3HKFA

Murine unglycosylated igg fc fragment
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
205
structure length
205
Chain Sequence
SSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the murine unglycosylated IgG1 Fc fragment
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Igh protein
total genus 31
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2009-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hkfA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hkfA01
1DFBH 4CN1A 1KPUA 3IJHA 2VDPL 3D0VA 2Y7QA 5DT1L 2W9LA 3HRPA 4DGVL 3CVIH 4I77H 2MCPL 3LKRA 2Y36L 2ARJA 4X80H 4WY7L 2OL3A 2DKSA 1QRKA 4WI7A 3TJHD 5JORA 3IFLH 4LLAA 1UCBL 4WW1A 2H6PA 5L7XL 1RZJL 2D0FA 3NTCH 4OZHE 2CKBH 5MEPB 1KTLA 5BV7C 2A9MH 3V0VB 2ADGB 4KMLB 4WDIA 3CD4A 2CR6A 5FGCB 4POZC 2DQUH 4JFFA 2AI0H 3RDTB 4XNUH 4K7FA 4CMHC 3KJ4C 2XTJE 4IRJC 4PJAF 5GS0L 4UV7L 5D2NA 4Q9RH 3PF2A 3EOTH 3FT3A 4CDGC 3KGRA 5DMKB 2J6EA 5I16B 3HA0A 1FZJB 1RZIB 2OI9B 4OT1L 4R26H 5E94B 1MLBB 3MLPA 2E6PA 3VCLB 3T2NH 4NZRH 2APBA 2VL5A 4TVPL 4UV4L 3D3VE 4FQXB 4Y1AD 1OF2A 1TDQA 4X9FA 3MRHB 2XY1A 3QUXC 1MJ8L 2DQCH 4M5YL 5I1GL 2IAMC 1FE8H 3QEGH 1V7NL 5EBMA 4X6CA 4EOWL 4F2MA 2NX5B 5CSZB 3B9KB 3CFJA 3LRSA 2AGJH 2D9QB 1J1OL 1AKJA 5EO0B 4OLVH 3CVHA 4FFYL 2YN3A 4WW2A 2R69H 4UIKH 3CMOH 3SDXE 1X5KA 1RZGA 1BOYA 3JTSA 5FUOL 5D7IB 1OP5H 4FQ2H 1E4KA 2AEQL 4LKXB 1UH4A 5F9AC 2K1MA 1G0YR 4MNQA 3QQ3B 3DV6B 3R06A 2Y9RT 2MFNA 4HX1B 5IVXE 3WIIL 1FZMA 5KZCB 4X83A 4KMTH 3CFDA 1E4XI 1NAML 1WZ1H 1NCAL 3BPNC 5CEXB 4OIBA 1MH5B 1JZ7A 1FPTH 1OTUD 3OB8A 3LQZB 1O7VA 1DFBL 4AEIL 4OTXH 4MJ4A 2NY6D 1FNGB 3ARFA 1MNUH 4MD5B 1F11B 1KF9B 2NY0C 1SVCP 1T0NB 5GRYA 4RMVA 5KAQG 4OCSH 1ZA3A 3SCMA 5L2KE 3PNWB 3QFJE 2HP4A 5IW1A 5C0BE 2YRLA 3ARGC 3D3VA 3O9WA 4JM2F 1A02N 4PRAA 2EICA 4M6OL 2BC4A 1XGUA 3H7LA 4HKXB 4OV5B 4QF1A 3PWJB 3MJ6A 4TSAL 1OGTB 3I3EA 4JN2A 1CR9L 2DQEL 3QUMA 4K3EH 1T2XA 5BS0E 1CD1A 2CUMA 4HS8H 4TNWK 2OP4L 1G9MC 4YHMH 3O0RL 3FFCD 1ZHBB 1R3HA 4X98B 1I8MA 3EFDH 4XNYH 1TETL 3FAXA 4KJYB 2HKFL 3SGJC 4YZFF 5L2KB 1M7IB 1HILB 2R0WH 4R3SA 4F9PA 3WNOA 3HNTH 3ZYZA 5DSCB 2Q7NA 4BFGA 1T20B 2I25N 2XZQL 4HBQA 4JLRB 5CJ8A 4NNXA 4YDVA 3MV01 2VQTA 4JB9L 1JZ2A 2D31A 3QBTB 1JGLH 1S7XB 1G9EA 1O0VA 1EHLL 1ZHNA 5BO1L 1AJ7L 2MTPA 2LAAA 2OTUA 2EDFA 3OF6A 1P7QA 4GJTB 5CGTA 4EXPX 1MAKA 4X6DA 2FHBA 4I9WD 4XRCB 3I9GH 4D9QE 3ROOB 2WIIB 1JTOA 3MJ9L 5KVFL 4L9LA 3EOBB 4UDTA 1IARB 3FRUA 4RAUA 3TH4T 4V1DB 5ACZA 3HC3H 1Z3GL 3ARDA 3JV5A 4OF5A 2C4XA 4YLQT 2E7LA 3B5HA 5A3IC 3DX9B 3W9EB 3HMXH 5GRVL 3CSPA 1EAPA 4PJHB 1QBMH 3OX8A 4J3SA 1I3VA 5IVXB 2Z31C 1PBYA 3AFLA 3IAPA 1X7QB 4M93C 3CSYA 4NFCA 1DQJB 4CN4A 4PLOB 3GZKA 3VFGL 1LO3L 3DX9A 3T0EB 1VEPA 1D5ZA 1E6JL 4GT7A 4ORGB 4PJGF 2HFEA 5F93C 1RU9H 3LV3A 4XBPB 1B9ZA 5ICYB 3FB8B 3KPMA 1OAXH 3GMPA 1G1CA 2VZSA 1T1YA 1ZSDA 3AB0B 4K71B 3O2DL 3JUZA 4LCWB 1HHHB 2GSGB 3V8CA 5FUCC 4DKEL 3BDYH 1KGCD 3ELAT 4GMSH 1PDKA 5EU4A 5HTSA 3PP3H 1NDGA 5E9DD 4MD4B 3WHXA 1NLDH 3TP4A 3K8LA 4RFNC 1JHLH 1QTYT 1XGUB 2EDKA 3FQTB 1NCUA 3VE0A 1EEZB 5MENA 4G6JH 2P47B 5TDOB 4NQXA 5BVPH 3WYRA 5DYOB 3IDNA 4UILL 3KYAA 2Z93A 1RHFA 1D5XA 1HSBA 2YC1A 3F6IA 3V6BR 2DRUA 2X4PA 5IB2A 1KXVC 4PRDB 1FVCB 2XWTB 5DK2B 1MY5A 4GRLA 1J8HA 2Z4QB 2FLBT 4N1EA 4NQSB 3UZEA 3CUPA 5CZVH 3ZE2E 3TVMD 5IB3A 5HSFA 5JW4N 3MLWH 5DUMH 3VG9C 5GXBB 1OTTD 1U42A 4FTVE 3W9DB 5I1LA 2Z35B 1AXIB 1MJ7L 3SOBL 5GZOC 3F62A 1FJ1A 4RFOH 4WO4B 3OPZL 1CU4H 2VLJB 1T1XA 3RNQB 5HVFB 3CCHB 5IVZB 1DLFL 1C12A 1F13A 3W11D 3TN0C 1R6VA 3G04A 1UH3A 2JIXB 2EECA 1KT2A 3MXVH 1MUJA 5L9DL 1YY9C 1J8HB 4MA3A 2XQYG 3U7WL 2AQ3A 3I84A 4MB5A 1G84A 3CLFL 1JPFA 3O11A 3OAYK 2J88L 4GS7C 4MJIE 2CIKB 2MKLC 4W4NA 5D9SB 3BGAA 1WBZB 4HUXB 2ZCHH 3DUSB 2VDRL 1TZGH 3BP5B 3TN0D 2APXA 3OJMB 4R97B 1Q9LA 5EU7E 1FL6A 2B4CL 2PYED 4XPTL 5AZEL 2YPKB 4DZ8A 3D85B 3BKJL 5FYJL 1AIFA 1JWSB 1R5WB 2GUOB 1A6AA 1WFNA 2AK4E 4L8SC 2C5DC 5DWUL 1IEBA 1M7DA 3BP7A 3LIZH 2V5MA 3U83A 3ZO0A 4LVOC 3S34L 2XNAB 5D7IA 4L29A 4HULB 1GPOL 3SE8L 4OJFL 5DGQA 3DBXB 4Z77A 3OV6A 1QO3A 3EJYD 1MHHB 5F89A 2FATL 3CSGA 2VN4A 4WUKH 1I8KA 2DL9A 1CXFA 3INUH 4H0HB 3OKOB 3FOMA 4OI7A 1QRNE 4KZEH 4N0RA 1OAKL 5EN2A 3UTSE 2PXYB 2O5XL 3TO4B 1HNFA 3FJTA 4XB8A 2Z8WC 3JV6B 4ORZC 4AT6B 4JFHD 5BZDA 5E6ZA 3QEQD 3EFFA 3QHFL 1WZMA 4HKBA 2WANA 5TPWH 1MFDL 3ULSB 4W6XB 5HDQL 1QEWB 2UWEE 2E9WA 3UBXI 3VXSB 2DMCA 2IEPA 5C1MB 4YX2L 3SDDD 2HJKA 1B88A 2AS5M 3MOQA 4E42B 4QRRA 4B5EA 4IRSD 4U7KA 5IW6B 2QKIB 2DMKA 2AXFB 5T1KA 2OL3L 2Q3AA 4M4RA 2BVPA 3MRQB 4Z9KB 3TN0B 3ECBA 5IBTH 8FABB 4YR6B 3VWJA 1ORSA 4Y2OA 2VLMD 2OBGA 1I8MB 5CEYB 2VDLH 2CGRL 3MRKB 5E6YA 3V79C 4HLZH 4H1LG 4LVHC 5I8EA 3FB5B 5EO9B 1RIHH 1L4IA 4GS7B 1FNLA 1GJIA 4LKCA 1I8LC 3D3VD 1F3JA 3O9WD 4M62H 1VFBA 2VLJE 4TULH 1P4LA 2D3VA 2WQ8A 1REIA 1GOFA 1INDL 1CICB 1U58A 4P9ML 3QDJA 5C0IA 5C08B 4I3RL 5HGAB 3ARFD 5HJ3B 1G7PB 4KJWD 3V0AC 3RPKA 1U8QB 5I71B 3QI9A 1ZHNB 5I74B 1UXSA 1TNMA 3AS3A 3FTGB 3OPZH 1HHKB 5EUKA 4J3TA 5KSAA 1ES0A 1F4XL 2B2XL 1BIHA 2X4QA 3LEVH 2FRGP 3TIEB 1MCJA 3Q6GH 5AG8A 5HYJA 3JWOL 2M26A 5SWSE 4NKDA 1MJUH 