1GY1A

Crystal structures of ser86asp and met148leu rusticyanin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
154
structure length
154
Chain Sequence
TLDTTWKEATLPQVKAMLQKDTGKVSGDTVTYSGKTVHVVAAAVLPGFPFPSFEVHDKKNPTLQIPAGATVDVTFINTNKGFGHDFDITKKGPPYAVMPVIDPIVAGTGFSPVPKDGKFGYTNFTWHPTAGTYYYVCQIPGHAATGMFGKIVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUSTICYANIN
publication title Crystal Structures of the met148Leu and Ser86Asp Mutants of Rusticyanin from Thiobacillus Ferrooxidans: Insights Into the Structural Relationship with the Cupredoxins and the Multi Copper Proteins
pubmed doi rcsb
source organism Thiobacillus ferrooxidans
molecule tags Electron transport
total genus 36
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1gy1A00
4NAJA 3QJVB 4YSOA 3WI9A 5D4HA 3C75A 4P5SA 4BWTA 1MG3C 1HAWA 1OCZB 3FU7B 4A2GA 1ZIAA 3TBCA 3AG3B 1E5ZA 1JZHA 1KDJA 1IBYA 3HEIB 2VW6A 2Y69B 3S3BB 3QQXA 4ENZA 4DP9X 1E65A 2BP0B 2R7EB 2PPCA 1AZCA 4G71B 2OCCB 1OCOB 2HRHA 2OV0A 4YSPA 1F56A 3NSYA 2DWTA 1W6LA 1WS7A 4Q89A 3D12B 4YVUA 1PY0A 3ASOB 2QPDB 4UAHA 2N0MA 1A4AA 4A2EA 4AKOA 2HX7A 1NIAA 1ET7A 4KO7A 2YXWA 1BAWA 2BP0A 2HZHA 2BZCA 3AG1B 2XYBA 1GS8A 2NRDA 3HB3B 6PCYA 5PCYA 4DPBX 1WA1X 4QLWA 1PLBA 2EIJB 1NPNA 3PAZA 2DY2A 2E86A 4E9VA 4E9XA 4A66A 2AVFA 2I7OA 2CAKA 3FU9A 1OV8A 2XXFA 1SDDB 2MTAA 1V55B 1NIFA 3NJFA 2J5WA 4DP1X 2TSBA 3CZUB 3EH4B 1IC0A 2YAEA 1J5CA 4N4YB 1BYPA 3N2JA 2EIMB 2QDWA 3CDZA 2XX0A 2VSKB 4E9QA 1GYCA 5TK4A 3NJGA 3PCYA 4BDVB 1OCRB 4YL4A 1M57B 2GB2A 2EINB 4G70B 2ZOOA 1PMYA 2UXVA 1AAJA 2VW4A 4K9JA 4UANA 2IH9A 5PAZA 4GP4B 3WIAA 1NWOA 2B3IA 1AQ8A 4E9WA 1JVOA 3X1NA 3GDCA 1PLCA 3OM3B 3U25A 1FFTB 1NZRA 3PPSA 1JVLA 2UXTA 2X88A 3JTBA 4BDVA 1JXGA 2FT7A 3WNIA 5AFAA 5I6OA 1XMEB 4AI7A 1EHKB 1SJMA 3OQRA 2GSMB 1AG6A 1A3ZA 4G7SB 1BXVA 5AKRA 4YSDA 1SHXA 1VLXA 2FJSA 1NIEA 3ABMB 4N8UA 1OE3A 3V9EA 3NSCA 5B7FA 3AG2B 2BO0A 1BEXA 3X1BA 2UXFA 2GI0A 2IWKA 3IBOA 4KO5A 2Q5BA 3IEAA 2CJ3A 4YSRA 4ZK8A 4DP4X 3KW8A 4TXVB 3FT0A 4BK5C 2CUAA 1RCYA 2UX6A 3T9WA 1PAZA 4A2HA 3QJSB 3DKHA 1CURA 4W1TA 4BXVA 4MFHA 4HALA 3EH5B 3S3CB 4RH4A 4QKTA 1PNDA 1KBWA 1NTDA 4JKNA 3ZDWA 4PCYA 1TU2A 3ZIYA 4A2DA 3CVCA 2OJ1A 1PZBA 3QJTB 4DPCX 1SFHA 2FTAA 1JZFA 2A3TA 1XB8A 4HCGA 5I5JA 1NIBA 3G5WA 2DWSA 1ILUA 2VMJA 4G7RB 4YSTA 3NJJA 5F7AA 1DYZA 2UX7A 1JZEA 2FQFA 1V10A 4JHUA 1ETJA 3UGEA 3OMAB 2AZUA 2CCWA 3SBPA 1J9RA 1KCWA 3OMIB 3UADA 3MX0B 1RZPA 4YSUA 4E9TA 2X87A 5LDUA 2WO3B 4WTQA 1ASOA 2YXVA 2LLNA 3FU7A 5I6NA 2J55A 1WS8A 3UAAA 1NICA 4M4RB 3FQ1A 1YLBB 5ANHA 1KCBA 5I26A 4KNUA 2DYSB 2YAQA 2EILB 3ABLB 3AZUA 3NP3A 2VSMB 3NJIA 2R7EA 3PLYA 4HHWA 1FA4A 1ADWA 3ZX1A 4E9RA 1GS7A 3NP4A 4BWUA 1AS7A 2J56A 2Y1AA 5B1KA 1M56B 1QNIA 3QJQB 1E30A 1SHWA 1WAEA 1A4CA 4M3HA 3DIVA 3ABKB 2AANA 9PCYA 2JFCA 1ID2A 2TSAA 3PAUA 2PP7A 4UF7C 3NYKA 1XB3A 1ZV2A 1DZ0A 1QHQA 5B7EA 4A67A 3WKQA 1AOZA 2XX1A 4CSZA 1ZDSA 2BWDA 2PPFA 3FQYA 2YAMA 2IWEA 3FSZA 1L9RA 4YSQA 1A8ZA 4DP8X 2XWZA 4HAKA 3T6VA 1E67A 3NSFA 2DV6A 3WNJA 1E5YA 4HHGA 2VW7A 2BWIA 1MDAA 1OCCB 4AX3A 2VM4A 1FWXA 1OOWA 2XLLA 2PP9A 3SBRA 1PCSA 4HCFA 2BHFA 2XV0A 1SDDA 2WSDA 4YSEA 4HIPA 6PAZA 1N68A 2JXMA 4E9SA 1L9OA 1AIZA 1GSKA 1OE2A 1PNCA 2YAOA 3FYIB 4GY4A 3AY2A 1KV7A 1CYWA 3T6WA 1NIDA 1KGYE 2IDQA 3ASNB 4L0PB 3ZBMA 2H5UA 1ZIBA 3X1FA 1GS6X 1RZQA 2IAAC 5B7MA 2HLEB 2YARA 1URIA 2P80D 1MG2C 1R1CA 1RKRA 4DP2X 2PCYA 1CC3A 2IDSA 3JT2A 2I7SA 1OF0A 1ASPA 1PLAA 5D4JA 4F2FA 3IN2A 1AACA 2IDTA 2YQBA 3FSVA 4G7QB 1HFUA 4F2EA 2WO2B 5I5IA 1JXFA 1X9RA 2FNWA 3CG8A 3UACA 3IE9A 3DTUB 3BVDB 3FYEB 1KYAA 4WKXA 2PCFA 3ABGA 3T6XA 2CBPA 1B3IA 3FPXA 2GC7C 3GYRA 5FC9A 1JOIA 5B1BB 1KBVA 2XVBA 2BP8B 2PPEA 3MBWB 1J9TA 2BZ7A 1ZDQA 3X2QB 5A7EA 3NJLA 4KO6A 1ET8A 4FAAB 3V9CA 3IN0A 2GC4C 1JZGA 1IBZA 2EIKB 2HX8A 4AKQA 5B1AB 2IH8A 1EZLA 2FQDA 2PPAA 4NERA 4YVNA 2ZONA 3EH3B 3TBBA 1AZRA 3L45A 4GXFA 3S8GB 1AANA 1AZUA 1AR1B 3T71A 3AG4B 5E9NA 7PCYA 1BQKA 1W6WA 3FS9A 2FT6A 3ERXA 1TKWA 1GY1A 4AZUA 1NDTA 2QDVA 3EF4A 3QJUB 2YAFA 1QLEB 3UAEA 3SBQA 1TEFA 2PPDA 1AZNA 1SNRA 3WKPA 2HX9A 2JKWA 4YSAA 4CSPA 1JERA 4KO9A 2W8CA 1BQRA 2XV3A 2CALA 2YAHA 1L9TA 2FT8A 2FQEA 4AKPA 3TASA 1T5KA 3NJKA 4P5RA 2P80A 2H47C 2AFNA 3KW7A 2PP8A 3PAVA 2BW4A 1ZPUA 1BQ5A 2FQGA 4PAZA 1PZAA 4DP5X 4DP0X 1A4BA 1SF3A 2XU9A 4X4KA 1ET5A 7PAZA 3H4HA 2IWFA 1GY2A 3RYMA 2VM3A 2I85A 4GYBA 4DP7X 1N70A 3CVBA 1AZBA 1IUZA 1NINA 1CYXA 1J5DA 3OD3A 2UXGA 5I28A 1SFDA 2XXGA 3FSAA 1JZJA 1L9QA 4HCIA 2B08A 3X1GA 4Q8BA 4DP6X 1M9WA 4W9ZA 4KNTA 1BXAA 2QT6A 1WA2X 4DPAX 3CDZB 1NPJA 2YAPA 5I6KA 3PXLA 1SF5A 4BWWA 2FWLB 1ASQA 2HXAA 4G72B 3GXUB 3TU6A 3NSDA 5B3SB 3CVDA 2QPEB 4F7KA 4HZ1A 4GP5B 4KOBA 3H56A 1A65A 3OMNB 2XV2A 2W88A 3SQRA 1J9SA 1JXDA 1PF3A 5B1JA 4JHVA 2GIMA 1KDIA 5IY5B 3T6ZA 4E9YA 2XUWA 2VN3A 3QPKA 3EHBB 3UABA 1NWPA 2MRYA 1BYOA 1PZCA 4GP8B 3NJHA 1MZYA 5AZUA 5I5MA 3S8FB 4A2FA 3FU8A 4KOCA 3TA4D 1AG0A 5I6LA 1I53A 1HAUA 2IDFA 2GBAA 2PLTA 1X9UA 1IKOP 1V54B 3X1EA 5EHFA 1J9QA 4KNSA 8PAZA 1OE1A 1GR7A 3H4FA 2AZAA 1MZZA 2J57A 4EF3A 1BXUA 1L9SA 3FQ2A 3AW5A 1UATA 1GW0A 1W8EA 1AS6A 1JZIA 2ZXWB 5B1JC 3FSWA 4BXSV 4FA7B 2DYRB 2ZWNA 4NB7A 3S3DB 5F7BA 2GHZA 1AS8A 2RACA 3QJRB 2BW5A 1ILSA 3NT0A 2IDUA 3BQVA 2HRGA 1CUOA 3NJMA 2Q9OA 5I6PA 5TK2A 3NJNA 2BP8A 5I6MA 5D4IA 1L9PA 3WG7B 1WA0X 4YSSA 4YSCA 3FPYA 3N55A 1XB6A 4A68A 1TEGA 2H3XC
