3HKFA

Murine unglycosylated igg fc fragment
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
205
structure length
205
Chain Sequence
SSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Igh protein
publication title Structure of the murine unglycosylated IgG1 Fc fragment
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 31
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2009-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hkfA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hkfA01
1K4DA 5T1KD 4JJ5B 4QTHA 1VKXA 3BO8A 5IHZB 2UYLA 1R3LA 4OF7A 4LIQH 4ACPA 4RAVB 3M8OH 1P4LB 4KK6D 5KSAB 4M7KH 2F53D 5M7QA 4ELMB 4Q6IA 4R3SA 1HHKA 4YHKH 3L9RB 4LSTL 1KPVA 1OP9A 2NY4D 1S7TB 1E4XI 1U8PB 1C5CH 5ISZA 5IUSA 4OIBA 1R5IB 1T0MB 4YBQC 2FZ3A 4U6HA 4HLJA 2BXZA 5I1AA 1BZQK 1GOHA 2PTTB 3QIUC 2I5YL 1IGML 4AYFA 1KB5B 4WFGE 5F1SA 4S1RH 5ILTL 4DAGL 5F89B 4FQXD 4KMTL 4LHUB 1NEZA 5CJBA 5I1IH 3W11D 5IHUL 1X5XA 5DRNA 1E27A 4WWKD 2IPUK 3BUYB 5D1XC 5BS0D 3NFNA 3QXAA 4G43B 4X83A 2AGJH 1QLEL 5I66B 2ZOLB 3N9GH 5FO9B 2VQUA 3JVGC 5T1LB 4HWEH 2FX9L 1EGJL 3HMWH 2J6EA 5C2BH 3MA9H 3BKJH 4WTZG 1AQKH 3SKOA 3OX8B 1A6UL 5A16A 2APTA 4YK4C 1WCQA 1KEGH 5LWYH 3MRBB 5K9KB 1BJ1H 1QFUL 4PJEA 2QQNH 3OAYH 2Z8RA 2V2XA 2ID5A 2F5BH 3L3IB 1YEGL 3DX8B 3DX9B 2GW5A 3QA3A 4JPWH 4Q58C 4BM7A 1BX2A 4LRIC 4R2GB 4YHNB 4KVNL 3OKLA 4P5TA 1MCNA 5T1MB 4X0KA 1A1MA 1CWVA 3EFFB 5DC9B 1BJ1J 3B83A 3X12A 3WXWH 2F54E 2YKLH 2J88H 3GSQA 1OPGH 4N8VG 4TVPD 5GIRB 5C0BD 5TDNB 2YPLA 4BQCA 1JI2A 2AXHA 5IM7B 3NACH 4JPVH 5ICYB 2DOCA 5GGQH 1T1YA 2HAZA 3NAAH 3BKML 4P4RA 2D7QA 3JTTA 1UXSA 1AP2B 1OD7A 2X1WL 2MQ3A 3TA3A 1NAKH 2UV3A 25C8L 2AK1H 2V7NB 3ARFD 4WUUA 4YDLC 2GITB 4JFYB 1OF2B 5BQ7B 3ARZA 1GGTA 3PGFH 5ECJE 1PKQE 2YBRA 2P5WA 3MGOA 4QOKA 4JM2F 2R56L 4GW4B 1EMTH 1A0QL 1FCCA 5DZLA 1LO0L 3MO1A 5D7IE 2FATH 3NTCL 3L3HA 4I9WE 2VQ1B 5EOCH 2VQTA 2LV4A 4PD4K 4QF1A 15C8L 3QO1B 1VFAB 1NBQA 3TPUB 2UZYB 1FZOB 3QEQA 3QIBB 4TUOB 3LH2L 1HKLH 1NCDL 2WLYA 4BFGA 4FTVA 4DVRL 3QO0A 3LRGA 1OM3H 2VDKL 1CF8H 4RAHA 3FFCE 3PHOB 3RUGE 3L5JA 1A6WH 3N1QC 4Q6YA 1I9JH 5EOCJ 1QSVA 4P2OA 2DKSA 3MRRA 2YMXL 8FABB 3WEXB 3EYQC 4G8IB 5FKPA 4RQQB 3ZTNH 4BQBA 1DEDA 4AEEA 3CFEA 2FJHB 4XPTL 3STLA 5CZKA 1ZT4A 4BQ8A 3QG7H 1X3DA 4MXWH 1BWWA 2QSVA 3HI1A 3I6KA 4YFLF 1X7QA 4OLWH 3FQRA 4A6YH 4UZGA 1A3RH 3CMOL 4NM8H 3CX2A 1JGEA 4NZDA 1TZGL 4G8EB 4PRAB 4URTB 1R3JB 3PJSA 5GGRA 3TO4B 1KPUB 5J6HA 3ULUH 1I1FA 1CT8A 4OQTL 4LSRL 4D9QD 4CMHC 5D8JH 5E6ID 1ZA6A 4XZUB 1CXHA 3U83A 1NFDE 2J8UA 1K6QH 1A4KB 4MCYA 32C2B 1P4BL 2DIJA 3G6AA 2P5ED 4UINH 5C6TH 3K8KA 1YC8A 2AQ1A 1KCRL 4DGIH 4ODUA 4PRNA 3G5YA 5I30H 2HT2C 1UWEH 1IBGL 2IBGA 5HTSA 2Y07L 1FZMA 3EGSA 2P44B 3WS3A 5B3JF 3FMGL 3G5VB 1MSPA 1YY8B 1SBBA 1DP0A 1KT2A 1UKQA 1AHWB 2QKIB 3HI6H 3ARDA 4KROC 4Y2DB 5FGSA 1NGPL 3D18A 1YNTB 5BJTB 3FB5B 4NBYB 2IFFH 2YN5A 5C0AB 3SDXB 1I75A 1U3JA 5FF6B 4L3EB 4JPKH 4NRYA 2OTPA 1BF8A 5DD3L 5C07E 2VLKE 4ZG1A 1N0XL 2H32H 2W9DH 4JN2A 3V5DB 1YN6A 2YR3A 2D7PA 4UDTA 1G6VK 1QSFB 1A64A 1T83C 3NZ8B 2AS5M 5DVMA 3ZKXC 2P7TB 4K71C 1IFHL 1AIFB 2JE8A 4WNQB 1EEZA 4GKNA 3TWCL 2ZUSA 1GIGL 3C09C 4FQ1L 4PLOB 1CLYH 1T21B 4V2CB 9CGTA 5C0CE 3T2NH 4HWNA 2ZG3A 4Q7DA 4LKXB 3NCBB 1FORH 4WW2F 3MUJA 3RGVD 3PDGA 3HKFA 4A6YA 3ESUF 4DTGH 2B8OT 4GUPA 4LDOB 4K3EH 3TN0D 5ESAB 2FX7L 3VFNA 4EUPB 1LO3L 1X4XA 1SQ2N 4Q6IC 1CZ8H 3DUSB 2QSTA 3MFFB 2W0PA 5GHWL 1EX0A 5D7SH 5GRJH 1K2DA 4HXBL 5D5MB 2W07A 4FFYH 2Z0BA 4Z9KB 5KSUB 4XP4H 4QXUH 4NO5A 4F33B 4NNPH 4C59B 4XPGH 1BFVL 1UACH 5I73B 1UCBH 1IL1A 3LEXA 4WIQA 5EORL 3RVXD 3E6HA 2C4XA 3QCVH 3EOBB 4JFHD 4PJBB 4X7CC 2VH5H 4PJ5B 1BOGA 1J5OL 1S9VA 1BZ7A 4LCYA 5GSVB 5JZ7C 4OGYL 4YIQB 3C5SA 2EO1A 2A77H 5F6HI 2YC1B 5C70A 4KUZL 2QADB 4POUB 4JHWL 4Y0GA 1JK8A 5T5NF 4KI5D 2AXFA 5BXFA 3MJ6A 4UU9A 3R06B 3RKDD 2H32A 1QQDB 4I0PA 1F58L 1RZIA 3A6CL 3WIIL 5CP3H 5C8JB 4M1CD 4ESKA 1SYSB 2JJUA 4P5TC 3WFBL 2QQKL 4N8PA 2DQJL 1IGFL 3GMNB 3WDJA 1SMOA 2E7BA 5FUZH 4DEPB 3SKNB 2GAZA 3S97C 5FYKU 4GG6E 1JUFB 2Z4QA 5J3HD 1MCBA 3TPKA 2K7QA 1FJ1B 4FQIH 4RAUB 1U3YA 5T3XH 4N1HB 5DFVD 5CD3B 3CJJA 2APWA 3N85H 3DRTA 2NZ9C 4P2RA 3MRQA 4JVWA 5L8KB 4ZUVA 3VXPB 1MCEA 4JQXA 1H3PL 1T5XB 4Z0XB 3UPAA 4YEFA 3TA3C 2APVA 5EN2B 4JB9L 3LD8C 5DSCB 1UEYA 3RI5K 4H25A 3TBVA 2MCG1 2C3VA 