2JQMA

Yellow fever envelope protein domain iii nmr structure (s288-k398)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
112
structure length
112
Chain Sequence
MSALTLKGTSYKMCTDKMSFVKNPTDTGHGTVVMQVKVPKGAPCKIPVIVADDLTAAINKGILVTVNPIASTNDDEVLIEVNPPFGDSYIIVGTGDSRLTYQWHKEGSSIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of yellow fever virus envelope protein domain III.
pubmed doi rcsb
source organism Yellow fever virus
molecule tags Transferase
molecule keywords Envelope protein E
total genus 30
structure length 112
sequence length 112
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2007-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2jqmA00
1ZTXE 4FG0A 4GSXA 5LBSA 5LBVA 2H0PA 1OKEA 2P5PA 2V33A 1Z66A 4FFYA 3C6EA 5KVGE 4BZ1A 5GZOA 3P54A 3MUUA 3N40F 5LCVA 3UZVA 4AL8C 5KVEE 3N42F 5AAWC 1SVBA 3N41F 5GZNA 5B1CA 4BZ2A 5JHMA 4AM0Q 3G7TA 2I69A 5AAMC 3C5XA 1Z3RA 1PJWA 2GG1A 1UZGA 4UTBA 5IZ7A 4L5FE 1OANA 4GT0A 1URZA 2R69A 1OK8A 3N43F 4UT9A 4FFZA 4ALAC 4UTCA 2JQMA 1TG8A 4UT6A 5IREA 4UTAA 3UAJA 3VTTA 2JSFA 3UZEC 5JHLA 2JV6A 3J2PA 5KVFE 2R29A 3J27A 3UZQB 3UYPB 1S6NA 3N44F 3WE1A 3IRCA 2HG0A 5H37A 5KVDE 4X42A 2ALAA 1RERA
chains in the Genus database with same CATH superfamily
2WXOA 5FF6B 5BZDA 1JZ8A 1SF3A 3GBML 5T1KB 4OIFA 3LS5L 3ORJA 3DSNA 4XP9H 5DT1H 5KVEE 3IDNA 5JW4M 2HFFB 3CFKA 3A6CL 3LDBB 3PWUA 4R5XA 2PXYD 5D2LB 4HJJH 2WKGA 3ECBA 4LSQH 4WDIB 1BXAA 5FX3A 5TGBA 5I16A 2X6MA 1FRGL 3MCKA 1BW8A 5SWQB 1OF2A 1JCVA 2VLKB 2CO1A 2DYPD 2GY5A 1KCSL 1NKGA 2DMCA 4Q56A 1TSRA 3WNJA 1RZFL 2VDPL 3H55A 4GAGH 4LPXA 4BH8B 3PP4H 1PBYA 2WANA 2AI0L 4TQPA 5J6HB 2MPAL 5B1BB 5KZCD 5LBVA 3MBWB 5EU6D 3O11A 5KSBE 1QBLL 1ZHLB 2V5SA 5KBKA 4HHAA 5DURD 3O45A 1KLFB 4LEBA 4GKOA 5EZLA 25C8H 2CGRL 4ATTA 1NGXA 1EERB 4YPGA 4TF4A 5C7ZA 3A23A 1P0SE 1E9OB 1GS8A 4NZRH 2W8CA 5TDNA 1AO7A 3C6LD 2QGBA 1IQWH 3OVUB 2EUVA 4KKQA 5H37A 4G8EB 4U0QB 1OM3L 4C56A 4A38A 2PMZA 3Q01A 2DIBA 3N1MC 4PRBA 1IQDB 5GRJH 4V1DD 5B7FA 3C5JB 5B38A 5D7JC 3FH5A 2P47B 1KIRA 4PM1A 4DCQB 4FE9A 3Q6FB 3KPMA 1UWFA 3S8WA 2F5AL 1WA1X 1U8LB 3E9TA 4HK3N 4P5MA 3WKPA 2XZCL 4OFKA 1S3RA 2Z8SA 2AQNA 1A7QL 3HE7C 5G4NA 1AO7E 1YEEH 3G5WA 3LMJL 5DJ8A 1YPZE 3WL9B 3NSYA 1Z32X 1MWAB 1QSEB 3QEQD 4C56E 5CJQH 2GI7A 3T0AA 2I07A 1WBZA 3UBGA 3G6JB 3FQNB 3EYOA 4KJWC 4NCC2 1U8PA 1MVUA 4PP2B 3VXME 1PJ9A 3FO2A 1IGJB 4DH2A 4ODXA 3DURB 5I1JH 1JD7A 3QZWB 4G2AA 2NY2D 4ZW7A 1OTTD 2C4FU 3PDOB 5A2CA 2XVBA 3IFNH 3QAZC 2VUYA 5BW7A 2FQEA 4GKLA 3MYZA 4AL8L 4O02A 5GGQL 4CGUB 4JO3L 2NXZC 4BM7A 2IDCA 1A21A 2BOCB 5HVGB 1MZZA 3O2VL 1QEWA 4KK6D 5AOJA 4HPOH 3U6XS 1VEMA 3VG0L 1T7YA 2OR8A 4IMKA 1MELA 2FBRA 2HH0L 5F9WB 1H3UA 1P7KA 3MRHA 1RPUA 2W0LA 3X3FL 3V0VB 1P7QA 5FUCE 1U3ZA 5T1LD 3EFDL 3TO4D 5IMLB 3VMOA 3VSUA 1SXNA 3WN5A 4WHYH 3V8OA 1H0DA 1PLGL 3DYPA 2ENJA 5DZNA 2EVFA 3AG3B 3IS0X 5AVYB 4H1LB 4WI0A 4GUQA 4FRWA 1T0MA 2CLVA 1CB4A 3SJVB 3ULSB 1NGZB 2FX9L 3EOTH 4X6CE 3JQOB 4X9YA 3UZQB 4CW1A 5DMKB 4R4NC 2ADJB 2I32A 5I1HL 3AXHA 4YDNA 5CP3H 1IEBA 5B39A 1E4XH 5IV2A 1U3YA 3VI3A 4ODBD 4WJ5B 3T0ED 4ZMAT 2XRAL 3VQMA 4PWEA 4JB9L 2EDFA 3HMXL 4LEXL 3BEWA 3I6KB 4XMTA 1PX4A 4ZUTA 1CDBA 2NYYD 1KCRL 2WLZA 3EFOB 4KKLD 2X12A 2J8OA 4LCCB 4UZUA 2DQFA 4OFYD 4GIAA 4E5XG 1DLHA 1BVOA 4GUOA 3N40P 3TEXA 4HIJA 12E8L 4C83A 1ZEAH 2ENQA 3F7KA 1P84K 3MOBH 3VFNB 5DZ9A 2WN2A 5I18L 3M7OA 4FI7A 3KL3A 2IH1A 4BD4A 3RIKA 4JO2H 4PGBB 3U4EB 2PPCA 4G43B 4Y88A 1WBYB 5DHXB 1LE9A 2O5YH 1MHPL 4I3RL 5F7WC 1NIFA 1PNDA 3MRQA 1BQHA 1HHJB 2EUZA 4R0LB 4XO9A 3CXHJ 5DMIH 1B6UA 3LQZA 4AZ8B 3CFCL 3QUYC 1G1CA 2V2WB 3HVDA 4Q6IA 3BW9A 4OGQC 1CD0A 1FAIL 3HZYB 4W9DC 1PDKA 2ZYSA 3HPLA 3OQ3B 2F15A 5I73C 4IBZA 4HIHB 5CGMA 2QADB 3KS0J 4G7YL 4P48A 5ES4B 3L3JB 1I3RA 4Q6YA 3DHUA 4GFTB 4HJJL 1A4JB 2D3NA 5EZIL 5H35A 5E08L 4WWKA 2OMVB 4ABQA 3PE9A 4IBQA 4ENZA 4WW2F 3C5XA 1FAKT 2CE6A 4XP1H 4NHCH 3K80A 1E4WL 3P1VA 5L88L 3TURA 4YOKA 4OZFA 2IGLA 3BKJL 5DD5H 2VLJA 3SDDD 2XWJB 3CN3A 1RZPA 1BHGA 4HKJA 5J3HC 1G7HB 2P4AB 5CMAA 3CVDA 3VWKC 2ZOWA 3FH8A 5CP3A 4QOKE 4KX7A 3K8KA 1S46A 4K7PX 5DZVA 2NY4C 3VFNA 4GG6E 4U1HA 1K8DB 2HTKD 5I1IH 3TFKD 1CXHA 5DQDH 4IRZH 4NN7B 1LE9B 4OFPA 2W5PA 4YHOL 2A4EA 1MG3C 4HAKA 1EO5A 4HS8L 4K8RD 3BUQA 2D8KA 2C9UA 1IC5H 1M2OA 3FFDB 1HKLH 2BNUA 1CYWA 4XO4A 5EV7A 1ZS8B 2Q86B 5EIIG 4RVBA 3VXRE 4M6NL 2SODB 1JYNA 2YAFA 2WIMA 3BPNC 1CG9B 1OGTB 2WUBH 3EYSH 3FUJA 4F20A 3FU6A 5CWSA 4GG6A 4NKIH 3IXTA 5C0IB 3BPLB 3MRBA 4WFHE 3DRQA 3UO1H 4BSVA 3PV7A 3NA4A 5EPMA 5GS2D 5DRXB 4M29A 2AAVA 2LW3A 4FQLH 3QDJE 4NUJB 4OD2B 4XCCL 1S78D 2X05A 3WEMA 2UUDH 4WHCA 3JXAA 4YSTA 1CGYA 1AD0A 3L08A 3O6FA 2EZ0D 3LEYL 4IJTA 4PV9A 1OD9A 1A9BB 2A74C 1DBKH 3DMMA 3TCLA 1T6WA 1E4KC 1QI4A 2VXUL 5T1DH 2ZXAA 4Z7NB 4KKCD 4Q9BA 1R46A 4AIXA 4KQ3L 5M94B 1IGML 5IWLC 2OZNA 4DAGL 2PWGA 4EI0A 1USQA 1NOAA 1JWMB 1R3IH 5D93C 3NESA 1MCWW 4E5XB 1G4MA 1HHHA 4NRXB 3U30B 4Z18A 2UY7B 1E8ZA 1JK8B 2QZQA 4ZSOE 4AEHL 2YXMA 2BSTA 3TO2A 3B2PA 2DYPA 1IM3D 3K8MA 4JKNA 3H42L 3T8VA 3UCRA 3O8XB 4S10A 3STZB 1ZTXH 2OR9H 4WWKD 1IC4L 1OLZA 2LFEA 4YBQC 5BMFH 3KCWA 2VRAA 3TESA 5BRZA 3TEZA 3IAPA 