chains in the Genus database with same CATH superfamily
1I1FA 1RZ8A 5DVMA 4IOSD 4JFOB 1ZTMA 4V2CB 3ZKXC 5BMFH 3HZ3A 5C71A 2EXWD 1NMCC 15C8H 4BQ6A 3Q1EA 5DEFB 5KVDL 4AMKL 3O6KH 1DQLL 3NGBB 3QUXB 5K9JH 1T6WA 4HH8A 1GZPB 1TLMA 3UG3A 3KG5A 4GRMB 3TFBA 1W15A 4PJFA 1P69B 2G2PA 4YDIL 2Y69B 4WSGA 3MRCA 3FK3A 3HE6A 1XF1A 1V7MH 4IDJL 1ANUA 3TEWA 2VL4A 2BVTA 1BIHA 5TQ0L 4LSVH 3EIFA 4QRSA 5HJ3B 2NYZA 3BYYA 4L1LA 2X1QA 4QYOA 5FGBA 4KXAA 4RAVA 4TNVF 1ICTA 2NY5H 4MA3A 4NIYE 5T1KA 4LU5L 1SM3L 4I9WD 3OJ2C 5JPMC 3SO3B 3LRHA 4PRNA 4KRPC 4HCRL 4PJFF 3LH2L 1JZDC 4UT7L 1IAMA 1OAXH 2V7HB 2E8YA 2RQ8A 2JK5A 2NRDA 2QQNH 3F83A 4JPKL 4FYRA 5IHUH 2AEQH 3U9WA 2O93L 1WA1X 4HJIA 2E3VA 4IOIA 1YDPB 2A5UA 2E86A 2G60L 4PW3A 4XCEB 2ITCA 5IVZB 5CP7A 3GRGA 3DX7A 4XNUL 3WXVL 5I73C 2J6EL 3F6JA 3C8HA 3PJSA 4X6CB 1EUUA 1KBKA 1SJVA 4FNRA 1SDDB 2C3GA 1V55B 4BQ8A 1HTYA 2VXTH 1NFDB 5KVDE 1A1MA 3B2MA 2ARJQ 4GOSA 3TCXA 3DO7B 4W6YB 2A6KB 5BZWB 5JDSA 2QDWA 3WNLA 5C0AB 4Z3IA 1FG9C 3O45B 3DDFA 4UV7H 2OLDA 1SYVA 5EIIA 3ARXA 1Z0NA 1IGTB 3PCYA 4AMKH 3GC3A 2HG0A 2ICES 1DQLH 3VMPA 1MCPH 2EINB 2NY2D 5CN2A 2H7WA 1P5VA 4JFFB 1DL7L 5A6MA 4DW2H 2C3VB 1OEZW 4L1SA 5HHOB 2HFEB 2KZWA 4WV1A 2EABA 5DRNA 2F58L 5CFAA 4EOWL 4YDIH 4OZHE 4RGNB 3EXLA 3X11B 5GS0L 3Q5OA 4MDRA 1MAJA 3I75B 1C9SA 4IDJH 3BZ4B 4A37A 1AGDB 5E94B 1INEL 4ZFOA 5TQ0H 3N1GC 2V2WA 3P4OA 4K5NA 4A04A 1LHZA 3K1DA 5FB8A 1OGTB 4TL5A 1WYJA 3LH8A 1SM3H 1UXSA 2E75C 1HS6A 4MWFA 5IROA 4IRJD 4NUPA 5IFJB 2EO9A 3U9UB 4NQXA 5DRWA 3Q01A 2OJZL 3NK3A 3QQDA 1IM3D 3LH2H 1MRFL 1S7VA 1VLXA 4UT7H 5C08D 2CA4A 3V0JA 3ARED 5CEZL 4Y4HB 4JPKH 4X6BB 1IBFA 3D0VB 2NDFA 2J8UE 1MAML 2Z8VC 4OCYL 4RRPM 1R4XA 5I1LA 2G60H 1J0ZA 2DB8A 3OKNA 1QSEE 3GBML 4K9EL 5MEOB 3WXVH 2J6EH 2EEXA 4Z7NE 4KTYA 5F7UA 3L9BA 4DKFL 4TPRL 4HW6A 4L05A 3BZFA 1NJ9B 1HXMA 2W81C 3EADA 4IOFD 1TTBA 1SFHA 4P23D 2V0AA 4LCVA 2B5IB 4ZS7L 1AHMA 3EFOA 4WNSA 3US1A 1T6BX 1DL7H 2CCWA 2WOYA 4ZX4A 3NIDF 1J9RA 1NM4A 2CRZA 2F58H 2R2HA 2B2XH 5ICUA 5EU5A 1A3RL 4NOBA 1X5LA 3PGDA 4N6QA 5DQDL 4NRZB 5GS0H 1MFEL 4PIBA 1CE1H 4TYUA 1INEH 2J55A 4WK4B 5DVOA 4K2UH 3D8MA 1Y1DA 5BRZD 1YLBB 3TWCL 5BVJB 3K2IA 2VXQA 4FFYH 3HBZA 1QMUA 1ZSDB 4PM1A 3ATDA 5LQBH 4MCNA 2YAQA 2VRKA 3PLYA 3RGVB 1FA4A 3CSPA 4JVUA 4V1DA 2BVPB 1KFGA 4L9LB 2XWTA 1KB9K 2ENQA 2OJZH 3OAWA 4GUCA 3ATBA 2EYRB 3QUZC 2EDJA 5GRUL 2AXGA 5CEZH 3C09B 2VLJA 1ID2A 3LXCA 1RV6X 3KPSD 4L3CB 3FCTA 2XQBL 3NYKA 3HMXL 3QGVA 4OCYH 4X7TB 4EN3A 2XTJE 3EBGA 3BFWA 4JM0A 1HQRA 1FFNA 2H0PA 3RFZC 4CSZA 1QUNA 3GBMH 3WJMB 1K2DB 1CE6B 3CSTA 3VJ6A 5BQ7B 4DKFH 4F33B 1JYWA 4HHGA 3HPLA 3EOBA 4TPRH 5GS1A 2FYVA 1TEYA 2YGNA 4UDUB 1MDAA 2QQQA 1LEGB 5J6HB 4JFXA 3SPIA 2LFGA 4KZDL 1PVHA 5CSGA 2EXYC 4XB3A 4XN9A 3I6GA 1OM3L 3N44B 4ZS7H 4NKOA 4MMYA 1OE2A 2DD8L 1KGIA 3AY2A 1KV7A 2A9DA 4A6YB 2OCJA 3ZBMA 4G80A 2H5UA 1UD5A 4MLSA 1PY4A 4TVUA 3RJDA 4J7RA 1FFPA 3CH1A 1R46A 5C0DB 1A6VL 1SMOA 3MUY1 4APQD 2O1AA 4WW1A 4R7VA 3UP6A 3TYGL 3U83A 1DE4B 3KR3L 1Z0MA 3QDGE 4NCC2 5DQDH 2L7JA 2IDSA 4IGBC 5ICYA 1WIUA 4JO5A 35C8L 3QNFA 4J39A 1JV5A 3SPCA 4O2EB 5EZLB 5AYTA 3RL1B 1J0KA 2M26A 3TVMA 2Z4TA 4UQ2A 3MMEA 2CIIA 1RI8A 1SY6H 4YX2L 1S9WB 1KYAA 1T1YA 2GJ6E 2PCFA 2ZJSL 2Q7YA 4IJ3B 3VE0B 2UZXB 4U1HB 3JV0A 1H0DB 3DIFB 4P3DB 4UV4L 2EICA 4K5OA 5IW6B 5C2UB 3ZYIA 1JOIA 1KBVA 3BAEL 4YXHL 5BS0B 2IFGA 2XZAL 4HK3N 4U1JA 4E5XA 2YS4A 2XKNB 3KL5A 2XQBH 3IFPA 1ET8A 4IK6A 3IN0A 4WU5B 3I9AA 3NA4A 2EH7H 1BQHG 5C0BE 3CQQA 1I1FB 1RZ8B 1Z9LA 2WLKA 4R26H 4PG9A 3DK2A 3GKZA 3LKSA 1UD4A 2BIHA 3B1UA 4PU2A 4Y5YC 3BLKA 3E6HB 3K4ZA 3LN4A 5AAMC 1AR1B 4R4NC 4KZDH 4PJ7E 3WJLA 4PJFB 4PBWD 3KDMA 3CLFL 4UU9A 3HFFA 3QR0A 3STZA 5D8JL 3MRCB 2QV2A 4GJTB 3HE6B 2NXYD 4C4BA 4KH9A 4UILH 4GSXA 4GSDL 2XA8L 3I3DA 5I8EA 2R69A 3TYGH 2KS0A 4QRSB 4OKVA 4H1LA 3GEFA 2CGZA 2WVVB 4GKLA 2WXOA 4MA3B 35C8H 1EEQA 5T1KB 2L7UA 2V7NB 4R6UA 2YD0A 4BHUI 2AFNA 4IBTA 3OBAA 4MAZA 1G9NH 2Z31D 3S6CA 3PWVA 2OSLA 3HLAA 3PG2A 4X5XB 5EOCJ 3TIEA 4JFED 1F1DA 4BFOA 2ZJSH 2XFXA 5GRVK 2P1YA 4B5EA 4Y0GA 2ZX6A 5DS1A 2JKXA 3IJHA 3BESR 1TQWA 4UV4H 4XZUB 5AW1B 2ITCB 2DQEL 3N04A 5CP7B 4YXHH 1OTTC 2PCXA 3MGAA 3PJSB 3VRLF 3E1F1 4RZCA 4PJIA 3TPUA 1NDGA 2NY1B 3O4LE 2Q1EA 1IQWL 5JHDE 4G6AC 3HS8A 1A1MB 4Q8BA 1MW2A 4JEGB 3Q6GL 3QDME 2K8QA 3UBXI 5JDSB 2JTYA 1WA2X 4KJPD 2R2BA 1S7WA 5EIIB 2WYTA 5IMLA 2VLRA 5GGUA 3UZVA 3VGAB 1ASQA 3X3GL 1DVXA 2BK8A 5EUOA 2WWKO 4GBXC 5MENE 5D55A 2B16A 4S10A 5GGTL 1P5VB 4JMXA 3H56A 1KCUH 1CD8A 5CLWA 4WV1B 4PJIF 1P4IL 4X50A 2YA2A 3CLFH 4I4WA 1V3JA 4H4NA 5DRNB 4MJIA 4NZJA 2VDRL 5DO8A 5D8JH 5F7YC 1FBIH 1XCQA 1JGIA 2W95A 3C8DA 4N8VG 1MJUL 3MLTB 3QEQD 4GSDH 2XA8H 2V2WB 3P4OB 1I85C 1OPOA 1R33A 1ZA6A 4P5KA 3RHWF 3V6ZA 1KY7A 3NCCB 4NQSA 5I0YA 5EUOF 2Q0ZX 1RURL 2DLHA 2G0LA 3VNZA 4ETQB 3C6LD 4NQXB 5DRWB 1YJDH 4KNSA 1S7VB 4J3WA 2H1LM 3KWTA 3V4PH 5L8JB 1OQOA 5JHLL 3H9HA 2VDOB 4GB9A 2EE9A 4N0FA 1DQJA 5A3ID 1AY1L 