1GY1A

Crystal structures of ser86asp and met148leu rusticyanin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
154
structure length
154
Chain Sequence
TLDTTWKEATLPQVKAMLQKDTGKVSGDTVTYSGKTVHVVAAAVLPGFPFPSFEVHDKKNPTLQIPAGATVDVTFINTNKGFGHDFDITKKGPPYAVMPVIDPIVAGTGFSPVPKDGKFGYTNFTWHPTAGTYYYVCQIPGHAATGMFGKIVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords RUSTICYANIN
publication title Crystal Structures of the met148Leu and Ser86Asp Mutants of Rusticyanin from Thiobacillus Ferrooxidans: Insights Into the Structural Relationship with the Cupredoxins and the Multi Copper Proteins
pubmed doi rcsb
source organism Thiobacillus ferrooxidans
total genus 36
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1gy1A00
4GYBA 1M57B 3WKPA 1AZUA 3DTUB 3AW5A 2EIKB 2FQGA 4E9WA 1AZCA 4P5RA 3PLYA 1PMYA 1BXVA 3ZBMA 1HAUA 1GY1A 1TU2A 1BAWA 2YXWA 3NJFA 3QJRB 3X1BA 1AANA 1OCCB 3X1FA 1A4BA 4A67A 2MRYA 1T5KA 5A7EA 1GYCA 3T6ZA 1NIBA 1IKOP 3UAAA 1OCRB 2GI0A 2BZCA 3L45A 2WO2B 1SDDB 1PY0A 2DYRB 2PP8A 1FFTB 3OM3B 1J5DA 1BYPA 2YXVA 4HHWA 4BDVA 3FYEB 2QPDB 3FQ1A 3OMAB 1KCBA 3QPKA 1XB6A 2WSDA 3ZIYA 4DPBX 4KNTA 2YAFA 3NJNA 3NJHA 1GR7A 4BK5C 1RCYA 5F7BA 1L9RA 3ASOB 2CJ3A 1RZPA 2BWDA 2J56A 4W9ZA 1GS6X 4FAAB 1NIFA 2CCWA 5B7MA 1J5CA 1ET7A 1V55B 4QLWA 1ETJA 1MZYA 3EH3B 5EHFA 2AVFA 3FQYA 2YAPA 3PAZA 2XX1A 4NB7A 2VMJA 1NIAA 3ABGA 3CZUB 3V9EA 2DY2A 2OJ1A 2HRGA 2CUAA 1N70A 3NP3A 3UGEA 3AG2B 4E9TA 4HALA 4YSTA 4DP8X 2H3XC 1V54B 3AZUA 3QJQB 3IEAA 3EHBB 1WA0X 2MTAA 2BO0A 3CVDA 1BXUA 4DPCX 4DP7X 3FQ2A 2TSBA 3CVCA 2ZXWB 4KOBA 4W1TA 4F2FA 3ERXA 1WAEA 1A4AA 4KOCA 3QJVB 2GC4C 3BQVA 3GYRA 2J5WA 4AI7A 3NSCA 1AR1B 1W6WA 4RH4A 1MDAA 3T6XA 2FJSA 2UXFA 3WIAA 4A2GA 5I6PA 1OE1A 4HCGA 9PCYA 1JXFA 1IUZA 1JZGA 3NJJA 2P80A 2Q9OA 4A66A 4BXSV 3FYIB 2UXVA 2IDUA 3QJUB 1ILSA 4HHGA 4NAJA 4BDVB 4DP4X 2UXGA 1JXGA 3FU8A 4GXFA 5B1JA 4A2EA 2VW4A 2P80D 1RZQA 3FS9A 3AG4B 4BWWA 1RKRA 3AG1B 4E9QA 1JXDA 2W88A 3CDZA 2XLLA 4L0PB 1CUOA 2BZ7A 3TA4D 1OF0A 1VLXA 1QNIA 4YSPA 1JZHA 2PPDA 5B3SB 1X9UA 2FT8A 3SBRA 3S3BB 2IWEA 4E9VA 4X4KA 2ZWNA 4PAZA 3EH4B 1CURA 1ET8A 5AZUA 2VM4A 4YSSA 4YSEA 4DP5X 1KBWA 4WTQA 1PNDA 2BP8A 3UABA 1SF5A 2EIJB 2XWZA 5B1AB 1PLAA 3NJGA 4E9SA 2YQBA 4A2DA 2OV0A 1E65A 3ABMB 1W8EA 3NJKA 4JKNA 4K9JA 3QJSB 2JXMA 1E5YA 2AANA 2TSAA 1AZRA 2LLNA 3IBOA 1JVLA 1BYOA 1JVOA 2PPEA 3X1GA 3FT0A 4GP5B 2FT6A 1A8ZA 1SJMA 2AFNA 5LDUA 2BHFA 1AQ8A 2HX8A 1J9TA 2A3TA 2B3IA 3WNJA 1GY2A 3NJLA 4G7RB 1AACA 3DKHA 2NRDA 1NWOA 1NPJA 4HCFA 4CSPA 2HX7A 2XVBA 2N0MA 2XU9A 2IH9A 1BQRA 1JZJA 1EHKB 1YLBB 2ZOOA 3PPSA 4E9YA 3WKQA 1HAWA 4ZK8A 3S3DB 2YAMA 4G70B 2PP9A 4YL4A 2BP0A 4G71B 2FNWA 4M3HA 4F7KA 2PP7A 1E30A 1SHWA 3MBWB 3SBPA 2BW4A 3CDZB 5B1KA 1ZDQA 2PPCA 5F7AA 2Y1AA 3TASA 4YSAA 1SF3A 2QPEB 5I28A 2FWLB 4DPAX 3ZX1A 1FA4A 1TEFA 1OV8A 2J57A 2YAQA 1SHXA 5ANHA 4AKPA 2VSKB 5E9NA 1ZPUA 2EILB 4KO6A 2BWIA 2BP8B 2JKWA 4DP2X 1A3ZA 2ZONA 1DZ0A 1BQ5A 3X2QB 1W6LA 2GIMA 1PZAA 3IE9A 3UADA 1AG6A 4KO5A 3FU7A 3OQRA 2Y69B 3NT0A 1ADWA 1WA1X 3JTBA 2CALA 3PAVA 4KNUA 4UANA 1FWXA 2OCCB 4A68A 2E86A 3CG8A 1TKWA 1L9PA 1KCWA 2GHZA 2HLEB 3FSVA 3T71A 4UAHA 2FT7A 1ZDSA 4YVNA 1IC0A 1MZZA 1PZCA 3G5WA 4BXVA 1MG3C 1OCZB 1B3IA 1OE2A 2DWSA 4KO9A 2GC7C 1SFHA 3GDCA 1NWPA 4N8UA 2HX9A 1KGYE 2XYBA 2PCYA 1A4CA 5D4HA 3NSFA 1L9OA 1MG2C 4EF3A 3AG3B 3TBCA 3NYKA 2IWFA 2RACA 8PAZA 1F56A 2BP0B 3WNIA 4GP8B 2YARA 5PAZA 3FU9A 3IN2A 3T6WA 5TK4A 1GW0A 4QKTA 4YSQA 4GY4A 4YSUA 4P5SA 2R7EA 2GB2A 4E9RA 2XXFA 1AG0A 1GS7A 1HFUA 2GSMB 3D12B 3HEIB 1BEXA 2IH8A 3X1NA 3BVDB 1PLBA 3FSWA 4HIPA 2GBAA 1KBVA 1NIDA 2FQFA 1NZRA 2HRHA 2HZHA 3AY2A 2QDVA 2FQEA 3OMIB 4E9XA 3UACA 4YSRA 3OMNB 5PCYA 2PCFA 2VSMB 2XUWA 2IDSA 3FU7B 2QDWA 2FTAA 2UX7A 3C75A 4Q89A 1R1CA 2FQDA 2PPFA 3S3CB 1ZIAA 3DIVA 1PAZA 1KDJA 2I85A 1CYWA 2UX6A 1SNRA 1IBYA 4KO7A 4BWTA 1IBZA 1PF3A 1ET5A 1NIEA 1EZLA 2YAEA 1NICA 1J9QA 1NTDA 2IWKA 4GP4B 3GXUB 4KNSA 3FPYA 1E67A 1N68A 1KV7A 1XB8A 4F2EA 3ABLB 3T6VA 2IAAC 2X88A 4BWUA 3NSYA 1L9SA 4G7QB 3ZDWA 6PCYA 2CAKA 3PCYA 1AAJA 1OE3A 2VM3A 4AKQA 2XXGA 3X1EA 3H4FA 2J55A 2BW5A 3JT2A 3PAUA 3U25A 5B7FA 4A2HA 1ASQA 4WKXA 4DP0X 5I5JA 3V9CA 4Q8BA 1AZBA 2VW6A 3KW8A 2R7EB 4YSOA 4AX3A 3ASNB 2XV3A 4YVUA 3QQXA 1AOZA 3N55A 1PCSA 1NPNA 2XV0A 5I6KA 2AZUA 2HXAA 1PNCA 1SFDA 4CSZA 5I6NA 1JZIA 4JHVA 4A2FA 3NP4A 4MFHA 1V10A 2JFCA 1CYXA 1XB3A 3S8GB 2W8CA 1ILUA 5I26A 2QT6A 1JOIA 3NJIA 3S8FB 4G72B 3UAEA 2YAOA 1DYZA 3FPXA 1ASPA 1M9WA 1NINA 2WO3B 2H5UA 5FC9A 4DP1X 5B1BB 3H4HA 1WA2X 3NSDA 2VN3A 3RYMA 3EF4A 6PAZA 1ZIBA 1UATA 1X9RA 1ID2A 3T9WA 1TEGA 2DV6A 1BXAA 2DWTA 1GS8A 1L9QA 2I7SA 2Q5BA 4AZUA 1L9TA 4AKOA 4N4YB 5I6OA 1ASOA 2I7OA 3EH5B 5I6MA 1JZFA 1JERA 1M56B 5B1JC 4HCIA 4FA7B 2EINB 1J9SA 2PPAA 5D4JA 5D4IA 7PAZA 1BQKA 5AFAA 2YAHA 4DP6X 1URIA 3CVBA 3H56A 4NERA 1I53A 5B7EA 3MX0B 2IDTA 4G7SB 3HB3B 2UXTA 1SDDA 4YSCA 5TK2A 1NDTA 1AIZA 2AZAA 4M4RB 1E5ZA 3SBQA 1XMEB 4ENZA 1AZNA 1JZEA 2CBPA 1QHQA 1ZV2A 4HAKA 1PZBA 1A65A 3IN0A 1AS8A 2IDFA 3NJMA 2X87A 3ABKB 1OOWA 3TU6A 5AKRA 2VW7A 3QJTB 4PCYA 7PCYA 4TXVB 1GSKA 1KDIA 3FSAA 2XV2A 2IDQA 3N2JA 3KW7A 3WI9A 2B08A 1WS8A 1J9RA 5IY5B 1CC3A 3SQRA 4DP9X 1QLEB 5I5IA 4YSDA 4HZ1A 3WG7B 2XX0A 3TBBA 3PXLA 1OCOB 1WS7A 1AS6A 2PLTA 4JHUA 5I5MA 3FSZA 5I6LA 4UF7C 1PLCA 2H47C 2EIMB 2DYSB 1AS7A 3OD3A 1KYAA