5F7LB 5GRJL 4P46C 1H3PH 2WM0A 3CU7A 3WS3B 4Y5XB 1DFBH 1HHIA 1E2ZA 3DURA 2I9LA 3ESUF 2Y36H 1YN7A 1ZHKA 2JJTA 4H26A 4HJ0D 1CE6A 5T33H 3VH8A 5IJDC 3IXTB 4ENEC 3DXAA 3NRPA 2F19L 2XPGA 1W15A 1BEYH 3U4BL 1SDYA 1ZV9A 5EWIL 4OGXL 5D7LB 2LAGB 4ALAL 2AJ3B 3HI5H 1UUNA 1P1ZA 4AUJA 1IEBB 4OQTL 4YSAA 1F11A 2EC9T 2V6HA 1JXJA 4XMLL 4JFHE 3KLAA 3HCVB 1UGNA 4PPTA 3THML 1LDPH 2BZ7A 1EEUA 5LXVA 4RSYA 5EC2A 5ANHA 1KBBA 3BFQG 4LARH 2V37A 3BH9A 1TR7A 1HCZA 1E90A 1FDLH 2OYPA 1C5CL 1RERA 5HJGA 4PBXA 3SKMA 3IJYB 4LQ1A 3U9UB 4AL8H 2NYYC 2E27L 4HC1A 3LN4B 4WUKL 1HQ4A 3ARGD 2FNWA 1CD1A 3CQFA 3GDBA 3ZQWA 1WCQA 5I0DA 4LEOB 2IAND 2A1WL 1RK7A 3ZMRA 4I18C 3ESPA 1CU4H 4Z7UE 3FRPG 1NSNH 1RZKL 3KYAA 4RQQA 1EJOH 5BV7C 1SBSH 3HLAB 4OW6A 1AP2A 1MH5B 4M03A 4A2EA 4G9FA 2O4EA 3RZCB 4N8CH 5A6LA 4R7NB 4JG0L 3S36X 1BWWA 2YJLA 4OD1H 4OKDA 5D4HA 4Z95L 4IOSA 2XPGB 4RMTA 5C0ND 3V9CA 4XT1C 1SFDA 2XA3A 4FCAA 1H8LA 3MO1A 4WFFE 1NGPH 1EO8H 5LWYL 3WDHA 4JM2D 3AABA 3MRPB 5AW9B 2HKHL 3PIQA 3QDGA 3QZBA 4JY6A 2WCSA 5G4MA 4BDVA 2BXZA 3I6GA 5E8PB 2PO6D 2K9FB 3JZ7A 1QEXA 4Z7NF 3N85L 2RCSL 1ZSHA 1IAIL 1YUHB 4JB9H 3F64A 4PGDB 1PZ5A 5JHDE 4MXVE 3QO0B 4OIIL 5KSAC 3L9RA 2NY0D 4QRQA 4XZ4A 1RURL 3GJFH 1I31A 3W0WB 4JVUA 1TYEB 2YXFA 5IR1B 4K7PL 2P8LA 3BDYH 4WU7A 2BVEA 2DI7A 2FATH 3QDGE 4IIQC 4UM8B 1DEDA 4J39A 1DQJB 1CL7H 4KJPD 3MLSH 4HBQA 1HYSC 2WO4A 1CDCA 5D5MF 2P3YA 3HNVH 4N2MA 3AW5A 1WYJA 4L1HA 4P2QE 2X0VA 3NFPB 3PHSA 4OJYA 4CC1A 3BSZA 2X89D 2J8UE 3RP1A 2I7SA 4XNYL 3FFDA 4HBCH 1AXSB 1YEEL 1P4BH 4M5ZL 4MAYD 5C92A 4YUEL 3UEZA 4GAYA 4C59B 1S9YA 2AEQH 2R1WB 3ZW3A 2ENSA 1KPUB 3LV3A 3H7BB 3GHPA 4IU3A 3HG1D 3SGKA 4JFFB 2QEJA 3GEWB 3MBEA 1HU8A 3PAVA 4GEJA 4XBEL 3UOAB 1OP5H 2P24A 1KN2L 5C6TL 5IB5B 2X5PA 2XWZA 1QNZH 2EIZA 4G6ML 1MJ8L 3NDYE 5CD5C 4JLRA 4P9MH 4XOAA 1VESA 4DIXA 1K2DA 3IU3B 1XBDA 4I85A 3P2TA 1T2QL 5HI5D 4D8PA 2DIJA 1KDIA 4FQLL 4LAQL 4XCCH 3H2QA 4DPAX 2AJSL 2F5BL 4XNBA 2WKLA 3JT0A 1W8OA 3WKML 3LEYH 1GC1L 1MJJB 1JN6A 1XF2A 5TE7L 1JZ7A 2C9AA 1NFAA 4K3JH 5E23A 2ERJB 4LSRL 2F68X 4ONFH 4OZHB 3O3EA 4POUB 3ARDD 4LMQE 1WTGT 2GITA 5CILH 1BD2E 4JPKL 1VKXB 4WDIA 5I5RA 3UG3A 3NFPA 3UDWA 4DZBB 1XMEB 3H42H 4LCYB 5HDOA 1HKLL 1JPST 2BM3A 4C4KT 4FFVC 5CUSH 1C5BL 3QUYA 4TVUA 1Z9LA 3VXSA 3TT1L 4KI5F 4BZ1H 1F1GA 4OH2A 1G9NH 2NYKA 4M3KB 5CGBA 3QXUA 2JKTM 3CLEH 4X8JB 5C0CB 3GTVA 2AQSA 3HUJF 2OK0H 1NANI 2XETA 2IANE 1LLAA 4U6HA 2YD8A 5HHNB 4YHML 2UZXA 2HMID 4LESA 1DFBL 2VIRA 3PGCA 1PCSA 1IFHL 4PLKD 3GKZA 5E8OB 4JY5L 3SODB 5CFHA 4JZNA 1SEQL 1N12A 1THCA 1I8LC 1E9OA 2NTSP 3EH1A 4X42A 3P9WB 5D6DA 2FJHA 2BRRH 1GMIA 2Y0SA 3DUHA 5LAPA 3T04D 4AV4A 1M05A 4ANUA 1R3IL 4NQED 2NSMA 1RJCA 2V2TB 4O02H 4PJDA 2N1TE 2X89A 2IANA 1UKSA 1AI1L 1WUZA 3NH7L 1DO6A 4DO4A 5MENB 3V52L 3EO9H 2P8PA 1PYWA 4V33A 4GMTH 2O5ZH 4LHQB 3IE4A 4QT5B 3L95A 4LVNB 4OZFH 1KXQA 2HVKB 4NZUH 3U6XA 5IOKA 3OGOE 4G83A 5DJ2A 4WNJA 2J4WH 4X98B 4B95C 5JR1H 3VXSB 1BYNA 1BX2A 5JLZA 2B7DT 1PLBA 4HG4K 2VITB 4JFXB 1QSVA 4X8JA 5HHVL 4G1MA 2OL3L 4MKTA 5A2LH 2JTDA 5EOCJ 1JPSL 1BEYL 3U4BH 4LFHD 4HOWA 3IJYA 1AVAA 4ZPVB 1DSFL 2C3HA 3C5JA 5B38B 1TCRB 3T2OA 1BMWA 3QRGL 4Z78B 1ED3B 1HNFA 4HUVA 4WEBH 4C55A 3IEAA 2RACA 3BGMA 2NW3B 1YPZB 4P2QD 3INOA 5I1LB 3C5SA 4PJIF 3LIZH 5GZOA 2X09A 1LDPL 3NOIA 3I9PA 1HZHL 4UF7C 1BDYA 2QLVB 2IVFC 5I28A 1BSIA 5TD4A 5IVZB 4CA4A 1ULVA 4Y9GA 3ZKMD 4Y5VC 4BRVA 4NO3A 2Y06H 1RFDH 2Y23A 1A1NB 3B2VL 2EEAA 4EUPG 2VB5A 3FRPA 3KBHE 5C0FA 3Q5OA 2PR4H 1JGIA 2LHAA 3GMQB 4LRNL 1PYWB 3I9IA 5BZWA 1AQDA 3GXPA 5KTEL 4HS8H 2AK1H 4MJ2A 2R69H 3EDEA 5IW3A 2FSDA 2ATPB 4FMKA 3QNZB 4MB1A 2PETA 3KYNB 2Y5QA 4NM4H 1H19A 4RMUA 1VGKB 3QJVB 4QXTA 4DN4H 5HI4C 3ZTJH 3VD3A 5EU5B 1QFWH 2X4QA 4JHBA 4OV5B 4MJIE 3K4ZA 3RVWD 5B21A 2ITCB 2JLPA 3KWUA 3MRDA 3QJHB 3KLSA 2FX8H 4WI6A 3SDCB 5FXCH 1CLVA 1KB3A 3KBPA 2Q6WA 4HP5A 3A67L 1TQCB 2VKWA 1SXBA 1YVLA 5I15L 1KPUA 3I6SA 2DOCA 2KMWA 1MPAL 4HT1L 1MIML 1W6LA 1ED3A 4S1RL 5BO1H 3WMQA 4UM9A 2I24N 1B0GA 4JFEA 4BFKA 2KI6A 3WEXB 1NBCA 1QSFA 2R0WH 1XF3A 2KS0A 4DP2X 2BP8A 4BK5C 5DJCA 2B59B 4P05A 1JRHI 7PAZA 2IMNA 4HHWA 5AOLA 1IBDA 2A77L 3E8UL 3NCWA 1J9TA 4MDRA 3MUGA 1KN2H 2C7UB 5ANMA 5FKPB 4CC4C 1U36A 1ACZA 2F19H 2YEVB 1G84A 1V7ML 3EYUL 3NSJA 4MRBA 5TK4A 5BMFL 2BZDA 4JFOA 4N2BA 3NZHL 1N2RA 5BUPA 4G8FA 4KXBA 3CFBB 2GJJA 2ICWI 3KBEA 1LK2B 4JFEE 5BVJB 3ARYA 3BD3A 3N91A 3QIWC 3ZGIA 3TEYA 1J0IA 3SDDA 3CLWA 1S7SA 2CIKA 2QVKA 1A5FH 1T5XB 4UIMB 4DFHA 5CN3A 4NI3A 4IYKA 4DTGL 4UV4H 5ANME 3UJIH 3TCXA 4AXWA 1U8IB 3OKOA 4Q52A 1HSBA 2OYMA 2NY0C 4V1DA 2EDRA 2OJZH 2IXQA 2DMGA 3ZE0B 1J9SA 3QFJB 1IFGA 2VTFA 3ZE2B 1HQRA 1NCIA 3FT2A 3W39A 4AQOA 4Y4HB 4KFZC 1CGWA 1OAXH 1AC6A 3BUBA 4WUUE 1QBAA 4YN3A 5JYLA 3OKNB 2VZSA 2H4EA 2IFGA 5CUSL 3U1SL 5IK3A 3C2AH 5TFSL 4MJ5B 3LN4A 3TH3T 2X6UA 2EIKB 3UFIA 1JGDB 1A3RH 1Z9MA 2OX5B 3MXVL 4FZEL 4PJCF 5E9DA 1W72H 3FB6B 3MRFB 3QJXA 3LRHA 4JFDA 2DMHA 1TZIA 2B4CC 2AJSH 5EEYA 4EUPB 1GCFA 4IOFC 4MAUL 3ZVVA 3AQXA 4E42A 4PCYA 3VXQA 3REVA 1TIUA 3TA4D 2XQ0A 3LIZA 2ZUSA 2H6PB 4V2BA 4F93B 3VI4A 4TUOB 2EINB 4U05A 2JCCE 1U4EA 5FO7A 4GSXA 1NKOA 4JY4B 4FFWD 2WMPB 3VD2A 5EN3A 2Z7UA 3LRSB 