3HKFA

Murine unglycosylated igg fc fragment
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
205
structure length
205
Chain Sequence
SSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords Igh protein
publication title Structure of the murine unglycosylated IgG1 Fc fragment
pubmed doi rcsb
source organism Mus musculus
total genus 31
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2009-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hkfA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hkfA01
3D3VB 4JO3H 4PGDA 4XCCH 2A83A 3MRHA 2DIAA 2IF7A 2XICA 2J5LC 2MPAH 1OVZA 4N5ED 2NY4C 1VADA 4XPGL 5FO7B 1T0NB 3D3VA 4BKLA 4ESKA 1JNNH 4HQQL 1BQHG 1RZKH 1CF8H 2EDQA 3BP5B 3SKMB 3ZTNL 4UTAL 2R1XB 4NN6B 1EO5A 3IAQA 4ZSOA 1A1MA 4NC0B 5FO7A 4J6RL 5JXEC 8FABB 2D0FA 5J9PB 3U2SA 4PJ9B 1DBJL 2F5BH 1FG2A 3SOBH 3BP5A 3L3DA 2R1XA 4M1DH 1PSKL 2ED9A 3ARXA 1MHCA 2IC2A 4AH2A 1XF5B 2XV6B 5DJ0B 2CK0H 3OAUL 4JPKL 1QYGL 3VW3H 1OB1A 1L9NA 4Q9QL 5DJ0A 4L8CA 2B1AH 1FN4A 4O58L 2XZCL 2OM5A 3QIBD 2JIXB 4FQJL 4ZXBB 3EYSH 4XB8A 1C12B 2QADC 3IF1B 2CKBH 3BVNA 2YD5A 5DZLA 2NMSA 3QDGE 1LEGA 3CDGA 1JNHB 2VLRA 3I02A 4LPVA 5D1ZB 1C12A 5I6XB 2R2CA 4OQTH 4PBVC 1ONQB 4JRYB 3S96B 5GS1A 5DUPH 3G6JB 4PRDA 1JNHA 1XR8B 3K8KA 3VMPA 3EFDH 3MFGB 3KJ4C 4JRYA 1KACB 5EUKA 3ALWA 1N7ML 1A3QA 1XR8A 1GVIA 4K8RD 1ZKAA 3T0DA 3FB5B 1KOAA 4PFEA 2R29L 4MX7A 4QHLA 3DVFA 4LLYB 1JWSB 5MERB 2JELL 1IJ9A 3DYOA 3C9NA 4NRXA 2YN3A 2Z91A 5E5MA 5E5RB 5KSBE 4UI2A 3WS6C 1EUTA 3FB5A 1MFEH 5FYJE 3QDMA 4LLYA 5IBLD 3HI6L 1U3HB 4LVHC 3CH1A 1RI8A 5B3NA 3JV6A 4Q2ZB 1DQML 4JVUA 4MJ5B 4QRUA 3PIQB 4RFOH 5DD3L 4JHWL 3MMEB 1IGTA 4M1GH 4R4BB 4Y8AA 2HG5A 1ND0A 1U3HA 1OT2A 1CLOL 4JFQB 1AI1L 5J0BA 3PIQA 4K2UL 5C0RH 3MV9E 3MA9L 1JHTB 3BP6A 4R4BA 1BX2B 1E28B 3LEVH 3Q5YA 1AGBA 3CFJA 3SDYH 5DK2B 1N6QH 1BJ8A 3MJ6A 3QUYC 4JFYA 5TDNA 5ID1B 1QFWM 5IKCB 3A6BL 4FQQB 4WUUB 2PYFA 1BX2A 4JZOA 1E28A 1VFUA 5KZCD 4L8DA 5IB4B 1BQLH 2XACC 2OYPA 1LVEA 3T65B 4EIGB 3WXVL 5JPMB 3HC0B 2P43B 5JR1L 1CDUA 1WEJL 2WNGA 4H20L 5E94B 1GOGA 1CQYA 4J3TA 4NWTH 1F90L 2CUHA 3VGEA 1MFAH 4FG6C 1QLRB 1X44A 2FJHB 4BZ2H 2L7JA 3ARFD 4LSRL 4XCNA 2EH7L 1U8LB 3BPLC 1P4LB 3KWWB 3DSNA 4LLVA 3RPIA 1P4BL 4GFTB 5EOQL 2NLJA 5FKAB 1MCIA 4JDZB 1P4LA 3X3FL 1HOCB 35C8H 4CU7A 1X6LA 5DRNB 2XNAA 1TPXB 1TZIB 3TA3C 2BXZA 4G6JH 4XAKD 5FDWA 4JDZA 1N0LA 4F7EB 3U36B 3S9DB 1QRND 1H5BB 1I1FB 4OLZL 5DZNA 3U9PL 2W0PA 1A2YA 1GGYA 1A7OH 3KPSB 4C83B 5GJTL 3LKSA 5D7IF 1YYLL 4M5ZH 4P23A 3U36A 5DFVC 4Y7MA 2AJ3B 1I75A 4ODVL 1I1FA 3EDJA 3RNQB 5I9QB 1MQKL 4GW5B 4P2YA 4JR9H 4KK8D 4LASH 2VXQL 3SO3B 4U1LB 4JFFA 4GLRH 5J89A 1R5WB 1CS6A 4ZUSA 3U4AA 2H41A 3GIVB 4Z5RB 4JFPA 4PJEA 4ZNEA 2QSQA 3RNQA 4FQLL 4K71B 2A0LD 1C5CH 5GRWA 2VSCA 4U1LA 4K94C 4LLDA 1VFMA 3SGEH 4LOUD 3GIVA 4X9FA 1A6UL 1NAKH 1FHGA 5HYJE 4DKFL 4L8BA 2EXWD 3MUGB 5T3XE 3MFFA 5TPWH 5L8JB 1KENH 4FOMA 2X40A 1HHHB 3ZE1F 3OKKB 2HJFB 4IMKC 2EIZB 3HAEH 3HC4H 2NY2D 1A7RL 1E6OH 3Q1SL 1FLRH 1N5YL 3NPSC 1HHHA 2LVCA 3MO1B 3NAAL 2IAMC 2HJFA 3GJEA 3V6FA 3LD8B 3REWB 1NJ9A 2VE6A 3KYOB 2DM2A 1AR1D 3IETB 4MDIB 4YXLH 2MJWA 5JHDE 1IL1A 1Q1JH 5FAAA 4S1RH 1Z9LA 1FL3A 1MI5D 3OR7A 1ODAA 3ARBA 4IDJH 2VXSL 1G0XA 3H6JA 1RPQA 1YEFH 4MDIA 1OLZA 3HE7D 3RNKA 3T0EC 1E27B 2W9EL 1KT2B 1UWGH 5JW3H 4KI5D 3P4OA 4PLNC 2E7LA 2ICEB 2WK2A 4N1EA 4QHUB 3I50L 4NO2A 1XIWA 3O8XD 3QYCA 4P5TD 1KGCE 2FDBP 1NCUA 6CGTA 5T1DL 3LV3B 3DURB 1NCBH 3F7QA 1XGUB 4ODSL 3CFCH 5E6ZA 3UPRA 3WIIH 3SKOA 3ARGA 3P0GB 4QOKA 2FSEA 3QSKB 4L4TD 1P9MC 3QUMH 3D1MC 2OTPA 2AABL 4K94L 3DURA 3D25B 3MLXL 3DV4B 1MWAH 2E6JA 3MV7D 1FNEB 2VJXA 1J18A 5C9JB 4QTIL 2WV3A 3QIBB 4BJLA 5F89B 1QLEH 1IFHL 2Q8BL 4JFDD 4Q58C 1OP9A 4U1MB 4R4ND 1PZ5B 3GSNB 3MV8A 4ZD3H 1YEGH 3PWVB 5DJ6A 1Q0YL 5C9JA 2EH8H 3BGMB 3BISA 1D5XB 3TBYB 3MRLB 3GO1L 1IQDB 4PG9B 3T0WA 2H26B 4U1MA 1R24A 1HCVA 1PZ5A 4X6CE 2SEBB 1NAMH 1KXVC 2D9CA 1I1AA 1IC5L 1IQDA 3VI3E 4PG9A 2H26A 1R5IB 1AR2A 3IDXL 5KS9E 3FFCA 2DL2A 5F7NC 4EI5A 3LDBC 4R0LA 1G9MH 4ZFOL 3VFVB 1RVFH 5EZOH 4C56A 2NXYD 1QR1B 4N8VA 3VWJA 3GIZL 1CD9B 2VL5A 1A6AB 1WAAA 4NYLB 2GFBB 2AW2A 1CDCA 5GGTL 4NKIH 3OMZA 2JB5L 4UDTA 3V6OA 4X4YB 2RCSL 2HTKC 4UUJA 1CBVL 3NTCH 4QHKJ 4YE4L 5IBTH 4NQVB 2ESVA 4NJAL 1U2CA 1S7RB 3FQRA 3HNVH 4X6DF 3EZJB 3F58H 4JO2L 1LO2L 1CYGA 3IJHB 4OAWB 4UDUA 1G7HB 2FJGA 4PJFE 4ZPTB 4XNUL 4DTGL 4Q9CA 1TCMA 4L3ED 4NCC2 5I1GL 5DUML 4ODWB 5KZCB 3IJHA 1G7HA 1DL7L 4AJ0A 4AL8H 4R2GD 2C1OB 3ALXA 3G5VA 1U95B 2ICWJ 3LB6C 4I2XB 2LABA 4Q9RL 1FYHB 3HUJA 1TQCC 4XP6L 1RJYA 3GMRB 4FZEH 1INDL 4JFXA 5ELIA 1IEAA 4ONOA 4KJQD 5F97E 3QCUH 2XZQL 1JZ5A 3PWPD 2BNRE 4I2XA 2B39A 4RDQF 3ARFB 4EEEA 4Z76A 1A6VH 4YC2C 1A7NH 4KTDH 1F42A 25C8H 4XMPH 1X9QA 2ATPB 4EXPX 3QHZH 3GSXA 1I3GL 5D6CB 3TEUA 4ODUA 3ARFA 3SGKC 1MNUL 1U9KA 4WJ5B 1YEJH 1TJIL 4LAJH 2ZUYA 2IFGA 1AE6L 1D5IL 1EGJH 4E41A 2ATPA 4XBGA 1UH4A 5HI3C 1NDGA 5DJ8B 1OAZH 5FGRA 4LSUH 3G5ZA 5GZNC 3P4LA 4TVPH 4MDJB 2DMCA 3UTTD 1QRNB 4OLYH 1ACYH 1FFPA 4LRIA 4K3JH 3WFHB 5B22A 5DHXB 4JFHD 1FG9C 3VG0H 4P2OC 2EDHA 1U8PB 2YXMA 1RUAH 4FQIH 1PG7H 3NACH 4I0PC 4MDJA 