1T1XA 1J11A 1QNZL 2HTLC 5I1LB 2QR0A 4TUKL 2YFOA 3ALWA 3OKNB 2DQEH 3B3IA 2R1WA 5D1ZD 5A2AA 1Q72L 3PWUA 4TUOA 3LPFA 3NIDB 3BKYL 3GHPA 2WQUA 4MA1B 4JKLA 2BSBA 5ERWA 2WBJA 4L4JA 2VM9A 4S0SD 3DROB 2BSEA 3DGGB 3Q6GH 2H1PL 3BZFB 1HXMB 4PJBA 2WNXA 4JFPA 1OL0A 1E90A 3RX8A 2BY0A 2MQ0A 3JV4A 4ADJA 1PFOA 3EAKA 3EFOB 4JRYB 4YPGA 4CVXA 4Y5XC 3X3GH 4I2XE 1NBQA 2FWOA 4KH2A 1L6ZA 4YIQA 5GGTH 4AYDC 1T03L 2KYIA 4FG2A 1X5JA 2DLTA 1P4IH 2BVEA 4H25A 3HI5L 4YNYB 2OSWA 2VDRH 3OTTA 5EU5B 4DH2A 3PGDB 4JZOA 4N2NA 3KPPA 4GIOA 1JPFA 1NBVH 2EEAA 2WXMA 4PJBF 4N86A 3T1FA 1KBGL 1MJUH 5CZXD 3TBCA 3AG3B 3B6SA 3MBEC 1Y6MR 1QSFD 2BDNL 4FQXD 3G5VA 2XWJA 3BVNA 3D3VA 3P73A 1QPXA 2VW6A 4BFNA 1E65A 2BP0B 1RURH 4MB3A 4ZMPA 2DI7A 4V1DB 5GRWA 2EDBA 4HP5A 5C0EA 4YSPA 4LPTA 4OGAD 4B9FA 2XA3A 2IH3B 2AXGB 1RZKC 2ZG2A 3QYMA 5JHLH 2LQRA 2VLJB 2XQYA 4QWWC 4Z1PA 5I1CH 1QNZH 1XR9A 4IMLB 3FCTB 5C9JB 4TUKH 4EN3B 5DTFA 1HQRB 1FFNB 3MLUL 1BAWA 1QUNB 3C12A 2BMKA 5EEZA 3BKYH 3BDXA 3FQRA 4URKA 4FX5A 2R2CA 4D9RE 5PCYA 2VAAB 5LBSL 3HPLB 5C07D 5GS1B 5HHPB 1QRND 4Y16D 5JW3L 5D7IA 4E9XA 3QUYA 4UM9A 4PP2B 4HD5A 3BUYA 3VD4A 1CGWA 4HK0A 3I6GB 3ML8A 3SZKC 3EJYD 4NKOB 4MMYB 5HP5A 4BK8A 2FBJL 3LD8C 1EXUB 4OGXL 2CXGA 2HLAB 5IOKA 2JKLA 1U8MA 2E76C 1MPAL 2LV4A 1T03H 1FFPB 5FGRA 3CDZA 4NBYB 4NUQA 3REVA 4AGPA 2AITA 5FFOA 2V5YA 5A7BA 4DOHB 3D39A 4XRCA 2R27A 4XO3A 3PV7A 5FV1L 1RUPH 4R2GB 5ICYB 5D7IF 3VMOA 3U0WL 4HUVA 1KBGH 1TNNA 1PMYA 1G9MC 2F9BT 3DXAE 3LN5A 4ZYKA 2CBQA 2BDNH 2RQEA 4K7FB 1I9EA 3B9AA 2Q3ZA 1GH7A 4TUUA 5E6UB 5IJBC 1AQ8A 4MDJA 1JVOA 3HNTL 3MMEB 4PJXE 4AJWA 2NR6A 2DZEA 2OI9C 2E9IA 3GDCA 1T1YB 4HHAA 2PCFB 2YBRA 3I9IA 3BT2L 4M7LT 2Q7YB 1UJ3A 5BUPA 5LGHL 4TTGA 2P9RA 3GJFA 4QO1B 2I5YL 1C5CL 4MBOA 2XN9E 3ZKNC 3KH4A 1NFIA 1Z6JT 1HJCA 4E5XB 1KTRL 1XMEB 4L1HA 3IFPB 2Q7NA 3MLUH 3IDXL 3DOIA 1IAIM 2AEPL 2NY6C 3IB4A 4OZ4B 3VXQA 2Z4QB 3L5IA 3RDTC 4PG9B 2VLLA 4M8UA 1JTPA 4ENEC 3LKSB 1E4XL 3A24A 4J3OD 5CXPA 2JKSA 4ISVA 5LBSH 5HI3D 4WK0B 3FO1A 3VSQA 3PGFL 2EC9U 2NY0B 4FKHA 5JW3H 4FNQA 3APCA 5CJBA 3F58L 4L4VE 4YSRA 5J7CC 4GAGL 4QHKI 4BK5C 5GS2H 5JIIA 3QJSB 3KDMB 2R4SL 2W9DL 2FBJH 3NH7L 4UU9B 4OGXH 3A4DA 5EC2A 3PHSA 4BKLA 4U1SA 2EDYA 4P2RD 1MPAH 1CBJA 4PCYA 4M1CD 3ARFD 3TFKC 3T4YA 4LXFA 2ZKMX 5I8EB 4OKVB 4H1LB 4UQCA 3RWCB 1FV1B 1B4RA 5J3HD 2Y24A 4ZAKB 2CBTA 5BOPA 1F18A 4U1GC 3U0WH 2ESVA 1GMIA 5KSAA 3MRHA 3ROLA 3U7YL 1BVNP 5AL8A 3PWVB 3ARZA 3HLAB 4RGOL 3TIEB 3HNTH 1WHOA 3POHA 1QYGL 2WO3B 2XFXB 3BT2H 3WGUB 4AVHA 3MN8A 3F7KA 1C5CH 2APFA 3RRQA 1EAPB 1FH2A 1A6WH 3NCYS 2FE0A 4FDWA 4GUPB 1SYSA 1BD2D 1MIEL 3FRUB 4GRWB 2XXCB 2E59A 3ZIMA 4WWKC 5K69A 1NDGB 1W0WB 2VISA 2XNAA 3C5ZD 2EDNA 2NZ9C 4E9RA 4F7PA 4G11A 4UIMB 2WB7A 3QDJA 1MH5A 2VDLL 2V9UA 4ZD3L 3MYZA 4KJQC 1P1VA 2NY3D 1QSVA 1RU9L 1WPCA 2R2BB 1S7WB 2VLRB 5GGUB 4HJGB 2TSAA 4FD0A 3PGFH 1G43A 2WWNA 1XB3A 2CO3A 2PXYB 5L4IA 5EUOB 5T3ZL 1OOAA 1PPIA 1JWUA 4GAGH 4MJ6A 5KYYB 1F8TL 4POUB 3D50A 5D7KE 3LZQA 4YSQA 2R4SH 2W9DH 3T6VA 2YR3A 2ZX7A 3NH7H 3S35L 1U91A 3DJRA 3BIAX 3FUEA 4DUWA 4IS6A 4XCFH 1LO0L 2O5ZL 4DZBA 1OCCB 1E5UI 1XCQB 4FYSA 4MAYA 1OP3K 1X7SA 4R4FL 5LAPA 2JLPA 2KHAA 3EYFB 1ZA6B 4P5KB 5C0RH 1LEIA 1IL1A 3V6ZB 1YNKL 2HKHL 5F3BB 5AVYB 4NN5C 3BCFA 1XAKA 2R1XA 1F6AA 1J12A 5FEBA 2YRPA 3HFML 3U7YH 1DJZA 1RJYA 3ZKMD 3SKOA 3QFJB 5HVFB 2YARA 3RTQC 3AQYA 2P80D 4RGOH 2K6ZA 1NA8A 4HUMB 5INCA 2CUMA 2BSRA 1T1ZA 3C87A 2V2TA 1QYGH 4UAOC 4HG4J 2VAJA 1T1XB 3VXUD 3FHEA 2W80C 4GQRA 1IIIA 2NNCA 5ACMA 1HFUA 4MS6A 3U30C 5BVPL 2R1WB 2BM3A 4F2EA 3PWUB 4TUOB 1MIEH 4YK4B 3DTUB 1MRDL 4RFOL 3WHXA 5HYJD 3D25A 3SE4C 1L9NA 5ERWB 3SD5A 3WMSA 3WELA 2VDLH 2X1XR 2XKSA 4KDWA 4ZD3H 5T3ZE 2AQ2A 2HG5A 4JGJA 3BWUF 4PJBB 4JFPB 2FH8A 3FH8A 3RIAK 1RU9H 1QWHA 4JG1H 3JV4B 4JKKA 2PO6C 2RMNA 4YPGB 4Q9BA 4UTAA 3V6OE 4CVXB 5A7EA 5H37A 4FAAB 4OCLC 2GFBB 2FWOB 2MOQA 1AP2A 5T3ZH 1KTDA 3T0EA 2IOIA 12E8L 1UG9A 2VSCA 1F8TH 4NQCE 1GOHA 1E9QA 2FQDA 4H25B 1WCBA 3ZDXF 4IU2B 5HD8C 4YR6A 4DF9A 3QZLA 1LO0H 2CM6A 4JZOB 5EU7E 3H55A 1JPFB 1S7UA 1S7SB 3CZKA 2HWZL 1AANA 3T1FB 5AAWA 5C09A 4NZUL 3B6SB 5BQDA 2PWHA 4R4FH 4WQOA 3G5VB 2E9GA 3BVNB 3D3VB 3P73B 1YNKH 2AERT 2HKHH 5CLXA 5ABDE 5IZ7A 3JZYA 4WI0A 3DBXA 5DJCA 2XICA 2DYPD 2WK2A 2NSXA 1SNRA 5C0EB 4W9DC 5KTEL 1NCDL 3QS2A 1JPEA 2XV6B 2EDLA 4FYQA 4M6OL 2IQAB 2FYYA 1G9HA 2WLLA 2UZIL 1I8LA 2YD5A 2E5EA 4N85A 2AJXL 1XR9B 4JCWA 1IO4C 5AVWB 5DTFB 2W60B 4EDWL 2X1WL 5IW3A 5K9OA 2FQGA 2BMKB 1TPXB 1T7WA 3FQRB 1INQA 1MRDH 2ZXGA 3DPBB 4RFOH 3E0GA 2Y7MA 4U4IA 2C7UA 1ZVNA 3BSHA 2FHBA 4HAFA 1JZ4A 3LDBB 1MKFA 3ZT7A 3UX9B 1TQBC 1XF3B 3G9VA 5D7IB 2X4RA 1M71A 5DK2B 3QUYB 4PJGE 4OF5A 3V0FA 1X5ZA 3BUYB 3M45A 4P46C 5DC2A 3LV3A 1ORQA 4JRLA 3O0LA 2Y1YA 3MRFA 1VFBA 5F9WB 3FUDA 3B5TA 4KDVA 4R7NA 5KBDA 2OX5A 4NN7B 3DHUA 4Y1AE 2QQKL 1VF5C 3RVTD 4OCWH 1U8MB 1BZDA 12E8H 4N8PA 4LHUG 1PKQB 3CDZB 3II2A 1GC1L 3F7YA 1MREL 3FUKA 4F20A 4OIAA 2IAND 1FNGA 2OTUA 3D39B 1FF5A 1O9WA 2YEZA 4XRCB 4G72B 1J5OH 5DJ8A 2BNQD 4JZJA 4WFGE 3S5LA 3PAYA 4HUVB 2JI2A 5IIEA 2HRPL 4NZUH 1J48A 4UT9L 2E6QA 4B96A 4ZYKB 3CQPA 1R3JA 1TQCC 3QR2A 4K3JH 3DRQB 2NPLX 3H9SE 3GXFA 