3SDDC 2AJ3A 4KTEH 1T22B 5CLTA 1IGJB 1WBYB 5C0ND 1KYOJ 1MI5B 2HFEB 1WGOA 1I1AD 5AUMB 3RWFA 3VXRD 4XMKH 3MODH 5DJ6B 3SOBH 3FTGB 3TM6A 3HA0A 4LPUA 3C60D 1EBPA 5BZDA 2RGSA 5IEHB 2X6MA 3ALXA 4B53A 2RAMA 3FO9A 5IVXA 2FBJH 4FZEH 4P59L 4XXCA 3WFEH 3V5HB 3LQZA 1DVFA 5HPMA 2W92A 1KBGH 5EUOA 1R5VB 3UJJL 2G9HA 5GZNC 1G7LA 3GUTB 1M7IB 5IB3B 1JF1A 2H8PA 2VN4A 1QFPA 3RZCA 1INEH 4LCCA 4F80A 2ZKHL 3QQ3B 4KWUA 1SYVB 2XA8L 5E70A 1D6VH 4J1UB 5FO8B 4FQHA 2XTJD 2EIEA 4P2OC 1A7RH 3O8XD 2X2YA 1P4IL 1Z2KA 2BSRB 1FNFA 3EJJX 5CP3A 3BHBB 4E41E 2A83A 2BVTA 3SGJA 2F19L 3FCTA 4RA3A 4K94C 3UJTL 3RWEA 1G0XA 4ODTL 4BZ1H 3PHQA 3D85A 5CIPB 4OF0A 2R4RL 3Q6FA 3I2CL 5GRZA 4KRMB 3TC9A 4R96B 1F2XK 5DD6B 3O6FD 4OZHE 3C5JB 2A0LD 3LDBC 4TSAL 1ZK9A 3PQYE 4RGNC 1ND0A 4YXKL 4YPGA 1A6TA 5HDOA 4GS7B 1VEMA 4JHAL 1CGSH 1OGAE 3KYKL 4HKZB 5E99L 2V6HA 4L8BA 1MCQA 5GRVK 5DMYA 4PB9H 3NGBC 5DWUL 3CDCA 1KOAA 1KPRB 5HHME 1VGEL 5ANMA 2BNQB 3BMVA 4OZHF 1UA6H 4YHYC 3P4LA 3F7PC 4PV8A 2ARJQ 3CVHH 4S0TD 3GHBL 5IIEB 3QQ4A 2Q8BL 1YPZE 2R29L 4HGKC 4MMXC 1H3TA 1MFBH 1XF4B 4EN3D 3RDTD 2B2XL 4X4ME 3DETC 2Q20A 3S34H 3WL9A 4L1HA 4P57A 4YHOH 5EFIA 3X13B 2DTMH 1IC5L 4PJXA 1U3HD 4J6RL 1N0LA 4YXLH 3GJFK 2J12B 1S7QB 1OTUC 5DJ0A 5EC2B 3QZWA 3ARDC 4XAWL 2BY0A 2A73B 4Q0XL 1YEKH 4KJQD 3P30L 1WZKA 5FDWB 5LXGL 1A6VL 2YPKB 3BEVA 3P0YL 2Q7YA 1Y18A 3QHZH 4X5WB 4M43H 4YDJB 5D93B 1N5AA 3TV3H 3QQNA 2EXWD 4LFHD 2NY5L 1A1OB 3H42H 3GNML 2OJZH 2R0WH 4JG0L 4APQD 2VWEE 1IGCH 3T1WA 1DUZA 4F37K 4PJ8A 1C8PA 3KPRD 3S37L 1I8LA 1UQSA 1Z3GL 2PO6A 1FC2D 3SCMD 2XQBL 4IMLA 3EO0B 3GSRB 3HE7B 4WHTB 5BOPA 5KN5A 2NYYC 2H3NB 5E8OB 1T03H 4PLKC 4HWZA 2VXUL 3ARQA 1PDKA 3X3FL 3VXTA 4H1LB 3BSZL 2F58L 3DVNA 3M45A 4C4KT 5I1CL 3PABA 4JREC 5IKCB 4YGVB 1MJUL 2Q8AL 2IQAB 3C6LD 1RZ8A 3OKDB 1C5BH 2ICWB 3WXVL 3FQXA 4LAJH 3HCVB 3LN5B 4WEUD 3I6LE 3HB3C 5K59F 1PEZA 5HDQH 4KFZC 2ERJC 5IBLD 1L0XA 2A9NL 3CVHA 4HC1A 1EZVX 5MEPB 1INQA 4XCEB 4GRMB 2I60L 4YH6A 3OKOB 2IPTH 3HTLX 1N6QL 1TJHL 3O6MH 5ESQB 2BY1A 4TQEH 2XRAL 1I3RB 3IFPB 2IALA 3HZKB 2GSIA 4Y16D 3G6JB 5J9PB 4CMMB 4RISH 4OLVL 3GIZL 2JCCF 3SKMA 1PAMA 4O2FA 1J0KA 1KN2L 4HH9B 3LQAC 1NH6A 3CXHK 3P77B 3W39B 1IQWL 4GW1B 3T8XA 1W0WA 1IAIH 3MCKA 3OKMB 1QNZL 3EZ8A 1U8OB 1PD6A 2ITDA 3LN4A 5HYFA 4I0PC 3EYVA 1F3JB 3BUTA 4JN1L 2R2HA 2FEDD 1DQML 3CFDB 3VFWB 4MD4B 4UQ2B 2BNRA 4EJ1C 5E4IA 1N59B 2AABH 4PJCB 4U49A 1CL7I 2YA2A 5E8PA 2YRPA 1X5HA 3AFLA 3LIZH 3HMXH 1HXMA 5EU6B 4U1IB 2WV3A 43C9A 1GC1H 2R1YA 4MD5B 1P9MA 3KYMA 3V6OE 2GUOA 3QEUB 4RX4A 2ZUXA 1RUPH 1MF2L 3HNVH 1V05A 4ZXBB 1QBAA 1AKJA 3BDYH 5FFLA 3QB7C 4NN6C 1WCBB 4P0DA 3HC4L 3TBSB 3I3BA 5GGRY 5I1KL 4LKCA 2W0LA 2E9JA 1MHPH 4QRUB 3EDFA 3JV4A 4Z7OE 4CRPA 5ITBL 4KJPD 3TH2T 4N0FA 1XGRB 3GKZA 1HIMH 1J8KA 1CFNB 3AUVA 1EJOL 3CFIC 3KHQA 1NSNH 3BVNB 4U1SA 5I75B 2GQHA 2KQMA 5KVGH 4K7FB 3G08A 3GKWL 2ATPB 5MI0B 1QBMH 4JFDB 1UM5H 3U82B 4Z7OF 4YDKL 2FHFA 2SEBB 5D1QB 1XH3B 4XCNB 1RAMA 4XP6H 1RUAL 5BMFH 1QUNA 4PJ9B 1DLFH 2WWMC 3MMEB 5D7LD 4QHNA 4D9RD 1TZIB 5FYKE 3FO1B 2QV2A 3RBGA 3DHMA 4CVZA 1UZ8A 1X6NA 4XXCC 5A1AA 1AFVL 1DVFC 3AXLB 2IGFH 1IM9A 3IAQA 4I0CC 2MHAA 2ZOKA 3QHFH 4YR6A 1MCWM 4GH7B 3RZCC 1I8MB 4LCCC 2RBLA 4AT6B 4OZFG 1YEIH 3PHSA 4AMKH 1AY1L 4O9HL 4HHAA 2DLFL 1D6EB 5IBUG 5H35A 1RJYA 4X6CB 3SGJC 4NSKB 4UNVA 2GTZB 3GSWA 4JFXA 3E6FB 3MGAA 4EI6A 5MENB 2NY3D 1S7SA 4IRSA 4FFVD 1T5WA 2WIIA 1KCVL 5L6YH 3GI9L 4LCWA 3CAFA 4HUXB 3IJHB 1QKZH 3HE6D 3SBWA 2XKNB 3HMXA 1U8LA 4WWID 1W8OA 1RSFA 4KKCD 4M6NL 3O11B 4KQ4H 1WISA 5A2IH 4LLVA 5DJ2B 1CFVH 4GW5A 2VYRE 3REVA 1EO8H 4ONFL 5GS3A 2QLVB 1ZT1B 1MFDL 1J1XL 1RZGA 1QHPA 1E4KA 4BQ6A 4XNUH 5I1JH 1Q72H 2R1XA 1JPFA 2FBOJ 3IVKB 4JO3L 2MQ0A 2FEEI 3S3PA 4HDIA 8CGTA 2YUZA 5J13B 1FV1B 2CRMA 1KIPA 2YK1H 1JFQL 1R3IH 3DIFA 3HG1D 2GY5A 3QDGD 2V2WB 7FABL 5EU4A 5F96L 5CEZE 4GO6B 3G6DL 3S37X 4ZFFB 2V9RA 2R1WB 4JPIB 5IGXL 4MZ2A 3H3BC 5H2BA 5AZ2H 2FNBA 4KK8C 4J3UA 4OCLC 4PGBA 1WEJL 4JRYE 3RWHB 1BFOA 5LGHH 5E6YA 3KYNB 4XNZC 3BH8B 1NBYB 5A3IC 5EBMB 1ETZB 4Z7NE 5HJ3B 1E28B 3HRPA 3SQOL 4ZOEA 1G7PA 2W0FB 5I2IB 3F12B 1CDIA 3MV9E 1DFBL 4FQ2L 3VXUB 4XBGA 4DKAA 4S1DC 5D7KD 1ZS8B 2VLLA 3QIUB 3QFDA 1GZQB 4PJ8C 1RUML 5FYJE 3V0VA 2HKFL 2HYMA 1PZUB 2PO6C 4Z7NF 4CVXA 2I9TB 5I1HL 4ENEC 1LGVA 2Y1VA 4KHTL 1FBIL 4RA0C 3QNZA 5DYOA 4NQEE 