 3EUDA 3WFDL 3KYMB 1JD7A 4EAEA 2BOBA 3AQYA 2VDOH 3BUYA 2XTJC 3KPLB 5ADOH 3CFEA 3SOTA 2CZNA 2MH4A 4IEFB 4CJ1A 4IKIA 3MV7A 5LG1A 2COVD 4GSRA 4MCZB 2XU9A 1O9ZA 1QFWI 1N6VA 2BJML 4ODVH 2Y69B 1D5IL 5IVOA 1MFMA 5KWYC 2HTKD 3S5LG 1YYCA 4RMVA 3C60B 4N8CH 2J56A 3B2UC 3P2DA 3DGCR 1F11A 3MRDA 2VQUA 4HUWB 4PJAE 2JWYA 4M6OL 4NP9A 2C3XA 1XCQB 4JY4B 1D3CA 2OXGA 5FM8A 1NLBH 3CU7A 3VUAA 5IIEB 5L4MA 4GH7B 5F9JA 1R3JA 2G30A 2EO1A 3BEWB 4KWUA 5FO9A 5K5YA 5F72S 3MUGA 1SXAA 1T89C 3GMPA 4MB5A 2PPFA 4G8AC 3ZKSD 2ZG3A 5A3IC 2QPUA 1NFDA 2QGBA 5DMJB 5HYQB 4LSVH 4YE4L 5HDRA 5JLZB 1E3XA 1KPRB 3WEMA 2GBTA 1MHCA 4XWGH 4OBRA 3KPNB 3MRRB 3N42F 3R4RA 2YS4A 3CZUB 1KPUB 4NJAL 4UM9B 1Z0MA 2AJZA 3SJVE 1SY6H 2V2WB 2ZE0A 1RI8A 3H4HA 3GSRA 3MRLA 2NLJA 4N0UB 5EZPA 4X6EA 4WCYL 1Y18A 5EOTA 2XIIA 3NCBB 3QG6B 4KRLB 4L8CA 1PZCA 3TYGH 3GXPA 4UDUB 4ANUA 2XZCH 1ZHLB 1J0KA 1T22A 3H3PH 3DHJA 3GC3A 4MRBA 4B9ZA 5EF1A 1DEEB 1HXMA 4N4YB 4A37A 3QRGH 4BXSV 1U8OB 1B3JA 3QBTB 3F5WB 5TH2B 1AZCA 5C07A 4QXUH 2L0DA 2G5BA 2WMPB 2O30A 5JR1H 4GBXB 3SGJC 1E30A 2JTYA 3CFQA 1QR1A 4W6YB 4YXHL 5CEZE 5KVGE 2D03H 1IKNC 1JVOA 4I3RH 4I3GA 1CD8A 3GEWB 3MXWL 5D5ME 2PR4L 3BP7B 3GLAA 3RLSA 1OB1B 2IH8A 1KB5A 2G9HA 5KUKA 3KVPA 4A2HA 1IGFL 3EH4B 1HNGA 4LASH 4BDVB 1GMEA 4GW4B 1XTMA 4KK8C 4NZRH 3E2HB 4Q6IC 3RY4A 2D0GA 3MLPA 4XHJD 1AHWC 4P07A 1PS3A 4M93C 5I75C 3GSOA 4I77L 3ZMEA 5GHWL 1FL6B 1MLBA 1KFGA 4GRMB 2PABA 1KXTB 1MI5E 2GUYA 3S35H 4CVZB 1ZOXA 3G5YB 1LD9B 4YIQA 4HS8H 5DJZB 1ZY9A 2EIZB 3NG5A 4UOQA 1NL0H 3FUHA 3ZYZA 1BZ9B 4BFGA 5KBLA 2WNXA 3GZPA 3GB7A 4KI5C 1E6JL 5CILL 4NM4L 2VM4A 3WTSA 2GUOA 3LXAA 3PGDA 4RAUB 2BNRB 1MEXH 2HA1A 4YPGB 2CDEA 2NW3B 1UGNA 1OAUH 1LO3L 1AGEB 2OS7A 2WQ8A 2TAAA 4JM2D 4LSPL 3LQZA 3TO4C 4PRHB 1U8MA 4CW1B 2E27H 1QKZH 1G0XA 5TQ0H 5B8CB 3KVDD 1G4MA 3ABGA 2N0KA 2YD0A 1CLYH 3GJFK 3KLKA 3NDYE 4AITA 4WV1A 3UC0H 3NFNB 4LVNB 1E3ZA 3JWNE 1XVSA 2BXZA 2AEQL 1BOGB 3BUIA 4LRIA 3CVDA 4QYOA 5CJOH 1MW3A 3NH7H 5JIKA 4FMVA 3SY0B 4BQCA 3DGGB 5KSAD 5D1QA 3ULAB 4JRYE 4PMFA 4FZEL 1D6EB 2V2XB 4U3SB 5IESL 2A73B 3L9BA 4DP4X 2QKIB 2FWOA 3CVHL 3SGDI 2VMCA 4G8EA 4NWTH 4B0MB 5L88H 1NAKL 3CVCA 3S36H 2N1TE 3INOA 2VSDA 4XAKD 2MKLC 3O9WA 2A6DB 5K1JA 3GHPA 1UOLA 1KIPB 2CK0H 3CC5A 4Y4HA 4NC0B 3WMPA 3FYIB 4HU8A 1TF4A 3T0EE 1P1ZA 4ZS6C 3HE6C 1U3HA 2XWBA 3Q6FA 2KDYA 1VSCA 4PBWD 5FC9A 3T4AA 3WIHH 5FO2A 5ACZB 4H0GA 4PJ5B 3VRIB 3QSKB 4DK5A 3EYUL 1KELL 2HT2D 2OZNA 3VXQA 2GJ6A 5AYTA 3TWCL 3FUMA 5ID0A 3ARRA 5T3ZD 3Q5TA 4HHAA 4IK6A 1W72L 1U21A 5I5RA 3FZUC 3X1FA 2YOCA 3RWIA 1OGAE 4LSUH 3LXCA 2DBJA 3KPRA 3X3FL 1BQRA 4OFVA 4JZJA 4L8DA 2N4IA 2J20A 1MCOH 3CMGA 4G7YH 3L2MA 4P59H 5E2VH 3LKOA 4WWNA 2E6QA 5DA4A 3HMWL 5GS0H 2W0FA 4ODXA 3U7YL 1JDAA 1RULL 2P1YA 1UXWA 1WBZA 3HG1D 4WW1B 4KUCD 5TGBA 1QLFB 2WLLA 1OCOB 2FQFA 2F61A 3CLFL 1Q4NX 4Y9CA 1EFXA 1MY7A 3VXSE 2CUAA 4MNQD 1RVFL 3PP3K 2XBDA 2ATPA 4H8WC 5C6TL 3LH2H 2ZSWA 3QA3B 4K7PL 4WWOA 3MA9H 2P42B 3CFJB 1CWVA 2FHBA 2YD6A 2XXFA 5HD8D 5J56B 1W6WA 5G2NA 5JQIB 4TQ8A 2NNFA 4Y5VC 1EPFA 4LSQL 1M42A 3QXVA 2EIMB 4LRNL 3L5JA 4NGHL 1MIEL 4HH9B 2ZUYA 4OD2A 4HZAA 4JFDD 4U1NA 2H0PA 1QPXA 3QO1B 3QQNA 2OFQA 5L4FA 1EEQA 4Y2OA 1NPJA 4U1GC 4IGBD 3PV6A 1O6TA 1RZKH 4N2KA 4ERSH 5KN5B 1SLVA 1HKLL 1HZKA 1AKPA 4Q52A 1DVFB 2BP5M 4LLQA 4HYTB 3SKMB 4GNKB 4LLVA 3FFCB 3LKQA 5H94B 5D93C 4F37K 4LXFA 1DQML 3IDNA 3LD8C 4QKTA 3O4LD 3CG8A 5EV7A 4NKMA 1RUML 4HPYL 4LKCA 5JW4Q 2J4WL 3HG2A 4W1TA 1GYWA 3D69A 3HBZA 1KPVA 2ESVD 2HKFH 1U30A 2NNAA 2VKXA 1GKOA 2CM5A 1OARH 4YWGL 4QJ4B 1KXVA 4CU8A 1N2RB 3FCTA 1LEGB 1S9XB 2DOCA 2PYFA 2ZKWA 2IAND 3VFMB 4L8SB 1EO8H 3HC4H 4D9RD 5FA4B 3TZVA 1TZGL 2KZBA 3FULA 1OXYA 2GITB 3L17A 2ENSA 5CUSL 2BY2A 3H9HA 3SKJL 2ENPA 4JFEA 1M6OA 1DQIA 3I9GL 5IW6A 1EZLA 3FO0H 3UFIA 3IGKA 1YEIH 1QSEE 2EADA 1XV8A 2CPCA 4R9HA 2IGLA 4XVSL 5E2TL 4LFHG 2YAFA 4G43B 3MYJB 1VESA 3TN0D 1FFQA 2QL1A 2BSRA 1JF1A 3BSZH 4RIRB 5SX5K 5EUOA 3H9SD 1A4JA 1TQSA 4A7GF 1WZKA 4HWBA 1CICC 4YSRA 2OMVB 3VMPA 5B3NA 2VKWA 3NJNA 1UACH 4X5XB 3SYCA 3UZEC 1INQA 4Z7OE 1MNUH 4UQ3A 4AH2A 2IXQB 4MWFA 4Y1SA 4YDKL 1EHAA 5MEPB 1CZ8L 4F57L 1CTOA 1WFOA 1J86A 2QPSA 2VR5A 1Q72L 4LSTH 4HEMA 1A9VA 1W8EA 2PXYB 3SDDA 3I02B 2JI2A 4POUB 2OULB 1CLCA 3QQ9C 2ZXGA 4FL4C 5I8OH 1XF5B 2BSEA 4OKDA 1E9PA 1VPOH 2AJYL 3D34A 3C8HA 4PLNC 3QEQB 4E0RA 3VVVA 2VMFA 2YMXL 1BZOA 4UU9A 1OSPL 4UTCA 3BAEH 2Y1AA 4Z5RB 1YNKH 2LLLA 1NMBL 4MA8H 4GRLB 4F7MA 1WFUA 1KY7A 3X2QB 4A55A 5E08L 1NC2D 3U36A 4IYKA 4PJ8B 2GTWA 1CYXA 5L0QC 1KJMA 2CALA 3VXNA 1OSZA 3UMTA 3V10A 2J6EL 1D5MB 1TYRA 5AB0A 2EE3A 4ELKB 3LEXB 3QZPA 4OUUB 3CZJA 4L5FE 3KDMB 2D4DA 3F6LA 4W70A 5CF3A 3IMVA 3G5VB 1QLEL 2ICEA 4V1DD 2DH2A 4FQ1H 2OLDA 3T2NL 1HH6A 4R7NB 1I7ZB 4XOBA 4NXKA 3ZE0B 3IDIB 5IG7B 1I3RB 4GP5B 1Q9LB 5T5NF 2GSIB 3KEHA 1KEGH 4N2NA 4YDNA 5C71A 3HZVB 1ZLDA 3DTDA 4PGBB 1OAQL 4AGNA 2RFXB 3LIUA 4IHOB 1U8PA 2D4FA 1CK0L 2WNWA 4Y2LA 5I0DA 4KPHH 3ARBD 3GZKA 3NFSH 2ALAA 1EEYA 4UTBL 5ABAA 5SWZD 