3ZGHA 3BGFC 1IAKA 3ARBC 3GNML 3L5WA 2APTA 2WXQA 1TTRA 5TE4H 2IAMB 2YRZA 3WIHL 5IVNA 2GBTA 3LPGA 2ZOKA 1OALA 1UJ3B 2W1NA 4OJYA 5KTEH 1NCDH 1TG8A 2BJMH 3CHOA 3GJFB 4M8RA 5GGVL 2AC0A 1MCHA 5IVXA 4M6OH 3M86A 4FYTA 4NRXA 5C6PB 4X6CE 3L3KA 2HMIC 3PIQA 1EMTH 1NFIB 3FU8A 1W72B 3L1GA 1LE5A 3PWNA 2AJXH 3B43A 3FO0L 1NFDE 1WBXB 3QIUC 2GVYA 4YBQC 2CXKA 1YYML 2C9VA 5KUMA 4L0YA 3MRPB 4EDWH 2DQIL 2D31A 3VXQB 5IMMA 3QUKB 1CICC 1S2EA 5J11C 4F8LA 1E8ZA 2VLLB 3RWJA 1DQQA 1MJJA 1AS6A 3I6LD 4OF3A 1NFKA 3FO1B 3E2HC 3A21A 1ML0A 3AJ7A 3NIFF 5B1JC 4B41A 4JFFE 3LH9A 5IVXF 3Q8BA 1TT6A 4OB5L 3S36H 2FB4L 4B9JA 32C2A 1Q9WA 4PJ5A 2Z7UA 4Y4FA 4PLNC 3H9ZA 5CKAA 5KVMC 1OSPL 4RGNE 1TYRA 1ETB1 1GGIL 1KXVC 2IDUA 1D5RA 4I9WE 5I6PA 2QQKH 3GSXA 4BKLB 5CD3A 1DQTA 1EFXA 1XWVA 2P5ED 3L4WA 4I0PD 4JANA 1XIWC 1JCVA 5TDOB 1RD6A 1GC1H 1FL3A 4G6ML 1MREH 1X5AA 3RVUC 1MCRA 1PIGA 2OBGA 3HUJA 2QADB 1RFDL 1UA3A 5D5MA 3IGUA 3OZLA 2NY4B 5I71C 1YAIA 3IDMB 2ESVB 2DI8A 2HRPH 2X1PA 5KSAB 3ROLB 3VWJD 3SOBL 5KSBF 1YEJH 4NAJA 1UACL 5FM5O 1PKOA 5G5DA 4MA8L 1SMAA 2AABH 1NKGA 2RFXA 3GMMA 3GNMH 3CBKB 2GJPA 4HFWA 4BRVA 3R18A 1IMHC 3UC0L 2ZXDA 5GGVH 1ZANL 1KDJA 4ABQA 3HUJF 2OKMA 2ENPA 2OTWA 3L1OL 2NSQA 5D5MF 4ZX3A 5IOPA 5TJWK 3B7SA 3FO0H 3MCG1 5IEHB 3UCRA 2VISB 2XNAB 5GS0C 4QHLA 4QRQA 4F7PB 1N8ZB 1OCOB 2CLRA 1UXMA 1YYMH 3QDJB 4IMKA 1MH5B 3Q2VA 4UB0L 4UNUA 5EZPA 1KY6A 1FAIH 2DQIH 4JM2D 1G9EA 2Y07L 4NWTL 1ZHKA 5LGJA 5HVWA 5DWPA 4RMUA 1R24B 3OHXC 5EB9A 4JKMA 2ZYIA 1LNUA 4WHCA 4Y5VC 5FO7A 2ORBL 1ET7A 1A6PA 2ZXAA 3AT9A 4OB5H 4UTBL 5C7XH 1JWUB 3L4TA 4MJ6B 1OP3H 1OY3B 2BZCA 3EW3B 1AD9B 3O3UN 3RNKB 3V95A 3OAUH 4NKDA 3E9TA 1F41A 1U91B 4DK5A 2OYLA 3E80A 3QRGL 4A6YL 4WEBL 3AMKA 4HYTB 5CHNA 2YA1A 5FUZL 3PABA 4MAYB 5DZLA 3D52A 5DU7A 4G6MH 4JB9L 4K9EC 2DJ4A 3VXOA 3SPGA 4WI4A 1RFDH 1JGUH 1IL1B 3QAZB 1NIFA 7FABL 1LEIB 2Y6SC 2A99A 3Q05A 2TSBA 5DD3L 4FQQB 2VMCA 4YXLL 1GYUA 1T2JA 4LCWA 2XTJC 4RMBA 1OVZA 1RJYB 4R90L 3SKOB 3SOBH 3KS0H 1NGQL 1UACH 2BZDA 4UUJA 2J2ZA 4X6FA 3AS2A 4MA8H 1IQDA 4B0MM 4X8JA 2O61A 4MNQD 2A4ZA 3EXJA 3AQXA 1T1ZB 5HJDA 2V2TB 3PHAA 2E7LC 3IAQA 2JSFA 4OJDH 4G82A 2WMPB 3W11D 2OCFD 3QORA 3ZU8A 3BSZA 2Z65C 4R8WL 1Z3GL 5MHSD 3L1OH 4JN2A 3COOA 4TULL 2BS71 5ISZA 3VD3A 5ANMB 1PLCA 3ZDXB 1KTLA 3QHZL 4UB0H 1NCNA 5GZNA 1JVLA 3CZGA 2HG5B 1KTKE 3PP4L 4ECNA 3LZLA 3EGSA 4ZODA 4ZUTA 5DK3A 2Y3AA 2D9QB 2IH1B 3P54A 1ONQA 3OQRA 4KRLB 2ORBH 4U1LB 1EJ6A 1HNGA 2ZKHL 3BLBA 1U8OA 4NZTL 1KTDB 5DD6A 1F4XL 4UTBH 4EIGB 2HVJA 5IM7A 3ZDZE 2NT0A 3CIQA 2CHWA 2BIMA 3I02A 3P4MA 3TS8A 1WCBB 2N7AA 2WC7A 5DRXA 4YR6B 4XPBL 3QRGH 4A6YH 3IBOA 1P0SE 1S7UB 1L5GA 2COVD 3IEAA 2VTFA 4XMLH 4LVOB 1JL8A 5MI0B 4BSWA 1WJ3A 1DEEA 4JB9H 2W0PA 4XMTA 4I3SL 3O2VH 1UA6L 2VZTA 2X4TA 1TR7A 3DJZA 7FABH 1Q1JL 5KZCB 1H6FA 3DX4A 5EU6D 4WI0B 2XPZA 3DBXB 5DD3H 5DJCB 1FCGA 4HOZA 3TEZA 4YXLH 3LQAL 3BKCL 1WWAX 3QJTB 1NGQH 1VADB 4WU7A 2XQ0A 5BS0E 2FYYB 3MRLA 1Y0LB 4AWJC 4KI5D 3FU3A 4PB9L 1XGTA 4PRID 2X05A 4N0YL 3UGEA 4QJ3B 1CF1A 4LDLB 5I9QC 5DEZA 1Z3GH 3Q3GA 1BFOB 1DVFB 3WUWA 3HI1A 2IFFH 2OZNA 1VAHA 2X87A 1INQB 4GG8A 2IG2H 4XAWH 1C7TA 3ELAT 1T7YA 4W9HC 1UOLA 2C7UB 5IB2A 3WEXA 4JFYA 3QNXB 2OA9A 1QSZA 4KITB 4IBVA 1HNYA 5KAQF 2X4RB 1M71B 1JAEA 2IGTA 3FQ1A 4G6FD 3R8BB 2AQSA 5LAXA 4PJFE 4KNUA 3SDXF 3KPTA 1ORQB 3LV3B 3AZUA 1T04A 3MRFB 1VFBB 1SXSA 4R7NB 2OX5B 3D0AA 3CLEL 2P8PA 2O30A 5J89A 2AJVH 1I1AC 3HJ0A 1SN2A 1CQKA 1FYTD 3SZ6A 1S3KL 3DIVA 3F7YB 2RHEA 4JE0A 4UOW0 1LO2L 4MMXB 1FNGB 4XPBH 3UJTL 5DJ8B 1DJYA 4JZJB 2ADIA 1UKQA 3S5LB 3BIBX 3S88L 2YUWA 3HN8A 5IIEB 1CTNA 2VLKA 3R4DA 4QRFA 5LLIC 1E4KC 2EACA 1R3JB 5KBKA 4AEHL 4PRHB 3BJ91 2P8MA 1X4YA 1IAKB 3T77A 2E8ZA 3L5WB 4FFZL 3BP5B 2YHGA 5CBEA 3LQAH 3BKCH 2IMNA 4LB8A 1IBGH 2GIYA 3FOMA 2ZOKB 3KVDD 3F2LA 4TF4A 4O9HH 7CGTA 5IVXB 4NI3A 2H9GA 4NRXB 3L3KB 3PIQB 2VDOL 4EN2A 4GY4A 1LE5B 1KCRL 3OAYK 4PB9H 3PWNB 4ONHA 5FGCB 8CGTA 5HTSA 4N0YH 4P9HL 1XEUA 2N7SA 5CZRA 4ELMA 5C97A 4V33A 3QPQD 4WFFD 4S1SL 5C92A 2CDEA 2AF2A 3FO2A 2D31B 1TETH 4TSAH 4Z7VF 1TTFA 4PS3A 1S9XB 3FQXA 1QI5A 5IB5A 3RWJB 1DQQB 2AQNA 2CA3A 1MJJB 2KL6A 2N4IA 1E5AA 1NKOA 4HA1A 5T5FL 3VGDA 4F5CE 4C56D 1M7UA 4FQLL 5KYUA 5AOJA 4G7QB 3ZYJA 3JT0A 1OQXA 3ZE1F 32C2B 1Q9WB 2JJUA 3B2PA 4PJ5B 5KSBB 1U42A 3CG8A 3UACA 3WNNA 1T89A 4G43B 5L0QC 4ELMF 4RA3A 5C3IA 5CD3B 3GSXB 1N3NA 1EFXB 3P3RA 3GYRA 5IBUB 4JANB 1G84A 4A39A 1NBYA 2GTWA 4KTEL 1MCOL 1FL3B 1S3KH 3L81A 4JN1H 2VZOA 1LO2H 2I26N 4G8GD 5D5MB 3UJTH 1QHPA 3OC8A 4X4MA 3OC5A 3S88H 2EIKB 4OKDA 3VWKD 3KLSA 2DIJA 4NM4L 5G5DB 1XXFC 4AEHH 2WD0A 4EBQL 3GXTA 1DQDL 4NERA 1UJTA 2RFXB 5H8DA 3GMMB 4CGUB 1J5HA 4MGXA 4FFZH 4HFWB 2LOEA 2CR3A 1AZRA 1NCUA 1OD7A 4HWEH 1T2QL 3SCMD 4DTGL 3RY6C 3GMOA 1UT2A 3T71A 5DFWH 1K3IA 1BQKA 1SGKA 1FYHB 2CK0H 4Z7WA 3UO1L 5GISL 1GY1A 4GXVL 1IARB 1DANT 3NIDE 1Q9OB 2VDOH 3CK0L 5IOPB 2Z3FA 4QTHA 1DN0A 1KCRH 3SJVA 4PP1D 4KROC 4P9HH 4QHLB 3UL4A 4MD4B 2GABA 1BX2A 2CLRB 3K7UA 4RA0C 3AU1A 3FRPB 4S1SH 5E7FA 1JERA 5LXGH 3EJCA 4MKTA 2CALA 1ZHKB 4OUUA 5AVRB 1JWMA 3ZRFC 4BUGA 2CM5A 4HU2A 1LDSA 4JRYE 5C7ZA 1UXLA 3NJVA 2AJ3A 1H5BC 1NCHA 2J6WA 2H47C 5FO7B 