1IAIM 4I0KA 4DVBB 5HHQB 1U93A 2ZWLT 1MH5B 4LQ1A 4WI9A 5J13B 1U8PA 5CJ8A 4P3CL 3GBML 4WI2A 4FQCH 4KTEH 1VFBA 4DVBA 1DBML 5HHQA 1FSKB 1VPOL 1IBGH 5TDOB 1X6NA 3SQBA 3O41B 4NC2B 2HVKA 4JHZA 1BFSA 3KJ6L 5DGRA 5IVXE 4NRYA 5TDOA 3QUZD 4KJWC 3MNVA 5L2KD 5D72L 3BZEB 3TIDB 1GGIH 4PRID 4Y16A 3V4PL 4LKXB 5IT2H 2F19H 1QKZH 5A16A 3MRGB 5F3HB 1WTGT 3TIDA 2FRGP 2NY2B 1T83A 1T6VN 4LKXA 3P9WB 1NMBL 2X10A 3D2UA 2UWEB 5IEKA 4IHOB 2DQEL 5DA4A 3GB7B 2A9MH 2RGSA 5T33H 4Z7WA 1JPTL 3CAFA 1WCBA 3LOWA 1YNTB 4PLKD 2HJKB 1F4WL 1NGWB 2UWEA 4HWEH 1X3DA 1XGTB 3QQ9D 4IHOA 3GB7A 5K9KB 4HT1L 1QLFB 3VWKD 3QEQA 4BFIA 3Q5TA 2ZUVA 1C5DB 5IHZA 4M6NH 1KCVH 4XH2B 2QHLA 2UV3A 2VXUL 5GRUL 5C0GB 1MI5B 2HJKA 1NGWA 1K8DB 3EKCA 1VGKA 3L3HB 3TJEL 1CXIA 2P24B 1S5IH 1QLFA 3HE7B 3Q48A 1U3YA 4XH2A 1AO7E 2X4QB 5C0GA 1MI5A 4D0BA 2WIMA 3FZUD 3TPKA 4Z8FH 4WO4D 3VFPB 5KAQG 3HE7A 2VR4A 3O8XB 5EWIH 2E9IA 4P5TB 3HE6A 1QSED 1INEH 1JWMA 4XBEH 1HYRC 4F15C 1ZVSA 1QR4A 4XVTH 2MQ3A 1WT5C 4P5TA 5I16A 1ZLWH 4UV4L 3SPVB 1V3LA 3WFZA 2BSSB 1CFSB 4LHUG 4L4TB 1O7SA 1RULH 4QRRD 3VXMD 1VACB 2DQJL 1Z2KA 1FIEA 4G7VL 4XGZB 3ARPA 3C6LD 1IGJA 3MV7B 1DBBL 4OGYH 3ETBF 3SPVA 5IF0B 2M8XA 2BSSA 5EU3B 5CEXB 1CFSA 5L88L 4CNIB 1I1YA 1VACA 1ZXQA 4O2EB 4JFDB 1NCWH 1ZSDB 4YDIL 2EDLA 4YFEA 5HD8C 5CEXA 4CNIA 1MY7A 4HFUL 4O2EA 2V2XA 3WD5H 1B4JL 4X9GA 3IDYB 3BX7C 2VDOH 5I74B 3MLVL 1XF3A 1UM5H 4OD2B 2XT1B 1FV1B 3CSBA 1MCBA 4D9QD 4HZLB 5B8CC 3RVTD 1FAKT 3Q6FB 1CI5A 1ZWIB 2AAVA 2J88H 4Z7UE 4PJDE 4IRSC 4X5WB 4MJ4A 2AJUL 4MAYD 4OD2A 1I9RH 4JREB 5I17B 4YBHA 2CDFA 2BNQD 2NXYB 2OL3H 4X5WA 4QHNA 2EDWA 3PP4H 1CE6A 3W2DL 5E6ID 2FATL 3BPOB 5I15H 5I17A 1CD1B 5C0EB 5E2UH 5A2FA 3IRPX 4M00A 4JB9H 2VQ1B 4YPJA 3MBEA 1WLHA 5DC9B 5DQDH 2DQCH 2Y36H 3SBWA 2UVFA 4W4NA 3UTZB 5C0EA 1HHIB 1D9KA 5FYKD 2QQKH 2O5YH 2JB6B 1T3FB 4KQ3H 1RZGB 4JG0H 4LEOB 3MODL 4CMHB 2IG2H 1DVFC 4DAGL 2WM0A 2IGFH 4YHIB 4WW2F 5HBBA 5TDPA 5INDB 3HI5H 5GS3A 4ZAKD 2P7TA 4OV5B 3N1GC 4IJ3C 1ZLSL 5D70H 4JKPH 1SBBA 3QO1A 3T04D 2CMRL 2DLHA 2IALA 4TUKH 4YHIA 5GRXG 5FO9A 1WZ1H 4L3EB 5CP3A 4OV5A 1FGVL 1T7XA 3V5HA 5AYUL 1KBGL 1KC5L 2A74A 3ILPA 5IW1B 3C6SB 3L9RA 2J8HA 4ELMF 2BHZA 2EDBA 1IEBA 4R2GB 3OPZH 4L3EA 3SKJH 5HGHA 4DW2L 3BT2L 4YDLC 3PWNB 4MJID 5E6YA 2EDOA 5JHLH 3IDGA 4WFFD 2ILLA 3C6SA 3WDHA 3HHRB 2DAVA 4N90E 3GBNH 2VUOA 1NGZB 3QFJE 4ZS7L 5GIRB 3PWPB 2XY1A 1FC2D 2XWJB 3DGGB 5C6WH 4FFYL 4Y1AE 5EC2A 4LLQA 3AB0B 3ARYA 4KAQL 1RD6A 4M48L 2R0ZH 5J3HC 5GIRA 1RK0A 5KW9H 5HHXH 1PYWB 2OTUB 3DGGA 5GISH 2HH0H 1AQDB 2EDKA 4U31A 1DQQB 4YGVB 4KKNA 2Q86B 2CKNA 3IXTA 5HHOD 3WUZA 3KLDA 2ZSWB 1S8DB 4RGMB 1ZT4A 1MJJB 4XCFH 3UTTB 1A7PL 3QFDB 1DQQA 4JGMA 4PB9H 2JKXA 2IBZY 3RL1B 4LPWA 4M6AA 3X3GL 5I76A 2ZSWA 3DSFH 1MJJA 1PX4A 3UTTA 1EK3A 2IPKA 1YPZE 5DRXA 5MP6H 4QEGA 5ESAA 4KGJA 1U8MA 4DGYH 2A6KB 5MEOB 3DVNB 3MGOA 3NZ8B 4P2RD 3FONB 1R3KB 1BD2A 1F45A 5DYOB 5JOPE 5CILL 4CADB 5BXFB 3OAZK 1QSVA 3QEHA 3C5SA 4OZHB 2A6KA 5MEOA 3L5HA 2UY6A 3EDDA 4UV7L 2XA8H 3G6AA 1BOGB 4NKOB 5I8CB 1CLYL 1QO3B 1AP2B 2ZCHH 4LAQL 3VDCA 3MYJB 3QUZB 4OZHA 5L2KB 1ZHNA 3RWEB 3DMMC 2OSLA 3P30H 4PRIB 2YK1L 2DBLH 4L9LC 4LMQE 5F7EH 4ZFZB 1ZT1B 2GUOB 4WTZG 4XNZB 4TRPL 1IC1A 3QDAA 43C9B 3KPQB 3QUZA 5CD3A 5L2KA 4NC1E 2R8SH 3RWEA 3IFOA 5H37G 1LP9B 1BFOA 5EORH 5JXED 3UBXI 2GUOA 3TFKC 1MEXH 2XG4A 5TF1H 43C9A 3UYPA 3KPQA 4H88L 3GSUB 1U8HB 4HKZB 3ZTJG 1LP9A 2P49B 4NGHL 5F6IC 4MCZA 3ARED 4XXCC 3KPRD 3M17B 4HCRH 3RWDB 3ZL4H 5FB8B 1U8HA 4JY5L 1QSFD 1NUNB 1IGML 5JMRA 2PR4H 3VWKB 4XP4H 2IMMA 1WZLA 3KYKL 4PJ7B 5IOPB 5E8PB 5C0BD 3KPOB 3UO1L 1ETZA 3MBXH 3M17A 3GJFK 5D2LA 1SQ2N 1VSCA 2FHBA 2KZWA 5E2WL 3ET9F 3ARTA 4GRMA 3V4VH 1K4CB 3KG5A 3WFEH 3RAJH 1UJ3B 1Z6JT 3H3PL 1YEDB 1BHGA 5E8PA 3KPOA 2OK0H 1I8KA 2ICCA 2QADD 2W65B 4WO4B 3QUXC 2VAJA 1UZ8B 2DLIA 2Y7QB 5BZWB 4PJIE 2XZAH 5IJKC 1QSEB 1GIGL 3OKEA 5C7XH 4ONFL 5EU6D 3F62A 2AJZB 3WFBH 4WO4A 3VFUB 5JNYB 4B7IA 1T04B 2Y7QA 5BZWA 4GRLC 4DCQA 5ITBH 4YHOH 2FEEL 4QRRB 3VXMB 2VKWA 4I0CC 3C6LB 3O3AB 1HXYA 2NY5H 4HS6B 3LQZB 4YHYB 4RBPK 4M02A 4MB4A 5KVGH 4PJ8C 3SDCC 4QRRA 4GH7B 4O2CB 1TZHB 1RZ7H 1ORSB 4FHBD 3WHXB 1W72H 15C8L 1YEIL 3ORJA 4HH8A 3PHSA 1NMAH 3LRSB 1S5HA 1CXFA 4K55A 5EZJA 5GSRB 1HSBB 3WHXA 2FHCA 1JZ4A 1NFDE 5FOBB 1WGOA 4MA1C 1CFNB 5EZIL 1G7LA 3LRSA 3WN5A 3WJJC 2OXGA 1BAFL 1RMFL 3NCJH 3WNOA 3MV01 5E56A 4LP4A 3HZMA 4MAYB 1SJHA 5D9SB 4X7SL 4I5BA 4NO5A 2Z92B 3SDXA 4V2BA 5D1XA 2BNQB 5F1NB 1MCEA 3QUYD 1YN6A 2X1OA 4JPWL 4R97C 5E6IB 5FGSA 5C07E 2Z92A 3M45A 4AIXA 5F1NA 1U58B 5BQ7A 4GBXC 2X9XA 3V5DB 4NM8H 5J12C 4RWYL 5E6IA 2C3WA 1EFXD 2VDKH 5F7HA 3BQUC 3MJ8B 4FG6D 1U58A 3C60A 4OF7A 4DN4H 1DR9A 1BZQK 4ONGL 2BK8A 1C08B 1IT9L 4MXVF 4ZAKB 2DKSA 1S9VA 1KN4H 2DD8H 4PJBB 3MJ8A 4XWGL 1YEHL 2DQIH 4Z78B 4KRPC 3MCLH 1C08A 4Z0BH 5D93B 4ZAKA 3KS0J 1ITCA 5EUOB 3UYOD 2PXYC 2H1PH 1TQBB 4KDTC 3G6DL 1CWVA 1NBQA 4GKSB 5AUMB 2F74B 2VTFA 3TA3D 4X5XA 4I4WB 1M7DA 4MJIB 3QP3A 5EUOA 4YWGL 4HS8H 1H3UA 1EMTL 4HUUB 3OJMB 5H94B 3GMQA 4X4MA 3X14A 2F74A 2XKUA 3V0WL 1D5MA 1Y0LA 4I4WA 3NCMA 2FWOA 1CLZH 1IC7L 3K1KC 4HUUA 4M7LT 4QHKI 3N85H 5H94A 2HLFC 3PABB 