5D1XB 2KBGA 1S7XA 1DBAL 2PW1A 3THML 4DKFL 5D2LE 4LEXH 2UUDK 1S9YB 4HK3J 4OF6A 5AYUL 4NQUA 3CFCL 4BKLB 3D3VA 1B4JL 5HYEA 4CN4A 1XF2B 1A3LH 1Q9OB 4RWYH 4YK4B 4OZ4B 4H8WL 3T4YA 3RX7A 5L2JB 1KCSL 4WUKL 2APFA 3L3OB 2HN7A 2EDJA 5JPMB 3IDIB 1JNHB 5D2LF 4NJAL 3I84A 4KKLD 2YD8A 2C3XA 1TZHB 1KG0B 4BZ2H 4KJYB 2EDDA 4ODHL 1FVEA 2Y23A 4MCZB 3U7YH 3BJLA 4XPFH 3IKCA 4K2UH 4F3FB 3P4OB 4JFED 3ARBD 1CCZA 4H0GA 5TF1H 2RFXA 1NDGA 3QFJE 1YEJL 1ZVHA 3QCTH 1HHHB 4ZPVA 2HKHL 5TPWL 1G7IB 4UOJA 4Z7VB 5HI4D 2QR0A 3IDXH 2PN5A 5C0FA 4XI5C 3ARRA 4P9ML 4N0YH 2UVFA 4RMWA 3MV7D 3MLSH 4LEOA 4GRWE 5DS8B 3QDMB 3WSQH 4U1LB 4L4VD 1V7NL 2X4UA 1R24B 3NA9L 3VWKA 4YDLB 3HFMH 2A6IA 2FIRT 3QUYD 4UILL 2CLRA 1RFDL 4AIOA 4PV9B 3AB0C 5EO0A 1J86A 4FABH 1I9EA 5HYJA 4EIGB 4NNYB 1TVHB 5DK3A 4V1DB 2CGRL 2CIKA 4FZ8H 3BD3A 3N1GC 4PJGA 1FNAA 1U41A 2Y6SD 2H1PL 4U33A 4P49A 5JOPD 4KI5F 2ITCB 5D1ZA 3KPOB 1XF1A 4HS6B 4KPHH 1RIVH 4YE4H 4U1KB 5GRUH 1P9MC 2H2SD 3SDCA 2B1HH 2J6EL 4N0UB 4Y1AA 4ZOBA 5EBLA 5C09B 3DX7A 1UH2A 3K7UA 5FYLE 3TZVD 4GQ9L 3DNKA 4YUEL 1TXKA 3GMRB 2RJMA 3VW3H 2NW3B 1RI8A 4KAQL 1J9CT 1FH5L 4J7RA 1AQDB 3MJ8A 3IS0X 3RNQA 5E2WH 4X6EB 1XEDA 2J3SA 1OCWL 4HKJB 1Z6JT 2FL5A 1CDBA 4D94A 4G6FD 1QO3A 4DQOH 4OLEA 4HUWB 1ACYL 5GS0L 1KTLA 4H0HB 4UMGA 5ACMA 2ZPKH 4M03A 1T7ZA 3REWA 1WIPA 2VC2L 4G6JH 3DXAE 4JFPB 3J8F7 2X41A 4G3YH 1KCUL 4KZDL 1EAPA 4ZO9A 5IMKA 4D0DA 1WZMA 4EVNA 3GMQA 3TCLA 4CAGA 2N7BA 2E7MA 4Q2ZB 4LIQL 2VXTH 4OFVA 4IJ3C 3BPOC 3M8OL 1AO7E 4G8FA 3VG0H 1YMMD 4M7KL 3BDXA 5E00B 1W2KT 1MQKH 5F9AC 3HC3L 4GRLC 4PRPD 4YHKL 2EDRA 5FOJA 2EXYD 4CMHB 1JN6B 1QFWH 4MAYA 5IB2A 2P24A 3U0TB 2V5RA 1C5CL 4NO3B 1QSEB 3D2UB 2JTDA 5GGSA 1I9RL 1RUQH 1T0PB 5JHDD 1QEWA 1E4XH 5HHQA 3G9VA 1T20A 4S1RL 1E4WH 4PJFA 2HFTA 4IRSC 3VXME 3TT1H 1G7MA 3WS6C 1UKSA 3FQWB 3SBWC 1LO5A 1QFHA 4MX7B 4PRIA 1NUDA 1ZLVK 4B5EA 2A6JB 2LABA 4WI5A 3L5HA 3UTTB 2YD2A 3N9GL 4KROB 1GC1C 1AGBA 1BP3B 3FB8B 3QIWD 5DGQA 5C2BL 3MA9L 3BKJL 4GBXD 1AQKL 2DBLH 4I3GA 4HS8H 1EUUA 2VISB 3EYSH 1KEGL 3MV8A 4HPYH 5LWYL 2Q86B 3VJ6B 1E4KC 5AAWA 2QQNL 3RX8A 2WWKO 4C54A 4XH2B 3FQUA 3CX5K 5FKAB 1BF2A 1HOCB 2F5BL 3GB7B 1O5DT 4JPWL 5JIHA 2JB6B 4EQ3A 1HE7A 3HAEG 3ZKXB 4H5SA 4W6YB 4BSVA 4U2ZA 2RHEA 4F7CB 4LHQB 3C09B 3EYFB 5EUKB 5ID0B 4M48H 1BFTA 1IGIH 1N5YH 4LQFH 4HK3N 3MBEA 3UTQB 1HH6B 3I85A 3MRPA 4P2QE 4LBEB 2HJLA 1K4DB 3WXWL 2YKLL 2J88L 4QTHB 1OPGL 1VKXB 3BO8B 2UYLB 5F7YC 1R3LB 3NACL 4JPVL 5DK0A 5GRWA 5EG6C 4CGTA 4HAGA 3RFZC 4GKSA 1MEXH 5GGQL 4OCRH 5JORA 5E5UB 4Q6IB 4R3SB 1HHKB 3ARTA 1CD9B 1KPVB 1RMFH 3FRPG 4PREA 4PUBH 3SO5A 4N68A 1LP9E 3L7FA 2H45A 1NAKL 2OP4H 5F9DC 2AK1L 3MLVL 2FZ3B 2IAMD 5TQ0L 1R3HA 4JKPH 4U6HB 1G9NH 3KVQA 5I1AB 3PGFL 1VA9A 5ICXA 3ALWA 1NEZB 2ADIA 2G2RA 4JG1H 1EMTL 1MUJA 5DRNB 1LP9F 1GL4B 3MRFA 2BK8A 1MJ7H 3VFOB 3NFNB 5HGGS 4UDUB 3QXAB 1OSPH 2DM3A 3TVMA 3CC5A 1B0GA 4XRCA 5CEYA 1KEML 5EOCL 1MFAH 4YO0A 3SKOB 3QJFA 1EUTA 4X9IA 2PYFA 3TIDA 3OXRA 3PL6A 2AXGA 5DUBA 3WN5A 1U8JB 3ECBB 4PJEB 3L3DB 4ELKA 5GS1A 4OKVA 1OM3L 1CF8L 5E1HB 3QA3B 1A6WL 5C07A 2PF6A 1I9JL 2XG4A 5DI8A 3OKLB 4WW2A 4P5TB 1XGUA 1QR1A 1DUYA 3ZTNL 4X0KB 4NCC1 4Z7WE 2VLJA 2PR4L 3X12B 3WUZA 3QG7L 4MXWL 5CINH 4JFZL 3U9UA 1URLA 5GS2H 4OLWL 4NCC2 4WEBL 4NM8L 1JMZA 3GMLA 3U30C 1OGTA 1T1YB 4W4NA 3IDNA 3F6IA 3JTTB 4HAFA 1UXSB 1S5IL 3OGOE 2DL9A 3ZLQC 4Z7WF 2VJXA 4QHLA 5FK9B 5JW5B 1EV2E 3ULUL 3OKNA 4DZ8A 3TA3B 5D8JL 3IJYB 1FAIH 1YYMH 4XHJC 2AEQL 5K33A 3LD8B 3MOQA 1K6QL 1M71A 4XPAH 4O58H 3SDDB 3WJJA 3DSNA 4UINL 1BJMA 2YBRB 1JCKA 4LASH 2P5WB 5C6TL 4FFZL 4DGIL 2H41A 3S5LG 4RGOH 3VI3F 1VFBA 1FPTH 4S0SD 5I30L 2ESVB 3ZYOA 4JCLA 1UWEL 5D6DC 3VA2C 4NQDA 4OCSL 4NFDA 5D1ZC 3SJVD 1GAFH 2AK4E 4PTTA 4B7IA 1FZKA 3MO1B 2V7HA 2A9MH 1AD0A 3MJ9H 3TNNA 3L3HB 3HI6L 3IU3A 3O2DA 3IGAA 4QF1B 5DD0H 1KJVB 4MDIA 3O4LE 5ISZD 3PWPA 1KJ2H 4BFEA 3UAJD 2IFFL 3QEQB 4JFFE 3ARPA 4X98A 3PE9A 1JPST 4YBHA 5D2NA 4JPKL 4FTVB 3QXUA 3QO0B 3LAFA 1UH3A 4CW1A 2W9DL 3EO9H 5T3ZE 2XXMB 3OB0H 4P2OB 3MRRB 2NY6D 4F2MA 4MD0A 5FKPB 2NY7H 3CFEB 5LGKA 1CLYL 1U8NA 1ZT4B 3T2NL 5I6XC 3HI1B 3I6KB 4HUVA 1ZEAL 3FQRB 2O61A 3LDBB 1X44A 3KJ6H 4RGNB 1EVTC 4DTGL 5IW6B 3UO1H 3PJSB 1IZJA 4K3EL 2AV7A 1CICA 4PRHE 4OI9A 5GGRB 1I1YA 2D4FA 5J6HB 3NGBB 4F8TA 1WSST 1CZ8L 5DK2A 5F93C 5HD8D 2VZOA 1RU9H 3CDGB 1RK0B 1ZA6B 