5T5FH 3SO5A 3EJPA 4N20A 4FQLH 3NCYP 4Z7WF 3ZHNA 3UTTD 3SDDD 1A4BA 2ODHA 4M56A 1FG2B 4OGZA 4G8IB 2P42B 1UXWA 4P5MB 3VG9B 1XR8A 3CZSA 2ZAHA 4KKNA 2WLYA 1YRKA 4XBMA 1KELH 3A4EA 5FM8A 4N90D 1PS3A 3FSOA 5C0CA 3PABB 1D9KC 4KTEH 1MCOH 4N1HB 2UXGA 2QHRL 3CPLA 5DI8A 5HDQL 1ZVSA 4OQTA 5E03A 3VXOB 1U3NA 4NX0A 5CAYB 3MRIA 2B08A 3MUGA 4V1DE 2V2XB 1FE8H 2WZ0A 3GLZA 3T0DA 1AHWA 5AWNL 2FD6L 4NM4H 4UUJB 4LP5A 4X6FB 4EBQH 1IQDB 2E56A 1DQDH 5J0BA 4P5TB 2VLJE 3LS5L 2KC0A 2O61B 1VCBC 5SV4A 1CZ8L 3CTTA 5T3XD 1FGVL 1T2QH 4DTGH 3QORB 1KUMA 5FAAA 5C0ND 2XV2A 4GW1A 4XTRD 3UO1H 4GXVH 2YMOA 4MB1A 3ARQA 1JGVH 1BFSA 3CK0H 5FKPA 2ZUYA 3D06A 4ODXB 4P06A 3TA3C 5ISZB 1HHJA 4TS6A 5CMAA 4ZS6D 1AGCA 3K46A 4U2YA 1KTLB 3EHBB 3GMRA 5EN3A 2EJ1A 3TYFB 4OV6F 1EK3A 4FQ2H 4MMZC 3U4KA 2P52A 3SPVA 3EGSB 3WDJA 1AG0A 5L2JB 2FLMA 1ONQB 3CFJA 5E1AB 4JVWA 5GRJH 4X8XA 4PRDA 5DD6B 1U8OB 2M1KA 1QSFE 4Z95H 4CADA 4WRLA 4DT2A 4PUBH 3VCLA 4EF3A 2NYYD 2VXSL 3I02B 3P4MB 4DOHE 3EF7A 3RY4A 1G6RH 4G1EA 2JCWA 4XAKE 1L5GB 5F7DA 3UAJC 3NFSL 4XE0A 5JIHA 1DEEB 4N0CC 3N91A 5HDQH 4L18A 4R83A 4ZXBB 3PGCA 1R19A 1F4YH 5IG7B 2DOCA 2FLRT 5D1ZI 3UGUA 4MZRA 4QR7A 1J8HD 3VU1A 2A0LD 5DUML 2FD6H 5LGYA 4WU7B 1W0YT 4ANVA 2GAZB 3N42F 4QXUL 4ZMZA 2Z64C 3QIBC 4JFDA 5DHVB 3MRLB 4YSCA 5JQ6H 2LLGA 1CZ8H 3SDXB 4P4KD 5SWZD 5TFSH 3BZEA 1XGTB 1QRNE 4A68A 4BZ2A 2J1XA 5ELIA 1YSOA 2IALA 1AO7B 3Q3GB 3HI1B 1OD9A 1S8DA 4IKKA 3SKMA 1FZKA 4OZGA 3QJFA 2P28B 5LCVH 3S96A 3LS4L 5IB2B 4P05A 1T7XA 3WEXB 1H3PL 2CUHA 2EXSA 3MOQA 4LSDA 5GJSH 1P5UC 3VA6A 4NP4H 4YBLB 2YO3A 3BKML 3SE9L 3REWA 2FUTA 4FG6C 3GUTB 3QUZA 3HEIB 3S7GA 1K6QL 2IBBA 4Z3TA 2PPCA 1ZCRA 4F58L 4XVSL 1A3QA 3DO4A 2OCCB 1HJBC 3I3EA 2P8PB 4G59C 3G5ZA 4LCYA 4P2OC 1G5AA 2WWMD 1WS7A 3RFZA 2XWRA 3D12B 4J3UA 5F8RC 1WBZA 4OZGF 3ZHLA 1XF2A 1L0XA 3WO3B 4TQEL 3WN6A 3SIKA 3VRLE 4HMDA 1VFMA 2VSDA 1MCWW 3EJJX 4JPQA 2ADIB 4QHUB 2YXWA 2QPFA 3NFSH 2VLKB 3QXTA 5D1XA 1KCVL 1QASA 4X9HA 2E6PA 1K4CA 2G9HA 1BVNT 1MCNA 3CX5K 3GB7A 4OH2A 4Z7VB 3U7AA 2YGPA 2MQCA 3OAYH 1MCIA 3T77B 4F2MA 3BUTA 1UADC 5CBEB 2JKIS 2P43B 1A6ZA 2ROXA 3OHMB 1QR1A 4O02B 5DUMH 2KDGA 4HJSA 43CAA 1OHZA 2NZ1A 4QXUH 2XXFA 2H9GB 3V7AG 4FA8A 5J06A 3ZE1B 2ZUQB 4GRWE 1JXJA 4ZFGH 1NC2A 2JIXA 3QG7L 3EH4B 1IC0A 1U93A 3TL5A 4UBDC 4YOKA 4XVOA 4ELMB 3B5GA 1FO0A 3TV3L 1WC7B 4BFFA 2CDEB 3FO2B 1EVUA 4FGMA 5DMGC 3SD2A 4GRWH 5TK4A 4X99A 3FQXB 5IB5B 1TENA 2VLRE 4JQVC 3LS4H 4G8AC 4FS0A 2XCMC 4OF6A 4W9LC 1M57B 1H3PH 4JJOA 5L6YL 3NEEA 1FC2D 2XBDA 4XVJL 5EUOE 3UPAA 4GKNA 4PJAE 4POZD 4Y19A 4D0CA 3BKMH 3SE9H 4K9JA 3SE8H 4AY0A 4ONGL 1K6QH 1BF8A 2PTTA 1XGYL 2C3XA 1Z9SA 1YMMD 2NX5A 3A3YB 4HH9B 4F58H 4XI5C 4XVSH 1B4JL 1GZHC 3ARGA 4LVNB 5SWQA 4KK8D 4F8NA 3RVXD 3L3JA 3SDCD 3R19A 2GSGA 1NBYB 1KPRB 2GTWB 4HUWB 3VAEA 3QP3A 2AEWA 2PETA 4TQEH 3ULSA 4PWGA 2EDMA 5I6OA 3IT8D 3ZKXB 1SHSA 1YCSA 4MB5A 4FQHA 2GSMB 2H8PB 2WXLA 4Z0BL 2OYKA 5I1IH 4Y5YA 3QO0A 3VO0A 3F7QA 5AAMA 3QFJE 4NDMA 1KCVH 5B39A 3CFEA 2PF6A 4URTB 3VVVA 1B9ZA 2XBZA 2IPKA 1OE3A 5AB0A 1FDLL 3NSCA 3FFDA 3MTXA 4MKMA 1YEIL 1KULA 3AGWA 3AY4A 1FFQA 4JY5L 2ZWKA 3GMQB 4ZK8A 3BISA 4A7GA 4JQXC 4P2YA 3VTAA 1RCYA 2YPVA 3NVQA 4CMMA 4HBQA 1K5WA 3VW3L 3BIKA 2FEEL 4QTHB 3GMPA 3JWOL 2WYZA 5EIVA 3WDHA 1XF5A 1FORH 4HKXA 1DFXA 3V6OC 1NTDA 4QRRA 3PWPD 4KKZA 4GS7B 1BX2B 3PHQA 4C4KO 3TV3H 4PJBE 3FU6A 1LYQA 2NLJB 1JWMB 4KWUA 4EO5A 4LLQA 4PMFA 4J4PC 5I1GL 5DJYA 5EU7C 5L6YH 4PD4K 4XVJH 2E7MA 3N50A 4UIKL 3E6FB 4XH2A 1ZT7B 4F15B 4KY2A 4ONGH 5E4AA 3G7TA 5EZJA 5I73B 1XGYH 1MCQA 2X89A 1UXWB 3TZVA 4UTCA 1E50A 4FNPA 1XR8B 5IROD 4Y4KA 2GW5A 5C0CB 4YGAB 4L3ED 1AGFA 1IKFH 1CDUA 2VZVA 4UQIM 2VUOA 3CPLB 3IGAA 5DI8B 4DEPC 1ZVSB 3RZCC 2Z34A 4TV3A 5CIPA 1JZ7A 3T65A 3WO4B 2L7EA 4Z0BH 3VXTA 3MUGB 4YEFA 1URLA 1CI3M 5EIIG 5BZDB 1AHWB 2ZQKA 5F9OL 3AMLA 1IKNA 2C1PA 1FNEA 1NCAL 1FDLH 5SV3A 1YEIH 2YQ3A 3FH7A 4RNRA 3R7RA 4U7KA 4JY5H 3QZPA 2H0EA 4GRLD 1GPOL 1S7QB 2X12A 3F62A 4KHTL 4N8CL 1ZDSA 3NGBC 4AW4A 2YD8A 3QUXC 3SDAD 4GW1B 3FTXA 2EVHA 2WINB 3OR6A 5LO7A 1EUTA 3VW3H 4EZKA 1I85A 1U3HD 1Z2KA 5FKPB 1W72L 3JWOH 3P02A 2VW7A 2WIMA 5CMAB 4AX3A 1AGCB 5CGMA 3ZE0F 4QF1A 1CXIA 5D7IE 2HT4C 3V9FA 2MPAL 2IC2A 1Y18B 1IVTA 3SPVB 1I9JH 1UB6A 3FYIB 2WSPA 1P2CA 5H2BA 1QFHA 3HC4H 1ACYL 3CFJB 2ICEA 2GI7A 4PRDB 4PHXA 3MZTA 4UIKH 4WFHD 4EI6A 1CCZA 4CADB 1PKQE 1P84J 4YHKL 3MGOB 2YD4A 5J9PA 5K1VA 3DI2B 4TQ8A 3VNYA 3D39E 2QVKA 4CW1B 4HGKC 4G1EB 1LK2B 2I7SA 4Z7OF 1N0LA 4F2FA 5F7DB 3H7BA 1S78C 4M1GL 2GCYB 1UZ6F 2JQAA 3GS0A 4LHQB 3QZNA 2EIDA 3PGCB 2NDGA 4EVNA 3BAKA 1Q0EA 5IBTL 3U4EA 3QHFL 2RIKA 4H20L 4Y5XA 4L37A 3FPXA 2D3LA 3W5NA 3PRZA 4GW4A 3H3PL 4FXTA 4HIQA 5F9OH 1JPTL 3ILDA 4NKIL 1R3LA 3WEMA 3WTWA 2M83A 2PPEA 3TEUA 1NCAH 1TCMA 2FEEI 4AXWB 4AIZA 2XY1A 4JFDB 5DS2A 5B4MD 1PX8A 1F00I 4MA7H 4UNVA 3BZEB 1GPOH 1VENA 4DEWA 1IBZA 3NJXA 2IALB 3P1VA 3QBTB 1T7ZA 3R1GL 5I76B 4LASH 4RFNB 3DMMD 1KTCA 3MBEA 5T1LA 1KB3A 1GC1C 1S8DB 5CJQL 1EEYA 1W72H 1FZKB 4OZGB 3QJFB 3SKMB 4RGNC 4XXWC 3S96B 3L45A 4KC3B 5I30L 2WKGA 1KJ2A 2BS9A 2WZPD 4YWGH 4LAJH 2MPAH 4FFVD 2DKUA 2CJUL 3REWB 2PMZA 2IANE 1KIQA 1TJMA 3JUYA 4K73A 3TXAA 2V3FA 