chains in the Genus database with same CATH superfamily
1T4KB 3F62A 3LKOB 1Y6KR 3ESUF 1XGTB 2X4RB 4GINA 4GYBA 4NDMA 1A9EA 3BDXA 5TPWL 1RZ8A 3SSGA 4A7UA 3MR9A 1AZCA 3RAJL 5GISL 5AW5B 5IVNA 2F58H 2E7BA 4JFYA 3BKYL 2BY0A 1ZCRA 5KSBF 4M8RA 4CMMB 2Z1PA 1DBJL 3EYUL 1UXSA 3X1FA 4M93B 1T7WA 3Q44A 2PWDA 2W60A 4L8SB 4A37A 3IDIA 4Z7VA 2MNUA 1H19A 1IKOP 1Z3GL 3KLDA 1UFUA 1AR1D 3MLVH 3RGVA 4JGMA 4KKAC 1IARB 2J88H 2WMPA 4FFWD 4U1HB 5KJ4A 1H3PL 4NZDA 5CCGE 4LT7A 3GB7B 2VLJE 3F04A 1XQ4A 1V27A 2YN3A 1OP9A 1NUDA 2XG4B 3OMAB 3ZIYA 4Y5XC 4WU7B 3GI9H 3BESR 4XAWH 4QJ4B 3ZOAA 3WO4C 3QA3B 4JANB 1GR7A 5MHSE 4JPKL 5FECA 1RD6A 2XWDA 1O6VA 2BC4B 1PS3A 3BVNA 5AVTB 3WYRA 3I2CH 3MYZA 5CS7A 4XCEA 4HG4K 2DQFA 1KIRA 5I8EA 2W9DH 4RGNB 3EDFA 4JFPB 5EIIA 5C09D 1RJLB 1DSYA 3PABA 1TTGA 4JZJB 1ETJA 1PBYA 3MV8B 3DJTA 5FO2A 3V0EA 3ZSSA 4NSKA 2ZUQB 4HK3J 3ZE0B 2IQAA 2I32A 3IPBA 2DY2A 5L2JB 3P4MB 1IAIH 3NP3A 4HUCA 4A7QA 4XNQB 1E43A 1E8ZA 1UURA 4EE2A 3MRHA 3LN4A 4NNXA 4LP5A 3WY3A 3EOTH 1BM3H 3VFWA 5FHBH 4R3SA 4ZYKA 4X98B 5BS0B 5KTEL 1F4YL 5IW1A 3EHBB 3TESA 1RUAL 1RU9H 1WA0X 2R51A 4MQXD 4X6CB 3T0EB 5KJ7E 3U30C 2O72A 4Q4EA 5L7XL 4P5MB 2DQ6A 3N91A 1S7UB 5D7KE 4H0GA 3VRLF 4BH7B 4MMZB 5DMYA 3R18A 5MHSD 2QQKL 3I50H 1E4XL 3CQFA 4RH4A 4DGWC 2ICWI 3H3BC 2VC2B 2WLIB 3NFNA 1JPGB 3NCJL 1KTCA 1OSYA 2FJSA 2UXFA 4CN1A 4PJAB 1YMMD 3VFSB 2CK0H 4ALAH 2ADIB 1J1XL 1MJUH 2Y36H 3UP1A 3UYRL 4BE6A 4BXSV 2Z0BA 2RFXA 4QLRA 4OB5H 5F1IA 2O4EA 3FOLA 3WS6C 1KFAH 3OQ3B 5E1AA 3ILEA 3QIUA 1KJ3L 1MCCA 4W6WB 1AQHA 1RKRA 1T1ZB 1JZ6A 1CFNB 3QXTA 5H4ZA 2P45B 4FXTA 1K8DA 4ZMLA 3DX8A 5HHQA 1QFHA 1S9YB 3HHSA 1QI5A 3GMPA 5I73B 1QNIA 2PF6A 5IG7B 2Y1ZA 2DD8H 2FT8A 1CFVL 3SBRA 5E2TH 3QIWD 5GGSA 1ET8A 1IEBA 1M2VA 5T5FL 2WBJB 1KBWA 2LFEA 1P4IL 2ZWSA 1V8HA 1SF5A 4U7SA 4PB0L 1QBLH 2AXWA 5HJ3B 4QDGA 4M5YH 4M6MH 3T65B 4BJLA 1KCRL 3K4AA 5IK3B 1KZYA 5HI5D 3BGAA 3KM2A 2FEEL 2YXMA 3IDGB 3OZKA 2MQGA 5I0VA 2BVQB 3D4ZA 43CAB 2CK2A 5C2UB 2XT1B 5AD0B 1CTNA 3HRPA 1LNUB 4FQ2L 5EZIL 1FH2A 4HK0B 1CICA 4OZFG 5LDSA 3QWRA 3GMMB 2BOBB 3L1FA 4XPFH 1CF8H 3MV7A 3NJLA 4LKXB 4DGIH 4ZAKA 5T3XH 3CN4A 4XVJL 5IJBC 3ARFC 1N5AB 2XU9A 3CZKA 3MRRA 4FMKA 3O3DB 3QR2A 1I7UA 4HKZB 4GFTB 4MXVF 5K9JH 2R59A 1EX0A 1LK2B 4GQPH 3WLWC 4CVZA 1BVZA 1ZE3H 3NA4A 3S3DB 3BD4A 1HYSD 3PP4H 3FN3A 2AQQA 4YL4A 3P02A 4L1SA 3VG0H 4HETA 1WK0A 4M3HA 4Y2DC 2LABA 1SN5A 4QY8A 1OTSD 5FW6A 4DOHE 3N9GL 1KF9B 5BV7B 5MENA 1CQYA 5EBLA 3DVGA 5FHAL 4C57C 5F7DA 5FGSA 2BVOA 5B1KA 3ZT7A 2DMGA 4IIZA 2OBGA 5EIQA 4WJ5B 2GTZB 1P5VB 4XPGL 3T3ME 4J1UB 4YDVA 4WWKA 4XNZC 4DKEL 4N8VB 2BOLA 2YPLB 2A7BA 3B7RL 3OX8B 4FFYH 1ANUA 3LX9A 3IJ8A 3EG9A 3S35L 1IC5L 3EYFA 5F3FA 3D07A 4MXQD 3ES6A 3CH1B 4R90L 4D0BB 2G3XA 4NC1C 2NZ9C 3DK2A 4Z7WE 4PFEA 2QZ5A 3UADA 2QTEA 1JL8A 4TS6A 1BXXA 5ABDE 1AP2A 3OXRA 1FZMA 4JG0H 1ZGLB 1FF5A 5E94A 4ZFOL 4PJ8D 1X5MA 2VXUL 4HUWB 4GUQA 1FUNA 1UC6A 2WTPA 4M1CD 4DCQA 3L2MA 3T71A 3L5XL 3NCYP 3OAZH 4I4WB 5CSZA 4U2ZA 4Y4HA 4X99A 4EOWL 1NCTA 1TLKA 5GGQL 4WUKH 4LNVA 4XXWC 2ITCB 4WWID 1KIUB 3MNVA 4EN3B 4BZ1L 5SWZD 1UM4H 2X6CA 4IGBC 4KKCC 4O2EB 1NDGA 3SJVE 3MRBB 3EGSB 3R7QA 3QO1B 4EVNB 1X5FA 2YR3A 4KRPD 2E74C 2C1PA 2G0LA 1KENL 3AG3B 5FA3A 4UQ3B 4MNGB 1PZ5B 3DUUB 1FZOB 4OCYH 4OJFL 4JFXB 3MJ9A 1G7HB 5PAZA 1ROCA 2VDML 1NFDB 4GQQA 3FB8B 4NKMB 2C7UB 4G6ML 3VX1A 1DJWA 1MWAL 4P5SA 4JHBA 2R69L 3GSNH 3HJEA 4PREA 1DJGA 1JWUB 2GB2A 3QIBC 1T22B 4LSVH 2DQHH 4Z95L 1U93B 2P26A 3U0TA 4N0UB 4OUUA 1J86A 1T3FA 1G1OA 5E1HB 5IKCA 2NY4C 1KBVA 1NIDA 4PJEE 4PWGA 2QHRL 1DVZA 2KUTA 1QO3B 2D3NA 2VABB 2CHXA 4UQ2B 5TPWH 5LLIC 2ZX6A 3QRGL 2EUXA 2EDQA 2NY3D 3RAJH 3A21A 5GISH 5CP7B 3T3MF 1TXKA 4CUCA 1QFWI 3BKYH 1BMWA 2F53B 3F58L 3QUMA 5KBPA 3I75A 4MSWB 4BSJA 2UX7A 2VLKD 3QJOA 3ASWA 1DBJH 1AR1C 1TLMA 3EYUH 4ZUTB 1WP6A 4MB1A 2E9WA 4OZFH 1FNEA 1P7QD 5D7JC 1DE4B 3W37A 3EJRA 4UTAA 1Z3GH 1I7TB 4BWTA 4L37B 3O4LD 1IBZA 4UT6L 3ZUCA 2GTWB 4C55A 1NCOA 1L5GA 4N90D 5GGVY 1XGRB 1ZGLP 1H3PH 1J8HA 3OC5A 2G4GA 2QMJA 2CLRB 3BIKB 4RLDA 3FPYA 5BZWB 4KFZC 1LD9B 2X12A 4EQ3A 1X6NA 1Z2KA 4NKOB 4H2CA 2HLAA 2ODIA 3MJ8A 2Z91A 1E8YA 2JCCB 3JV6B 4JPKH 5GJTL 4A6YL 4P4KA 2C9QA 2AQRA 1MHEA 2IANE 5IWLC 4JAMB 1ZLUH 2QQNL 4AK1A 5JW3L 1OWRM 4OIIL 1P7BA 1HXYA 2XA8L 1UWYA 4D0CB 4RQQA 3ETBJ 4UM9A 4GW5B 4XN2A 4F57L 3CZGA 3SDDB 2QLVB 3P30L 3V6FA 3FC8A 1COBA 2XJLA 4HKBA 4NO0A 4MQXC 4K3EL 3INUL 3W57A 1SFDA 4CSZA 1R5IB 5MEPB 2G75B 5E5MB 5KTEH 2C1OB 1T5XB 5KSAD 4HMDA 1F4YH 1G94A 4KDVA 1PGRB 1RUAH 2EH7L 4JRFA 3B7TA 1RZIB 3ARSA 3V0AC 1OSEA 4FG4A 3CCHA 3KDMA 4TN9A 5L7XH 2QT6A 3S96A 2C3GA 4U1IA 3IFPB 3TNMA 1NMBL 2RQ8A 4PBXA 1IIKA 3ILQC 1RAMA 3O3BB 2QQKH 1WE5A 2VN3A 4N68A 5DK3A 3QDJE 5BRZB 1E4XH 3MLSL 3QG7L 2C8NA 3NCJH 1TQTA 4OI8A 1BLIA 4Z7UE 2BHYA 4DVBA 1L9TA 4XHQA 3UYRH 3K81A 3DHJA 4N0FA 4Y2OA 2VN7A 5G55A 2AJVL 2I7OA 3DV6A 1HINL 1OM9A 2F7OA 1HEZB 4KI5D 1NOFA 4GEJA 4PRPB 4YHYB 3ME0A 1SXZA 3G6DL 2G30A 1KJ3H 