4TSAH 3GI9L 5C2BH 4LU5H 5T5FL 1S7SB 4PJAB 2QHRH 5GGVL 4HHAB 2X1WL 1I7ZB 5DD6B 5EG6C 4F3FA 1XF1A 2F58L 1MIEL 3LN4A 5CIPA 2YPLD 4HPYL 3PABA 1H3GA 3KXFD 4G6FD 3V52H 1LE9B 5CHNA 1RHHB 5ALBL 3VXOA 4BUHA 1I7ZA 5HHOB 4Q74A 2Z8VC 3MRPB 1R3IH 1L0QA 1EHNA 5JW5B 1BOYA 4MNQE 2ZJSH 2HLAA 4QWWC 5IUSA 5HHOA 2WLYA 2E8ZA 2JJTC 3MRPA 3DRQB 1MCFA 1T5XB 5JW5A 1QFWH 3FQNB 1AXTL 1IGFH 5C9KA 3BH9A 4ODHL 2ZUSA 5ISZE 3NFSL 3QISA 4PYHA 4XPTH 1PBYA 4P2RB 3DECA 1T5XA 2UZXB 5FGBC 2EDRA 4J3OC 1GOHA 2IAMD 4ZPVA 2BHUA 5IP4A 4WI6A 1U8NB 4MXWH 4P2RA 3W0WD 3LZFL 3O4OB 4HWBL 2GTZB 1LE5B 4FQPA 4P2QD 1MJ7H 4OB5H 2AK1H 1T2QH 2IJ0C 3ARWA 3P9MB 1A9EB 1Y18B 1U8NA 1IGCL 2Z8SA 2J5LB 5I1JH 5HVHC 4F9PC 2IFFL 1LE5A 4JAMB 1EXUB 3QH3B 5LXGL 1Y18A 4MA8L 3T0ED 1FNGB 2F54A 5EBMA 4JAMA 2JE8A 5C08D 3S37H 1GC1C 1EXUA 3OB8A 3IU4L 3QH3A 1A6TA 1FPTH 2CO6B 5HJ3B 5TFSL 3H0TB 1FNGA 3DETC 3MLUH 1OGAD 3QZWG 3M8OH 2BFVH 4U0RC 3WYRA 3ROOB 4BH7B 2WIIB 2GY5A 3VA6A 4RDQG 2L4OA 4ZQKA 3AREB 3KPRB 5HJ3A 3H0TA 3DX6A 1QSFB 1CFBA 4NZUH 5IIEA 1KPVB 2WIIA 3MZTA 2AV1A 3KNBB 3AREA 5DFTA 5C0BB 2OTWB 1A9BB 5E2TH 2EYRA 2GHWB 4F80A 1IKFH 4PJXE 1F13A 5BS0D 1T0MA 3IJSB 2VLJD 1KTDB 1N64L 2OTWA 1BVZA 4JZNA 1A9BA 2QADB 4ZTPL 5BRZD 4QNPE 4YO0A 3AVEA 5ACZB 1PKQA 2XN9E 2XPGA 4NBXB 5EU6B 5J1AB 5LAXA 1DE4B 1UENA 3RHWK 4D0CB 2ORBL 1JYNA 5MHSD 3BZDA 5E8OA 2X9YA 4ZUTA 4Y5XC 4HMDA 5ACZA 1KTLA 4JVWA 5EU6A 4R9HA 2YKLH 4EKXA 5IVNA 1KSRA 3KJ4B 3AC0A 5FHBH 2P1YA 4GG6A 4M6OH 5DT1H 3X17A 1J1PL 1P2CB 2JTDA 3QO0B 3MXVH 1JWUB 1CLCA 2CRZA 2WWMC 3GSNH 1J87A 1AHWA 1P2CA 1NUGA 3QO0A 3QHFH 2P5WE 1JWUA 1IAOA 5HXMA 2RBLA 3GRWL 4LVHB 2VZVA 4DOHB 3HMXA 4J3UA 1HKFA 4O00A 2HTKD 1B2WL 1J1OH 1KLUA 2KUTA 1SEBB 3CFKB 1SYVB 4WCYL 2H32B 4NHCH 4V1DD 1NGXB 2HN7A 2E9WA 4K8RH 3FMGL 5TE4H 3QXDB 3TNNA 1SEBA 1T22B 1SYVA 2AEIT 3HB3C 4JRXE 4Z7QF 4BSVB 4S1QL 3DVGB 3WNMA 2ZUWA 1N4XL 3QUYB 5DHYA 2FIKB 4KHXH 1T22A 3O6ML 3RUGB 4HBQA 4BSVA 1KJ2B 2QQLL 1L0YA 4JZJC 1DSFH 4HMEA 3D48R 4M8QA 3QUYA 5CCKH 5JQHC 3U0WH 5E0QA 3LB6D 1KB5B 1EFXB 1WBXB 1KJ2A 4TVPE 1K6QL 3CGTA 2OJZH 3MNZA 2VXTL 1VEPA 1N3NB 3QULB 1KB5A 5C0CD 1EFXA 1ZT7B 2IBZX 1LO3H 5HYFA 3QDHA 1KTRL 1QFUH 3RGVA 1N3NA 3MGTB 1S7UB 2H6PA 3QULA 3S88L 3BPCB 1P5UA 2HJLB 4D9LH 2VERN 5IR1B 4TYUA 1HHGA 4I3SL 3U0PB 1FIGL 1TDQA 4ZFGH 4OZIF 5HI3D 2I25N 4OUUA 3TA3B 5GZND 1DDHB 3BPCA 4M4PA 5DLML 3RQ3A 5IR1A 3WKML 2ZZUT 3V8CA 3U0PA 1V7NL 2KDGA 4G6AC 5LGHH 1ZGLM 1DDHA 4P2OD 4G6KL 4I0PD 2LQRA 1S9YB 2GIYA 4J3SA 2HKHL 5FIEA 3L1OL 4PJHF 4OT1L 1NEUA 4JFOB 4P99A 5FUOH 2AK4E 2NY7H 4U1KB 5KSBA 4M7LH 1S9YA 2R4SL 4RNRB 5I1HH 5IQ7L 1NUFA 2RQ8A 2YPLB 4OIIL 5F7FA 5T1KA 4YJZL 4UIKL 3KXFB 4G6FB 5HGGS 5B39G 3W39A 1ZLUH 3UC0L 2VR5A 5EFIA 5SX5K 1N6VA 2YPLA 1JPST 4POYA 4KJWD 1AIFB 1WFUA 2AXFB 3FJTA 2AVGA 1WQVT 2JJUA 4PGZA 3QG6B 3KHOA 1MLCA 3FKUS 3CLFL 1DLFL 3UTPD 1AIFA 1EZVY 3OXRB 1DBAL 3H9HB 2YUVA 4AIZA 1QA9B 2DIBA 4HUWB 1I8IA 3QG6A 1JN6B 4MJ2A 5GHWH 3NPSB 4XHJC 2IAMB 5HDBE 3OXRA 3H9HA 1F58H 1QA9A 1C1EL 4ODXB 4EDWH 3MNWB 3KS0H 3W0WB 5F1IA 1J86A 4MMZC 4TNWF 3M1BA 4P2QB 3NH7H 1CGSH 1A6PA 1RURL 1UXWA 3MNWA 3E6FB 5IHBA 1L6XA 4MSWA 4ZFOB 3C08H 5SWQA 5KVDL 3OKMB 4POZC 2APFA 3N1MC 2VZTA 1EHXA 4HJJL 1JMZA 3T0EB 3MJ7A 4LDLB 3CXHK 1GOFA 4NCDA 1JGLL 1WF5A 3OKMA 5C08B 4E0RB 3DI3B 1W8OA 3G08B 4LVOC 4LMQI 4NKDB 3T0EA 1SJEB 1UEYA 4F7PB 1OGAB 3BSZL 2Q6WA 5C08A 2YXFA 4E0RA 3EHBC 3G08A 1HHJB 3K1DA 3IJYA 1YEEH 1TETL 1J1XH 1SJEA 1NSNH 4F7PA 3ILQC 1OGAA 3ZKMC 4YXHL 1CZ8L 3WIHH 5GGSA 5FYJL 3RZCA 3BW9B 5ESVB 4JKKA 2KQMA 1HHJA 4PJCF 4YBQC 3RWIB 3KPPB 3NABH 1YN7A 2YC1B 5BS0B 1T20B 2VLJB 3SE9L 2F5AH 3UXFA 4LCCC 4XI5C 3KPPA 5A2LH 4DK6A 5BRZB 3RL2B 3RX8A 5BS0A 5HD8D 4YBLB 2VLJA 4DZBA 5FHAL 3I75B 2AJSL 3V6ZB 3VXTA 3MRBB 1X5HA 1AQKL 1QNZH 1EO8L 1U8QB 1UB6B 2EC8A 3OKOB 1K3IA 5C2UB 3UJJH 5F1SA 3WSQH 2CPCA 4FFWC 3ULUF 2VITB 3V6ZA 4UIMA 2NW2A 5BW7C 4WTZA 5DD5H 3JWOH 3LH2H 2H3NA 1CDGA 1UB6A 3OKOA 1BGXH 2OZ4H 3T77B 1VKXA 4IRSD 3NFNA 2Z4QB 1RIUH 3BAEH 3LDBB 4GQ9H 1PQZB 1CK0L 4KKAC 3BKCL 5LBSL 5IBUG 2B2XH 5D2NA 3T77A 1IC4H 2C3VB 3B9AA 3VFWA 2Y07L 4YXKH 3D9AL 1AXIB 1FO0A 5HHNA 3TNMA 3VJ6B 3JSSA 3PG2A 1FNSH 3WUWG 1CICC 2R0LL 4GMSL 3HCVA 1MFDH 2DQTH 1RUQH 5JIKA 5TQ0L 4MQSB 4V1DB 4MQ7B 5HPMB 1DVFD 1MFBL 4KHTL 4HJ0C 5JDSB 2BVEA 1MREL 3CMOL 4HK3N 5DQ9B 1TCRB 2D9QB 1ZA3B 3NIGF 4PGCB 1Y6KR 3D85D 4LPXA 1EEUA 5JDSA 2VLKD 5D7IA 4K7PL 5C92A 3UEZA 4QXTA 2DS4A 2FB4L 3FAWA 4N8CL 4NBYB 5CINL 5TE7L 3IKCA 4ELKB 1ZVYA 5EU4A 1TQCB 1G7JB 3BH8B 1LMKA 3DHMA 2DTML 2ADGB 4U6VH 4ZG1A 4ELKA 5I2IB 3BKML 2NX5E 5C0CB 4PV9A 5CP3H 3U7WH 1G7JA 4L4VD 3FO9B 2DQUL 4JN2B 3VXQB 4KROD 5T3XL 5J3HD 2ADGA 3SKNB 5EOTB 1JZ7A 3LMJL 4CJ1A 1FP5A 3T3ME 2G60L 3F8UB 4Y5YC 2YHGA 4HIXH 5I18H 1F8TL 4JN2A 3VXQA 3O2VL 3O6KH 3SKNA 4CN4A 4OLXL 3RWCA 3SGKA 2XYCA 1Q9KB 2BSRA 5E8DL 5C6PB 3OV6A 1G84A 4P5MA 4MA3B 5I71C 2QBWA 5GGUB 1ADQL 3GSQA 1KELH 1UKQA 1WIPA 4XVJH 5F21B 4P2OB 1Q9KA 2AXJA 2EYSB 4I0PB 3WJLA 1B88A 4AENB 4PJ5D 3R4DA 4PGBB 3PDOB 5GGUA 5GRJL 5CZVL 2G75B 2VDPH 3HAEG 4I0PA 1A64A 3I6LD 4JJ5B 1FORL 2AV7A 4WFGD 4PGBA 1NCNA 4HKJA 3O9WA 1T21A 