3RDTC 3OAUH 1YEKH 2CMRH 5HGAA 3P0YH 3D85A 5I0ZA 5I8KL 5LJYH 3G6DH 4MDIA 3UYRH 5CLTA 1KC5L 3LDBC 2NY3B 4GKZB 4PLNC 1GZQB 2E5EA 4N0CC 2EH8L 5D1QB 2ICCA 3GDBA 4JHWL 1I9JH 2NXZB 4AMKL 4Y19D 3KPPA 3LQMA 2GAZB 2M8XA 4PY7B 5IROA 5JUEH 4ZPVB 4OF0A 3FL7A 2Y5EA 3ZYIA 4PRHB 4Y4FD 1OB1A 3DBXA 3PWPA 4G9FE 1JBJA 5DC0A 5IV2A 3VXTB 4MZ2A 5AYUH 4JKWA 4PJ7A 4YHPA 4Z7VF 4PRAB 3H7BB 3NCBB 2HAZA 4PJFA 5DJCB 5FYKE 1P69B 3QCTH 3ARGD 4WHTA 4LRNH 4H5SB 3LKOA 4DKAA 4M7JH 3K2MC 4PFEA 4YFLF 5F8QC 1FG2A 4NOBA 4U1GC 4NQUA 3OTTA 2D31B 2C1PB 5DVLA 5MI0C 4ZOBA 2JJTA 4KK8D 4PJBA 2DD8L 2LVEA 3KNBA 4LHUD 4IIQC 3C5SB 5ID1B 4FFZL 2X4RA 3MZTA 5IBUG 5JDSB 3VW3H 4HSQA 4JREC 4YXLH 4NO3B 1UADC 1D7FA 1W0VA 5DGRA 1CDCA 4Q74A 1UA6H 4GRWE 2DLIA 4L9DA 2X4SB 2BVPB 5BV7B 5I6XC 1S78D 1UWXK 2C1PA 1HH9A 2R56L 3K1KC 4KVNH 1IAKA 2KH2B 1JVKA 3WKNA 1FFOB 4M6NH 3V6FB 4X7DC 1LK3H 1RMFL 5IBTL 5GRJL 1JNHA 2JF1A 3DRTB 1TVHA 4O2FA 4PRPE 1TZIA 1VGKA 5TDPB 5A2IH 1FO0A 3VFUA 3DX6A 2KZ1B 3WDIA 4KK9C 1MCNA 2IBZX 2XQBH 4P2OC 1WCQA 1N2RA 2R0ZH 5DD5L 4A6YH 4TUKL 2E7MA 4PJ7F 2IFFH 1A6ZA 5C7XL 4HGWB 4BSWB 5C3TA 4LF3A 4G7VL 1W2KT 3LRGA 3G04B 3V4PH 1GGUA 1U9KA 2DYPA 3UBXG 1JZ6A 3PHQA 4K8RL 3RTQA 3S35H 5HYJB 1J5OL 1CDYA 1IGCH 5EUOE 5IK3A 4NSKB 1BEYL 5E2VL 4U1JA 4M1CC 4PJ8A 5KVDL 1TJHH 5A2JH 1S7RB 2DQIH 3TZVC 1RZ8A 1WWAX 4YE4L 5BOZG 5IUSA 4J6RL 1OLZA 5EH1A 4G8IB 1LO4H 1ZVSB 3O6MH 3TFKC 1H5BA 1A4JA 2DWDB 3BKYH 4KTEH 1ZA6A 1QSEB 2H32H 5EBGA 3EOTL 4KDWA 2J88H 4BH8B 4ORGA 4W4OA 3SDDB 4KHTL 1AD0A 4OV6F 2ZUTA 3BPNB 3I6KB 3IJSB 2CR3A 3VJ6A 3K8KA 4QHUB 3HPJA 3CMGA 1U8IA 2ADJB 5CP7A 4DUXA 1HHHA 4X8JA 3RA7H 1WSST 1NCTA 1X5YA 3T08A 4HUNB 4IM8A 2WP3O 1K9TA 3IJYB 3DSFH 3QIWD 2BSTA 3FHAA 5ETUB 3TV3L 4RRPA 3VXNB 3VW3L 1BGXL 1F6FB 4R7DB 5IBLD 2QSVA 4GW5B 1SYVB 1EAJA 5I9QC 3Q1SL 3VXOB 1UVQB 1G7JB 4N8VB 2DQTL 2VDQH 1UZ8A 1AE6L 2A38A 5C0JA 4WO4C 4B7LA 4GOSA 4S11A 2FO4B 1C5CL 3BH9A 4XX1E 2M2DA 3PL6C 3V5KB 1LK3L 3TPUB 5BZWA 3KXFA 1NCBL 1HNGA 4LLVA 4Y0GA 2I27N 4UBDD 3OKDB 2EDYA 4MNHB 5I66B 3MA9L 3PGFH 2NY5L 5IEHB 2N56A 3IU3B 4UU9B 4HIEA 2BSRB 1ZLWH 2B1AL 1Q1JH 9CGTA 3MLTB 4XH2A 3S4SA 3VXMD 2ENYA 4XPBH 3BZFB 3B9KA 5ISZA 3QPQC 4NHUB 4JRYA 1SM3H 1DQTA 1XF3B 4ALAL 1F4HA 3L3DA 4I1NB 4NO2A 5E8PB 1KIPB 5HPOA 2HFGL 2P24B 4PJEF 2VLKB 4BFIB 4I2XB 5D1QD 1DJSA 1EMTH 3W5NA 1KLUB 1CYGA 2XA8H 4OCNC 1UM6H 2GTWA 3CDGB 4OD3H 1N2RB 3O4OC 4NP4L 4KZDL 2P5EB 3SKMA 4RFNB 3VA2C 1EHLH 3DGGA 1P4LB 3S4SB 3HE6C 4ODBD 2BP3A 4PJ9A 2Q8AL 2MSPA 4LLWA 4EDWL 3IDGB 2FZ3A 5C0BD 5I17B 4GKOA 4HS6A 2JELL 2G5BA 4FFVC 5I19L 4BFIA 4Z5RA 1MHHA 2XTLA 5C0DB 4QWWD 1NBZA 3ESVF 2GTWB 2R0WL 3KS0J 2GK0A 2AV7B 3SJVB 1BLNA 4G5ZL 4MLIA 3QUZC 3O3BB 3PWUA 3RVUC 1HK6A 4Y2DC 2FGWL 1JRHL 5HGBA 2A9NH 1R0AL 4X98A 4CNIA 4FXGB 3RGVB 4KKCD 5T1KD 3GSNA 3MNZB 4K7PX 1HILA 3VG9B 3E2HC 4R3SB 1DBAH 2NY1C 3QR2A 3UTQB 4F7CB 3EDDA 4ZUWA 4MHHI 1WQVT 4Z7UE 1U3HB 1T89C 4UB0L 2B2XH 4Z7NE 4XPHH 5CJOL 4OCXL 1B6UA 4FQJH 3IDMA 4HFUH 1E4WL 3NPSB 3UTSB 3OGCB 4JPWH 2QADC 4D0CB 1WWCA 1C1EL 4L4TB 4P9MH 3BJ91 5B22A 2B1AH 3T3PE 1JK8A 2GY7B 5DVKA 1S3KH 2AXHA 4LHQB 4W70A 5GRUH 4Q7DA 5B21A 4U1HB 5HHVL 5ADPH 3H0TB 4TPRL 4GBXB 2PETA 1WAAF 2XZAH 4WU7A 3QIBC 5CEYA 5C0BB 4HHAB 3MFGB 3TBTB 4JRXD 4LLUA 3SDCA 3V6OA 3GGWA 4HDIB 4I0PA 2KQNA 1IJ9A 1KBGH 4MJIA 1RZFL 3QQNA 3WN5A 1BM3H 1QD0A 2WBJC 4MAUH 1PZ5B 2GT9A 4DZBA 3P0GB 4CW1B 2VOTA 1NCAH 5IBUB 1B0RB 3D39B 3GIZH 5I8CB 2ATPB 1IGTB 1AGDB 1NC2A 1BD2D 1ADQH 1CLOH 3TBWB 1E28B 4GRMA 4LFHG 5D1XC 4APQB 5AG9A 4RGOL 3FZUD 3SPVA 5BW7A 4P48A 3M1BA 4YEEA 4KI1A 4M6ML 1AGCB 2HTLD 4XP9L 2FWOB 5E9DE 5DD0H 1U8JA 4UAOB 5GGVY 1DQJA 2CUIA 3Q5OA 1S5HB 3STZA 2AI0L 1YMMD 2V9QA 4WWKD 3MXVL 3OXRB 3PABB 5F6HJ 2J4WH 1BHGA 5IQ7L 4JQXC 4EIGB 3BO8A 1NUFA 3I6GB 1UC6A 4XPAH 5A40E 1UQSB 2ZCHL 5EZIL 1HDMB 3KPTA 2R0LH 1X5ZA 1OM3H 1YNTB 1M71B 3FFCB 5BVJB 3F7YA 3UC0H 4O2CB 5EFIB 4PJXB 1A7RL 3U36A 4ELMF 3J7HA 1H3PH 1J8HD 4AQOA 4H8WH 1BBJA 2NPLX 3K74B 4RWYH 4V1DE 3WO4B 3TVMB 1ZHKA 1KBGL 4P5KA 2DWDA 5T5FH 4YHPB 2AK4A 3KLAA 3MUGA 3S34H 5L6YH 3WKML 3VD4A 1QSEE 4HZLA 4FP8H 4P59H 1U95A 3EJZD 1E4JA 5FM4A 4JFQB 4PG2C 1JUFA 1FGVL 4Z7WB 4PJ9D 5D72L 5GISH 3V0WH 3LKOB 3U4BL 2EYTB 2QSQA 4UTBH 3MX0A 1T1ZA 2B1HL 4XNXH 1J1XH 4IJ3B 2VTFA 3F8UB 3FFDA 4U7SA 3RZCD 4B0MM 1EGJH 3F12A 1L0QA 1FH5L 4WFEE 1C12B 3QZWG 4PJGE 1XZ0A 2C7UA 1G7HA 2QHRL 3ZT5A 4I18B 5FKPA 1T1XB 3DX7A 3VXMA 5CJQL 3CIQA 2Y25A 2BY1A 3DUHA 3ZKNC 3GHBH 2VH5H 1JRHI 5J89A 3HI5L 4G7YL 3CK0L 5I0DA 4OBSA 5I8KH 4P9HC 4PV8B 5T3ZH 4LLUB 2ZSWA 2BVQA 1PLGL 3KXFD 3RUGB 3A6BH 3V7AE 1G7HB 1GL4B 1L7TL 1A9EA 2FD6L 4QHMB 4P46A 3WJJC 3ORJA 1BVKB 5GGRA 2YOCA 4H0IA 5C71A 4HJ0C 2WBKA 5JW5A 1M7DB 1H3GA 1S7SB 2NLJA 2X1QA 3GNMH 5HYSB 2OZ4L 1FL5B 1A6TB 1QR1B 2P8MA 4ZG1A 3LD8C 1J0YA 4KROD 1OP3H 1NH6A 5T33H 4DFHA 3LQZA 3PUCA 1IAIM 1XFPA 1LWRA 1T3FA 3DETC 1AFVH 2FJGB 5J06A 4NPYB 5FKAB 2PYFA 2CDEA 2BVYA 3GSWA 4R7NA 1DTUA 1F02I 3TO2A 2NY1B 3OF6D 1HZHH 4OZ4B 3GHEL 4OZIA 1JL8A 5IFHH 4P2RA 2NTFB 2XG5A 5F9DC 1CQYA 3UTOA 5EUOB 3RZCB 1ZLVK 3WO4C 3CFBB 2IPTL 3CDFA 3TT1H 1N6UA 4TSCL 2R1WB 4AL8L 2NX5E 