5GRJL 5CD5C 5GS0D 5LQBH 2J8UB 2MTPA 2R15A 4IOFC 4MCYB 4YHYB 4HULB 4FFYL 2BRRH 1GSMA 3WIFA 1WT5C 1PY9A 2JLLA 4Q9BA 1NCWH 4XP4L 3T04D 1F02I 4QXUL 4H20L 1ONQA 4ODUB 4NNPL 4XPGL 1QLFA 4XXDA 2YPLD 3GSVA 3G5YB 1UACL 4PJ7F 2NY2C 5I1EH 1UCBL 3MRIA 1FZMB 4A2LA 1BD2D 3WS3B 4ZO6A 35C8H 1H8OA 1NDMA 3QHTC 3ARDB 2NX5A 1UFUA 3MRLA 1G7HA 2CKBA 1UWGH 3D18B 3RWGA 5FXCH 3MJ9A 4OGAD 1H5BA 3HNSH 4WUUD 1B90A 5HY9A 4OTXH 3KGRA 1CLZH 4MA1C 3MX0A 1H3VA 2A77L 5FGCB 1TPXC 2DQIH 3T09A 4I5BA 4NRYB 4LDEB 2HJKA 4AQOA 3UZEA 1UJ3A 1FAKT 4QOKD 4YHPA 5MERB 4JN2B 1Q94A 1MRCH 1YN6B 3BP5A 1JRHH 4HGMA 1I8KA 3N50A 3ZHDA 3EKCA 4HIHA 3UTSD 4G6MH 4X6DA 5BRZE 1EEZB 1UM4H 2VOTA 1OAZH 2EDOA 4QRPA 3UTPD 1OLZA 3J7HA 4NQCA 2MQCA 4MXQD 5JUEH 2WM0A 4WTZA 5FUZL 3MBEC 1UZ6E 2W59A 3AS2A 3I75A 3WFCH 1QBBA 1T7YA 4OCYH 5F6HJ 5DJ8A 5E1AA 2AQ2A 4QYOA 3ZE2F 2KPNA 1T2XA 4MWFA 5CS7A 4A6YB 4FQIL 5C08A 1TVBA 3OPZH 5MEQA 5T3XL 2GJJA 3VFNB 4O02H 3OKEB 2EKSB 3BX7C 4OZHA 3Q0HA 1SJHA 3N85L 4LVEA 3D39A 1RJCA 4JREB 1UZ6F 1OGAA 3C5ZA 1K2DB 4ZAKA 1EEYA 4LSPH 5I15L 3T2PA 4J3XA 4P23D 1ZHNA 5DHYA 4CDHA 3KXFD 2ERJB 2P49B 4N8VA 4KTEL 5DMIL 3N1MC 1HK6A 1IL1B 3LEXB 4ZSOA 1B2WL 5FAAA 4HQQH 5L2KA 3E6HB 4XMKL 3MODL 3RHWK 3SOBL 5EA0H 3KLHC 4PIRF 1BOGB 3VFTA 1A02N 4JRXA 5E4EC 1S9VB 3TVMC 2BFVH 1BZ7B 3IFLH 4LCYB 3TGXA 4DGVL 4XVUC 2FGZA 3C5SB 5F7EH 4RFEA 2FBJL 2X1XR 4FZEL 4MAUH 3WFEL 3PL6C 3V7AE 5CGYC 3WN5C 2IANE 4FS0A 1KBGL 1YPZB 1U8IA 4LLMB 4LGRB 2EDLA 2MKLC 2AXFB 4UU9B 4OLUH 2NMSA 1INEL 4I0PB 1RZIB 2XKUA 4XVTH 1PKOA 2DYPA 4N9GB 3RP1A 1A7RL 3RRQA 4WW2C 5ALCH 4FQLH 4WFHE 3ET9F 1REIA 1CDUA 2VZSA 4ZFZA 2DQDL 4JJHA 4BZ1L 5IMMA 1I7UA 4XMPL 1J0JA 2O5ZH 2Z4QB 3NABL 5FM4A 4R4BA 3QXTA 2NY1D 3F62A 1T6WA 4TVPH 5DURD 1RULH 4NN6B 1VADA 1JIBA 1CGSL 3DRTB 5T1KA 3BESR 3P0VH 3MRQB 2V9QA 3DJ9A 4PB9L 4ZUVB 4OAWA 3OR7A 2V5SA 4TPRH 2IJ0C 2ARWA 4PYGA 1IAIM 3NFSH 2F53A 1UA6L 4H25B 4G5ZH 5GJSL 3TBVB 2C3VB 5GGSY 1JF6A 3CVHL 3WJJC 2AJ3B 2FJFA 3E3QC 3O6KH 1ZHKA 4LCUA 1G9NC 3SN6N 4POZD 1PBYA 3RWFB 5TFSL 5C0GA 4S10A 1YDPA 4ORZC 1FG2A 4C56D 2WUCH 3S34L 2JCCA 3V7MA 4YHOL 1FNHA 2DTML 1WAAA 4KXZH 2ZSWA 4YXLL 3GK8H 4LAQH 2NCMA 2J2ZA 1YEKL 2DLIA 3ULUD 4JANA 5IVXB 4P99A 2FLRT 3LQZB 1S7RA 1DVFB 5H8DA 5HPMB 5D2NC 5KAQG 1LEIA 3FHQA 5EUOB 3OG4B 2Z31C 1G7LB 3QHZL 4M43L 3TV3L 1JF1B 2D31A 2H8PB 4FMFA 3MLXL 3ES6A 3RZCB 4LCCB 4J4PA 3H42L 5TE7H 1HQRA 2UUDH 1Q1JH 2OJZL 1HI6A 5MP6H 5ACZA 3NFPA 5DHVH 4F9PA 3IFOA 2BZDA 4NFBA 2GK0A 3VXSD 2A83B 4G6AC 4JZOA 4JE4B 3T0EE 3RWEB 3UROR 2ZG2A 3BISA 3PHQB 4BFIA 3I3DA 3D85B 5IHLB 3PP3K 3MRKA 1S7WA 4MJID 1Z5LA 1T3FA 3EYUL 3Q6FB 4E0RB 4MNGA 4KV5E 4WTWA 4M7LT 4BSWB 2I07A 3QYCA 1T03L 2M8XA 3B43A 1ND0B 4YPGB 1A6TB 3FAWA 1JTPA 4X4XA 4NKQB 1CICC 4L4TE 4L8BB 5ETUB 1FYTE 1XF3A 3CDYA 5FHBL 5SWZD 4MNQD 5ANMB 4MQTB 1C5BL 3CVIH 4KV5F 3EOYG 3N06B 4EDWH 4PV8B 2UWEA 2Q87A 3QQ4B 2PYEE 5C3TA 4L8SA 4L8CA 3ARFA 1EHNA 3BXNA 2IPTL 3WL9B 2XTLA 4YJZL 1NC4A 3O6ML 4P57B 4ZOCA 3O0RH 1D9KD 3MOBH 4P2RD 4I13B 1J18A 4HBCH 5DJ0B 2AAVA 3QZWB 3GO1H 1MAMH 3PWLA 4TQEL 3TBWA 4Y4FD 4OUOA 3QUKA 4XMLH 1BQHG 4HEPG 4RISL 4UT6L 5E0QA 4LF3A 4U3CA 4YHLH 1JZ8A 4X5XA 3WFHA 2XOTA 5I8EA 4PBVC 4XNZB 2Q7YB 5I76A 3W0WE 1UJ3C 1N5AB 2V17H 1IAIL 4PJDA 1NL0H 3T2OA 1SBSH 2PW2A 2XWBB 2YD6A 5DR5H 1XCQA 5E9DD 2QBWA 3TO2A 1J8HE 4PGEA 4PJ8B 5I17A 4AIXA 5DHVA 2AABL 2PO6B 4OD2A 2IH3A 5C86A 5DEGA 4IMLB 5FYJH 1CFTA 2OSLB 5HXMA 3LIZL 3QNXA 3HMXL 2ORBH 3TESA 4HWZB 3V4PH 3VXTB 1RUPL 2IPKA 3BDYL 3BN9C 3TBTA 2NW2B 1AR2A 3QSKB 1MWAB 3NCMA 1MHPL 1T1WA 1RZ8B 3QDHA 3QQ9C 3C5ZC 1KN4H 2UVEA 4ZAKC 2R69H 3FQXB 2DN7A 3QNYA 2GJ6E 2EYRB 2GJZA 3LSOA 2I25N 4BH8A 5E6IA 1NSNL 5HHOE 1BIHA 2HJFB 2O5YH 4Y89A 5KVGL 1INQB 2X10A 1GRWA 4TRPH 5HGHA 2P5EA 1QBML 1CE1H 3K1DA 3W9DA 4F15C 4Y5YA 4H88H 1YEHH 5T3XD 4XP6L 5F72S 5BMFL 1BGXH 1QRNE 1IC4H 1A7PL 2IALB 2GSIB 3H9SD 1K3IA 5HVHC 3SKMB 3B2VH 4O2FB 4ZYKA 4EQ2A 5IHBA 2X4NA 1XT5A 3RKPA 1FFNA 4LLUA 1A8JH 2IBZY 3T8XB 4QGTA 4M7JH 2IGFL 3QHFL 3V8OA 3LV3B 4FXKA 5MHSE 4M9PA 3ZKMD 2ITDB 3LN4B 2BOCA 4GAYA 3EYVB 2I5YH 5HI5C 1EHLH 4AMKL 4NGHH 1G1YA 2VRAA 2R2HB 3EHBC 1ZVSA 3OTTA 2HFGL 1Z9LA 2BNRB 4KMTH 2BJMH 3AB0B 3U1SH 2X09A 4WTXA 5CJOH 2MFNA 5E8PB 1NGQH 1BIIA 1CFSB 1HXMB 1EXUA 2OR9H 3KPSB 5L6YL 2DMBA 1UADC 2XZAL 43C9B 4G8GE 1QKZL 2R1YB 3KYMB 