3NGBB 4PRNA 1JWMB 4YO0B 4MTMA 1MRFL 5JYLA 2WNGA 2XWXA 2IDTA 4PV1C 3LEXA 4N2NA 4IKKA 4WWNA 3CLEL 3PWLA 1CFVH 1NDTA 5C0CE 1JPEA 2AV1A 5DD5L 1UKTA 3CFBB 5T5FH 1RPUA 4CL7A 3MV9E 1P4IH 4HAFA 2J6WA 2HVBA 4HKJA 4UQDA 5HYJA 4PB0H 1ONQB 3FH7A 2WINB 4JFHE 4IRZA 2ZF9A 1UH4A 2XIDA 1GW6A 4J7RA 4OF6A 4P46A 1IKFL 1LL1A 2HJFA 2XA3A 5ESQA 3INOA 4GUPA 1CD1B 1FNGB 1I75A 2VW7A 5D6DA 3IPEA 5EN2A 3VWKB 1DP0A 2JELL 2O5XL 5CIPA 3T4YB 3CFEB 5EEVA 1X7QB 2VYRE 2A9ML 4W93A 2R29L 5B21A 4X6EA 1JN6B 2NNAB 2ZAIA 3M45A 4EZMA 1G9HA 3BH9A 3WE6A 1SVCP 1T0NA 1T21B 2XNAB 32C2A 4JVUA 2MCMA 7CGTA 2Y07L 2OTWB 3X12A 2COVD 4FQ2H 5GS2D 1M6OA 5EZIH 3K6IA 1ZA6B 3S98A 2X3BA 4DKDC 5DS8A 3TF7C 5D8JL 5K33A 3F7YB 4HS3A 4MDJB 1I7ZB 2V5MA 3DYMA 4D2NA 3L3DB 1DVXA 1S9WA 1QQDB 2EECA 3RDTB 3WFBL 1VFAA 4XVJH 3GSOA 3B8YA 3QZNA 4XCCL 4TQPA 1AXTL 1WO2A 1OP3K 1FHNA 2CGZA 1SHMA 3MV9D 4V33A 1OTSC 3OXSB 2WZPA 4FQPA 3ORJA 1O6SB 4JFHD 4LHUB 1KGXA 3T09A 4E2OA 5EH1A 3T2QA 4PJIA 3N9GH 3ESOA 2HVKB 4A67A 3KL5A 5FHAH 4AZ8B 5GSVB 3EJUA 3P4OA 5TDNA 1NCHA 4H13C 2ERJB 4XPGH 3RILA 2DYRB 1R0AL 1KFGA 4L3EE 4BINA 4DEPC 4POZD 4DKEH 3MGOB 5EBGA 4XO3A 2V7HB 3S35H 3RGVD 1IC5H 4KNTA 4AE0A 5DXWA 3MCG1 3RLSA 3QP3A 2PNDA 4QWWC 2QGBA 4LL4A 4R90H 4WW2C 3HZKB 1VFOA 2G60L 1KYFA 1WZLA 5I16A 4UNVA 2WQXA 1CLZL 4WTZG 4G7VL 1JNLL 1TZAA 2DYPA 3HZ3A 3GSWB 3ZMEA 4WGWB 4Y16C 3VRIB 1T1YB 4E9LA 4HWBL 4JFQB 4QLWA 5IFAL 4AEIL 2VXUH 5J1AB 5CBEA 4XMPL 3X3FL 4CC0A 1RZGB 2WJ7A 3FCSA 2FCBA 2JJTC 2VMJA 1NGZA 2FRGP 3ABGA 3L5XH 3QJZA 4EOWH 3CIQA 2YPVL 3SB3A 5KS9A 4ECNA 5KSUB 4XWOC 5GGQH 2P28B 1O7VA 3HG1E 4AIEA 5GJSL 4F20A 4JE4B 4LP8A 2DLGA 4Y9GA 4L9LA 1X5LA 3BP4A 4BZ1H 3LRSA 4PRIE 5DFVC 2AKRB 2BO0A 3LH2L 2Y6SD 2X9YA 3KM1A 4FQLL 4PBVC 1X5JA 1AJ7L 4Z7VF 4HUVA 1ZJAA 5C8JB 2QZQA 3CTTA 2QQLL 1Z6JT 3R4RA 4CC1A 3FQ2A 5IMLB 4B9GA 5GRXG 4W1TA 1KENH 1GOFA 1TVBB 3C5ZA 3H6AA 4WRLA 2H1PL 4OJFH 5BOJA 4HIEB 4OZ4B 3VW3L 5I9QB 3EJJX 2VDMH 5HGHA 2CIIB 3ATDA 4N8PA 5F89A 9CGTA 1KNOB 1ZXQA 3ARYA 4G6MH 4G8GA 1KBBA 1MWAH 1KEML 1KXTA 2R69H 5CLYA 3N44B 4Z95H 1NCCL 3WEXB 2UXVA 1IAOB 2N1TE 1XGUA 2F5AL 3JZYA 2PXYB 2IDUA 1XEUA 1ZT1A 3QULA 4JCMA 4O02L 2NY3C 3L4UA 4JRXA 1KB5L 1E40A 3ECWA 3FU8A 3FT2A 1PJ9A 5DS1A 3HBQA 2QHRH 1DDTA 1FN4A 5IROC 3TNNA 3QRGH 2W88A 2CKBA 4JMXA 3KPRB 4JJ5B 2JLPA 3G9VA 1G87A 2IFFL 5DEFB 3F58H 3QIUD 4YSPA 3VQ1C 1RVFL 3AQZA 1AVAA 1X9UA 1ZV5A 5L2KE 1A4JB 5IBUB 4CN4A 1CGTA 2GJ6E 3IDJB 3N42F 4MA3B 2CIKB 1UM6L 1R6VA 4Z0XA 5B1AB 3WTWA 4UT6H 4YZFE 2BFVL 4OZHA 3U7AA 1RIUL 2VL4A 4Q9QL 5I0YA 4WK4B 5KVDL 4OZGB 4Y7MA 4X7SL 1X44A 3QEUB 5CINL 2R1YA 3RURA 4AQ8A 3DUHA 1SJHB 2HKHL 3IJSA 3ZKSD 2H3NB 4AGNA 3DO4A 5GJTH 3CC5A 1Z9OA 2H32H 3H9HA 3OHXA 3MO1A 2MH4A 4A6YH 1UH3A 3BQUB 4L8DA 1REIA 4R7VA 2M2DA 1RI8A 1RJZB 1UVQA 2A2QT 4TVUA 1G6RL 3APMA 1FFOA 4YLQT 5DJCA 2QQNH 3VXRB 4BFIB 5JW3H 4OIIH 1KT2A 1M2OA 2DQMA 3VXNA 3UCRA 4AGQA 1BD2E 2XA8H 4P9HC 4KH9A 5EF1A 4YOKA 2OMZA 1CICD 1NM4A 4CSPA 3RA7L 3QWRD 3OGOE 5JPNB 4F57H 3RY6A 2ZCLH 3FO0L 3TX4A 2XFXB 3MV7D 4D9RD 2XWTA 2O61B 1DFXA 4GO6B 4QHNB 1E6JL 1S7RB 3BP6B 3P30H 1YAIA 4ZAKD 1DUYB 2RA1A 1NFAA 4XOAA 1K8IB 4K3EH 3INUH 3KLKA 4IRSA 4JN2A 3HUJB 2VDPL 4P2QB 5IB3B 4HS8L 5E6YA 5FGBC 1JDDA 5CCJA 1P84J 1EJOL 2F54A 2EH7H 2I9TB 4G1EB 5A2LH 4OD3L 1PD6A 1YPZE 3NZHL 3MBWB 4HD5A 1U3NA 1S5IL 1JFHA 4YNYA 1KPUB 1NMBH 2AQ2A 3V6OE 1YAZA 5MEND 3VTAA 4MAYB 3G5YB 5IB2B 3QJHA 2B77A 5F7WC 5D2LB 1XSJA 4KROB 2ESVB 2H26A 2Z7WA 3MLSH 3QG7H 4WNQB 4GT7A 4PJCE 2X0UA 4B41A 4G6JL 1YEIL 3AWGA 4YHIB 2GFBB 4U1SB 3BWAB 4HK3N 4IK6A 1JMZA 1VGKA 4Q6IA 4WWKD 4JBSA 1OGAE 1T1WA 2MPAL 3BW9A 1ZHBB 4JRWA 4WEEA 1ETA1 2AJVH 1HINH 1HIML 4XCYA 5DQ9B 4LP4A 2PW1B 1WA1X 4NN5B 1OIOA 4XN1A 2NR6A 3G6DH 4MMXA 2D2CC 3D18B 1CYGA 4ZPVB 3I3DA 1QA9B 4BHUA 1IU1A 1OAQL 1YVLA 2ALWA 1MRFH 4XWGL 4YZFF 5F7UA 2NY1D 5ERWA 2GHZA 3WHXB 3VMOA 3WXWL 2GUOB 2Q3ZA 1NCIA 3CLEH 4MDIA 4NQQA 3WUWA 4CVWA 1U21A 5EEXA 2V9QA 5IGXL 1ZHNB 4P07A 5AW7B 3O6ML 5JHDB 1VACA 1C7TA 3Q8CA 4V1DB 4KZDL 3Q2NA 4Y4HD 3UP6A 3RWDA 3HIZA 4DZ8B 5HHMD 1CQKA 2ZUXA 1IKFH 4PG2A 5IQOA 4JY5L 2FX7H 3TBCA 3V4VL 3NYKA 4JG1H 2JELH 2O5XH 4LCYB 4AK2A 1F56A 2BP0B 2A9MH 2R29H 1CR9L 4HIJB 5I0WA 1JYVA 3DJZA 1A47A 3D0VB 3IU3B 3WNMA 3ZW3A 2A74B 2Y07H 3CZLA 5BO0D 3RUGA 1PY4A 5J3HC 3BGMB 3ARDB 5E1GA 5EZOL 3BP5B 1NKOA 3TV3L 4E9RA 4MDRA 5SWQA 1IQWL 4FNLL 2JI1A 4U1JA 5D8JH 4G2AA 3SCMB 3VGAB 1XCWA 4PVBA 3HMXL 3NZ8B 4AQ1A 3K6SB 3QQ4B 3VWJA 7TAAA 3RB7A 3WFBH 1YPZF 4MWFB 3MV01 4XCCH 3CZSA 1DQML 2WNKA 1AXTH 1QABA 3QH3A 5J6SA 1OK8A 5KVFE 1CLCA 2HLFC 3UTSE 3VI4E 3TV8A 4PVLA 3CX5K 1ND0A 1RHHB 1VSCA 1J8SA 1R75A 3ARGB 3WMPA 1E3FA 3VAEA 4GBXB 3UGUA 3WHE1 1F3JA 3KYOA 2MOQA 4POZC 3UPRA 3BC9A 2GJRA 3EBHA 3PDGA 1ET5A 1OLZA 1R0AH 3LD8C 4CA4A 1QR1A 3U9PL 1E2WA 3OKKA 4TNVK 5MEOA 4YK4B 1U8OA 1OO2A 3B6SA 3QT2A 3MA7A 3RX5A 4EUPB 3JV4B 4JK0D 1OP3H 1P5UB 4PUBL 1J8HD 2CO6A 1DN0B 4BWUA 4HX1A 2VDRB 4BFBD 2NCMA 1TTUA 2AXHA 1T5WA 2J6EA 4HEMA 1A6AA 3OJVC 4NZTL 4YL9A 1JE6A 1TQBB 1CLZH 4CNIB 4G7VH 5J5EA 3TYGL 1FV1B 5IF0A 3JT2A 4O2FA 1JNLH 3DDFA 5JDSB 2X70A 2XVKA 4JL2A 1ZOXA 3M86A 4P4KD 5IVOA 4HWBH 4DP0X 