3JWOH 4IRJA 4OQTH 3ARWA 3ULUE 4PJ8D 5MEOA 4OZHA 2B1HH 3VFOB 1ZS8A 2BSED 4X4XA 1AP2A 2JJSA 3MACH 3MLUH 5D7JD 3RFZC 1DL7H 4OLZL 2NNAB 4CJ1A 3GMRB 1TQBB 3PGFL 2LV4A 3K81A 4WFFE 1C7TA 1MCHA 1FVDB 3OG6B 5FCUH 3D2UA 5F7FA 1RULH 1INEL 2CLRB 3B4NA 2ZUSA 2IG2L 4H25B 4OKVA 2DM7A 1KOAA 2XN9E 1ZEAL 3OBAA 1QQDB 2F74B 5ACMA 4DKEH 3MOAH 3RUGE 2JELH 2X4UB 1CDIA 2DIAA 4L3ED 1XGPA 4HIIA 3MLTA 3RWDB 1YEKL 3NIDE 3AREC 5IGXH 1MLCB 3B9AA 3GRWA 3VH8A 2X7LB 1S7QA 1XZ0B 1YNLL 1MNUL 3QI9B 1GIGL 5EIVA 4KPHL 4D0CA 5BCAA 1E4KC 1FBIH 3FB7B 5D2LA 1S8DB 3ZTNL 3LKPA 3ME0A 3JTTA 4HC1H 1MVFA 2XT1B 3SE9H 4N90D 1UKQA 2IBZY 3W9DA 5I1LB 2DQHL 8CGTA 3GJEB 4M7LL 1I7ZA 3EYQD 4YHLL 4DFIA 5ICZA 5BRZE 4UNUA 4ZUUA 3K4ZA 2D7NA 2P24A 3MJ7A 2CLVB 4KTEL 4YHML 1DN0B 3MRPB 5E08H 3HAEG 3RVVC 4MDIB 3RVXC 4KTYA 5I2IB 4HBCL 4LRIA 4XTRD 3GMOA 3MBEA 1GZQA 3HUJE 3D39A 2JB5H 1CFQA 2VNCA 5CD5C 1I1AA 3VD3A 1KCKA 3DRQA 3G5YB 4YNYB 2WIMA 4HFUL 4G42A 3D39E 1IC5H 3L3IA 1KENL 2Y07L 5J0BA 1BM3L 2AEPL 1T3FB 1ZEAH 1NBZB 2CRIA 5GHWL 1JGLL 5CINH 1JFQH 1Z6JT 5E8NB 2IMMA 1QLEL 1CXKA 4YO0B 3RZCC 4J3WA 3D69B 4P3CH 4NQEE 5GRXG 3SGJA 3QCUH 2XN9B 3G5YA 4PJEA 1CFSA 4FXKA 3GMLB 4ZXBA 3IFOB 1FP5A 3S6CA 4KPHH 4X4MA 4YGVB 2Y72A 5E99L 2Z91A 5IW1B 1LP9F 5FCUL 5E5RB 1QLFB 1XT5A 3T65B 5J6GA 4U31A 1TZGL 1NSNL 2NY4C 2I5YH 5I74C 4QRSB 4X5XA 5I1EH 4KQ4H 4TVPH 4PTUA 3ULVF 4XWOD 1VKXA 1U8OA 3VU2A 3NCMA 5HYJD 3OAYH 2NNAA 5D70L 3U9PL 1QNZL 1F4YH 1XF1A 4BKLA 5DD0L 4LPWA 1AQKL 1NMAH 4U0QB 1V7NH 4S0TD 2A6KB 2AJSH 5A2KH 1Y18A 3QQ9D 1WFUA 5D6CA 2XPGA 4E42A 2X5PA 1JF6A 3QIWA 1QSED 5DFWH 2NY2D 1M7IA 4WVRA 2YD7A 4IMKA 1I1YA 3QXTA 2YPLA 4YPGB 5CZKA 1QSFE 3MR9A 5C07D 2XTJD 1GC1H 4MAYD 4LLMA 5SV3A 4KMQA 3BP5A 1U2CA 2X4OA 3FQUA 3VWKC 4WEBH 1D5IL 2NYYD 4HGWA 3HMWL 1MCDA 2BVTA 1WFOA 3EBAA 1U8JB 4PJGB 2OTUB 4QRPB 5CMAA 3EOBA 3A6CH 2EDEA 3BP4A 1AGDA 2X70B 2VABB 3OKMB 4ZUUB 3RU8L 1TJIL 2QHLA 2BSSA 3B2VH 1FFNA 4APQA 3WFHB 1EHAA 1GVIA 4U1IA 2D4DA 2BERA 2BNQD 3QXWA 5F7LB 2H2PC 1O7SA 4JDTL 1LE9A 1WICA 4JQIL 4YAQA 3M1BB 5I71C 2L4OA 4PJHF 3RTQD 1OSZA 1J7VR 4PV9B 3S36H 1N5AA 3H42L 1Y0LA 3X3FL 3ILPA 1CICC 4QNPE 5F96H 3GSRB 2DTSA 2X70A 4XNXL 2E8YA 1ND0B 2DLGA 4QHUA 3ULUL 2AV1A 4M3KB 1BFOA 4GRWB 3C6SA 4I4WB 2JCCE 1AD0B 2ZJSH 3BPCB 3IXAA 4MXVF 2BNRB 4WV1B 2RGSA 2B39A 4ODUA 2QADD 3MGOB 1FNHA 2AEIT 2QSCL 4Z7UA 4KROB 4O5LH 4WUUD 4NNYA 4J12A 1FORH 5C92A 5I19H 1NGQH 2HT2D 4OZIB 4KHXL 3WE6A 1N8ZB 1ONQA 3RWEB 1NAMB 4OUUA 4ACPA 5HHVH 1WBXB 1I3RB 3LDBB 5C0CD 1JGVL 1MCPL 1NDGB 4POUB 3TESA 1EVTC 4ODUB 5DO2C 3BD4A 1QP1A 4LCWA 2ORBL 2FX7H 4ZFOB 2NZ9C 2MCG1 2DKUA 5GGSB 3QNXA 1JNNH 1N4XH 3Q6FA 1NCNA 3MLVL 5AD0A 1A1NB 2ZCKH 1B2WH 4OQ1A 1Q94B 4Y88A 3P0YL 4ZS6D 1FDLL 1MQ8A 1T1ZB 1CXLA 4M7ZC 2Q8AH 1YNKH 1SBSH 4U1KA 5D7LD 5T1LB 3U0WH 4TTDD 1T5XB 3LEXB 4ZXBD 5KTEH 3P40A 1I3GH 4GG8A 1QRNA 1V3MA 1CZ8H 3MMEB 3LRHA 3CJJA 4WI3A 1JHKL 5DRNB 3O6LH 5C0RL 2PTUA 1HH9B 4A6YB 3WJLC 4JFOB 4L8SA 1UXWB 1TJHL 2V7NB 5DRXA 1C1EH 4EIZC 1YN7A 1UENA 2DQGH 5I1EL 4YFDB 4AH2A 3BQUC 3E0GA 3HCVB 5BXFB 2FATH 2YS4A 3UTTB 4M8QA 4IDJH 1BREA 5K9KA 2EO9A 1JYXA 3RWGB 3QXDA 2AJZA 3W2DH 4S0SD 1U8MA 2B0SH 5IJKA 3I02A 1Q9OA 5DI8B 2BHYA 3SBWC 2VLRD 2HT4D 2PW1A 4LCWE 3X3GH 2UVFA 4OZGF 1EJOL 5C2BL 5GSVB 1KJ2A 5I1DB 2ZUUA 2XZQH 3QWOB 1NUNB 3P3YA 2Q7YA 4UBDC 1RHHA 3PDOA 4JFZH 5E9DA 4K2UL 4KAQH 4G6FD 4M7KL 3DXAA 3QXDB 5AZ2L 3VG0L 5IHZA 5F1IA 3DSNA 3QDAA 1RK1B 5IR1A 5FYLE 1BVLB 3KPNB 5FAAA 4AEFA 4M00A 2ICWJ 1JHTB 4Q9RL 5ENWA 1CI5A 1OPGL 2O61B 3DHMA 4WHDA 4DVBA 5FOBB 3RI5F 2Q7YB 1P7HL 2R1XA 1BQLL 1FNEA 2OJZL 2WWKO 4JAMB 1NMBL 2YN5A 1ETZA 4M6MH 4V1DD 1XR9B 2ED7A 4YC2C 5JMOC 4OLUH 4MAUL 3MV9D 4H1LA 4MCYB 1UYWH 3NZHH 2VYRE 4PB0H 3WEXB 2UYLA 5L2JA 4X8JB 2MHAA 1BF2A 3UROR 2X1OA 1MHCA 4Z95L 2Y06L 1T20A 3B8SA 2VZOA 5HD8D 4RIRB 2AXGA 4M43L 4J3UA 5E2TL 1H3PL 5D7JA 4FZ8H 1NEUA 5ITFB 3U82B 4KY1L 3L9RA 3KPLA 4IDLA 3C5ZC 3O6LL 4N0YH 4YDLB 3SE3A 3SJVE 1R5VB 3VFTB 4KJYA 1EBAA 2ICEA 1U2HA 5KSAC 3C60C 1S5IH 5JNYB 1YEDA 3DIFA 5BMFH 5KS9A 4P59L 1DUYB 3VFRB 1FSKB 3BRFA 4YEFA 3TBWA 3NIFF 5T5FL 4Z78B 1S7TB 1E0OB 4MNHA 3UPRB 2DI7A 3RKPA 3P4MA 3BUYB 2Q6WB 5GGSY 4MGXA 3TYGL 3U1SL 4NWTH 4J3OC 4BQCA 1AGCA 4ESKA 4CADB 2BDNL 2V2WB 1R5VA 1CG9B 1A7RH 4NKOB 1MFBH 1RJCA 1I7ZB 3SJVD 2DIBA 2P8PB 4J2XA 1EX0A 2BNRD 1FAIL 2FGWH 3I75A 3L5XH 3DHJA 1MFCL 1PFCA 2NY2C 4PUBL 3BIAX 3BQUD 4TVSa 3QDJB 5I18H 3C6LA 4QGYA 1MF2H 3VXPB 3T09A 4Q97A 4KKBC 1U8QA 4HXAL 1DUZB 1WLHA 3C2SA 1NBYA 3TH3T 4LEOA 2OK0H 2WNGA 1XAUA 3O2DA 3GHBL 4C56A 1C5CH 1MCIA 1TVDA 5KVGL 2VRAA 4LL9A 5DRZB 2IGFH 5JXAH 4OV5A 4U4BA 2OQJA 2QQLL 3ZZ1A 2RR3A 1A6WL 5JPNB 3KYKL 4TTDC 1TZHB 3SCMD 5KJRH 2NY4D 4LSRL 3ZDZF 3KLAB 2YSSA 1UB5A 3JSSA 3IJHB 4NQDD 4XPBL 1ZHKB 4FA8A 1ZXQA 2VZVA 4LVEA 2ICWI 2QLVB 3H9YA 6CGTA 3O2VL 3VXRE 2IF7A 2R56H 4KVNL 4LDLB 4NZJA 4MQ7B 1EEZA 1Q8MA 3K8MA 2LABA 3KPMB 2R1XB 3X13B 1BFVL 3L7FB 5DDHA 4OZFH 5INDB 2E9BA 1FYTB 4XXCA 1QR4A 4WJ5B 3GUTB 4XVUC 4UQ2B 3ZL4L 3VD7A 4KXZH 2DWEA 1MFBL 5HYJE 3JVGC 4IIQB 4M1DH 4TQEH 1ZGLP 4Q9QL 3B9VA 1MF2L 5CJBA 5IB5B 1R0AH 2JIXD 5IWLA 2W60A 4U3XA 5F1SA 