5FFGA 4MA1B 3MJ9A 4PTUB 5D7LB 2EE2A 3ET9F 5L2KB 4LHUG 1PYWA 4APQC 5IHUL 1QFWM 5GIRB 2ZXBA 5J1AA 4X6BA 4YOKA 3DO7A 1BQLL 3ZJAA 1A5FL 1KGCE 6TAAA 3GDBA 1YDPB 3U4EA 3PJNA 3IAQA 3W56A 3K8KA 4ICXA 1QBMH 4NRYB 3QIBB 1P0SE 4K9EH 1MWOA 3BDYH 4NQED 3B3IB 2MQ3A 3QUHA 4ZO9A 3CVBA 3QIWA 5F3FA 2CO3A 2HVJB 4QRSB 1NA8A 1GRWA 2G2RB 1TIUA 1YMMA 3PQYD 2E46A 3GMMA 3SOBL 3EYFA 3FQNB 1XXFC 3QO0B 3KLLA 4KTYA 5IMKA 3MOQA 1VFUA 2FEDC 2WBJD 3GKZA 4GAJH 2ICWB 1AJ7H 3DKHA 4WI7A 3ZKXB 4KZEH 4FGMA 3DBXA 3UERA 4Z76B 2R4RL 2W9LA 4LAQL 2DMBA 3VFOA 3LEYH 5JHDD 2VAAA 1FZOA 3BKYL 3HFML 2APSA 5CP3A 3UAJA 5BQDA 2F5AH 5FHAL 5A1AA 2ZUXA 4WRLA 2WXGA 3BW9A 4XMZA 1TZOA 4N6RB 5J6HA 2JIXD 4RFOL 5B1JC 1UWGL 1T80A 4K9JA 3MROA 3TTSA 1Z5YD 2OCJA 2IPUG 3Q3GA 4JQIL 3FRPB 3FCUB 1TFPA 2ICES 2V4LA 2XLLA 1ADQH 1CD1B 3F7KA 4K2UH 1EZVX 2BERA 4JCWA 4KX8A 4XVOA 1ZVNA 1HHIB 4BZ2A 3V4PA 4APXB 1E8XA 1GCYA 1FE8H 4F91B 3RWCA 3ARED 1K6QH 5DLLA 3DMMA 1J8HB 1C08B 2P52A 1NGXA 3QGVA 5E6ID 1T0PB 2YC1B 1H15A 5T5FA 5E2UH 2G3NA 43CAB 5C0BA 1QI5A 1WAEA 1I9IL 4N9OB 3V0IA 4M5YH 3SE8H 1T0OA 4MMXC 1QBLL 3MV9A 1WF5A 3C8DA 1YEGH 2D0HA 3EBAA 3NACL 1R5IB 5EULV 1UKTA 2MTAA 3LIZH 3Q5YA 1XT5A 2MHAB 3FMGH 2AVGA 2GBVA 5L4JA 1NGZB 2EUXA 1R19A 2R0LH 4FFYH 5IT2H 1JXFA 1E50A 2YKKA 3UBHA 4JFFE 4M61B 5HI3D 4HUXB 1N59A 4I87A 2H3NA 4P3CH 2X6BA 5D72L 4ALAC 5JPNB 3LB6C 3LPPA 5IB4A 2ENJA 3QZWG 4YC2B 3QUGA 1WA1X 3ZOAA 1NIFA 3P4LA 4Y9FA 4ORZC 5DJAA 4C4BA 3X3GH 4PLJC 2H6OA 4CGUB 1I8MA 3EH2A 4NHCL 2GBAA 1LP9B 5I0ZA 1JTPA 4IRSB 1DQQB 4UB0H 4ZJ9A 4OF8A 5LVEA 5I2IA 5E8EA 2ZCHH 5CJQH 4NKDB 3UBFA 4HW6A 2DM4A 5I6NA 1DDHB 1S7UA 4R7DB 4LEBA 3RJDA 4AQ1A 1KCWA 3WNJA 2R1YB 4POZD 4XPBL 1T1YB 4TL5A 1PTZA 2KH2B 1J8RA 3O8XA 3SE3C 4GXFA 5CKGA 1HJCA 1FH5H 5BO1L 2I7SA 2IQ9H 4RWYL 3DX0A 3EOYG 2IGFH 3OX8A 4DEPB 2ZJSH 4G70B 2LLGA 1JUFA 3H2QA 4R0LA 1UOVA 1FFNB 4Q74A 1XEDA 4NAMA 5F93C 5E8NA 1TKWB 5IFHH 4M5SA 6FABL 4PJ5E 4LLMB 4ONHB 3FF7A 5E0FA 3T6XA 1GZPB 2AXGB 4N5ED 3RWHB 4QOKA 4ZNEE 1P4BL 3EFFB 3FW6A 2VDPL 4FQPA 5C09A 3QHFH 1BHGA 1YCSA 4DP0X 4NO2A 3OLDA 4Q4EA 1DQJB 1S3KL 3QULB 2CLVB 5EU6B 3T9WA 5ADPL 4G8GB 1M53A 1X6NA 4J3XA 5CBAA 5HDOA 5EN2B 3PHAA 5DO2D 4EDWL 3TBVB 3VFVB 3ZE0F 2DIJA 4K7FB 4EZKA 1MFCH 4G9FA 5KSVA 2V7NB 3QZMA 3BVVA 5C2UB 5DJ6B 3QCUL 4LOEA 1TTBA 5CSBA 4F15B 1HOCA 5J06A 3S5LB 2BP8A 4WW2B 2P5WE 4LNRA 2BSBA 5DYOB 5GZOC 1BZEA 1Y1DA 4GKSA 2LQRA 3TA3A 5DRZA 4UIMA 2IWFA 2EYTA 4AMKH 2G0KA 1KCUL 5DRXB 1I1FB 5KYNA 3A24A 5DD0L 4Y9GA 4QTHB 3QQ4A 1NIEA 1UCBL 4PIRF 2G4EA 1T7YA 2NQ3A 2NQCA 1WRFA 4LLYA 2HN7B 2XICA 1KLFA 3DHMA 3GRBA 4WIQA 4FNTA 3VGDA 2P46B 4ZO6A 1CMOA 1W6LA 3IMWA 4KZCA 4OV6F 5GZNA 2NXZC 1OOWA 3G04A 4PS7A 5KTEH 4GAGH 2ROYA 3FB8A 4P2OD 1WLHA 3ML9A 1B3IA 4JG1L 1BMZA 5ICYB 4CKQA 2BINA 3FFCE 4JZNB 3LRKA 3FT0A 4O4YL 4RMQA 1MCDA 3BKCH 1TR7A 2XCMC 4NLHA 3QUZB 3QUML 1R0AL 3VD0A 4NFCA 3W0WA 5FKAB 1UM6H 4DHLA 5LDUA 2VLKD 1J1PL 1E4XH 3OMIB 1NFIA 2XXCB 3QWOB 1LLAA 2H8PB 3TJEH 1DQLH 2Z7UA 3FQ2A 4AYSA 4DQOH 1EEUA 5CR8A 1QSZA 5C9JA 5L7XH 1J9CT 4B53A 2CJUL 4CBZA 5EO1A 5AG9A 3Q5OA 1PG7W 5ETUA 3B1TA 3L4XA 1LO5A 2JELH 3BPNB 4KQ3H 4J3VA 3FHAA 3FTSA 1U3YA 3DVGA 4J4PD 1ODUA 3ZDZE 2R0WH 2PYED 5I1LB 2R23A 3QJVB 3MVSA 1XL4A 4P57A 4CJ0A 4GW1A 4LL1A 1RUAH 4Z8FL 3I9IA 4RZCA 4F9PA 3C2AL 4P4KA 4LCWB 4E9VA 4PYHA 3V0GA 5ANMB 3LKRA 4WWKB 2CM6A 1QHPA 4IMKC 1PZDA 2R83A 2XTJD 4O2FA 5DUBA 4F58L 4KGLA 5HJBA 1FO0B 4AVJA 3KWWA 4YH6A 3CTTA 5L8KB 5J11C 2FH8A 1F1AA 2WQAA 2ZYSA 4HS3A 3EAKA 3O6ML 4U1IA 2LTQB 4UNVA 3FT3B 3ABZA 4FZ8H 5GGQL 5CCJA 5EC1B 1H3VA 5JA8B 2Y7LA 1FPTL 3C9NA 3BYTA 1JI1A 3PGCA 4KNQA 3K72B 1FRGL 2XZQH 4Y2NA 2NZ9C 4J3OD 1BZDA 3MJGX 5CZXC 4E2OA 4QHLB 2W95A 1GC1H 2VXTH 1IGJB 1R4XA 2WW8A 4KK9C 4HD5A 4JO2L 1AC6A 2DM3A 3HE7B 3PDOB 4X5QA 3T0XA 4ADGA 2FATH 3BESR 3LRSB 4GKLA 4LP5A 4BA0A 2KQMA 2Z91B 7TAAA 3VGHA 4FNLH 1KBGH 1RK0B 1C7TA 5TDPA 2CRYA 1LP9F 5KYUA 3PL6A 4JCMA 3PJSA 1J0ZA 1IEAB 4RBPK 4KXAA 4LOVA 2Y7MA 2NQDA 1CB4A 4XCNA 1IBFA 3RWJA 3T6VA 2G5UA 3D3VB 4FFTA 4AQOA 5A3ID 1FCGA 2P5EB 5DFTA 1M4KA 1C12B 2BIMA 3GLEA 3PAUA 5CINH 5C3LD 1DBJL 1Z9MA 2PO6B 3QHZL 1TQBB 2K78A 1CF8L 1VFAA 2A1WL 1C16A 1G6VK 2MOGA 5CIPA 3L9EA 3CQQA 4FTVA 1L9SA 1A64A 1QASA 4N2LA 3RWEA 1PPIA 2OYMA 1B0RB 4M1GL 3BEVA 5DQJB 1ZHKA 5FW6A 4PJCB 3FCBA 4ZD3L 2Q8BL 3L3HA 1F2XK 3BAIA 3DV6B 4Y2DB 4F1SA 3HA0A 2FDBP 2WQXA 4S10A 4XNQA 1JZ2A 1BVKB 4NC1C 4XXDB 5CJ5A 1ETZA 2V8LA 4Y4KD 1A1OA 1R3HB 5I9QC 2F5BH 2WYZA 2DM7A 1I3UA 1FNHA 3DRTB 1IC5L 1J8SA 1TEYA 1JRHL 2WUCH 1U8HB 4ODBD 1N8OE 4P3WA 3OKMA 1S9YB 1UD5A 4G80A 2WVUA 4JR9L 4U6XB 3R7QA 1H0DB 4PI0A 3DHPA 4JREB 5D7LE 3MR9B 4MCNA 3TVMC 3HMXH 3VFGH 3SDAA 1IJNA 4M48H 3M1CA 4KXDA 3BJLA 2HWZL 2VQ1A 2F8OA 4GINA 3VQLA 2YA1A 4Z7QB 3NN8A 3NPSB 2F2HA 4WW2F 2O1AA 3PWLA 2DYPA 3FS9A 1YJDL 5LB1A 4FXLA 3MRJA 1MN4A 3FO2A 1OLZA 4HP5A 4MXQD 5D2NA 3TH4T 4EN3C 1KN4H 4P2QB 2WAHA 4NO0A 4KZDL 4XBMA 3EFDH 1S2EA 5CN2A 2ICWI 4FFVD 3AB0B 3QI9C 5ALBL 1ORQA 1PD6A 