3HKFA

Murine unglycosylated igg fc fragment
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
205
structure length
205
Chain Sequence
SSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Igh protein
publication title Structure of the murine unglycosylated IgG1 Fc fragment
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 31
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2009-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hkfA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hkfA01
2H6PA 1YYLH 1FG2A 3DRQB 1CVRA 4YDJA 4IRSB 3O2DA 5EDXA 1CLOL 4BA8A 4J1UB 1RJLB 1DLHA 1ZLVH 1IGJB 2R1YB 4XVJH 1KV3A 2X4QA 1ZWIB 2HLAA 4HUXB 4JZOA 3B6SA 5IKCA 3MRCA 4DFIA 5ALCH 3WL9B 5AG8A 2V2WB 4MQSB 2VSCA 4YFLI 2NXYC 1LP9E 2EH8H 3BYYA 3U79A 4NUGL 1U8NB 1CFNB 4KK6C 5CBAA 3F12B 4Q2ZA 2HN7A 1IGIH 4WFFD 4D3CL 4PD4K 4G8FB 2C26A 5JXEC 3HAEH 4L8BB 3E2HB 1DN0A 4Z5RA 3SJVD 5CSBA 5EO1A 5GISL 2UUDK 3O6FB 4WI2A 2ADGB 1SEQL 4WTZG 1KPVA 5DDHB 1OF2B 1WVZA 2CLVB 1I4FB 5DHVA 1KBGL 3LPWA 3I6GB 1X4YA 1YYLL 3MR9B 1KB9K 4XTRC 3SEPA 4OZGB 2VLKB 2R1WA 5C0EB 3X3GH 3FOMA 5K9QI 1IFHH 1NC4B 4XVJL 3C2AH 5KSUB 4F80A 4J8RA 2WAHA 4TTGA 3OKDB 1WAAE 5ALCL 3D39D 5GGSA 2RBLA 2A77H 4XH2B 1HXMA 1W0WB 5E6IB 5C08D 1MJ7H 3EYFB 4JR9H 3LRSA 4DKAA 2C4FU 1GOFA 5JHLH 1I1FB 2EH8L 1A3QA 3RRQA 6FABH 4NQDD 3BP6B 4IIQB 1KACB 3DX9A 3ZT7A 1JZ2A 4H0IA 2R0LH 1IGIL 5FB8B 1OTUD 1VENA 4AM0A 4XB8A 3T04D 3ME0A 4PJCB 1D5ZB 3S5LB 4MNGB 3CFJA 1WQVT 3M17A 3AAZA 5C0FB 5CZVH 1KTDA 4S0SD 3UTTD 2AV7A 2CLRB 5GS2D 5TDNB 5FO8A 1B90A 1A9EB 4I48A 4H1LA 3EGSB 4BH8A 3IXTB 2B5IC 1KGCE 1JNJA 2VKWA 1QBLH 3OKMA 3HC4H 3UTSB 3X3GL 3QIWA 3P4NA 4S1DC 4JB9H 3SE3A 5JW5B 4GAJH 5J3HD 2XYCA 2R1XA 1IFHL 3LN9A 3GO1H 3C2AL 3GK8H 3EDJA 4MNHB 3M45A 4F3FA 4G9FE 4XBPA 4ERSH 2R56H 1K8IB 1ZHKA 3VFPA 3QULA 2A77L 2H3NB 2VOTA 1MJ7L 1VEOA 4JR9L 5JHLL 5BRZA 4L8CB 3GFUA 3SDCC 1X5ZA 1P4LA 2NY0B 6FABL 4NC1C 3TVMA 3EJJX 4YO0B 3G5YB 4O51A 3R06B 3BUTA 2ZP0T 3KJ4C 4JGUA 4PR5A 2R0LL 2ZSVB 2IPKB 3V7AE 4BELD 3CUPB 5CEXA 1BLNB 1G7MB 3KLHC 2HT3D 1EH9A 4H5SA 3TT1H 5FF6A 5FECB 5CZVL 3B5GA 3HE6D 3G6JB 1PJ9A 1VFAB 2P5WB 3F5WB 3N1GC 3OX8B 2Y5TA 3W0WB 1D5MB 3WNLA 2ATKB 1QBLL 4MAYD 5E24E 3ILPA 2EXYD 3HC4L 4P4RB 3IU3B 2X42A 4JB9L 3GJEA 4GAJL 1EAJA 2ED9A 3SDYH 3GO1L 5CCKH 3GK8L 1GOHA 4OUOA 5F7EH 4ERSL 2R56L 4N8VA 3PIQA 4DTGH 2AXHA 4D2NA 1GCFA 5EU4B 4NT6A 3VG9C 4HC1A 3MJ9A 4I0KA 1UEYA 1ZANH 2PW2B 2BX5A 4CVXA 5B3JF 1OT1A 4L4TD 3JV4B 4HHAA 4RGNE 1LE9B 3BDBA 4PG9B 5HHOA 4LPTA 3HUJF 2NY1C 1IKNC 5DGRA 2ZG1A 4LSTH 1IZJA 3BQUC 3HMXA 4F57H 2YRZA 1MVUA 1IKFH 3HAEG 2X1WL 3TT1L 1WFOA 4HUKB 1N26A 3MFFA 2V9RA 1W72B 4DKDC 4F7CB 2EDJA 2MHAA 3OV6A 3MJ6A 3SE8H 5KSVA 1VKXA 2P5EB 1TCRA 2Q76B 3WFZA 1TFHA 2ICCA 3QWRD 2SEBA 3FQXB 1YN6A 3V6OE 3QFDA 4HK3N 1XZ0B 4JRYA 5K93A 3E6FB 3SDYL 5CCKL 2ID5A 5EZJA 4A2LA 5KSBF 5F7EL 4RMWA 2YA1A 3BAEH 4K55A 5BW7A 4X98B 5E9DB 2NXYB 5F6IC 1G0YR 4EJ1C 2BHYA 4DTGL 1ES0A 2GJ6D 5DF0A 3QDJA 4GBXA 4PJ5E 3LN4A 1YY8A 5J6HA 3HC0B 1J18A 1UWEH 1ZANL 3G9AB 1U91A 3FO2A 2NXZB 3VI3F 5JZ7D 1T04B 5D7SH 4LLYB 3FMGH 3GDBA 1SEBA 2P43B 1Z6JT 4D0DA 1KLGB 3VFVA 4LSTL 3GSVA 1XGPB 4XNZC 4F57L 1QQDB 4YGVB 1IKFL 3AFLA 3OB8A 3ULUH 3P4OA 5F7MC 3DX6A 4ZOCA 5IVXE 1ORSB 3TNMA 1AC0A 4PJ9B 1H3UA 1VDGA 3MRNB 1JP5A 1PKQA 4GKZB 1DCLA 4W4NA 3SE8L 2WLYA 2YC1A 5F6HI 1Y0LA 5FUOH 3ZKNC 1QR4A 3ARRA 1ADQA 4JDZA 2FDBP 4IMKC 4KK8D 3K4AA 2X4NA 4J3XA 4PV8A 2UWEF 5EU7C 3BAEL 2V17H 1UXSB 5E7BA 3DVNB 3NVQA 1T4KA 3LKPB 5JW4N 1LWRA 5BCAA 1EBPA 4WW2C 2DS4A 1CDGA 3ARBB 1HOCB 4JM2C 2DOCA 1CFBA 2JK5B 5D2LE 4OCXH 4WWKC 4NNYB 3MZGB 5D7SL 3FMGL 1DL7H 1ZA6A 3MA9H 3O6LH 3FZUC 5D70H 3W9DA 1JZ8A 2WSKA 4PJXF 2I9LA 5DUBB 3P0VH 5AEAA 2KDGA 2X4RA 3ZE0F 3GMOB 1TVBB 4NCC1 4Y16C 1N2RB 4PJIE 3VFWB 3ULUL 1P6AB 5MENE 1XCQA 4Z18A 4BKLA 1NL0H 5D5MA 3NN8B 1DR9A 1AKJA 2B5IB 4Y4FB 4JG0H 2B20A 1FV1B 2P45B 2NR6D 3HNSH 5FUOL 3WUWG 4OFYD 4Y4HA 4YPGB 5CD5D 1FLTX 3JZ7A 4W6XB 4Q97A 3ZE1F 4UU9A 3BKCH 1WZLA 4WI3A 1OAQH 2PYED 3H2WA 2V17L 5A2JH 4KPHH 1ZGLP 2H9GB 2KZ1B 3SDCB 4HKZA 3CFBB 3U0TA 3VFNB 5GS3A 3D6GA 4OCXL 5GS0H 3OKEA 3MA9L 3O6LL 1DL7L 2D31A 5D70L 2CQVA 3MXVH 5TQ2H 4XAWH 4G5ZH 5EC1A 3QXDB 4C4KO 1I8LA 4JFDD 8CGTA 2APFA 5IMKA 5C3TA 1XR8A 4FQJH 3BMWA 3NBNA 4PP2A 1N0LA 5KOMC 5E8OA 4KZEH 1NL0L 2E5EA 3QIUB 4Y5YC 2MKWA 3ARWA 1ZHBA 1FO0A 2EE3A 4JG0L 4LEXH 5HHPB 4JANA 3HNSL 3DXAD 3FCTB 2KQNA 3ES6A 3HZKA 2R39A 3WJJA 2I60H 4MAUH 4JFYA 1NCBH 4M43H 1AR1C 3BKCL 1WCBB 4KKAC 1OAQL 1I7ZB 1J87A 5DUPH 1MCHA 4EI6B 4LEOB 4M61B 2EXWD 5FFLA 1X4XA 4M6OH 5DFTA 4KPHL 3UTQB 1HHGB 3VG9B 5J6GA 4OZFA 5T3ZH 1F4AA 4Z7WF 1FZOA 3ETBF 2A73A 3MLXH 3ARXA 1HI6B 1EDQA 4GRWH 3UBXA 1TITA 3LIZH 5EUKB 4JY6B 5GS0L 5TQ2L 3MXVL 1G7LB 4XAWL 4G5ZL 4M8VA 1U3ZA 3BQUB 5I1AA 1JPGA 4C55A 1G7JA 5ID0B 1U8OA 2QTEA 2VDKH 1I7UA 3OWEA 4W70A 2CKBH 4FQJL 3D0LA 4MJIE 2PTVA 3ULUF 3O9WD 2LTQC 4KZEL 3NFSH 4U0RC 3O41A 3RA7H 1YMME 4JEGB 3TPUB 3FTGB 4LEXL 5D1XA 1JFQH 3DGCR 3GMQA 3MRHA 1T1ZA 1MFBH 1T1WB 5KANG 2R9HD 4HAGA 2I60L 2FLRT 4MAUL 1NCBL 1UM6H 4ODTH 1FGNH 4M43L 4FQHB 3QRFM 1FCGA 