5IFAH 3PUCA 4Q8BA 4AEIH 3DI3B 3GRWL 5HDQL 3MLPA 1UZ8A 1OB1B 4QTFA 4Q56A 3AM8A 4XMPH 1A1NA 2BSRA 3X3FH 3RFZC 4X9YA 4PRHB 4GRLB 1HWHB 4L9DA 4Z78B 1D5RA 1E5AA 1I8UA 5DEGB 2YPVH 1BG1A 2XV0A 2C3XA 2X4TA 3OBAA 1OL0A 4UM9D 4BKTC 4A04A 5GJSH 5LCVA 5IM7A 4OUOA 1OWWA 1V3LA 2E8YA 4C4KT 1ORQB 2WKOA 4R5XA 3HR5B 1OGTA 1UB5A 2A0LC 3LH2H 4H1LB 4NO0D 1F8TL 1LO5B 1WBZA 3PU7A 4FQLH 1AJ7H 2JCWA 1XIWA 4IU2B 1JOIA 2J8OA 2QQLH 2WBWB 3S4SB 4I2XB 1KCSL 5IV2A 1INEL 1M9WA 1J18A 3A0OA 1KY6A 3JVGC 3AAZB 2H1PH 3MROB 4A7TA 2FATL 4PJ7E 3VW3H 2P42B 5T1LB 3CMOH 2EYSA 1THAA 4PGEB 1SPDA 5HPMB 1KEMH 1GAFL 4HCRL 3QDGA 3V4PL 4BFOA 2DQJL 3US1A 5B39A 3VI4F 1BLNB 4QRBA 3S5ZA 2VMEA 3QQDB 3S9DB 1NCCH 1S5HB 3AREA 3PWUB 2F5AH 4MGXA 4O02H 5I8KL 1VFBA 4LGRB 1MCPL 4S11A 1KB5H 4LEOA 5K39B 5KYUA 4F7EB 5IOPB 2EINB 1BZ7A 4FI8A 5D4JA 2GYSA 5F1SA 4Y9EA 5DEJA 4TL4A 4U33A 5CNHA 2IFFH 3FRPA 4KJYB 3LQMA 1RVFH 1UA3A 4PJHA 5BQ7B 3WY4A 4W9KC 1JNJA 3CQQA 3NN8B 1VAHA 5KBMA 3V55A 1AGFB 1QG3A 2JMRA 4R5TA 4Y7OC 4XP4L 4FQQA 3AUVA 4U6YA 2Z4TA 1UM6H 5C9JB 1I9IL 4OJAA 1PZBA 4NO2B 3ETBF 4QRAA 2BFVH 2BVUA 3C6SA 2VOTA 1RIUH 4MS8D 4Q9QH 3QXVA 1S7TB 5HYJD 5KVDH 4JFFE 1KDIA 1SYSA 4AQEA 2BSSA 3FSAA 4QHUA 4X7SH 4P46D 1QTPA 1D5ZA 4X83A 5CINH 1OEZW 2ATKB 2ZKXA 5IB4B 2HKHH 4PRAB 5HD8D 3UL4A 2NSMA 3PYCA 1MRCL 4X5WB 5JIDA 1HI6B 3MBXL 4X8CA 4JKKA 5DTFB 4XI5D 1CE1L 2BCKB 1CICC 1D5IL 3SPCA 1G6RH 3J27A 5I6LA 2ZXBA 3TS8A 4K8RD 3VFVB 4R7DB 4GRWF 3KPQA 3RZCA 3VI3B 4M00A 4F9LA 1E5BA 3H9ZA 2ZKWA 2FECI 2VQ4A 2DJSA 2V0AA 2B9AA 3L3KB 4ZAKC 3RA7H 3TEYA 3PDDA 3E1ZA 1P6FA 3FO0H 4WK2B 3FH5A 2P1YA 3ATFA 1E6JH 4E9WA 1M53A 2HG5B 4C56A 2X1XR 5C6WH 1PMYA 1BXVA 3SY0B 4XCFL 2OXGB 3P0GB 1W72B 3SDCA 4FCAA 4AYDC 5BVPL 1PG7X 4HLJA 3MRNB 1RUML 2VDPH 4QRSA 2UZIL 4HS8H 2VDLL 5HJDA 3STLA 1EJOH 5H2BA 3H54A 4OD3H 4S1SL 2WZPD 5AAWA 2IGLA 3NZHH 5EU4B 1DDHB 4IOIA 4GIPD 4I1PA 4L3CB 2VXVL 4MJJA 4PJXB 1S5IH 2PYEB 1FO0B 1YY8B 1KTRL 4LGPB 2HKAA 1NFIA 4EIUA 2WXGA 2AEIT 3OB8A 3LKSA 3RIAF 5I82A 1GGCL 4WWKC 5E8EA 1S7VB 2EQDA 2QPDB 3VXTA 5HVHB 5HDOA 2QKIC 3ZE1B 4FXGA 5KVMC 1IVLA 5KSVB 3B2UC 4G6JH 1YEIH 2NYYC 1AHWB 4JREC 4HGMA 5DMGC 5C0BB 4IKLA 5I1HL 3GHEL 3SDAA 4OFIA 2MPAH 3BLBA 1LTXA 1RZPA 3DROA 5EMYA 1CFQA 1HIMH 4YS4A 4CSTA 2NY1C 5KZCD 4K15A 4ZUWA 5EF2A 4AV4A 2KL6A 3LRHA 3PGFL 5F0PB 4YBLC 1CXLA 3EH3B 3ARZA 5JHLA 4XWGH 3DX3A 1AGBB 3JYCA 1G0XA 3CVHB 1ZA3A 3WXWH 2DYPD 3LV3B 4M8QB 4RESB 1NIAA 2UZXA 4H26B 5E0FA 3ZXAC 4ZMOA 5LQBH 3LQZA 5F44A 1GZPA 4OD2A 4Y4HC 3TN0B 4ES9A 2BNQB 4G9DA 5IGXH 2XG5B 4PR5A 2CLZB 5I6XC 3O6MH 3VDBA 2J71A 1R3KB 4JRXE 4PJIF 4CGTA 4KZDH 3QC6X 3RIFF 4AYBA 5L88L 4BSWB 2DF3A 4JY5H 2Z4QB 2ZXWB 2W65B 3H2PA 3L2NA 3V4VH 3KYNB 1R3JB 3H7BA 3KMDA 1CR9H 1A2YB 1T4WA 1WRFA 3N0PB 4QJ5B 1KELL 3OLDA 5ABZA 3BPCB 5I6PA 3C5ZD 5EZOH 3VNZA 3TV3H 4LHQB 4PP2B 1IQWH 4FNLH 4GW1A 2Q9OA 4YDZA 3RB5A 4I0PA 2XDHA 4G8GD 2ARJB 3HMXH 2WP3O 1TDQA 1UXWB 4LHJB 2VUYA 3APFA 1HN1A 4GXFA 5JA8B 1KC5L 2K3HA 1IM9B 3FTUA 4OF5A 3HAEA 5DRZB 1DQMH 3FHEA 6CGTA 1K5WA 3RVXD 3FUKA 3TTSA 3V0GA 5I17B 4JRXD 4J39A 4AUUA 4XAKE 2WUBL 1XCXA 3SYQA 2FLMA 5AG9A 2Y7NA 4WSKA 2NQ3A 1JBJA 4CJ1A 4I3GA 1G6VK 3L5IA 5LXGL 2FL5A 2CO2A 2V17L 3WJJA 4AH2B 5E23A 4WTQA 4FNSA 4YXLL 2BP8A 3HRZB 5BVJB 1EJFA 3GMOA 1HXMB 1R5IA 3QFJE 4QUOA 3UDWC 1LP9E 3LNEA 3ZDXE 5E2VL 4F91B 5IVXA 3BEWB 5B3NA 4RDBA 3U9PH 5DHXB 4AXWB 3U48A 2GCYB 4JGUA 2KZ1B 1E4HA 3IXTA 2EE2A 1DVFA 4PWEA 5EIIG 5D93B 4XN9A 2FJGB 4PUBH 2HT4D 2DMCA 4GI8A 2F54E 1A4KA 4TL5A 3WNNA 2OPCA 2WVVA 2EUZA 2K6YA 3FOMB 4FXLA 3OG4B 5EUOB 3KNBA 4NZTH 2FUQA 2BH0A 3QWOA 1HH6A 1YEJL 4JHAL 5DFAA 3TYGH 1R5VA 2DH3A 4HPYL 4LMQE 1J5HA 4XAKD 5B4MD 1U8JB 2OMVA 5EU6B 4DQAA 2FIKB 5DJYA 3GRWH 5HDQH 4Z1PA 4ODUB 4LB8A 4EDXB 1EHKB 5JOFB 3NABL 3NIFB 5IIEB 4MNQA 1CFTA 3PJSB 3QUYC 3GO1L 4H0LC 2YOCA 3S6CA 4YDKL 3DGCR 2Q76B 3RWJA 4UCFA 2VN4A 2PP9A 4XZ4A 4H40A 5E2JA 1ZWIB 2X6BA 3CFDA 3DVIA 1N67A 2Z35B 4M6NL 1ZVYA 5A2FA 3IE4A 4Z7AA 4LSSL 1X7TA 3DO3A 1F8TH 2QGDA 3IGKA 3RWIB 4IRSD 2VTFA 3UH8A 1DVSA 3P3RA 4Z23A 2WLLA 1KCSH 3Q8FA 4JM2B 4F93B 2LFGA 2F54D 2FWOB 5EU7E 4XXDB 3QRFM 2FATH 5D71L 5ANHA 4HIIB 4NQSA 2KMWA 1H6EA 4R4FL 3SYOA 1BFVL 1V3KA 4NQUA 1GAFH 1TNNA 4HCRH 2YJLA 3CPLA 2NY7L 2A6KA 2DQJH 3V4PH 5GS2H 1BA9A 4AIXA 1EJ8A 1X5KA 3MJ9L 4FEIA 3WJLA 3EXJA 2VDQL 1QI3A 2XACC 5I8KH 1G7LB 3O11B 1VZIA 4ANXA 1MCPH 5T8IA 3K6NA 3U4EB 4NHUB 2C3HA 4M5ZL 3ILPB 3VFUA 1PDKA 2L0DA 5HI4C 1FSKC 2ZKMX 3SO3C 3F8UB 3ZDXF 4HU2A 2HLEB 3MA9L 3MJ7B 2NR6D 3LEYL 4L1LA 4AGOA 1J0KA 5HXMA 2EP6A 4LOEA 4OVUA 3PV6B 3RL1A 4NIYE 3O4OC 1M7XA 5F1KC 4G11A 4MD4A 5GRWA 1MAML 5E8OA 4XP4H 4CW1B 5LBSA 1E5UI 1FL6A 1I9IH 4WU5A 3QUML 5HHNA 1GCFA 1A14L 5F0LB 5F1NA 4Q2ZA 5EBWB 4ZXBC 4KRNA 2X42A 3D05A 2H0PA 4L4VB 1I3RA 1OP4A 1BQHA 5EEWA 1F4HA 4UTAL 3WNIA 5D7LB 4UV7L 2XN0A 2UY7B 2DL9A 1OAXL 4XI5C 2YARA 5HDBE 3TP4A 1FYTA 1RL1A 5IHZB 3F7KA 1M7DB 5TK4A 4WEUD 1I8KA 1GW0A 2XPZA 1ZJBA 1MRCH 1LWHA 3ILDA 4K8RC 4X9GA 5M7QA 3MBXH 4YIQB 2K78A 1CE1H 5E2WH 1BF2A 1D5IH 3Q0HA 1OALA 5GGRY 1FG9C 3U1PA 3IDNA 1U6AL 4FXKB 1BEXA 1XF3B 3I85A 4OD1L 4F7PA 1PLBA 2DMBA 4HIPA 3IU4L 1XH3A 