3GLDA 5EBWA 2AHIA 2M83A 3NZUA 3WL9B 2Q1EA 3WFZA 1UHVA 3NJHA 3V5KB 4A6YL 2KC0A 1I1AC 1M56B 4XWOC 2VMDA 5EEYA 1RPQA 1RZ7H 1XH3B 1A1MB 4W9IC 5AYUL 1KNOA 4GAFB 4O58L 4KI5D 2NY0B 1I7RB 3FT4A 1SEBA 1EMTH 1KYDA 2Y72A 2NZIA 4R90L 4A38A 4NZDA 1WHPA 1IGIH 1TO4A 5EWIH 3P3UA 2C1OA 4URKA 4HPOH 2GCYA 5HI5C 1U8CB 4OCYL 2X9YA 4W68A 4TULL 4JM4H 2P28B 3WEAA 4ZUTA 4Q56A 4R8WH 3SDYH 4ISVA 4YQXL 4HKJA 2V17L 3ARGB 1P4LA 4AKOA 3QDGE 2HG5B 4LOFA 3ZPDA 2RMNA 5BS0D 4ZFOA 2P24A 2ITEA 1USZA 5GGVL 3TYFA 3KJ6L 5EC2B 4X5LA 1IAOA 1IMHC 2F19H 4FNPA 1CF1A 4GRWE 1YPZB 3RPIA 3ARFB 3T71A 2BSSA 2ADYA 3BZEA 1ZHBB 3EHBC 3BH8A 3BCDA 4B3EA 4UQBA 4QCIA 3O4OC 4J3TA 2FX7H 3VRJB 4XMPL 3GMRB 3ARDC 4OGQC 3WEOA 3ZTJG 4D3CH 1LO0H 1S9KC 1I8KA 1JPGA 1RZIA 5HSFA 4Y19D 1PDKB 4YHLH 1X9RA 3VQMA 3TEWA 2HTLD 5HI4C 5TF1H 4XC1H 4JS7A 4D8PB 4K94H 4ZS6D 1Q1JH 1QMUA 3HE6D 2XTLA 4U31A 2NX5B 5BOJA 5TPWL 4A68A 1JD9A 1ZLSH 4B27A 1P5UC 5GGTL 4UAOC 2J5WA 2CBQA 1QNZH 5D8JH 1MJ8H 1TVHA 5FCSH 3V52L 1HEZB 5FAAA 2HPTA 5IVZB 5GS2D 5TK2A 5A43C 3GMNA 5D7KE 1LP9E 4WK4B 4TUJA 3UACA 4FAAB 3GBMH 1QNIA 4HIXH 2HRPH 2XDHA 4PGZA 4PJAA 5JQ6H 1KV7A 4OM0L 2OL3L 3FZUD 4FE9A 4G9DB 3DYMA 1UJ3A 1PZ3A 3C09C 3QDJD 2GSGB 1NCDL 4S2SA 2ZWYA 3EYOA 4N8VB 1L6XA 2EH7H 3MCKA 1V55B 3VXRD 3KL5A 1DVUA 1G7IB 1JZEA 4LQFL 4MDIB 5IFJB 3WS3B 3ZTJH 5FYKE 3EGDB 4FNRA 3O11B 3QUXB 1MW1A 3TCXA 2OTUB 4XP4H 3G7TA 4E9WA 1HHJA 4UCFA 5ITBH 2K4WA 1QLRB 3FT9A 3H3BC 4LSRL 1JI2A 1L5GA 4QKXB 5HYIA 4KO7A 3EDJA 5F7KC 3OJDA 5B39B 2KL6A 1M71B 5EEXA 1JV5A 1QRNB 4OJDH 1N67A 1UM5H 3SBRA 1O7VA 1NANI 2HT3C 4HBCL 3SJVA 2YN3A 1NKOA 3DIVA 1NJ9A 1XH1A 4PB9H 1JDDA 5KYWB 5E99L 5EU6E 3OHXB 2BPBA 1F0LA 5J7CC 3HS0C 4G8GE 1DVTA 1MFEL 2L7UA 4A1RA 1C8QA 4B0MM 3QJUB 5D9SB 4BFIA 2D3JA 1WPCA 4AUJA 4D9QD 5EB9A 1E67A 1W72B 1G6RL 2EDXA 5KZCB 3TFKD 1IZJA 3ULUC 4O9HH 5HGHB 4YHYB 3EF7A 1KTCA 5AOLA 5BVPH 4RETB 4PP2A 1NGYA 3OKEB 3U7WH 4ORGA 3L3GA 2IQAA 1AY1L 1MIML 1R24B 4G6KL 2JVUA 3RYMA 1M05A 3F65A 3CHOA 4P5TC 3T09A 4BRJA 5FX3A 2Q2EB 1LK2A 5D5MA 1RSFA 2E7LA 2UYLB 3QORC 4HSQA 3BOVA 4U6TA 5DRWA 2ETWA 4FQCH 1MHPH 2IWEA 4LKXB 1RUPL 4BIKA 5AVTB 4Z7QF 4OV5A 5HGDA 2LR4A 3QC5X 5JW4R 2CE6A 1C7SA 5AOMA 1E5BA 2IH1B 3EBGA 5F0LB 3WFCL 4JFQB 5DJYB 2JK5A 3IJ7A 2OJEB 5T33L 4M8QB 1MFBL 3MZTA 4NQCD 5ILTL 3U0TA 2K3TA 1P9MC 1KZQA 5DD1H 4GB9A 2FHFA 2IH3A 1RP8A 2QSCH 4PAZA 1MXGA 3OC8A 2AK1H 2MCAA 2KUTA 4HDIB 2WJ7A 3HJEA 4BJLA 3CH1A 3IU3B 3MJ8B 4XVTL 1PZUB 1R9FA 2ZZUT 2CKBL 3VG9C 2YPVL 2AP2A 1L7TL 3BD3A 4QRPD 1KCBA 4FCAA 2XFXB 1CICD 3QDMB 1NCIA 3IJYA 4HK3N 1MRFH 1ZCRA 1R47A 3CIAA 1NDGA 3E7JA 4OI9A 1TLMA 4JFXB 1D5ZB 4M7KL 1A6WL 1DFBL 1TFHA 1JHKL 5BRZA 5LCVH 4UF7C 2AV7B 4BM7A 2VUOA 3IJ8A 3RU8H 2WUBL 3K6IA 3VWJB 2NXYC 1FZJB 1QYGL 4XPAH 5F9WC 4ZPVB 3HPLA 4HV8A 2BVPB 4NUJB 1ADQA 3BD4A 4M1DL 4B7LA 2OCCB 4PY8I 1U2CA 3BWSA 2CCLA 4A63A 1MQKL 1CIDA 5IB5A 3GPEA 4LCWE 2DAVA 3U1QA 1HK6A 2DN7A 1OTTC 3MTXA 3MV11 4PW3A 4JRYA 1YPZF 5ANME 2BNQA 1CFVL 1NAMH 2FD6H 4BE6A 1WZ1L 4FNSA 3KH3A 2DQFA 4YK4B 1E8WA 2ZQKA 5T1DH 5KS9B 2Q8AH 1G9MH 3E1F1 1OGTA 1IL1A 2CDGB 3BP6A 2BP0B 4FQQA 1LO2H 5KOMC 3ULSB 4G7QB 4XE0A 3VFWA 4EE2A 2YAQA 3T65B 3T0EA 4OJYA 1JZ4A 4H20L 1S5HB 5ITFB 4FFYA 5JZ7D 3BWUC 4TVPD 2V6HA 3CFKB 1PY0A 3B7YA 4NYLA 3CU1A 1N0LB 3M7OA 3DGDA 3W5MA 3ILQC 3Q2NA 3MLYL 4FG0A 4HUNB 4TNGA 3IE4A 1SJEB 3MA7B 3NTCH 3P40A 1ZLWK 4DW2L 3GBLA 3BQUD 3UBXA 5HPOA 4OD3L 5EZLB 3I6KB 4KJQC 4E68A 1H5BB 1E4KA 1OGAA 3DXAD 2VR6A 1GGBH 4RMWA 2Z8SA 3D3VE 4ZXBB 3O6FC 4OB5H 2P5EE 3DUUA 5DJCA 4OLZL 5IB1A 1SJHB 4RISH 4WEBH 4JO1L 1VEMA 3L8QA 1TU2A 3BPLC 2DQEH 2ED7A 4HFWA 1RZJC 2F53D 5MEND 2EDWA 1AQDB 3UABA 1D5BA 4PJCE 2AGJL 3C87A 4OM1H 5E4EC 3H56A 5IHHA 4ZDHB 4LP8A 2DQUL 3S8WA 1OO2A 2XVKA 1SXBA 4O51A 2XY2A 2YPLE 4DIXA 2J21A 4FCHA 1E8ZA 5T1LB 5E6UB 3NBNA 1E90A 3PHQB 3MRFA 3GJEB 1OCZB 3LZFH 4KKBC 2VLRA 3VXTA 5I19L 1QLEB 1LQSR 1SUHA 3IDYB 1XGUA 4WKZA 3AITA 4AI7A 4CL7A 4LLUB 1D9KB 2DJ4A 3QEHA 4NQDA 1MJJA 2EE6A 2W60A 3B7SA 3Q48A 4NPKA 4P5KA 2E74C 4KRMB 2LAGB 4LHQB 1G7MA 5EZOL 3QPXL 3FN0L 3MUHL 4JHAL 5D96B 4AV0A 1EO5A 3WE6B 3KMDA 3CPLB 4MNHB 4Z7QE 3DRQB 1RSYA 4IRJB 3RWDB 1FI8C 1QPPA 4UDTB 4R2GB 3RFRA 4P5MA 3SPVB 4X7SL 2EDYA 2YD2A 5TE7H 4K7PX 4MZ2A 2C1PB 3WN5C 3QUKA 4P2QE 5DVPA 2CPUA 4FQ2H 2WTRA 2YEZA 4U0QB 2DQJL 1J9SA 3NIGB 2RGSA 3AU1B 3B9KA 1S7QB 2DWXA 3BFWA 3RZCB 1DVZA 3C5SA 4Y4FB 1EAOA 4NDMB 2J1ZA 2V9RA 5EA0L 3FH7A 2YAOA 4YGVB 3AT0A 1CXHA 1VGKA 5F9DC 4AYDC 4WUUA 4ZSOB 1BFOB 4LVOC 4DN4L 4XMKH 5CJ8A 1YRKA 5IMMB 2Z92B 1A1NB 2WKGA 2SEBA 4L9LC 5EU3A 2P44B 4X8JB 4PRAA 1XGPA 5AOJA 5GSVB 2DLTA 4EIZC 4MAYC 5SV4A 5G5DB 1JXKA 2X0WA 2BC4A 3K4ZA 1JZGA 5IB2B 4ODUB 1ID2A 3ASWA 3F3HA 1AXTL 4WV1C 3LB6D 3MBWA 1ACYH 3PNWA 2QBWA 1F4YH 4RX4A 4A7VA 5JOFA 2F18A 2V7HA 4FQXC 1FFOB 4XXWC 1P7KA 2HJFA 1GGCL 1Y1UA 1Z6JT 3E9UA 3C75A 3KR3H 3TOPA 1JNLL 4WDIB 1HH9A 2W81C 3QEUB 4DZ8B 1E9OB 1FJ1A 4L37B 3OTTA 1ZVSA 5LGHH 4JHUA 3ZTNL 2VZ3A 1NUGA 1LEKB 4N9GB 5F6IB 