3OAYK 4HDIB 3RGVB 3IFOB 3B5TA 5DUPL 2APWA 2D7OA 5IW3A 3EFFB 3QG6B 1CDUA 4M6OL 5E4EC 1T21B 1A6AB 3MLTA 4O2CA 3MV7A 5T3ZL 2EIZB 3MLXL 1R5IB 1BQHG 3BWUC 1OAUH 3LIZL 2BVEA 1SHMA 3KJ6H 3MA7B 3DRQA 5HI4C 1I8KB 5GRWA 4IRSA 4M1CD 1Z9MA 4PRIE 1FZKB 4J1UA 4U7KA 4XNZB 4X6CE 2VDKL 2Q8BH 2CKBL 2R1YA 4HUXA 1ZWIA 3OTTA 3AREC 2HJKB 1F4HA 1ZGLB 1J8HD 3WL9A 4U2ZA 3NFSL 2V2WA 4HWBA 1I3VA 3RA7L 2CXKA 1KLFA 2GAZB 1MRDH 1JFQL 1JMXA 1GZPB 5IV2B 4P2RA 1MFBL 1S7XB 1U8NA 2AJYH 3MV9E 2H45A 4HD9A 1R24A 1UM6L 5CAYB 4ODTL 1FGNL 5DZNA 5EO9B 2OI9C 4GUPB 4G8FA 1OY3B 4G42B 4JHBA 1A4KB 1JGLH 2RIKA 3O6FA 5DDHA 2ADGA 3WNNA 4PJFE 4WWKB 1OAUL 5EO0B 2BVQB 4Z8FH 1RZ7H 2OL3H 1JZ4A 4UDTB 3KJ6L 3I6GA 3H9SE 3MR9A 1V3JA 1S7TB 3VXNA 5D96C 5I0ZA 4OGAD 4Y16B 5C0EA 2Q8BL 1NC4A 4NFCA 2PETA 3KPNB 3HPLB 2YPKB 3BHBA 3CDFA 5DLMH 2G5BA 3MUGB 5KS9A 5HHQA 2F54B 4U1KA 5MEOB 1D9KD 1MRDL 3VXRE 1C12B 1I1FA 5B3JE 5GS1A 3BT2H 2AJYL 5FYJU 4IIQA 4YDKH 2B1AH 5JQ6H 5DEFA 3HR5B 5IBLD 1CD1B 3QEQD 3W11D 1TVDA 4PJCA 1D5ZA 2O61A 1B4RA 1JGLL 4PJ8C 3BP5B 3MUHL 4XT1C 5HHMD 2VL5B 1CQYA 3PWPB 4GRWF 4Z8FL 15C8H 1A9EA 1RZ7L 2OL3L 3CPLB 4D8PB 3IXTA 2KZWA 2NTFB 1OP9A 1YPZB 3M1BB 5D6CA 3UTSA 5JW5A 2AEPH 1B4JH 4X7CC 4U7MA 2DTMH 5DLML 2IAND 4NBYB 4PRHE 3IFNH 4Y5YB 1FFNB 3L7FA 1HZHH 4E0RB 2H3NA 3PHQB 2PNDA 2DQHH 3M8OH 4PLJC 1CXLA 2BVOB 3GSXB 3WFDH 4L8CA 3VI3E 3BT2L 5FEBA 4F7MA 4ZO7A 4YHLH 4YO0A 1NCTA 5DK2B 1J1OH 3R06A 4YDKL 3T0DA 2B1AL 2DLHA 1M4KA 4Z6AT 1KCRH 5JQ6L 2AK4B 2ZSVA 5DMGC 3CUPA 7FABH 1BLNA 4JKLA 1CBVH 3WLWC 1FNLA 2I07A 2E9WA 3OR6B 4K7FB 1HQ4B 5I15H 4CBPA 3C5SA 3UJIH 5BMFH 4PG2C 3G6JA 5JNYB 1VFAA 2F53B 5AG9A 1FNSH 15C8L 4NN5C 4Z7VF 2J1KA 4Q6IC 4FQXC 4WY7H 5DRWB 2Y5EA 3W0WA 1D5MA 1NGPH 2ATKA 2FGWH 2YHGA 3ZDXF 4P4RA 1VADA 2UWEE 3IU3A 3ARFB 2ZUXA 2AEPL 1B4JL 1G7PA 1UWGH 2DTML 3WXWH 4U0RB 3VWKA 1QPXA 3IFNL 4KVCH 1QSEB 3PDGA 3KWWB 4N0FA 1XF2B 1HZHL 4S1SH 2CUHA 1JYNA 2DQHL 4JQVC 3M8OL 3QI9D 3KPTA 1FC1A 3TBSA 3WFDL 3SGEH 3FFDB 2PW2A 2IAMD 2FHFA 4YHLL 4FQPA 4PJXE 1J1OL 1RVFH 4WW1B 3IJHA 3ZE0E 1KCRL 4QRTB 1B0RA 1T89C 5MHSD 1LGVA 4PG9A 5E4EB 5I6XC 3KYKH 7FABL 1PG7X 1CBVL 5KVFH 3O3AB 1QRNB 4FXKB 3ILQD 5I15L 1NQBA 1AO7E 3UJIL 5BMFL 1J0ZA 4XCCH 4F7CA 4JCMA 4D0BB 1FNSL 3OGCA 3ARGA 3DBXB 4WY7L 4BFEA 1JUFA 3DV4B 1NGPL 3VJ6B 2ITDB 3ZE1E 2FGWL 2Q76A 4A6YH 2GYSA 3RL1B 3IU4H 3FQXA 4MQ7B 1EHLH 4X4XB 3AREB 2VLRE 4NQED 1UWGL 2FO1A 3WXWL 1OSZB 3C08H 4X98A 1IM3B 3UBXI 2R4SH 5C0AD 1DQJA 3AXLB 4S1SL 1JJUA 2E7CA 4X6FB 4Y4KD 2IJ0C 5KG9B 3EHBD 3DJ9A 4LHQB 1NGZB 4OGXH 1YYMH 3TO4D 4HX1B 3RNQA 2OI9B 1T04A 2YRLA 1RVFL 4LLYA 5TPWH 4UTBH 4TUOB 2ZPKH 1I3GH 5JORB 5JXEA 3KYKL 2N7AA 5KVFL 3WV0A 1KLGA 1XGPA 5BVPH 4OD2B 4YGVA 3G08A 1F3RB 4IM8A 2FH6A 1I9JH 1OAKH 2OX5A 1CCZA 3QIBA 1D7FA 1ZV5A 4XCCL 3UYOD 2IH3A 4NN7B 4ZUWA 4OV5B 5D2NC 5D96B 1K3ZA 4JFFD 1WFTA 4RA3A 1LP9A 1R3HB 1MSPA 2GEEA 3FB5B 4A6YL 3D9AH 3IU4L 5JQHC 1EHLL 4LCYA 5DQJB 3CFKA 4G6FB 2QJDA 4JZNA 3T0EE 4Q9QH 1QSFE 3BKJH 1LD9A 3C08L 1UXSA 3DVNA 2R4SL 3GUTA 2H32B 5CIPB 4Z7WE 2DWDA 4NM4H 5TH2B 43C9A 2VZTA 4M4RA 4OGXL 2ZUSA 4KKBC 1MEXH 1RJYB 1YYML 5DRZA 3SKNB 1NBQA 2H41A 2Q1EA 5CUSH 4JLRB 5C0BB 4UTBL 5TPWL 3EKCA 5BZDA 2ZPKL 1I3GL 5GRUH 4P3DB 2N4IA 4NPYB 3GHEH 1YNKH 1XGTB 3ULSB 1TVBA 2IALB 1XF1A 4NCC2 3VXSE 3D2UB 5BVPL 3ULUE 3MROB 1YEEL 3OKNB 4Q74A 1D5XB 3VFWA 4ORGB 1NFDB 5AD0A 2XFXB 1WFNA 4J3SA 1I9JL 1OAKL 5ICZB 1UXWB 5HGAB 3I6KB 1QSZA 3T0EC 5D93C 4Y1AD 2ZOKB 3EW3B 1RZKH 4OBSA 5IW6A 4N8PA 1MCIA 2MQ3A 4MMXC 5D1QC 1SVZA 3D9AL 1JNHB 1JZ3A 1WEJH 3HUJB 4Q9QL 3BKJL 3ISWA 5IB4A 1R3LA 5JLZA 3HAEB 4XVSH 5J06A 4NM4L 5KW9H 4KTEH 3HKFA 4XNYH 1MEXL 3ULUC 5F1SA 3LS5H 3VFNA 4GAYB 4HGWB 4F2MA 4N5UA 5CUSL 2XRAH 4WCYH 4FFVC 3V5DA 5JDSA 2RJMA 5IJVA 2OZ4H 3MLPA 5HGGS 5F3HB 2DYPB 2R2HB 4I3SH 5GRUL 2ZCLH 3EBAA 3QXDA 3GHEL 3ULVD 3BPNC 1JPFB 3LKOB 1PX4A 4M93C 1EX0A 5KSBB 5L2JB 2J8UF 1IAIH 3SDAD 4LQ1A 1HNGA 5DMYA 3N0PB 2VR5A 1A21A 4NN5B 4Q6IB 2DQIH 1DANU 1A7RH 4YBQD 1G9MC 1CK0H 3H9YA 5E00B 5HHPA 1RZKL 1BGXH 3QG7H 1NKOA 4M4PA 5HHVH 1J0KA 4E5XB 1EVTC 4X83A 1CDHA 4LHUA 1WEJL 2X40A 3V0AC 2JTDA 4QXUH 3MV8D 1I7ZA 1DQQA 5BS0E 3Q48A 2PTTB 3TZVD 4XVSL 3UTQA 3UZEA 5KW9L 4KTEL 4XNYL 3GSOB 4GQPH 4HCRH 5DK0A 1JBJA 2F8VA 3ZKXC 4XVUC 3S96B 2VDPL 4DZBB 3LS5L 3QDHA 3HE7B 1MLBB 5EUKA 3LEVH 2XRAL 4JY6A 4WCYL 4YBHA 5I6XB 1WCQA 4GRMB 1DZBA 1G7LA 2OZ4L 3AB0C 1Y6NR 1IKNA 4I3SL 1CDIA 3BQUA 2X4PA 3BN9C 1GGIH 5ID0A 4PJGF 4ZOBA 5CSZB 1IEAA 1TMCB 1IAIL 3O4LD 3EDKA 2DQIL 3BP7B 1A7RL 2YUVA 1CK0L 3OKYA 3TPUA 3MFGB 4JFEB 1BGXL 1T1WA 3QG7L 5ISZE 4FG6C 5HHVL 1YDPB 3OGOE 3L3HB 3SN6N 4ELKB 5A16A 4F7PA 5DD5H 5EBLB 1NBZA 3IFOA 4QXUL 5GS0C 3RIFF 4L3EA 1LDPH 3EFFA 3QG6A 1KF9B 4BQ8A 3VFRA 4QRPB 1X3DA 4KMLB 1XH3B 1T21A 1JNNH 2V9TA 1JWSB 2BOCB 5T3ZE 4HCRL 3GZKA 2Q86B 2EIZA 1R5IA 5JHDD 3QFJE 4JZJB 3C60D 3LEVL 3PUCA 3MA7A 1CXEA 3WUWB 1I8KA 1WICA 1U95A 5MP6H 4F9PC 1GGIL 5GGSY 4HUWA 5F9WC 1KOAA 4PJBB 3RI5K 4QHLB 4Z95H 5D2NB 4Z77B 3PP3K 2ATPA 1FIGL 5C07D 5IV2A 4TUKH 3FT3B 4KKLD 4L3CA 3BE1H 4N0UE 4OLEA 5EO9A 2W9DH 2B39A 4ZSOB 3BGMB 5DD5L 4XCYA 1LDPL 2YXMA 1CF8L 2OM5A 