3IS0X 4F15C 3HRZB 1AKJD 4PJIE 3VI3E 5EZOH 3HMXL 3IDNB 1J5OH 4XMPH 4M43H 3HKFA 3O3AB 2F54D 3O6ML 3LN5A 4N1HB 4PGDB 5KN5A 5FYJD 4NO3A 3CCHA 3KJ4B 1Q94A 4G80B 4B50A 3HR5A 3N1FC 4OFYA 3SGDI 1IZJA 3P77B 2BVEA 4JFFE 2VZ3A 4F80A 1T03L 2R0KH 3SDXA 3NZHL 2R2BB 4J3VA 3W9EA 5B39A 4AQ1B 4OZIF 2HLFD 3WFHA 12E8H 4KI5C 4OZIE 2EE6A 5CJXA 4CMMA 3MRRA 3VRJB 4NKIL 4Y5VA 1JFQL 2A83B 5EZIH 4M93B 3DURA 3MV8A 3UZVB 1UM5L 3P4OA 5HI3C 1VB9A 4GSDH 1IE5A 1K8DB 1YEFL 5BRZA 3V4VH 1FZKA 4MJ6A 2BNQE 3WFEH 4LSSH 3ARED 1UXWA 1BQHB 5D71L 4F58L 5GRZA 1S9XB 1Z9LA 1JPFB 1NEZG 3O9WC 5T3XE 3EYVA 4G6AD 4LHUG 3N06B 3IXTB 1A7PL 2E3VA 4XP6H 3RVTC 5I15L 4YQXL 3RPIA 1YYLH 1CE1L 1MRCH 2NXYC 4ZO7A 3KYNB 4NQEA 1U8NA 2C3VB 2FECL 3D0VB 2IH3B 5DHVB 5FM5O 4LLDB 5HGBB 2MWCA 4RBPK 3VGGA 5DVNA 5HHQB 1LK2B 2CDGB 3LKSA 1KJMB 3QO1A 4EN3A 4JM4L 3ZHKA 1WAAE 1IEBB 3O8XC 2JE8A 4S1RH 4X0KA 5F70A 1J1OH 4IDJL 2OM5A 4OSUL 3W0WE 3VFOA 1D5XB 1HSBB 1Q9KA 3IETB 4OUOA 2A77L 5IIEB 3QFJA 2XV6B 3EIFA 5AWNL 4XNZC 3T1WA 5F88A 3C2AL 1P5VA 1BBJB 1Q1JL 2IH1A 1B4JH 3RWEA 3OGCA 5F9WC 4W6WB 1GGTA 2DBLH 4K71C 1BMGA 4BQBA 5LQBL 4Z7QE 1R3KB 2ADJA 3LCYA 3V7MA 1XGPB 4HIIB 2QBWA 4LSQL 5FGCE 2OX5A 3EFFB 3NACL 4P5MA 2ZNWA 2BFVL 1DBMH 4NBXB 1A7PH 5LGJB 8FABA 2EYTA 4GAYB 2YWZA 2HJFA 3RVWD 4F9LC 4NQCA 5ESQB 4D8PB 3WEXA 2R9HC 1UZ6F 3OXSB 2E27H 4F8TA 5DJAB 4HCRA 4LCIH 5D8JH 5EOCJ 2E7LC 5ISZE 1CE1H 1MRCL 3W2DL 2MQ3A 4MNGE 4Q2ZB 3QWQB 2W65B 2H41A 1WAAA 3U7YL 1FCGA 4P23D 1RZKH 2WBWB 5CZXC 3HR5B 3JV0A 4BK5A 2BSRA 3CXHJ 4XP5H 1ZANH 2Z31A 3L95A 2ZOKB 4E41B 3TJEL 5DEZA 1Q0XL 3RI5K 1D9KA 1EXUB 4PV8A 3DUUB 1X5AA 3QWOA 4U1GB 1IMHC 3QA3B 2KBGA 3QUZA 1RFDH 1DL7L 4OLZH 4L8BA 2VN7A 2X1PA 3G6AA 5J9PA 12E8L 1TCRB 3CDYA 5IMOB 2VSDA 2F8XC 1BVZA 4NQVA 4PRHD 3M17A 2WUBH 4Y4FB 3EO9L 3RWGA 3W11C 4JANB 3DECA 4Y5XA 3ROLA 3VXUD 5C0NC 4RDQG 1OP3K 3WD5L 4OLEA 1J87A 3HZYB 1HCFX 3GSNH 4FXKB 1H8SA 1KN2H 5FXCH 1GGYA 4HKZA 4GAGL 2LTQC 4OSUH 1JGEA 1RV6X 1T89A 3V6ZB 1HWHB 4TUOA 1DBJL 5EOTB 2Z91B 5KW9L 3O8XB 3OMZA 5ISZD 3ARTA 1MHEA 1U6AL 4JZOB 4K94L 3G08B 3U7WH 3IFOA 1WTGT 3ETBF 3TO2B 1F2XK 5IFAL 4DTGL 2W9EH 2IAND 1NCWH 5T3ZL 1RZKL 1MVUB 4PJFF 4X0KB 3IDYB 2FIKB 1VGEL 1J0HA 1MCLA 3KPPB 4LVOB 4GRLC 4L3EB 5B8CC 5IW6A 3BKJH 1H3WM 4HWZA 5KBNC 4QTHA 3MRMB 2OTPA 2XWBB 2NY0B 3BH8A 5BMFL 5KANI 4WENB 4UNTA 5A16B 4QYOA 1J05B 3QIBA 3U30B 5MENE 2IGFL 5JXAL 4PJ7B 3CAFA 4P3DA 3F12B 4XZUB 4YDIH 1IQDA 2HVKA 1RURL 1UH2A 3MGAA 2XXMB 1P7QB 2ZUVA 1DCLA 3VRLF 2GFBA 4QRPD 4ZYKA 3UPRA 3VDBA 5FO8B 1JN6A 1L9MA 1EA9C 1KCVL 5ALCH 3HUJF 4NP4H 4KZDH 5DZOA 2XKNB 5SV4A 4KWUA 1YEIH 3DSFL 3FQWB 2ICEB 5D1XD 4UOJA 3CPLA 4QOKA 5EPMB 3U2SB 1T22B 4FG6C 1UJ3C 4O02L 5CD3A 5DC9B 2L0DA 3O2DH 2C3WA 4BSVA 5F3HB 5ECJE 4FFWD 1FGNL 1S7TA 3ZSTA 5I1JL 2CO7B 2R4SH 2MPAL 3ZDYF 2P7TB 1RU9L 5E2UL 2COQA 1HI6A 1FLTX 4JQXA 2GT9B 2FBJH 3MRNA 1P5UA 1ORQA 4G8FA 3QUYA 4HDIA 4HJ0D 4MJIB 3QIBD 1WJ3A 3LH2H 4QXWA 3BE1H 1U91B 4Y8DC 4F15B 4XC3L 5D7IE 3ROOA 1JHLL 5JDJA 1TCRA 2FH8A 2ILLA 3DV4A 4DGIL 4LSUL 1WIOA 4PJ5E 3QNZB 1BFOB 2AJSL 4PRPD 2MQCA 3QSKB 2XKSA 3SOBH 1LDSA 1Q9WA 2OZ4A 1QFWM 4KK5C 1RUPL 4A2LA 4YHKH 4EJ1C 1D6EA 4MQXC 3FOMB 4ZFOL 5FOJA 4JPVL 4RMSA 4WIQA 3QAZC 4XVUD 1URLA 3SDAD 4GKNA 1RJLA 4FRWA 1FSKC 1IGFH 3JV6A 4PB9H 1EJOH 4AT6A 1LE5A 4JR9L 5FDWB 4PGJA 3KLHD 4ODHH 1MCWM 4KKCC 1LDPL 5DQDH 4LSTH 5DD6A 4U6VL 3QO1B 5IMLB 4HGKC 3SGEI 3TNMA 1B6DA 1EEUA 3RWFB 3WXWH 2OR8A 4OZHF 1GZPA 3CMOL 3IJSA 1JPGB 3IS1X 3QISA 3SCMC 1GXEA 4P2QA 1U8HB 5SWQA 4ZUTA 4M03A 4PGBB 3VXRD 3QT2A 1CGVA 3S9DB 1TJGL 2C9AA 4HZAA 3ZKXB 1OGAE 3VWJB 3HC4H 4Y16A 4YHIB 3V4PL 2R1YB 4D2NA 1YA5A 2F15A 5IMKB 5JO5A 2HRPL 3HLAB 5DYOA 1GPOH 3JTTB 4NNPL 3QJFB 1WZKA 1SEBA 4HAFA 4MA7H 1DDHB 4BSWA 3P9MB 4GXVL 3LKQB 3D9AL 3GK8H 4JFFB 4MA1B 3RDTA 3P11L 4LBEA 4UNVA 1INQA 4YWGL 4G6ML 1OT1A 3E2HB 5C0AD 3T0AA 3FAWA 2XTJB 3H3PL 3U0TB 1DQQB 4K9EC 1B0WA 4XP6L 1J11A 1RIVH 3GO1H 3P77A 1FORL 1EVUA 4I5BB 4YHNB 5FKPB 4AL8H 1I4FA 3UZQA 3V95A 1AQDA 4PJAB 4BQ9A 3L3KB 1NL0H 4U1JB 5IQ9A 2BVQB 5E2TH 3REVA 1HHGA 4EI6A 1JGDB 5DURD 2VLKD 3C5ZB 4PJ9B 1NSNH 4UT6H 4GW1A 5IROC 4UQ3B 4NHCL 2H26A 2R2EB 4HCRL 2IH3A 4OB5L 3DRQB 1CFBA 3BFOA 1C7SA 4S1QL 3RHWF 5C08D 1IFHH 3LVEA 1FZKB 1RULL 3C60D 3L95B 4E41A 2VDKL 4NO5A 2UY7A 5DEGB 2ZUQC 2VXUL 5GZND 2AEWA 1X4XA 4KHXH 2V17H 3AM8A 5IHZB 4ELKA 7FABH 5EN2B 5CUSL 3VFPA 3CLEH 4ZFZA 5GS0D 4DVBB 1T2QH 2R15A 3MA7A 3VXME 2G5BB 3KLDA 3X14A 3GSNB 1JZ8A 3NABL 4F57H 3BP7B 4P0DA 1DBML 3WFBL 4LLQB 3PWPE 4G9FA 3K46A 1RIVL 3GO1L 4JFDE 4JO2L 2CRZA 5L0QB 4J4PA 4N8VA 2WMPA 5DJCA 2K7QA 3VH8G 2AXFA 1WWBX 4CU7A 2G9HB 2HLAA 4RMTA 1FLRH 1BD2B 1UJ3B 1YUHB 3FQXA 2HG5B 4HMEA 3E3QE 3LKRB 1W0WB 3GMQA 3T1FA 1PG7L 5I8OL 1DP0A 2DOCA 5HYIA 4H20L 1LP9A 2ZUWA 5HI4C 4XAKE 3IU3A 4JFEB 1KCUL 3CZFA 3OG4B 2ARWA 4AZ8A 5MEPA 5IF0B 4LCUB 3BP6B 5CIPA 3UTSD 4LGRB 3V8OA 4NHUA 2EKJA 1S7VA 1D5BA 1YPZB 3H3KA 5CILL 5FUCE 3FN3A 4DGYL 5ESQA 2CDFA 4CRPA 1I7UB 4KI5E 2BMKA 3WS3B 3HB3D 1NFDE 5DMKA 3K2UH 2H2SD 2PR4L 4QRTA 1VDGA 3O3UN 3QO0B 2NXYB 5C2BH 2BY2A 4C4KT 4KKLD 1HYRC 4CKVX 1FJ1B 4YQXH 3LKQA 3G9AB 