1D6VL 1YPZE 3WIFA 2WSPA 3TEZA 3RDTA 1T2QL 1FHNA 3EF4A 4GKZB 2HKHH 2EDEA 1WFNA 1BQHG 3KXFB 1JTOA 3FTGB 2GFBB 1UKQA 4N0FB 1NINA 3GM8A 1TSHA 2H2SC 3FTUA 2J8UB 2DLGA 5LQBH 4XNXL 1F2QA 3T0BA 1T21A 2Q7YA 1M1XB 3KPLA 3EADA 1M2OA 4IEFA 2NX5E 1FNSL 3T6ZA 2H0EA 3AG1B 1WCQA 4MCZA 3BE1H 5KVDH 1XIWD 1YQVH 3FO1B 5HHQA 1C5BH 1OKEA 3DIDA 3FBKA 5KS9F 3HBQA 4FABH 1TTRA 3QZNA 1ETJA 2K3HA 4DKEL 3C60A 4X6DB 2WN3A 4HUWA 3PYCA 2Z93A 2O5XL 3AFLA 4DZBB 4JY4A 1D5RA 4JJOA 1ID5I 1DE4B 1SHWA 1JGVL 1JJUA 1XGYL 2DICA 3OZLA 4ONFL 3ARTA 2YPKB 5LGJB 3G9AB 2K7PA 3ASNB 2AXWA 2VN6A 5DYFA 5A6IA 3V0WH 4L3ED 2JJTA 2FUTA 4N6QA 1TMQA 2ZWLT 5HYQA 3QYCA 2OR8A 2VH5L 5E03A 5GZOD 1QW8A 2A74C 1KPRA 4HC1H 3BP5A 3O3UN 3WGUB 4EOWH 1B4JH 4JY5L 4KH2A 4EI5C 1CLZL 1E5AA 2VXVL 4YHZH 1IC1A 4G6JH 4XMVA 1I9JH 1ZPLA 4JKMA 1QRNE 2PCXA 4N85A 4UM9A 3G5ZB 5AVVB 2V2WA 4QF1B 1XGZA 1HZHL 1CGUA 2UWEB 4WTQA 4LLWB 1OE3A 4N0UA 4D2NA 1XHHA 5C2BL 4XMWA 4XN1A 1RH8A 3QG6A 4R5TA 3U46B 3B2VL 4UDUA 3LS4H 4QNPF 1ZHLA 3BPOC 1IC7L 1OWRM 5EBLA 1SXNA 3MBED 5EIQA 3SKOB 2VDPB 3LX9A 1A6TB 1DEEA 2ZXAA 4H13C 4MXWL 4NQTA 1MCRA 4FHJA 5E94B 1U8OA 4M62L 3F5WA 5TH2A 1FLTX 3LKNB 4Q6YA 3ZSTA 4GBXA 1H3PH 3V0JA 5LBGA 3X13B 4LARL 3Q7JA 2QVMA 4JEGB 1T0NB 5DMGD 2UUDK 2OYKA 1UZ8B 4AJVA 4BWUA 1FYTD 4JPKL 5B3SB 2NR6D 1U95B 2ZX5A 2NY3D 4FQLH 3BP7A 4QUOA 1OB1A 3N5AA 3MDJA 2HH0L 4M4RB 5H8DA 1X4YA 2MCG1 3RZWA 4Z6AT 3MLVL 4OCWL 4BDVA 2VWEC 2VZUA 3C5ZC 5TQ2H 1PVHA 3O6KH 3MNMA 1U6AH 3BKJL 4OGZA 1Z0NA 2F74B 4Y8AA 3WOVA 2ADGB 4EI6A 1FL6A 3C8KB 3L3IB 4HIQA 3AMLA 4BH7B 2FO8A 1KXTA 3NIGF 3BJ91 2X4RA 4CVZA 1E43A 3LZPA 1C8PA 4I1RA 4QXVA 1MVUB 1DJWA 1LD9A 1NICA 1NUNB 4MMZC 1AXSA 3HI5L 2GT9B 1BZ9A 4UMSA 1ANUA 2WXMA 4A7GA 1I9EA 1AO7D 1RHHA 2CRMA 2JKTM 4Z0BL 3E0GA 4HCFA 2F8XC 3QDME 2AFNA 5AW6B 4RAUA 2BNRA 1S7WB 4BUQA 4YPGA 4JQVC 3WJMB 4F7CA 1CDYA 1AGEA 1U42A 5E00B 4AL8H 2NCEA 3QUMB 2CBMA 5IBLC 1SQMA 4PRHA 2FBRA 2ZF9A 4CW1A 5GPRA 3FCSB 5CZXD 4ZAKB 5B8CA 2BCKB 1B2WH 3WS6A 2I9LB 4L0YA 1Q0YL 3ULVF 3CFTA 3CXDH 2JJUA 1G9NC 2OA9A 3HI6H 2I5YL 3NFNA 3RIFK 4WFED 3HC3L 3IS1X 1CU4H 2IPKA 1QBBA 1BOGA 5ICXB 3SY0A 1OP5H 3DGGA 4TLTA 3K6DA 3N2JA 5I26A 1F02I 2ZPKH 2GB2A 3JVFC 5E9DB 4HJ1A 1D6EA 3S48A 2V2XA 3EFOB 3WFDH 2OSWA 2A73A 2ISDA 2QKIA 2X12A 2ENQA 3HNVL 1ORSB 2ZUTA 2EUWA 2CBPA 5KS9E 1GYVA 3JV6B 2KLRA 5CGMA 2A6DA 2ICEC 2MCPH 1RL1A 4OJEH 2BJMH 1UZGA 3MAWA 3B2MA 2J8UF 1GGTA 1M9WA 1D5IH 1P84K 3GBDA 1JVLA 4I0CC 1WD8A 3UG3A 1A7QH 4XP5L 3WTYA 4JFZL 2F8VA 3GHBL 5D71L 2D2CC 4J3OG 3CIQA 5FYJD 3VRIA 4M6OH 5CEYA 2VN4A 4BFJA 4TQEL 1TENA 1PBYA 1SQ2N 3AADB 4ZNEA 3ZKND 1UWFA 4Y7OC 2BSTB 2O6EA 4ONGL 5AOZA 3IDMB 1X44A 4X6DF 4R83A 1DQDH 4KJWD 5PAZA 3D08A 3RGVC 4AT6B 3FUFA 3LRLA 1C5DB 1Z32X 2ZP9A 1MWAL 4JM2B 4X5WB 5H37G 1AR1C 4U1JB 5DZAA 2BNUB 2AXHA 3ETSA 3A4DA 3VD4A 4NERA 4W9GC 3FN9A 1CXFA 3PXHA 3QXWA 3VI3E 1ZT1B 1EQWA 2VDNL 2I60L 4AVIA 3A4EA 3OXSB 5FK9B 1QLFA 2E0PA 3DNKA 3JYBA 1PJ9A 3QZLA 5C0IB 5TTRA 3VI4E 4NJAH 5I30L 3SGEI 2FB4L 4NO5B 2H41A 5A2JH 4QNPE 1BFSA 1KIUB 3PGFL 2WXNA 4C56D 4Z78B 3JUZA 4CN1A 4AEEA 5KSAB 5A6MA 2V9TA 3LRGA 1KB3A 4NLAA 3CFJA 4JUSA 4WHYH 5AOIA 2FWLB 1UB6B 3HS8A 4DOHB 3F2LA 5LNDA 2ZAGA 4I18B 3UTOA 3DX7B 2EXWD 2EO7A 2UWEF 3GLZA 2VQTA 3QI9D 3L95B 5DF0A 1VB9A 4PRPB 4H8WL 1F00I 5JW3L 4HH9A 4IBTA 3UAJC 4W9LC 3IXAB 1I1AD 3JTSB 3WKQA 4CN6A 3QO1A 3HW7A 5CFAA 5J1TC 5CS7A 5H37H 4XI5D 1WCBA 2KMWA 4XVJL 4NCC2 4YNYB 1J48A 5D7JC 3ZO0A 4IU2A 1J0JA 5KN5A 1XWVA 2AJUL 2XA3A 4G8IB 1DVFA 3N85H 4L4TB 4P5SA 5F7FA 2JXMB 3SKMA 4WJG3 5F7UA 3FFCA 5H94A 4G5ZL 3B7TA 3MXWH 1MAKA 1JMXA 1LJMA 2PR4H 3SPHA 3I2CL 5HI5D 3TBTB 4EPSA 1QI4A 1FIGL 1P84J 1TQCC 1I8AA 4R26H 4U7MA 4BK8A 3FPXA 3IS0X 1T83C 1QWUA 2B0SL 4AGLA 3UJTL 1QI3A 3D9AL 1AGCA 4JW3A 5HHNB 2BX5A 1DSFH 2YGQA 3NIGE 4PJDB 1ZIAA 1UWXH 3FONB 1BD2E 2YEQA 4RMTA 5GRXG 4I77H 1N2RA 1U3JA 2BIPA 3OD3A 3ZY7A 4C83B 3RG1C 4IKLA 5IEKB 1LEGA 2DTSA 4ZSOE 3RI5K 1MY5A 2AEPL 1KSRA 1MFAL 3HG1B 2IADB 3JVGC 5EEWA 4DF9A 3OAWA 3H0TB 5FA4A 2YOAA 3KBEA 1JZ8A 1DDTA 2X1QA 3NSYA 1LO4L 4FXKC 3AZUA 3QJQB 5JXAL 3OG6B 3ESVF 3KYAA 1E6JH 3ARDD 5CILH 4NM4H 5H35A 4FXGC 4Y7MA 1RLWA 4A6YB 3EJYC 5F9OL 2DF3A 1JPST 3MYJA 4G43A 4TNWF 1IRAY 1E40A 4BELD 1V5JA 3PIQB 4XGZA 3D85B 4GI8A 5IQLA 4WJKB 5B7MA 1NCCL 4X4XB 1ZE3H 2PUQT 2X1XR 1LO3H 5I5IA 1B6DA 2FVNA 1NBZA 2OMVA 3EYSL 4X5XA 5GQBA 4MS6A 3ULVE 4KDTA 3ABMB 2EEXA 1RZ8A 4J3UA 3W2DL 1ASPA 1IIKA 2IXQA 5AL0A 5EEVA 3CSGA 4IGBB 1AKJD 4QHNA 4E5XG 5F9AC 2PXYA 4JGNA 3I02A 2B59B 3O8XC 2AEQH 2XY1A 1ETB1 1OTSD 1XF5A 2MOVA 2Y25A 3QIUC 4KY1H 4R7XA 5T3XD 3OAZH 1KBKA 3QEQA 5LCVA 2HX7A 1WGOA 1ES0B 1V3LA 3U2SA 2O4EA 1XR9A 3KGRA 2FIKB 3KXFE 5IESH 1JNHB 3AMKA 4CAGA 2FJHA 4YDLB 2ESVB 3CVHH 2B4CL 4Z5RA 3GO1L 1ZSHA 2IF7A 2J8UE 1K8IB 5IBUB 2QQQA 3IDUA 1NAKH 2X89A 3OB0H 4GRLA 2OSLB 2GBUA 1TOXA 1TPXC 5LHDA 1ZV9A 3OAYH 2HLEB 2W80C 3U83A 1HL9A 4PJ8A 1BJ8A 3BVTA 3TASA 3RVUD 4XN4A 5I1EL 4UWQB 2L3BA 4GXVL 2X53A 1J7VR 1OHQA 