5I1DA 2GUOB 3S36X 1AKJB 3LN9A 1A6UH 4ODWA 5E94B 1BBDH 5D2LA 3RGVA 3SDYH 5FYLH 4LKCB 4FNLH 1OTTD 4KQ4L 3QWOA 4HGWA 3FONA 1CFVL 3JV4B 1EO8L 3TN0A 4KK6C 4N0FB 1MELA 4ELME 1MY5A 1G9ML 3LRHA 3O3EA 5I1JL 1Q72L 4U1SB 1P5UA 2NY4C 3WO3B 1Q0XH 1CIUA 1NAMH 4P9HC 3G08B 5DRZA 2YK1L 1R3IL 2EDQA 2X4QA 4ELMF 4IIQA 1CDJA 3I3EA 4FQXC 4Z5RA 5GZOD 1JYXA 4NYLA 4QHNB 3W11C 3IAPA 5HDBE 4WWKC 5AZ2L 2VDPH 4Q9CA 2E27H 4QHMB 5J6GA 4CVZB 4UAOC 5J4MA 4IJ3B 3BPOB 4DZBA 3ALPA 3HC0A 3BIAX 4IHOA 5LGHL 2ED7A 4GRLB 2CMRL 1IM9B 1KC5L 2MHAB 2ZOKB 4YR6B 3MNZA 2VZ1A 1H3GA 2N56A 1FL3B 4WFFE 4LMQE 4JVPA 5HDBF 1BBJA 5C2UB 3F65A 4F9PC 1SVZA 3GM8A 1RJYB 5H35B 3SPVB 4JFXB 3LKSA 4KH2A 4EI6B 1P7QD 3T0XA 1S7SB 4IRSB 2GSGA 4OI7A 1T5WB 2FH8A 2WIIB 2E9BA 4LCWB 4HMEA 4HG4K 4PP2A 4KJWD 4ZNEE 1U8LB 1WZ1H 2DICA 4L3AA 4LEXL 2W65A 1NCCH 3MRDB 2D0FA 3LH2H 5HVWA 2CDEA 3BYYA 4LLVB 1A3LL 4GW5B 5J0BA 4RWYL 4UUJB 3DUUB 1ITBB 1U95A 4PB0H 5F9WC 2R1XB 1JPFB 1EH9A 1QFWM 4N1CA 4HDIB 3MSPA 1F4HA 4NO0D 4MSWA 4Z8FH 1NBVH 1KIPB 4L8SC 3LZFH 3ARFC 3DIFB 1OP5K 3U7YL 1NAMA 2EDHA 5EU4B 4XPFL 3GBMH 1A7OH 1KB9K 2P47B 1BZ9A 4K2UL 1I1RA 2W9EH 4WCYH 1V3MA 1SJXA 5TF1L 3QXDA 2EIZA 1FE8L 3BQUD 2F5AH 3QCTL 3QDJD 3VXRA 5H2BB 1RVFH 5HHPA 2R2BB 3DOSA 4PGBB 4D8PB 1BFOB 3VG9C 3IDXL 3C60A 3RVTD 4YQXH 1G7PB 2ZUQC 4N0YL 3S88H 3MLSL 4P3WA 4B50A 5J7CC 1HKFA 4G9FD 3WSQL 4P48A 1SEQL 3HFML 2NLJA 3RY4A 3I6GA 3QFDB 3Q48A 4IRZL 5EZLA 5KZCB 5IF0A 3V0VB 1MIMH 3IXAB 4FOMA 3FMGH 4FABL 4JM4H 3ARGD 1E0OB 3QUZD 3BMWA 2YUWA 5C0JA 3O8XA 4FZ8L 3QNZB 5DYOB 2DM7A 1AXTH 2PW1B 1NGXA 2P4AB 4KPHL 3O3AA 4YE4L 4DW2H 5GRUL 1A9EA 2B1HL 5IG7A 1R5WA 2IG2H 4ORGA 1KGCE 3DVIA 4HX1A 3O6FA 1KTDA 1S7UB 1BLNB 2X1QA 4QO1A 3VW3L 5FOBB 3G9AB 3SKJH 3T4YB 1OSZB 5E2WL 4UOW0 4WRLA 1JHTA 1EFXB 1F45A 1TCMA 4WFEE 1IFHH 1A3QA 5E6IC 2ZNWA 2EIBA 4DQOL 2JB5L 2EDYA 5A40E 4PJHF 1FVEB 1V5JA 3RJQB 1MH5A 4PPTA 3IKCB 3HNTH 1TQBC 1UC6A 1KLFA 4S1QH 3MOAH 4Y5YC 1OP3K 2YUVA 4S2SA 2RFXB 4G6JL 4EN3A 1NDGB 3RDTA 2DMKA 4XPHL 4G3YL 2YWYA 4LSQH 2X4RA 4ZPVB 4XTRD 5DVOA 3U30B 2E7LA 3PP4H 2OBGA 2CIIA 2QR0B 2VXTL 2FIKA 5GHWH 1AI1H 5FUCE 3VG0L 5MEOB 4KC3B 4DKEH 5C0AE 3SDXE 4KRLB 4LEOB 4L3EE 2X4UB 1QFWL 1W0VB 3HLAA 2A6IB 5F71A 4P5MA 4X7TB 1X5AA 2CLRB 3EO1A 5EZJA 1RUQL 4HZLA 1GGIL 5EO0B 1E4XL 4N5UA 4OD1H 5HYJB 3PGDA 4KI1A 1QSFE 4QRRD 5B8CA 1E4WL 2CIKB 4APQA 2GI7A 2FO4A 5HI3D 1X6LA 3LRSA 4JQVA 4PJGB 4MXVE 4X6BA 1TFHA 3TT1L 2XN9B 3KPRA 5D1ZB 1ZLUH 4I3RH 3SCMA 2V5MA 2RB8A 4OM1H 4Y1AB 4K3GA 3WIHH 4NC2B 5GJTH 1AXSA 1YY9D 4OZFA 3RGVC 1UGNA 2I26N 2YRLA 2DBLL 1XGQB 3OHXB 4HS8L 1NCNA 1CD8A 3EYSL 2OXGA 3RNQB 3TN0C 1HSAB 3KJ4C 3IDGA 4UTAH 3VFGH 3WD5H 4TNWK 1QO3B 3C6LA 2FDBP 3QDAA 5SWSD 4KRPD 5D5ME 2NNAA 1KLGA 4IM8A 3PWUA 1KTLB 3P4MA 2YS4A 3VFSA 4P46D 4XB8A 4Q97A 3RWCA 2Z91A 3REWB 1UJTA 3I50H 4KGLA 5IVNA 1Y0LB 1WJ3A 3OAYK 2VL4A 4MB4A 4M48L 3WNPA 3WMSA 1IGIL 3D3VD 4IIQC 5I6XB 1N5YL 4LQFL 4X4ZA 3MLWH 5ACLA 4JY6A 1IARB 5E8DH 3RVUD 5JXAH 2FSEA 1EAPB 3ULVE 4LGSB 3ZYZA 4D0DB 1G84A 1KLUB 4EVNB 3RVXC 3LKRA 3TCLB 3QPQD 5D5MF 1M6OA 5HHNA 4Y19D 4O51A 4PJBE 5HGBA 4PJ5E 1MEXL 4G8FB 4WU5A 3MV11 4Y16A 4PTUA 4CBPA 4U7SA 3QR2A 5IFJA 1ERNA 4UV7H 4WV1A 1RMFL 4N0RA 5IB2B 3ULVF 3AS0A 5DQ9A 2IH1B 2OP4L 1OHQA 5GGSB 1B4RA 4JKPL 4AH2A 4UV4H 5IBTH 1QEWB 4IS6A 2K9UA 4KI5C 5FA3A 1IKFH 5HHQB 3RKDC 1T20B 2NY2B 1II4E 4PJFB 3QI9D 2VLRD 4M1CC 1PY4A 4JG1L 1G7MB 5FV1L 1MJ7L 1KNOA 4PRIB 1OSPL 3V79C 2VXSH 1AGBB 3W81A 5CMAA 3KNBB 4ZFOL 4PGJA 1NUGA 3VWKD 3WIHA 5J3HC 1DE4A 1MFAL 3ZDYE 2LTQC 5J1AA 4MA1B 1TPXB 4WI8A 3MV8B 1LO4H 5DFVC 1YQVH 3MUZ1 4D3CH 1FSKC 1X5ZA 5DLMH 5JIKA 5AWNH 5TGBA 3WNNA 3FQUB 1A7NH 4NQVB 4OIIH 5LGJA 4WFGD 2X40A 2OM5A 4JLRA 3UJTH 1JHLL 2VDOL 4H5SB 4MJ4A 3ZDYF 3PV6A 5LG1A 4BSVB 3FO0L 1C08A 3JSSA 5E8EA 3SDCD 2X42A 5GRVL 3ROLA 5KVDH 3VFRA 2R4RH 1J0ZA 1MI5E 5C0NC 3MBEB 2DQHH 4Z0BH 3MRPB 1I1AC 2HJLB 5CINL 1LVEA 4P2CG 3FKUS 5EO1B 1NJ9A 1TMCB 5DK0B 3JWNC 4MA3A 2FR4A 5CGMA 1CD0A 3NCFB 4ZUUA 5JORB 3C60C 4JFOA 2WK2A 1UT9A 4PREB 3VFPA 1A2YA 5KW9H 5JPNA 4D2NA 5KVEH 3L7FB 3GHBH 4PJ7A 1OW0C 1FAIL 1YYML 1R3HB 4AM0A 2B1AH 1A5FH 3QBTB 4XPAL 2WAHA 1WWAX 3OXSB 4O58L 3F7RA 4LASL 4N8CL 1X5IA 2N1KA 4RGOL 1IC5H 2BC4A 4EBQL 2X9WA 2XTJC 1FPTL 3O8XC 1MUJB 3DV6A 2F54D 3MRFB 4NN7C 3HN3A 4U1JA 4X6FA 2W1NA 1P7KB 4JDZA 