3UEZA 1JNNL 5L88H 4G42A 1A4KA 4EEEA 4WW2A 4JKPH 4PRDB 1P7QD 4PJEB 1BD2D 4JM2A 2VDRH 2A74B 1Q0XH 4JRXD 4Z7VE 4WUUB 1NGWB 4WWKA 4WTXA 5EO0A 2A0LD 2BVQA 3HFMH 4KY1H 5IVXA 1U8QB 4MLSA 3RBSA 3VA2C 4RDQG 4UDTA 4WIQA 3BPCA 3ZDXE 3KYMA 4KV5E 4Y16A 2YN3A 5I8EB 5MP6L 4D9QD 1R3JB 3CK0H 4DFHA 2H8PB 2IBBA 4ZFOB 2YPKA 4Z95L 4NO2B 3QO0A 5FYJD 4HKXA 3MUGA 4GW5B 3DRTB 5D93B 4LGRB 5E9DE 4UMGA 5MEOA 1DBJH 2HTLD 5D1QB 4Z7UF 2UVFA 4TUKL 1U8IB 1FJ1B 3EZ8A 3NFPB 4CDGC 1T0NB 1ZAGA 3HZYB 4FTVE 4ISVB 5FHAH 2W9DL 5IMMB 3U4AA 2O5XL 1Z2KA 4XB7A 3AS0A 4JG1H 3BVNB 3RWGA 5L88L 1ETZB 4JKPL 4X0KB 5ETUB 4TTDD 3VFOA 5DXWA 4PJIA 4P4KA 2YPLB 4L4VA 1Q0XL 2VXSH 4DVBB 3MJ7A 4FFYH 1BZ9B 3HFML 4KY1L 2OTWA 2E8ZA 3O8XD 4P23C 2NNAA 4CU7A 2NTFA 2DLGA 4UIMA 3RJDA 1LEGB 2A38A 3RX5A 3M1BA 4M93B 3WHE1 3KXFB 3CK0L 3D5OF 1KCLA 3ZKMD 1QFHA 4MQXC 4M02A 1MCPH 2ESVD 1PG7H 2FWOA 4C83B 4Y5YA 5C7XH 1FFNA 4M00A 5C8JA 2QR0A 1N0XH 4E0RA 5B8CC 3PHQA 1DBJL 2DL2A 4JO3H 1BQHB 4U6TA 1UZ8B 3CH1B 2K9UA 4XPBH 5EFIB 3CZJA 4KJYB 4RFEB 4DW2H 3QDMB 4G6KH 4P48A 2IBZX 5DK2A 5FHAL 3U7WH 1FAKT 4BZYA 2EC9T 2XWTB 5C0CE 5FAAA 1KXTB 1MAKA 2AK4A 1NGXB 4JG1L 2QV2A 4PY7A 2I9TA 1LMKA 1A4JB 3ZKXB 3OR6A 4K7FA 1HQ4A 5CJQH 1HH9A 2NZIA 3EOBB 2OR7A 3T0XA 5BO1H 3JWDH 2N56A 3NGBB 1T0MB 43CAA 2VXSL 4X9GA 3AROA 4FFYL 1T20B 5JNYA 1AQDB 1PQZA 3W5MA 4U1MB 5DRWA 4K94H 4J23A 2W0KA 4FXGB 4L9LC 1MPAH 4XCEB 5HDLA 5FO9B 5AAWA 1QZ1A 3T2OA 5TF1H 3IRZA 4UOW1 1MCPL 5CZKA 1PG7L 1S9KC 5C7XL 3D48R 4FFZH 3JTSA 3OAZH 1QSEA 3KWWA 4AMKH 3PHOA 1XF2A 1N0XL 4W6YB 5JIKA 4V1DB 1A9BA 3FFDA 2E9JA 4XPBL 5F93C 4I2XB 4DW2L 1NDMB 4QHUB 2D3VA 4G6KL 5IB5B 3U7WL 4LDLB 4N0CD 4QRTA 3PWVA 3NCYP 2YD9A 4P2QB 3TA3D 5CJQL 3WMSA 1OAZH 5BO1L 3HI5H 3JWDL 5E5UB 4CAGA 3EJZD 2GCYB 4R9HA 2BSTB 4S2SA 4D0BA 2PUQT 4GG6F 3DBXA 1UQSB 4CADB 4Y8AA 4LP5A 3F65A 4K94L 1DUZB 2P48B 2O5YH 5EULV 5SX5H 1MPAL 4OTXH 4ZO9A 3VJ6A 4RNRA 3WKMH 5F9WB 3PNWA 1MCCA 5LJYH 3QT2A 5TF1L 4HUVA 3GRWA 3AREA 4X4XA 5I8OH 1ZKAA 1O5DT 2J7LA 1K4DB 1DDHB 3KR3H 4ZXBB 4FFZL 3BO8B 5DRXA 1IM3A 1RQ5A 1NAKH 5EU6E 4AMKL 3AXLA 1ND0A 5KG9A 2JF1A 1R5WB 2BSSB 3WNMA 1NGZA 5C3LD 2BVPA 3FFCD 2R2BA 4HX1A 3MOAH 4QOKD 4G80B 3ZSTA 5T3XD 2EO9A 4TUOA 4NQCD 5CJBA 1BVLB 5JORA 1S9VB 1PW3A 1YNLH 1N7MH 3QEGH 1I85C 3FN3A 2J8UE 2X5PA 3BIKB 4OD2A 4H26B 3VFSB 3VXUD 3LZFH 1OAZL 2AQ2A 3HI5L 4KTYA 2EYTB 4PGCB 1UCBH 3QNZA 3KPSE 2A83B 2XACC 4OV5A 4O2EB 2E7MA 1ZVSB 2Z31B 2O5YL 1T66C 3FB5A 4KK9C 4OTXL 1FQ9C 3WKML 1WBZB 4WU7B 5DEGB 9CGTA 3IKCA 3MV9A 5CD3B 5ICXB 3QQ4B 1XAUA 3SKUD 5I8OL 4XXCC 1X5YA 4AQ1B 4WI8A 3KR3L 4IS6B 5F7UA 1NAKL 2H32A 5CIPA 5KTEH 2X4SB 3TJHC 1P84K 4MSWA 3TCXA 3TBWB 5EBGA 2W0LA 3MOAL 1M7IB 1ED3B 5F96H 4JLRA 4HS3A 5C0BA 3VMNA 5IW1B 4MLIA 3H9SA 4PJGE 4NKDA 4P3DA 4NPYA 1YNLL 1N7ML 3QEGL 4RGND 1XGTA 3QDGB 5J1AA 2E6JA 5E94A 3D2UA 4PJ8A 2Q6WA 3MROA 4Y2DC 5DT1H 3LZFL 5GGUB 1NFDA 4NRZA 1UCBL 1U3YA 3V0VB 4P23B 2NPLX 2FZ3B 5KSAD 2JIXA 5CGYD 1EIBA 2C3HA 2ZOKA 4HJ0D 4OFKA 3AS3A 5DMKB 3OJDA 5F7WC 5J11C 1JNHA 4E41B 4JFHE 1QYGH 2RHEA 3F7PC 4LLQA 2X10A 5A3ID 3HUJA 3WN5C 2AXJA 3I9GH 3WHXB 4KRPC 4Y88A 5B8CB 5GIRB 3T0VA 3HAEA 4HK3J 1J7VR 5CMAA 5KTEL 4CMHC 3CSYB 4XGZB 5DJAA 1ZHNB 5EIIB 3QJFB 1CGWA 2VWEE 3N9GH 3DTXB 4GAYA 3RWHA 2OL3B 1OWWA 3MRFB 5F96L 5CKGA 3CXDH 4U31A 2XPGA 5DHYB 2DM4A 3GSUB 2CKNA 2DYPA 2R2HA 4J2XA 4RSVA 5IUSA 5IP4A 3KYNB 2QQQA 4UV4H 4C56A 1F6LL 3LKOA 5DT1L 5KSBA 4LLWA 2D7QA 3FAWA 4PG2A 2HKHH 2J8OA 3RY5A 2DI9A 3WE6B 4Q6IA 4FQXA 5E1AA 3ARDC 2VAAB 3L6FB 1QVOB 4E42B 4L9LB 1QSVA 4Z78B 5E00A 3GSNH 1WTGT 4OIAA 5A2LH 3MNVB 5C0RH 2GTWA 3D85D 2VQTA 4EXKA 1QLRA 3LV3A 1QYGL 4WI5A 3LCYA 1JNLH 4ZYKA 3KGRA 1X9QA 1KEMH 3I9GL 2Z8SA 1HWGB 2PTTA 2PTUA 2BNQB 3GSOA 3BEVA 4RMSA 3S96A 4RAVA 1EEQA 3N9GL 4ONOA 4KJQC 3CXDL 4OZ4B 4QCIA 1S7SA 2X4TA 1RZKC 2UYLB 3ARQA 3O45B 4UV4L 3MUZ1 3FQTA 3D87B 2UWEA 4NO0A 4IOFC 5EB9A 5EIQA 2HKHL 1Q9KA 3Q3GB 4PB0H 2WINB 3BP7A 5E1HB 4Z7UE 1CGVA 5MEND 2E6QA 3QQ3B 4KUZH 2AVGA 3GSNL 5JIHA 5C0RL 4JFEA 2IQ9H 4OLVH 4K2UH 2VZUA 5JOEA 3GB7B 3MNWA 3MV01 4FQ1H 2HFEB 1JNLL 4U3HA 5SWSE 4WV1C 4ODUA 1KEML 5SWZB 3EO1B 2Q7YB 1V7MH 4ZFGH 1QKZH 3V2AR 4QRPA 1XH3A 1JWSA 1TPXC 3DO7B 5DJDA 2BOCA 4EOWH 5F89B 5DJXA 1MHCB 1EFXB 5DJYB 1UZ6E 2F53E 1Z9OA 3IGAB 3S6CA 3WUWA 1EMTH 4MVBD 3VG0H 1P2CA 2NX5E 4AIOA 4WHCA 3CVHH 3MRDA 2CGRH 3SDDC 1RJCA 4QRQB 4ZTPH 1OP3H 4P5MB 1T6WA 4XPFH 5C6TH 1KJMB 2RR3A 2WIIB 2VLRA 4HIXH 3OMZA 5C1MB 3HHRB 4I0PC 3V4VH 4PB0L 5D2NA 1GYAA 1T7XA 3DVGA 3CU1A 3HG1B 5FV2A 2I5YH 4JO4H 4KUZL 1B0GB 5D7LB 1OARH 2R69L 2IQ9L 4OLVL 3SGDI 4K2UL 3UCRA 5GZNC 1H8SA 1RZ8B 4HIIA 4FQ1L 2YUZA 3KS0H 1A5FH 4ZSOA 3BGMA 4NQUA 4P46B 4ZFGL 1S7QB 1V7ML 5CP7A 1PFCA 1QKZL 1VGKA 5LVEA 4P9MH 1M7XA 3WYRA 5D9SA 2OYPA 4PRDA 4AIZB 4EOWL 2NY4C 1E0OB 4MS8D 1W2KT 5GZOD 3N06B 4QWWD 1IEBB 3GJFH 5CJ5A 2XN9D 1BIIB 2WWMC 4NNXB 3VG0L 4B41A 4N5ED 3CVHL 4U6XB 5F7FA 3WS6C 4A6YB 2CGRL 4YPJA 1MHEA 3EYQD 4Y2DB 4ZTPL 5I76B 1R3JA 4XPFL 5C6TL 4O02H 1QA9B 5SWQB 1NMBH 4HIXL 4QRRE 4NO2A 2LABA 4GW5A 1INEH 4YUEL 5I1KH 3VRIB 3V4VL 4J4PC 3T0EA 3VGEA 4MJID 3PG2A 5ECJE 4TVSa 4Y19D 2C1PA 2I5YL 