2MKWA 2L3BA 2X6UA 1A25A 4LCYB 3TVMD 4YHKH 1I7UA 2ADFH 2VDQL 1L9TA 3RBSA 2OP4L 1MWOA 1WBZB 3X17A 5L88L 5GGSA 2J20A 4KXDA 4Y4HC 2YLKA 4M7LL 2IOMA 1EHLL 2ESVE 1E4JA 2MFNA 3O2DA 3PAVA 4LSQL 4M1GH 1YPZF 1XDTT 5D1XB 2AK4A 4R5XA 1S9VA 5F9JB 1JNHB 5K59E 7PAZA 1K4CB 2G9HB 1NPUA 4M61A 3UYRL 4F27A 1B0GB 1YN6A 5IBTH 4H20H 3L2MA 3LIZA 4U0QB 3ZL4L 2WNWA 3ARRA 3KPOA 2I85A 1E43A 3H3PH 1JPTH 2Z8WC 4NKIH 3RWDA 2G2RA 3IJSA 5KVGL 43CAB 1YEGL 2BVOA 5FV2A 3FSAA 4HETA 3TN0B 4ODTH 5BXFA 3VI4A 2QHLA 2JIXB 4XBGA 3QXVA 3F7VB 4JE4B 4NQDD 3RJQB 1U93B 3HR5A 3Q9QA 4HPYL 4WSKA 2QT6A 4M9PA 3IETA 1FO0B 4A63A 4WWPA 4I0CC 1PDKA 4X99B 3UOAB 1YY8A 5I30H 4OZFH 3TU6A 3X12A 5B3SB 3NRQA 2X3CA 3LKQA 5F72S 4IRJC 5AVSB 1BBJA 2CBMA 4LPYA 5DA0B 4GKNB 4D0CB 4Y19B 1GA2A 3L48A 4DO6A 2CJUH 4KUCF 4OVVA 3VI4F 5I1DB 1OK8A 2YPKA 4K3DL 2PTTB 5HHMD 2DICA 1Z9SB 4KKAC 1J05B 4BUHA 3RGVC 1MFBH 2B15A 3L3HA 3KXFB 3ARGB 4EJ1C 5SWQB 5A2BA 4L9LC 3KHOA 4E5XG 2VDQH 2GSGB 2ZT9C 2OP4H 1AJ7H 3S8FB 3RDTA 3WY1A 4MQ7A 3C09C 2DQCL 3J27A 1NM9A 3EYUL 3ME0A 3ULSB 4YHNB 3JTTA 2OXGA 3UC2A 1EHLH 3MU3A 4UM8A 1EAJA 1LQSR 4FQHB 1KPUA 1IKOP 4LSQH 1KWGA 1BZQK 3QO0B 3VFGL 4BGDA 4IOFC 5E7BA 5B39B 3MODH 3KVQA 4P23C 5KVGE 3CFEB 5DHYB 4BK5A 1CLOL 2IPKB 3FFDB 1GW0A 1FUNA 4W9KC 3EYVA 3BHBA 3ZL4H 3O8XA 5EZOL 4H40A 5E5UB 3GRWH 4ZSOE 1J1OH 3VQ2C 2FZ3A 3UJJL 4RMTA 2ICWI 1E8YA 1G94A 4OM0H 5AYQA 4LFHD 5KVGH 1YEGH 4CMMB 5HSFA 4YBHA 5L2KD 1TDQA 1CUOA 4ACTA 2ZXQA 2KLRA 1V5JA 1EJOL 1O6VA 1XF5B 3GSUA 4HPYH 5ANME 3ZDXE 3ZHFA 4P2QA 2X9XA 1ADQA 4H1LG 3U46A 3W0WD 4TLUA 3T2OA 2HVKA 4XN7A 4UQ3A 1L9PA 4YSSA 4MJID 2PUQT 4LLQB 5D7JA 1BM7A 5CGYC 3ZQWA 1OAUH 4OLXL 5FUOH 4FA6A 5DJYB 5JZ7D 1HL4A 4HKZA 5IR1B 3KYNA 3OSKA 3UTPD 4XH2B 5J1TC 2ENJA 2WAQA 3TM6A 1UOVA 4XHJD 5DLLA 2C9XA 5EZJB 4K3DH 2OR7A 5TDNA 2K4WA 1FNSL 4JFTA 4YHYB 1BFVH 4PGZA 3TZVB 4IJTA 3FTZA 4H5SA 5ALCH 4Y4KB 4A2MA 2BNRD 3DO3A 3BLPX 5FWQA 1FGNL 1CYGA 3IGAB 2ATAA 4MNQE 4GAJL 2DQCH 5SX4H 4ENZA 1LWRA 2D4DA 4GO8A 4QY8A 1AZCA 4HXAL 1Z9PA 5CIPB 3G9AB 3KYOB 3QUMA 1BQHA 3VXTB 1LXMA 2Q20A 3VFGH 4OLWL 2LLLA 3OWRA 5MHSE 5CJOL 4Q89A 4PSRA 2C1PB 4O5LL 3VRJB 3ZE0B 3ASOB 1CLOH 2GT9B 4CU7A 5LNEA 3ZL1A 4FQ1L 2YKLL 3MI6A 4QNPE 1ZGLA 3AU0A 4RNRB 3P77A 2WBJD 5EZOH 3TOPA 1LJMA 2XZQL 2W0FA 3UJJH 1AR1C 1F4HA 2YXFA 3AACA 4PJ9B 4LKCA 3OXSA 4UQ9A 3OR6B 1XX9C 3STBA 3KLHD 5JW4M 1EJOH 1CGXA 5KVFL 3NRPA 5D9SA 1JNNL 4M7ZB 1XL4A 3VXMA 1JUFA 2HRLA 4Z7OB 2DN7A 1AKJA 4MCMA 5EORL 3MACL 1WDAA 3FU9A 4YHLL 2GBVA 5EF1A 1K9TA 3T2PA 3RTQA 5DFAA 5FGBC 1UB6B 4Z18A 2JI1A 1OW0C 1FRGH 5H2BB 3PU7A 1H3GA 4OLXH 5F3HA 5TE6L 1N0XL 1AGBA 3GGWA 2ICEB 3E1ZA 3N2JA 3LQAC 3W5MA 4F93B 4N68A 4EI6B 5J9PB 1MWAA 1ULVA 4X5RA 1DP0A 5SX4I 4AQEA 2I32A 4HEPA 4YHOH 4K5LA 1EEUA 2WQ8A 3IPEA 1NKRA 3QFGA 3UIYA 4EXKA 2CO7A 2FCBA 3CN1A 2X28A 3WMPA 4PJ8A 2R2EA 3H7BB 3ZTNL 3CFBA 2Z1KA 4GP4B 3VGGA 4DZ8B 3RWEA 3P30L 1FGNH 1ZA3A 4PRHE 1MCWM 5ITFA 4GAJH 5CR8A 3TCLA 2A9NL 4Z0XB 1CB4A 2IPUK 4PJEF 5D96B 3S5ZA 4EUPA 4EVNB 3JZ7A 2NY1C 3U4EB 3DX9B 2IBZX 4Y5XB 2XIBA 3U25A 4AJYV 1RZIA 2PCPB 3X14A 4KX8A 3PL6B 5CJOH 3QAQA 3DSFH 4AH2A 5J8OA 5IVXE 4PWFA 1RK0B 4AOFA 2WO4A 3DX0A 4JW3A 4AIZB 2R4RL 4FQ1H 5AFAA 2YKLH 2HVBA 4ZUVA 4XP1L 2VDMB 5FGCE 4YHPA 4N5UA 1N19A 3VGAC 4AK1A 3A23A 2XZQH 5CLYA 5KVFE 2XTLA 3A4FA 2J73A 3KWVA 4OF0A 4ORGA 4UM9D 2PWGA 4KVCL 1GGCL 3MBEB 4HEMA 3BUQA 4WV1C 3AG2B 3MHZA 3CQFA 1G7MA 3HG1D 1DCEA 4HOMA 5FHBL 1KB5L 1QPPA 3FAWA 2OMNA 1JNNH 3MLSL 1UYWL 4YO0A 2BVUA 2WWKT 4DSYA 1KJ2B 3ZTDC 1IBBA 3OLGA 5K9KA 2UX6A 4YHLH 2Z91A 5I2IA 3ZXAC 4PJ5E 3WKNA 5KSBE 1YPZB 4PS4H 4E42A 5JIQA 2CZNA 3LTVA 1KIQB 4PS8A 3HBQA 5TE6H 3N9GL 1N0XH 1YMHA 4OLZL 1TU2A 1WLHA 5CJXA 1EZVY 3G08A 4LKXA 4I0KA 4LEEA 2YSSB 5CD5C 1DSYA 5I5JA 4WFEE 3IVKA 4B97A 2WYIA 4YSTA 5F7AA 5CJ5A 4N0UA 2NR6D 4ODUB 5D5ME 3F5WA 3BVVA 3CC1A 4DQOL 1EDQA 1GW6A 3KJ6H 5CF3A 4GKZA 4BIKA 4P9ML 2DBLL 3P30H 4L29B 2A9NH 4FJYA 1C7SA 4P46A 4M61B 3TNNA 4PJCA 3AUWB 4MA1C 4WTQA 5MP6H 1YN6B 2VUKA 4AIXA 4L8DA 1RHFA 4FLHA 4PI2A 5KVEH 1OSZB 3KPOB 3Q8FA 4H0GA 1F86A 2I9TA 2P48B 4ALAH 3RWDB 5HGHA 2BVYA 2G2RB 3L4VA 4D3CH 2AJYL 3O3BA 2R4RH 3IMRA 5BXFB 4KMLB 1KLGA 1SVBA 2YD9A 5D1QB 2H2SD 4U3HA 4XBGB 4LOVA 5D4QA 3PQYA 3Q43A 4C56E 4P3WA 2IGFL 3I6KA 1N10A 4D8OA 3WMQA 4HS3A 1BEYL 1SHWA 1OP5H 1E9OB 4KVCH 3VXSA 1X3DA 5AOKA 1GGCH 2AW2A 2EE0A 4GPVA 2VR7A 3V4VH 1PDKB 4PJCF 1NOFA 2K0RA 3NRFA 5EDXA 4FCHA 3ZOAA 3FO9A 2AJUL 1S46A 5E6ID 5F7MC 3U79A 1KB5H 1DJSA 3ARBA 3U7WL 1OKEA 2OI9B 3LKQB 3MLSH 1UYWH 1SN5A 4GT0A 1BBJB 3BKJL 2D0GA 1MNNA 3U1SL 5TPWH 1GZQB 1KZQA 3SYOA 4DP8X 1OAJA 4YHZH 2DV6A 2YPKB 3BWAA 1O7SA 3V0VB 3HZMA 5J1SC 5J1AA 4ODBD 3N9GH 2ZSWB 2QEJA 3BPCB 4OLZH 3WLWD 4CVWA 3DVFA 4DGYL 3L3HB 5EF3A 2RCSL 3JBG7 3QIUA 4FZ8L 4PCTA 5H4YA 1YEKL 5D72H 2BHFA 5IESL 3KPNA 3N5AA 5KJRL 2JNZA 2W38A 4K94H 4CSSA 1CICA 3GXPA 2BY3A 4MQ7B 4D94A 4UCFA 3ME0B 1INDH 4L0PB 3JTTB 2OXGB 4MX7A 5F1IB 4UM8B 5JHAA 2WLNA 5ECGA 2WNKA 1KBBA 4EN3C 3RWHA 4RETB 3JWDL 4P9MH 2C3WA 2DBLH 2QLYA 2H6PA 4L8CA 1UUSA 3OVUB 3ZDYF 1CC3A 2ZCLL 2F54A 4KQ4L 3U4AA 1L6PA 5T3XL 1XHHA 5LWYL 1UM6L 1RZ7L 3O8XB 5GS1C 5C6TH 