1KN4L 3WUWB 5GZNA 4OCRL 3DI2B 3O6KH 3E3QE 3N85H 3PHQB 2CUMA 2HPTA 3PWNA 2OSWA 1CR9L 1U8HA 2AJUL 3FQRB 3ARDC 1DQML 3NJHA 3P4MB 4YWGH 3K46A 1RAMA 2DLFH 1C8PA 4UQ2A 2G5BA 1C1EH 1O5PA 5CINH 1OP3K 4YDJA 2EIBA 1S5IL 3GMPA 4W9JC 4N2CA 5HY9B 5D8JH 3UZEC 3RU8L 5KJRH 3ECQA 2A6JB 2UYLA 1I53A 2ZCLH 2CO6A 4OGAC 3U25A 2NY1D 1Z3GL 1XR8A 5A2JH 1AS8A 2EIDA 3MLTA 1AXIB 3BP5B 3U79A 5IFHL 5JR1L 3MMEB 3L9YA 4NYLB 4R4FH 3CXDL 4U1LA 3UAEA 2A4CA 1IM9B 1BLIA 3WD5H 1JK8A 5D1QD 1KYFA 3CCHA 3PNWA 1FO0L 1RURH 2FLBT 4QO1A 1ANUA 1WF5A 1KXVA 4I48B 2YPLB 5E00A 3ZL4L 3T77B 3STZA 3WTWA 1I1RA 5DLLA 5DC9B 4LHUA 4NS0A 2FGZA 2BNRD 4GP8B 3FHEA 1WTLA 3KM2A 2NSQA 4FULA 3EBAA 5D2NC 2B1AH 3UZQA 4PJDF 1NEZA 1TU2B 2EQDA 3D39B 4PV9B 3EO9L 4HMEA 1F6LL 5C0DA 1BZEA 4NKDB 5LLIC 3A0OA 4N0UA 4N8VB 4ZSOB 1HEJC 5CP7A 5KVDH 2Y1ZA 1YYLH 4BFEA 3BIBX 1ORSB 3TNMA 2OMWB 1H15A 2F1EA 2WTRB 4R90H 3BPCA 4Z0BH 1DEEB 2WLJA 3H6JA 3TWCH 1SJHB 4ZTPH 4NQVA 4CU6A 3ROLB 3JSSA 4P5TC 4MNHB 3LKNB 5IB5A 4FG2A 2OM5A 4EN2A 4DPCX 5CEZL 2ZOLA 2GEQA 2Y1AA 3MV9E 1MF2H 2F7RA 2P5WA 4N0UE 2EDEA 4N90E 4U0RC 1PZDA 5D5ME 3QWOB 4MCYA 3EJZC 1U3HC 4M1GH 4L8SB 5DLMH 3INUH 4GYBA 3X13A 4DEPB 5KJ7E 2J25A 3S4SA 1PKQE 5E8DL 3S8FB 3U0WH 4HUUB 1WZ1L 4WI5A 3O0RH 4HGWA 3TVMB 3E6HA 5PCYA 3V4VH 1CFTA 3QR0A 3WKMH 3HNSH 1OVZA 2X28A 1GGTA 4PRDB 1BV8A 5DJCB 4ZXBC 4XB8A 3FUNA 2CUHA 4G6AC 1JV2A 2QT6A 1UWEH 3LNDA 1J8SA 4E41E 3NK3A 1R33A 3HLAA 1CO1A 2L7QA 3ATBA 5ESVB 1I1CA 5FM5O 1XH1A 2A77H 2F7IA 3DGCR 4QRTB 3UTSE 4XCEB 1EBAA 3M86A 5LAXA 1LEIA 3HC3H 1B0WA 4KTDH 2W0PA 5GIRA 1CN4A 3PS6A 4APQB 4BFRA 3EYUH 2J71A 4MQ7B 2ZWZA 5F9DC 4F7EA 2Z7ZA 5FDWA 3D18A 5MI0C 4GW4B 5I6LA 1KG0A 5D9SA 3C8DA 4OCSH 5DJXA 5F9WC 3TGXA 4KPHL 4LLDB 2OI9B 3GMOA 3TA3A 1IGIL 2FEDC 4ZX5A 1E9QB 2YRZA 5IUCA 4XPFL 4LLVA 4MAYA 1JNLH 1T89C 4BKSC 3S37L 1SFHA 3CMOL 1PZ5B 5AVQB 3MRHB 4RSVA 1AANA 5CSZA 3ZE2E 2FHBA 1WAPA 1UACH 2BNUB 5L4FA 2WKOF 3AVEA 3ES6A 2NY2C 1XZWA 1SRDA 2E6QA 2VDOL 3PABA 3WV0A 5AVZB 5ITBH 1LP9F 5CU5A 1E28A 1J11A 4HJSA 4FX5A 2ZAHA 1MCCA 3BT2H 3DECA 3MV8A 5IHLB 4AUUA 1LGVA 1ZVHA 4I7ZC 5DUPH 4TS6A 1NCBH 4WFFD 3SSGA 4IKIA 5IV2B 4XO8A 2HTKC 2ICCA 4GKSB 5L2JA 3VI4B 1D2OA 1Q72H 2XFXB 5FS5A 5HVHC 1AZZC 1U93A 2WUCH 5IOPB 4F7TB 1YY8B 1ZXKA 4GMSH 1EZSA 2FJGB 1FC1A 1A6WL 1NUFA 1RIUH 4GG8B 1L9SA 3IETA 4DJMA 5D6DC 3NPZB 3P11L 4DVBB 2YKLL 4JRYE 4WKZB 1HHHB 5FUZH 3TEUA 1IGCH 4X5WA 1NFDE 5T5NG 2YBRA 1ES0A 1I7RB 5EOCL 1U58B 2VJ0A 3R4RA 2CH8A 3U7YH 5FECB 4K94C 3KPSA 4OFQA 4RFOL 5F7EL 4FQXC 3N42F 1QHQA 1IVTA 1V3KA 3QDAA 5D1ZA 3BT0A 5CR1A 3CFDA 5JIDA 4G9DA 4P4KB 3P3UA 4BINA 5I1KL 4Y5VA 4HV8B 3CX5J 4LPTA 4Q6IB 2M2DA 3Q2CA 2D03H 5C0AE 1AGCA 3RWHB 1NFDA 3V8CA 5MP6H 3X11A 4E41B 1QFPA 1PW3A 1Y07A 2CR3A 1QLEB 3FQRA 3ZKSD 4AMKL 3KS0H 3D69B 3GSUB 4PS4L 4XNUL 4JQIL 3K2MC 2R69L 2Y2YA 4H7VA 4EQ2A 2HJKA 4KO9A 2A6JA 2UYLB 2W65A 4XODA 4JFVA 4S1QH 3SDYH 3VI4F 3ZSSA 3E2HB 5FYJD 1AY1L 3FNKA 1W72B 4NXKA 2DL9A 5CP7B 5FLVA 4UT6A 3SHSA 1JPEA 1IL1A 4NPJA 2E7HA 3IMRA 5CMAB 5C0AB 3HG4A 3WGUB 4EDXB 4AGMA 1CFNA 4FJ6A 1XL6A 3CZKA 5CINL 1JFQH 4Z7UF 5HP5A 1RH8A 2DDQL 4RCAA 4G8AC 1K9TA 3DETC 2BP8B 1Y6MR 2XIBA 5EG6C 1DQTA 2GSIA 1YEGH 5KVFH 1SLVA 3T3PF 4UBDD 5LG1A 3K6SA 4QAMB 3FTGA 4Z77B 1NBQA 3HG0A 1JVKA 2ADIA 2J44A 2FECL 2X4RB 3L1OL 3KEDA 2WXRA 3EADA 1NCCH 4L4JA 5BNXD 4E0RB 3OM3B 4M48H 4LP5A 2OXHA 1O6TA 1D5ZA 5C9JA 4BH7B 4DGYL 1OB1B 3B9KC 2CJTA 3CVIL 1ASPA 2G2RA 2IWEA 4AT6A 1T5WA 2XKNA 3ZZQA 2UXFA 3T71A 5I8OH 3FU8A 3QFDA 5E1AA 2H26A 1QVOB 2XV6B 3QRFM 5IHUL 4JFHD 1FNHA 4IDLA 3LRKA 4YHKL 1DE4A 4B9IA 3DV6B 4GAFB 1G6VK 3MX0A 4XOBA 4H5SB 3SPIA 1DCEA 1DBBL 3BKCL 4ZUSB 3RAJH 2IALA 3BWZA 3Q1SH 3TVMC 4OZGB 2QVFB 4MCYB 3HTLX 4O9HH 4X4YA 5D1QA 1A3RL 4FZEH 4R90L 5DVLA 1MFCH 5DUBA 4ZO8A 3Q6GL 1ZJAA 3MRMB 4RRPG 2LU4A 4R26H 1ZHNB 1N8OE 1FZMA 1I9JH 4YHLL 2ZP9A 3L45A 2YLKA 2VDRH 3KLLA 1PD1A 3LHPL 5CJ5A 3D2TA 4WO4D 4J4PD 3MSPA 2V9RA 1HAUA 3KPRD 3QXTA 3I9GH 1UA6H 5IMOA 1JZHA 1E8XA 3UPRA 2F54E 4O51A 1XR9B 4F37K 1PLGH 4HH8A 1WAAF 4NFCA 1NCWH 2EYSA 1B0RA 5C07B 2VJ8A 4BE5A 5J89A 4R2GB 4LNRB 1NCHA 5D1ZI 4TULH 4XRCA 3O45B 1KLFA 1CLYL 4NNPL 2KZ1B 2P45B 4DQOH 5E1HB 4QCIA 5EORL 2VRQA 5IB4B 1FAIH 3KHQA 2Z92B 3BUIA 4M9PA 5AYQA 1E4JA 1E5ZA 1QSFD 1AZVA 2P24B 1EVUA 4NJAH 5EU5A 5KS9A 4FTVA 2YFOA 4NQQA 2X88A 3ARQA 3ESMA 3QEUA 4YDJB 1S7WB 2WXKA 3MRDB 2FX7L 5HPMB 3F01A 1WO2A 3ATAA 3QZLA 1NEPA 3MODH 4J3BA 4MS8C 1UD2A 1AD9B 3IJ7A 5C0FB 2Z8RA 4UNUA 4WK0B 4NKOB 1WBXB 2QGCA 4UQ3B 4BK8A 3KDMA 4EEEA 5IKCB 2WXPA 4PJ8D 2B1AL 4PY7B 2J1XA 4YSCA 3BKJH 1K6QH 3OB0H 4FTVE 4ODUA 3R8BB 3BUDA 3CVCA 2BERA 2K3HA 3QJUB 4N2NA 5TF0A 2VO5A 1A66A 5K59F 1SBBA 3KVQA 4ZMQA 5DCCA 3Q9PA 4GXUM 4W4NA 4ZYKA 1QSEA 2YD6A 1X5LA 1DSWA 2A38A 1G6RB 2R1XB 3A4FA 5C71A 4LF3A 5I1IL 3HS0C 1I7TB 2FBJL 3CDYA 1OQOA 4HWUA 1Q4NX 1N6UA 2VQ1A 2WKOA 2AXGB 3EJUA 4YHOH 3ERXA 4H20H 1JGUH 1LP9A 3N0AA 1DYZA 3QDJB 1BFVL 2ATKA 2GJ6A 5DS8B 3IS1X 3STLA 4EJ1C 5D7IA 2BX5A 3UTQB 3OQRA 5JPMC 5DWPA 3QSKB 4BDVB 1K4CA 4DGVH 1O9WA 1XEUA 4O02B 5CZKA 2F7OA 2BHFA 3DJTA 3UTZA 4M1GL 5DLML 3TN0D 2WYIA 3VGEA 4PBWD 1KCKA 1U0QA 3V0FA 1BCIA 4ZTPL 