5D1QA 2M26A 4JO4L 2P44B 5FCSH 5BZWB 1OARL 2XKSA 5J11B 1AGBA 4PRPD 4YHPB 3NFPA 2DLIA 3NAAH 1T0NA 3NH7H 3HZYA 1A5FL 4KRPB 3H6JA 5IMMA 5F3BA 4P9ML 2GKIA 1XGQA 5F21B 1ETZA 1G9NH 4X0KA 2VB5A 5ETUA 3VXSA 1BJ8A 3N1MC 3KPRB 4HUUA 4GG6E 4BH7B 4PYGA 1KN2H 4P2OC 3CDGB 2FNBA 4YFDB 4APQD 5HYJB 1T7VA 2H2PD 1LEGA 5I2IB 2P8PB 5IFAH 2J6EH 4HFUH 2LE9A 4O02L 1OSPH 2Q3AA 4NHCH 4L1HA 1NMBL 1FNGB 1INEL 3ARDB 4C83A 5I1KL 4MWFA 2DAVA 3RVUD 1BQHA 5DFVD 2VLJE 5JA8B 1UZ8A 3ZKQD 1LO2H 5EFIA 4KJYA 4POZC 1JL8A 4RFEA 1X44A 3NAAL 3QDMA 4XP6H 2BXZA 2VNCA 3NH7L 1A02N 3J8F7 4JM4H 5FV1L 4DOHE 4JKKA 4IRJC 4M5YH 2Y9RT 1VHPA 3RDTA 5DC4B 1A4JA 5DVOA 3MRBA 1G9NL 1AXSA 1MCQA 4LDEB 5CP3H 1T0MA 1KN2L 1T20A 3WD5H 1MCEA 1XIWD 1AQDA 2ARJQ 2FJHA 1MIMH 4RAHA 4U1MA 1QTYT 5EA0H 1EEZB 3D3VB 5GRVK 5FO9A 1S7VA 3J7HA 5IFAL 2J6EL 4GG8B 4HFUL 1N6UA 4WHTB 1OSPL 4NHCL 1DJSA 5JIIA 1JPTH 3K8KA 5DZLA 3IJSB 5BS0A 3WDHA 3A6BH 5L2KB 1IGCH 2ICEB 3LQZA 4WFFE 3X12B 4FQIH 1LO2L 1IM9D 4EUPH 3QDJD 3RL2B 3VXRD 1W0YT 1GIGH 1A3RH 4G8GE 4I2XA 5F9OH 3ZYZA 4XP6L 3P40A 2OMNA 4EI5C 5IB5A 4Y5XC 3SJVE 4Q58C 1TVHB 4HBQA 4JM4L 1N8ZB 1TPXB 3P73B 4M5YL 5EU3A 2JCCB 4PJ7E 3WKNA 4P5TA 1HKFA 2BNUB 3UPRB 1GOGA 3VD5A 2GCYA 3WD5L 2BSTA 2A6JB 4YHYC 1MIML 5F71A 1E28B 2OTPA 4JGJA 5EA0L 1DUZA 4OV6F 1FFRA 4F9PA 3CVIH 4LRIC 3EO0B 4ODSH 3L5WB 3D39E 3VCLB 1WIOA 2L0DA 1IQWH 2CDGB 3GHBH 3L3GB 3CXHJ 3IDYC 5C08E 1K4DA 3OKOB 1DDHA 1NFIA 5LAXB 3B8SA 1U3HA 1JPTL 4NQDE 4H25B 3FQUB 3A6BL 4PRHD 5JPNA 3OB0K 1IGCL 5EOTB 5C2UB 5C09D 1R5WA 4L5FH 2DQCH 4FQIL 3JWDC 1GIGL 1A3RL 5E8PB 5F9OL 3GMMA 3LRHA 2P49B 1FBIH 3UTTE 4FFWC 1S9VA 3JV6B 3RVTD 3RWEA 5KN5A 3MO1B 3BIKA 1LK2B 1CXIA 1K85A 1BZ7A 4PGCA 2DIAA 5E0QA 3IF1B 2IQAB 2A83A 5I71C 2RFXA 5ANMA 2OXGA 3S37X 1M7DB 4QRSB 3C5JA 3CVIL 4ODSL 1WBZA 4WU7A 1EVUA 1IQWL 3GHBL 3IDIA 5ICXA 4N0UA 3ZHDA 5HYEA 2C3XA 3QUYD 3OBAA 3H0TB 1OGTA 1OM3H 1J88A 1XGRA 5FA3A 3BMVA 4XPGH 2ZOLA 4PLNC 1UH4A 5HVGB 3GBMH 4ODXB 1CICD 4C4KT 1G84A 2X4SA 1S3KH 4FQCH 1F58H 1A6UH 3X17A 3UYPA 4L5FL 5JOFA 2DQCL 1SYVB 3CDCA 4Z7VA 5D1ZA 2ARWA 4LIQH 2F5AH 2EE6A 1CIDA 1FBIL 3O3DB 4YDLC 5J3HC 3L3IB 2MFNA 4N8VG 3T2NH 4TUJA 1QBBA 4L29B 3QDGA 1RIUH 3N1QC 4LLUA 4KKNA 1F6AA 5GGUA 3ZLQC 2H1PH 1ZVHA 5EH1A 1YJDH 2DJ4A 1AO7D 2XIDA 2XTJC 2NYYD 3SCMD 1YN7B 1DLFH 1EJOH 2BP3A 5J57B 1MCOH 2HRLA 1NDGB 1S9WA 1UVQA 2X1QA 5CLWA 4YAQB 2E8YA 3UDWC 4KI5D 4G43A 2HT3C 3Q5OA 1OM3L 5E4IA 3MLWH 5I9QC 4XPGL 5B8CA 3GBML 5GIRA 3T1FB 1ZEAH 4NM8H 3RWDA 1WK0A 1DEEB 4L4TE 4XGZA 2C9AA 1S3KL 3LKQB 1F58L 4FQCL 1A6UL 5HBBA 1ZHNA 5EIIA 4PJEE 3QJFA 3E8UH 5IEKB 2OL3A 4NQSB 3MRFA 4EUPG 4MAYC 3PL6D 2EXYC 4LIQL 2F5AL 5FYLD 1BFOA 1G7IB 3LKNB 4IRJB 2QSCH 3H9HB 3EOAA 3T2NL 4MNQD 2WM0A 1ZS8B 1TJHH 4R7DB 1RIUL 4ZFZA 2N7BA 3DVFA 2BY0A 2Y1VA 3L95A 4GKSB 2DKMA 2H1PL 5H37H 4OLWH 3WE6A 1YJDL 1FZMA 3VDAA 1QVOA 1K2DA 4C58B 4L9LA 3VXTB 4E42A 4Z78A 3I75B 2AXFA 1MI5D 1KNOA 4HPYH 1DLFL 1EJOL 3K46A 1MCOL 3NCFB 2HRPH 4XNQB 2ZUWA 2VN7A 3IT8D 4X5LA 3QA3B 2V7HB 2BNRB 3CIQA 1Q1JH 5C0DA 2AEQH 2IFGA 3V6FB 1HDMA 2VN4A 1J0YA 4TULH 1ZEAL 4NM8L 1KJVB 3QEHB 4UTAH 1QSFD 2BNQA 1ZSDB 1MUJB 3C8DA 3IXAB 5ENWB 4EI5B 3LKSB 2AV1B 3E8UL 4JO2H 4Y5XB 1KIRA 3RUGF 4JFPB 2M8XA 3PGDB 4OZ4A 2QSCL 2UYLA 3RTQC 3KXFE 1TJHL 1UKSA 2CLZA 4IRSD 3S98A 4RWYH 1AHWB 4F8QA 4XWOD 3BDYH 3HS0A 2PO6C 4LAJH 4YHYB 4QHKI 4OLWL 2L7UA 2ZUVA 1ZTXH 1CDCA 1JWMB 3QQ3A 4X6BB 2ZKHH 4QHNB 1V3KA 1BBDH 4HPYL 5JZ7C 1UWXH 1SM3H 2HRPL 3IDYB 3GB7A 2HP4A 2HFEA 5T1LA 3MRPA 1RZIA 1Q1JL 1NH6A 2AEQL 2Q7YA 1JWUB 3EO1A 3SE4C 5GSVA 4NFDA 3GNMH 3ZTJH 5HYQB 1EO5A 3VXMB 4G6AC 4TULL 4UTAL 3WXVH 4G3YH 5ERWB 3DO7A 3RJQB 4MQTB 1MHCA 5IHBA 5DJYA 4ZUSA 1BHGA 1P53A 3FQWA 4JO2L 3ULVH 2QHLA 4OI7A 4IMLA 3MRJB 1I85A 2ICWJ 3ARVA 3D18A 4JY4B 2GT9A 4QRQA 5FUCE 3V5KB 1UKQA 4MCYA 4RWYL 3VFUB 2YR3A 3KPQA 3W2DH 2VLKD 2WIIA 1YEJH 3BDYL 1A1NB 3P9WB 5GJSH 1WBXB 3OZ9H 1ZTXL 4ELMB 1ONQB 2OS7A 5EBMA 5AYUH 3HI1B 3SDXF 4AEHH 2ZKHL 2PYEE 1BBDL 5IIEA 3QH3B 5D7IF 5D7LA 4KK5D 3ZYOA 3U0WH 5B38A 1IL1A 2X44D 1SM3L 3GGWB 5E6ID 1RZ8A 4XXCA 5JOPD 3BKMH 4NBZB 4WGWB 3I2CH 1MY5A 4X7EC 3GNML 4W81A 3RX8A 3WXVL 4G3YL 3SBWC 3V0WH 3G5ZB 5FYKU 5JTWA 1U3JA 2VQ1B 4Y89A 1R3KA 3BZDA 2NR6C 3ULVL 2BY3A 3KPSA 4R4BB 4YDLB 4NBXB 4Z7NF 2VXQH 5CD5C 4UAOC 1NLDH 4N8CH 4U6XA 3UXFA 4A6YA 2Z4QB 4Y2DA 5JMRA 5H2BB 4OKVB 1EUTA 1QA9A 1DQDH 3W2DL 1YEJL 4KKCD 1I1YB 3QZWG 3DSNA 4HKBB 5GJSL 4M7ZB 2XTJB 1I7RA 2JB5H 5H37G 3OZ9L 5AYUL 3IDJA 4K8RD 1T6VN 1M1SA 3BD4A 3G6DH 3WDJA 4AEHL 5BZWA 1BIHA 2V7NB 4NQXA 3DGGB 4BK5A 2IH1B 3U0WL 4POUB 5FHBH 5E5RB 3BKML 5ISZD 3WN5A 4YHMH 5I9QB 4F15C 2G75A 1HXYB 2NY0D 3I2CL 1T83C 2YKLH 2YD7A 4PJGA 4KUCD 1I9EA 2XT1B 4RX4A 1FL5A 3V0WL 3CZFB 4ZAKD 4YZFF 1BVKA 3KPRA 5H94B 3MRGB 4JN2B 4BH7A 4MAYB 2FYYB 2VXQL 5HYJA 1NLDL 2P5WD 4JRWA 4N8CL 1G1YA 2P8PA 1JTPA 4LARH 3P2TA 3S3SA 2EXWC 1DQDL 3SE9H 3RY4A 3U0PA 3PQYE 3ARDA 1M6OA 1A6PA 4HV8A 3VXQB 2JB5L 1S8DA 1JZ6A 3I85A 3QDAA 4CU8A 4I77H 2DQDH 1BOGB 2NY5H 3G6DL 4BFGA 4ODHH 1A1MB 4U1NB 4TNWF 2X7LB 5FHBL 3QHZH 3S36X 2NY2D 1CE6A 4MD0B 2XG4A 4YHML 4U1JB 4W6WB 3V6BR 5I1LB 2B2XH 