2XYCA 1HCYA 3D39E 3P73A 3BX7C 2QDVA 3DSNA 2FD6L 5E70A 2ZCKL 5LN8A 4OKVA 4XCFH 2YEZA 3VWJD 3ZKND 4ERSL 5TGBA 5BVPH 4HEME 1RUMH 3FU7B 4LL9A 2UZIH 3QR0A 3HZYA 3FZUD 2VDLH 3TO4B 4WF7A 5FO9B 1O0VA 1X9QA 4M7JL 4W9LC 3PHQB 4FFVD 4EI5C 2GIYA 4QTIL 3W1ZA 5LAXA 2WVUA 2VXVH 2H0JA 3FHQA 3KWWB 4AIZA 3TFKC 1YEFL 2C3VB 4LPTA 2A1WL 2IH3B 3MRPB 5DDHA 3BRDA 4FABL 1NICA 4Z7QB 4XP1L 5EOCJ 4HDIB 1GGCH 4P2OA 4BBWA 5A6LA 3EJQA 3JTTB 4Y1AA 2Q20A 4Y19E 1W0YT 4NI3A 3VCLB 3NSYA 5I1HH 3RUGF 3GHEH 3CFJB 1GSMA 4OGZA 4N25A 1T03L 1JFQL 4MHHG 3G08A 4UDUB 2XXGA 4H8VA 3X1EA 4HBCL 3HS9A 4NFBA 5ESAB 5IB1B 4OLUL 4Y89A 1AD0A 1YUHB 4WUUB 3PGFH 3QUXB 2YFOA 3BVVA 1SEBA 2IPKA 2CXKA 5FM4A 1H9VA 3F83A 3KW8A 2GK0A 4G82A 2YD8A 2ENPA 3UAJA 3ARVA 1AOZA 1DUZB 5I71B 5KUKA 1S7QA 2F8IA 4KPHL 2I27N 2B5IC 3II3A 4PP1D 1UT9A 5I76A 1KCUL 2EEAA 2VMDA 4MFHA 1U58A 3PWPA 2W8CA 1VF5C 5C0DA 3L3HA 5L88H 1EJ6A 4OQTA 1FAKT 1HHIB 3EOBA 3CVIL 3DTXB 3EYOB 5DUBA 4KX9A 4KU1A 1QR4A 1R3HA 2A73A 1I3VA 1S8DB 4MJ4A 1OQXA 2BXYA 2D73A 2YOAA 2WB7A 1OAUL 1E7UA 1XIWD 3KVDD 3L3OC 4G7YL 4IRZL 4RGOL 3LZNA 1KELH 1TEGA 5AYUL 2UY6B 2CH8A 2YN5A 1YYML 4RA3A 5HHPA 2CDGB 2OSYA 4B97A 2ADGA 4K07A 4LLYA 1H3TA 4X6DA 4ORZC 2HUEA 4HJ0D 5E24E 2FZ3A 4ZNEE 3K8MA 4AZUA 4IW4C 4RMQA 2QSQA 3ARRA 2G3NA 4N4YB 4AMXA 3VYOA 2Q0ZX 4K8RL 1ZXKA 1UUSA 2ZX5A 1WC7B 3B5GA 4N2CA 3B83A 3BWZA 2E9JA 1F4XL 3C60A 3QDGD 4GW4B 1KC5H 2NX5B 3RIFK 2NY6C 5DRXB 3QORB 2Z3FA 4DKFL 3SYPA 3KPTA 3ARED 3ZDZE 2HKFL 3D09A 3H3KA 4S2SA 1ZV9A 5GSRB 4BQ6A 1E9OA 3QZWG 3MX0B 3ECVA 3PWNA 1DJXA 1U4FA 1BJMA 2WUBH 5D5MA 1T04A 3AGWA 3REVB 3DARA 1XGQA 1MHHA 2XTJE 5F71A 2CHWA 2RJMA 5LXGH 1ZLVK 3TBYB 2V17H 1JZEA 2WKOF 3L2LA 4XX5A 5EC2B 2O6DA 1NGXA 4YXLH 2OR9L 1CK0H 1ORSB 3B56A 1D2OA 1OLLA 1MFAL 1W16A 5E2VH 3L8QA 3APCA 4QT5A 2ZXAA 1QPXA 4JRYB 2HT4C 5EOTB 4PRBA 1PKOA 5H4YA 1HHKB 4AQ8C 4NZFA 5GRVL 3VD7A 4IBLT 3LKQB 2JKJA 1NCUA 1P4BL 3UIYA 3KJ4B 4PGDB 1YEJH 2WANA 1DVTA 1UB6A 3CIAA 4D9QD 1B4RA 2G2RB 3D0LA 4HPYH 4QRPB 3DVNA 1KLUA 2YKKA 4M02A 1U91B 2W07A 3DBXA 1ETZA 4FKEA 3O6FB 5EU5A 4KKLD 5JOPE 4NPYA 3IFLL 3NABH 2HMID 4QO1A 3RZCD 3P54A 5CZRA 3GO1H 4Y9FA 3DJSA 4YDKH 4X4ME 3SGDI 2LV4A 4PJHF 4W9GC 5HJGA 1EV2E 5FDWA 3HZMA 4QJ3B 1BQUA 4KY2A 3BZ4B 1XXFC 3MNWA 4M6NH 4LSSH 4C56D 3RKDD 4K71C 3SDCD 2QPSA 4M43L 5FS5A 4RNRA 2VLRE 1WIPA 3OKNA 5AVRB 2FSEB 3RI5K 2F7RA 2K6ZA 4IIQB 3TBWA 2KKQA 5ID0A 4MASA 1J5DA 4X8JA 5D71H 2VMCA 5I2IB 2NNXA 1D5MA 4QD2E 1XF4B 4R4FH 4G5ZL 1BFVH 4DPBX 3X14B 3M17A 3GS7A 2WGXA 1HSAB 1Z5LB 4WI5A 1PG7L 4FL4C 2LE9A 5E6IC 4DUXA 4G8EB 2NY7H 2BZDA 3N85L 3G3LA 2EUVA 4IMLB 2B1OA 3MJ9H 5EO0B 4DFIA 5JOPD 2A6JB 1JSYA 5CEZD 4E36A 5EO1B 4JX0A 3VB9A 1EWHA 2NR6C 3MMEA 1MWOA 4M5ZH 3SDAD 4F3FB 2UZYA 4MMXC 5SX5K 4RWYL 1VEPA 5EHFA 1JPSL 1CL7L 3TZVA 2GITB 3MA9H 1F42A 3LEYH 1EHXA 5EU7C 1F02I 2FSDA 1V3JA 2WSPA 1J87A 2B20A 3HS8A 4OJYA 3SPVB 4TTGA 5J57B 3S88L 1AO7B 2CKBL 1MAMH 1V54B 2J44A 1ESOA 3BHBA 3GSVB 3OKEB 3NFPA 2BNUA 3QUMH 5HJBA 4NCC2 1A14H 1P7KA 1HL8A 2ZSWB 4RGMC 1NBCA 5FKAA 3GIZL 5C3TA 4DP7X 3IYLW 2YA2A 4PG2C 1FVDB 3MRCA 1WQVT 5IZ7A 4ZBJA 4HW6A 4KOCA 3RWCB 2B1AL 3ALWA 4UTAH 1MIEL 5F3BA 4UV7H 4JQVA 1OAXH 4APQB 1FFPA 4ZS6C 4NBZB 3ROLB 5ACMA 3MREA 2QLYA 1RK1A 3M8OL 4AL8C 1JZGA 1CO1A 1XSOA 2AJZA 4HJGB 3VVWA 2Y6TE 3IDYB 2IAMA 3MKGA 2BHUA 3GLZA 4KVNL 3GSNB 4F8OA 5H35A 4OD1H 1SM3L 3ARBC 4UAOB 4LARL 1SUHA 3IU4H 2WQAA 4TUJA 3VWJC 4O4YL 3ZKNC 4BK8A 3CZNA 4I0PD 4ETQA 2W91A 1R46A 1D2PA 3SDYL 3M1BA 2FD6H 1R24B 2ZCKH 3FZUC 4H44C 3CHOA 2IV9A 1KYUA 4ERSH 3QXWA 3TA3B 3F6IA 1JZHA 2DWDB 2QSTA 4J3OD 5HDRA 5B3SB 3DX7B 1H15B 5F2FA 2EXYD 1ZVSA 1P84K 3V7MA 4M7JH 1OVZA 3QDAA 3AGVA 2CMRL 2SODB 2BVEA 4QTIH 1MFNA 4KKNA 4E41A 5DHVA 2WV3A 3FFCA 1CDCA 4JPSA 1G43A 1YEFH 2A1WH 4OZFB 4KZ0A 4MNQE 4A2DA 4FABH 1W8EA 3O9WB 4JKNA 4XP1H 5CUSL 1JTOA 1SGKA 2WTRA 3I9PA 4OGQC 4YDMA 2O93L 4UOQA 4MAUL 5T1KA 4MA7L 3ZYIA 2JKTM 5GZNC 2E7LC 5DI8B 4U3HA 1SJEB 2FT6A 4HISA 4CU6A 4H8WC 2KYIA 2R0KL 4GSDL 3WS3B 1LMKA 3ULAB 2BIQA 1T03H 1JFQH 1DVFD 4Y5VA 4R4ND 1B90A 3NACL 2HX8A 2FR4A 4HBCH 1WPCA 1CCZA 4OLUH 5T1MB 1SDYA 4NT6B 4ELMA 1ULVA 1JZ7A 1AACA 1LVEA 4FKKA 5AYTA 4OCXL 4S1QL 5CFHA 4J3OF 4PP1C 4OW6A 3MRGB 1F13A 4GRWH 4UQAA 5IQ9A 4LSUL 1J88A 3BUPA 4HS6B 4PY7B 2NUTA 3W9EA 4KPHH 5CILL 3UYOD 1KCUH 3RVTD 2W59A 1KIPB 5INDB 3COOA 1FCCA 3F7QA 4MNQD 5DSCA 2P7TA 4F7KA 1MI5B 5AVUB 4G80B 3BZEB 3P4NB 2VWEE 4LCCB 1FNSL 3FQWB 1XIWC 2OQJB 3CVIH 1YY9D 5IVXF 3GMRA 1BIHA 2E56A 3QO0A 1IBBA 1OAUH 4G7YH 4P9ML 4HJ0C 4IRZH 4PD4K 3WCYA 1JVKA 1OAJA 5D2NA 5CP3A 4RGOH 4QIRA 1ZPUA 1JGDA 3D7PA 3PNWA 4O51A 5AYUH 5KVGL 3E80A 1YYMH 3DO7B 3FK3A 3F05A 5FA4B 3GXNA 5CIPH 4P2RA 3ESVF 3B3BA 1A9BB 1A0QL 5KYYA 3IE9A 4K8RH 2G5UA 4K94L 1S7SB 2NNRA 4MB3A 1F4XH 5CEXB 4DKFH 1CXIA 3KPMA 3O81A 2E86A 2HKFH 1GMIA 5GHWL 3VTMA 1HDMB 7FABL 3RPIB 2FT7A 3HC2A 2FNBA 2P5WA 1IC0A 1NOLA 5A2IH 2X41A 4D8PA 5EZJA 3FNKA 4N0RA 4XBPA 1F97A 1TJMA 3PFQA 5GS3A 3G6AB 1E42A 2BVPA 2Q7YB 3RDTD 3EH1A 3L6FA 4ZX5A 2OR9H 1PX4A 2QGEA 2MMXA 2OMWA 4GXVL 3FQUB 1MFAH 4L1BA 4UMGA 1R4XA 1QWUA 1Y07A 3OC8A 3QHFL 3AABA 2ADJA 4L4TE 1LE9A 1Q9KA 3ZKXC 