2R59A 1W72A 1MW3A 2VZTA 4BCXA 1IILE 4CMHC 1BYOA 5GJTL 4XMVA 4NKOA 4UQ3A 3GRWL 4NZTH 1JZGA 4BIKA 5BQ7B 2ZX6A 1XWVA 1E6OL 3ULUF 3ATFA 5BVJA 3MDJA 2QTEA 1UB6B 4Y5YC 7FABH 2F54B 1E65A 2WQSA 3HKZA 3EBGA 4YGVB 1MCFA 4FNLL 4V2CB 2ZX7A 4H8QA 4MA8L 2ADIB 3QJZA 4PYGA 5CZRA 1YQ2A 3J07A 1KBGH 2GC4C 1W80A 4IJ3B 5D4IA 3VI3B 2Z31A 5HYSG 2QJDA 2R56H 5AZ2H 1AQMA 2B2XL 2R8SL 4XAWL 4N0RA 1B3JA 2ESVD 3BMVA 3LZPA 3BZ4A 1NCCL 1FJ1A 3LKRA 3FOMA 1CFNB 3B83A 1I1YA 5DA4A 1MCDA 2X40A 4TSCL 3C8KA 2NY3B 1R3KB 4XTRC 2XQBL 2ZKHL 3JVFC 4TPRH 4TQHA 3HC3L 3WIFA 1MCWM 4HULB 1HHGA 2BNQA 3GS7A 2ZUQC 3AFLA 2CLRB 1IGMH 4O2FA 1EZLA 3NUKA 2N56A 3K1DA 4HAFA 3HS0A 1FH5L 4FA6A 3VD9A 2YGOA 1GW6A 4KO5A 3TBCA 1P4IH 1FWXA 1T2XA 4AM0B 1NBVH 4B60A 5AOMA 1HK6A 2J5WA 2WQAA 4H44C 1XBRA 5BZWB 2HLFC 1KTCA 3KVDD 4GY4A 4WW1B 2BNQE 5KVEL 1C16B 4HHAB 3D7PA 4LAQH 1P53A 2HUEA 4FQPA 5SWSA 1JF1B 2EADA 1WDAA 1H3PL 4N86A 4YXLH 4FC3E 4H5SA 1X7QA 1DL7H 1RIUL 1MZYA 4URKA 4U6YB 1E7VA 4M8QB 3I6LD 1INEH 2GJZA 4L5FH 3U0PA 1SMAA 4LAJH 1AGEB 2YKLH 4K2UL 4JFDD 3HB3D 4F7PB 4PG9A 3RVXD 3DUSB 2B5IC 4R3SA 3W9DB 3RGHA 4WSKA 4U6HB 1IGYA 3IFPA 5HHXL 2NQCA 2BVTA 4PN6A 1WV7T 2AJYH 2LLGA 4G7VH 4ALAH 3BJ91 3HAEB 5DVMA 3RPIA 4RFOH 1DANU 4WKZA 1LK3H 2VXQA 3TZVB 2XVLA 4O5LL 1NCWL 5EHFA 4XMUA 2BDNL 1FNEA 1I7RA 3D0LB 2C34A 2JH2A 3P54A 1U91B 4OJAA 2QPUA 1JFHA 1NOFA 1KGXA 1D5BA 5J3HD 4FEIA 2IPKB 2QPDB 5EOCH 4ES8A 4DT2A 2R51A 2PCPB 2OL3B 3OR7B 3GSWA 4QTHB 4AX3A 3IDYB 3QUKA 3MCG1 1U3HB 2WXFA 3L2MA 1M2VA 1N0LA 5DJYB 5JQHC 3PWPA 5J4MA 5I1KH 4HD9A 1KCWA 4PJ7A 1ECYA 4M3JA 2V17H 2ZXCA 5DD1H 1Q9OA 3JUZA 3EGDB 3L16A 3NTCH 3AWEA 3MZTA 4KK5C 4N68A 3QUYD 4F8NA 5IW6A 5BOZG 3BZEA 4BGDA 3UZVA 1OE2A 1DQLH 5F89B 5FM4A 2OS7A 1DP0A 1EZUA 2VNCA 3ME0A 4ORGB 1Q1JL 5IW1B 4APQD 1PIGA 4LVHB 3IBOA 5IT2H 4KTEH 5I8EA 1AC0A 2X1WL 3QULB 2ID5A 1KYDA 1HI6A 4WJ5A 4HH9A 2QKIC 2EH8H 2OR7A 3QWOA 3PWPE 4GIPD 3SYPA 3DOIA 4NNPH 2K1MA 3ARGC 3UYPB 2CDGB 3ZHLA 1OT2A 2OMXA 4F7EB 4EZLA 5D7KD 2BY2A 4XHJD 4ODWA 1RP8A 1KEGL 3VVWA 1KENL 2FSEA 5DWUH 2X3CA 4AEFA 4NQDD 4FQ1L 4JHUA 5EIQA 1V10A 1T4KA 4WCYH 1YEKL 2MOQA 3BI9X 3VXRA 4N2FA 3V79C 2DDQH 1RJZB 5TPWH 2FWSA 3UCQA 1A3LL 5ISZE 1M71B 3FUEA 4W9KC 1HSAB 5DJ6A 3RVWC 4G59C 4R0LA 4OVUA 4K4KA 1CZ8H 5LAXB 1CLZL 1XCTA 3VW3L 4AV0A 3B3IA 4IMLA 1OSYA 3IKKA 4NO5B 1RD6A 1A7NL 4LZKA 1ZLVK 5TE7H 5MEQB 3K5RA 3O2DL 3CVIH 1MLBA 3NP4A 1X6NA 4F1SA 1F2XK 3S5LB 1J5IA 4XC3H 4HIJB 3IDXL 4J6RH 4OZFG 1TQCC 2G5BB 2NY5H 4NRYB 2VQTA 5BV7B 3QCUL 2AANA 2AJXH 4WRLA 5MERA 1QPPA 3KYKL 1N59A 2F74B 3UYPA 3PJSB 4X0KB 3U4KA 1XR8B 3D39D 1U41A 3EHBC 1DJYA 4CU7A 4RIRA 5T1KD 3FQYA 4NUGH 1ZHBA 3CU1A 4I1NB 3UO8B 1JYXA 3DBXA 2DLIA 2YBRB 1MVFA 4KNUA 3S5ZA 4BHUI 2PW2B 1OANA 4MX7B 5FO9B 2ZKHH 4TPRL 2ISDA 5KVGL 1KYAA 2I9TB 1M71A 2G9HA 2G2PA 4E41D 5HJ3A 5AZUA 3UPRB 4NAJA 4CN1A 5GJSH 2ADJA 1PLCA 2J20A 1XF4A 1KGCD 1ZT7A 4GKNB 3RA7L 1VRSA 4FHJA 3ZY7A 5CBAB 3D2UB 5F8QC 5C0BD 4GXUN 3BQVA 2IWGA 3BIKB 3ZTNH 2IBBA 2APBA 2NY0B 1W0YT 3EJQA 4NUJA 8CGTA 3P4LA 4RBPK 4HEPG 1OWRM 2R56L 3BLKA 4EN3C 3CLEL 1MI5E 4F2ME 3V0DA 4AYGA 5E95B 3V9EA 4P23C 3PJSA 4X0KA 2X4UA 4N0YH 2CHNA 2P5WB 3D12B 3Q43A 4UYQA 2N0MA 2EIJB 5AVRB 2IH1B 1K6QL 2DQHL 1YEJL 1RLBA 1VGEH 3F6IA 4GSUA 3S3JA 3N40F 1IL1B 4L8SA 3X13B 1A7PL 1BQKA 2AQTA 3H6AA 2M26A 2GCYA 1QO3B 4CBZA 3ULVF 1AO7D 4WW1A 3MLZH 1O7DC 3IJHB 1FNLA 3BN3B 3EF7A 4XE5B 1SGKA 2B5IB 4JK0D 3QNYA 5DDHB 3RWGA 5BS0B 1YMMD 3OTTA 1MCRA 1OAXL 4Y9CA 1NGZA 2FR4B 4PU2A 1E9PB 1OK0A 2DBLL 3SPCA 1NMBL 4CNIB 3PCYA 4PIRF 4BQ9A 1F3JA 4M7LT 2OL3A 1T6VN 3OR7A 4E0RA 2ZG2A 4ZXBD 3QS3A 3NFSH 4HUWB 2BSCA 4PRHB 4KOBA 3B2VH 1UXSB 4MS6A 1XXDC 5FYJU 4U6XB 5AYUH 4U4BA 3NIGB 4APQA 1N5YH 1ETA1 1V7NL 2RAMA 4OZFB 3AUVA 5L2KB 1PEZA 1SLUA 5EF1A 5IG7B 3VFOA 2YD7A 2AI0H 2VQ4A 2H8PA 1ACYL 3IN2A 2NY6C 5HHVH 1MAML 1YSOA 5I8EB 3TJHC 3SQOH 5HHXH 4GNKB 1UB5A 2MKWA 4G7VL 3DX4A 1NTDA 1A6TA 4OCRH 1ZDQA 2NZ9C 1OT4A 4JHAL 3A6BH 4YDZA 5I19H 4EXPX 1HHJA 3HR6A 1A6VL 1BAGA 2N4IA 4OCNC 2DLFL 4KUCF 4PGEA 3HZKB 3ETBJ 1VEPA 1G6RL 3P0VL 4PGCA 3FCSB 1IKNA 2OMTA 5T1MA 1IVLA 4NN7C 4QEGA 4RGMC 4L4TE 4HF5H 4KY1H 2Y06L 4YGVA 3SJVD 1MCQA 2AITA 2R0WL 3VD1A 5BXFB 1DE4B 2IAAC 1IT9L 5FM5M 1LE5B 2DKMA 2F5AH 4PEEA 4R2GD 4N0UB 3QPXL 4PJHE 4WWKB 2H32A 4RESB 1FO0H 5K39B 5E2UH 5IJVB 3L4TA 4HMDA 4AK1A 1E42A 3FO0L 1KUMA 2E9IA 3OWEA 2BJMH 4PJ8C 5C2BL 1SHXA 2X53A 4L4TA 2KZBA 3IPEA 3MV9D 1WC7B 1PG7W 2J72A 4S0TD 3RX9A 5LXGH 2OSXA 5AZ2L 4AVKA 3RUGA 3DX9A 1KLGA 1GZHC 4QXGH 5C08B 1DN0B 3RY6A 1BAFL 1MCOH 2YXVA 4KI5D 3CPLA 4KGJA 4O2FB 2VDKL 1A7OL 4A7QA 4ELMB 4IW4C 4M5YL 1MVYA 4HT1H 4AQEB 1WZKA 2Q3XA 2JKNA 3ECUA 2X9WA 2H41A 2E6JA 2WQVA 4FQXA 4Z3JA 3S4SB 2G3ZA 5CIPA 4PH8A 1SJEA 3DVIA 4BFFA 5E4IA 5JA8B 3FKUS 5GGQH 1R34A 3S6CA 4EIZC 5EOTA 1JPGB 1L9MA 2C9XA 4LE8A 3F6JA 5BW7C 3MUY1 4U1JA 3WIHA 3SE3C 2H2PD 4KDWA 1KBPA 2CK0L 2FAUA 2HVKA 4DO5A 2ODIA 4K2UH 2W95A 4HQQL 5I75B 5AYTA 4QOKA 4DP4X 4L4VA 1P6AB 3TS8A 4H8VA 4OFDA 2F53A 4IDJL 4LSPH 5I23A 1XTLA 3V0WL 5ACLA 2AJYL 1CZ8L 4GBXC 5L2KE 2JB5L 1TF4A 1F42A 4PMEA 1L7TL 3BSZL 1A65A 1GYCA 1UVQB 2ZOKA 5JHLH 5EEZA 3ZIYA 5HGBB 3J2PA 