4ZS6D 3I3BA 2YKLL 2PXYB 2VYRE 1QEWB 3O9WC 3ZSSA 2YD2A 3DURB 1JMZA 3O3BA 2W38A 2D0GA 1TZIB 1WIUA 2R9HC 3ULVF 2DQEH 3IAPA 2XZAH 3RTQB 5FYJH 3TN0A 3SE3C 4LARL 5F8QC 3RU8H 1JHTB 4WWID 1HQRB 1I8IB 2P5ED 2PO6B 3SE9L 1CR9H 2VH5L 2GJ6B 4AJ0A 4DK3A 3DIFB 3REWA 2AJVH 3IFLH 3TBTB 3U48A 2IEPA 2YEZA 5L2KA 4I77L 5IB3B 2DJUA 3OXRA 2DQDL 3RHWK 2NY5L 2NXYD 5E9DD 5MERA 3DETD 5I74C 4ODHL 4PRAA 1UYWH 1BAFH 3VFTB 3EO9H 5L0QB 3RL2A 3QHZL 4QHMB 2W0PA 1PG7W 3QUXB 4M1CC 4WV1A 3KNBA 2AK1H 4DJMA 4KK6D 3RZWA 5HVWA 2OZ4A 1TVHA 1JPSH 2NXZD 2B2XL 3M07A 3MJ8B 4O9HH 1MWAB 2FSEB 3P73A 4LSRH 4IHOB 1CDYA 3VI4F 4JPIA 3JTTB 5JXED 2BNUA 3UPRA 2YD8A 5F70A 5I1CH 5EBWB 4GKNB 1GXEA 3VD3A 3SKMB 1E28A 2R0KL 1OVZA 4PGJA 2DQEL 4PJ9D 4YXLH 3SDDA 4MGXA 3EYOA 3A67H 2XZAL 2PN5A 1RV6X 2V5SA 5FYJL 4GAFB 4I3GA 3W39A 1FNHA 2CDGA 4PJDF 3RU8L 2LU3A 3L3GA 4X6DB 1CR9L 4XRCB 4I0PA 4F33B 4WO4B 4UUJB 3U2SA 3OKOA 5DVNA 2AJVL 3IFLL 5I1EH 4H25A 3BRDA 3FQUA 1MFEH 4U1SB 1L6XA 5KAQG 2L4OA 4HCRA 5EOTA 4HWEH 1CT8A 3T2QA 3QEQE 1UYWL 1BAFL 3EO9L 2XNAB 4X6EB 5C0IB 3B9KC 3VXPA 3C8HA 1HEZB 5E8PA 1NLBH 1S7UB 3RPIA 3QSKB 2AK1L 4OGAC 3ARBD 4X4YB 1SMAA 3SPVB 1JPSL 4XPHH 1BWMA 4O9HL 4OZHF 5HHME 3TJEH 5C0CD 4LSRL 2ED8A 1U58B 1CXFA 1H15B 2CD0A 2YOCA 4KJWD 4WFED 1JV5A 1LK2A 5EUOB 3MRRB 5HI5D 3AUVA 5I1CL 1D9KC 1HNFA 2IQAA 1CU4H 2BRRH 4K71C 4UAOB 4WEMB 4JVPA 1NAMH 5IG7A 3WS6A 1DLHB 4YXLL 3A67L 4RWHA 4Y4FD 1T5XA 4XP4H 4PBXA 2X4QB 4JZOB 1MFCH 2HLAB 3B6SB 5IKCB 3MRCB 3W11C 3ROLB 4J4PA 3H0TA 1YEHH 4ZPTA 2GY5A 5SWZE 2D4DA 2DM2A 1VFBB 5I1EL 3BIAX 3P9LB 1MFEL 4GBXC 2DI7A 1M71A 2V6HA 4HWEL 5T1MB 4PJHF 2C7UA 1LEKA 1BEYH 3UPAA 1SYVA 3RUGE 4Q2ZB 4R97B 4NKIH 4X4ME 3PJSB 2HN7B 3SDCD 4F15B 4JDTH 4G8EB 4ZNEE 3TWCH 1NLBL 4JFDB 4UINH 5DFWH 1I9IH 1WWBX 1YNTA 4XPHL 2VERN 3O3DA 3CVHB 4Z5RB 1P5VA 3TJEL 3BKYH 5EO1B 5LG1A 1J0JA 1GVIA 1GGUA 3NTCH 3VMOA 5HPOA 5DHVB 3F6IA 1T7ZA 4P2OA 3SGEI 2EYRA 3RIAK 2YN5A 1R3IH 2BRRL 4ODWB 1RY7B 1NAML 1YN7A 3QIUD 4XP4L 1MFCL 1NDGA 1J86A 1HHIA 3TEUA 3KLAA 2F15A 1R5VA 5GGSB 5IHZA 1FYTB 4NZDA 1YEHL 2GITA 1HXMB 4ZTOH 4ZO8A 3LRSB 3T1FA 1DEEA 4XPTH 1MHPH 2DIBA 3I3EA 3F8UB 1EPFA 4HGMA 1OQOA 4YNYB 3B9VA 2HVJA 5EU6D 5T3XH 3MYZA 1KG0A 1BEYL 3DX9B 4ENED 2FJGA 1XR9B 4NKIL 1NC2A 2YWZA 4GG6A 5MI0C 2VZSA 3GJFB 4JDTL 5T5NF 1CFQB 3TWCL 4NQSA 4LIQE 4UINL 5T5NG 4AM0B 4QTHA 3BIBX 1I9IL 1G7IA 2WQRA 1R0AH 3LKNA 2APTA 4IRJA 3CFJB 3H9HA 3BKYL 3M17B 7CGTA 1ZS8A 1KTDB 4IOSD 4R7DA 2AV7B 3NTCL 4HKJB 4PUBH 3BOVA 3NPZB 1JN6B 3SDXE 3LN5B 1R3IL 2R0ZH 5D7IE 1F13A 4PP1D 1A6VH 3VXTA 3OKMB 3DMMC 3I75A 3QIWB 4F7TB 4Y4HC 1M05B 4FMFA 1KUMA 2R1XB 4NRYB 1TTUA 1Q8MA 4EXPX 5C0AE 4F3FB 1KIUA 1D3CA 3VFPB 2V7HA 3GMNA 2BNRA 3QULB 5HYSA 4O58H 4OF6A 4K3JH 3ILQC 3V6FA 4ZTOL 2J3SA 1AP2A 3L3JB 1AD9A 5BRZB 3RGVD 1KJVA 4XPTL 3BD5A 1MHPL 1P4LB 2NZ9D 5I74B 1ZSDA 3TVMB 5T3XL 4P0DA 4DZ8B 4O51B 5ENWA 3LKSA 4PR5B 1HSAA 1L4IA 4Y5XA 3S4SA 4Z7NE 4YFLF 4JFPA 2FHBA 4NHUB 1YJDC 3PGDA 3PE9A 3RWCB 1FL6A 1R0AL 5C9KA 2HFFB 3DUSB 4H5SB 3WNPA 3CFDB 1ZLWK 3I6LD 1IAMA 3F7QA 4IJ3C 4PUBL 4GO6B 2ADJA 3X13A 4GJTB 3U7YH 2Y25A 2Y5TB 4AH2A 4OAWB 3EHBC 4P3WA 1ODAA 1MAMH 2R0ZL 3EJYD 3TO4C 3ILPB 4LRIA 3U83A 5JPMA 1JWMA 4X6BA 3TH2T 4QHNA 2Q87A 1BP3B 3WJJC 4CNIB 3ROOA 1RUKH 4H8WH 5DD6A 3G5XB 3U46A 4LASH 4M62H 4N8VB 3PIQB 4O58L 1XGUB 2IF7A 1WAAF 1FGVH 3BJ91 1OGAB 1GGTA 4K3JL 2FR4B 4RAUB 1HK6A 4YZFE 5ERWA 4FABH 4F58H 2HWZH 3AM8C 4CVXB 1SVCP 4JHZA 3B9KB 1HHJA 4HHAB 2X09A 4POYA 4PJAF 5HHOB 4RFOH 2WBWB 3RKPA 3BH9B 2M2DA 2Q7NA 2IC2A 5FKAA 1MVUB 3Q6FB 4JY4A 5T1KB 5IHLB 3HRZA 3NA9H 5D7KD 3D39A 1KB5B 2NLJA 4RIRB 1A1OA 2MHAB 1A1NA 5C08A 1G1CA 1WBXA 4K71B 5F1IB 3U7YL 5KSVB 4KTDH 2CR6A 4HK0A 1MAML 2Q20A 5F1OB 2F54D 1YEDB 3V6ZA 4JRYB 4EUPB 1RUKL 5GQBA 5FYKD 4H8WL 3H3KA 4LASL 4M62L 4CVWA 1IAII 4GW1A 2FECL 4J3VA 1FGVL 4H20H 4GBXB 1UC6A 3LN4B 4HMCA 4FABL 4F58L 2X4OB 1U91B 3FO2B 2HWZL 5HYFA 2AI0H 3AMKA 3G5ZA 3TM6A 1BREA 1N6QH 2VQ1A 4LHUG 4RFOL 3FO1A 4R4BA 5CINH 4D0DB 2HG5A 3VFVB 3GSVB 3PWPD 3V7AG 2VAJA 4Z7OE 3BXNB 4LLMA 5E2JA 2IANB 3NA9L 2XQBH 5H2BA 5HI3C 3MNZB 3TNMB 1NGQH 2APBA 2JLLA 1C8PA 4KMTH 1PKQB 4HKBA 5FGCE 3T65B 1FPTH 2C3VA 5DJZA 4KTDL 3MUY1 3VH8G 3L5HA 4JDZB 1QRKA 1TQBB 1DBKH 3DGGA 5HHXH 2IH1A 1ZMYA 3S9DB 3GKWH 4RGMC 3UDWA 2C3WA 1B6DA 1EAPB 4CJ1A 4FXLA 3ULVC 3JUZA 1PEZA 1HXYA 4TN9A 1AR1D 5FGBC 3IB4A 4Y0GA 4KKAD 4H20L 1CLZH 4BQ6A 3MREA 5SWSD 4NFBA 1IGYB 2AI0L 3CZFA 5H94A 2OTUB 1N6QL 3MRGA 4JN2A 3W9DB 1RAMA 4IDLA 2I9LB 4MAYA 1OL0A 2X4RB 2FYYA 3QQNA 5CINL 2QADC 1RMFH 4PGZA 3B43A 2F53D 3FB7A 2XA3A 5DURB 2W92A 1CL7H 5DUMH 2NX5D 2XQBL 1BQLH 2R23A 1NGQL 3TZVC 1AKJB 3WNKA 1VEMA 4KMTL 3ARFD 4WHYG 5DJ8B 1FPTL 5M95B 1HN1A 3DMMB 5CJXC 5JUEH 4Y4HB 4TSAH 3KYOA 3JVGA 4L4TA 4KQ3H 2ARJB 5GS1C 4I3RH 1A1MA 5HHXL 5C0JA 4RGOH 2X7LA 3GKWL 1BX2B 4MD0A 2AS5M 1U8PA 3P11H 1X7QB 4KC3B 4U1JA 2DQUH 4LMQI 2APVA 1WITA 2BDNH 1CLZL 4OF8A 4HKZB 2X6MA 4GW4A 3U0TB 1QEWA 4L1DA 4PY8J 5I1GH 2ZCHH 1B9ZA 1QRND 2NW3B 3OKEB 3PF2A 5H35B 3DURA 4XBGB 1JYWA 4NN6C 1H3VA 1IAOA 3MQIA 1RMFL 1VSCA 2DB8A 1F2XK 3GMRA 4NQEB 4IOIB 3VA6A 5IMKB 4HS8H 1CL7L 