1UWGH 4ANKA 1P7HL 3DOHA 2H6OA 2WGNB 1CLVA 2FZ3B 3MRJA 3LKRA 4PY8I 5GIRA 2BY1A 2V17L 4TNEA 4PJHF 1XIWA 3V55A 2AJYH 4U3CA 4CC1A 4CVUA 2J6EA 2EEFA 2VC2L 3LNIA 4UWQB 2WUCL 2XHNA 5CR1A 2GC7C 2IGFH 3UTTE 2J8UA 1BEYH 1HWWA 1AD0A 1XCTA 3U46B 2XVBA 3RU8H 1I7ZA 2HVKB 4LK4A 3ULVD 1QSEA 2AK1L 1PEZA 1PJ9A 4PR5A 4UMGA 2DF3A 3X2QB 3WNMA 1E6JL 4KKPA 4KO6A 5D7JB 3WE6A 1EHAA 3WTXA 3U7WH 4R2GC 2OK0L 5FDWA 4N90E 4HKZB 2IF7A 4AQZA 1HZLA 3ARDA 4JDEB 4XP6L 4YVNA 3ZTJG 1NANH 1SZNA 5F1NA 3PWLA 3WGVB 2XVGA 3ZT6A 3MKKA 3QK0A 4DGYH 5F70A 3UJIL 4GG6A 2RCSH 5E9NA 4Z3GA 1FZJA 2A73A 1BAGA 5KJRH 4OZFG 1P4LB 1DJHA 3L3DA 5FUCE 4Z7NF 1GRWA 3I6SA 2FK9A 3ZKQD 3U0TA 3OHXA 4FEMA 2CDFB 3EO0A 4FFYA 2PPDA 4QY8B 3MJ7B 1NCBL 5E5RB 4PBVC 2HSIA 1VHPA 4Y5VA 4AEEA 1IAIL 4IBSA 3FCUB 3VB9A 3JWDH 3B7TA 4W4OA 2ZNWA 3SKNB 4X2UA 4CMHC 2UWEF 5CN1A 4JO2H 4K8RL 3ZZ1A 3TJEL 4ZI8A 2QVMA 3NJKA 4PWKA 1ZGLB 4PY7B 4N5ED 5T3XH 3SDXE 2PW2B 5LWYH 4GG6F 1RZ7H 1YEFL 2BSTA 2NY0C 3K8MA 4O02L 2A9ML 4LIQE 1IEBA 1AO7E 1BQ5A 2A6IA 5DJ6A 5E4OA 4LGSB 5I8CB 3H0TA 3MA9L 1J1XH 2OMWA 3OXSB 4RRPG 5E2JA 2CHZA 3TO4B 3GBDA 2CUIA 2VC2H 4FQPA 4DPRA 1DVUA 1ECYA 2VM3A 3FB6A 4HIEA 2SODB 3T0ED 1OAYL 4QUOA 1JUFB 3PUCA 5DMKB 1NANI 4UDTA 1G7IA 1DBJL 5AVTB 3RTQB 4FXLA 2BC4A 1E6JH 3FUFA 4TNWK 1QTPA 3APNA 3OXRA 3X1GA 1U8NB 4ZAKC 1GOFA 2ITDA 2OK0H 4PJEB 1AGBB 3LB6D 4PEEA 4NP9A 5ALBL 2E7LA 5C09D 5EULV 5CN3A 3P0VL 4J6RH 1NC4A 3VD2A 4XP6H 1MWAB 4AQEB 4BWWA 1AMYA 2EVFA 2VNCA 3Q44A 3G5XB 5DHEA 1UVQA 3FTGB 3UJIH 4PJ8B 1A65A 1ZE3H 2R2EB 1OGPA 3CFBB 3HA0A 4WUUD 1HEZA 5T1MA 1ZK9A 1X5FA 2DEXX 5ITFB 1ZA3B 1I3RA 1PF3A 2AP2A 1NUGA 5JIDA 4Z7VE 4QRTA 1UWFA 3B3BA 2GIMA 3DPDA 3FONA 4EUPB 4MS8D 2NOYA 1SY6A 1QFPA 4HOXA 1IAIH 1RZIB 1YECH 1BYOA 3X14B 3S37L 1DBBL 1HH6A 3K74B 1BDYA 2QKSA 1A9BA 1F6LL 2Q8AH 3ZTEA 4AH2B 3IDNA 1KSRA 4BHUA 4A2FA 1PSKH 3TJEH 3ZE1E 4Q58C 3O6FD 4O2CB 2MHAA 4YHPB 1YEFH 2NUTA 1X9UA 2VKXA 3X1EA 4O02H 4AVKA 1SOKA 2PXYC 2A9MH 4ELME 4PLKD 4YN3A 1ID5I 1GR7A 3CDCA 3O6LL 4FQJL 2YKKA 3HAEH 3IU4L 3AW5A 3OF6D 1G7MB 3U36A 3MV01 3Q2CA 3H53A 4X0KA 1WWBX 4YO0B 5I74B 3W57A 1BGXL 4TUJA 1MY5A 4N2LA 2JMRA 5IHZA 5C0BA 4E42B 4HT1H 1A9VA 2HRGA 3GD1C 3EZJB 3UBXA 5JORA 3L7FA 1XTLA 3VRIB 1O75A 2ADGA 1TU2B 3MXWL 2HPOA 3G08B 4LKXB 3P0VH 2G3ZA 5D4IA 3IVKB 4MJ4A 4PJ7A 4CSTA 2WSKA 3DV6A 4S1QL 5LG1A 4N0UB 4PYHA 2MOVA 3F5WB 2P8LB 3NACH 3NK4A 1IAII 2GJZA 5GJTL 1D5BA 4DVRL 4UZGA 4AW7A 4D0BA 2CHXA 1TQBB 2FEJA 5F6HJ 1GHFL 5D4HA 2NY3C 1N59A 1R5IB 3MNZA 3QUGA 5DUBA 5FO9B 1HI6A 4P5SA 1MG3C 4YK4C 3O3AA 4LOUC 5EFIA 1MFDL 2J43A 3TNNB 1LTXA 4P59L 4PJCB 2Y2YA 4XWGL 5T33L 2DH2A 4HUCA 4L8DB 4CUCA 3IJ9A 2I9TB 1DBBH 3DUSA 4XCNA 5HGHB 1ACXA 2H3NA 3ESOA 4MQTB 3O3BB 3OLIA 3MR9A 4UOJA 1KLGB 3LRKA 1OGAA 5CCKL 3PQYB 1QD0A 1SLWA 3GZKA 2DWTA 4HWNA 3UDWC 3FQTA 5AW0B 4ZNEE 1IB5A 1IGFL 4HS3B 4JFQA 3WV0A 3O6LH 2OMTA 3VXSB 3HS0A 4D7BA 4TSCH 5C3TA 4Y4FD 1MFVA 4LGRB 1N5AA 4U7SA 4CU6A 1YMME 5CCGE 1CS6A 3S5LG 1DVYA 2G4EA 3FO9B 4L3AA 3MNWB 4WWOA 3LZRA 2HX7A 1ESOA 2AXHA 3ARBB 5F89A 2NUPB 3DYPA 3O4LA 5JHDA 1BGXH 3MJ8A 5L4JA 3HE7D 5DDHA 3AADB 4BCYA 5DURD 1ZLWK 3FT9A 3V52L 3QDMA 4NT6A 3JWNE 4LSUL 4BQCA 4F7TA 3BWAB 1NAMB 3TT3L 4AQAA 4NQEA 3HZMB 5J1AB 1F3DJ 1U95B 4KFZC 3ZDYB 3HS9A 5FHAL 4L3FA 2E7CA 3F6IA 3W56A 1D5MB 4UZUA 3WCYA 4GQZA 4NENB 1S7TA 3JWNH 3KPNB 4PJHB 4YFDB 4BCZA 4OCSL 2GTZA 4IW4C 4RMRA 3OKOA 4MX7B 2KUTA 4MJ2A 5GJTH 4DVRH 4JG0L 5DJZA 1OGSA 3RWHB 5JQHC 4BK4A 4PGEA 3EJRA 1DEDA 2H6PB 3VFOA 1TPXC 4L8CB 1MFDH 3FB5A 2Y4SA 2F54B 4P59H 5T33H 2PTVA 5ABZA 3PWPE 3C5SA 3V79C 4W9IC 1JXKA 2Y7SA 3V0GA 3LDBC 3TEYA 5GIRB 3MRJB 3B9DA 5DF0A 2D7NA 3LKRB 3D0LA 4QAWA 3QUYC 4AL8L 1XIWB 4E9WA 4M62H 5E95B 3MO1A 1IM9A 2DQJH 3QWQB 4XC1L 5IBUG 2ZOTA 5GZOA 2JKNA 1KIPA 4U6VL 4LHUA 4CDGC 4F91B 4NN7C 2W65A 3LPPA 3EYOA 4IRZL 4BDVA 5C1MB 1IGFH 3FOLA 1AD0B 1XCTB 3IU3A 1I7ZB 1HE8A 1T0PB 3QPXL 5CZKA 5E0QA 4B5ZA 1QSEB 5DRZA 5BRQA 3RVVD 1TTGA 3RHWK 3MCLH 4PR5B 1EHKB 1RMFH 1RQ5A 1YC8A 5I0VA 1DQVA 4IRSB 5FA3A 3RY6A 3ARDB 5GGTA 1UFUA 4LSUH 5C9JA 5D7LD 2UY7A 1HILA 4XB8A 3TT3H 3PWLB 2UWEB 4KO5A 4R3SA 1MFNA 2AI0L 4LDCA 2YGOA 5FHAH 2IAMC 5JIKA 3HB3D 4GG6B 3UBHA 1NH6A 1FZJB 2A73B 3V8CA 3L3DB 4OCSH 3DBSA 5CEXA 3U0TB 3FRPG 4BFRA 1CT8B 1PNDA 3VD1A 4A2DA 5T5NF 1H5BA 4JG0H 4G7YL 4HSAC 4F57L 2EDTA 1NCWL 4I3GA 3LYRA 4JFDE 3FT1A 3QZWB 1WK0A 1TQTA 3O9WD 5TDPB 5DUJA 2FO1A 5I75B 2W94A 3GUFA 1ZLEA 5JHLA 3AS3A 1ODUA 3FB8B 1TZIA 3OMIB 1IEBB 1U3JA 2A6IB 4AL8H 2RA1A 2GJJA 3SQBA 2HKFH 1D9KA 2LW3A 4XC1H 4D2NA 2N1TE 2YXVA 1MI5B 2LLNA 1TJIL 1AQMA 2FDBP 1JWSA 4JO4L 4U6VH 5K39A 3SE3C 1NICA 2NXZB 4IRZH 3C60A 4PRPD 4WFHE 2UV3A 1GIGL 3BGMB 3I74A 2XTJB 3QPXH 4HJ0D 3NJIA 5AZEH 5L4FA 2QADC 2BC4B 3BN3B 3RX9A 3OXRB 1RJCA 5B1KA 1L7IL 2ITDB 3D9AL 1M56B 4JJ5A 5E8EA 1RIVL 1QFUH 5KSAC 2VXQH 3ZSTA 1A4CA 1NC4B 4N2HA 1IE5A 9PCYA 2JFCA 1GVIA 4GT7A 5IREA 3H2PA 1UVQB 3BN9D 3MRBA 2AI0H 1FQ9C 3ORJA 4LLYA 3TA3A 1AGEB 4IM8A 4KMTL 2JXMB 4GIPD 1ODAA 3UTSD 5D1XE 5T1MB 4FNTA 2Q2LA 2X7LA 3ECWA 3AITA 1I3RB 3MJWA 1GGBL 1E0OB 4MMZA 4QRTB 3ZE2B 3T2NL 2YN5A 4AENB 4MRCA 2K4AA 2DMCA 4F57H 1CQYA 1LO4L 3M8OL 