1QSZA 2P5EB 1KG0B 3BUTA 5D9SB 4AYBA 2Y07L 5AW8B 4LSUL 1JDAA 4OGZA 2X6AA 3S34H 1RK0B 5CD3B 2XN9B 3C6LC 4JG5A 4LEXH 1V27A 1CR9H 1U95A 1FL5B 5C8JA 4ZTOH 4O5LH 1OAQL 4YXKL 4PJGA 2B4CH 3K2KA 3TA3D 4XBGB 1ZLDA 2JQMA 1URIA 4GG6F 2YPVH 1XB8A 1INDL 1LYQA 2DWDB 4S2SB 4L48A 2QLYA 2VN7A 4IHOB 1S9VB 4NERA 4IIQA 1IBHA 4MD0B 3LXUX 8PAZA 2HTLC 1HVXA 2Y9RT 2AK4E 4G80B 4P23B 5E03A 5JUEL 2OMNA 4K8RC 4XXWA 5EFIB 1J0JA 4PJ6A 3TBSA 3UGUA 2EE9A 5KG9A 3VQLA 3NACH 3ZL4H 4S1DD 2WVVB 4ZUSA 1D6EB 4TSBL 4GS7B 4UTCA 4M8UA 1FYHB 3B1UA 1IE5A 4HS3A 1CXKA 2HB0A 2ATAA 2W0FB 1YCSA 1LD9A 2VLRD 3NSFA 3V5KA 4F33B 4DP0X 4XWOD 4ELME 2V5TA 4Y4KC 1AHKA 1GYVA 1E27A 4H0IA 1PIFA 2K45A 2WUCL 4ZUWB 3CH1B 5FWQA 1FL3B 2VCOA 4KVNL 5H94B 3V4PB 2LU7A 4LCCC 3ILPA 4FYTA 4NGHL 5KSAB 3NJMA 3BAWA 4Z0BL 2WSKA 3H9SB 1UM4H 4MNQB 1P6WA 3VGGA 1QR1B 3TT3H 1E4KA 4TQIA 2EDLA 3EFFA 1H6UA 3ASNB 3LVEA 1VFUA 3NAAH 1T1YB 4OM0H 1WFOA 2YHGA 2W92A 2GJPA 3LKPB 4LKCB 3U7YL 5TPWL 2C1PA 3QORA 2DZEA 2ZXDA 1YA5A 2PYFB 1MHHA 2YFNA 4MGXA 4RETB 3LRGA 1L5GB 3TBWA 5DTFB 3V4VL 3HVNA 1P7HL 3ZE0E 1OLLA 1QA9A 1YAIA 2DM7A 4Z7OF 1R5WB 2EYRA 4NUPA 5HXMA 2BY3A 1JTOA 2LQRA 4N3UA 4ODHL 1RUAH 4HKZA 4QRUB 1BVKB 2KLTA 3BIAX 4Y19B 5IJVA 4R83A 4YHNB 5I6PA 1N64H 2WYZA 1LD9B 1OD7A 1K3IA 4KNTA 4ODVH 4YZWA 3RKDC 3V5KB 4AQ1C 2ZXQA 2OW6A 4OGYL 1MI5A 2YQ2A 4NSKB 3HNTL 4HS6B 4H0HB 3MUUA 2FYVA 5FHBL 3RQ3A 3Q5TA 4N2LA 2ED8A 3GUTB 1CFSB 1D7CA 3GTTA 3GXIA 4L05A 5DD0L 4PY8I 1XO8A 4MVBC 3QCTH 1CVRA 4MLSA 5HI3D 2FYYB 5F2FA 1KTDB 1G9MH 2A9NL 2K8MA 3MCKB 5HGHA 5ICZA 4JRYD 4TNFA 2BNRA 2XZAL 3CC5B 3DYOA 5IVZA 5I19L 5E8DH 1HEZB 1NDMB 2JQZA 3U0WL 3ILEA 2ZP0T 3D85D 3ECWA 3MRNA 4P4KD 5IIEA 3WMSA 3FFCB 3HNSL 4CL7A 4URTB 5GGSA 3QHZL 3AS1A 4KFMA 5DF0A 2VLRA 3UTPE 1MFBL 2YD0A 2J88L 1D9KB 4AKPA 5J11B 1XGQB 1T1ZB 4OQTA 5DS8A 1NJ9B 3VUAA 4QTIH 4YEEA 3RJDA 2XIDA 4Y4FA 5F44A 2WXMA 4P49A 4G8GA 1DN0A 3CFNA 2O1AA 4IOSD 4MWFB 1JWUB 3WNKA 1SPDA 3HC4H 1XCWA 4WUUA 4OZGA 1CXFA 1XF5A 4AQEA 3VE0A 3ZTEA 1KYUA 2V7NA 1KPVA 2Z35A 4P2QA 3TF4A 1XEDA 2BHUA 5C2BH 2WW8A 3MUZ1 1FV1A 1GOFA 2VMJA 3WNLA 1BG1A 2CHWA 5HGBA 1VFBB 2EKSA 5C6WH 1FFNA 4XMWA 2RBLA 4FFZH 1CF8L 5BQ7A 5KSBA 1A6WH 4K7FA 1PEWA 3G5YA 4DUXA 4BEIA 3JV4A 2R39A 1RP9A 1OP5K 3M88A 5HGHB 4L4VB 3LQAL 3CSYB 2NY3D 3PJNA 4UAOC 2AQ2A 2HLFD 2QHRL 3IM1A 3FYEB 4HIIA 2ZCKH 1NCNA 1UG9A 1CE1H 1XCXA 4L1SA 3SPGA 4WGVB 3NRQA 2VN6A 4J12A 2X1XR 1U4FA 4WO4A 3NIGE 2CO7B 2J2ZA 4ZS6C 3V6ZA 3WNOA 1VCAA 3SYAA 4X9HA 1RZKH 4MBRA 4PJHA 2PWHA 2CD0A 1GGUA 3P0YL 5E4EC 4JFFD 1XMWA 4IGBB 2QSQA 4NKMB 3TH2T 3EDKA 1U6AH 3VFOB 5JIQA 3ZDWA 3MRKB 2A0LD 3RB7A 1DJZA 3DJRA 2VSMB 1YPZA 5I1LA 4PJ9A 1KV3A 4AMKH 3I50L 5GRWA 3KYMA 4Y16B 4L4VD 3APDA 4X7TA 2WLIA 1AIZA 3ETSA 5F96H 4ZAKB 3QXAA 2QMJA 4WF7A 4YS4A 1DDHB 1HJCA 3PGDA 4DQOL 2BVPA 4RA3A 2HKHH 4M93B 3KJ4B 1J8RA 1VSCA 2WOYA 4M7JH 4PJ9D 3BH8B 3MBXL 4Z7WB 1CFTB 1ITCA 2YGNA 3VFSB 3IAQA 1IT9H 1XV8A 2MPVA 3ML8A 3CBJB 4NDMA 4NCC1 3O3UN 5E6YA 4EZJA 1U33A 3NIGF 3FSOA 4WQOA 2LTQC 4C58B 4WV1C 5C07E 3ZL1A 3KGSA 2WVVA 4XNAA 2BS8A 4DP8X 5C0BB 2Z0UA 4ERSL 1BREA 3JVGC 2ZG3A 4FNPA 4G1EB 3N0PB 2PTTB 4ZOEA 4UDTA 4YNYB 5DZAA 3BFWA 3RGVD 2W0FA 3OJVC 5HBBA 4H0GA 4PJDE 3FC8A 4QXGL 4LCUB 4R7DB 3SO5A 3D52A 1I8IB 4XPTL 2IPTL 2XFGB 3LQMA 3BVDB 1FRGH 3QPKA 4GT7A 4YE0A 1JVLA 3TNNA 1HXKA 2Z31D 1YC7A 5DQJB 1KCUL 4D8OA 4HUVB 1CTOA 5AL8A 1X7TA 5I1EL 1P5UA 2MKLC 4GAGL 2FLMA 5KBNC 3T09A 3D0LA 3GMOB 5I5JA 1UQSB 1PKQA 1GW0A 2ITEA 4OLYH 3GF8A 4P4RA 1BGXH 2VOTA 3TP4A 3TPUA 3ZRCC 4DWHA 2HMIC 5GSVB 2NY7L 4OT1L 3MRJB 5L9DH 3Q1SL 1DVFD 4PRIA 2PKDA 1KBVA 1BF5A 2WXIA 2GTZA 3GSXB 4DNLA 1TQTA 1XZ0B 3SGJA 4LHUG 3WKQA 4NWUL 3GHBH 3UMNA 3BP4B 2GJ6D 3F00A 4CVUA 2HRHA 2W88A 3QAQA 2PP9A 4L3FA 2Q76A 4D7PA 3II1A 3R7QA 5F9OL 1W16A 2X38A 1L4IA 1RIVL 3HJEA 4XPBL 1G7QA 5D7JB 3PQYE 1HCYA 2A9MH 3RWGB 1ZS2A 4YSUA 5C0BA 2WD0A 4D9QE 1FH2A 4OM0L 2HVBA 3NIDF 3QQ3A 5TDPB 2A74A 3DMMC 4LBAA 3QIWB 2CXKA 3RWJA 4LIQH 4MZRA 4ONFL 1TZGL 4LLWA 3WBDA 5KAQG 2R7EB 2KERA 3HG5A 7FABL 2AJZB 1Z9NA 4MJIB 5EO0A 3U0TB 3VD5A 1CS6A 4RMSA 3MMEA 2DM2A 3D39E 3OJDA 4JREB 3BN9D 4Y5YA 3S2AA 1RZJC 4OJEH 4PJAE 4X4MA 3X14B 4R6UA 4Y9EA 4LPUA 3E1F1 4NO0A 4FI8A 1QBMH 4RISL 4J1UA 2FECI 1AOHA 3QDMD 2DQUH 2RR3A 5HYFA 3S0PA 2HVJA 3EFOA 4QRPA 5JHLL 4N5UA 1PSKL 2FQFA 4XNMA 1U8QB 5J13B 1GJWA 4HJ0C 3V5DB 4BZYA 5GSVA 2WBKA 4FLSA 2G0KA 5BO0D 3HC4L 1TU2A 3QRBA 3D39A 4E42B 4YLCA 1G7JB 3GI8H 1AAJA 1T66C 4XP6H 5FHBH 4LP8A 4DW2H 2FX7H 3FW6A 2QGEA 1XZ0A 1KCLA 3MV8E 1B2WH 3UYOD 1Q94A 1I9JL 3OG4B 3ARBA 1KCVL 4OFYA 4TUOA 2YK1L 4FKKA 1MUJA 4WI7A 4GKZA 4JG1H 1NC4B 3WLWC 1A4KB 3BW9B 1J0KA 3RWEA 3ZDZB 4R96B 4RBPH 5IVXE 4G8GB 2DQTL 2EXYD 3LZQA 3ZYOA 2UWEB 5J6SA 2UX7A 2GJZB 3VH8G 4XO5A 1IB5A 1CPUA 1EGJL 3ZHNA 3G08A 1KTJA 4YPGB 1G7IB 5AAPA 2QADD 2VDRB 3MZGB 3AU1A 3OX8B 1A4AA 3LQAH 1LEKA 3X12A 2G4GA 2YXWA 1QABA 3OMIB 4BQ8A 3B2XA 4WFHD 1LO2L 2CO6B 1N59B 2F74A 5DHYB 4K7FB 3G5YB 2QDVA 4TLSA 2FO1A 2OMYA 1EAPB 1FG2A 3O8XA 1DLHB 4JDTL 4NHUB 3CSYA 4OLXL 5DEFB 3T8MA 1VB9A 3HKFA 1HESA 1I3UA 3GINA 2BXYA 2RHEA 5CU9A 2DKSA 4AENA 3HMXH 4DGVL 4QPEA 2IDTA 4GBXD 3NDZE 