1GAFL 4K7PX 1MREH 2JELH 5E4EB 2A9ML 1KFAH 3TVMB 3CC5B 2B5IC 3MJ9L 1B0GB 2VXQH 4OV6F 4XRCB 1IC1A 4JM2D 2GCYA 4MAYD 3LOWA 3HE6A 4KQ3H 3QJFB 5DD0L 3SE3A 3KPPA 3O6FC 5ELIA 1KJ2L 1JJUA 2A0LC 2PYFB 4WHCA 4WDIA 3TIDB 4HBQA 1JYVA 3PL6B 2AXGB 3D0LA 5DUBB 3WN5B 4DFHA 2CUMA 4GFTB 4NKDA 1BHGA 4OT1H 2R8SH 3P2TA 4OKVB 5EBWA 3VE0A 1QA9B 5HYSG 1HQ4A 2BNQE 4WI2A 5FA4A 5DI8B 4Z18A 1Z3GH 4WW2B 4U3XA 1XGUB 1FZJB 5ITFA 4OM0H 2NY7L 2VLJB 2KUTA 4ALAL 4EN3C 3RDTC 3HG1A 3ARSA 1JPTH 2P43B 3U9UB 3QDGA 4I9WD 1J87A 4DUVA 1N4XH 5F7LB 2DI9A 3BSZH 2F58H 3S7GA 3GMLB 2WNGA 2E7LC 1B0RA 1U3HC 5D7JD 1MJUH 3VRLE 1Z0NA 1FO0H 3HAEH 1HYSD 3F6LA 4KJQC 5SX4I 2EICA 1D5XA 3OKNB 4FA8A 1RU9L 2DQEH 4UQ3A 3FFCD 3F58L 2X4PA 1N64H 1CGWA 1H15A 5LQBL 1M71B 1JNNH 4MLIA 5INDA 3P40A 5F7WC 1HILA 1NCWL 1MJJB 5B8CC 1VFBB 4OLXH 4APQC 3PDOB 2MJWA 5I1EL 4JQVC 1K8IA 4K9EH 4NQDB 2XRAH 5CUSL 4PTTB 1WBZA 1CG9A 1FZKB 2V7HB 3SCMC 5EOTA 5INCA 1IAII 3TNNB 3OKKA 3IU3B 1IQDA 3S96A 1TIUA 5HGAB 3IGAB 4JKKA 1YEDA 2Z92A 1UWGL 4MDIB 3PWPB 1I3GH 3HNSL 4YWGH 4OTXL 3U2SA 4X98B 1CLZL 2M26A 5D2NB 2DQIL 4LDLB 3L5WA 4Z76A 2Z31B 1PX4A 4YPJA 3R8QA 4BQ9A 3DGGA 4CW1B 3AY4C 1FL6B 4NZUH 1GPOH 1MRCL 5DRXA 3C6LC 1CFQB 1JRHL 3AC0A 1VSCA 5J1TC 2XA3A 1Q8MA 4QXWA 4U4BA 1DBKH 1P5VA 1K85A 4F2MB 4MD0B 3L5IA 4G6ML 4JO4H 3HUJA 5JW4M 4KZEH 1R3KA 2Z8SA 3IDUA 1U8NB 5IBLC 5JUEL 4Z7UF 4Y5XA 4CADA 1F6FB 4HUVB 3GMPA 1MF2H 2OL3H 2O61B 3OAZH 3ARBA 4L4JA 4LHJB 1RJZA 2AV7B 1CICB 5I8CA 5FCSH 4O02L 3G6JE 4HV8A 1DBBH 4Y16C 2XZCH 1L0YA 4PS4H 5C07D 2VLKD 1BQSA 5DK2B 5DVLA 3HAEA 4WV1C 4AEHH 4HLZG 3HZMA 1XZ0A 2DTSA 5F7FA 3EOTH 4LSPL 4NKMA 3MV7A 3QUMB 3WIFB 1T7VA 4L4VA 3BIKA 3ISWA 1QLFB 3G6JF 4XXDB 4YDKH 5C0CD 4RMTA 3GSVB 2ADGA 5CGTA 4DUXA 2FWOA 2OTUA 3MRIB 3QUYA 1T2QH 3RIFF 2FEDC 4XBPA 3BPCA 4HQQL 4PJCE 4DFIA 2WIMA 4O2EA 1DQTA 5EA0L 5IR1A 2NX5B 3FRPA 3IB4A 3W5NA 2CKBB 5EU6E 4F7PA 2BFVL 3IFLL 3RWGB 4D0CA 4TTDD 2EH7L 1KXVC 4LVNC 5HY9B 4LARL 2BSED 4MAUL 3TNMB 4I5BB 1JGDB 2HJKB 3TZVA 1UJ3B 4XHQA 4KK9D 4PJCF 3ULSA 4YHPB 3CSYB 3GSNH 1GOGA 4QT5A 1Q94B 4O9HH 2D3VA 4OLUL 2UY6A 3RTQD 4MMZC 4KJPC 5IK3A 1I8KB 1NKRA 2BDNH 4HIHB 4XVTL 4R90L 4X6DB 2A6KA 4MVBD 4QRPB 5ALCL 4FQLL 1F11A 1KCVH 3GI9H 4U1GC 4NQCB 4J8RA 1ODAA 5IOPA 2G5BA 3I75B 2COQA 3DURA 4JFDE 3T0EA 3TLRA 4NM4H 1YNKH 5DJ8B 1CQKA 5E1AB 3P9MA 4QYOB 2O5ZL 4U1MA 1WIOA 3ORJA 4RFNC 4R6UA 1T7XA 4LPWA 4MWFB 5D7KE 2OL3A 3RA7H 1IE5A 5C08B 2QSQA 1TVBB 1JGUH 1X5GA 3T1FA 1RULL 1SJHB 4ZPTB 4YC2C 4ZFGH 1U58A 3D39B 1N6UA 4M3JA 3P0VL 5DJYA 2Y5EA 4AG4H 3LEVH 1J1XH 5DGRA 4FHBD 4LSDA 1HHIA 4L4TA 3C5ZB 4I2XB 4TPRL 4ZAKB 5F97E 1YMMA 1EEYB 3FT2A 4FXLA 2IQ9L 3NFSL 4YLQT 4PRPA 4LLYA 5DHYB 3O6KL 4N8VB 3BP6A 3VGDA 1ZE3C 4LNRB 4GJTB 2KZ1B 4ZSOB 5GS2D 2PYEA 5JHDA 3C6SA 4X6CE 4F15B 5L2KB 1RZKH 4YAQA 2P8MA 3AREA 5MENE 5KSVA 2HG5B 2NY3C 3VFTB 2Q3ZA 1F97A 3DX6A 4JRXB 1MHCA 4FFVC 2EEAA 4XPBL 3BP7A 5HVHB 3GK8L 4LAQL 4KUCF 3GEWB 3HE6C 3H8NA 3SE3C 4RFEB 1V8HA 4GG8A 4OLYH 3EDKA 4JO2H 4X6CF 5BZWB 2DLHA 4KKCC 4IMKA 3BEWA 4Y4KD 1QBLH 3QIWA 1U8IB 1RIHL 3HZVA 4GBXA 1AJ7H 3S5LA 2BNUA 3PXJA 5L8LB 5TE7L 3GSNA 3BZEA 2EC8A 1Q1JL 3CFKA 2DYPB 1QSZA 4G80B 3RWDA 1S8DB 4QXGH 2CD0A 5IT2H 1IEHA 1YMHB 4XCCH 3C87A 2R2EA 3L1OH 3A67L 4UT9H 3WNMA 1F3DH 2Y36H 1MFNA 3RL2B 2EO9A 4MA8H 3X11A 3T0DA 2BOBB 2WZPD 5IMMB 1I7UB 3B8YA 4OZGA 3ZKQD 4R4BB 1C12A 1YUHA 1DCLA 2W91A 1VADB 1KTKE 5T1KB 1NMAH 4K3DH 1KCSH 4WUKH 3F5WA 1F3DJ 4U7KA 4OAWB 2DB8A 3OR7B 5FHAH 2V9TA 4NKIL 2XG5A 3FOMA 1MCLA 2F53B 3CVIL 4O00A 2DI7A 5EIQA 2YD9A 3JWOH 2FJFB 2HT4D 1P1ZA 2NY4B 3PF2A 4E41D 1ZHKB 4UTBH 4LSSH 2LE9A 3UYRH 4LCUB 3VXUE 4JKMA 2WBWB 5C0GB 5KVFH 1VACA 1JZ6A 1FG2B 2VDRL 2JCCB 3O0RL 1KB5H 3MOBL 2ZSWB 4FQXB 3PQYD 4HBCL 1CDCA 4K55A 5F1OB 1UB6A 1MAML 3GO1L 5FDYA 1OGAD 2AERT 4M3KB 4WWKB 1DDHA 1FL5B 5D70H 4PJAA 4JANB 4XMLL 5BS0B 4UAOB 3WFZA 5JQ6H 3IF1A 4YHLL 5JLZA 1S7RB 5HHMD 2HWZH 1LEIB 5F8RC 5T5NG 3WNLA 5I18H 3VWJA 2AQ3A 3STZA 1JNJA 4M1DH 5CCKH 1I7RA 2D31B 2V17L 2NY5C 1NL0L 2F15A 3ES6B 1UWXH 5E5MB 1CIDA 1SBSL 4NOBA 1CS6A 4I1NB 5DR5L 1LHZA 5ACZB 3NFPB 1AD9A 5DD1H 4MJ2A 3IFOB 2GK0B 3MRNA 1YQ2A 4KKLC 5IESH 3BZ4A 4K3HA 5FYJL 1IEBB 1S7WB 3MRKB 4Y5XC 1Z5LB 5KTEH 1T3FB 5JDJA 3DYMA 5CP7B 1W72H 2ORBL 4MNGB 3L5XH 2I07B 1IGTA 3VD5A 3ARBC 4U3HA 4LLQA 3V4PL 4X4XB 3MYJA 