1QVOB 5BV7C 1FZOB 2J6EL 1G6RB 2KZ1B 1NANI 4JJ5A 3D3VE 4QCIB 2GJ6D 1DN2A 2DI7A 4FXKB 4IOIA 5LGKA 4UU9B 2K7PA 2WUCH 1AGCB 3DMMD 1VB9A 4NUJA 3MXWL 1FZOA 1G6RA 1D6VH 4ZSOE 1MOEA 4M93C 1GRWA 5F7DB 3RDTC 4LSTL 4PRBA 4UU9A 3LHPL 5HYQB 4XPFL 2JCCB 1NCDL 2BRRL 4OKDA 4YUEL 5HYQA 5GZOD 5L7XH 1XZ0B 3MRRA 4RFEA 4X7TB 4XMKH 3L6FA 2D0GA 2YD6A 1FFQA 2V17H 4U1IB 1Q9WB 3PXJA 4WY7H 2GT9B 4MHHG 5TQ2H 4RAUB 3WIFB 1NEZB 1IAII 1XZ0A 3I6GB 2BNRA 3ULUC 1ZK9A 4Z7UF 3HNTH 2VC2L 1XF4A 4RAUA 1H3XA 1J0ZA 1NEZA 3WIFA 1NL0L 4UTBH 2DM4A 2VLRE 5FKPB 3N0PB 2N1KA 3E1F1 3QUXD 2NXZC 1PGRB 4GXUM 1I9EA 1A14H 4G8FA 1OTTC 1UG9A 3P11L 3F6IA 4HUVB 3OJ2C 5FKPA 4F15B 2PUQT 2WUBH 5E4EC 4LCIH 4JRYE 4GRLD 3G6JE 2UYLB 2X4OA 5BV7L 4I18C 4LF3B 3T8XA 1A4KA 1WT5A 4H8WL 4WI5A 4G6ML 4HK0B 1HH6B 4PJ8D 3SDCD 4OGAC 4X6DB 5DJZB 1HILB 1JGUH 2PW1A 2AP2A 5JZ7D 5HDQL 2FHFA 2WWKO 4NDMB 3GDBA 3RY6C 1U8JA 4HK0A 2AJVH 2KBGA 4X6DA 5DJZA 1VESA 2X7LB 1E4XI 1Z5LA 2YUWA 2F53D 3U46A 1HEZB 3MRCB 1PKOA 3THML 5DD0H 1FFOA 3R8QA 3TBVA 2XWBB 1HQ4B 2X7LA 5B8CB 2D7NA 1UCBH 3VXNB 2QKIA 1KEGH 3MRCA 2R2BA 4MA7H 3O45A 4IRSB 3L3JA 1G9NC 4Y5VA 2P42B 1FL6A 1HQ4A 1JF5A 4M43H 3BHBA 4KMQA 3PWJB 3ULUL 3ULVE 1LNUB 4LGPB 4TSBH 5ECJE 1MHEB 3OKLB 4ZO7A 4M7ZB 3C8DA 3QZWA 2WLZA 3Q0HA 4IRSA 2DQFA 3ALPA 5EZLB 3EYUL 5EOCH 1PAMA 1MCOL 3HS0A 1CL7H 3OKLA 4K3EL 4D2NA 4PRHA 1DFBH 3ME0A 1NCCL 4GBXD 4F58H 5LQBL 1KCKA 12E8H 1RFDL 5F88B 4OCWH 5EZLA 1FDLL 5CEZE 4Y19D 4HXAL 3FO1B 1QFOA 2XKNA 3CVHB 1RK1A 5T5NF 3BQUD 5BMFH 1DN0B 1OSZA 1U8KA 5EH1A 5I1CH 4NUGH 2FJFA 4JKLA 1DVFB 5I1IH 3O2DA 1AO7A 2EE6A 1FAIL 2BVUA 1QBAA 3FO1A 2WSKA 3CVHA 4IJ3B 1T4KA 3ZE0E 3KYAA 3D85B 4M9PA 4KRPD 1Q9OB 2VLKB 4HX1A 4JDTH 3VGHA 3TN0C 5I19L 4JG1L 1QHOA 3LSOB 4KVNH 4PY8J 4YPGB 5HI5C 3MCG1 2PXYD 3CVIL 4MB5A 5M94B 1Q9OA 4K7PY 3VXRD 3SE3A 3LN5B 4ZOCA 3LSOA 3VXUD 4YDLB 5FYKH 4YPGA 4OCYL 3MREB 3VMNA 2A9NH 3X11A 4LLMB 3LN5A 4R90L 2BVOB 3KPSE 1BIHA 3KLAA 2DWDA 1NBZB 2HWZL 4K7FB 2A6DB 4Y2DA 3P73B 3TV3L 3LRGA 4L4VB 4P4KC 2HLFD 3VXSD 4PJEE 4ZNEE 2YN5A 3GI8L 4KROB 2G2RB 5DJ2B 2B5IC 3BP7B 1IILE 1NBZA 2A6DA 2VOTA 4MNGB 3QG7L 4Z77A 3P73A 1EZVX 1G9NL 5SX4I 1JE6A 1OAQL 4XPGH 5KSVA 5GGQH 3G9VA 2R69L 3ZDYE 2G2RA 5DJ2A 4HQQH 4YZFE 4D3CL 3MLRH 4MNGA 4LHJB 4UTAH 4XCEA 4XP5L 4ZFFB 3B9KD 4J6RH 1H3TA 4I48A 1BJ1J 1DBJH 1F6AB 1KJMA 5HYSB 4PJDA 1DBKL 4OZ4A 2HMID 2VDRL 4IIQC 4ZFFA 2BJML 5F9WC 1PSKH 3BE1L 1J8HA 4R7NB 3MLPA 4QHMB 4F7MA 3RA7L 1P53A 1WIOA 1MFCL 5HDLA 2IWGA 1F11A 3JV0A 3IAGC 4JPKH 1D5ZA 2Q7YA 4R7NA 5ESQA 2XTJC 4QHMA 5DVOA 3ZDXF 1F4YL 4UNTA 2BRQA 4NRZB 4XNXL 2EE3A 4LBEA 4O58H 2XZCH 3OXSA 2GJ6B 4FQJH 5EIIA 3K8MA 1MQ8A 4NRZA 3DMMB 1H3PL 2X1QA 4L9LB 1UGNA 3K4ZA 2XG5A 5TGBA 2VLMD 4A6YL 2WBJA 3DX7B 3ULSA 4G8IB 2I24N 3DMMA 4HKBB 1EEQA 3BJLA 3BDXA 1JRHI 3WKNA 4JGUA 2EO9A 3DETD 4HDIB 5DR5L 4FQ2L 4HKBA 2ARJQ 2ZCKL 5F6IB 5I66B 3PE9A 4L8SA 4QOKE 4G5ZL 5IHUL 1N7MH 4H26A 4Z7OE 1S9WA 3CFEB 5KJRH 1GGBL 3BZFB 2E9JA 2PTTB 4HS3B 4X99B 3UAJC 4XXCA 3IDUA 3K80A 5MEQA 1PEWA 2AEQL 3RX7A 3B9EA 4PRAB 3BZFA 4RMUA 5B39B 3MV8E 2QSCL 3L5XL 4PY7A 1VERA 1RZ8A 3C8KB 5FOJA 1BIIA 3HI6H 3G5YB 2F8OA 2QQNL 4YDJA 3RY5A 1I85C 1DQMH 2EDTA 1AH1A 3QUXB 5DD3H 4PRAA 5B39A 4RRPG 4OF5A 4JHWH 3C8KA 2BNUB 3G5YA 5FA4A 4XCYB 4RMWA 1CLOH 2R23A 4K2UH 1RIVH 1M6OB 3VRIB 4J1UB 4NWUH 4GRLB 5IB3A 2MOVA 3IXAA 3V7AE 4C4KO 4XCYA 1NGQL 1M6OA 3MOBL 3VRIA 1K2DB 2V2TB 3A6BH 4C56E 3MRNB 5L8LB 3EZ8A 4M5YH 4YFLF 2YMXH 1ZLWK 4RGOH 4OCNC 3UTQB 4FABH 3CPLB 4PJ8B 4WW2B 5CP7B 3SDCB 2W9DL 2WWMD 3WXVH 5CD5C 5DJCA 5JR1H 1WAAE 3MRNA 4ZYKA 2VL4A 1WEJH 4H20H 3FB8B 3WMSA 3CPLA 5KSUB 4WW2A 2ITDA 5FO8A 3V6OE 1HCFX 4XC1L 4U49A 5D7JC 2F53B 1BZ9B 4LSRH 5BJTB 2EH7H 2VZUA 3FB8A 4ELMB 4MA1B 1LEIB 2ESVE 4GKNA 2P8LA 1KEML 3UJTL 5FECA 4CVXA 2RAMA 3AROA 5EOQH 1T7ZA 1LK2B 1BZ9A 5BJTA 3GMOA 1MCHA 4ELMA 3BXNB 5F44A 5J4MA 1OWRM 3HG1D 3X3FH 5HGAB 3QA3B 4NC1C 1OW0C 2X4PB 3HB3D 2W91A 3H3KA 1F6FB 4YIQA 1FVEB 5BOPA 5HGAA 1B0RA 1CGUA 1E4WL 3O3UN 4OLZH 5ALCL 3U9PH 1NLBL 4H25A 5HSFA 4F37F 2X4PA 1P7KB 3QQ4A 4TULL 2AXGA 3HUJE 4KY1H 3RWFA 1YYLH 2PW2A 2Z35A 3VGFA 3EJZD 1TTGA 4GBXB 4OQTA 4ODVH 5IVZA 2DTSA 5J12B 1ZLVH 4I2XE 4Y19B 1MQKH 4MD5B 2H32H 5F7MC 3BQUB 4IRJC 3ARRA 1TVDA 3S3PA 1FNHA 1IM9D 4FQLH 3N1PC 4OBRA 3EJJX 1GGUA 2P46B 4MGXA 2X4SB 4E41E 5CJXC 4LCYA 1TENA 5KANI 4KRPB 5K9OA 2Y06L 4KZDH 4DKFH 3QEGL 1JNNL 2X4SA 1NDMB 2PXYB 1CF8L 2GQHA 2XZZA 3SJVA 4MS8C 2FGZA 3VFSA 3I6KA 1AGFA 3VXRB 1KB5H 3VFRB 4XAKE 4U6HA 3VXUB 3T2OA 5J11C 3SOBL 1A7RH 2PXYA 4KDTA 3PL6D 4G6AD 3P0VL 4OLUL 1N5YH 3VXRA 1J9CT 4UQ3A 1WVZA 1BFVL 1FCGA 3DWTA 1PVHA 2IPUG 5KG9B 1WWAX 4OBSA 3SE8H 3VXSB 4QRPD 5EU7E 3FT3A 1ZTXL 3VW3L 4QYOA 2OBGA 4RISL 2W0FA 2B1AL 3QIWA 4IRZL 5FYJD 1H15B 4BH8A 3V5KA 3WUWA 1IZJA 1I7UB 4AQ1B 4WHDA 3JVGA 4S1SH 5IEHB 1DEEB 3QCTL 4YK4C 1UB5A 2W9EH 1YY9C 5T1LD 2CKBL 1YECL 3B9KB 5DDHA 1H15A 4GXVL 1EEZA 1X5LA 4C58B 3I50H 1UH3A 1DEEA 4JHBA 4YHMH 1A6ZB 1KCSL 2AGJL 3EW3B 3B9KA 3VG9C 3MV9D 3O81A 5EO9B 3RKPA 5DUPL 5T1DH 2IPUK 1NFKA 3CMGA 4ODSH 4LNVA 2WINB 5ICXA 1XR9B 2UWEE 4GW1B 4W4OC 4X9IA 4W6YB 1X5IA 2AABH 4K94H 