3DRQB 5H37A 5EOQL 3RFRA 1N59B 1ZSDA 3OKOB 4ODWA 2NW3B 4QKTA 4OM1L 2X44D 3MLYH 4OTXL 3V4LA 3VXSB 4YSUA 4TLTA 2Q86A 2NLJA 3GGWA 3MRFB 1KYOK 4LLMB 3JVFC 4U1MB 3SYCA 3VXMB 4N3UA 3K91A 3UBXA 1P4BH 2XTJC 1FYTD 5CHNA 1IAKA 4KKLC 1S9XB 1RV6X 1ZLVH 5AW2B 3RZCC 4QGTA 5KBKA 3BVDB 2C9VA 2PO6A 4Y5XB 2AITA 2J6EL 5AZ2L 3KPNA 3GRGA 1MPAL 5AAPA 1DL7L 1C5BL 2HRHA 5DD6B 3WO4B 5I1KL 3IFLH 2EYRB 3A24A 4Y1AE 3ZIMA 5CJ8A 2VGLM 1DFBL 4XXCC 1JGEB 3OMNB 4KZCA 1BZDA 3RBGA 3RKDC 2EDXA 3SDCC 4BM7A 2P5EE 1MJJB 3FB6B 3C75A 1CG9A 3U79A 1R1CA 2HFTA 4UU9A 3VX0A 3ROOB 3V0WL 5AAWC 2ZIDA 2EDRA 3FT3B 4M43H 4RFNB 3KL0A 5D1XE 5DD3L 3RNKB 3BFWA 3GINA 3BT2L 3MI6A 5LCVL 3HBPA 2E5EA 1NIEA 1ZHKB 1TO5A 5ACZB 3QI9C 1FG2B 2Z93B 2VERA 5DUJA 4G5ZH 1XEDA 4FXGC 5F72S 1PG7H 2Q8BL 4LRIC 3UYPA 3N85H 3PWPE 4G7QB 3ZDWA 1U8MA 4Z3FA 4P2OD 1EBPA 1NCJA 3QAZC 1Q38A 3D48R 3FUHA 5D6CB 3F65A 1UD4A 2FYYB 1E27A 3L9YA 5DLLA 1J11A 1I7RA 1JRHL 1AYOA 2B59A 3JWNC 2Z31C 3ZR5A 4RWYH 2F7PA 2JIXB 2VIRA 1JPSH 3OMZA 4P5TA 1CL7H 3BCFA 5AG8A 2BSEA 2K3TA 3C5JA 1QUNA 1UOKA 4L29B 4YDLC 4ZDHA 4ZFOB 5E8NB 3ZZLA 1OF2B 1YQVL 4LSRL 1PCSA 1QZNA 3P9MB 2KI6A 3CX2A 3GTNA 3S88H 1NC2B 3UBGA 3D3VE 1FL5B 2CKBH 1SOSA 3UAJD 1WBXB 4I0KA 5JIKA 5F88B 3TH2T 1TYRA 3DOSB 4QOKB 3CHXA 3D85A 3DMMA 2XKNB 1MHCA 3LZRA 4RETB 4GO9A 1IE5A 3GIZH 1XF5A 4ZZFA 3FPXA 3AT9A 3VB8A 2QADD 3P3UA 3PWPD 4RX4A 5B38A 1ITCA 2B1AH 2IBZY 4X4XA 1MIEH 3RWHA 3OAYK 4QYOB 5SWSA 3ZTCC 2MPVA 4XO8A 1BXAA 2ZSVB 3CSFA 1KJMB 3M8OH 2VL5B 3W39A 4M7ZB 3SKOA 2V5SA 3D34A 4PJBA 3BIBX 4KVNH 2BY1A 3NEOA 4I0PC 1JZ5A 1MWAB 2IXQA 2V2TA 3K71B 1SM3H 3B1UA 3ESMA 3G5ZB 1M56B 3I84A 4LARH 5GQBA 4MQTB 3B9VA 2R0WL 4FFTA 4O4YH 3MTRA 3C9NA 3EJYD 3O3EA 4ZW3A 4HUUA 1MJ8L 2P8LB 4JPVL 4ZJ9A 3SDYH 3AS3A 4NUQA 4FJ6A 3SIKA 3C60D 4Z3HA 4PWFA 1I53A 3VGFA 1KWGA 3FFDA 3ZR6A 4PS7A 4X9HA 2ICEC 5CR8A 3OB0K 2MHAA 4NQDE 1KLFA 1T83C 4GO8A 3HS0B 4QCIB 1QSEA 2CMRH 2WXIA 3ARFB 5C07E 1L3NA 2X4UB 3WEBA 1IGJB 3H9SB 1EHNA 4IEFA 3FQNA 2AV7B 4Z77A 1G7QA 1OOWA 4X42A 3WAJA 5CUSH 3U9UA 1KV3A 2YBGA 3W0WB 1IILE 4MAUH 2NY5C 1R5WA 4MA7H 5C08A 4HULB 4PJDE 2AEOA 2QBWA 1RQ5A 3I9IA 5FF6B 3WI9A 5E4AA 1DSWA 2R0KH 4GSDH 1QLEB 1B0RB 3HE7B 3LHPL 1M6UA 2XN9B 4X6DF 2XX0A 4PV8A 4N2BA 2WSKA 5JZ7D 2CLVA 3NACH 4XZUA 4B7IA 5E5RB 3RJOA 2E4FA 4ZO7A 2XN1A 1K3IA 2H32B 4A6YB 5CEZL 4M3JA 3PGCB 4NJ9L 2EDHA 4OCXH 4S1QH 3RVTC 3LJ3A 4G9FA 3VE0B 5C3IA 5EA0L 3GXMA 4LSUH 4D7PA 1AGEA 5CCKL 5CILH 5D5MF 5IEHB 3U82B 4XNUL 1MCFA 1YN7A 5AUMA 5JHLL 3G04B 1LO4L 3QZMA 1UADC 3LN5B 4WI7A 2BVTA 1G7JA 1DQLL 2Z92B 3PL6B 1FNSH 2I07B 3NA9L 2HFGL 5B8CB 3EO0A 2FIRT 3N1QC 2X4PB 4H25B 1QVOB 5B39G 2OX5A 4WENB 2DQIL 2CD0A 1AQMA 1KIQB 3BLKA 3UTOA 4DAGL 5KSBB 5KVEE 2CM5A 4HUNB 4P9MH 2CZNA 4BDVA 3DDGA 3BAIA 4KUCD 4ODHL 3VACA 4AV5A 1CGWA 3UAFA 1Z9PA 1D9KB 2ZWZA 5D1QE 5KVGH 1JI1A 4IGBB 4HIQA 3GNML 5MERA 5JXAL 3L7FB 1ERNA 2GPZA 2UY7A 3EKCA 4PV9A 1TEYA 1CDIA 3MRMB 5KANI 2CJ3A 2PETA 3FRPG 1OAYL 2LVCA 2VLLA 3QXAB 4X7TB 4CU8A 2J56A 4K94H 2XTLA 4FAAB 4FQXA 4GG8B 4PYHA 1AMYA 2QV4A 1M71B 1XGPA 3PXHA 4CC4A 3RPKA 5GHWH 2OMNA 4WFGE 2X53A 1E90A 7FABH 3QIBB 3K8LA 2WZAA 4N0CD 4NLAA 4XCNB 1HZLA 4ODBD 1T7YA 5M94B 3O41A 1YDPA 2IALB 3CFTA 4HALA 5IR1A 1GHFL 3TZVD 3H85A 3AZUA 1QRNA 3H0TA 5J6GA 3MNMA 2Z8SA 4FNQA 4ZSOA 4GXVH 2OZNA 1TJHL 1VZGA 4Y9BA 4BUGA 4KUCF 4Z7NF 4ZNCD 4LSTL 1T0PB 3LKRB 2YUWA 3QHFH 3U2JA 1LE5A 4MRCA 1GZQA 5AZEL 3KLAA 2CE6A 2W9LA 1IFGA 4QRRE 3H6JA 1AR1B 3GXIA 3IMTA 3NEXA 4JFOB 1EAOA 2VDNL 5EOQH 5D1ZI 1EH9A 4OM1H 5CZXD 4OTXH 3WIAA 1A66A 4GKSA 5IQ7L 4H8PA 3QXDA 3LKPB 1JK9A 2Y4SA 4UIMB 1J05A 3VSUA 1XZWA 4XNMB 2ICES 1UGKA 3WBDA 1VRSA 2ZZUT 3RNQA 1LILA 2GEEA 4B7LA 1UQSB 2J6EH 5AW9B 5AZ2H 3C09C 1MPAH 3TL5A 1DL7H 1C5BH 2IAMD 5I1KH 5ANMB 5AB1A 5C0GA 2NXZC 1DFBH 5MEQA 5C09B 4JGNA 1CUOA 4FNUA 3TA4D 2EUWA 4HP5A 1OF0A 5DC2A 3WKNA 4L1TA 5IFJA 3SZ6A 1Q1JL 1SXCA 2GSIB 2V3EA 4J2QA 4OLYL 2YBRB 4TNGA 4ZX6A 1A3LL 4TNWF 5GIRA 3V0WH 2RMNA 5DD3H 2EIJB 3UTTA 1ZK5A 3BT2H 5LCVH 2BS8A 1AQDA 3VGBA 2BSTA 3P77B 4I9XA 1N9PA 1A3RL 4UINL 1LEKB 1OT4A 4UT7L 1N3NB 2P5PA 5J06A 5CLZA 2JXMA 3FFCD 4E41D 1CFSA 3FQRA 4P2OC 4YC2C 3JWNG 2G3MA 4KJQD 4KJPC 1QMUA 3AITA 4CMHC 2C3WA 1MCEA 3MLTA 4L8CA 3FT0A 2VE6A 4NQVB 2WAHA 5C0IB 2Q8BH 2R1XA 2OYMA 4LAQL 1JS4A 1U8PA 1QWNA 4HH9B 1S46A 5T1KD 5L6YH 4JZNB 5ETUA 4NQTA 1WBYB 2Y2TA 2ZPKL 3ZZ1A 1AQ8A 2XPGB 3DHUA 4DQOL 3CBRA 4RSVA 43C9B 1YMMB 1WZAA 5LNDA 1JRHH 3VQMA 1KCVL 3L3GA 4MBRA 3LVEA 4I5BA 3M7OA 5AB0A 2N1KA 2NRDA 4I87A 1NPJA 2HT2C 2WLZA 2WXHA 5D1XC 1WT5A 1E28B 2IH9A 1BQRA 2IBGA 3GMQB 3KE0A 3BAXA 4IDJL 3UAJC 4E5XA 1DBBL 1YQVH 5JHMA 4LSRH 4KNQA 3GJFK 1WFJA 3E38A 4Z5RA 4OQ1A 1VA9A 1WUZA 4FFZA 4HWZB 3SKNA 3VTTA 3PHOA 1NUFA 3IDMA 3THML 2QADC 1H5BA 4PSPA 4NQCA 2IJ0C 2E6JA 3QIWB 4L5FE 2BW4A 3D6GA 2H45A 1ZDQA 2DKUA 1NGWB 4M03A 3K6OA 1WFIA 2NY0C 3BJ91 5I1AA 5E9DA 5LBSL 2P5WE 4OFDA 1S78D 2FYVA 3L9EA 3HPLB 1IEAA 3BH8A 2WYTA 5AAMC 4Q9BA 2FEDD 3HAEG 5DMIL 4PJ5A 4CDHA 4DGUA 3AQXA 4UNTA 4G1MB 4P2RD 3C60C 4C83B 2R0WH 3MGTA 2OCCB 4LPWA 4UBDD 4JHWL 2X28A 4O02B 1MJ8H 4JPVH 5C0JA 2VMFA 3SHSA 2BDNL 2EVGA 2OM5A 4W4OA 1KB5B 