1XR8B 4PP2B 2FEEL 1KTKE 5DUML 4IJ3B 1BQLL 1HQRA 1I8IA 3UTPD 3VDCA 2GJ6A 1FO0B 3K4DA 3TO4B 4JANB 4PJHE 5EPMA 3O2VH 3ES6B 4WU5A 5JUEL 3HZKB 5A43C 4TSAL 2FGZA 4KQ3L 4I3RL 2ENSA 4RGOL 3VFTA 4YLQT 5FM5O 4U2YA 2WNGA 4YK4C 4QHMA 1OOAA 2GUOB 3P11L 3SE4A 3WCYA 3B5HA 1BD2E 1RIVH 2DQUL 2ZNWA 1ZK9A 2BDNL 3WO3B 4M7KH 4WI7A 2A73B 3JTTA 1S5HB 3QZWB 4I1NB 3E6HA 4NRXA 1AR2A 5I1GL 1XMWA 2ZCHL 4N9OB 4NGHH 2XI9A 1MVFA 5EBWA 1IJ9A 5D2LF 3FHQA 4X9IA 2P8MA 5I1AB 1AJ7H 1U8OB 1N6VA 1I7UB 5FYJE 4XNUH 4HS8L 5C86A 2NY5C 1SBSH 3MRKB 4NO5B 4WVRA 4YC2B 5TQ0L 4JQXC 2E3VA 4OZIB 2EEDA 5I8KH 3T08A 4WTWA 4X6DA 1P4BH 2W07A 3O41B 4XRCA 4F33A 1KCUH 3MRHB 3GMQB 1T1ZB 4G6FD 1AGCA 2HYMA 3O2VL 1U2CA 4U1SA 2YSSB 5F44A 5EZIH 5F7LB 1TETH 2A0LC 1SY6H 2XNAA 4LKCB 2QEJA 5C0IA 2QBWA 2VLJD 4M5ZH 3RGHA 2B1HH 1TJGL 4J6RH 1F97A 5IT2H 4RISH 3TIDA 4OFIA 1RIVL 3GIVA 4XCNA 4P59H 3SBWA 4M7KL 4X9BA 1FVCB 2BVUA 4Y1AB 3VE0A 4NGHL 3TO2A 1PYWB 3GBNH 4R0LC 5HPMB 2HTLC 3ARGC 4OFYA 4JCLA 1AJ7L 3IAQA 3FL7A 2PF6A 2ESVE 2Z8VC 4XNUL 2PYEA 1SBSL 5CSGA 5I8KL 3PABB 1P4BL 3ROLA 1VFUA 4LVNC 4HLJA 1KCUL 4TTDC 1VFBA 3VXME 1VESA 3P9LA 4P2RB 2WP3O 3L1OH 3K3QA 4I9WD 5EZIL 5T1MA 2YZ1A 1TETL 1R24B 3OHXB 3O8XC 1SY6L 4PLJD 1A7BA 3PJSA 5E2TH 4G8EA 4M5ZL 4JFDA 1URLA 2B1HL 4NOBA 4J6RL 5IT2L 1T83A 4G8GD 4RISL 3BGFC 3CVHA 1INQA 4P59L 2DYPD 3JSSA 5I1DA 4U49A 3QIBC 3MLUH 4CN6A 3K8MA 4LKXB 3GBNL 3DXAA 4JPKH 1C7TA 3VXNB 2QADB 1CQKA 4ODWA 1GC1H 1SJVA 1IILE 1F11B 3MV8B 3I3DA 3BHBB 2G5BB 5KS9B 3TZVB 5HHQB 4U1KB 1FYTA 4BSWB 4I0CC 1GGBH 1T2JA 1D5BA 2YD3A 5GS1B 3KHOA 3L1OL 2UV3A 4KJPD 4LCWE 1UJTA 4PJAE 4YNYA 1X5HA 4FS0A 2YD6A 1T22A 2VR9A 1XR9A 5DEFB 2XXCB 2QSTA 3IVKA 3GJFA 5E2TL 4CDHA 1CFQA 2MJWA 5HD8D 1IGTA 3VDBA 3K1KC 3OF6D 4HEME 3WIFA 3HE7D 3TH3T 3BPLC 2BJMH 2O61B 3NACH 4TOYH 1C08A 5FCUH 3O9WA 4PJDB 3O4LB 5L8LB 4MDJA 5J4MA 5ITFB 4MCZB 3K0WA 4HKJA 2VABA 3MLUL 4NN6B 4JPKL 1JN6A 3LN5A 1NUGA 1T3FA 1GC1L 1H3XA 2OR9H 5D6CB 3RWIB 3QJHB 4F7TA 1EEYB 1M05A 1ADQL 1OD7A 5ESAA 3LB6C 5J89A 4NRYA 4N0CC 3TIEB 4X6CF 4JFED 3UX9B 3TA3C 3L7FB 5I66A 4OZHB 3FFCE 3SQBA 1PVHA 3RVVC 3CNKA 1GGBL 4BZ1H 3L3JA 5JHDB 5K9KA 4QOKE 5T3XE 3U7AA 4F7MB 4DZ8A 4NQCE 4QRPD 4YK4B 3BFOA 2JJVA 3BZ4A 2HMID 4MX7B 3VXUE 4NHUA 5ESQA 4U0QB 1FH5H 3CDYA 1CWVA 4LVHC 3RWCA 2I07B 2BJML 2HFFA 1PBYA 3DUSA 3NACL 4TOYL 3CFDA 5FCUL 5DSCB 2J6EA 5IF0B 1UB5B 1J8HA 3C5SB 1CGYA 2Y07H 1RZJL 2AEWA 3IDMB 4UNVA 4P49A 4PJFF 5C07B 2OQJA 4EDWH 1A6WH 5ITBH 1G7HA 4OAWA 2OR9L 2APXA 3VGAC 1VADB 1L9MA 1G7PB 4CNIA 3MGTB 2CXGA 1CD8A 4TNVF 3GI8H 5LKNA 3VWKB 1F3JA 5K59F 3G5XA 2VRAA 4OQ1A 5HTSA 1A6TA 3JBG7 4N0FB 1CXKA 1ZVYA 1XGUA 4K7PH 2FR4A 1OGAA 5KVMC 4RAUA 3QCVH 4JRXB 4BZ1L 4DUXA 3GSQA 3TBSB 3UC0H 1RJZA 1NJ9B 4NKMA 5CP3A 2DIJA 2X9WA 2C1OB 1GH7A 3B9KA 5FYLH 3IJHB 3OQ3B 1B0RB 4KKBD 3IFPA 4Z7QE 3K2MC 4QGYA 3A6CH 2ILLA 4PS4H 1FH5L 4WUUD 2W1NA 3BH9A 3BESR 2C4FT 4PRNA 3Q6FA 5T1KA 3GMPB 5ACZA 2BY2A 1KB5A 4WI4A 1X4ZA 2Y07L 3RVWD 1CS6A 4RIRA 4JKWA 4R0LB 3OGCB 1D9KA 5DD0H 3ARGB 1ZLVK 5F1IA 1JUFB 4L8DA 1A6WL 4EDWL 5ITBL 4PGDA 3QWOA 2HT4C 2HVKB 1C16B 2LV4A 1D5IH 4LSVH 1YEDA 5I18H 4EUPA 3QEQA 1NEUA 5D1QD 1G6VK 1JRHH 3GI8L 2ZUQC 3FN0H 5CGTA 4RGNC 4LVNB 1DQJB 2EKSA 4K7PL 3LEXB 4ONGH 3QCVL 4JFXB 3UC0L 2GTZB 4MB3A 2X4OA 4JFOA 1S78D 5F1KC 3RNQB 5FYLL 4AK1A 3RQ3A 5E7FA 5CGYC 2FL5A 4HJ0C 4U6HB 1CGXA 3A6CL 3BGFB 2YPLD 4PS4L 1DBMH 4FFVD 2KKQA 4AQOA 3BXNA 5FDYA 2IANA 1NMAH 3G08B 3REVB 3X14B 3V6OC 2MSPA 4YBLC 3QIBB 3MNZA 2C3GA 3MACH 5GRXG 2IH3B 4H8WC 4ZUWB 1MQ8A 1XF3A 3KXFD 5DD0L 4PLKC 5D5MF 3T65A 1LP9B 1OCWH 2P46B 2JB6A 4NQTA 3K7UA 5LWYH 1D5IL 3CAFA 5K33A 2DBLH 4LSVL 4LCYB 5TE4H 3CFKB 5DS8A 5I18L 4HFWB 3LPGA 3RUGA 4JZNB 1JRHL 1LD9B 4NIKB 1EAPA 4ZNEA 1V5JA 3FN0L 4OM0H 3GUTB 2RAMA 2DWDB 43C9B 4ONGL 1HHHB 3MMEA 3MRQB 4RZCB 5DRZB 3WIHH 1IGYA 4UQ3B 2WUCH 3DI3B 2OTUA 4ZG1A 5BZDB 4DVRH 3BPLB 1NAMB 1NGYA 1DBML 4LSQH 2IADB 5F9JA 1NMAL 5AD0B 2Z92B 3MACL 3QO1B 3VXOB 5DJ8A 2H2SC 5ACMA 1OCWL 3DYOA 3DMMA 2IAMA 5IW6B 3NCCB 5LWYL 2ARJA 2DBLL 3CLFH 5TE4L 2D7TH 4V1DD 3QNXB 5IJKA 3SY0B 4KI5F 5H8DA 1BX2A 4FG6D 3EOYG 3IJYA 4QEGA 5IB4B 4OM0L 1R3LB 5JLZB 1X7QA 3PWLB 4Q6YA 5LXGH 1RULH 3C6SB 5EZOH 1ZLSH 1WZ1H 1UB6A 4BSJA 4V2BA 2EDBA 3WIHL 4P4KC 4P2QD 4F2MB 1NUNB 3KJ4B 3O6MH 4XC1H 2WUCL 4GLRI 4AEIH 5I19H 4P2CG 2NW3A 3V5DB 5JDSB 5H35A 4R7NB 4XBGA 5IJVB 3ZHKA 2CK0H 2O5ZH 2AP2A 1CLYH 4WHDA 4DVRL 4LVHB 1UENA 4LSQL 1CIUA 4NQEA 4BYHA 4IOIA 3O2WH 5DMIH 3MX0A 3H42H 4LVOC 4G9FB 3ESUF 4K8RH 3WFHB 5C9JA 2D2OA 3TO4A 3RZCD 4WNQA 4QF1B 3UZQA 4ZXBD 4UI2A 1GGYA 3DI2B 5DJ6A 3CLFL 2Z93A 2R2EB 4LHUB 2D7TL 4X99A 4CKVX 5AZEH 4MVBC 1PZ5A 1DQQB 1EHNA 4PREA 4HXBH 2GUOA 2A6DB 4AL8H 3WS3B 1BPVA 5LXGL 4F7EA 1RULL 5EZOL 1ZLSL 2Z91A 5DJ0A 1IGMH 5DK0B 1WZ1L 4WRLA 1U92A 3LD8C 5E6YA 2XN9E 4LQFH 3AM8A 1S5HA 3QZWA 2FATH 4XC1L 3O6ML 5D72H 4JFFA 4AEIL 5I19L 3U9UB 2J2ZA 2NY1B 3VH8B 2CK0L 2O5ZL 3CLEH 1CLYL 3Q6GH 3FT4B 1Z3GH 3DV6B 2X4PB 1UKTA 3D69A 4X9FA 3HZMB 3HLAA 3MRKA 4NO5A 3O2WL 1IEAB 2E27H 5DMIL 4OZIA 2Z31D 4Y19E 3H42L 2ICWB 5AZ2H 2DM7A 4NYLA 3L5JA 4K8RL 2OSLB 3TV3H 4PRPE 4NNPH 3PQYD 