1EVUA 4WHYH 1C5BL 1JMXA 3QEQE 5GRYA 3MLXH 5FGBA 2QJDA 3AM8C 3PGDB 2WINA 1XR9A 4GW1A 5CLWA 3ARQA 4HJGA 3QAZC 1IFHH 2Q8BH 5HVHB 1F3DJ 1MFEL 1MI5E 4POZD 1Q0YH 5IWLA 5E1HB 1JGDA 1ZAGA 2CRIA 3GO1H 4Q6IC 4YDVB 4Y4KA 1KB9J 2PF6A 2VDNL 4KI5E 3LS5H 2IANA 4M1GL 5GRVK 2FO1A 2HRPL 4LP5A 4YDVA 2J12B 4U0RB 1FL5A 3MROB 3KYMB 3WO4C 3EHBD 1QG3A 1KLFA 1BF8A 2J7LA 1IGYB 3ILQD 3ZKMD 1DQLH 2A6IA 2ZG3A 4P5KA 1L7TL 5HI4C 5FUCC 4P49A 5JA8B 4HXBL 3GIZH 4YBQD 1BWWA 1UM4L 3CX5J 3QJFA 5CWSA 2NY3C 1LK3H 5DF0A 3HAEA 5GGTH 4NZDA 1NC2D 2DLGA 4JFEA 5DA0B 4JGJA 3O6FB 1I8LA 4XI5D 2RCSH 1CBVH 3MA7B 2GTWB 3NIFE 4AEFA 2GITA 5CJ5A 4YE4H 3O6FA 2EZ0C 4NJAH 2LVEA 4F2MA 4HD9A 4QGYA 3ZDZE 3LKPB 5C0DA 2GW5A 4JO2H 4Y5XB 5FYLE 4FFWD 2FX9L 5L0QC 5HYJD 4N1CA 4XNUH 2ZG1A 2C26A 4WWKC 1DEDA 4RAVA 3DX8B 1UZ6F 1ZE3C 1DL7H 2FYYB 3LKNB 3VRLE 1YC7A 4KKAD 1KLGB 5I0DA 4Q9RH 3DX8A 1U8IB 4XP6H 2OCFD 3BDYH 2V5MA 3HPLB 1PW3A 2PN5A 2XQYG 5FM5O 2BVQA 4P9ML 4XVSL 2P8PB 3GHEH 2YA2A 3BN9C 2DM7A 2J8UF 5DMIL 5MEPA 3BRFA 4G8EA 3HPLA 2X4RA 2NY6C 1RU9H 1XCTA 3IU3B 1I3GH 2PYEA 3GHBH 3QUMA 1MNUH 2ARJA 4K7PX 1JF1B 1W2KT 1GHFL 1TJIH 1QPPA 1C5CL 1AE6H 1D5IH 1MWAA 3HG1B 4HJ0D 3WFCH 3T09A 4HPOH 3B2VL 1XH3B 2MKLC 4NPYA 5EU5A 4CJ0A 2EE2A 1HWHB 5IB5B 3U82B 3AS0A 4U6XA 4BYHA 2EDJA 9CGTA 3ZSSA 3VD3A 1XH3A 2GAZB 4P2CG 4QRQB 4L3EE 3RTQC 1R5VA 1CTOA 3PGFL 4G7YH 1TMCB 3RKDC 3TYGH 4JZJB 4OZFG 2OJEA 3HC4L 2XQYK 1E6OL 3DV6A 3PF2A 4KK9C 3ESUF 1FRGL 4QRQA 5CAYB 5E08L 3VE0B 3WNKA 1KG0B 3IS1X 4P3CH 2LFGA 1ZHBA 4GAYB 4PJXA 1DBMH 5IG7B 1VPOH 2L0DA 4UT7L 1KNOA 5JPNB 1S78C 5F8RC 4APQC 3R06A 3S36L 1KN2L 1KG0A 1CDIA 5DC4B 4YXLL 4GAYA 1BBJB 1HQRA 5IG7A 1ORQB 1AD9B 3OG6B 4LFHG 4FQHB 5D72H 1VGEH 4LIQH 4GOSA 4QRTA 3V4PH 1BBJA 1DJSA 4NZRL 1UWGL 4L3CA 4KRLB 4CVZB 1YYML 1Q72H 3MRJA 2GCYB 1IAIL 1K9TA 4NOBA 5SWSD 5D5MF 3HFML 3JTSA 3UTTE 3IDMA 4X7CC 3PL6B 3F7YA 2XY2A 3EO1A 3DUUB 4JFHE 3VD5A 1J0JA 4YHLL 1BD2E 2UUDH 1YY8B 4RMQA 4X8XA 3PL6A 4HMCA 2CUIA 2Y23A 5E9DD 3MRQB 4QRPB 1JPTH 1F4WH 2X05A 4HT1H 4X8JB 3VRJB 1R3JB 2VXUH 3MRQA 4QRPA 1DQTA 1A3LL 4OZHE 3WLBB 3SCMC 2YPKA 3TJEH 4FQ1L 1RUML 2O26U 5T1LB 1YEGL 1FC1A 5C3TA 4KUZL 3WLBA 5L2KE 1G1CA 2B4CC 4KVCL 3B8YA 2HT2C 3WDIA 2DJ4A 2FLBT 2I9LB 5D1QC 3RDTD 2B20A 5EB9A 1SHMA 3MV9B 3SGDI 4UILH 1NAML 1X5AA 1MIML 3LEXA 5ACMA 2NNAB 1LP9E 2D0HA 4LLWB 4X83A 4UV4H 2V2WB 5I30L 4G9FA 2Y5TB 1EGJA 4X80L 1G6RH 2AQ3A 4WVRA 1NGYB 4G7VH 4LKCA 4MVBC 2VABB 4F9LA 1DBBH 1RVFL 3QWOA 3X13B 5L88H 5D2LE 4D8PB 5T3ZE 2WP3T 4HKXB 1OQXA 4PS4L 3EFFB 4XNQB 3ULUD 4PJ7E 4YDIH 5CJOL 5F72S 5D4QA 2MHAB 3UTSD 4NKIL 1T1YB 4QO1A 4HFUH 2FECI 4P4RA 1B0GA 3BIKA 4Y0GA 3EFFA 3IKKA 4XNQA 5KSAA 1UQSA 3MLVH 2MFNA 3HLAA 2MHAA 2G5BB 4TTDC 3V0VB 1T1YA 4HWZB 2NXZD 4LVOB 4WV1A 1CG9B 2ZUUA 1UEMA 4JPVL 1OTTD 2YBRB 2ZSVA 2E7BA 1QSEE 2E3VA 1A6WH 1IAKA 4P3WA 3F58L 4QGTA 3DROB 3V0VA 4HWZA 5DVLA 4DZ8A 3MRKA 5L6YL 2K9UA 3U7AA 3LKOB 3LQAC 2YBRA 3NPZB 4P46A 4N0YL 3SY0B 4BM7A 4QRRE 3VXME 3QXTA 5IB2A 1QBML 3W2DH 3W9DA 4XZUB 2FATH 3VD7A 3LKOA 5C6TL 5AZ2L 2CIKB 1NC2B 2B4CL 4OGAD 4MMXC 3FQUA 4FQXA 4QXUH 5ID0B 4M6MH 4X7DC 4YQXL 1CR9H 4HV8A 5JO5B 1MJ8L 1HXMB 4PTUA 5DK0B 4WW1B 4NQSB 5F8QC 3ARZA 25C8L 4PB0L 4XMPL 1FVDB 4DAGH 3GMMB 3EYQC 4ZS6D 4U6YB 2D7MA 1RZIB 2DJUA 1UH2A 4BZYA 2EDYA 3MLZL 1N0XL 2Y6SD 5M95B 3V7AG 4MCYA 1ZLSH 2A77L 3UBXB 5HYJB 4HGMA 4BK4A 1YEJL 4NQSA 5E95B 2CMRH 1ZA6B 5DJXB 4LSVH 2FR4B 2VH5L 1R3HB 1B6UA 1RZIA 4MAUL 1CFTB 5EDXA 1FGVH 4EDXB 2AQ1A 5AYUH 3UBXA 1KBGH 1KC5H 3FRPG 3LS4L 3V4UH 3MLTA 4PRPD 4TVPL 1ZA6A 5JORA 3S5LB 4KMTL 4X6BA 5F71A 4DW2H 3BT2H 4K3JL 4EDXA 3TVMA 5JMOC 3GK8L 1YQVL 4FFVC 4ZS7H 3LEYL 2NZIA 5IHLB 2HT3C 1FZJA 5ICYA 3FO0L 4FFYH 2DWEB 1CDYA 3BMWA 4KTEL 4M48H 4KAQH 1JV5A 4E5XA 3IVKA 1T7VA 5FYKE 3P77A 4ETYA 1JPSL 4OZIA 4LGSB 1WBZB 3ZKQD 4ZOBA 3LQAL 3D69A 4GS7C 2D4FA 1LEKA 5C09D 4PJBE 2HT4C 3S98A 4PJHB 4RRPA 5FCUL 1A7PH 1WBZA 3OKDA 3L95A 3TN0D 4J4PC 5E00A 1CD8A 4LL9A 1QKZL 5EUOE 3X3GH 5TF0A 1S7QA 4RSVA 4B5EA 3TBWB 3G04B 4X4ME 3O2DH 3STLB 1KPRB 2X89D 1RJZB 4DKAA 3CVHH 1MUJB 4U4BA 2IQAB 3EOAB 4MJIE 1MCPL 4JM4L 4HUXB 1N26A 5CBAB 4KV5E 4M7JL 5CILH 2A73A 3STLA 3NA4A 5H35A 2YRZA 2IQAA 3EOAA 3BP4B 4OM1L 4P4KD 4UV7H 3SE4C 3F7PC 4K3GA 1CLYH 5I8OL 4LSPL 3ELAT 4LAQH 4PJAE 4RA3A 2XIDA 3BD4A 4AYFA 1FYTD 1U92A 2OL3A 3BP4A 5CBEA 2YA1A 3L7EA 3FRUA 4Y5YB 2YK1H 2VWEE 1F4AA 2BHYA 3VD4A 4TRPH 3FB7B 3TWCL 4EUPG 5HHOE 3N9GH 3VI4F 4AT6A 2APVA 3UPCA 5SWSB 5I8EB 2NY0C 5EA0H 2PNDA 5IESH 5I71B 4OTXL 2AKRB 3FHQA 3HZKA 4H88H 5BVJB 2HFGL 5GGRB 5KS9B 1HK6A 1MSPA 2ZNXA 5SWSA 2NZ9C 4EBQL 4NGHH 1HHKB 1OD9A 3D39D 5E9DB 4XX1E 3T3PE 2YRPA 4P2RE 4UBDC 1I7TB 2NYYC 5GGRA 4JY5H 4NT6B 1IGMH 1RULL 5ILTL 3QNYB 3RVUD 4WFHE 1HHKA 2XTJD 5DD1L 5E9DA 5ANMA 3UO1H 1PY9A 1HI6A 2ATKB 4FZ8L 5E2WH 2Z93A 4HH9B 3AY4A 2B0SL 3H3PH 1NCWL 2NW3B 1OPGH 2M26A 5JXAL 1DUYB 1ZLUK 2ATKA 2HTLC 2M1KA 3FB6B 2MCG1 1XGRB 2F54E 3C5ZA 4M93B 5DI8B 5GPRA 4TOYH 3WD5L 1IQWL 2NW3A 3PHOB 2NR6C 3ARDC 1GIGH 4PJCB 4F8QA 2O61B 4ONFH 2X2YA 3FB6A 4XRCB 5DI8A 2YPVH 5GQBA 3KPLB 4PJFB 3UPAA 5LGJA 4PJCA 4YHPA 2EEBA 3I3BA 3MOAH 