3K7UA 4R4BB 3HKFA 4WTXA 3F12B 1SJXA 4BH8A 5TH2A 3EJZC 4G8FB 4C4KO 1OP5H 4TUOA 4ZMZA 3OAYH 4NOBA 5KG9A 5KYNA 1OE2A 3AB0C 1IBHA 2HX9A 1MDTA 2P5WD 3CUPA 4WFEE 5IB5A 3TBVB 3FQ4A 5EFIB 5DT1L 4MJHA 3IS0X 1JYNA 1KXQE 1BG9A 2VJXA 2X4QA 2X89A 2B16A 2ATPA 1PFCA 3K72B 3K80A 4S1RL 3GBEA 2DQDL 4F7MB 5JZ7C 5DHEA 2EVJA 3PDOA 5CEYB 4X5RA 1A5FL 4PJGE 3FTXA 3LHPH 3PS6A 2R7EA 1K2DA 4PJ9A 2A83B 2R9HC 2HJLA 2XXFA 4MVBC 4CBZA 4KX7A 1EDHA 3VMNA 2OMUA 5CGBA 5CEZH 4NJ9H 5AVZB 1ZTXE 1G6RB 2VT0A 3ARXA 3GM8A 4XOBA 1HH9B 2AP2A 2RBLA 4LGSB 3RRQA 4CSSA 2D7PA 1BBJA 1D5XA 1IC1A 1N18A 5T3ZD 5EA0H 1CJYA 4E9XA 4PBDA 2O6FA 2YA0A 2G5BA 3HBZA 3IMWA 3JWNH 5EOCL 3UTQA 5CCKH 4WFED 5CM1A 2PO6D 5IUCA 4XNUH 4Q7DA 3NDZE 4PJ8B 4LPVA 2CDFB 5JHLH 5C0AE 1LO4H 2YUVA 4U1NB 1E9PA 2VN5A 3RX8A 1DQLH 1S2EA 4HBQA 5JO5B 3ETSA 1TENA 3LTVA 2QEJA 3NA9H 3LNGA 3HPJB 4PVNA 1WHPA 2HFGH 4JY4B 5F7EL 2QHLA 2VDPB 1CI5A 3PJLA 3WTVA 4KO7A 4LVNB 2DQIH 2NT1A 5EZLA 2VDKL 4DAGH 3KYMA 4P5KB 3CAFA 3TEUA 1P7HL 4KRPB 4ODHH 4OQTL 1KJ2A 5C0EB 4RSYA 3QQ9D 4Q9RL 1ZTMA 2H2PC 2AERT 3GNMH 5DQDL 5JXAH 6PCYA 4YAQA 3GS0A 2CAKA 2EE0A 3FO9B 4ZFFA 1QTYT 1OE3A 1FVCB 1OAYH 3AC0A 2X10A 3CN0A 2GQHA 3PIQB 1BECA 2YWYA 1GGTA 3KGSA 3E6HB 1LJMA 1SEQH 2WWKO 4M4RA 4Y4FA 1CXHA 3SOTA 4WKXA 3Q6FA 2VR8A 3U2SA 5FM5M 3V5HB 5EBMA 3TZVC 3VMPA 1WTGT 3WL9A 4P3DA 1WAAE 1NSNL 3QQXA 4U6HA 3E9TA 4PJBE 4AY0A 3K2UL 4J3OH 1U0QA 1EK3A 3HAEH 1BQHG 4P5TD 3MRDA 2UYLA 2NY3B 1GHFH 2GBUA 3RWEB 2VH5L 2BSED 5D1QC 2EE9A 2HPOA 4LNRA 5T33L 4NNYB 3MRLA 2VLKB 1XZ0B 1TJHH 5CD5D 4FZEL 3FBQA 2R23B 5J9PA 3CZEA 5F3HA 3UTZA 4LSTH 1P7QB 1JWSB 3CV5A 5I66A 2DIAA 1NINA 4JDTL 5FFOA 3NSDA 5AZEH 1RUPL 1XH0A 3D85D 3DMMD 4BFKA 1JCKA 1VEOA 4TF4A 3O4LB 5KBLA 4OGXL 2VDNH 2XN2A 2OMXB 4ZX3A 5CN2A 3V4VB 1BREA 3OKLA 5ITBL 2GABA 4UIKL 4YGVB 4M61B 4RX4D 5HY9B 5IQ7H 1BYNA 4UOW1 2DH2A 2VQTA 3QUZA 4X0KA 5SWSD 5JIIA 3SKMB 4D0DB 3WN5C 1ZS2A 1U95A 1ACXA 4KKBC 3DX6A 3FO1B 2ZICA 1IAII 1YSOA 1C16A 5D4IA 5F8RC 3VUAA 3PWJB 1OTUC 2OCFD 5D72L 3ECBA 3KPSE 1U2CA 4JDEB 3V8CA 4XE5B 1Q1JH 3V0IA 4DNLA 2KH2B 1UWXH 4QNPF 4XMWA 3MYJB 4R96A 3OZLA 1AIFB 1IC7L 3BUIA 1XR9B 4OLYH 4APXA 3T04D 1PTZA 3VD3A 3UX9B 1IJNA 1A3LH 2EO1A 2EDKA 4HKXB 3FONB 2AK4A 2CRMA 1KBPA 1EXUB 1U8KB 4HG4J 4Z0BL 4R2GD 5KSAB 5LGJB 3TYFA 1JP5A 3D69A 5GS1B 1QSED 5AKRA 1A3RH 4UINH 4UT7H 5TDPA 2A9CA 4HXBL 3KYAA 4UZUA 5BO1L 5K1VA 1JNNL 2B08A 5CWSB 1ZS8B 3E8VA 4LAQH 3VXUA 1WAAF 4FHBD 1ZT4B 4HZLB 4ISVA 1MQKL 4PJBF 4GAJL 2ZPKH 5C08D 3TBBA 4F33A 5GS0C 4PLKD 4DQOH 5FCSH 2VERN 4BFFA 4TNWK 1KCVH 8FABA 1UJTA 4NRXB 1M7IA 5L4MA 1AY1L 5EPMA 4FA8A 3HI1B 1KYAA 2CJTA 5HHOA 1WAPA 3WIHA 3SQBB 3RTQA 1QSFE 4YN3A 3CLFL 1TETL 2B39A 4IDJH 2OMBA 4U4BA 1DBBH 2HH0L 2FJHA 1Y18A 2GAZB 2W94A 2XBZA 3R06B 4G9FD 5LB1A 5IHUL 5C70A 1MQ8A 5EN3A 1U8HB 1A64A 4A39A 3THMH 3FU5A 2MRYA 3W9DA 5FK9A 3VGDA 1GYCA 4D8OA 1BZ9A 1JG9A 5F9JB 4ZO6A 3TIEA 3L45A 4LCUB 2WO2B 4ZTEA 4F8QA 2W5PA 5LBSH 3BVUA 1MCJA 4FQ1L 5F9WB 1BYPA 1FYHB 4P2YA 2DBJA 2CUMA 3OJDB 3MUGB 1TQCB 3CZFA 1FGVL 1TR7A 4K23L 5J6HB 3T08A 1BX2B 3V5DA 4QXWA 3OG6B 3NJHA 4MJ6B 3GSUA 1AQKL 2X2UA 3WELA 5TDOA 5DMIH 4NM4L 2IBBA 1L7TL 1FLTX 4UBDC 3WY1A 4BGDA 3ULVE 1I8IB 4H7VA 3MRFA 2PWFA 3V4PB 5TE7L 1MFCL 3T3PF 4NKDB 2IDCA 4F1ZA 1U36A 1MVUB 2MKWA 4JHWH 3WENA 2XZCL 4NENA 1WLHA 2BDNH 3BAJA 3STZB 1IBFA 4FQXD 2XX1A 1G7PA 3HLKA 4JG5A 1BQSA 1NBVL 3AG2B 3ZSTA 2KDGA 3MV9B 4NP9A 1EAJA 1MIML 4NDMB 3PHAA 4PW4A 1A9EB 1GKOA 1NA8A 3ARUA 4YXHH 1RZ8B 1GGUA 1USZA 3MR9B 5DT1H 2E8ZA 1WWWX 3MUJA 3CVCA 1QRND 4JFYB 4K7PX 3MKKA 2CHZA 4IM8A 4RGNE 2F15A 5EO9A 1F1AA 3C6LC 3LOWA 1BDYA 4QHKJ 1TSRA 4S1RH 1DLHA 1N19A 2DQDH 2YMTA 1UXSB 3MV8E 4JL1A 2W60B 1MDAA 3T6XA 1A5FH 2J2ZA 3IDIB 4Z7VB 3ZE0E 4OV5B 2OW6A 3QGVA 4TTDD 3EOAA 3UTTE 3RGVB 4J6IA 2WMPB 1DEEA 2ZE0A 2A6IA 4BQBA 5BS0E 4U7MA 2OZ4A 4GPVA 4MBOA 2YD7A 4X6CE 2PO6C 3T0EE 1HT6A 5FV1L 5AALA 3V0VA 1EANA 1N4XL 2XWJA 5FECB 1PZDA 1TPXC 4NXKA 4WFHD 5EOCH 2E0PA 4B0MM 3BVNB 5JORA 4GSXA 1JPFA 1QSVA 1OSPL 4PBWD 1S9VA 1HWGB 1GJIA 4XCEB 2DQFB 1KIRB 5I8EB 4CBPA 1OTTD 4EXKA 5EIIB 2UUDK 1PCXA 3EH4B 3PABB 4PJAE 5F7EH 3UABA 5IJDC 4OCNC 3US0A 1XTMA 4NSKB 2VDLB 4OCWL 3RY5A 2IQAB 3QEQA 3RPBA 5FYJE 1BBDL 1HEHC 2VDKH 2WXOA 3NJKA 3ELQA 3GIVA 4EZJA 3MRHB 4NNXB 3UTTD 1WTLA 1XFPA 4OQTH 4ZYKB 3VFWB 4KI1A 4OSUL 4R3SB 4AVKA 2LLNA 3N42B 2YSTA 3IBOA 4XMVA 1JHKL 4Y4KC 5IW1B 4Q9RH 4ABWA 4GP5B 1EIBA 5DQDH 4N20A 3W3BA 4CN6A 1Y6NR 1E3XA 4F8TA 5LDUA 3UMTA 2MNWA 4ZFGL 4AW7A 4JMNA 4WKZA 2VZOA 2W38A 12E8L 4JKMA 3NFNB 5FLVA 4EKJA 3S48A 3ZL4L 4JPIA 3HG0A 1EAQA 5E0QA 5HGDA 1M42A 1NSNH 4RMWA 3WKQA 3Q48A 3K2UH 5F96H 2EDEA 3C08L 1QPPA 2RFXB 5F1IB 3NRQA 5IHLB 2E6PA 3FOLB 4YHZL 4NN7C 2VH5H 4G71B 4Z7IA 4HJSA 1UXLA 3Q6GL 5E1AB 3QIUB 3S2AA 3Q3GA 5T33H 1BEYL 1G9NC 2DQUL 4Q58C 2QL1A 1M9SA 1K8DB 1TJXA 4FZEH 3DX8B 5HHQB 3WFDL 2J1YA 3HHSB 2CJSA 2P46B 4FG6D 4AW4A 3GMPB 4EI6A 1SF3A 2YSSA 1II4E 4J8QA 4JDTH 1RUPH 2ZUYA 4XBMA 4NQCD 2ZQKA 5GGSB 1RSYA 4OGXH 5FGRA 3I6LD 1IEBB 1M2VB 1WD8A 3F5WA 2OKMA 3UBHA 3VRJA 2F1AA 5ITBH 1WIOA 3FQXA 4QXTA 4UIKH 1D7BA 5E9DD 3B5TA 6PAZA 2PMZA 3O2DA 4JO3L 2X4SA 2P44B 