1OP4A 2FQEA 3Q44A 4PREB 5LXVA 1GGIL 1D5MA 4ELKA 3A4FA 3LEXA 2QHRH 1KGXA 1KELH 3JBG7 3L7EB 4HS6B 3KDMA 2K0RA 3V4UL 3TWCH 1TNMA 4HLEA 4RQQB 3G5VA 3PP4L 4GYBA 4IQHA 2F1AA 3CCHB 5JW4M 4K15A 1CDCA 5I71B 1X7QB 2RCSL 4N26A 1I7ZA 1S7TB 4R7NA 3FK3A 1GYUA 5JOPD 3D0LA 3IDIA 3V6OE 3X3FH 5B38B 2WXHA 1I3RA 5IG7A 3PUUA 1Q9LA 5IR1A 3BMWA 2YBGA 2A83B 3B5TA 4N1CA 2O72A 2E9WA 3BAYA 3HZVA 3EXJA 5JMOC 1FVCA 2VN3A 3TA3C 1T5XB 2RFXA 4QRQB 4IHOA 2QPEB 5AZUA 2IBGA 4KVCL 1SZNA 1M1SA 3HMWH 3GDCA 1MFDL 1VGEH 3U7YH 1WBYB 1PEWA 2APTA 2X4PA 4JM2F 1ZTXL 4QTFA 3CHPA 4TSAL 2Y22A 4ZPTB 4PTUA 2J72A 3ETBF 5L2KA 5HVFB 3QJHA 1XBDA 2ED6A 5GIRA 1RVFH 2GK2A 4MAUL 4UQIM 1P4IL 4K7PH 2UWEE 1YDPA 3T2PA 2FSEB 4NRYA 3QIBA 1OQXA 2QSVA 2ITFA 4ABQA 4LSQH 3D2UD 4QRSA 3WLWC 1CBVL 1MIEH 2WCGA 2G2RA 4OW6A 3WHXB 4XBGB 3KM2A 2H0JA 3UDWC 5C0ND 4ADIA 3TPUB 3FQNA 3QO0A 2YRPA 1F6LL 1UG9A 4TL4A 3NGBB 1M7IA 2OMYB 2OMUB 3KVQA 3PWPD 4WJ5A 4H40A 1AOZA 1CJYA 5AVXB 1T4WA 1Z9SB 1G6RB 5AVQB 3OSKA 4V1DB 2X6AA 1DQMH 5DC4B 4NBZB 5F1OB 4N6RA 1JYWA 2J4WH 5B3JF 12E8L 5HXMA 5EF2A 3FRPA 2EDBA 2NSXA 1CG9B 2DQHL 4X6CB 4YWGH 1DQKA 1CD1A 3TNMA 4YDIL 1AOHA 1M7DB 3QFJB 2FECI 4NOBA 1OM3L 4XX5A 4EZJA 5JNYB 2NW2B 3QARA 4APXA 3ARBB 1UA6L 2NXYD 5SWZB 4F9PC 2FBJL 2Z9TA 4P4KC 2VDQL 1J8HA 1C08A 2A77L 2JJWA 4PJDF 3RURA 1TZGH 4P9ML 1ZKAA 5JDJA 2IAMC 2YC1A 5CUSH 3SKJH 3US0A 4QDGA 43CAA 3F7VA 5AVZB 3OJMB 4OJAA 4M43L 2CGRL 2YD7A 5KVEL 2GAZB 3L3KB 3MV7D 1OTTD 1FSKB 3TV3H 4A7UA 1F6FB 3QNFA 4XCCH 3GK8L 1GOHA 3P9MB 4ZMOA 1DP0A 3ZKQD 4TSBL 1BP3B 1R5IA 2LE9A 2X70A 1KTDB 4NQEB 2MHAA 2AI0L 3BSHA 4WHTB 1MVFA 4PRNB 3FOMB 3GRWA 4L4VB 4JE0A 3PFUA 3CN4A 3MLTB 4M61A 5KW9L 2CKBB 4HUXA 4YDKH 5JPNA 1CZ8H 4QPEA 4KH9A 2WBJB 2LW3A 3QR0A 2P45B 3AW5A 3MRGA 1USQA 4GQ9L 3F84A 4TRPH 5CLZA 2KI6A 3LN5B 2PCFB 1THCA 5JHDB 4BZ1A 3AUVA 1LP9A 2AJYH 4ALAL 3CHRA 2Y1ZA 1DQQA 4Y9EA 5IK3B 4WTWA 4J1UB 2YMXH 4K5LA 4MKTA 2K8QA 4G6FB 4PRIB 2WAQA 1DUZA 4NKDA 3SD2A 2JIXB 5GISL 1DDHA 4R7DA 4I0KA 4LEXL 1KJ2L 2R1YA 2H1XA 3FQXB 3O6FD 1NMBH 3IB4A 1OK8A 5EFIB 5E08H 1A7NL 4JHBA 3DJTA 4ACTA 5FGRA 3L4CA 3PWUA 1NBQA 1N4XL 3AREB 1RUKL 4JHWL 4N3TA 2J6EH 1SYSA 2YQ2A 4WU7B 3SGEH 5IM7B 1TZIB 1AIFB 1FFNA 5E6IB 2DMHA 4Q9RL 1WZAA 1TKWA 4LIQE 4LLMA 4ONHA 1QLEH 4MJIB 2WD0A 3CHSA 4YS4A 3L16A 2AXGA 1P5VB 2FJGB 5BUAA 1WSST 3EFFA 5IMOB 5DHYB 3P11H 5EDXA 5C07D 5ABZA 1G7PB 4KKBD 1E7VA 2I25N 5HHPB 4YX2H 2AAVA 3MRMB 3QULA 5EU6A 2CLVA 4G8GA 3B43A 2XZAL 4E41A 3MOAL 1OAQH 1F58L 3GQFA 3HNTL 5DK3A 1NSNL 5EN2A 1SM3L 1MRDL 3IM1A 1WFIA 2B1OA 3JT2A 4K7FA 1PNCA 3RTLA 2V7NA 4ZTPL 5DJ6A 1A6AB 3WSQL 5GS0C 3RFZC 2QV2A 4WW2A 2OTPA 4PR5B 3ZBMA 1IU1A 5DYOA 1E28A 1PY9A 1CE6B 2ITDB 3H6AA 1BQLH 3HKZA 1A5FH 4FMFA 2XV3A 5DRXA 3IXTB 1I1FA 4N2BA 5DQDL 5LLIC 1CDGA 4QTHA 5EMYA 1AE6L 2NTFB 1JP5A 3HRZB 3T8XB 1ILUA 1BF8A 3DVNB 2CDFB 1RJZB 4K3JL 4DOHE 2HN7A 1A7RH 1S9VB 2M2DA 5FGCE 2XV2A 4NXSA 2OJZH 3TH2T 2J57A 2X0UA 4LAJH 5IJDC 4W9ZA 4WI9A 3SO3C 2H1PH 2R4RH 3WYRA 4QGTA 1DANT 4KXZH 4LAQH 1UD8A 3FQWA 3GI8L 4CBPA 3WU1A 1JRHI 3MTRA 4PBVC 1RZKC 5AKTA 5B3JE 2QJDA 5BOZG 1KYOK 4L4TE 1PSKH 5ICYA 3ISRA 5D1XB 3NCYS 3SE6A 3NJLA 4JZNA 3NSXA 4NZJA 1FC1A 2HVKB 4J23A 5T3ZE 2WCSA 4RNRB 3WTUA 4RFOH 1PCXA 2NRDA 3QUZA 1UWGH 4JJ5B 5DJ0B 5JPMB 3S8GB 5DS2A 2ODHA 2ZWNA 4XTRC 4HQQL 4JQIH 2B1HL 2QVTA 3DX8B 5E7BA 1OALA 1VFBB 4UT6L 3QWOA 4QWWC 1U8IB 4Y5YB 4FQXD 4CA4A 4HHGA 4PJDE 1QUNB 5IQ9A 3QQ3B 4LPVA 4LPWA 1PFCA 3DK0A 5HHXL 3V4VH 2EXYC 4BGLA 4X4ZA 5AAWA 2XKUA 4X6CF 3HG1E 4I7ZC 1SJXA 2IIJA 1MCWM 2JQZA 4OVVA 3X11B 1FV1B 4N3UA 5D6DA 3VSTA 5I1LA 2E76C 4MNQE 3O9WD 1QBLH 4QRBA 3VD5A 5KOVC 1J10A 4LCWA 4OFDA 4FYRA 2VXUL 2H2SD 1N6QL 1KC5H 1VACB 3BLKA 1I85A 4WWKA 4XVUC 4NWUH 4HXBL 1EHLL 3VXUB 3K3QA 5JORB 5D72H 4GUOA 1TTUA 3KCPB 3FT3A 2A6IB 1IKFH 1DVSA 3BH4A 1WE5A 3B6SB 3PCYA 4N22A 2YUWA 3KPRD 4DERA 1MKFA 3O2WH 4NHCH 2WVTA 4QHLA 3WKML 3CMOL 4CC4C 1REIA 5AB1A 3HEIB 1IGJA 5KSBE 4UINH 2XFGB 3COOA 4XNYL 3PDOA 3HE7A 4XXCA 4DKFH 4FNQA 3LRSA 1BEYH 4Y88A 4JX0A 2Z91A 3O4LE 2RQ8A 4P4RB 3O3DA 1RK0A 5CO1A 5JO5B 1OE2A 4MJHA 2R1XB 4XPBH 1J9QA 3IFLL 4WUKH 2YAHA 1BGXL 5DVMA 2ESVE 2JJSC 1IEAA 2NNXA 1A9EB 4X9YA 1EFXD 1KYOJ 3C12A 2ITCB 3ZDYF 4X9FA 5IMLB 3T3PB 2P5EA 1IBZA 1MG3C 2G4GA 1C12A 4EO5A 4X0KA 4Z7IA 2IANE 2PO6A 1O9WA 4D9RE 4PJBA 3EJTA 1MLCB 1A8ZA 3POHA 2X7LB 3H3KA 5E24E 2WOYA 5DQJA 1K9TA 1ZA6A 3ARZA 3OR6A 1T7WA 3Q2VA 2IFGA 1P4BH 3P0YL 1DLHB 4KMLB 3DV6A 3Q06A 4MDJB 5AZ2L 4OVUA 4CVXB 5ADPH 5F44A 3UGXA 3MKKA 4UMGA 1KJVB 2XTJB 3MACL 1BVKA 1EZVY 2W0PA 1T2JA 3MOBL 1FHGA 4BINA 5FYJL 1P7QD 3DRTA 3VDAA 5I6XC 1Z3GL 2V5SA 3QCUH 2HJKB 1U8HA 5GJSL 2FT8A 4U6XA 4X7TA 2WWOA 4WTZA 1H0DA 5B4MD 4PJGB 4PUBL 1NIBA 3GBNH 3T6WA 2ICWJ 3BVDB 2CIKB 1KCUH 3BN3B 1DO5A 3UEQA 3K6SB 2Y06L 2H45A 1KG0B 2ZUVA 2I26N 5DD0H 1R5VB 1UCBH 5C3TA 2ARJQ 2XG5B 3C5ZD 3TZVD 3PHOB 2OMZB 4K9EC 4CSPA 3HBGA 2GJPA 3Q8BA 3IFOB 2QZQA 1ZT7B 4N2DA 4JFED 4UOW1 3NJKA 3PU7A 4M3KB 4Z7UE 2Y07L 2YD1A 