4ETYA 4QWWC 2YSSA 1KTRL 1S9YA 3EIFA 3VD9A 3BUYA 5A16B 1YQVH 2ZUQB 4FQLH 4YFEA 4F7PB 4LKCA 1NBZB 4RGNB 5AZEL 5KZCD 4L3EB 5IK3A 5F6IB 4HXBL 4N5EC 5I16A 3VFRB 4AL8L 2GQHA 3EYQC 4K23H 1IGML 3VGBA 4P5KA 1KJ2H 4YDVB 2PKDA 4BZ2H 5IVZB 4LQFL 3IDGB 2FATL 1FVCA 3HC3H 4Y1AA 5D72L 2V2XA 3QDGD 4PD4J 1W72H 4Q0XH 3T77A 1PYWA 2Z8RA 5HPMA 3LHPL 1F5WA 3CLEL 3Q6GL 4ACPA 3BRFA 1FNFA 4NDMB 4NC0B 1U95B 1Z3GL 5JR1H 3WUZA 1GPOH 4HUWB 1OD9A 5BVJA 4UOJA 4P23D 2D0FA 4OZGF 4YBLB 5MEPB 2E27L 3PXHA 3W82A 5E2VH 1A7NH 5AZ2L 1KCKA 3PABA 3WLBB 1MCRA 4MQXD 4E41D 2RGSA 1PD6A 1QFUH 4R96B 3TV3L 3LKRA 2ATPB 4NNPL 4L3CB 4PJ5B 1F4WH 4ZS7H 4D94A 3NZ8A 2VE6B 3OHXA 1YQVL 1P69B 4FQLL 2HFGH 2HA1A 3HMWH 4XCYB 2H2PC 2XG5A 2QQNH 3N1FC 5FGBA 4S11A 4MJ6B 4K23L 4WW2B 3CX5K 1KJ2L 3NPSC 1JE6A 4JM2B 4BZ2L 3U30C 4LFHG 1R6VA 3HC3L 5IVXB 5BJTA 1W72L 4Q0XL 4LKXA 4CN1A 3BPCB 3T1WA 3KYMB 5FDWA 5DFVC 1RPQA 3RBGA 5JR1L 5LGKA 1GPOL 1LO0H 1F11A 5K59E 2VQUA 3MV8A 2QKIA 4JRYE 3L3KB 5TE7H 3X11B 1HH6B 1A7NL 3QO0B 4HKXB 3QWQB 5E2VL 3TZVA 1L7IH 3T3PF 2EE9A 4BSWA 2BZDA 1QFUL 5CJXA 1RU9H 3QDJE 4C54A 1Z9LA 3CSBA 1F4WL 4ZS7L 2EZ0D 2XZQH 1XIWC 2C5DC 2V2TB 3SKJH 5D2LB 2BNQD 2HFGL 2FRGP 3HMWL 3UAJD 1WWAX 2QQNL 3RWGB 4KUCF 3B9EA 3E3QE 1JCKA 4OIIH 3FQNB 3VFOB 4PJDA 3IRPX 4ORZC 3O4LA 1CN4A 4PJIB 4P4KB 1EXUA 3C87A 3IDNA 4L4VB 5ITFA 4S10A 4GAGH 4MCZA 5B4MD 3MJ7B 5MENB 4CVUA 5F88B 4E9LA 2OTWB 1F2QA 1IBGH 1MFDH 4ZOAA 2G60H 3G6JF 2NNAB 5EG6C 4UIMB 4X9HA 1HILB 3VWJC 2Y4SA 1IEHA 4LBEB 3RWIA 3QJHA 1EEYA 3VGFA 1LO0L 4Z76A 3OJMB 5TE7L 4B7IA 1Y18B 3DX7A 3TIEA 4LVOB 2EDLA 2FWOB 3IYLW 5GPRA 4RFNC 3RFZC 1FNEB 5C09E 1L7IL 1YMHA 5C8JB 2QR0B 4YR6A 4OZHA 2AABH 1KT2B 1RU9L 4XHQA 3AC0A 5JHDA 4LF3A 5SWZD 1LHZA 2XZQL 1KPRB 2WK2A 3GBLA 4B7LA 3SKJL 5I30H 2BMKB 1EFXD 4MX7A 4PY7B 2I9TB 3ALWA 1ZA3A 1GC1C 4YHNB 3LD8B 1HH9B 4OIIL 1SJEB 3Q5YA 1TXKA 5DSCA 5IF0A 1UB5A 2BRQA 5ID1B 2PYFA 1UA6H 1JGVH 43CAB 4GAGL 1JYXA 2MOVA 5D5ME 3IDMA 4A2MA 4P99A 1PQZB 4XZUA 3TT3H 1IBGL 1MFDL 1GHFH 2CRZA 4S0TD 5C07A 2G60L 3BRGC 1LQSR 3KYAA 4OCMC 4PJHA 1TNMA 1DBBH 4JQXA 4KV5F 1QFOA 2LTQB 3HG1D 3MGTA 1T66D 4KK9D 4ZDHB 1U8MB 3DECA 4ZUVB 3JTSB 1U0QA 2EDDA 2WWKO 3PHOB 3ZMRA 5CZXC 2AABL 1BD2A 4JRXA 5I8CB 4P46D 1A9BB 1N59B 4TVPD 1NJ9A 4JN1H 4NZRH 2ZSWA 2C1OA 4JQIH 3PWVB 5I30L 1J12A 2E9BA 3GM8A 3MODH 2Q8AH 5IB2B 3GMPA 3QUYC 4KROD 1UA6L 5A40E 4MJIB 1JGVL 1OP5H 4R0LA 4S2SB 1CICC 2CIIA 4Y2DD 3TT3L 1GHFL 1YMMB 2UVEA 3GSWA 4KRNA 3VRJA 5I75C 2AQ3A 1JTTA 3PV6A 1MCNA 4RNRB 2FEDC 2HVKA 3PNWB 1C16A 1BVZA 4WJ5A 5F9AC 4KI5E 4LP4A 4JHAH 4HUVB 1DBBL 3QXTA 3MRMA 3BW9A 4N90D 1DVFD 1JTOA 5DRXB 2EE2A 2XQYG 3NFNB 5DVMA 5FK9A 1ND0B 3LEXA 1JPST 2QL1A 4KRPD 4JFXA 4P2YA 2BVPB 2R2BB 4J3WA 2LAGB 4MZ3A 2GTZA 3DROA 3O8XA 3PGFH 5FYLE 4JN1L 4NZRL 5KJRH 4OB5H 4JQIL 2NYYC 4MNQE 3PDOB 4U3XA 3SCMC 4U6HA 3RVXC 3KPRD 1BFSA 5HVFB 3TNNA 3V7MA 4F9LC 3NMEA 3MODL 5GRYA 4PRIB 1B0WA 2Q8AL 2ESVA 1YEEH 2AJSH 3REVA 2JJTC 32C2A 3U30B 3X14A 2VITB 3T0AA 3QNZB 1MI5E 2V9QA 5FGSA 4YGAB 1I1RA 3NA4A 3TPKA 2FD6H 2AERT 2XQYK 3CC5B 5DA0B 1NEZA 3IKCB 3MV9B 4JHAL 1IC7H 4HFWA 3PL6C 2CIKB 4ODBD 5EIVA 4I5BB 3WHE0 4MSWB 5D8JL 3AGVA 1HHHA 3VGDA 3MV7E 3MRQA 1WTLA 4RZCA 1W0VA 1XIWB 2UY7A 4UQ3A 2JJUA 3PGFL 4M7LH 4PJFB 5TDOB 1T0PB 5KJRL 4OB5L 4HS3B 1IAKB 4R4ND 3ECBA 5GGTH 3H9SB 3MXWH 4NKDB 5E56A 3RNKA 1NAMA 4R3SA 5F1NB 5J1AB 2IADA 1XF5A 5E94B 4PJ8B 2Q6WB 4ZODA 2AJSL 5F7DB 2EO1A 2Y23A 5E8NA 5FXCH 1OTTD 3D3VD 2VUOA 2Z92A 4NRZB 2NY3C 3QO1A 2VIRA 4YEFA 2XZZA 1WAAA 3VXOA 1S7RB 3BJLA 2JIXB 2Z8WC 1JI1A 3VWJB 4Z0BH 2FD6L 3VXRB 3OJDB 4PJAA 1IC7L 5J8OA 4LLQB 1FVDB 3QNXA 4J12A 3SY0A 4RFNB 3TA3A 4BM7A 1ZGLM 5GGVY 3PWLA 5CMAB 3C6SA 5DJAB 2Y6SC 2F5BH 2VDPH 4UOW0 5JO5A 3RWHB 4M7LL 2W65A 5B38G 2XPGB 1ZT1A 4R7NA 4Z0XB 5GGTL 3ORJA 3BWAA 2UY6A 3MXWL 5DVLA 4OZGE 1K3IA 2VLKE 3LDBC 4C56B 4BUGA 4LLWB 2X05A 3C2SA 4LPVA 5KS9E 1IRAY 4XI5D 4PRHB 4G9FA 1KJ3H 4FQXB 5E1AB 2FIRT 5FM4A 3WFHA 2QQKH 2KH2B 1AGDB 3FFCA 3T09A 4Z0BL 2B7DT 2GTWB 5JOPE 2BOBB 4WDIA 5FYKL 3C6LD 4JAMA 4QF1A 1S9XA 2BHZA 1QLRB 1ULVA 3LV3B 1MCSA 2OJEA 2R2EA 4NQCA 4ZYKB 3UYRH 2UUDH 1O0VA 2A6DA 3WS3A 3VXUA 2XWBA 3LVEA 1ZXQA 3OKKB 4PJCE 3RDTC 4CN4A 4YX2H 5J9PA 4MNGE 4PGEA 1NCCH 2F5BL 3H3PH 3BEVB 2DLTA 4RAVB 3PDDA 1II4E 1FZJA 1ZHLB 1E6OH 3U9UA 3O3EB 3P0YH 4QCIB 1S7SB 4ZMAT 1L6ZA 2X4TB 3VH8A 4LPCA 3NIFF 1KIPA 3FT4A 4CL7A 4KK5C 3DV6A 3MZTA 2DQJH 1OW0C 5E6IC 3UTSE 2WWMD 3FQTB 5TE6H 5EZLB 3QUYB 3HZMA 2UWEB 3ELAT 4NO0B 4RMUA 1AGEB 3QQ9D 3T3PE 4OLUH 4CGTA 1Q9KB 4BUHA 1KIQA 2ICWA 1KJ3L 4D0CA 2QQKL 3K4ZA 1QACA 3LSOB 5I75B 2OSLA 4WEUD 2XKNB 5DHXB 2F8XC 4OCRH 1FIGH 5BOZG 3TYFA 1MAJA 5IB1B 1X5XA 2N1KA 2Z35A 3MNWB 3DYPA 1IAIM 4PJXB 3UYRL 1I9RH 4ODUB 4AEEA 1FRGH 4OQTH 1CF8H 4CMMB 2XKUA 2CO7B 1FFQA 1K9TA 4HJJH 3STLB 4ZUUA 5DJDB 4YX2L 1NCCL 3H3PL 5DJXB 4YDVA 4P5TC 4KKCC 1G7QA 2X89D 4UB0H 5IVZA 1LE5A 4NJAH 3IDGA 4XP1H 3G6JE 3U82B 2P5WE 5KSAA 5E8EA 5I17A 3SCMB 1E6OL 4UV7H 1KXQE 3QCTH 5HJ3B 3P0YL 4K8RC 3W0WE 1P2CB 4NDMA 1EZVX 3MRDB 2DQJL 2V5RA 4BSVA 2J4WH 5TE6L 5DK3A 3V6OA 5DYOA 1SYSB 4KI1A 5MEPA 2CMRH 2VLRB 1WISA 