1J1XL 4GG6F 1D5BB 2JTDA 2VITA 3MMEA 3DWTA 3H0TA 5AUMA 2JIXA 1XGTA 1CLZL 3V5DA 4X5WA 2IFGA 2AJYL 1S8DA 1AHWA 1XIWD 3UTTD 4HS8L 5H8DA 4LKCB 1EUUA 1IGMH 1DUZA 5F3HA 5CJQH 2V5YA 3UJTH 5MERA 1NMCC 3SDAB 4R97C 2FEDD 4PY7A 4FTVB 3OKYA 5GS3A 1RZJC 1TZHA 2QQNL 4TSCH 4PLJD 3CNKA 2CLZB 3MBXL 5BV7L 2UV3A 2OQJB 2FX8H 1PEZA 2EXWD 3T4YB 3T3PF 1XF5B 2NY6B 4WEUD 3MJ9A 5D70H 5FK9B 5EU6A 4PB0L 1A4KA 1L9NA 2ITCB 3ARRA 1FFQA 3W0WA 1IAOA 5TDNB 4PYHA 4PJHA 2C3XA 3PWNA 2PR4H 4JFPB 5F9JA 1MHEB 1WZ1L 3IAQA 1LO0H 5GRUL 5CILH 4G42B 5KSBA 1ZWIB 4MCZA 3BO8B 3I6GA 1CGSL 1NAMA 2FDBP 3GI9L 4OUUB 3HG1B 4X9BA 4TTGA 3AU1B 2R4SL 5E8EB 4XPTH 4XCCL 5AZEH 4LSSL 5IBLC 4YDJA 2AEQH 2DLEA 3MO1A 2W60B 5FGBC 1V3LA 4GG6A 2Y5TA 2DWEB 4LSPL 4F7EB 4JFDD 3VG0H 5HYFA 4PYGA 3IVKB 5DQJA 1EEQA 2NY7H 4GQ9H 1QZ1A 1KFAL 4RZCB 4X4YA 5BO1H 5FB8B 4HWBH 1W0VB 3AREB 2GJZB 4NFBA 3BPLB 2R0ZL 3HE7B 1EZVY 3I50H 3B9KC 4N8CL 1UM4L 5SX4I 4Q0XH 3EOAA 3MFFA 3QUML 1CXHA 3EDEA 5JIPA 4FMFA 4C83B 5IMLA 1QFUL 3DRTA 2AW2A 2LQRA 3OKDA 3UYPA 4NDMB 4NQXB 5FB8A 1RSFA 4JLRA 3NZ8B 5GGVL 5IFJA 1LO3H 3EYFB 2LU4A 3L6FA 1OP5K 2G60H 2I07B 2ZJSL 2PNDA 1VEMA 3FKUS 2DBJA 4UOW0 3TZVD 2A2QT 2Z8RA 1FIGL 1PG7X 5TE6L 4X80L 4OLWH 3PV7A 4WHYG 1GGCH 3HFML 3TBYB 5LGHL 5JDSA 1CVSC 4MDJB 1QSFA 1IGIH 1X5LA 1NC4B 2VDPH 2PO6B 3B5TA 5D93C 1RZKC 5GISL 4YBQC 1CBVH 4PJ8B 4OCYL 2EIEA 5CINL 2A6JB 3CFCH 2BNUA 2GEEA 3G6JF 1X7QA 1ORQB 4NGHH 4OIIL 1DE4B 1G9NL 4U3HA 4P2OD 4KK9D 2P8PA 4JM2D 1PX4A 5DFVD 2ZCKL 1TTGA 4NRYB 4BH8A 2FIRT 4NM4L 1B0GB 1FQ9C 2AXJA 1TMCB 3QQ9C 3QI9C 1MRDL 3ZE2F 3UX9B 3VFNB 1SYSB 2WWMC 5GIRB 5KTEL 2GJ6A 1BOGA 2FR4A 1IKFH 1RFDL 5GS2H 2WLYA 5E03A 1SEQL 4Y4HC 1SY6A 4G9FD 1GSMA 2W92A 4PP2A 1W72L 2D0HA 4NNPH 4F3FB 3QH3B 3P30H 4HLJA 3DLQR 3NOIA 3RQ3A 3O4LD 3PWPB 4DUVA 1G7LA 3BYYA 2QQQA 1EBPA 4E0RA 3D9AH 2OZ4H 3GK8L 4ZUTB 3I50L 4XHQA 1F58H 4WV1A 3TEUA 2EH7H 1IFHL 1BOGB 2FR4B 2ZSVB 4NYLA 5F89B 3V5HA 2LTQB 1BJ8A 4HH9B 4PP2B 1P1ZB 3DYOA 5CBEA 3SDCC 1CBVL 1FV1B 2DQFB 4IRZL 3WNLA 2Z9TA 3BXNA 3SKOB 2F19L 4YWGH 1JPGA 3BDBA 2BOBA 1K3ZA 5BZDB 2VDKH 4XPFL 4PREA 1T0MA 2YUVA 5AD0B 1N0XL 5KS9B 3QUXB 4OLWL 2FEEL 1OVZA 3VI4E 1LO0L 4U1NA 1YECL 2I24N 3MV11 2EE9A 2YPVL 5CD5D 4AEIH 2VLKA 1UM4H 3QHZL 1DBBL 1CD9B 1LP9B 5CSZA 2F54B 1MCEA 2FHCA 1QQDA 2F74A 3IDUA 4XCCH 1M6OA 1T5XA 1HQ4B 3SBWA 2HT3C 3LRSB 4U1KB 4LSPH 1AXSB 2XFXB 4OIAA 4KZEL 3LZFL 5A43C 3CH1A 3QFDA 1ODAA 4ENEC 2J8HA 5TF1L 3ARBD 3MCLL 4GBXD 2V7NA 3HC0B 4ODWA 5JHDD 4I2XE 2PO6C 2VERN 3EO1A 4OJFH 3QQ3A 5LAXB 3S3PA 1VA9A 1T7WA 5ANME 1HYSD 3QQ4B 1G7MB 3BT2H 4KJWC 5C0CA 5DJXB 1R3LA 4O4YL 3U4EA 3FO1A 2PYEE 4NO2B 5E8PA 4LIQH 4K55A 3C6LD 2V7HB 2JK5A 1A8JH 1DBKL 4D9RD 1ZLUH 4PJAE 1G0DA 1T4KA 1YNLH 1QLRB 4WUKL 3SDYH 4WUUA 3BGMA 1ULVA 5DI8A 4CBPA 3DTXB 3RRQA 2EC8A 4PGZA 3PDOB 1ZS8B 4FTVA 3RIAF 1ADQA 3QDJE 4N0UA 4Y5YC 1AI1L 2VLJD 1P53A 1PW3A 4M7LH 1H0DA 4P57A 1G7IA 4XC1H 3T0XA 4G8GD 5D7JC 5DMYA 4LSDA 3SDDC 3UTSA 3N9GH 2CXGA 4K07A 5E00B 1SJXA 1XCTB 3W82A 4FN0A 2P1YA 2EZ0D 1MWAH 4D9LH 3ARPA 4U49A 3LD8B 3LY6A 4BYHA 1QVOB 4XCNB 1I9EA 3Q3GA 5E8OA 5I9QB 4YXHH 2Q3ZA 2IALA 2GFBB 1EFXD 4J6RH 4HUVA 3P9LB 3WL9B 3DVNB 4J7RA 1P7KA 2ESVA 1DBKH 3UJTL 1KTLB 5C0AE 5IVNA 4N68A 1II4E 4MAYA 3WUWG 2D7TH 4LAQH 4N90E 4YUEL 3SKNB 3EJYC 4Q6IA 3DETD 1LO2L 2G75B 3S96B 5EIQA 3QPXL 2Q76A 4V1DA 1TLKA 1IGTA 2AXGB 3FRPG 5C09E 4KROC 3B6SA 4HUKB 5F3BB 2KZWA 4XRCA 4GKSA 1UGNA 4G6KH 4KRMB 3C6LC 2BNQB 2VAAB 2W1NA 4HIXH 4DOHE 3CVIL 3L3HA 5ITBH 3EYOA 5JW4R 3OQ3B 4FQIH 4HEPG 4P46B 1EEYA 4R2GB 4PJGA 1YJDC 3IDXH 1UCBH 4RAVA 4HT1L 2PO6D 2VXTL 1DR9A 5C08A 4LAJH 1K2DB 3JWOC 4ENED 5M94B 2NX5A 4QTIH 4DGVH 5F1OB 1ZTXL 2EDXA 3R1GL 5D72H 5GQBA 3RKDD 3T0ED 1ZVHA 4D0DA 4NKMB 4YFEA 2VXVH 3ZKND 5BJTA 4I48A 3FT4B 1FO0B 4AMKH 5IESH 3T3MF 2BY3A 3S98A 1VCAA 3FB8A 4NPYA 5FKAA 5INCA 5HHPA 2J5LB 4JANA 1AE6H 3KPOB 4EI5D 4JY4B 3C6SB 1DSFL 2JJSC 4WRLA 1I7RB 1FZMB 1I75A 1G6RA 4AENA 2CMRL 1FRGL 1A6UH 5FV2A 3UTZA 4JN1L 3WIHH 1U92B 4HJJH 4PJ9C 3UMTA 3RHWK 1EMTL 4QRSA 5FHAH 5JPNA 2J12B 2FNBA 3MSPA 4HKJA 1ZT7B 4WTZG 2YSSB 3WDJA 2OSLB 1L0XA 1G9NH 5JORB 4HPYH 3B9EA 3JV4B 3D39D 3VXRA 1P4IH 1E4XH 4JO1L 4Z8FL 4OGAC 2DMBA 3UTZB 4ZDHB 32C2B 5EC1A 3HZVB 4EVNB 2I9LB 3MLXH 5J11C 2NY0D 2XA8L 1DBJH 2HH0L 1U8LA 1HQRB 4UDUA 1I1RA 1KV3A 4GG6B 3VMNA 3L7FA 4R0LA 1MRDH 4JPKH 4M02A 1OTUC 2EEAA 3QIUC 2EH8H 5F1KC 1MJJA 4WJ5A 1HSAA 3GMMB 2VDMH 5LBSH 2NZIA 5JHDA 5CJ5A 5IB4A 1DDHA 3E6FB 1CXEA 5MI0B 3QXUA 5E2VH 3I6LE 5E2JA 1EH9A 3JWDH 3UJIL 4ZAKD 3IFPB 2F8VA 4ISVB 1FYTD 1I7TB 4WWKC 3K3QA 5DJYB 4AG4L 4JFYA 5ELIA 3QI9D 4HUUB 2OP4H 3L5XL 3BEWA 5J13B 5IFJB 5KSBF 5GGRB 3RWIB 4G7VH 2HVJA 15C8L 4X6DF 3OB0K 5IQ9B 1QA9A 1KN4L 2HYMA 3DX8A 5DFVC 1JI1A 3B6SB 4PGDA 4WFFD 3MBEC 4RGMB 3BH9B 1S7UA 2EDQA 4ZFGH 3CVHB 4N8VG 4KU1A 1AQKH 1NMAL 1NKRA 4KK6D 5B3JE 2KDGA 4JG1L 3QA3A 4FABH 2H8PB 4JFYB 2X4NA 3UC0L 4MSWA 1FL6B 4DZBB 1RIUL 1K8IA 1B4JL 1F97A 5ESVB 3WXVH 3ILPB 2KKQA 2WBJD 3BSZH 5I2IA 4BK4A 3BKYL 5F7WC 2LVCA 4OZ4A 3BHBA 1BAFH 1IRAY 4G8IA 5CJOH 5TF0A 3EW3B 4O9HH 4YUEH 3VXSD 1KXQE 3WN5C 5FYKH 1DQDL 1ITBB 1OAKH 