1KZYA 4UOZA 1AI1H 2AV1A 1HH6B 1NGZA 1A9BB 1I4FA 1LMKA 2XQYK 4WNQA 3IDNB 3C6SB 3SY6A 1L9OA 4MCZA 2XC8A 1MQKL 2G4GA 1AYOA 4PJXA 2MHAB 2NUTB 3MLXL 3GO1L 4MNHB 4RSYA 1WBYA 1RZQA 4JKPH 3UAJA 4H0LC 3J2PA 2X3AA 2YPVL 1Q9LA 1QACA 4FOMA 3WEOA 1R1CA 1KTJA 1B4LA 2WKOA 4XGZA 1UM5L 1MCFA 3U36B 1TJIH 4HUXB 4H8UA 1PLAA 5FYLL 3SY0A 4EI5A 2DQUL 4X0KB 3LCYA 3FSVA 5LBSA 4FADA 1GIGH 2WLIA 4Y19E 3MJ6A 1I7TB 4MAYC 5HPOA 4EIBA 2R29L 1D5XA 1MN4A 2OPCA 3BVDB 3IE9A 4HJJH 2AJSL 3L4XA 4OR1A 5IHZB 1AR2A 4PJXF 1SJEA 4WKXA 3QAZC 4Q14A 2H4EA 1K8DA 3T3MF 4KXBA 3UBXB 3L7FB 1L7IH 3D9AH 2VZ3A 4GIAA 4YLQT 3KXFE 1RIVH 5KAQG 2ADGB 3UTSB 4WO4D 1G1KA 3GSNL 1J18A 2WKOF 3D05A 4LVEA 2K1MA 4TOYL 3BWUC 3NZHH 5E1GA 3DV6B 2AXWA 3MVSA 4KMTH 1X7TA 4M3KB 4YQXL 2GJZB 1D5BB 3CWGA 1XF4B 3QYNA 2XWBA 5ICZB 1P5UA 4JM2C 3GSRA 4ZFFA 1JE6A 2GSIB 2LFEA 3MNZB 5DUBB 4B9YA 3MUJA 5E4EC 2CJSA 5HY9A 3DX8A 4FXGA 1HI6B 1NCTA 2BFVH 1XH3A 2ED7A 3LNDA 3O3AB 3ATAA 3CFTA 1W2KT 4H7VA 3T2NH 2PWFA 1BF5A 4X6DF 3ALXA 4NPYB 3Q8EA 5JUEL 1C16A 1LO4H 3M8OH 2HJLB 1FAKT 1DANU 3DUSB 4P2OA 3V5KB 3BQUD 2H3NB 4AZUA 2LVCA 3MV9D 2JH2A 2K3HA 3MR9B 3LQZA 4G5ZH 5D7SL 2BSSB 2WKLA 1MQKH 3CN0A 4RIRA 2DMHA 1HKLH 1OGAB 4TVPE 5GQBA 3MLXH 1JNLL 3GO1H 5FYLE 1XCXA 3UPCA 3FQTB 4KO9A 3KE0A 4JFQB 4ERSL 2I07B 3GM0A 2FT8A 2OMTB 2R9HD 3B34A 3HS0B 4QTFA 4RCAA 1ZLWH 2VIRA 3QW9A 3KPRD 1N5AB 1XVSA 1JMZA 3IJ8A 3V4LA 1UM5H 5JOPD 1RAMA 2CDGA 5FYLH 3GLAA 4H0HB 3RY5A 1P7BA 3BRGC 5F89B 1UC6A 3FFCB 3DK0A 3O4LB 4JDZB 3MJ8B 4LVOC 4PHZA 5MI0C 1ZRUA 5DJ2A 3OG4B 2R29H 3TJHC 3QDMB 5EMYA 2AJSH 1AXSA 2VUYA 4NQEB 2W07A 4EMZA 4QDGA 4JFHE 5ETUA 3FQWA 5EN2A 3APFA 3GSNH 4DNLA 1U92A 1JZJA 5TF0A 4TOYH 4X0NA 2WZ6A 5E1HB 1OSYA 4ONFL 2XPGB 2GTZB 3OKOB 4JQVA 4YQXH 4X7EC 5T8IA 5DJZB 1CL7L 4M7KL 4M8VA 4PGEB 4J5VA 1ZXKA 1DVFC 3M46A 4P57A 4WHTA 3VFOB 5L2KE 3LY6A 4HJTA 3S0PA 4D8PB 3FB5B 3SJVD 4XPGL 2MIZA 3V4PB 1UKTA 4G9FA 2QPEB 3B37A 4F7KA 3C5SB 1GZHA 3W0WE 5I1KH 4E0RB 4M1DL 4KRPD 1VEMA 5HPMA 4OJFL 5D7SH 3IRZA 3MO1B 2VQTA 1RP9A 4JQIL 1IM9B 3E8UL 4RAUA 3T6ZA 2APBA 3QPKA 5ACZA 5KEZA 1E3ZA 1SLVA 3EYOB 2D73A 4Z7OE 2MRYA 1PZCA 4PVNA 4GP8B 4ERSH 3FOLB 4ICWA 3ESMA 4PB0H 3ZR6A 2GHWB 2QV4A 3PV6B 1UZ6E 2G9KA 3B7UX 5DRZB 4AQ8C 4MMXC 3LRMA 3AFLA 2WPGA 2O5YL 4MQXC 5A16B 2BNRE 1BG9A 4FQCL 1R47A 5FA3B 4A7VA 5C8JA 2PWEA 1NEZG 2V8MA 1HKFA 3TX4A 2K6YA 1FHGA 3UPRA 2UY7B 1I3GL 1HILB 2PYEA 1ROCA 1CD1B 1ZT1A 2WP3O 3FSWA 4R3SB 1KG0A 3UIZA 4NUGL 3KEHA 5FA4A 3AB0B 3SBWA 4FA7B 1A1NA 2I9LA 5BCAA 1J87A 4RMSA 5AEAA 4WVRA 1MHHB 3HCVB 4ONFH 2BWQA 3JXAA 5EO1A 1VFUA 5E8PA 1QAWA 3GXNA 1A4JA 4NFBA 2VMDA 3NZUA 2P44B 1CL7H 2CBOA 2MQ3A 4M7KH 2Q76A 1R3KA 3QEHA 4DGWC 1IT9H 5E1QA 5EBGA 4QRPD 5DQ9A 3AAZA 1ZLVK 3JVGC 5LBGA 2J72A 3QXAA 5J6SA 2AMUA 1S5IL 2Y0SA 3GKWL 3JWNG 4JLRA 1Q0XH 1TZIB 2VABA 4M1DH 3GTTA 1QWNA 5DZPA 4ANUA 4OJFH 3SQBB 1D9KB 3Q0HA 1JFHA 2MNWA 4JQIH 3RZCA 3E8UH 3KMDA 1IFRA 4K7PX 3K6IA 1JWSB 5K39B 1O6SB 3C60B 3CN4A 3QFDA 4HMCA 3D85B 1QI3A 3VI3B 1YPZE 3CFUA 1M53A 3C08L 4FNSA 5JA9A 2PN5A 3WE1A 1GKOA 3CSBA 2O5YH 5E8EB 1FNHA 5DEFA 2P45B 2R8SL 4KZCA 5J13C 3DOSA 1JGEB 3B2XA 4NOFA 1T4KA 1GZPA 4PJGA 3ZL2A 1TTUA 4GRMA 1OT4A 1I3GH 4GAYA 4NQVA 1PFCA 4NUGH 1FFRA 3Q48A 1OTUC 4LLYB 3QVAA 1CL7I 1ZT4A 4QHMA 3A6CL 4Y1AA 1JK8A 2XYBA 1A47A 3BAJA 5IWLA 4WHYG 4KKCC 2EIJB 5HJ3A 1GJIA 1LL1A 2CO4A 2AVGA 3O3DB 2VR3A 2DQTL 3IXTA 3H2WA 4DK6A 3WTSA 2I7OA 4PJGF 5JMRA 1ZVHA 1NGZB 2AV1B 1I4FB 4WNQB 2R0LL 4XWOD 4YE4L 4MCZB 1T1WB 3HG1E 5D1QE 3WXWH 2L7QA 3H9SA 2V7HA 1TQUA 1BYPA 2JJSC 4PJXB 5JNYA 3BYTA 1DFBL 1S5IH 3KHQA 4RQQB 3GKWH 3QI9A 3T3MB 1WBYB 5A2IH 3M17A 4B50A 3D51A 4DEUA 3NCXA 3QUZD 1B88A 4R4BA 2ZKWA 3N85L 2WXRA 2QGDA 4IOSA 3VXRD 3RPBA 1JNJA 4X6CA 4BFGA 2Q3AA 1A6UL 1A1OB 2CRIA 2JB6A 3CFDB 5D93C 1BCIA 1U8KB 3UFIA 3VG9C 3SY0B 4EI5B 1NFDA 2ZYHA 2WLIB 4N2AA 3GBNL 3DO7A 2EUWA 2A6KA 5E0FA 1D5XB 4G8FB 5TE7L 3C08H 3IKKA 3Q8AA 1SJEB 4FHBD 5AVXB 1K8DB 1MF2L 4X5WA 5T1DL 3QDAA 2O5NA 3NABL 3Q6FA 4H88L 4P49A 4X6DB 1G6VK 3PP3K 4QXVA 1I8KA 2P5WD 2C3VA 2ZWSA 4X6CF 3VXNB 4P5TC 1NFDF 3ZMRA 3HC2A 4QOKD 5AKRA 3MUUA 1S4IA 3X11A 4G83A 4NQTA 2XWEA 3AS1A 3QORC 3GSRB 3BZ4A 3WNOA 4F7MA 4DO4A 1UTDA 2BCKA 1DO6A 4Y9BA 3V9EA 1OAKH 5HY9B 3DX8B 4FXGB 1NC2D 1XH3B 3OX8A 2Q2EB 1OGTA 2DWDA 4IGBD 1FVEB 4XR8C 5CKGA 2CD0A 2DQTH 2NNRA 3KW8A 5D71L 1C16B 4HS6B 3EHBC 2VOTA 5GZNC 1LO3L 1PAZA 3BAYA 4P2OB 2R0LH 1PG7L 5FYJD 2Y1ZA 3LQZB 3RNQA 4AE0A 5EF2A 1KBWA 1DFBH 3MA7A 2OJ1A 3D0VA 5AW8B 4YC2C 5FS5A 2G0KA 1JZ8A 3MV11 1A7PL 1DTUA 2EKSA 2XOTA 4G7RB 1VCAA 2VIRB 3I3BA 3WTVA 5MEOA 4K3EL 2NX5D 3ZR5A 4Z8FL 4FP8L 4ES8A 5SWSD 3Q7JA 1ETJA 3AS0A 2BOBA 4OI7A 2RB8A 2EDOA 4FQIL 5JYMA 1QI4A 3GBNH 2X2UA 3EUDA 3EOTL 5DJ2B 3ULAB 4PV8B 1UD8A 1CBVH 4WW2A 4ZXBC 4HQQH 5IJDC 1FIEA 1MF2H 2EIZA 4JY6A 5T1DH 2I25N 2BH0A 2W07B 3H3KA 3NABH 4H88H 4M4RB 3LAFA 4R4ND 5ETUB 5EN2B 5C0NC 4FN0A 4JAMA 1MWAL 1U92B 4CL7A 4FTVD 1ITCA 2EE3A 2EYTA 5F7LB 1XTMA 2FBOJ 3PUUA 4KKLC 4ZS6C 4O00A 1BW8A 1KXQE 3EDKA 4U1IA 1E30A 4ZUWA 4IRJA 2YOAA 4O4YH 5HHXH 4IKLA 5EG6C 4WW2F 1IM3A 2AANA 5C08A 3MOBH 2XIIA 4WUKL 4XPAL 3HZKA 2WJ7A 3AREA 4NO0D 2JQZA 4G9FB