3NJLA 3QJOA 4LHUB 3GSWB 3R4DA 5BV7H 3O0LA 4C8XA 1LJMA 4JMXA 2MCPL 2BNRE 5C0RL 3IF1B 4CJ0A 3L81A 3T2PA 3ZLQC 3FTUA 2NCMA 1QTYT 3R06A 3KE0A 2FH6A 3DGGB 1DVFC 3D25A 4KMQA 4ZSOA 4AEIL 4NZTL 1B4RA 2UZPA 3TBWB 4CSTA 2YQ3A 1DCLA 3SEPA 1U8KA 1PFCA 3FULA 3OLDA 3V9FA 2QSVA 5E9DE 3RIAF 1D5MB 3PNRB 3RNKA 1TSHA 3CFUA 3EAKA 4NM8H 3STBA 4CADA 5F88B 5HY9A 4A63A 1GC1C 3PGFL 4UDTB 4YNYA 5C7XH 2IIJA 5AW7B 4G43A 4YMPA 3O2WL 4KI5E 4HUXA 4AJ0A 1OGSA 2BNQD 3MLTB 3RHWK 3R19A 5E2TL 2BS71 1G9ML 3PWLB 3DROA 4Q0XL 5T3ZD 2R0KH 1JERA 3SYOA 3V95A 4XPAH 2FX8L 4Z0XB 2YD4A 1RUKH 4IHBA 1WD9A 4YGAB 5DK2A 5DVPA 2EJ1A 3ALXA 2J5LB 5AB2A 3QQ4B 1MQ8A 4QOKB 5I30L 1CGUA 3UAJA 1G7MA 1HOCB 2CGZA 3KNBB 3HI1B 3BAEL 4PRPE 5K69A 3ABLB 2HG0A 4OZIE 3RTQB 1MJ7L 2DWXA 3N9GL 4X2UA 4NKDA 4UV7L 1N6QL 1HHIB 4B3EA 4Y8DC 4PJEA 4M4RB 4NRZA 3WJLC 5D1XE 5I1AB 3VXMD 4KK9C 3C75A 1PGRB 1XGQA 1TJGL 4NRXA 1GAFH 5IHWA 4P23A 3UTTB 3W5NA 4U1NB 1C9SA 5DK0A 3QRLA 4JUSA 5AKSA 3TWYA 2H1XA 3RDJA 1SYVB 2NLJA 5EC1B 2YSSB 3FN3A 1A1MA 4M6NH 2CWRA 2VN4A 1JOIA 2A6KB 1ZA6A 2XU9A 2QFPA 1P84J 4ELKB 3H9HB 3KPSD 3RVVC 3O2DH 4ZQTA 4X7CC 2UVFA 2JK5A 4FOMA 4KDTA 5I74B 1KIUB 1S7QB 3QUZA 3NEEA 3QI9C 2CBOA 4WK4B 3PWVB 5AKRA 1K4DB 3WFBH 1KC5H 2KC0A 5F7HA 3WTTA 1BVZA 3LQZB 3DRTA 2PYEB 3QCUH 4AW4A 4YAQA 2DL2A 1DFXA 3VAEA 3FAXA 3GSVB 4Q9CA 1H3WM 1I8MB 1LK3L 2D0HA 2EXTA 3TC9A 2CKBL 4HCFA 4DP7X 3MNZA 1GGBL 3C2AL 3IJSB 4YO0B 1OQXA 2WP3T 2ALAA 4E9RA 2HP4A 2W9DL 3O8XC 3PRZA 1WCBA 2YRLA 2WZAA 3GHBL 3MV9A 3OB8A 2CUAA 5CJ8A 2QL1A 3DIFA 4Z6AT 4Q58C 3KG5A 1RZKC 4KROC 4JDZB 4OF3A 1A6ZB 2P42B 4KZ0A 4UNIA 4WTWA 4IU3B 4RGMB 5EU6E 4JJHA 4KZEL 1EFXD 4IKLA 4EN3B 3IRPX 2CBQA 5KVGH 3WY1A 3T2NH 2IAMA 5EH1A 2BSTB 3TO2B 1QTSA 4TNGA 2VN5A 3UAJD 3H8NA 4NKMA 3NCFB 2VRKA 3RVUD 4WTZG 2L0DA 2DQGL 2KUTA 1TVBA 2CXGA 2OJ1A 2ZF8A 3BFOA 2A6KA 3NVQA 1S7TA 2GIXA 4F2FA 4JFUA 5DVOA 5EU3A 3CFMA 5LDSA 3TCTA 4FG6C 4M7JL 4OGAD 1T20A 4U7SA 3LEVH 1U2CA 2WZ6A 3BYTA 1TITA 2IDUA 5E24E 3IT8D 1GL4B 3REWA 3SCMB 1NIDA 5I2IB 4LSSL 2EE3A 3KYOB 4YZFE 2Z93B 1C1EL 2PNDA 2YAHA 4G8IB 3FTZA 1S7RB 3N04A 1KB5L 4FN0A 2X9YA 3L1FA 1MFEL 1ZHNA 2CBPA 3SQRA 4ZFZA 5I1CL 2P5ED 4U1IA 1AKJD 2CRIA 3MBXH 4OIBA 4TVPD 2FDBP 2X4OA 3OSVA 4EBQL 4HKXB 2OLDA 3ZDZF 3MLZL 4D9RE 4OD3L 1WP6A 3JTBA 3US9A 4MA7L 4TUJB 2HJKB 4K9EL 3PQYA 1JMZA 43CAB 4ZMYA 5LN4A 3MC0A 4OI7A 1FZKB 1SUHA 3CUPA 1UD4A 1JPFA 1CF1A 1M56B 3SQBB 2RMNA 2JCCF 5TF1H 1YDPA 3UBXA 5MEOB 3GK8H 5IG7A 3QUXA 1KGWA 4JX0A 4OQ1A 2X44D 4ZS7L 1EAQA 3SCMD 4EKJA 4QCIB 5D4JA 2BOBA 3OMZA 5GPRA 1TEGA 3Q8AA 1ETZB 4OBRA 1RJLA 1USZA 2E46A 2CHZA 5CN1A 2LR4A 1AXTL 1EJFA 3GNMH 2J8UF 4YSSA 4IK7A 2XV2A 1WZAA 3Q2VA 3GD1C 1BFOB 2NY5L 3IJEA 4KJQD 4ZS6D 4APXA 5BUGA 4LPVA 5LWYH 5DWUL 4FFZA 4Z7WF 2NY7H 3DGGA 4JBSA 5ABDE 3SQOL 2VLRB 3L5JA 4J3TA 2I7OA 2VXTH 5DFVD 1XSOA 4GUPB 3QHTC 4I0KA 3O3EB 3NPSB 1O9ZA 2XA8H 1M3IA 3ABGA 4P2OB 4Q0XH 2B15A 2EDDA 3ISWA 5EBWB 5IFJA 3H2WA 2R4RL 2KBGA 4AK2A 5BS0D 1KPRB 4WLCA 1NICA 1V3JA 5LGHH 1ADQH 2ZTBA 3U0PB 3ZSTA 3AC0A 3ABZA 5SWZD 1YUHA 2VL5B 4QNPF 1Y6NR 5AAMC 3RTQA 3WE6B 1G6RH 3P0VH 3ROOA 4XPBH 4AG4H 3BKML 1K2DB 5I66A 1F4WH 5IQNA 1JPFB 1IGYB 3IFPB 4PJEB 5FGSA 3SDAD 1FORL 4BQCA 5F9AC 2J8UB 4GI8A 4JN2A 4PJCA 3O3BA 3P3RA 1J87A 4LIQL 1OAZL 3RFZA 2AMUA 3D85A 3MBEB 5ID0B 1AOZA 4HLZG 2CK2A 3RI5F 2FIRT 3L4UA 1MKFA 4HALA 4NQXB 5L2KD 2VT0A 3X2QB 2JKSA 4AC4A 4HBCL 1J0ZA 2QQLH 4F2EA 2PXYB 1NCUA 4Z7VB 3QPQC 5E2UL 2BHZA 3VD4A 2EXSA 2XXGA 3OXRB 3QG7L 3VFUB 1UJ3B 2CCWA 3IGKA 3EUUA 2BJML 3DDFA 2DQUL 1N7MH 2WNKA 3D08A 2IPKA 3KPOB 5E2TH 2ZWNA 4N2GA 4BFOA 5GRVL 2O72A 4LF3B 5LBSL 2WBXA 5C09D 2AAAA 1KY6A 3BSGA 5K1VA 4DKEH 4XPHL 1LXMA 3GJFB 4P9HC 5FYLH 3BWUF 3NBNA 4ZUVA 3FUIA 4OLZL 1LP9B 1XR9A 1BD2D 5J1TC 1E5AA 2P5EE 5CHNA 5C0CA 3DHPA 4Z7IA 1MFUA 4LT7A 3C2SA 1YJDL 3NQIA 3PY9A 4H88H 5IF0A 1TKWB 1G9HA 3I3EA 1J1OL 1ITBB 3VQ1C 3A24A 1GC1H 5HHMD 2EEFA 3LNGA 4Y1AE 2CDEA 5GZOD 4K8RH 4PRHE 1J5OL 4W9FC 1DVFA 1IIKA 5A16A 3UERA 4LL1A 2R83A 4KKLC 1RUQH 2Q6WB 1ERNA 2V3DA 4MA3B 3VYPA 2YMXL 1FBIL 4JDZA 4KY2A 1A64A 4LIQE 1F45A 2P5EA 5SWZA 4NPYB 3D85B 3QUMA 4P8QA 1WAEA 4G71B 4IDJH 1MAKA 1WG3A 4JHVA 2IQAA 4L9LA 5C0AD 3F7QA 3K3QA 1AD9A 3Q2WA 4ZDHB 4JDEB 3P9MA 5ACMA 3GSVA 3TJHD 4JPWH 4PRNB 3ZRFC 4PY7A 1V7NH 2C1OA 1A25A 3RHWF 1A0QL 2IDFA 2V9UA 3CHOA 3QWRA 2JIXA 1PAZA 5JQIB 4ZTEA 4WI8A 5GRVK 5E0FA 3AB0C 2X70A 2H0JA 4GLRH 4HU2A 1NINA 3TN0B 2K78A 3QA3B 1EEZA 4AGOA 3OAZH 3LRLA 1AXSA 3QS2A 4JCLA 4NC2B 1XCTB 2XOTA 3F2LA 3FTWA 3VRIB 1DVZA 4NENB 1CQYA 2VIRB 4HOMA 5IBLC 1OTUC 3C8KB 4J3VA 1B6DA 4LSSH 4JDVB 2B4CL 3GSRB 2CU9A 4LSDA 4PJEE 1OCOB 3Q44A 5T5FA 3V4VA 3X1NA 3I6LE 1MEXL 2G2NA 4AITA 5IMKA 5KUKA 3WCYA 4YE4H 1E50A 5I17B 4BCYA 3DOSB 1KJ3H 4JFXA 2WJ5A 3GXUB 1BVNT 3KXFE 4DKAA 5SV3A 5HVHB 4ZNEA 3BDBA 3PWPD 4TLUA 1YY9D 4EBQH 4AIZA 4BWWA 2QGDA 1F58H 3E6FA 3VXUB 4A7TA 3IU4H 4L8SC 4YXHL 4BZ1A 2K8QA 2OTUB 4ZODA 5F8RC 3U30C 4XVSH 2DMKA 2VLLB 1WBXA 4F37F 5JO5B 3HJ0A 4WWID 4HUCA 1X5YA 4LVOC 4MMZB 2VISB 4KU1A 5CEYA 3ZZSA 3NG5A 2BOBB 3BAEH 2ESVB 4UTBA 2WV3A 1K5NA 3CFEA 5FUCC 1XGYL 1V3LA 4AYMC 1TVDA 2D7OA 4ZFFA 2ZJSH 3G6JE 4YSDA 