4CUCA 3NACH 1JZ4A 1AXTH 3J8F7 4M5ZH 2YMXL 3FQNB 1FNGA 2V9TA 4F33A 4JZOA 3P4OB 2DQDL 1MQKH 4ONFL 1K8DA 2P46B 2PN5A 5TPWL 2R39A 1JPTL 4HWBL 1AGEA 5D1XA 2D03H 1YEIL 2R8SL 1TXKA 3M07A 1VENA 5BW7C 2IPUG 1MI5E 2D7QA 5EU3A 2SEBB 1OAYL 4R4BB 3QFJD 5K9OB 1H3XA 4PJXE 1LHZA 2EDLA 4ERSL 3NCYS 1VPOH 3KPSB 1W0WA 3GMQB 3T1FB 4XI5C 4ZO8A 1BQUA 43C9A 3RBSA 4LP5A 5IW3A 4PJXA 3U36B 4OCRH 1PAMA 4UZGA 4PJDF 3IKCA 1K5NB 4Z0XB 1KPUB 2OSLA 3CX2A 3PXJA 2L7UA 1ZLVH 1A0QL 1LO5B 1KPRA 3C08H 4IMKC 2W07A 3TGXA 1A6WH 1KIUA 5SWZA 1BZ7A 4QHNA 1E27B 4BKLB 1NJ9A 2J4WL 3SDYL 1HINH 2QKIA 4JGMA 3RVUD 2QR0B 2R0KL 1LD9B 3OJVC 4DQOL 4JO1H 4Z7WA 3LS4L 4IRJB 1AH1A 1EO7A 2J5LC 3PDGA 4MHHG 2C3HA 5EO9A 5FYKL 5HHXL 5FDYA 4GMSL 3CFEA 3QO0A 5MP6L 1D5MA 3Q0HA 4I18C 3M8OH 2L7JA 4DN3H 2YD5A 3JWDC 5KSBE 1I1YB 1A3RL 5E5UB 1A14L 5FHAL 3EYUL 4OFIA 3WUWA 3KYOA 3NIGE 4JVPA 5T5NG 1RUPH 2HJFB 4IOSD 5H94A 3TIDA 4IMLB 5DD3H 1A9BB 3HUJA 1KIQB 3VFGH 1CGXA 1EO5A 3CDGA 2XZZA 4GAGH 4RMRA 5FF6B 1LEIA 4M1DL 4I9WE 3NH7L 4TRPL 3MRCA 5C0AB 3QDHA 5E8DH 4XH2B 2DQUL 1BJ1H 4FQXA 1DANT 5I73C 4NN7B 4Z7OF 4P4RB 5C8JB 1INQB 3WUWB 5DEFA 3VWJC 3GFUA 3EUUA 1J12A 3KYMB 4P3WA 4MSWB 3QPQD 5DMGC 4Q9CA 1JI2A 3CFJB 1BFTA 3UAJD 1PQZB 1WT5A 4XVSL 1K3IA 1JTPA 1J0ZA 1CG9A 2G2RA 5DQ9B 3I6LD 3VI4F 1OGAB 1JHTA 2DKMA 1HIML 5BS0A 4MMXC 5AWNH 4KDTC 3ZHLA 4WI5A 3PL6D 4OF7A 5EC2B 1G7QA 3LPGA 4Z0BH 2NMSA 3E1F1 1CFVH 2P5EE 4QOKE 4KDVA 2CDEB 4Y5XB 3ROLB 3H7BA 1MPAH 3HE7D 1F4XH 3R8QA 4ZUWB 5D5MF 4PJDB 3G5ZB 2UYLB 1WBYA 5DK0B 3QDGD 1X5XA 2JCCA 3T77B 2YD2A 3MQIA 5EU3B 4MB4A 3G5XB 2ZCLH 3OKNA 2ZPKL 2ZUYA 4WEBL 4YFLI 1UCTA 2VJXA 5INDA 3UYRL 3BOVA 3MNZA 1PYWB 1T66D 5F1NA 3O45A 4FQQA 2BC4B 4FQPA 4XP1H 3N50A 1C16B 3VFWA 4MWFA 1NFKA 3PDDA 1KACB 2V5RA 3MNVB 5L0QC 1YEFH 4P2YA 3QUMB 5F7DB 4HC1A 3PQYB 2Q8BL 1WWWX 5ID1A 4NZUH 4HMCA 1BD2A 1UJ3A 1YUHA 4PJ5A 4LDEB 2CO6B 5ILTL 4O2EB 1INDH 3PGDA 1QEWA 4JFED 4PLKC 4NDMA 3S36L 2H45A 1RPQA 1ZGLB 1C8PA 2OI9C 2X4SA 3BQUA 1J0IA 1OAYH 4ONOA 2V5TA 3ILQC 4DAGL 3BP6A 4CVWA 4NCDA 2F54E 5A2LH 1YDPB 4P2OB 4MLSA 1AR1C 1A1OA 4UI2A 3UPCA 2Y07H 1X5FA 2ADIA 4PRHE 2X7LA 4ONHA 3VFUB 5DUPH 1P7QD 3S35L 4XP4L 3RIFK 2AQ1A 3GB7B 3QCVL 1VFMA 3HCVA 2ZCLL 3OR7A 1VEOA 1YMHB 5F9OL 4KK6C 4UUJB 5F7KC 2W0KA 4X9IA 1KTKE 2W0FB 1HH6A 4JPKL 1KEGL 3O6KH 3KJ6L 1OTSD 4HQQL 2X1WL 2FLRT 5SX5K 2P7TA 3MV7D 1B0GA 1WF5A 1JYVA 1KB5A 3KWWA 5J8OA 1SJVA 3U46A 4Z7NF 3FOLA 1U41A 4I8DA 3FHQA 3MOBH 4YBLC 4RAUB 1S78C 4L4TD 3N9GL 2DJUA 1M71A 3FFCA 1A64A 3GIVB 3ULVC 3F7PC 1SBBA 3SQOH 1GRWA 5B39G 2GITB 2R2HA 4B41A 1KELH 2V2TA 3NFPA 4G3YL 4HBCH 3GBNL 3S8WA 2DI9A 2NR6C 4UILH 3MA9H 2OL3H 5IGXL 3KPQB 3HNSL 3MRIB 5EOQL 4F3FA 2UWEB 4JRXB 5JOPD 4FZEL 5EU6B 1FIEA 1MWAB 1NCBH 4L4VA 4ZD3H 5E8NA 2DD8H 4M1GL 4RISH 2CKBA 4OGAD 5TDNA 4K7PY 3ESUF 4NKIH 1TVBB 4FNLH 4PRPB 2PYFB 4URTB 1OB1B 2IH1B 3TZVA 3IGAA 1U3JA 5DA0B 1CU4L 4LPVA 1N64H 4XVTH 1T03H 2DQFA 4AEEA 3C60A 3OAUL 5F8RC 4JFEA 3O6FB 2Y1VA 5I1KH 5F1NB 1R24A 4JG0L 5F9OH 1XCQB 5DHXB 3RZCA 5J6GB 3WLBA 1C16A 1I7TA 5EA0L 1U8LB 5D1ZB 4DAGH 4GW4B 4P5MB 4W4OC 5FYJU 5IHLB 3IFNH 5F44A 3ZLQC 3M45A 2ADFH 3MRQA 5EUOF 1OSPH 1FFPA 1DANU 4P23B 2YK1L 3GBML 4OM0H 4KGLA 1NCWL 3BPLC 1X44A 1HSAB 4KK5D 4MJ5B 4K7PL 4HAGA 3MLSH 1RI8A 2FB4H 1PZUB 2B4CH 5ICXB 3UO1L 2H3NA 1SJHB 3MRFA 3NVQA 3W39A 2DLHA 5E95B 2EYRA 5JO5B 4P9HL 3CUPB 2YHGA 3DX7B 4J1UB 5E6IA 1I9JL 1M05A 2ERJC 4X5LA 1H3TA 2R69L 4DK6A 2WSKA 3I02B 3OL2A 1UXSB 2ADIB 1RJYA 2IANB 5J57B 4WW2F 2WWKT 2XWJB 5E94A 3AM8C 3MREB 3OKLA 4ERSH 1AD9A 1HXYB 1TZIB 1RZGB 3CXDH 3O3DB 3MGTA 1WGOA 4PRID 5B38G 4C56E 4P2QD 2ZG1A 1NGQL 1JMXA 3EYSL 3DMMB 4JFFD 3BGMB 3B9DA 3SJVA 1KPVB 3BAEH 3STBA 2FD6H 4WTXA 3RY5A 2Z31B 4XPGH 4HFWA 4FG6D 5SWSA 4A2MA 5ENWB 3ET9F 4YPJA 3QAZB 5DRZA 3VXUB 1IGIL 4H26B 3VWKA 4POYA 5K9OA 2VISB 4EQ3A 4H20H 3CU7A 2EIZB 1NC2D 3OGOE 1AC6A 3WIFB 3NH7H 3AY4A 4TRPH 4IRSC 4M9OA 1XCTA 2FL5A 3PV6A 3S3JA 3M8OL 4DN3L 4WCYL 5I75B 4RGNC 1C08A 3MACL 1CFQB 4HF5L 1NAMH 2PYEB 2ZKHL 4ELKB 2EZ0C 2VDML 5LBSL 1X5GA 2WQRA 4F37K 3V52L 1YEHH 4QHNB 2ATKB 1TTUA 2BVOB 2CLRA 43C9B 4PRPA 3BN3B 4JHAL 5HY9B 1QO3B 3F7QA 3P9LA 4OLYH 3WL9A 3GUTA 5EWIL 2X4UA 2XICA 4HH8A 3SCMB 1K5NA 1JK8B 4JDZB 4E0RB 2E8ZA 3KNBB 1OP9A 4Y2DA 3S96A 3RP1A 5HYQA 1G9ML 1KN2L 2VDNL 3QHTC 1VACB 2GCYA 2APTA 4XNZB 4E41E 4WNQB 4UIMA 5B3NA 3SDCB 4DKDC 2BNQA 4LOUD 3ABZA 3O41B 1PZ5A 5F3BA 4LCUA 2WUBL 1S9KC 3ZSSA 5DZLA 4L3CB 3B83A 3DMMD 2YZ1A 5DXWA 3V5KA 1BJ1J 2HH0H 3L3JA 5TE4L 5CD3B 1SQ2N 3MRDA 2EEDA 4Z8FH 5ITFA 4JPIA 3MNWB 4S1SH 3HHRB 4GFTB 4GG8B 3ARBC 2D7MA 2X2YA 4HIJB 1E28A 4F7TA 3OR6A 2YPLD 1HHIA 3GMOB 3QZWB 1S9YA 1CS6A 2PUQT 3TO4D 2B7DT 2HT3D 5EB9A 1MHPH 2JB5L 4V2BA 2VLRA 5DMJB 3VFRA 1KSRA 2CK0L 3WFCL 5I1HL 1RUQL 2VB5A 4GQ9L 1G7QB 3T2NL 1WC7A 4WI2A 1M7XA 3V6OC 4ODSL 2YKLL 4P23C 2A0LC 5IEKB 1TJGH 4X5WB 2UZYB 1U8NB 3WJLA 3TVMC 1SJEB 5ID0A 4G8GB 4NFDA 1ES0B 1YPZE 2PCPB 1KNOB 4IRSB 3NCEB 3OKMA 1U92A 1KJMA 2IQ9L 5K93A 4ZFGL 4MA8H 4GAJH 3UTTE 4XCYB 5HPMA 1DBBH 4U1IB 3DJ9A 3PWLA 2FCBA 1T1YB 3CVHL 3FONB 4Y19A 1J0KA 3O4OB 1KEGH 4U2YA 3CU1A 3HZVA 3VFWB 