1EAPB 5HGDB 4XRCA 2XA3A 1P1ZB 3CSPA 4NN7C 1JZ6A 5MEND 1EAPA 2CLRA 4DGIL 2VZ1A 5IV2B 4N90D 4PREB 4TQEL 15C8H 5E2UL 1YEIH 3UTSB 3RUGF 1MCKA 5BVPL 4UT9H 2ZUXA 2P48B 1K5NA 4XBPA 4JFZL 3IDJB 1A0QL 4ZUVA 2DQCL 1HKLL 4Y1AD 4KKBC 4NQCB 3DI2B 3A67L 4PGEB 5K9QI 1PKQE 3UTSA 5EZIH 2NXZB 3U7YL 4JG0L 1BAFH 1RMFH 4OD1L 4NQCA 1CGVA 3SDAC 3HI5L 2VRAA 5EU6E 1HH9B 5E4EB 4IOSD 2ICWA 4X7SH 4GG6E 1KJVB 4I18B 1HH9A 4JPWH 1FE8L 1ZHKB 1JVKA 5K33A 2VKXA 3OPZL 5CD5D 1KJVA 2QSVA 4I18A 1J11A 3P4MB 1B90A 1PX3A 4RWYH 1S7XA 2O5ZL 4R8WL 1INQA 1C16A 5JOPD 4LSDA 3GBNL 4JY6A 1E6JL 3EO0B 4BQBA 5D7JD 2PCPA 5J1TC 1YC8A 3BZ4B 1IARB 1UACL 1IT9H 4LEXL 4HCRA 2X9WA 5IVXB 4DOHE 4QXGL 5KW9L 4OJFL 1LO0L 5HHXL 4XWGH 3RWJB 1YEHH 5DZOA 4M9OA 3FFDB 3QWRA 1T0NA 3BZ4A 4HSQA 3GBLA 5FUZL 2FIRT 3RVWC 4R4FL 3SKMA 2VXVL 1WK0A 2X6MA 2A6JB 3C2AL 3SHSA 3FFDA 4PRPB 1BEYL 3G6DH 8FABA 5J9PA 4HK3J 4PJ9A 3ZE2E 4PB9L 1JL8A 1AJ7L 4X9HA 4YWGH 4JLRB 2P47B 1DZBA 1EMTH 4KGLA 3NIDE 4ENEC 3BESR 1XF5A 3V0WH 1LILA 4DGYL 2WQRA 1D5BB 2VZOA 4JLRA 4Z7NE 5FYJU 4J23A 2NY1B 3GI9H 3LPFA 5T5FH 2C3GA 5GGVH 1XF2B 4IRJD 2R1YB 3NMEA 4K3DL 1GXEA 5J06A 4PP1D 2BDNL 1MIEH 2F58H 3VFMB 4XPHH 4HPYH 1ZVHA 3P40A 2JIXA 1OCWL 1W72B 4ZXBA 5ALBH 3IF1A 2I5YL 1QUNA 4NQED 5C09B 2FL5B 2W59A 4N0UB 5JLZB 3VFMA 4DKDC 2DBLL 3TN0B 1W72A 4DFIA 3ZHKA 5D1ZA 1SJVA 5GS1C 2R1WB 1AD0B 5C09A 2I27N 1IRAY 4MS8D 1J0KA 1ONQA 3S96A 4ODHH 7FABL 2XQBL 3G6JA 5EORL 2R0KL 3TN0A 1MRFL 3AMLA 2XRAL 3NFSH 5TF1L 4U1SB 5MEQB 4XNYL 3MJ9A 3ROLB 2VDMH 5CKGA 4G43B 1ZANL 3GFUA 1BF2A 1RSFA 2VNCA 4OGXL 4IBLT 3MACH 3F12B 4P4KB 5E8EB 1RJCA 3ROLA 4UQ2B 3EDFA 1A1NB 4G43A 1JWSA 5MERA 5DC0A 2B5IB 1QOKA 1FYTB 3JBG7 1IGCH 3MBXL 1QFPA 5F9AC 2IFFH 5HHPB 2YPLE 1A1NA 3KXFE 3MLYL 3RAJL 4YHNB 4Q2ZA 2Z8RA 4MJ5A 4HWNA 5LXGH 4MA8H 4NZJA 1RUKH 2OK0L 3K7UA 3BN3B 4ERSL 1YY9D 1UWEL 2YD1A 3MMEA 3U4EB 2YD8A 1T1WB 5HHPA 2ZG2A 3VGBA 3HRPA 4MJ6B 3IU4H 3MCKB 1KJ3H 4JFQA 3PJSB 4IIQB 2FEDC 5C7XL 5D7SL 4Z7UB 5F9WB 1JHTA 3U4EA 1T1WA 4WI4A 4MJ6A 4OZFB 3D39B 4QF1B 3ZKXC 5A2JH 2JJSC 3ULVC 5DK2A 3EO9H 3BWUC 5ID1A 4Y4HC 5IKCA 4FQQA 4Q7DA 2DDQH 4WUUA 2XTJB 4OZFA 3D39A 4QF1A 5IB4A 4BFGA 4N68A 3T65A 5JPMA 2V7NB 5I1KL 3HC0A 1OARL 5KVGL 2FEEI 1BM3L 2B1HH 1B0WA 2BP3A 4P2QE 1MAKA 1SY6A 2DLFL 3P4NB 5E94A 1GGTA 3BEVB 2VZ3A 5CSBA 1N64H 4XC3L 4Z9KB 4DUWA 2V7NA 3EYOB 1QLRA 3QPQD 4ZTPH 2FJHA 2HAZA 5GSVB 4B0MM 4EN3C 1U8LA 1BQUA 3KWWA 2G5RA 4U3HA 3EYOA 3T0EE 2ED7A 1WAAF 5IW3A 1EO7A 4OFYD 2ORBH 5FKAA 5GSVA 5C08E 5HGBB 1HOCA 3T4AB 2C9AA 4P59H 1CXEA 4LARL 3TJHC 1OGAE 5DRNA 2V5TA 4LLUB 1TZIA 4M1CC 1BREA 1CVRA 4F7EA 5MENB 3TO4C 3T4AA 1H5BA 1WWCA 5GRZA 3ZYOA 4P23C 3FT4B 3KPSA 4S0TD 4OZGF 4C83A 1Z9OA 5HI4D 4F33B 3MLWL 5MENA 2MQ0A 2AJ3A 3GMLB 5E99H 3FT4A 2NY3D 5BS0E 4Y1AB 4GW5A 1GC1H 4F33A 2VLJE 3ARVA 3T0XA 1R5WA 5E1AB 4AK1A 3O11B 4Z5RA 3SO3C 3BYTA 4OSUL 1C7SA 1B2WH 3OF6A 4WCYH 5IGXL 3ULVL 2EDDA 5E1AA 3N1FC 2LAAA 2GK0B 3FMGH 3O3BB 3TT1L 2CDEB 3CK0L 1JFQL 4MNQD 3OB0H 5MHSE 2DQIL 1J88A 3U1SH 2QR0B 3MCLL 4Z0BL 3MUGA 4S1QH 2X09A 1N4XH 3SGJA 1M05B 1U6AL 4WWKD 3OKKA 3CIQA 2EIZA 2Z8WC 1YPZB 5CEZL 3WEXB 5D2NE 5EULV 5EN2B 1RZJC 5ISZD 5I8KL 5FM8A 1I3RB 1Y6NR 3MO1A 1T89A 3QT2A 4C57C 5A40E 1VEOA 5EN2A 4D9RD 1I9JL 4YEEA 4KJYB 1I1CA 1IE5A 3REWA 3KYOA 1V3KA 5FGCE 3P9LB 2H2PC 3IETA 4LU5L 4TNVF 2QHRL 3ARBC 4KJYA 5B3JF 1ULVA 3BEWB 5CGYC 3IAPA 3S88H 2GJJA 4NCC1 4WHCA 4V1DE 1I1RA 2E7LC 1NMCC 1E27A 1KT2A 1JZ8A 4I3SH 4X98B 1R3IL 5D7IE 1DCLA 1XIWC 4DQOH 3LIZL 2HVJB 2ICEA 3BYYA 4QHUA 5AEAA 1A3RL 4HAFA 4H1LG 1MLBB 1V7NH 3RTQD 3NA9L 2HVJA 4MD0B 3RKDD 3WNLA 4WGWB 3LV3A 3ARGC 4LIQE 1XGUA 5J1SC 4XPTL 4KK9D 3S36X 2HKHH 4N8PA 1MLBA 3GM0A 2JCCF 4JY4B 3L1OH 4IS6B 2AEWA 4C59B 3AXLB 4MD0A 1KXQE 3U4BL 4IRJB 2CJUL 3D25A 3DV4A 2R4SH 1FNEA 3RBGA 5IQ7H 4JY4A 4OIIH 4IS6A 4UIKH 3QIBA 1S78D 4Y4FC 3AXLA 4O9HH 5E2VH 5F89A 4Z7WF 2XWTB 4NQDD 3UC0H 4NQEB 3ZE1E 3L3GB 3GSNA 4U1JB 3RBSA 1CGYA 3PWVA 1AC6A 1OAYH 3MLSL 3BGMA 3KLHC 4OD3L 1D5XA 3U6RB 1JPFB 1RZJL 2LTQC 3MRLA 3TBYA 3FT2B 2E7MA 5I1EL 2XN9D 3L3GA 5HHVH 3HC3L 1I1AC 2SEBA 1DLFH 1V3MA 1H8OA 3OGOE 4XMLH 4E42B 5D6DA 1DBAH 1T7YA 3U6RA 1JPFA 1KIQB 4GUPB 5J11B 1EVTC 3NFPB 4XAWL 4EI5C 5DURD 3VGAC 2CR6A 4FP8L 1R5IA 4JKMA 4R0LC 4F8TA 2FECL 2Q76B 3FRPA 1C1EH 1MCCA 2GJZB 2J4WH 5SWZD 3VWJC 1CU4L 3VFVA 2Y72A 3EDEA 1QR1A 2PTUA 1PD6A 4B50A 2Q76A 1SM3L 1MCDA 5DFWH 2GJZA 4OV6F 1LO4L 5E2TL 3ZYIA 1A6AA 4NYLA 1Y6MR 2GFBA 2H9GB 3V6OC 5KVDH 4I13B 3SCMD 2ZOLB 1D6EB 2X4UB 3EOBB 1T03L 1REIA 5IBLC 1NFDB 4LNRB 5F9OL 5CJQL 4X4YA 5JIIA 1F2QA 4YK4B 3GSOB 5DUBB 3PWUB 2H9GA 1ZHLB 2X4UA 4NQVA 4WHTB 4U05A 2HT2D 4LNRA 1S7RA 1WFOA 4UB0L 5D1QD 2W38A 3VG9B 3UTPE 4TPRL 4XX1G 4OAWA 5DRWB 2FBJH 4ZPTA 1R0AL 1TETH 1FZMB 4P57B 5DMYA 4N1HB 4YXHH 1CZ8H 2BY3A 5FYJH 4ODWA 1T1XB 1AKJD 5FHBL 2YZ1A 5C0NC 5DT1L 2R39A 1YA5A 2C1OA 4NBZB 1U95A 3GSVB 1H0DB 4MVBD 1OP5H 4W4OA 3GMRA 3SE9H 5CUSL 4GRWF 4QLRA 1H0DA 2F8XC 5FHAH 2FNBA 2AJSH 4GW4B 2ZCLL 1W8NA 3QCVL 4Q6IB 4P48A 5D6CA 4EUPB 1AQKH 1EO8H 5INCB 4WJ5A 4TTDD 4GW4A 1A21A 1XGQB 1JHKL 4KQ4L 1JP5A 4NJ9L 3GUTB 1V8HA 3DO7B 5DJ8A 4EUPA 