3N3EA 4Y2DA 5DMKA 3FTVA 2D7QA 3IWVA 4ZUUA 5IHBA 2HN7A 3ZPDA 3ZRSA 3M7FB 3NT0A 1GL4B 2XKSA 3E2HC 3WY2A 4PJ5D 2BNRA 3Q7JA 3EGXA 3P9LA 5T3ZL 1JAEA 5D72H 3KGUA 2C9XA 5E5UB 1CICB 4N2HA 3QAQA 5LNEA 4GRMA 3L7EA 4AT6A 5K5YA 1IC7H 3MV7B 1YRKA 4ODTL 2WTOA 1SFHA 4A55A 5A43C 4ZAKB 2H1XA 4KH2A 5BZDA 1KGYE 3V5KA 4AE1A 2XYBA 3MRRB 3ZTDC 1V7ML 1D7CA 4Z0BH 1I7UB 1T80A 2FJFA 1E4XI 4CVZB 2APBA 1MJ7L 1F6AA 4ZMQA 1N2RA 3A23A 4JY6A 4BZ2A 3MCYA 4HXBH 3GI8L 4WWOA 3KBEA 4QY8B 2PR4L 5BO1H 4S0HA 4JQXC 5MENB 1JNNH 5EBLB 3DVGB 5F7DB 3JTSA 2X89D 2KC0A 1VB9A 2BVOB 5E8PA 1QACA 2IF7A 4H5SA 1MQKH 4GAJH 4J3WA 4K5MA 3BP7A 3H7LA 3U6RA 3QJFA 4GKLA 2GSMB 4Z76A 4YDVB 3ZRFC 1CZ8L 4QTHA 4WWKB 4OGAD 1H6TA 1AY1H 4LVOB 4PJ9D 2G9HA 3IF1A 3L9BA 3FSWA 1B4TA 3QPQC 3EG9B 4JREB 1JHTA 3EYFB 3N5AA 2H6PA 3CLFH 1U3HC 1E8XA 2YEVB 1TETH 3EFFA 3LXCA 2QPUA 3O0RL 1NAKL 3ES6B 2HH0H 3MLXL 4MNGE 2KBGA 4JFEA 4I3RL 1G1YA 2DWXA 2TRYA 1ML0A 2D9QB 2Y5EA 2NY1B 2ZP8A 5IHUH 3SD5A 2ZUSA 4K4KA 1AP2B 3OXRB 1FZMB 2VRKA 4GUCA 2ZP9A 1CXKA 3DRTA 5I5RA 1YPZB 5E94B 3ZMRA 1HZKA 2H2SD 3AXLA 5HPOA 3B34A 2FEEI 4K9EC 4DCQB 4F15C 4KK6D 3AUWB 5GPRA 4YE0A 1HHHA 4OIFA 4X99B 4Y4HB 1PD1A 5CSZB 2YAEA 2HRPL 4FQ1H 5HHMB 4LLDA 3IJYA 4K23H 3D2TA 1FGVH 2NY2D 4XH2A 4POUB 4OJDH 3DHPA 3MNVB 4JKWA 4LEBA 2VRQA 4IRJA 1NDGB 4N2FA 3WAKA 1AQKH 2XVGA 2XPYA 4NM4H 2F53E 5L0QC 5D7JA 4Z3JA 2C1PB 1L7TH 1X9LA 3BVTA 1WYJA 5FA3B 3VFNA 3QHTC 3DPBA 3NBNA 5TE7H 2K45A 1MFCH 2VLME 5B7FA 2VDQB 1AZBA 2XZCH 2YQ2A 1J8RA 2DLIA 4URTB 4PREB 5J0BA 2BRQA 4Y4FD 2D7OA 1SXAA 4MQ7A 3HHRB 4YPGA 1NBVH 5I6KA 3UMNA 4WI9A 4B6ZA 3LB6C 3U0TB 5HVFB 4OUUB 5H37G 1T3FB 5J1SC 4I77L 3L5HA 3QQNA 2COQA 2JCCE 5IKCB 1MIMH 5IWLA 5HHXH 2JFCA 4OLWL 3ZU8A 1B0GA 2BS9A 1PYWA 2CDEA 2YAOA 2G0KA 4Q9CA 2OP4L 2V8MA 2Y7MA 3I75B 3QUMB 4M93C 1LO0L 3TOPA 4L8SC 5DHVH 2F0CA 3EF4A 1JCVA 5IQMA 1VCBC 1FNEB 2DQGL 2VLJA 2KLSA 4W9IC 4PG9A 2JH2A 3GFUA 4N2AA 1QLRA 2AK4E 3HCVA 2APVA 3MRJA 3QVAA 2WYHA 1O9ZA 3LPPA 1L5GB 4P0DA 5IMMA 1P1ZA 1J8HB 2R83A 2JKLA 3OWRA 3IMVA 2OMTA 4Z6AT 2FHBA 2EVFA 2V3FA 3KPLA 1F18A 3QUZD 1EHLL 2HLAB 3MJ8B 3BUYA 2Z91B 2GHWB 1N4XH 4KXBA 4AITA 3AS2A 2IOMA 4TLUA 5I74C 3AACA 4GKOA 4P4KB 2BSDA 3VXUE 2J1KA 1MHEB 3L4VA 2UXTA 1OSPH 1SDDA 1RZJL 2ZYSA 5BRZE 3TVMA 5K9OA 3D30A 5KAQF 3T6QC 1HXYB 4ENZA 4MKTA 2D7MA 5FB8A 3FAXA 4RQQB 3L13A 4HSAC 1QNZL 4RWHA 4UM9B 2LLGA 3I02A 2JB6A 4OCWH 2AXFA 3IN0A 4EBQL 1SLVA 3V6FB 1BBDH 3VFRA 1Z1WA 4HKBB 5GGUA 4NO0B 5GGSY 2AK4D 3KLHD 1WCBA 3SGEH 1G84A 3EHBC 1KXVC 4BYHA 1E2ZA 4OSUH 2XV2A 2OJEA 1N7ML 1JHKH 3DV4A 3QHZL 4JCLA 5IJCC 1WCQA 3KW7A 2XETA 3WTYA 2FLBT 3K2IA 3CCHB 3KDMB 1CB4A 2DMHA 3SQRA 4XNDA 5I5IA 3S96B 1RK0A 4U1IB 1WS7A 2IMMA 3TNMB 1ADQA 4JHUA 4J8RA 3QBTB 4KHTL 3GEWB 3TCTA 3FU6A 4ZFGH 3VXUD 3ZZSA 1EBAA 1Y1DA 2X40A 2JCCF 4PY8I 2DYSB 5LG1A 12E8H 4JVWA 1UOVA 3KPPA 1CT8A 5AVQB 3GK8L 3ZL4H 5IMOA 2H0FA 2PTTA 1TTBA 1B4LA 3QRLA 3MHZA 3WTSA 2WQUA 4DVBB 4DW2L 4N0FB 1AGDA 4Y2OB 3C08H 4YFLF 4RFOL 1GY1A 4MLSA 3P11H 5HHOD 3DV6B 1K6QL 3RTQD 2HT3D 4LIQL 3U4BL 4GRWB 5B38G 4YHZH 2WIIA 4E42A 5E6SB 1AANA 3P40A 2ETWA 3JXAA 3Q6GH 4O2CA 3ME0B 3UZVA 2P4AB 4PRNB 2JE8A 3FF8A 1T5KA 1BEYH 5CLWA 2DQUH 4MCZA 1H5BC 2YPKA 3WFDH 2XFGB 2DI7A 1RJYA 3EYVA 3LEXB 1MEXL 3D4GA 4YZWA 1MY7A 3PWLB 3SE6A 2F2HA 2WXNA 2WBJC 4H8QA 1JXJA 4MS6A 2AV1B 1UGNA 2HTLD 5JW5A 5LGYA 3FYEB 5IHHA 4NQXA 2RTTA 2V37A 4U6VL 5IJVA 1BZ8A 3Q06A 4HKJB 3SGJA 5J8OA 2GKIA 2NZ1A 5HYJB 1W0VA 4JO3H 4AMWA 4YHLL 3BAEL 1IM3A 3P69A 4P46B 5H37H 2HJFB 5ESQB 4N0YL 4GUPB 3QQ3A 4TV3A 1IZKA 1ZGLM 4N22A 5EN2B 3PPEA 2FX9L 3I3EA 1EGJA 4WK0B 1OW0C 5CIPB 4NKQB 1KCKA 4HSCX 4X6EB 4ATWA 1BZOA 2YUXA 3BH9B 3WE6B 1CLOL 1T0NB 3NIGF 1MZYA 1AXIB 2YC1A 4TSBL 1T2XA 32C2B 5T3ZH 4J3VA 3GQFA 3FQYA 5CJXC 1SMAA 3X12B 1GYUA 1M6OB 2XQYA 4MZ3A 4GKNA 1GOGA 5DS8B 3P3TA 4E9TA 1BVNT 3ABZA 1KPVA 2V2WA 2Y0SA 4HS3B 2ZCZA 4ODTH 3HLAA 4WW2A 4YSTA 5HGAA 4DP8X 3I9AA 2EICA 4AYEC 1QBAA 1S9WB 2G5RA 4MCMA 3JWOL 1I8AA 1VFAB 4MYWB 3GSOB 1V7MH 3FKUS 4LRNL 3HHMA 1F5WA 4GMSL 2ED9A 2KQNA 1PKQA 3KXFA 4TQEL 4Y16A 4FQJL 1MJ7H 1K4DA 3BSGA 5BV7C 3QJVB 1EVTC 2ZNWA 4AM0Q 2GJPA 3GI8H 3NEEA 1K85A 5E99L 4CRPA 2PR4H 4PJIB 5HSFA 3IGLA 2OA9A 5G2NA 5F6HI 3B7YA 1T6VN 3P4OB 5D55A 5TDNB 3UTPD 4PJ9C 4J27A 1TSHA 3B2DC 1AE6L 1HCVA 1CZ8H 2P8PA 2VSCA 4Z7WA 5GGVL 3CSPA 2BIOA 4ZPTA 2VW4A 2ENSA 4X6BA 4K7PL 4B96A 2N7AA 3O0RH 4WNSA 4P48A 5KZCB 1NAKH 1NH6A 1Q94A 4MX7A 1AZVA 2AQSA 3MLXH 5GGRA 3X13A 3MLRL 2F74A 5A2KH 4I3RH 1H3VA 2H2SC 2XIBA 5I16B 5D1ZA 3TBTA 1RP9A 2LU5A 2DYPB 5DJAA 4PAZA 2A6DA 2D0FA 1L0YA 1BFSA 2EO9A 3BEVA 4LEXL 1XV8A 1HNYA 3CFKA 4GJTB 4P4RA 1T20A 5CBEB 2YRPA 4KV5E 3FCSB 4AGPA 2FLRT 1NGZB 4FFZL 5INCA 2YQBA 5DRNA 3SJVA 3WHE0 5IROA 5KS9B 2HRPH 4EN3C 1Q1PA 4HHAA 1BPLB 3QEQD 1GC1C 4L9LB 2H6OA 1ZK9A 3BP4B 3LRSB 2H3KA 4U6TA 4DO5A 4ZUSA 1TO4A 1T66C 4LLQA 4HUVB 2IMNA 3BUDA 4PCTA 5AOIA 2A4EA 1UFGA 4JFTA 2Q2LA 5AVVB 5L9DL 3F01A 3WNJA 1LWJA 4X7FC 2Q3AA 1CGVA 3C5ZB 5K1JA 2DQEL 3Q43A 2AXGA 5HGHB 3ZHDA 2WIMA 5F89B 5HDWA 3ZVVA 4G8GB 2X7LA 1Z9SA 1KXTB 2BP5M 1T7XA 3CWGA 3MJWA 4GQ9L 4PJEA 2JWYA 2AI0L 1BWWA 3KS0J 4PQXA 1LHZA 4AGL