5DS1A 2XY1A 2JLLA 5AG8A 1A9VA 1R3HB 4L3CA 2P26A 5ENWB 1A6PA 5ISZD 4ZXBA 4K3EL 4UM9D 1DJSA 1FL6A 3RL1A 4A7GF 1OP4A 1OSPL 1UM4L 2PW1A 5DI8A 3EO1B 4B9PA 4G72B 5AG9A 2ZSVB 1IQWL 5FYKD 4N20A 5D7IB 2P5WD 1HWHB 3K2IA 4R96A 5IZ7A 2X4TA 2CGYA 3D50A 4LL4A 5EU6A 2CDFA 1I1AB 2ZICA 3JZYA 2VERN 4MA7H 1FZJA 4YL9A 5IREA 3V5HB 4OU3A 2X6BA 4LRNH 4TXVB 5EF3A 1I8KA 5C0JB 4HWBA 1QSEE 2AK1L 4AGPA 2VW7A 1EX0A 1H8SA 5FYKE 1AQHA 3QUZC 3LSOA 3W82A 1G7JA 2JCCA 3HRZC 4ZNCD 3IDIB 4FXLA 5F7MC 1R5VB 3BRFA 3ZX1A 3D34A 3ARBB 2XN9E 5LCVL 2HPOA 3RWIB 4PLNC 3KR3H 1A7OH 2XYBA 3BDXA 2EVJA 2PO6C 2FQDA 4L29A 4N0CC 3SDXE 2W9DH 2V3EA 1JGLH 4N9OB 1KT2B 1N64L 5IM7B 4EO5A 5GXBB 1KC5L 5LNEA 4HXAL 5L0QC 1AQKL 4LSVL 4N5ED 1E9PA 4CNIA 2DS4A 2XPZA 1BQSA 4L9LC 4HUNB 4MNQD 2VR4A 5IW1A 5IUSA 4F24A 3EYOB 4PRID 4V1DB 3IFNL 3S37X 5E6UB 5B7MA 2CKNA 2F18A 4Z3IA 5J06A 3CFBA 1AGEA 1E8WA 4HWEL 1I9RL 4JQXC 1BF2A 1OSEA 4CKQA 1H15B 1BZQK 3WHXA 3RBSA 2MWCA 3LXBA 2XNAA 4LSPL 3B6SB 5KYNA 2JCWA 3NQKA 4XI5C 1X5ZA 4L18A 2FWLB 3GTNA 3WNNA 3LKNA 1RMFH 5DUJA 3H54A 4S1DC 4FABL 5EA0H 1KB9K 5IBLD 4ZO9A 4U33A 4ZQKA 4U1GB 3UTTE 2CLRA 2DLTA 3R7RA 1MI5D 4MAYC 1TZIB 3CVHL 4JO4L 5DJDA 2VDMH 1U91A 4EE2A 2I27N 1AGBA 2KLSA 1NGYA 3AG2B 1CLYH 3C5ZC 4FTVD 5FYJH 4Q97A 1R5VA 3GM8A 1CCZA 1A5FL 3JWOH 4OZ4B 1FVEB 1L0QA 3QFJE 4NJAL 4ZRGA 5IK3B 5A2KH 4PB9L 1BZOA 2NY1B 3GSXA 3QNFA 2R4SH 3TBVA 1P6FA 4YVUA 2P8MA 5KYWB 2OX5A 3O81A 5E9DB 1E4XL 4WWOA 3D3VD 3BUPA 1NLBH 4K7PY 5JDJA 3N42B 1I85C 3HW7A 4XN2A 5E2VL 2NRDA 3QVAA 1E2VA 2WC7A 1H8OA 4ZMZA 1Q0XH 2WY3B 2ZXEB 3B8YA 1OKEA 1MFEH 3GBLA 5I75C 4YDVB 2CPUA 1TMQA 4M8QA 1KCRH 3MLRH 3QQ3B 1EXHA 2CAKA 3QFJA 5MERB 5TDOA 1HQRB 3A6CH 3W39B 1UM6L 2P48B 2NNFA 5TJWK 1G5AA 2XACC 3GMLA 3NK4A 2ZQKA 5HI5C 4AMXA 4U2YA 3LRSA 3JV6A 4K9EH 4L37B 4FI6A 4JM2F 2LU5A 2VJXA 2DQFB 2LVEA 3IRCA 3L4ZA 4PB0H 1GJUA 1TQBB 4PVMA 4Y2LA 5SWSE 1DVUA 2O30A 5HVFB 1JSYA 2VKXA 4NQVB 4XN1A 5C09A 2WLIB 5T5FL 1E9QA 2IQ9L 3CH8A 4MNHA 2F8OA 1N70A 4XC1L 3MGTB 1EDQA 2YN5A 1MWAA 3OJMB 2A73A 3UXFA 1RJZA 3HLKA 1B4JL 2IGFH 3GS0A 3TBVB 4YWGL 1Q94B 3Q7JA 1W0WA 3ZN6A 5I74C 3CCHB 4LPWA 1IAKB 5I1AA 1BOYA 5KJRL 4HLZH 1YMME 2DF3A 3WN5B 2C9RA 1M9SA 2GT9A 5CR8A 3ULUH 1RIHH 1TETH 2DJSA 1LTXA 1ZJBA 4BSVB 1OALA 2EP6A 4A55A 4OD2A 2XWTA 1BFSA 2ITDA 4XMXA 1JV2B 2EXWD 1YNTF 2GKIA 5F1OB 3OHMB 1I1FB 4JZJA 5IQ9B 2VDLH 1GY2A 3BZDA 5AVTB 4GXVL 4DUVA 3BPNB 4PV1C 5AW3B 3SDAC 4HDIB 3EZJB 3FDWA 3TYFA 1FPTL 5CZVH 2VMCA 1EAJA 3VTMA 4BXSV 3QUML 3NN8B 4RH4A 5DD6B 1QW8A 3KPRA 4OLEA 4LRIC 2BC4A 3CC1A 3D0VA 1O6SA 2CDGA 3VFTA 4BSWA 3RFZB 2ORBL 3FBKA 4HC1H 3VRJA 3UMTA 5DHYA 2VM4A 2X2YA 3K71A 2PP7A 3OKNA 3ATEA 3CFJA 4HU8A 2LFGA 2OAAA 4P06A 2ESVA 4ODHH 4FP8H 4IGBD 2CA4A 1K8DA 4KOCA 2DLHA 3IGAB 4LCCA 3RILA 1EGJA 1HHKA 1QLFB 2ZOLB 3RPBA 3CTTA 1JF5A 3UZEA 3FTVA 5MENE 1MW1A 3UAFA 3Q9QA 2G75B 3OBAA 5I76B 4MASA 1OF2B 1T3FA 3SE9H 2HT4C 4EOWL 4X5LA 3N1GC 4U1SA 3SPHA 2X4SB 1TO4A 3MGAA 4IK6A 3D6GA 5I6OA 3QBTB 1WEJL 2E7MA 2H6PA 3SCMA 3RVTD 1UD8A 5I2IA 4U3XA 1A7RL 2Z1KA 1WWWX 1J1OH 4YK4C 3ZDXF 2CKBA 3BEWB 3I6KA 3R06B 4OCYL 5GIRB 2G0LA 3K4AA 5A6IA 4P3DB 5IBTL 1GJIA 1FFPB 2OMUB 3D2UA 4Q89A 2NSXA 4A66A 1S9WA 3N1FC 3FQWB 3H0TB 4FQJL 5SV4A 1EHXA 1NDTA 1YRKA 2EDNA 2YC1A 3FQ4A 4Y5XC 32C2B 2OZ4A 4A39A 4AIOA 4OKVA 4X5RA 4ZK8A 1URLA 3V2AR 4WTXA 4OUOA 3VQ2C 5FYKL 1WZLA 1OSPH 1E6JL 4NFDA 3HC0B 4HLEA 2Q3ZA 1J05A 4MQTB 1V05A 2NUTB 3HN8A 2FD6H 2ZKYA 4ZOCA 3V4LA 1BZ9B 1ZKAA 4OJFH 1BQHB 3BO8A 4JANB 4YHIB 2FH8A 2IFFH 2MMXA 3TLRA 3EW3B 3DVFA 4NYLA 4TQ8A 1Q0EA 3GDCA 1FUNA 2H3XC 1E27B 3EBIA 2PPAA 5FCSH 1Q9LA 1SN2A 1GVIA 1U8MA 3VXPB 1ZVSA 1I7ZA 4NNXA 1FGVL 3ZYIA 1JBJA 2JKIS 2JIXB 1YNLL 4CU8A 3GRGA 1TYRA 4J23A 3ZKND 2X4OB 3FQ1A 5LDUA 2GPZA 3WL9A 2CZNA 3Q8FA 1XGPB 3M45A 1CFVL 3U2JA 1MLCA 1K85A 5E0QA 1O7VA 3G6JA 3DX8B 4QRSA 2G2RB 2YAOA 1P7BA 5HHOD 3QT2A 2CRMA 3N06B 4AOFA 4U1JB 4Q74A 3WN5C 2BMKA 4ADGA 5DC0A 1TJIL 2E8ZA 2YD2A 3C60C 1JNLL 3NGBC 4HIXL 1BA9A 3OAYK 5SX5H 1G7HA 1OWWA 5DTFA 1SUJA 1MHPH 4I3RH 2EDQA 2C9VA 1U92B 3MRIA 4G5ZL 4Y0GA 5EBWA 5BS0E 5CFAA 5LNGA 1B2WL 1SJHA 5IFJB 3L3KB 5GISH 2O61A 4OIAA 1DUZA 1G0DA 1KCVH 2DWEB 3GKWH 1WQVT 4ELMA 4FXKC 3O4LD 1A3QA 2DMBA 4KKCC 1SOQA 4PREB 4JO1L 2N01B 4CMHB 1U9KA 3HA0A 4P5KA 1S9XA 4NJ9H 3H2PA 1P5VB 1VFMA 2BVYA 5I8KH 4W9CC 1KNOA 4GRWH 5ID0A 2DQCH 4NQXA 2XVGA 1OGAB 1EV2E 1IGFL 4X80H 4ANKA 5ICZB 1D7BA 2YIHA 2BFVH 4K73A 3OXRA 4G6JL 1UJ3A 1MFDL 2GUOA 1XGPA 2PUQT 2VXVL 4M5SA 3ESNA 1D9KD 3RB5A 3UPCA 3MR9B 3B34A 3BVTA 1E43A 3C60D 1NGPL 2VL5A 3TO4B 1I4FB 4EAEA 1BZDA 2YO3A 3EYQC 3MJ8B 3KZ8A 1SYSB 2XT1B 1B9KA 1G1KA 2E56A 2OA9A 1CI3M 4O2EB 2R1WA 1WSST 3AZUA 1YEKH 4JHWH 1J5DA 3MO1B 2R1YA 1WWAX 4BGLA 5LQBL 4Y2NA 2RH0A 2ICEB 1QRKA 1NFIB 2ICWJ 3EUDA 2ED6A 2WTOA 5B8CA 4NWUH 1C08A 1WAAA 2QPSA 3HE7B 1X5KA 3B7RL 3C09C 4I0PA 4AW7A 1FL5A 3TIDB 3MV8D 4P5RA 1TQUA 2B0SL 1MCNA 4MDIA 1TNNA 3NN8A 3BN9C 5DD6A 2X4PA 2ZOUA 3GLAA 3JWNC 4XVTH 3RNQB 3TBYA 4XC3L 1JGLL 4HZAA 5GS2H 1TZGH 3U83A 1CDYA 2UY6A 2DTMH 3Q5YA 1DVTA 3ZTDC 1FFOB 4OTXH 3BAJA 3WS6C 1DVSA 2GT9B 5JTWA 3PABB 3M8OL 2BVOB 2YZ1A 3E0GA 3GBEA 4JFPB 3VWJB 