3VFUA 5C0BB 3Q1SH 4YFLI 4RRPA 1OCWH 3OAUH 4Z7VE 5CSBA 5CZVH 4RWHA 3ZE0E 5J56B 5IHZA 2AJZA 1LK2A 5HI4C 3D0VA 1KN4L 2R69L 2UWEB 5F9WB 5M95B 4P4KD 3SKUD 5GS0H 1H3XA 3QDME 5IV2B 5JA8B 4XAKE 4L8SB 3X14A 4L8CB 2WUBH 3ARFB 2AJUH 2D7OA 3BXNB 3PWNA 3QUYC 3MXWH 3TFKD 4TRPL 4OZIA 4Z7VF 3ZE0F 3KWWA 1R5IA 1H8NA 1GJIA 1I9IH 4H88L 4V1DE 1YEHL 5HYQA 2PTTA 5E5RB 1BGXL 3PWLB 3BAEH 1IC4L 4UBDD 3TBWB 3QUKB 5F89A 1NGZB 1QPPA 1U8HA 5I19H 2Y6SC 3CPLB 1QFWI 5GGTH 5ID1B 3SJVA 3B2VL 1RIUL 3HC3H 3WFHB 3VG9B 5I8EB 4N0UE 3RWJA 1DQJA 2H2SC 5C09E 3V6FA 2XXCB 5I76B 3TZVC 3NCCB 2ZWLT 4M7JL 4PJDB 2ZUQB 5I66A 2ZOLA 1N3NB 3I6LD 4OGXH 5T1LA 1JPGA 1I9RH 4F7TB 2WMPA 1Q0YH 4WO4D 2G75B 5EU7C 3MFGB 3TO2B 4LP4A 3ZDXE 1U8MA 1EHLL 4NGHL 2B4CH 4PGEB 4Z95H 4K3JH 1YJDL 5CEXA 5I17B 2BJML 1JTTA 3U1SL 4OD2B 2IH3B 5CJOL 5DEGB 2E7CA 2QL1A 3ROOA 3DO7A 2I9LB 1CFTB 3H9HA 5BVJB 4QKXB 1NGQL 2WINA 1S9WA 3QNXB 3DX9A 4AEFA 2OR9L 3I02A 3H6JA 3ZL4H 3QAZC 1W72A 2OJEA 2IPKB 1ZA3B 4J4PD 1BBDL 4ODVL 3BWUC 3SDYL 5FYLL 1L7IH 5KS9B 4FNLL 2EH8H 2HVKA 4NKOB 5TDNA 1T1WB 5GIRA 2HTLD 2L7JA 4NRXA 3QNYB 3LSOB 2EXYC 4BH8B 5E6IB 5CZXD 1Q0XL 2JIXD 2VL5A 1NAML 1QSEE 4H26A 4KKNA 2P5EB 1TQBB 4Z78A 2FEEL 3W9DB 1OQOA 4Y5YB 1IM3B 5F6IC 5F7UA 2GITA 1BPVA 1OF2A 3G04A 1M4KA 3U0PA 1BD2A 3PNWA 3FN9A 4GW4A 3P73A 2VDPL 2E27L 4ZYKB 2X4NB 1OAUL 1FFNB 3UTTE 4LLUB 5DUPH 3T65A 1N26A 4TNVF 3SDAD 1IC7H 4IMKC 1HWGB 1MVFA 3QIWC 3C9NA 4GBXC 3MLVH 5TQ0H 2VQ1A 5JXEA 4GAYB 3EDDA 1QOKA 1CXFA 4ONHA 1NC4D 4GKOA 3K2UH 3GDBA 3LEYL 2EDXA 3WHE0 1ZVSB 2YUXA 4TUOA 4HUUA 3RIAF 3KS0H 4OQ1A 2YWZA 3FQTA 4HJGA 3B9KD 4X7DC 3WLWD 1WWCA 5AG9A 5ADOH 2IMMA 1BIIB 2C1OA 5DFWH 3UTSA 1EXUB 12E8L 2J1KA 5K9QG 4JDVA 5I1DB 5IROA 1MCCA 5FYKD 1WZ1L 1KEMH 4G8IA 3ZKSD 2YPVH 1NCCL 2FJHA 4ODWB 2ATKB 3RGVB 1MCHA 4EOWH 4L8DA 4FQQA 3Q5OA 3QWOB 4HGWB 3FONB 3TN0B 4PJHA 3KJ4B 3CNKA 5D7IF 3D25A 1F6AA 1A47A 4G8EA 4PRAA 4PB0L 3O3EB 5DO2D 4NQXA 3LKQB 1MNUH 1YECH 3WUWG 5ISZE 1KPUA 3GMOA 4Z8FL 1NBVL 5DRZB 2FH6A 3LZFL 4YX2H 2IAMC 2PR4H 1U92A 2CUIA 3GBML 1A7OL 3NOIA 4M4RA 4P23A 3S35L 3KXFA 2BVQA 2X4QB 4LSUL 4U6VH 4JFZH 2WBJD 2W9EL 32C2A 4IIQB 4WCYL 2CK0H 3RUGF 4Z5RB 3AM8A 4WEBH 3BWAA 2F5AL 4NYLB 4KKBD 2FYYA 1JWUA 2C3HA 3ULVH 1RVFL 1S5IH 3C8HA 5J6GB 4N5ED 1INDH 4DZBB 5AD0A 1PQZA 3HC0B 5CKAA 4QRSA 4IHOB 1ZHBA 4RMVA 3MR9A 5I1GH 2C5DC 1XIWD 4YQXL 4F7MA 1AHWA 3UCRA 3MNZB 5E2UH 3ZT5A 2AEQH 2X70A 3S88L 2OR7A 3K46A 1HH9B 4UB0L 2D0HA 4J3OC 3FB5A 4PJEE 4FFZH 1BBJB 1L9MA 5FF6A 3CFBA 4ODXA 2D9QB 4WGWB 4R4FH 5CEZD 3U4EA 1F13A 1MIML 1AH1A 4OCSH 2BSTA 1BQHA 2GSGB 2PETA 4JM4L 4LVOC 3V5DA 2FECI 1NFDF 4PP2B 2FB4H 5EPMB 1RZFH 1F8TL 2LU7A 3FFDA 1AXTL 2LQRA 5EIIB 4QTIH 4PJEF 4EZMA 2EDBA 2W65B 4DW2L 1VDGA 4JRYD 4NC1C 3K2MC 2ZUTA 2YPLE 3JV0A 2IG2L 3L7EA 1NLDH 4HK0B 3B3IA 2LTQB 2CDEB 3WKMH 3HPJA 1PYWA 4LLAA 4YDIH 4H8WC 1MHHA 1FYHB 3SKJL 3HZYA 3MV9D 4LPTA 1U95B 4NZJA 1FSKB 3U4BL 2YZ1A 4MSWB 4KHXH 5FYJD 3NIFE 4CU8A 3DUSA 5LKNA 3BE1H 1NAMB 2ZUYA 4EI5D 4PR5A 3HNTL 2P5WE 5D5MA 3MGTA 4NQED 4S1QL 3MOAL 4BH7A 1ZEAH 1MAJA 3AMLA 3QXDB 1X5FA 1I1AB 4XCYA 2ESVE 2NXYD 4F33A 3BH9B 4GXVH 3VXRB 4C56A 4LSQL 2JJSA 3K4DA 5EBGA 5HHPB 3NIFF 3TH3T 3S4SG 3PP4L 4X7EC 4F7EA 2Q3AA 3EOBA 4LLDA 3C60B 1AI1L 4DCQA 2VAAA 1A4JA 4DKEL 4PJ5A 3UAJC 3QEQE 2R23B 3D87B 4YIQA 4FTVE 3MLYH 2NLJB 1Y6MR 3QP3A 4H20H 3I6GB 1VEOA 2DKUA 5EZLB 5IF0B 1EA9C 4OD1L 3W2DH 3JWDH 2XTJB 2HT3D 5C0JB 3O8XB 3ARWA 3R06A 2NY6C 3QFJD 1D5ZB 4NN7B 3VXSA 2F8VA 1B0WA 4HZAA 2VTFA 5C8JA 1NGXB 1BMGA 2OI9C 1A9EB 4I3RL 1SYSA 4RMQA 1RZJH 2B5IB 2EECA 1R5WB 4OM1L 3WIHL 4MJIA 4ORGB 5GJTL 2G60L 4HX1B 2PXYD 3O6FB 4RGNE 1KTDB 1JRHI 43CAB 3CZFB 1A1NA 1I3UA 2FD6H 1KCLA 3TIEB 3K74B 4RAUA 3GGWA 5KSBB 3MRMA 3IFNH 4UTAL 3WHXA 2D0GA 3VFGL 3WD5L 3C8DA 2DM4A 1WWWX 5SWZA 5HD8C 4MNQA 4CDGC 2J8UE 5GS0C 1L0QA 2BSSA 1DN0A 1MH5B 4OF5A 4PRDA 2UY7A 4EDXB 5E2JA 1BVKA 4ISVA 3DO3A 3FOLA 1WLHA 3I50L 5C92A 5JIIA 4S2SB 1G0DA 2Z9TA 5D6CB 4EN3B 2DQTH 1F6LL 3RDTB 3MLWL 1U2HA 5E8DL 5FYLD 5JXAL 2X4RB 2YEZA 3LY6A 4GT7A 1T2JA 1D9KA 3VCLA 1U3HB 5KJRH 2CDFB 2CIIB 1FNSH 3OF6D 2FIKB 5GRYA 5F7DB 1FHGA 4Y4FA 3V95A 4OCXH 3FTGA 2QTEA 4GG6F 1S3KH 3Q5TA 4JY4A 4OGAC 4UV7L 4X80H 5I15H 2H2PD 5FGCE 3MPCA 5DJXA 5BV7H 3HLAB 3MLZH 3K8LA 4P5MB 4EXKA 5DMIH 5EZJB 4UV4L 4N90E 4HZLB 5IBTL 2AW2A 