3ELAT 5F88B 1LXMA 5DSCB 1J5CA 2AV1B 3G6JB 4YMPA 2B8OT 1HFUA 2A9AA 3FU7B 5IWLA 3I6LD 4UT9L 1FL3B 4TSCL 5DI8A 3WL9A 4JG1H 5C0CB 5I1DB 2FX8L 3V5KA 1J0IA 2XYCA 3RHWK 3BMVA 3VFPA 1XH3A 3GWJA 5KVGL 1A1MA 4F37F 5LBSL 5IUSA 3EO9H 1I7RA 4V1DE 1OP3H 3N1QC 3QUMH 1R0AH 4L9DA 1LDPH 2UVFA 5D1ZC 5KAQG 2MRYA 3LMJH 1J1PH 4PS3A 4P46C 1SHMA 4ZFGH 1XR8A 5LNGA 1OCCB 1U8CA 1WISA 2XQBL 5CSZB 1JL8A 4F5CE 4E36A 5IBLD 2UZIL 4X6CE 4JQXA 1BVZA 4YXLL 5F89B 4Q97A 4WNQB 4ABWA 3W3BA 3ARSA 3NCJL 1MXDA 2F9BT 2AERT 3ARGA 3HG4A 1JFQL 2HG5A 4N2CA 5IROA 5SWZE 2Z34A 5L8JB 3NRPA 3L4ZA 2X4UB 2R69L 5EC2A 1JK8B 2WZ0A 3M45A 4O5LL 4DO4A 3K5SA 5I1CL 4LO9A 4D94A 1YPZA 6PAZA 4Z8FH 2FYVA 3MREB 3ARFA 2OBGA 3N0AA 2EVIA 1X5JA 5IQMA 4ZK8A 4P2CG 3FH5A 3GMRA 3ZW3A 4Q6IB 3NJGA 4NQEE 1AHWB 1HINL 4J8RB 4M29A 2DI7A 4F58H 1Q0EA 3CV5A 4M93B 5I75B 1CFSB 3HHSB 3V95A 2DLHA 1PDKA 3PQYE 4L4VE 5FM5M 3PG2A 3TIEB 3WY2A 3SZ6A 3O6MH 4DPRA 4FQIH 4D8PA 5GGQH 4YJZL 4S1RL 2CD0A 3JUYA 1KUMA 5J12C 4ZMPA 1FPTH 2NX5A 1EEZB 5BJTB 5AQ0A 3RTQC 2EYRB 5ESAB 2AK4B 5IFAL 2XT1B 1NOFA 4KITB 1R3IL 3QNZB 4PJ9C 4WAFA 3RPKA 5IVZA 5JHDE 4L8BB 2BY3A 4FLHA 5K93A 4JO2H 2O6PA 4H2CA 4PSRA 1J8KA 4WFGE 2MQGA 4DP2X 1WUZA 1OAZH 5L9DL 4G9DA 3UYRL 3BVNB 5LUMA 3NZSA 2JQMA 4ZNCD 2ZUQC 1N7ML 3O2DL 3RGVD 2NDGA 2GSGA 2WIMA 3MRHA 2Z8WC 4N8VA 4KJPC 3TO4B 2FO4B 3OR7B 3O6LH 4RMSA 3ASOB 4TUKL 1G7IA 1E9QA 2BDNL 4MDIA 4XNMB 3WS3A 5IFJA 4ZQKB 3WXVL 3KPOB 3O11A 3MCYA 1KT2B 2AMGA 2OTUA 3QHZH 5BS0B 5JIDA 4JY6A 4XC3L 2A1WH 4TXVB 5AW4B 1QLRA 4WY7L 3CVHA 5HDLA 3STZA 1S78C 4M1GH 3T3PF 1SLXA 1WEJL 4OGYL 1NKRA 2AABL 3UYOD 1M71A 5B39A 5C8JB 3QK0A 3ECUA 4MJIE 4XOCA 5DURD 3TCLB 1QRNA 1YUHA 5DJDA 2LFEA 1COBA 1CGYA 3CSFA 3RA7L 1IM9B 5F1IB 3DOIA 4BCYA 1J1OH 3IAPA 4DP6X 3A4AA 4LDLB 3A0OA 4YL4A 5KYWA 4HSCX 3LVEA 5KVFL 3OHXA 4HLZH 3SBQA 3UAJD 5AVUB 1ND0B 3MBXL 3WJJC 1IC5H 3HE6B 5D9SA 3H54A 3EH5B 1JRHH 1W72A 1HHKA 4GMTL 4KRNA 4UT7L 2GK0A 4V33A 1W16A 4AQ8C 4DH2A 4JR9H 5HGHA 1YMHA 2UY7A 3PHSA 4BRVA 1HYRC 1BAFL 4WKXA 1MWAB 1SGKA 3RY6A 4A04A 1VIWA 2HWZH 4HJGA 2VZSA 1R24A 5GGSB 4XZ4A 3ULUL 1WC7B 3NQKA 3B9KC 1HT6A 1CR9L 2J88L 5F6HI 4X7FC 1UYWH 4PJGF 2CBOA 3QQDB 2VDNB 1CFTB 3DMMD 3DX6B 2P43B 3IMBA 2VSMB 3RDJA 2UYLA 2A3TA 1G9EA 1MQ8A 5LWYH 4Z3GA 3X1EA 4LKXA 3VXRB 1RUQH 4DSYA 1UADC 1WT5C 1TQUA 5KYYB 1CGXA 1RJYB 2AJXL 3MV9D 1SN2A 2YQGA 3MLUL 4KHXL 4AW4A 3HAEB 3E8UH 2EXSA 2IH1A 3EGXB 4LOUC 1MAML 4JFQA 4M56A 5DJYA 2OJEA 1HDMB 4M8QA 5D70H 4NC2B 2Z4TA 2DWTA 5AYUH 2A99A 4ES8A 5E8OB 3OHMB 3SGKA 5KBDA 3G6JF 5ACMA 5D1XE 5I1JL 5DMKB 2HRGA 3EJYD 4YSCA 1DJXA 1F56A 4HDIA 5F70A 3MFGB 4XN7A 3MJ8A 1URZA 3N41B 4Y5VB 2P9RA 4J39A 2XFXA 5AG8A 4PGEB 2X28A 1NPNA 1NUFA 3IFNH 4X2UA 4OCRH 4YQXH 2FT6A 1D5ZA 2ZUUA 1ITBB 3REVA 2QFRA 4U1GB 3RDTC 2DI9A 1PLGH 1UWEL 3IGFA 2X9XA 1X3DA 1OP9A 2BS8A 1FNGB 3IRZA 3O8XD 3OBAA 3QNXB 1FZJA 3VWJA 3OB8A 5D93B 4Z7WE 4ZPVA 5B21A 2BVPA 4NUJA 5TK4A 2HFFB 3LD8B 4NPYB 5DVNA 1E27A 4YN3A 3U7AA 1A3RH 2VB5A 4XMPH 3F01A 2OR9L 5K33A 1FYHB 4W4OA 3IPFA 4HGKC 3OLGA 5CZRA 2I24N 2VTFA 1V8HA 3VXUE 4HG4K 3S34L 2DMGA 4X7EC 4QOKD 3UEZA 1YN6B 5TPWH 3KZ8A 2PCPB 3DECA 3QS2A 4NKIL 4OI7A 2CDGA 3ULSA 5GGTH 2BP0A 2K4AA 4E9YA 4UQ2A 1QWNA 4JFHE 4KROD 3V52H 3T65A 4NQCB 2EDOA 3MX0B 1WAAE 4XPFL 3TJHC 1S5HA 3QS3A 1EANA 3KS0H 5ITFA 4XPTH 5F1NB 3CFKA 4OF7A 3L48A 1GC1C 2BW5A 1N0LA 4KMTL 4N0YH 5SWQB 2OL3H 4G9FD 3ME0B 1RY7B 4QRPB 4XO8A 2NT0A 5G55A 3MA7A 4KI5F 4XCFH 1G7LB 3K4AA 4N1HB 3QXDB 3VXPA 3ZQWA 5EZLA 4E9LA 2UZYA 1H5BA 3TA3D 3NCCB 1ODAA 3DK2A 3N44B 4FJ6A 1TETL 4IBUA 4JANB 1XF3A 1FZKB 1VCAA 3QJFB 4KKCD 4W9FC 5DS1A 4ZXBA 3T3PE 5HYSG 2AXFB 1G0DA 5CLTA 5FF6B 4JB9L 1LE5B 3VGEA 5FECB 4I85A 1GPOL 3AC0A 1CD0A 3LZNA 3MRQB 2AEWA 4FL4B 2J7LA 3MRCB 3I6GB 3GSVB 2PYEE 5SWSB 1NFAA 1AQDA 1L0XA 1V05A 1DEDA 1WWAX 1XF4A 4HBCH 4YGAB 3UH8A 2YJQA 2TRHA 4ZDHA 5GZND 5J8OA 4JFVA 2GJRA 4J3BA 5AW9B 4EZMA 5C7XL 3I3DA 4U2YA 2J6EA 4AY0A 1RZJL 4MLSA 3WLWD 5IJKA 5T1LA 5EOQH 2YEVB 3U6XA 2XTJE 4PV9B 3PHQA 3GJEA 4KAQL 3S4SG 1QPKA 5EZJB 5L0QB 5KBNC 2R51A 3SCMC 3PRZA 3IETA 1G6RH 4Q2ZB 4LLUA 1D9KA 5MHSD 4B9PA 3W0WD 2ZXEB 4R6UA 4HISA 2K1MA 1JHTB 4G11A 4OD1H 3ISWA 3J07A 5J9PB 2ZT9C 4PJGE 1X5LA 1AY1H 2UX7A 4LVHC 2DI8A 3BZ5A 4RGNC 2XBZA 4G6KH 1DN0B 1WS7A 2QSQA 3EG9B 3MNDA 2FGWL 3SPJA 1TTGA 4YSTA 3NZ8A 4MNHA 3B83A 2N56A 3QZBA 3DRQA 4UTBA 4FJYA 3MMEB 5IHZB 2X40A 4F8LA 3NCFB 1KYFA 3R19A 4GXUM 4UDTA 1B4RA 1FDLL 3SPVA 3F8UB 1BXXA 4WI0B 1JS4A 3L1FA 3DXAB 2C1PA 3BO8B 3VFNB 3IMUA 3OMNB 3AU1A 4E42B 3JWDC 2MNUA 1S7QA 4PJFB 3X1BA 3RZCA 4P4KD 4Y4FA 4K8RD 3D07A 4NDMA 5ALCL 4ZUUB 4XN8A 4YGVA 4AKQA 5GRJL 1NCAL 3F58L 5HHMB 4APQB 4ZSOA 5ILTH 4NQVB 5LKNA 2BFVH 1YYML 1BFOA 2R29L 5CU9A 2F53B 1X5HA 2UZXB 2DBLL 5MENB 2A2QT 3IDXL 1CYGA 3IVKB 2AJVL 4UILH 2Z92A 1A1NA 4PH8A 3WNNA 4OSUH 4PFEA 4J27A 4X8JA 4WNSA 5CR1A 2J1KA 3S7GA 2BVOB 1L7TH 2YZ1A 4FADA 4N90E 5AVRB 5G5DA 2D7TH 2OK0H 5F2FA 4XNUL 1KCVL 1JTTA 5CCKL 5E8DL 4ODUA 4BWTA 3WS6C 