4CN4A 3EKCA 3UIZA 3HC2A 1FCCA 3COOA 4NBZB 1NUDA 5IESL 1T3FB 1KACB 3E3QC 2W65B 1BOGB 5TE4L 3WIIH 4H8WH 1EXUB 2WYTA 4WO4B 4YC2B 5DHVH 4DESA 3BVXA 4PJ5E 1R0AH 1WHPA 1Z6JT 1OAUL 3CUPB 4U2ZA 1LO4H 2F7PA 2H26B 3LVTA 2DRUA 4M1CD 4OSUH 1DLFL 1N3NB 4X9GA 5LGKA 2IQAB 3MNDA 4POZC 1KXTB 2EDBA 5J9PB 3T6ZA 2JB6A 1OCCB 1I3VA 3DV6A 4GXVH 5FYJL 2PCXA 4WV1B 1DANT 2MSPA 4PB9H 4P23D 1W2KT 2J6EH 4LSRH 4YSEA 4FZ8L 2ZOOA 3C6SB 5I8OL 4W9EC 5C8JB 4J3XA 1X3DA 4YHNA 1P2CB 5EIIA 4Z7WE 1MH5A 3DVNB 5C09E 1K4DA 5CIPB 5KANI 2CR6A 2JI3A 2MOGA 2YPLE 4BFIA 5K9JL 2Y2TA 3J8F7 5FYKH 4OLVL 4M7LH 2Z3FA 5EOTB 1KV7A 4ZMXA 4EI6B 4OZHA 3J7HA 4KK9D 3MROB 4L9DA 3QQDB 4OLUH 35C8H 2QPEB 2R29A 5LUMA 3B37A 1FE8H 3MBED 4KRMB 3S35X 4KROB 3GI8L 3TV8A 3KGRA 1A7PH 3QWQB 3SGEH 5LVEA 2FT6A 1CDGA 3ZKNC 4WI4A 1CWVA 5HDLA 2AERT 1BQ5A 4OB5H 2KDYA 3AT9A 4ZYKB 4JFZH 2G3MA 1LILA 3GUFA 2I69A 1T1XA 2E0PA 4G6FB 4JVPA 2E7CA 1HH9B 3K0WA 3HN3A 4KK6C 4UAHA 2MTAA 4G3YH 4LU5L 1UXWB 4K5PA 3FU7B 3LHPH 1NMBH 2Q8AH 2HCZX 5D72H 2XPYA 3VM5A 4ZMLA 4L37A 3E80A 4PW4A 3F7VA 4QI3A 2JB6B 1Q9LB 1UA6L 1MRFH 1BM3L 3UPAA 5DU7A 4A2FA 2FJHB 2WQWA 1DJHA 4E68A 3RTLA 4NP4L 5GS0H 2YUZA 1XL4A 3S48A 4Y4KA 2V5RA 2ZD0A 1KGIA 3G9AB 4U0RB 3VE0B 3OKLB 1H3XA 1KZYA 5E6IA 4WGKA 4ODTL 3B9EA 5HHMB 5IB1B 2L04A 1X4YA 4QHLA 2W1NA 5AOIA 4BCZA 2GTWB 4EKXA 1T80A 3NYKA 2E74C 2YMTA 4ZMOA 2WNXA 3BVVA 4QUOA 3W2DL 2NT0A 2DB8A 2PXYC 4Y2DB 1T5KA 1D9KA 5D96C 4WY7H 2X9XA 1IAIH 2AFNA 4I2XB 3MLUL 4X6BA 5IJKA 4ONHA 2YAMA 1FPTH 5FYKU 4XPAL 6TAAA 2Z91A 1B9ZA 2XWTB 3NCBB 4XGZA 1XH3A 1ZXQA 3V5HA 2PCFA 1CFQB 3C5ZD 3FS9A 5DO8A 4K3GA 1BVNP 1F1DA 4LNVA 2XWEA 1LO5A 5CEXA 4HK3J 1OW0C 3SBRA 2VDPB 1KZQA 1CL7L 5EC2B 2C4XA 1ZLWH 1KIPA 1J8HB 4I5BB 5SX4I 1SXCA 4J8RB 1EHLH 2ICWB 3IVKA 1XF2B 4U1MB 2E75C 2DWSA 4UV7H 4HISA 1RFDL 3GHEL 2YA1A 2O5XH 2FBJH 3KPQB 3UP6A 4B9GA 3P2DA 2O6EA 4R7LA 2H1PL 2D3VA 1P7QD 4QYOA 4WSGA 4F7KA 3DDGA 4XI5D 3MRLA 4GW5B 4MMYB 3OZ9L 3WIHH 2WWKO 3EOAA 2XTJC 3MJ8A 4NM4L 3D3VB 1E5UI 5ITFB 1HXMA 4QTHA 3P0GB 3OXSB 2VR7A 2IANB 3C5ZB 1N2RB 4OUUB 4GO8A 2BP0B 2VUOA 2LGNA 4EOWH 5IJKC 3DTXA 1T22B 1NC4A 1YQVL 4F58L 2NT1A 1J10A 2JJSA 3TTYA 2G9KA 2BWQA 5HGDB 2AEPH 1SEBA 2F5BH 2Z91B 1S7VA 1ADWA 3PQYD 4XGZB 2ZIDA 5ICUA 1NM4A 3UH8A 2VDOB 3RJOA 2JKWA 4DP6X 3TN0C 1UCTA 4PJFB 1H9DA 3D06A 3L4WA 4YDVA 3ALPA 1IGTB 3BZFB 4F3FA 4WENB 4OFVA 1KIQB 1PY0A 3P77B 2VLJE 3WHE0 1YEFH 1F4YH 3F05A 4QRPE 1TT6A 2XA8L 3GJEB 5AOZA 3ZMEA 1S5HB 3EJZD 3APNA 4KKBC 5D2LE 1Z66A 2DIEA 2KQMA 3ULUE 4JPVH 4ODWB 4J7RA 4LEEA 3ZTJG 4PJ7E 2FSEB 2XN1A 1FLRL 4DGWC 2P44B 2ZX9A 1LO4L 3I2CL 1G9NL 2ZUTA 4QXUL 5KYYA 2Y1VA 2NY3C 2XN0A 2J5LC 5ICYA 1CK0H 4HW6A 1HXYB 4UT6L 4TSCH 2X0WA 4MCZB 5HHQA 5KYUA 2VDQB 2F8IA 3QXDA 2H2PC 3DLQR 4LSUH 4J3UA 3KLHC 4PCKA 5FGCB 5J1SC 4JNXA 5C0EB 1N5AB 1MN4A 5F7NC 5BVPH 1N7ML 2E9JA 4Z7NE 5CJQL 2JXMA 5E8EA 3DK0A 1F4XH 1ETB1 1QUNA 1UADC 2BNQB 1G7QB 4BHUA 1XGUB 2BRQA 2C3VA 2E9WA 1P4IL 4D9QD 4A67A 5A16B 2ROYA 5HJDA 1OAYL 3P69A 4F3FB 3WKYA 1FZJB 5IMMB 1YEIL 2JSFA 1I1FA 1NPJA 4CDHA 1JZFA 5ICXB 5GS1A 5FA3B 5F1IB 2WBJD 3RTQC 4BFIB 4PSPA 3OD3A 1HZKA 1IAII 5DO2C 4ZAKA 9CGTA 4PRIB 4HEPA 4M7ZC 3SDXF 4AL8C 2XZQL 3OAUH 1MWOA 2V7HB 2HSIA 4LGRB 3RX5A 3DX7B 3NACL 5HD8C 3OSKA 3FCTB 2HKFH 3NZSA 5L4JA 4M1CC 3PNWB 4KQ4L 4G3YL 2EUWA 5ABAA 5DRWA 4HFWB 1COBA 1YEDA 1KBWA 1U8QA 2CJUL 3V5DA 3ULVL 3GGWA 5J7CC 3RI5K 3QXVA 5B7EA 1LO0L 5GS3A 3VB9A 4NP4H 3WJMB 2OCFD 4OJDH 4Y1SA 5GS0L 3QIUC 4CC0A 4M7KH 1MFDH 1N5AA 1N0XH 3BD5A 3DXAE 2EACA 3GBMH 1ZOXA 4IEFA 3V0JA 3VXUE 3OJDB 3FUDA 4AJVA 1H5BB 3O4LA 5FCUH 5DSCB 4IRSD 3PHQA 2ZCLL 2ADYA 3WHXB 1QPXA 2KZKA 3PDOA 1CT8B 5FFGA 4AGQA 3BPCB 4ZMVA 3UZVB 3FCUB 2VLJB 3N50A 2EDJA 4RMBA 4O2CA 3W2DH 4ZFQA 4AYEC 2F1AA 4DEUA 4WHYG 2ODHA 4WWNA 3UYRH 3D48R 2BHYA 1CC3A 2K7PA 4LVOB 4MMZC 3FAWA 4AIZB 2C5DC 4JE0A 3C12A 1IC7H 2P7TA 4OTXL 3IMTA 2N3JA 3CZNA 4NQEA 2HN7A 3RNQA 4I87A 1LDSA 1NCDL 1SVBA 12E8H 1WHOA 3NCMA 4X6FA 4OZ4A 5FGBC 5CEYB 2HJFB 3S9DB 3KPLA 2JIXD 4Y2DA 2NNCA 1BM3H 4N4YB 4Z76B 2EUXA 4W6XB 3V0VA 1J8HE 4I2XA 1QFUL 1NDGB 2JJSC 3ZKXB 2VMFA 1G43A 4I77L 4HWZA 4X6DB 5E00B 1JGDA 4NO5A 5HI3C 5TE4H 4ONHB 3S3PA 1T0MB 2YGVA 5E2WL 4DPRA 4Z5RB 2R2HA 3W9EA 5IEKA 4FQCH 4X99A 3TX4A 3H4FA 5I0YA 5EPMB 2P9RA 3QG7H 2IXQB 3U2IA 1FL6B 5JW5B 2NY4B 2KHAA 2AK4B 3QIWA 1K72A 4L1LA 3MCYA 3RWJB 3O11B 5HDRA 4XMKH 4H8WL 1S3KL 3K6OA 2C9QA 5EU7E 2WLLB 3E8UH 1EBPA 5A3IC 3P30H 2XWDA 1XD0A 2K4WA 4BKTC 3GQFA 4CRPA 2FRGP 3HN5A 4U3SA 4AG4L 3NGBB 3LNHA 4DP5X 5H37G 2BVQA 3IDMA 3WXWL 3FTXA 1ADQA 3ESVF 4GEIA 4OBSA 4QHKJ 3HRZA 4UQ2B 1RZJL 5I8CB 4G8GD 1UB5B 1EEYB 2HTLD 2ZSWB 4N0FB 2A6IA 3VXMA 2X0UA 4FXKB 5MEPA 5F6IC 4QRAA 1FCGA 3LKOB 3L3DA 1E5BA 5I1HH 4L29B 3Q6FA 4E9LA 1GSKA 4FQQA 3GMMA 1OB0A 1Z5YD 5GGVH 2DEWX 3CVHA 3HPLB 3B3BA 3HI6H 1W91A 4BK4A 2YAPA 3WIHL 5IHHA 1AR2A 2NPLX 1CVSC 1YEWA 3D4YA 1CXIA 2PP8A 3QJSB 4HJGA 3V6BR 4BZ2H 5KZCB 2W59A 2X9ZA 3OHXA 1RZ8A 2YR3A 3EGXB 1M1XB 5GHWH 3CQPA 3QJHA 3BP6A 4IBWA 1NBYB 3X1EA 3ARRA 5KBDA 2YN3A 1YJDH 2Y24A 5FK9A 1NGQH 4R8WH 4OR1A 4M6OH 3QUXB 3V0AC 4FNTA 2DAVA 1CE1L 3FPXA 1O0VA 1SY6A 2CNYA 4M8VA 2WQXA 3ZZLA