1FVEB 4OLUL 4X7TA 4MA1C 4ESKA 3WLBA 4EN3D 1U3HC 3DVGB 3QISA 4R96A 1WBYA 4AENA 2YK1H 3S3PA 4OCRL 1T1XA 4ZAKC 5F7YC 3RIFK 2FIKA 4PJ5A 4DWHA 3B2UD 4HIIB 3PL6B 2VE6A 4Q9RH 1I9RL 1CE1H 3MCKB 2O5XH 1FRGL 3QUMH 2Y7QB 4OQTL 1DANT 2IBZY 4POZD 5CP7B 3F7VA 1EK3A 1VGKB 3HB3D 3QUZD 4HJJL 4MJ6A 5D9SB 4LVEA 4LSPH 4UB0L 5E99H 4IRJD 4NJAL 4XP1L 1KFAH 4UV7L 3QCTL 3ABZA 1KEGH 4FQQB 3D85A 1FHGA 4Y7MA 2P5EE 4XP9H 3L3DB 4OD3H 1MHEB 4NZUH 2J4WL 4FQ2H 2NY2C 1ERNA 1YPZF 1KLUB 3X11A 3L3KA 2CMRL 2NY3B 4TPRH 1IC4H 4V2CB 1U8LB 5FKPA 5SX4H 1HH6A 1RHHA 3T0EB 1FLRH 4EBQH 4KMQA 2E7BA 3IAGC 2C1PB 2R0WH 2VLLB 2YK1L 3C9NB 2EICA 4Z7WB 1NKRA 2BNRD 5M7QA 1AGBB 1RI8A 4ZFFA 3F62A 3E0GA 4ZO6A 2V2TA 4R2GD 5D2LA 4Q9RL 5D1ZC 2ZZUT 1CE1L 5F3BB 1AIFB 1C5CH 3QUML 1PGRB 2DL9A 5CJ8A 3OR7B 4EI5D 4X8JA 1XGQB 3U36A 5D6DA 1I3UA 1E4XH 3NCBB 5C0ND 3FQNA 3VXSB 4LSPL 5E99L 4HUUB 1IC5H 1OB1A 5MENA 1NANI 5F88A 1KFAL 1UZ6F 2VL4A 1KEGL 3TCLA 4U1LA 3DETC 3LDBB 3KS0J 3BPNB 1HILA 1I1AD 3H7BA 4XP9L 1J8KA 4OD3L 4LBEA 4NZUL 4FQ2L 5GSRB 1Q72H 5HYIA 1Y18A 4TPRL 1IC4L 2NXZC 3NZHH 3T0BA 1FNEA 1FLRL 4MWFB 4EBQL 2DBJA 2DMKA 3NABH 1NCDH 2R0WL 1KT2A 2AJXH 1V7NH 3MBED 4H88H 2X9YA 4QYOA 4HEPG 1A6ZA 1KPRA 3FAXA 3VXMD 3BZEB 2HJLB 1XEDA 2BCKA 1C5CL 4PJ9C 2BMKA 2EEBA 1U6AH 1DSFH 4WFEE 3RDTB 2NY6C 3BI9X 4YHNA 3MRBB 1YY9D 1AXSB 1CFVH 1E4XL 4HZLA 1SJEA 4FFWD 5ID1A 1IC5L 2DI8A 3FRUA 1U93A 3S35X 2FJHB 1E4JA 3AB0B 4NO3A 5IM7A 1X5JA 1PEWA 1S7VB 5INDA 3EDEA 1W8OA 1HHKB 1Q72L 3T4YB 3ARBC 2WBJD 4ZDHA 1U8MA 5E2WH 3BPOC 2CK2A 3NZHL 4ZUVA 5CWSB 5BS0B 4OGZA 1UJ3C 4X8XA 4R4FH 3NABL 1NCDL 4KJWC 4NP4H 1G9EA 2DDQH 2AJXL 3LQZB 1V7NL 4XBEH 4H88L 5I8CA 4NC1E 1GJIA 5HI5C 2XV6B 1N59A 3HNVH 2XN9A 4HUMB 3V8OA 2CDFB 3OAUH 4D9RE 3MSPA 4JVUA 4LCWD 1KCSH 5DC9B 1RUQH 4Y4FC 1Z5LA 1U6AL 1DSFL 5EU3B 5GS2H 1L7TH 2OCFD 5IB2A 1WC7A 4P5TB 2IPTH 1CFVL 3C8KA 2AJ3A 4JVWA 2FBJH 4MJIA 4JJ5B 1RSFA 1AD0A 5J1SC 4ZUTB 4Y19A 1YMMA 2WLZA 5HDBE 2W59A 1CGSH 4HF5H 1V8HA 4PRPA 4LL9A 4MD4B 3KHQA 1H3WM 1T1YB 5ISZB 1WWWX 2XTJD 3MLRH 3K80A 1YA5A 2DQFB 4MA1B 5IOPA 5E2WL 1NFIB 4RRPG 4HH9B 1U3HB 3NFNA 4DUWA 3ARZA 5JPNB 4ZAKB 4R4FL 4NP4L 4CRPA 2DDQL 3THMH 3PGCA 4XBEL 4U1HA 2FB4H 4GRWB 3HNVL 1Q94A 2HT2D 5KVDH 1JF1B 4APQA 3QFJB 3OAUL 3GMMB 4WI6A 5IMLA 4N0YH 4FOMA 1KCSL 1RUQL 1MCFA 3PDOA 4KHTH 3QIUC 5HYSG 4HJGA 1FP5A 3RWEB 2ICWI 5CBEA 5KN5B 2A1WH 2VXUH 1L7TL 4NKOB 4PRIA 2IPTL 4X6CA 2CKBB 3PWJA 1KYOJ 2FBJL 1BZ7B 2VITA 2G2RA 3MBXH 1NFDF 2VMFA 1U8JA 2RFXB 5ANMB 3S4SG 1CGSL 3C5JB 4HF5L 4GXUN 2AXGA 4ENEC 2NY2B 3CC5A 4NOFA 1YC8A 1T7WA 2H26B 3IDIB 1UG9A 3MLRL 4OI9A 2BERA 4N0UB 1SY6A 4J3TA 1HYSD 1FAIH 1CD0A 4NUJA 1VA9A 2CIKA 1OGTB 1FL3A 1WUNT 1XGRB 4L3EE 5FA3B 2ZOLB 4O00A 4I5BA 4Y2OA 1KJ2B 3THML 3FQRA 5JOFB 2FB4L 4GS7C 1BOYA 1XIWA 4M8QA 3I84A 2PXYD 5KVDL 5TGBB 4KXZH 2AQ1A 4PJFA 4Z7VB 3C5ZC 5D1ZB 5TDOA 3NIFE 3FT2B 4N0YL 4PP1C 3TGXA 1IAKA 2X4UA 3MCG1 1AH1A 4KHTL 4N9GB 5BXFA 3I6LE 3MLSH 2A1WL 2VXUL 4TUJB 5F1NA 2FECI 1SJHA 4LLUB 1F6AB 5F7DA 4PJ7F 5IWLC 3RTQD 3MBXL 4LLDB 3RGVC 1BFTA 1S7RA 2NZ9C 4B53A 1KPUA 2PO6D 3VWJA 1FE8H 1IM9A 1ORQB 3OAYH 1KULA 3VXRA 4LSUH 2BHUA 3CU7A 1S9WB 1UVQB 4MDIB 4I8DA 1QHPA 5EU7E 1FVDA 1FAIL 4FTVB 2XOTA 4G43B 4XX1G 2YBRB 1DN2A 1MFNA 3F6LA 3RWDB 5DQ9A 3QUXD 1TZGH 2W0FA 2RQ8A 3QEUA 3EZJB 4G6AD 4HT1H 4CVZA 4BK4A 5AUMA 5CEZE 3EJYC 4GH7B 5DJCA 1BFOB 2HAZA 3P30H 4Z0XA 5D7KE 2NY6B 1RUAH 3EOAB 3MLSL 4GRLD 1LEIA 2Y72A 3UTOA 5D7JC 1N3NA 4ZFZB 5GGVH 1A22B 3L95B 5IHUH 4ZFOL 4PRHA 3TBYB 2F54E 1G9MH 1FZMB 5B3NA 5C09A 1K2DB 4ETQB 1AGDA 1SBBA 2AXFB 1FE8L 1KNOB 3BH8A 4WO4D 5FYKE 4LSUL 5HY9A 2BOBA 1UWEL 1QG3A 3OAZK 3BPOB 2VWEC 3BD3A 5KBNC 5C0DB 5C0CB 1UJ3B 1BZQK 1HDMB 1MNUH 1P1ZA 2O26U 1Z0MA 3I02B 2EYSB 3OKKA 4UT7H 1FNAA 1CZ8H 1TZGL 4O2FB 3FONB 1TNNA 4L4VE 2CDEA 1KIRB 4HT1L 1C5DA 3PWPE 4K07A 4L4JA 1AGFA 1ZHLA 2JJWA 3O3EA 4KGLA 3P30L 1UACH 1XFPA 3DO3A 1YPZE 2WP3T 1RUAL 2DD8H 3U4BH 5EZLA 2CLZB 3QUYA 1LO5A 5GGVL 3TN0C 1AGEA 4GQ9H 4XMPH 3HS0B 5IHUL 1V3MA 1CICA 1G0DA 4NSKB 4MXQD 4PYHA 3F58H 4PJBF 5SX5K 3RWFB 4FRWA 3G04A 1G9ML 3LSOA 2XKNA 1UFUA 1CFSB 1BM3H 1DUYB 2R69H 3DUUB 2VXTH 5IB1A 3D25B 1TCMA 5CJOH 4DGVH 3HI6H 1CL7I 4PJXA 1TZHA 4URTB 3MRPB 1RZIB 3HN3A 5T1LB 2AK4E 2FEEI 5GSVB 1AI1H 1A7PH 3GSRA 1MNUL 3P0VL 4CMMA 2GJJA 3STLA 4UT7L 1CZ8L 4W68A 1OAYH 1DQTA 4ZUSB 4W4OC 1OWRM 3MRLB 1AO7A 3FQWB 4WFHE 4PJEF 4EQ3A 5EC2B 4IMLB 3SCMA 5HJ3A 5HGDB 1A2YB 4F9LA 1UACL 1K5NA 3D18B 1IQDB 4G6MH 3TLRA 2GT9B 2DD8L 3U4BL 2JJTA 4MCYB 1LNUA 1Q38A 2PW1A 3KPQB 1SYSA 3JUYA 4GQ9L 4XMPL 4NCDA 1FVEA 2VDNH 4YUEH 3F58L 1NUFA 3S88H 3EFDH 1QSEE 5EBMB 3UZVB 2CSPA 2GJZA 5EU6B 5FOBA 1BM3L 2GSIA 5DC0A 1FYTD 5IIEB 2VXTL 4X5WB 5B38B 1IL1B 2AJZB 4Q9BA 5CJOL 2NY7H 4BFBD 3PL6A 4DGVL 3B8YA 2XZCH 3HI6L 3ESVF 4M6MH 3OG6B 3MCKA 2Y7QA 4MNQA 3ZZ1A 3RKDD 1AI1L 1A7PL 3NCMA 4QY8B 1QRNE 2J8UB 4MJ5B 4GS7B 1T5WA 1OAYL 3IDUA 3LMJH 2IGFH 3ARFC 3C5ZB 4DEPC 1R3KB 2EDXA 4ONHB 3NCYS 2P24A 3KPSB 1MI5A 4LDOB 2EEAA 4FQQA 2EDOA 2X70A 3PWNA 4G6ML 3UTPE 3L3DA 4WI9A 3GMLA 4HMDA 4XNMB 4FP8H 5KVGH 1KLUA 4HWNA 1B3JA 3VFGH 2A6KB 4JGMA 3QIWD 1U8LA 1G6RH