4P3DB 1XF1A 4KV5F 1T20B 4M7KH 1A6WH 1DFBH 3HVDA 3N41F 4FYQA 1ZEAL 1JHKH 4BQ9A 2D3NA 5I76B 1FFOA 5AWNL 4XPGH 3R1GL 3U6XS 2WY3B 2WUBH 3PL6D 4HIIB 4WDIA 2EAEA 4JQIA 2OP4L 4HUCA 1N9PA 2KDGA 2OQJB 2QQLL 4YL9A 4DZ8A 1E9OA 4L37A 1IX2A 4M1DH 3CDGB 2CLRB 4X6FB 3MLZL 2JKJA 3KPSB 4GIPD 1LEKA 4N9GA 1IGCL 2NCMA 1HQ4A 1JZHA 2Y23A 2X42A 3TEUA 1EBPA 1TVBB 4F33A 1AP2B 4GKZA 5IEHB 4YO0B 4IOIB 2F54B 3EO1A 1CS6A 4FTVD 1ZWIB 1WZ1H 4YHOH 4N0FA 4BKSC 1JWMB 2O5ZH 3FH8A 4F8OA 2J8UA 3FBQA 3WEBA 1A6VH 4PS4L 4NCC1 2UZPA 3ZT6A 1M1XA 1F4AA 3OAUH 4K94C 1YEEL 5I74B 5IB3B 4NJ9L 1TQWA 1BQUA 3T2OA 2YXVA 3T4YA 4H20H 1TYJA 4KTDH 1C5CH 3FO1A 4M7LT 2KT6A 1ASOA 1KGIA 3CWGA 4MMXB 4S1DD 3GPSA 2ZTBA 1PZAA 4KI5E 1CBJA 3DBSA 2R0ZH 4X6DA 1J11A 5CP7B 4M9PA 3CBJB 2FIRT 4ZW7A 2H6UA 5E6RB 1GJWA 4DZBA 4MX7B 4JGMA 1DJHA 4DW2H 4F7EB 2N7AA 3W11C 3L3JB 4PW4A 2RALA 4NOFA 4OD3H 1DE4A 4KKRA 5J0BA 5A2LH 3SDAD 4A2DA 3V6OA 1JWSB 2RR3A 4ZMWA 2YPKA 3Q01A 5LGJA 4OLZH 3N06B 3EJJX 1INDL 1TDQA 2DJUA 1Q0XH 2DYPD 3KCWA 5DZLA 2Z31A 1KJ2B 4MD5B 4PPTA 3U4BL 5BS0E 5E5RB 2WP3T 1QO3B 4H1LB 1W2KT 3N44F 1VZHA 3RX5A 4GLRI 1DUYB 1IJ9A 3KYKH 1XH2A 4M9OA 5IQOA 2NSQA 2QADC 5BW7C 3Q1SL 1FG2B 2IDSA 1GCFA 1JZJA 4MBRA 5DJ2B 2DQUH 4XO3A 3G5ZA 1YQ2A 3DROA 3HG5A 4QF1A 2UWEA 4LLWA 2VC2H 3V7AG 2WXOA 1R46A 5I19H 3U46A 1PZ5B 1T3FB 2PP8A 3B5HA 3LN4B 4V2BA 2PW1B 4Z95L 3NZHL 2H9GB 3LRHA 3VD9A 1ET8A 1U8QB 3D06A 1KACB 3MO1A 5ABDE 4CDGC 1TNNA 1OZTG 1A6TA 2NUTB 5FGBC 1WG3A 5E94A 4AV5A 2BY1A 5J6GB 4LP4A 4XN2A 4LCIL 2J1YA 2XPZA 5B7FA 3ZE2B 3QPXH 2PWDA 1B90A 2IPTL 3LKNA 4QRUA 1J18A 3Q8CA 3ZSSA 5GGRB 1SVBA 3X13A 2JI3A 3OJ2C 4DN3L 2ILLA 1T0NA 2V37A 4DTGH 1UZ8A 2HLFD 4XH2B 4XTRD 3VCLB 2YD8A 3FUDA 4AKPA 1U95A 2R15A 1SHXA 4X7SH 2FQDA 3I9PA 1NC4A 4LLDB 4PG2A 2IBZX 3GSQB 1L9QA 4M4RA 3R8BB 3VXRE 5CU5A 1KF9B 2DQJH 5SX5H 2ALWA 3GMQB 1IGML 3VFSA 4NBXB 5HPMB 4UAHA 4PGDB 3EJUA 2ZOUA 1LYQA 2F74A 1DR9A 1YEDA 4L3EB 5EA0H 1XD0A 2DJMA 2A4CA 2OYLA 5A16B 2XN9B 2ADGA 4MQSB 3UL4A 3C8KA 3L3IA 2Y5TB 3MN8A 4DN4H 3VTAA 4PJFF 5C7ZA 3CHXA 4Q7DA 1MVUA 4OTXH 3UGEA 3KLDA 4XN9A 4GQZA 1KB5H 2GT9A 3EOAB 7CGTA 4ZUWB 1TCRB 4KV5E 3UJJH 2ARWA 4KDTC 5C6PB 3LNDA 1MCBA 4XVUD 1QP1A 4ELDA 5IJCC 3B4NA 3MV8B 2AQ3A 2FAUA 1YNTB 1RZPA 4EDXB 2FHCA 4DGWC 2PMZA 4ZMLA 2JE8A 3WJMA 3LHAA 2NXZB 3TIDB 1NMCB 3O2VL 5E00A 3ZHDA 4D9QE 4F9LA 3QUMA 1GGCH 4NRZB 4RESB 1U91B 1VEPA 1H6TA 2B3RA 4IU3B 3D25B 1JNLH 4B3VA 3FCSA 4ZAKA 2CRIA 4DK6A 2ZKYA 3N3EA 4YUEL 2BCKA 4S0HA 2I9LA 3BIBX 3ZTNH 5CGYC 5AL8A 1D6VH 1JGDA 3DHUA 1T2QH 3K2KA 1II4E 3MXVL 4BKLB 1FYTB 2ZYIA 3NSJA 2CA3A 5ICXA 4I2XA 2WSDA 4NT6B 2GEQA 3GNML 2BRQA 4KX7A 4OFQA 2CHXA 4I13B 1IARB 3CX5K 3DVFA 4EUPA 5IKCB 2RA1A 4LFHD 5E9DA 1G9NL 3EFOA 4XNXH 3NSDA 2FGZA 1KDIA 4MJ5A 2MWCA 1HN1A 4TNEA 2WGNB 5GS1C 3SJVD 4AC2A 1NCOA 4D7PA 1FNSH 3BXNA 3BH9B 2Y4SA 1QR4A 2LU3A 1KCSL 2PF6A 1I9RL 1OGSA 4I8DA 4NQCE 3WNIA 2FL5B 3LHPH 4OIIL 1ZLUK 2C9SA 4CKVX 3G6AB 1AQKH 2HCZX 3H7BB 1MF2H 1TJHL 2YR3A 4IBLT 3UIZA 2O5XH 3FHEA 1I1CA 4B9CA 3NK4A 4POYA 1VDGA 3LS5H 2Y7NA 4QRPE 2X4NB 4PY7B 4JLRB 1YY9C 3BHBA 3WUWB 2BSTA 4K7PY 3S35X 3IDMA 3GMOB 4ONFH 3ZL1A 5J11B 5EU4B 4AT6A 1PLCA 1C5DA 1HQRA 1RJLB 4JM2A 4X5WA 4U1JA 4ZZKA 2BNUA 3V6ZB 5ID1B 3TN0C 3E38A 3HPJA 2VH5H 1I3GL 1XCTB 5I1IH 1ZT1A 3GF8A 4JY5H 4ZX4A 1CLZH 4K3HA 4HKXB 3OXSA 2VDKL 5FK9A 4IW4C 3CZLA 4JFOB 3CC1A 1S4IA 4X98B 5AAMA 5C0IA 4KRPC 3B2XA 4PV8B 5DVKA 5JIHA 1IAIL 4HJSA 4L29B 1DBKH 4GUPB 1CDUA 4Z7NB 4X5PA 1SMDA 1A3ZA 2BOLA 1LTXA 4L0PB 1PL3A 1BYNA 4PRBA 4Z78A 5C2BH 4M6NH 5DZPA 3T3MB 4GSDL 4JDEB 1IBHA 3B2VH 1MRCL 3F6JA 4MYPA 2QFPA 2YAEA 4M7LL 2Y9RT 3LQAC 5DZOA 3ZDXB 4RMRA 3DX7A 4HCIA 5C0AA 2A6JB 3L95A 3I9AA 2DQMA 4PRPA 4PLOB 1GYAA 4MXWH 3IXAA 3JTSA 4RCAA 4M62H 3KBHE 3SZKC 1ZK5A 2PETA 2YRBA 1QA9B 2P8LB 3NCXA 4GQPH 2WLHA 3GMLB 4K3DH 3FQYA 4TVPE 1U2YA 1ZA3B 4YNYA 4YSDA 2DLIA 4LARH 3WD5H 4G8IA 5C6WH 2K9UA 1ZHNA 4L4TA 3K0YA 5D1ZD 3S36X 2JXMA 1NWOA 4JPKH 4X7DC 4BK5C 5BRZD 4YDVB 1BMWA 4P46D 3EIFA 4MD0B 3ROLB 3ZE2F 2CR0A 2C9XA 3TBTA 4KVPA 1ZTXE 2LVCA 2HH0H 1JHLL 3CXHJ 1OW0C 5E95B 5I9QB 2Q76B 4OCWH 3DXAE 1R6VA 5HHNA 2W07B 3H85A 5FYKU 3BKJH 2X5PA 4PJDA 4PJFE 3FONA 1RV6X 4G7SB 3VFTB 1CI3M 1FNEB 1N26A 4KNUA 4C83A 1N8ZB 3KLAB 5IEKA 2A9NH 3TVMB 1MCEA 5HHME 1FGNL 2BNQD 5AVYB 5E5MB 2EDNA 3MLSL 3HG1A 2IADA 4LBAA 2MQCA 4QAWA 2F53E 1VKXA 2DPKA 5MENE 2FQGA 3DO4A 5J13C 1BPLB 5AAPA 1DBML 3HI5H 1CDBA 2WHVA 1SBBA 3GGWA 4DKAA 5BUGA 4G3YH 3DWTA 2V3FA 4Z0BH 4A6YA 4EN3B 3PIQA 3DOSB 3BAWA 3D85A 1KDJA 4U49A 3UZQB 4N2IA 4X4XA 4EKJA 4FA6A 3QI9B 2OSXA 3UBGA 5C3IA 1R3LB 4MCYB 5KANG 3BD5A 1N70A 1ZLVH 3RTQD 4NKQB 4DO6A 2A38A 1I1AB 1YNTF 4QRAA 32C2B 3OM3B 3W82A 4BFKA 2AZAA 3NJJA 3BDBA 2X1OA 3EJZD 5DJ8A 1BX2B 2ADJA 1KXQE 2I5YH 3RUGA 4OGAD 4AQAB 2FO1A 3HC3H 1JFHA 2NMSA 3WLBA 4KBPA 4AZUA 4OU3A 4PJEB 5GRVK 1TJGH 4ZO7A 1KV3A 2F54E 2QPDB 4HWBH 5FUZL 2J25A 1MCKA 5FYLL 4P23A 3SB3A 3N6YA 1WICA 4PWFA 5EDSA 3FKUS 1JNHA 4ZOCA 3ELQA 