1A3LL 5B3JF 5EZJB 2AEPH 5C0GA 3VXRB 4JFQA 4NCC1 4EOWH 4OFDA 4FQIL 2G60L 2WAHA 2Y06H 4ZAKA 5DUPL 1MJJB 2GYSA 2VDNH 4I0KA 5K59F 2HA1A 1E6OL 2J1KA 3RWHB 4QRPE 1J10A 4Y4HD 5JTWA 3PIQA 1YEEL 3WFCH 3EGSA 4H1LB 4MCYA 4ZTPL 4DW2H 3ZDYE 4PGBA 3KHQA 2XKNA 1MCBA 4WHTB 1JYWA 3PQYA 4MZ3A 4JJ5A 4QRUB 5EULV 5MHSE 5E1AB 1ITCA 2XWTA 5DK2A 2YPLB 4XAKD 5EBLA 4ZPTA 2IALB 5KOVC 4ODTH 1J0JA 4NM4H 4AIZA 3MLRH 4UU9A 1D9KC 4L9LB 3G6JB 2GJZA 1EIBA 5GS2D 2IPTH 3TT1L 4P2QB 4U6YA 1SHMA 2FYYA 3UDWC 2G75A 4JJ5B 5JW3L 4KUCF 3WIHL 1CR9H 4ZTOH 1S7SA 4Y5XC 5HHOA 5HGDA 4ZFFB 4I3SL 4QHKJ 4XXDA 3GJFB 1WTLA 4IOFD 2Q87A 1AFVL 4XHJD 4OM1H 5TE4H 5K9JH 4X7SH 4O58H 4X7FC 2BJMH 1W72H 2P8MB 3D5OF 2DDQL 2EDHA 1JGUH 2V2WA 3T0EE 4JO4L 4KI5D 4TPRH 1TETH 5F6IC 2DM2A 2H1PL 1FYHB 4RMWA 3T0EA 1TIUA 2A6JA 5FYLL 4QKXB 1MCCA 3U30C 2AJVH 2NTSP 4WY7H 4Z7QF 1I9IL 1MIEL 1SY6H 4R96B 5F7EH 5FO9A 5FEBA 3P73A 1PG7W 4ZNEE 1A6ZB 1N6QL 4NZRL 5B8CA 4P46C 3WJJA 2A83A 2D2OA 2YXMA 4UQ3A 4PV9A 4N0UB 4WV1C 4NSKA 1ZT1A 3G08A 3QHZH 5T5NF 3RWCA 1F4AA 4Q58C 3U0PB 1YYMH 3TZVB 3PHQB 4FQCL 5F21B 4OZHB 4K7PH 4C57C 1KPRB 4CMHB 1ZVSA 3QXVA 1X6LA 4K8RD 5CSBA 2J3SA 3ZT6A 5IESL 5KVFH 1Q0YL 3QUMH 1GHFL 3X11B 1T1WB 4KRPB 3QNXB 1LD9A 1JNNL 3LS5H 1FC1A 3BH8B 4UV4H 1U93B 3GEWB 4WI8A 4P2RD 3DO7B 4WTWA 4NBYB 3C8KB 1A3LH 2VIRA 3CFEB 4PRDA 3KPNA 1U8IB 3ZMRA 3BRGC 5JIIA 2B5IC 5IJVB 1FRGH 4XMLH 1HZHL 5IMKA 2PYEA 2VUOA 4OGYH 5E08L 2CRYA 3MXWL 1RZIA 3N0PB 5SWSD 4DCQA 1R24B 3MUHL 3GSNL 1D5MB 1I3UA 4EDXA 2DM3A 3PP4L 1HQRA 2N4IA 3JBG7 2EC9T 1BIIB 5T1KB 5AAWA 2NY6C 5D2LB 1CGSH 1FV1A 1S7VB 1QACA 3MLZL 2UZIH 4ONGH 1ZHLB 2A6DA 4NHCH 1GGBL 4M62L 5J6HA 4PLJC 3VRLE 3ULVH 3MRKA 5EBMB 3RJDA 4EDWH 5DUBB 2AVGA 4DN4L 3QUYC 1UEMA 1MRFL 5HI5D 4DVRL 3C09B 1OWWA 3QDMB 4K23L 3MRCB 3H9ZA 4QXTA 3WFBH 1AY1L 4I77L 2BJML 2VDOL 2APFA 3EAKA 3O3DA 4BZYA 1FNSL 2EEBA 4FTVD 5I66A 3PWPD 4P4RA 2F54A 5C8JA 1WCBB 2I9TB 1EK3A 4GRWF 5D7KD 4Y4FA 5IWLC 2H1PH 3FT3B 1J8HE 1V3JA 4A6YA 5DUBA 5JLZB 4OCSL 4U6TA 1FZOB 1S7UB 4KKLC 3DVGA 5GGRY 4PTTB 3DPBA 1HQ4A 1A7QH 1HXYA 2NY5H 4NJ9L 4PBVC 1XF2B 4JRYB 3OWEA 1RUAL 5DJ0A 3RBGA 3D85D 4Y5YA 3WIFA 1DEDA 1UKSA 3MUY1 4OZFG 3SKMB 5IB1A 1KPVA 5A1AA 4PR5B 4WU5A 4OCRL 1YEHL 4XCFL 5DJ2A 3S97C 4NJAH 1FNFA 3QEQE 2GAZA 4HPOL 5CJXC 3ZKSD 4Y4HB 2VISA 4TUJB 1KCUH 3G5ZA 3QXAA 3UBXA 1HOCB 5C0EB 3MLZH 5HDOA 4LPYA 1NGXB 3MYJA 2AGJL 4G8EB 3A6BL 1MHPL 1N6VA 1A3QA 2Y4SA 2EDTA 2NTFA 3BD3A 4RQQB 2C1OB 4LVNB 1I1AC 5IOPB 2VXUH 5C07B 1N0XH 4PJFB 4XT1C 3TT3L 3RWFA 3LB6D 3PWLB 4Q6IC 4S1QH 2P42B 1HOCA 4FXGA 3RGVA 1RMFH 1F11A 5DA4A 4YDVB 1KELL 3SGDH 5F88B 2GY5A 1HCVA 1FBIL 3MCKB 4EN3C 3KJ6H 4QRRD 4L3CA 3MFFB 3GBNH 4XCNA 4QRTB 2OR9H 4JM2B 5EOCL 3O4LE 3PGCA 3VXUE 3EO9H 1MFNA 1U58B 1UFUA 2XZCH 4FMKA 1OD7A 3O4LA 5JW4M 2IQ9H 3QEQA 5IKCA 1R3HB 1CGUA 2GHWB 2VZ1A 1ZK9A 3OZ9L 5JOFB 4UB0H 5IFHL 3V6FA 3OB0H 2FJFB 4D0BB 3DVNA 1EFXB 1Q0XH 5CMAB 1OAUL 3BVNB 4HPOH 3JUYA 4QEGA 1N5YH 3TH2T 1YMHA 3B2UC 3OKKA 2P48B 2W0FA 3MCG1 3NCJL 1J86A 3HUJB 3NPSC 3L3KA 3MOAL 4YDKH 3MRHA 4I0PD 3O4LB 4BFBD 4OQTL 1OM3L 3IFNL 3EYOB 4WU7B 3TBVA 1PKQB 3PHSA 1NBYB 1SJEA 4CVUA 3K4DA 2A73A 3F7VA 4NQED 4NWUL 1A6AB 2UZIL 4ONGL 3HS0B 5T3XD 3S37L 4HS3A 1NLDL 4UAOC 1NC4A 4K3HA 4ODXA 1E4XL 1P9MC 4LSTL 4HG4J 2IG2H 4PJ5D 3NBNA 1U3ZA 4UTAL 3MRIA 3GSRA 4L3AA 3FONA 4CVXA 4YH6A 2AKRB 1FDLH 2YD9A 2MJWA 5BJTB 2YEZB 4N5ED 5KVEL 1OQOA 4J4PC 3WSQL 5EZJA 4P2RB 2ZUXA 3C9NB 3IXAB 1ROWA 1T04A 3MA7B 4LVNC 4OGXL 4NZTH 1U91A 4ETQB 4KVCL 1GGCL 5LGHH 1YN6B 1CVRA 4HJGA 1VFAB 1N3NA 1DEEB 3LEVL 1JJUA 3TA3B 1S5HA 3V4UL 4LOUC 5AEAA 1IM9A 1IGYA 3A67L 4RDQF 4CVXB 2AJ3B 1QFWI 2J8UA 3QIUA 35C8H 1HDMA 4LHUB 1CE6A 1NQBA 2H9GA 4I13B 4Y4KB 4P4KD 3HE7A 4NM8H 2CUHA 5I6XB 4U6XB 2XN9A 1ZT4B 1C5BH 4X6FA 3BX7C 5IHBA 4HKXA 3OKNB 4HH9A 1CFVL 2XRAH 3SDAC 4PJCA 4UT6L 2W9EL 5EBWA 2HT2C 1MCKA 5DJ8B 5E2WH 1CD1B 4W81A 3NFNA 4EBQL 2X44D 5C0JB 4GAFB 2XYCA 2AJVL 4JFDA 3BD5A 5D2LE 4YJZL 4JJHA 5D4QA 5CKAA 1CDHA 1JF1B 1RZ7H 3OKEB 1V7ML 3SKJL 5DRNA 2E9JA 2OL3B 5GJSL 4XPGL 3FO0L 3OSKA 4X6CE 5GSRB 4ELMA 4UT9L 2RHEA 1IQWL 4K3DH 2K3TA 1P84K 1ZGLA 1UZ6E 4L1DA 4K3GA 2HRLA 3RU8H 5F71A 1YYML 4X6CF 2YC1B 3P2TA 3GSVA 1KUMA 3LIZL 1FPTL 2V5SA 3FO2B 4NQDE 1MQKL 4ONFH 4XBEH 2H2PD 2V6HA 4NCC2 2WZPD 3ARZA 1X3DA 4H8WL 3W0WD 1R3IL 3BVNA 4XB7A 5HHOB 4NQDA 4MS8D 4XVJH 2OJEA 1CK0H 3ZT7A 3MV7E 3EYVB 4DKFH 2QHRH 4NZDA 5MERB 2OS7A 5EOQH 2NYYC 1FYTE 4OCXH 1YQVH 3QDMD 4JQVC 2ARJQ 3DURB 3MV8B 2DQEH 5EZOL 2XTJC 25C8H 2VLRE 4LCWD 1S9WB 5KANG 1CT8B 4YHOL 4QXUH 3HS0A 5E9DB 4R90L 5EORL 2A77H 2E9IA 3PHOA 5CKGA 3BE1L 4RFOL 3OHXB 1RUML 3PJSA 5C6TH 4L8BB 1NKOA 2B20A 1WBYB 3TWCH 2DAVA 2CK0H 4TOYL 5C7XH 4WFGE 1NBVL 2VR5A 2EC9U 2UY6A 2YA2A 4ZO6A 4Z5RB 3NFPB 5FHBH 2Z0BA 2YXFA 4GG6E 4HJGB 1CLZH 4KJQC 4JDZA 5E00A 1Z0MA 5F6HI 2P5WB 4HLZG 4XX1G 3VDAA 1A2YA 3MJGX 1A7NH 4ZUSA 4ZUVB 4TUOB 4MXQC 3QXAB 4X5XB 3KPSA 3NA9H 3P11H 1T1WA 4F58H 1DLFH 1HKLL 5L88H 1OY3B 5BOPA 4U1NB 3CFBA 1S3KL 3DVIA 4PJBB 3F58H 4WI9A 2FJHA 3EZJB 3T04D 5TF1H 1BX2A 1BWWA 3O6FA 4OQTA 4RISL 4ZUSB 5EU5A 1F3JB 5AYQA 1BZ7B 2YPLE 4YHZL 1DQLL 