3OL2A 4OFYA 3WO4B 5INCA 5TE4L 3PV7A 3IFLL 4XB7A 3WCYA 1KCRH 1QRNA 1S9KC 2KPNA 3MRFB 2YSSB 3CU7A 1QACA 1CK0H 5CFHA 3CSGA 3B43A 3WFHA 4D0DB 2DBJA 3AAZB 4AEHL 1S3KL 3BKCH 5LBSH 3DXAD 4KHXL 4FTVD 4WEBL 2ZUQC 3D9AH 3MRFA 2YSSA 3IFPB 4WI8A 1MH5A 5LCVL 4D0DA 2NY3B 3AAZA 3U0WL 2ZKHL 2AK4D 5J13C 4X6DE 3EGSB 2R0LH 3HPJB 2OJZL 4ORGB 5DTFB 1MCWW 1EJOL 3B6SB 4HEPG 5TQ0H 3CUPB 2A1WH 2CSPA 3O41A 2O5XL 1LO3L 3EYQD 4Y16C 3HPJA 3WFDH 3BPNC 3F7RA 1QFUL 1WV7T 3S35L 4MNQB 4ORGA 3S4SB 3BZEA 3O4LD 3FQTB 1MREH 3CMOH 1X4YA 3ZT5A 5L0QB 5I1LB 2HKFL 4D9LL 1T83C 2EXWC 4RQQB 3MRGA 1L7IH 1JK8B 4K7PH 4WWKB 5F3HA 2WMPA 1PG7X 3FQTA 1QEWB 2C4FU 1T6WA 5ISZB 1CVSC 3RIAF 2Q7NA 5I1LA 1UCTA 2FB4H 4N8CH 1E0OB 3WNNA 5CINH 1CXKA 1H3WM 2HFTA 4WWKA 5TE7H 1TZGL 3M07A 4PRHE 1A1OB 2DTMH 5H2BB 4FFVD 4O2FB 2VDLL 2HFFB 1YNTA 4NNXB 3QB7C 2HT3D 3BKMH 1XGTA 5K9KA 5FF6B 1A1OA 3L5JA 1FZKB 1C5DA 3VXPB 3WIHA 3O3DB 4JN1L 2HFFA 43CAB 5I1DB 4PRNB 2C7UB 1K8DA 3L3HA 5E8NB 3LMJH 2P24A 4WNQB 3C5JB 2G60H 3K81A 3MSPA 2XXMB 1F8TH 1S7TB 4U3CA 2X4QA 3O2VH 3O3DA 3G9AB 3VH8B 43CAA 5I1DA 3RWGB 2C7UA 4OLXH 3WHE0 3HE6C 5IFHL 5KTEH 3C5JA 2HT4D 4QTHB 4PP2B 5E8DH 3VFPA 3GZKA 3O8XA 5E4IA 1JHLL 4J4PD 3HMWL 3ZT6A 3RTQB 3VH8A 3RWGA 4P5TC 4QTHA 4PP2A 2EICA 4X0KB 4U2YA 4L4TA 5GRJH 4X0KA 3BRGC 4I1NB 4XGZA 1WUNT 4YH6A 3MV7A 3TCXA 5DEGB 1FORH 2FGWL 1ZLVK 3JWOC 5IF0A 5EU3A 4WDIB 2OZ4A 1FJ1B 5T1MB 1P7HL 4JFDA 1EHLH 2J6EH 5KVFL 1ZSDA 4NQDB 2D7QA 4HGKC 4XXDB 1IGIL 3C08L 1FJ1A 3MPCA 4LSSL 4MNGE 3OX8B 1JGVL 3MRMB 3MXWH 3L3OB 3QNXB 4NQDA 4AMKL 2XN9B 3UP1A 5JOFB 1LQSR 2C4FT 3FN0H 4LSTH 2OR9L 4QT5B 4URTB 1FV1A 2NY0D 4XPFH 5DURB 4HZLA 1J8HE 3Q6FA 2BRRH 1NLDL 1ZWIA 3B2UD 4YUEH 5SWZB 5JIHA 1J1XL 4S11A 1NSNL 3IFNL 1WJ3A 4UBDD 2NYYD 4FFZL 5D7KE 3ZHDA 4HIHB 3MBEC 5ERWB 5SWZA 1MPAH 1CD1A 4K23L 4WFGE 1CGTA 2P8MB 2VQ1A 1E4KA 3SCMB 3TF7C 1RJLB 4KTYA 4CW1B 1D9KC 4KKLC 4WHYG 3JXAA 3UTZA 1OGTB 2WZPD 1HHIA 4HC1A 4MWFB 3CSYB 1P7QD 5HVFB 2JB6A 1T3FA 1RZGA 3SCMA 4CW1A 1BWMA 4OCSL 4LEOA 2HTLD 1WWWX 5F7YC 3CC5B 3MV11 5INDA 5D1QB 2NR6D 3P11H 3ARDD 4KMLB 1QNZL 3A6CL 3DBXB 4NM4L 2GYSA 1WICA 4J3VA 4N9GB 5DJAB 4PD4K 5DD5L 3JWOL 2V5RA 1AKJB 5IW1A 1BGXL 3DBXA 1HDMB 1RIUL 3BUYB 3PGCB 3PWNA 4G6MH 4EJ1C 5GS0C 1T1ZB 1WCQA 2E8YA 2B2XL 2IH3B 5K59F 4JKWA 3ECBB 1NGZA 3BUYA 3SDXF 1JIBA 3CXHJ 3PWPA 3PGCA 4OFIA 2XWJA 1FBIH 3OKNB 4L4JA 1T1ZA 5J7CC 2IH3A 5FYLL 2BVPB 3QXAB 1NPUA 1AFVL 5IROA 4KKBD 2X70B 4DVRL 1PYWA 2CLZB 2LU3A 2OTUA 4UNVA 2DQTL 1RUQL 1AQDA 3THMH 1MRCL 2BVPA 3I2CH 4YGVA 2Q86A 4J2XA 3TH4T 4TUJB 3SDAD 3E6HB 3GSRB 1S8DA 2EDNA 4JQVA 4M61B 4BQ8A 3GMNB 3QFDA 4FA8A 4HIJB 2M2DA 2J8UB 1JCKA 3RL1A 3ULUH 3MQIA 3OHXB 3QQ3B 3E6HA 4KWUA 3DXAB 4O5LL 4M61A 4FTVB 3GMNA 3P2TA 2D7TL 3EYUH 2J8UA 3IDNB 5AG9A 3OHXA 3DVNA 4X4XB 4RIRB 3NZ8A 3QQ3A 3FONA 4K3EH 1R3KA 1TTUA 2AK4B 5DYOA 1NCCH 1RFDH 4FTVA 4CADA 5BXFA 1MCRA 1BLNB 1ERNA 1JNJA 1GL4B 1G0DA 4X4XA 4RIRA 4U6VL 1BOGA 2NY4D 4NKOA 5I8CA 1QO3A 2WQ8A 2N7BA 1AP2A 4U1GC 1FAIH 2ZP0T 3H42L 2F53E 1PLGL 3MYJA 5C0IB 3VDAA 3NN8B 4JDVB 4XPBL 4ELME 3O4LB 3CXDL 3H8NA 3GSWB 4PRIA 3H7LA 4ZFZA 1ZT1A 3VD9A 2D7OA 3MR9B 4RX4D 5I19H 2FO4B 3NN8A 4JDVA 1MRDL 1U8OB 3GSWA 5GS0L 1PFCA 5C0AD 3CVIH 2I07B 3FOLB 2CR3A 1J7VR 2MCPL 4CDGC 5ABDE 3MR9A 3BO8B 3HRZB 3GSUA 1KELL 4HKZA 4QY8B 2QSTA 4CBPA 4OCYH 32C2B 4LCUB 3CFBB 1Q0XL 4AZ8A 3EOTL 4LQFL 4ENED 3LKRB 3WXWH 1Z3GH 3ESVF 5KN5B 4I9WD 3BO8A 2I9TB 3RWDA 5FB8A 4JE4B 4OF0A 1OAUH 4QY8A 4PLKC 1CFVL 32C2A 3VWKA 5K9JH 2V9QA 1P5VA 4WFEE 1N8ZB 3DNKA 4PJ7A 5IOPA 3GI8H 3H7BB 5D5MB 5C8JB 2CDGB 1TVBB 4JCMA 4LDEB 1G9NH 1K4CA 1UJ3A 4NNPL 1YEDA 3CDFA 3H7BA 2IPTH 3EYFB 4GS7B 2W65A 4D3CH 2VLRD 2WUCL 3RX5A 1W0VB 1BZ7B 1UZ8A 3SJVE 4KXZI 1D6VL 4ORZC 4WO4C 4TSCL 1QSEA 4PTTB 4XHQA 2GK2A 5IMKB 1DBKH 2AJZA 2VDRH 3VFUA 5JNYA 1W0VA 2FX7H 1BZ7A 1T04A 4W81A 1EAJA 1CDHA 3VXRE 5A1AA 2EE9A 1MVFA 3VXUE 1MFCH 4I77L 5IMKA 3VXMA 2X41A 4HF5H 4JO1H 3C6LA 3ZSTA 1PDKA 3O3AA 1Q94B 2FBOJ 4HS6A 3LQZA 2VAAB 1F4YH 5DRZB 2DYPD 1I4FB 4GKZB 4O2CA 4WY7L 1TZHA 4POUB 2BCKB 4P9HH 4Z7VF 3VXSE 1ORSA 3QDMD 2RR3A 4PJGF 2BOCB 4N9OB 1I4FA 2IQ9H 4OQ1A 5EO1B 4GKZA 3MJ9H 3CDCA 3WN5C 5GSRA 2R4RL 1HSBA 5FOBA 4BSJA 2BOCA 4JO4L 1A8JH 1CFNA 2G9HB 3J8F7 1UXSB 2NY0B 4GAGL 5LG1A 1DUZB 2C4XA 4NKMB 5IQ9B 5L2JB 4H1LB 5D1XC 4MAYA 4FQ2H 5D9SA 5T3ZL 2WUBL 4HAGA 2AJXH 2C5DC 2BNQA 3ULVD 3DTXB 4G5ZH 5IHUH 2VB5A 4NKMA 2DRUA 5L2JA 4H1LA 4Y4HD 4EXKA 4ONHB 2UUDK 4X5LA 3IRZA 3WS3B 5E6IC 3Q3GB 3RFZC 2AEQH 3B3IB 3V5DA 3K4DA 2QSCH 3L5XH 2I60L 3C60C 4YR6B 3WS3A 5IB1B 4HIIB 5CEZD 1P7QB 1U3ZA 1K3ZA 3QI9C 5DXWA 2R2EB 5DHVB 4DN3H 3IDIB 4ISVB 4YR6A 4EN3D 2FLRT 3TP4A 2IANE 1OTSC 4OZFH 4X6EB 1P7QA 3ARDB 2VLME 2YWZA 4G8GD 1OT1A 4PJBA 2E27L 4OCRL 5DHVA 3LVEA 4ZAKC 4CN1A 5DD0L 2FD6L 4Z78A 4WI7A 1SY6H 2DOCA 3K4AA 4S2SB 3BWAB 4TNVK 2EDXA 1GGCL 4Y89A 3GM8A 4NO3B 3TJHD 3T08A 4GKSA 1U42A 4WU7B 5AUMA 3MOBH 4M1CD 4PUBH 1IKNA 3BWAA 3PWLB 4NN7B 5CSZB 5DFVD 3TO4D 4MJIA 1YNLL 4P23D 1JPGB 3W5MA 4L1DA 1NEZG 5CMAB 5B4MC 5KAQF 5CSZA 1WFNA 4JFEE 4RGNE 1YMHB 1DFBL 4JFFD 4XC1H 5IM7B 5L9DL 1S7SA 4PJAA 1N59B 4HHAA 5DD6A 