3UTZB 3FU9A 4KOBA 2H2PD 4RRPM 1JZDC 1KENL 5KVEE 1AYRA 5FV1L 3UJIH 2OSLA 4XPHL 4GSXA 3CFCL 4NUPA 1WGVA 2NY4D 5DC2A 2O93L 4XNAA 3S3BB 1T0MB 1AYOA 1B0WA 1JE6A 3OKNB 4LNVA 1S78D 4AM0Q 1YN7A 8PAZA 4BH8B 4XP5H 3QC6X 3MJ6A 4F27A 3GHBH 5GJTL 2VLRD 2VW7A 2XWDA 3EYQD 3EHBB 3OQRA 5I6MA 3K2MC 3L7EA 3U6RB 4Y5XC 2CJTA 4HS6A 4IDLA 4TQEH 2VDOL 2XWTB 3ABLB 1HJBC 3ARDB 2ZNWA 4NQDD 3WNPA 1SEQH 4GKOA 4MA3B 3CCHA 1RIVH 1CCZA 5GGTA 4OZFB 4LBEB 3UTTD 1CPUA 1X7QA 1S7TA 15C8L 3NEOA 4NUGL 1LEIB 5B38A 4KGJA 1TQVA 1MREH 3IBOA 2BK8A 3WDHA 1UA7A 2DL9A 2NSMA 1CXLA 1O7DC 2OL3A 5FHBH 1P5UB 1T5XA 4NI6A 4QRQA 4UAOB 3SE4A 4W9JC 3NEEA 1ZLEA 3D18B 2OV0A 2VDNH 2I60H 2VABB 1QSFD 1THAA 2ZUWA 1WBYA 1AKJB 5FA3B 5E5UB 1EERB 1QTSA 2JNZA 4PVLA 1YVLA 3SBWA 4ZPTA 5BZWB 3HZ3A 1JXGA 1YYLL 5ICZA 3Q2LA 2ZXDA 3C5JA 3B9KD 4OFPA 4X8GA 2VE6B 4LDEB 3C09B 3PUCA 1E0OB 2RHEA 2IC2A 4WUUD 4LSVL 1U8KB 4IS6B 3UYPB 1T2XA 4LCCC 2GVYA 4GSQA 4UYQA 4QXGL 4AE1A 2FSEA 3TXAA 1FNAA 2Y3NA 5C92A 1VAHA 4QY8B 4Z7NF 3RIAK 4LVEA 5JW3H 3WHXA 4TTDC 1SY6L 4XBGA 3T3MF 1AMYA 3AQXA 3TPUA 1MFVA 4PV1C 4PJ7A 5TE6H 2YQ3A 4WSJA 4OCXL 2VZ1A 4IK7A 4XVJH 2OMUA 3ZDXF 1ET7A 1N0XH 2ERJC 3CPUA 3DARA 4ZS7L 3TYGL 3ZE2E 2CCVA 2AJUH 5CLWA 4RGOH 1DQVA 1R5WB 2OPCA 3H3PL 2GQHA 3WEXB 3WKPA 4G5ZH 1G6RA 3QJOA 4V1DA 3I2CH 3F64A 1YG9A 4TOYL 3BQVA 3MJWA 3HS0B 3VD2A 1M2VB 1BWMA 4QXUL 5AAWC 3UJTH 5JR1L 1NCBL 4NAQA 3S4SB 5E7FA 4FA8A 2EP6A 5INDB 1FWXA 4F5CA 4JO4L 4AK1A 35C8H 4U6YB 3RDTD 4NENA 1WAPA 1M7DA 1TTFA 3QFJA 1AD0B 4I3RL 5D6DC 4L3EE 5JNYA 3FN3A 1HNYA 3N1GC 1EDQA 2NW2A 2XN9E 2XZZA 2MPAH 3GKWL 2AEPH 5SWZA 1MFAH 2YKLH 4OIFA 4QHUB 1LO4H 4P5TB 5JXAH 4UTAL 4ETQB 1DVXA 3QXTA 2ZCZA 1UXLA 3K1KC 3QORB 4JK0D 4RFNC 2GAZA 3L3KA 1MCNA 3JWOH 3N91A 3MV8E 1PX8A 4MSWB 4OR1A 1KTDA 4NQEA 4U1KA 4ODTH 4HMDA 3E9TA 3ZMRA 4YBQD 1HNFA 2QVKA 3EYSH 4WHTA 1TLKA 3QCVH 1TQTA 1HOEA 4PRNA 3FOMA 4YSPA 1KZYA 4L4VA 4NEHB 1G7QB 3W2DH 2CKBA 4AL8C 2HG0A 1NEZB 2YPVA 3BSGA 2WBJA 5DA0B 2C9PA 2X38A 3QB7C 5DRNA 3IF1B 3PWPB 1PJWA 2UXVA 5L2JB 3MV01 2EC9U 4IJ3C 1Z3RA 3QFGA 5I1KH 5IHBA 3LN5A 2PCFA 3OKOB 5JHDA 1OAUL 2X87A 4J7RA 2PKDA 4O2CB 2Y7QB 3VG9B 5BZXA 1HYSC 5JQHC 4KKNA 3FCGA 2CUIA 1FYTE 5IK3A 2XJLA 2E27L 2ZG1A 1WIOA 4J1UA 1QKZL 2CCWA 2DQCL 4PRIA 5KUMA 4P2OC 3S96A 5TQ0L 4XX1G 4K71C 2JIXA 4M6ML 1NEUA 1F90L 2B4CH 3ZO9A 3S88L 4GG6B 1FO0L 1U92B 3ZTDC 3LKPA 1QSEB 3FQXA 4M1CD 3UC0L 4PJEF 2YBRB 5EFIA 1SVZA 4BSWB 2ZCKH 2IFFL 5CJOL 3ZQ9A 4EUPB 2NXYB 5I1EH 5F9WB 4GXVH 9CGTA 3O3AB 1SOXA 4IKKA 4OZHE 1ED3B 5EIIB 4WU7A 3ETBJ 1QOKA 1GGIH 2Q3AA 4Z7OB 5C1MB 4ZMZA 1TZIA 1AIFA 1PZSA 5K9QG 3N1PC 1MAJA 5L88L 3STBA 2L7JA 5I17B 2BWIA 3PP4H 1EVTC 4MJIA 1B0IA 3IRPX 4F2FA 5IJVB 1MZZA 2B08A 1P5VA 1AO7E 2FJGA 2RCSH 2OMWB 3FQRA 5IMOA 3FSAA 2L7QA 4J4PC 1G7PA 5FKPA 4DVBB 4GBXD 5HHPA 1HTYA 2PNDA 3SCMD 3WIHL 2DWSA 3CZFB 1N19A 4PRDB 3OPUA 2FNBA 5FIEA 3VFRB 2AVFA 3HN8A 4Z23A 3VW3H 4UOZA 1DZBA 5FUCE 1N18A 4KVCH 1BMGA 2OXGB 3O41B 3MHZA 1MFDH 2AQ2A 4B9JA 2EQDA 3DV4B 5F9JB 3QWRA 4RGND 4TSAH 4CRPA 1EXGA 1A6AA 4S1QH 4LZKA 3CX2A 2XIDA 3OZ9H 4LSUL 3VYNA 3QNYB 3L6FB 4PR5A 2YGNA 3F12B 3KLSA 4GS7C 3DX2A 4WFEE 4G6AD 3EJPA 2ITDA 4MAUH 1MCOL 5E8PB 3W9DB 4UQAA 4Z7NE 1P4IH 1ZDSA 2W59A 2WC7A 1SUJA 3IXTA 2QQKL 3DYOA 3P2TA 4KKAD 5GS0L 4TVSa 4J3OC 2NTFA 3KM1A 3T3ME 2R56L 3O6FB 3DVNA 4NZUL 1RJZA 2HX9A 4PD4K 1CBVH 3ZDXE 1S9VA 2J2ZB 2LU4A 4YBLC 3BPLB 5DFWH 4YHIB 4HOWA 2DKUA 3GSRB 3MRLB 2BSDA 4X6EB 2W65B 1Y18B 1Z66A 4HZ1A 4EN2A 1UT2A 2OXHB 4K5OA 4H2AA 4MQ7B 2BNRD 4C54A 5E4EB 2XQYK 1IFHH 3FT1A 3MUJA 5FYJE 2YIHA 1Z9PA 4K3EL 1XO8A 1E7UA 3TS8A 4LPUA 3ATBA 3BAJA 5D1XA 4DGYL 4PRHD 4JQXC 1T5WB 4HH8A 5EBMA 2HVKA 2K7QA 4RNRA 2DMKA 5C07B 4NC1E 1ITCA 5DJ0A 3ARGC 4JJ5A 5JPMA 4XMLH 4AJWA 3IJEA 4A67A 2VLJA 4XBEL 3DX8A 4AEIH 3PWNB 1VFBA 3IDGA 1U8IA 4YDIH 1L9OA 4J2QA 2E8YA 1BIIB 2HFEB 1OM3H 3NIDE 2VLMD 1H3GA 1OAKL 4ZYKB 2PR9A 3DX1A 1NDTA 1QUNA 3FB6B 1UA6H 4H8QA 4PVMA 3RB5A 2A4ZA 3QUYC 3BRDA 3JV4B 3QQ3A 1NLDL 2FBJH 5KSUB 1U58B 2X9WA 2A77H 2VDQH 3RVXC 3SYPA 3VWKB 3ULUF 4P9MH 4PGCB 4Y4KC 2BZ7A 4U0RC 3ISYA 1BVLB 3X11A 1FV1A 2WIIB 2E9IA 1OARL 2CGRH 5KVEH 1X9UA 1Y6KR 4W6XB 5F3HA 2X2IA 3BLPX 4TNVK 1MLBB 3GK8H 4C56E 4PB0L 3L2LA 3WN5B 2DWEB 3Q8EA 4HIHB 2H6PA 2DD8L 1KN2L 1SYVB 3HC4L 4YIQB 1BXVA 1I31A 4PWGA 2WPGA 2Z8VC 3D0VB 5G4NA 5IBTL 4RDBA 1ZE3C 3PDGA 3VXUA 1EGJL 4HJJL 5JORA 3SYOA 1YEIL 1UM4L 3C6EA 1WUNT 1EA9C 1Q9KB 3KCPA 4GQ9H 4LVOB 2A0LC 2A6IA 4AUYA 4ANVA 3VH8A 4MXQC 5D4QA 1GZHA 3OG4B 3PNRB 4F7KA 3B6SA 4X4ME 3BSZL 5AZEL 3RIFF 4L9LB 1KTKE 4L05A 2LGNA 4ELMB 4PD4J 4S0SD 4ALAH 4K8RH 4MAYB 4FFVC 1BF5A 4A66A 4JGUA 3LYRA 3W11D 4PJEE 3PPEA 1I8LA 3S3DB 1IGTA 5AFAA 2CHNA 4QO1B 4P4RA 2WLZA 5JO5A 3VSVA 2R1XA 4UANA 4GO6B 4X8CA 5C86A 2IDFA 2Y36H 2FZ3B 6PCYA 4FQXB 1A7NH 3KBFA 4G6ML 2DV6A 5DD3L 4QYOB 2ITCA 1UD6A 3QRFM 2FT7A 3UADA 1N4XH 3R06B 1RUKH 1I1YB 4GG6F 4JHWH 1LK3L 1R17A 3NESA 3VTMA 4JFFB 3BAEL 3PJLA 2QADD 1U8JA 2FWOB 3D87B 4NNPL 1YNKL