1AXSA 4BELD 4JFDB 3L1OL 1R5IB 3V4UH 3BN9D 5LGJA 3ES6B 4LSVH 2OMBA 4QCIB 3ALWA 2NY2B 3V5DB 1PKOA 2BX5A 4HUVB 4PJXF 4ELMB 3MV9A 5HYSG 2ICES 2HKHH 4LFHD 1X5HA 1IT9L 4ZOEA 4Y1AE 5DD1L 1A22B 4QRRB 3ULVD 5DQDL 4K3JL 2NY4B 1I8IA 4Z7VA 2GTZB 4Q6IB 1MREH 2AJXH 1PJ9A 4AM0A 1R3LB 4N5UA 4NC2B 4JO3H 1KB5B 4BSJA 4XMKL 5CZXD 3REWB 5C0BA 4HHAA 3SPVB 3T0DA 4LVHB 3MC0A 5CSGA 1I4FB 3LPFA 4JFHE 4Y19E 5EO1A 1IKNC 1LEIB 1J18A 3IF1A 5CP3H 4JZJC 1JGDA 2NXZC 4J3XA 1QG3A 1HKFA 2GTZA 4NO0A 4Y4HA 4JRXE 1P4BH 3MJ7B 5CLWA 5FUZL 3RVWC 2ID5A 3VGDA 3JWDL 3UJIH 3ZKMC 4X7TB 3U48A 4CVZB 1AR1D 1H5BB 3DVFA 3AAZA 4RMQA 4IS6B 1BJMA 3MLSL 3BDXA 3WFDL 1GGIH 2XA3A 5CGMA 3OZ9H 3EZ8A 5C6WH 5FV1L 3MBEB 4RGMC 5DS8B 2HKHL 2QSTA 4YK4C 5DQJB 5L88L 4GMTL 3T0WA 4LPTA 2AKRA 3ZE1E 3PIQB 1UKTA 4GXUM 1NEZB 4Y1AA 4PLKD 1QHOA 43CAB 4QYOB 5HVHC 3WS6A 1ZLUK 3MODL 3LB6C 3Q6GL 5DRWB 2P5WE 2O61A 2AK4B 2Q1EA 4Z76B 3H9SA 1JIBA 2ESVB 3V5HB 2K9UA 3O8XD 5KSUA 3W5MA 3AVEA 2NW3B 1QPPA 4Y7MA 2PW2A 1UM5H 1T66C 3NZ8A 4JO3L 3C8HA 2R8SH 5GRVK 1KCVH 4DK3A 5F7MC 3FO9A 5FM8A 2A6IA 5J1TC 3LN5B 4AIZB 5E24E 1DSFH 4MD4A 1WV7T 1TQCB 4OCWL 1FFOA 1NGPL 2CKNA 2NXYD 3TPUA 3BGFC 1OW0C 2WV3A 2GQHA 2AP2A 2FYYB 4G6AC 3RGHA 4ZYKB 2PO6A 5E6IB 1OPGH 4L4VE 1R5IA 4XXCC 1X4YA 1N7MH 3HI1A 4OTXL 2X09A 5EU7C 4Y4KC 1HHJB 2OCFD 3HNSH 3S5LA 2JJUA 4RNRB 4YE4H 5E7FA 4G3YH 1ACYH 4LSVL 1KIPA 2DL2A 3CH1B 4ISVA 4DQOH 5K59E 1CFNA 3FT4A 4X7CC 2Z4QA 1EAPB 5D7LB 2D9CA 2B4CC 2VH5L 3T0VA 2X9XA 1T7YA 3H2WA 3QHFH 2MQ0A 5DJXA 3D2UD 1CL7H 5SWSB 4G43A 5FO9B 5FFLA 4LLMB 4U6HB 1KCSL 2VLRB 4UT9H 1MFAL 3C09C 2GJ6B 4MDJA 2X4TA 4GH7B 5HI5C 2P5WD 1WIPA 2YK1H 3GBMH 4OM0L 3ZHDA 5B8CB 3I75B 3GKWL 4F33B 1HE7A 3SDDA 3GMPB 1DQML 2FSEB 3ARBB 2D7PA 4IOIA 4ODVH 3RWCB 3DUSA 1U0QA 4MXWL 3T2OA 5T3XH 1U36A 1NCCH 3MV7B 4EN3B 2NCMA 3H9HA 4FQHB 1IAIL 4FZ8L 4K9EH 4Y5VC 5HVHB 1UWGL 4R2GC 4MVBD 5F72S 5HDQH 1AHWC 2YR3A 1K4CA 4OZGA 1W0YT 3VA6A 1N7ML 4NYLB 4QOKD 4NWTL 2OXGA 3BRDA 2HFEB 3GI8H 1RIUH 3FCTA 4OLXL 4ZPVA 2IFFL 4I0CC 2F5AH 3N1PC 1YNKL 2C3GA 4ZS7H 3AUVA 3EJZC 1ZWIA 1U3HA 4MCZB 4LHUA 3SKJH 3NFNB 3QB7C 3THMH 3FFDB 3Q3GB 4XMPL 3TPKA 4YHOH 5DRWA 2BHUA 1ZA6B 4U6XA 1QSEA 3V0VA 1QBAA 5KSVA 4YXKL 3DXAE 2KUTA 5KVDH 4JN1H 1ED3B 2VLME 5MENB 4FABL 3LMJL 1TFHA 5E6IC 2DQDH 4MX7A 4X6BA 1XCQA 4KUCD 1SEBB 3BYTA 3GSVB 1MAML 1NAKH 1MJ7H 4I3RH 2X9YA 2IANE 4PBXA 3KYOB 3L3JB 1UG9A 1XF3A 2EDDA 3IJYA 3QDMA 3A6OA 4O9HL 4KKBD 4GBXA 4LSRH 4C83A 3O2WL 2E7BA 3FB6A 4LPUA 2JKXA 3KS0H 3HC0A 4XGZB 4HIJA 5HDLA 3VGAB 3RAJH 1F8TL 3HI1B 3RWDA 5C09A 5KW9H 3WD5H 1XF2A 4QT5A 5IMOA 1N26A 3U4EB 2BXYA 5JPMB 5I17A 5J12C 3FMGL 2NY3D 3DV6A 3FQRB 5D7SL 1DQQA 4DTGH 3DO3A 1UB6B 3HPLB 4KJPC 5DJ0B 4N1CA 5DTFB 1QFHA 1QLRA 3PHOB 3HZMA 1M6OB 1VESA 1U6AH 4JGUA 1XGRB 4I48B 1HHGB 4EI6B 4R26L 5C09B 5BVPL 3BZFA 4L8SB 1IAMA 5DJ2B 5KSAD 2B5IB 2C26A 1JNJA 4OLUL 2CQVA 35C8L 1IL1B 4M8VA 3QDGB 3EJJX 2AJZB 5D96C 2BRRH 4ZSOE 1AGBA 1UB6A 3HPLA 3QCVH 1KCLA 1A7NL 15C8H 5DD3L 3B3IA 3ARFB 4O51B 4OB5H 3NIGF 2HFFA 5TH2A 2HN7A 3CXHK 4XCEB 3VGHA 3QDME 3SGKA 3RPIB 3TO4A 3I2CL 2EDBA 3MROA 3O0RH 4GUPB 1NCDH 3AS1A 1TQCC 4PJEB 1MVUA 4R0LC 4YXLL 4N0YL 2MOVA 1A4JB 1Q72H 1ZT7A 4IEFB 2VXTH 2BFVH 3RWJA 5HHQA 3KR3L 4OCYH 4X7TA 3MCKA 3LEYH 1A7OH 2ITDB 3NIFE 3QIUD 5D2NE 4ETYA 2CD0A 1JPSH 5DSCA 4L4TA 2NW2A 1M4KA 2AJXL 1C5DB 1DQDH 1F3RB 2NY1D 3Q48A 4KVCH 4WEMB 1BZQK 4FQCH 2HFGH 4O2EA 3DO7A 1CIDA 1S7QB 3KDMB 5JOFA 2ICWB 2DQJH 1F00I 2BMKB 5FCSH 2J8OA 4F7CA 4LLYB 4Y2DD 1MCOL 5D7IF 3UPAA 4QNPF 4HD9A 1F8TH 4RIRA 4G9DB 3N1QC 4GMTH 1I8IB 4Z7VB 2X1XR 3STLB 1VPOL 5HYQB 3SE4C 4JQIH 1H3UA 2XRAL 3C08L 5JZ7D 5FIEA 3ARDD 5DEFB 3WUZA 5BZWB 2XG4A 2P4AB 4EI5C 3LKNA 5JMRA 3FTGA 5EUKB 2CDFB 3FRUB 5ACZB 3RUGA 3A6CL 1HI6B 4M6OH 3INUL 4JZJB 1S9VA 3RX5A 5J13C 3RKDC 2AK1H 1WCBA 4HWNA 2VUYA 3T8XA 4BQ6A 2CLZA 1HHJA 4PP1D 5I1KL 4CADA 3FOLB 4YHKL 3ALXA 1MRFH 1HHKA 3PQYE 4DEPC 4DVRH 2GSIB 3X3FH 1QKZL 1EXUA 1LP9E 3BZEA 5IVXA 3GRWL 3G9VA 3DX6B 5ALBH 1N5AB 4NO0B 5IM7A 1F90H 3JTSB 3VGFA 2P49B 3UEZA 5E8DL 1RUKL 3C6LB 4ZOCA 3M17B 1AI1H 5CBAA 1MOEA 4ZS6C 1D5ZB 3U4BH 4XBEL 2QSCH 3L5JA 4U1MB 3RL2B 4HC1L 1B2WL 4NQTA 5CP3A 3GSOA 1NGZA 1A7QL 3AB0C 2XQYK 1LE9B 1FAIH 4WO4D 1HN1A 3DTXA 5DFTA 2JJVA 3MO1B 1H15B 5DO2D 1MWAL 3UTPD 2RBLA 4F7EA 1UJTA 1IGJB 4YBHA 4OT1H 4RZCA 4X4YB 5CCKH 2AJYH 4UMGA 4OCWH 2QV2A 3ZDZE 2ZNXA 1D6VL 1AP2B 4DGIH 1I3GL 5IJVA 4UV7H 2JB6A 1O5DT 3GSOB 1E27A 1UB5B 4LIQL 7CGTA 4QF1B 4Z7UB 4MNQE 4S2SA 3WNMA 4PD4K 3QIWB 5FUOH 1KYOJ 3VI3F 4F7PA 4MD0A 5MEND 3VXMB 1DLHB 4UIKL 4MQTB 1UWEL 4LCCA 4NN6C 2N1KA 3L5HA 1N8ZA 1ONQB 2XN9D 2MPAH 3HLAA 1T83A 4FQXC 5ERWB 3BDYL 2VAJA 2VE6A 5TE6H 5D5ME 1BAFL 5EG6C 3GRWH 4LLYA 1IBGL 4R4NC 4OD1L 4X99B 1IM9D 1PKQE 3V2AR 3P9MA 3SE8H 1IILE 3KG5A 5C09D 4M1CD 1FFPB 5DURB 1GAFH 5E99H 1QHPA 1WBZA 4HUXA 3EYFA 4E5XA 3VMPA 4CGTA 4Q9QH 1T0MB 4G43B 5KAQF 3BPOC 3OKLB 5DHYB 2J6EL 4Y16C 4XNUL 2EIBA 4NM8L 1T7XA 4MAYC 1HYSC 1QNZH 2YPKA 4M6NL 3BEWB 3NABH 1PEWA 4F57L 2HKFH 4ZMAT 4FOMA 4E5XB 3MXWH 1IM3A 3EO0B 1ND0A 4OGYL 4LARH 2XFXA 3VFNA 2VO5A 4M7KH 4XNMA 1CGYA 2VXSH 4LEXL