2V7HB 2YEZB 4PLJC 3UJTH 2EKJA 4OLWL 2FCBA 1LE9A 1RHHA 2VWEC 5ICZB 2V7HA 3SDAB 5IJVB 5BZDB 3DARA 2N4IA 1O0VA 2R0WL 1G7IB 2VQTA 2HYMA 3FTGB 4NNYB 5ICZA 1JF6A 3DRQA 1NBYB 2GSIB 4EQ3A 2C1PB 1IAMA 3FQNA 5BZDA 5HVGB 1E4WH 5ALCH 1NLBH 3CZFB 4NFCA 2XXCB 4TULH 3GMPB 4OFVA 4OM0L 4XPAL 4R96B 3O0RL 3E2HC 1EV2E 4MXVE 5D7LD 4PGJA 1RIHH 3BKJL 2A9NL 1I8MB 1TNNA 5DGQA 2EYTB 1CDJA 2ID5A 3GMPA 3E0GA 2GTZA 2NY4B 2E9BA 1JNLH 3MRHB 4KH2A 2YR3A 3ARUA 2H2PD 2PYEE 3O4OC 6FABL 3P9MA 4NP4L 1I7RB 1A9EA 2EYTA 4J8RB 3ZKSD 4BKLB 3ARBD 5ADPH 1HN1A 5CGYD 5HVWA 3W11C 4ZSOB 2VYRE 5KSBF 1A1MB 2BX5A 2Y06H 1I7RA 2EEAA 5GGQL 4J8RA 5CZKA 3QEGH 3U2SB 1HZHL 1FG2B 3MLRL 2YRLA 3HG1E 5C0AB 4BZ1L 1BVLB 3HNSL 3L3DB 1U2HA 2VDQL 1XIWD 5JXEA 4RX4A 1BVKB 3FQWB 3V79C 3PQYD 1MHCB 4AH2B 5C0AA 1BVLA 3ROOA 4BH7A 3P0VH 4OLUH 4O02H 3EBAA 1KB9K 1BVKA 3FQWA 3KPRA 5EO0B 1BFVH 5DEFB 3ARGD 3ARSA 4QOKD 1QBLL 3AREC 1OB1B 1QSFA 4L8CB 1KPVA 1RAMA 1QSZA 4JM2F 1EERB 1FN4B 2LU7A 3KNBA 2F8VA 5C0BA 5EO0A 5DEFA 1ZTXH 2YD4A 2J3SA 1KXTB 4RISH 3BVNB 4Y4FD 3IJSA 4IRZH 1KTDA 3MV8D 1LEGB 4LPYA 3CDGB 3FCTB 2VLRB 3I02B 2A2QT 2FX8H 3S37X 2EIDA 3RVVC 3QCTH 1J5OL 1YECH 3VFTB 1YMMD 4GXVH 3KLHD 1J0IA 1FGNL 3CX5K 5GS1B 5DK3A 4XTRC 3FCTA 4PRDB 5J1AA 1UA6L 1DE4A 4D0CA 4NZTL 1I1AD 4GG8B 1KCSH 2AGJH 2H8PB 2CGRL 3VFTA 1TITA 4JPIB 2OMNA 5FCSH 5AD0B 3FFCD 5EUKB 4EI5D 4GG8A 2H8PA 4MX7B 1KIRB 4QHLB 4C56D 4JPIA 1MF2H 5AD0A 1EBPA 1NGPH 2V5YA 4OFPA 2DYPB 1AHWC 3VWJD 3C9NB 4NRXB 5E5MB 2Z91B 1C5BH 3TH3T 5KJRL 4QRPE 3QDMB 1KIRA 1K8IB 3K74B 3WS6A 1G0YR 2DYPA 5AZEL 3CH1B 3JV6B 1YNKL 4H5SB 4QRUB 4RFNC 1IGTB 1K8IA 4RCAA 2HG5B 4HG4J 1ND0B 4K3HA 2EIEA 2DKUA 1TLKA 2ESVD 5JUEL 2N56A 4JHAL 4H5SA 2VDNH 3CFKA 1WZKA 2H32A 1NGXA 1UT9A 3BP6B 5HYSG 2HRPH 1AGBB 4N0RA 3CFJB 3QXDA 4XP9H 4M3JA 4JFYB 5TDNB 1RIVL 3TYFB 4NWUL 3ZKXB 3DVGA 4G9FE 1GPOL 2PYFB 4JZOB 1G7QB 3C2SA 4L8DB 4Y4HB 3UJIL 3U83A 5C0JB 2FIKA 2GI7A 3TYFA 1YEKL 3RUGA 1L7TH 5C0ND 2JJSA 4M5YL 2YMXL 2AJYL 4RGOL 1G7QA 4HXBH 2YS4A 4I3GA 4FABL 4Y4HA 4N0FB 1UM4H 5C0JA 1ZS8B 1BECA 1WBXA 3R8BB 3BPLB 2EXYC 4YHZH 3F6LA 4XCNB 3RIAK 4N0FA 3FHAA 1ZS8A 4LLVB 1XGPB 3RPIB 4KPHL 3RGVC 4EN3B 2NLJB 1ZT7A 4G8GB 4KZEL 2ADFL 3OTTA 2RB8A 3MGTA 4E41D 1S7UA 3ZYZA 1NUDA 1XGPA 4W6XB 2V5SA 4EN3A 2AI0L 2HJLA 1KYOJ 2FX9H 2XNAB 5FDWB 4G8GA 3DX9B 3UMTA 4IOFC 4ALAL 1WTLA 3OAYH 3TA3A 1XEDA 2UZIL 1OAXL 2AEPH 5FA3B 1A2YB 3TO4B 3DX9A 3LKSB 3HMXL 2Q3ZA 4P23B 3OZ9L 3CLEH 3D6GA 4OLVH 1N6UA 5FA3A 5GJSL 3TO4A 1P4IL 3HI1B 4KY1L 4UMGA 1TJGL 4JFFB 4P9MH 1BBDL 4XVSH 4ZUSB 4EUPH 4JFOA 4U1KA 4JFPB 4PJEB 5DMIH 3EJYC 3S35X 4LCWD 4RNRA 3HI1A 3JWDC 2BY1A 4Z7QE 5J6HB 3FQXB 4LLDB 3KXFA 4P3DB 5D71L 5F7KC 1GHFH 1AY1L 1CGWA 4L8BB 4Y16D 3MFFB 5J6HA 3FQXA 5LWYL 3B2VH 2AXFA 3CU1A 1YZZA 1D7FA 5CEYB 4KZDL 4P3DA 4JM2C 1KJ2L 5DWUH 3QWQB 3RVXC 3N06B 4D94A 4MNHB 4IMKA 3TIEB 3PGFH 1KB5L 4O4YH 1NANH 3D2UD 4HUWA 5CEYA 4X6CF 3RIFF 4BSWB 3GJEB 5E2JA 1HINL 3C09C 5BO1L 1JN6A 1M1SA 3RI5F 3V6FB 2XOTA 1ZGLB 5D7LB 3QPXH 2IAMA 1FRGH 3LCYA 4MNHA 3TIEA 1NJ9B 2VE6B 3O6LL 2Y1VA 4ODXA 3TBTB 3VI3F 5E08H 5CKAA 3W0WA 4BSWA 1ITBB 3MYZA 5KS9F 4P2QA 1IL1B 1ZGLA 3QEQD 1UWXH 5D7LA 1NBVL 3SE8L 5DSCB 4UT7H 1FL3B 2YD7A 3GNML 3VU2A 3TBTA 3OR7B 3S36H 1KN2H 4OZIE 3E6FA 3ARBB 4AEIL 3OSKA 2Q87A 4ZFOA 3RNKB 5DSCA 4I3RH 4LSQH 3P4OB 4DGVL 1NMCB 4Q6YA 3T2NL 4NO2B 4S1SL 4NZRH 1XIWB 3ABZA 5GGTA 1OSPH 3HE6D 2DB8A 1YYMH 1IAIH 4NKDA 3PQYB 4PJHE 3HFMH 3D0VB 4YHML 3UPRB 4HW6A 4XT1C 5H8DA 3SKOB 3RZCC 3ARGB 4QOKB 2FSEB 4YHLH 3PQYA 2WAHA 1LD9B 3JWDL 2QL1A 3D0VA 3ZLQC 3BW9A 1MAJA 1P9MA 5ESVA 3V6BR 2APXA 3H3BC 4PJFF 4ACPA 4F57L 3U0TB 1EUUA 2RIKA 3RWIA 1LD9A 1MHPL 2YC1A 1T20A 4Y4FB 2DL9A 3MV8B 1A3LH 5DJ6B 3U0TA 4FQ1H 3SQOH 5BRZA 1RUMH 3RL2A 5ACLA 1UKSA 4Y4FA 3AS1A 1R24B 2CLVB 1YMMB 3I75A 2GKIA 4KUZH 2LTQB 4YBLC 4U33A 2OI9C 4KVCH 3MRBA 1I1AB 4HBCH 1U8QA 1UKTA 2CLVA 1YMMA 2VITA 3LS5L 1DP0A 3FFCB 1MIMH 5FYLD 5SWSE 4EI5B 3VGAB 4R0LB 1X5JA 2JK5B 1MFNA 1FH5L 5I30H 3LAFA 3EAKA 4C56B 4AY0A 4J7RA 2Z4QA 1E4XH 4U7KA 2NPLX 4X80H 4N8VB 5D2NC 3VWJB 1PQZA 5AAMA 5I75C 4JQIL 5E9DE 5ANME 2VL5B 1L0XA 2JK5A 4GSDL 2C3VA 1DQLL 2ZPKH 4J12A 3MBED 4S1DC 4UOW0 4JJHA 4PS4H 4UDTB 5IW6B 3VJ6A 5DMJB 5CJOH 4UUJB 1D9KD 4KKLD 1LK3L 5F1OB 3VA2C 1VEMA 2ESVB 5IW6A 1T2XA 4P0DA 3FQRB 4V1DA 5IFAL 1QBBA 1MJUH 4MQ7A 3HR6A 5HPMA 3IGAB 4OZGB 2ADIB 1FVCB 1URLA 4UDUB 4JPVH 2FJGB 1KFAL 5DQ9A 4PJCE 1TCRA 1ZA3A 3K2MC 5IVXF 4PGCA 1F4HA 3IGAA 4OZGA 1K4DB 2ADIA 5L6YH 1FVCA 4HC1H 2P4AB 3G5VB 3VFGL 4DKEH 4N0YH 3HR5B 3HUJB 3RU8L 1K4DA 2X44D 4UINL 3X12B 1QBMH 1RJYB 1SBSL 4JFXB 1IEAB 1GSMA 4YC2B 5C6TH 5AZ2H 3BH8A 5GS0D 3HR5A 2B4CH 4Z76B 4A2LA 2W92A 3X12A 4E9LA 3BDYL 5I2IA 1CQKA 3ULUE 5C0CA 3GSXB 3RHWF 3TCLB 4YQXH 3VGGA 5F9JB 3GHEL 3K2UL 4ODUB 3FO9A 3UTSE 2DQHL 5A3IC 1MJ8H 3OJDB 4M62L 2PKDA 4PB0H 3KDMB 5B21A 3OBAA 4AQOA 4R3SB 5EOTA 4E41B 1F5WA 1RU9L 4NQCE 4XBGB 3TCLA 5ADOH 1NDGB 5F9JA 3CFDB 3MLZH 1N0XH 3GHBL 3G5ZB 4N5UA 5F1KC 1CDBA 2A77H 3OJDA 3DGCR 3FN3A 1YJDC 3KDMA 3WL9B 4R3SA 1FO0L 2XFXB 3WFCL 4GLRI 4HPOL 2VH5H 3Q6GH 4MAUH 4GAJH 1FFPB 1ZEAL 3CFDA 5HHMD 3MRDB