3AROA 2HLFD 5H37G 1B2WH 1IKFL 3P9WB 3PGDB 5E9DA 3GUTA 1CI5A 3VDAA 3KPMA 5B8CB 4APQB 4OJFH 3LRSB 3DXAD 4X6BB 3T3ME 3S35X 2IC2A 1SYVA 3C8KB 3KPRB 5FO8A 2EYSA 3U46A 5IROC 4U0RC 4DGVH 3SCMB 4MXQC 5IB4B 3DVFA 4HJ0D 5B4MD 4NWUH 1AO7D 3NMEA 5D4QA 2VXSL 3MNWA 4NJ9L 1GGBH 4OZFB 4UNUA 3WNKA 4OCWH 4U1HB 4LPXA 2X9XA 4X99A 5DD6A 5DVNA 5IBUB 1LO4L 3T3MF 2D7TH 3IDGB 3BJ91 3SE4A 1YQVL 2DQFA 3INUH 2EE2A 3O3BA 4D3CL 1DN2A 5DLML 1N6VA 4NHCH 3C6LB 5AWNL 1D5MA 1A7NL 1XF5A 2AV1B 4OIIL 3S3SA 2NNAB 1KLGB 3BDBA 1DJSA 1KPRA 1XR9A 3VFSB 4X7SH 3Q2CA 2D03H 4RFOH 3V6BR 3RWCB 2Z91B 2IFGA 2DQDH 3VXMD 4P23C 2ICEA 5KVDL 4AY0A 3K1KC 4XMPH 3NABH 5F88A 4M9OA 3BKYH 3AM8C 4JY6B 2DQHL 4Z0BL 1VGKA 1OB1B 2FSEB 2XWJB 1WFOA 3HS0A 3LKRB 3NPSC 1M6OB 5HHNB 1A21A 4O51B 3IDYC 4JEGB 5HGBB 3VFVA 3W9EA 2X7LA 3E8UH 1NANH 4WU5B 2CDGA 3NH7H 4Y16B 4PTUB 3H9SA 4MS8D 5IFJB 3BOVA 1L9NA 1S7QA 4WV1B 1ZANH 5FM8A 5IB5A 4XCFH 5KW9L 5GJSH 4E9LA 3OQ3B 5KVEL 5DQ9B 3H3KA 5B3NA 3TP4A 3IJSA 1XFPA 4V2BA 4AH2B 5IMOB 4FMKA 2B1AL 1A5FL 1T1XA 4IOSD 4IS6B 4U7MA 4KXZI 3C08H 5FA3B 5TFSH 4OFDA 1HZHH 4M61A 2AJVH 4I77H 2WBKA 4XB7A 2R4SH 2WWKT 2DIAA 3S36H 1G7QA 4P2QD 1FRGH 4U1NA 4DUWA 5J8OA 3H0TA 1DL7H 1KNOB 1MHEA 1D5IH 4YEEA 1YPZF 1MREL 2JELL 1OAYH 4X9BA 4QHKI 3IS1X 5TJWK 2D7MA 2DWDB 1KFAL 4ZS6D 4LRNH 5CMAB 5TE4H 1F4XL 1KIQA 2R9HD 2VXQL 4R8WH 1DE4B 5I9QC 3EO0A 3P11H 4KQ3L 4LVNB 5IW1A 5J1AB 1PSKH 1WV7T 2NY1C 3UX9B 4YBLC 2VZUA 2PTVA 3MLXH 5E8OA 3DECA 2OMBA 4OT1L 5ADPH 2R8SL 5DA0B 4OI8A 5TGBB 4KK5D 3CH1A 2MOVA 5LGJB 3RY6A 4RNRA 2BY3A 4Y88A 4Z7UA 5D72H 3OJDA 5IKCA 4FN0A 5J11C 3WE6A 2IQAA 4O5LH 1C08B 5E8EB 1UM6H 5D96C 3ROLB 4U1GB 1KIRA 4OM0L 3VFRB 3EYUH 1HDMA 3HCVA 1TNNA 4POZC 1JPTL 3SY0A 3OB0K 4RFNB 3VXNA 2JJSC 1N4XL 1NJ9B 4MA3B 2FR4B 2ED9A 3OKOA 5LVEA 4OV5B 4RIRA 1M7XA 1JBJA 1N8ZA 5FHBH 3SO3C 5D7LB 3T3PE 4YC2B 3HR5A 3MLUH 4JFOB 1FO0L 5DVKA 3VFPB 3ULUC 5IVXE 3NZHH 1A2YB 3IFPA 5JPNB 4UT7H 2ZJSH 2DQEL 2V2TB 5TQ2H 1N64L 2ILLA 1NFIB 5EUOE 5SX4H 3OL2A 3TJEH 4YZFE 2YRZA 4AM0B 1JNNL 3UTZB 3RPKA 1DBJH 4GW1A 1NCBH 3T3PF 5DQDH 2W60A 2HTKD 2BC4B 3A0OA 5IVXF 4OLXL 3DV6B 4U1JB 4X6FB 4K9EL 1JE6A 3KAAA 4AJ0A 1P7QA 2NY3B 4YZFF 4UT6H 1N59A 4PJCA 3MRGA 2LAGB 2EYTA 4RDQG 2GCYB 3HE6B 1I3GL 4NCDA 3DVGB 2CRYA 4HWBH 4KDTA 4WDIB 1T7WA 3M1BA 4J3SA 4YWGL 1A14H 5EU6A 4NKDB 5DZOA 5DTFA 1XGPA 2OQJA 5EBWB 2VO5A 4QHUA 5JOFA 1WFUA 4NZUL 5ANME 1GPOL 1WCBA 2X05A 1HQ4B 2QJDA 3MROA 1Q38A 3IRZA 1O0VA 5FA4B 4CU6A 4GSDH 1YYLH 1DQQA 1DBKL 5DJAB 5ABDE 2NPLX 1TLKA 2AEPH 4JO4L 2W9LA 4KZEL 4NO0A 4XNYL 1RHHA 2AK4D 2E3VA 3RL1A 3O9WD 4F9LA 3HG1B 3QPXH 5DDHA 3QDGB 4PG9B 2OL3L 5KANG 5ICZA 1AGDB 1WFTA 3O4LD 5DJZA 1D9KC 1B0RB 3ZTJH 2AKRA 3BQUA 5D1QA 4JFFD 4XCNA 3QDJA 4Y4FC 1DBBL 3QULB 4JQXC 2XZCL 2LVEA 1FIGL 3CZJA 4PS4L 1D5XB 2A1WH 1IJ9A 3F7YB 4UQ3B 1MLCA 1HCVA 4AEHL 1YEFH 2X4PB 1TZIA 3D69A 3V0AC 5T3ZD 3QXWA 4U6XA 4JY5H 4H0IA 1H15B 5F3HA 4PJIB 4ZO8A 3EOTL 1LE9A 3V4UL 3GJEA 4G9FA 1OWRM 1UVQA 5LJYH 3OGCA 1KULA 4NUGH 3ILPA 1K8IB 3R1GH 3VDCA 1T2QL 4IOIA 3JWDC 1A7PH 1T89A 2MKWA 1WBZB 1F90H 1CG9B 5IB1A 1QHOA 3KYAA 4WI7A 3ARGA 1LD9B 5EOTB 3QUZA 1FC1A 5INCB 2Q6WA 1IQDB 4NSKA 5KOMC 3S96B 2BP3A 1YEDB 2XY2A 3E6FA 2PUQT 4PRHD 5D71H 4ZTPH 5F21B 1RZJC 4HCRL 3SGKA 4MJ6A 1I8IA 1NGYA 1I1CA 4Y2OA 3P4NA 3VMPA 3IJHA 4MZ3A 5GQBA 4HWBA 1SJEA 4O2CA 4Z76B 5FM5O 3DBXB 4NHUB 4FG6D 3KPQA 1SVCP 5GGUB 3ZO0A 1Y6KR 3GSNL 3QUXD 4L5FH 5DRXB 2HFGH 5JNYA 4XGZA 4XBEH 1KV3A 4QY8A 2BDNL 3LVEA 1ZT1A 1CD1A 3HUJB 1R3KB 4LU5H 1WF5A 2PTUA 5IQ9B 2XZAH 4Y5XB 1XGTA 4M62H 3GMPB 5I1LA 3DTXA 4NM4L 1YNKL 5T33L 3BGFC 4JFEB 3ARBB 1IAOA 2CJUH 3RA7L 1IILE 1BVZA 1QFOA 5F70A 1JGUL 1RJZB 1A9BA 4ZFFA 5I8CB 1S5HB 4ZFGL 3AAZA 4G6KH 4AG4L 1FNEB 1G9MH 3LEVL 1M05A 3HAEB 4JPIA 4X8JB 1M1SA 1J1OH 3RVWD 4G7VH 3HZMB 4HS3A 1XZ0B 3QG6A 2B20A 4NKMB 3MV7B 2GKIA 4OD3L 1CQYA 2VE6A 5BRZD 5BV7C 3DMMD 3KYNA 3BH8A 3ZKMC 1DANT 3BIKB 4L4VB 5DEZA 1KSRA 5B21A 2ADGB 1FIEA 4K23H 2OTUB 3LS4H 4DVBA 3QUYB 1MIEH 2BNRE 2IADA 4XBPB 3BPCB 1ZOXA 1RZKL 3LHPL 4MGXA 4O2EB 4XWOD 4QRRA 3QIUA 2YA1A 3T77A 5IR1B 4Y8DC 3KPSE 4D0CB 4HT1H 1IKNA 5GISH 1KACB 5HHXH 2CMRH 3WLBA 1KC5H 3TZVB 4OLYL 4R4ND 2EE3A 4JO2L 1J0IA 2LVCA 3ULSB 1QBLL 1XGYH 4GAGH 1AJ7L 1OTTC 1T04B 4BKLA 3ZT6A 2P45B 1OTSD 3RY6C 4UOW1 5IK3B 1H3UA 1I8LC 1WVZA 2A6KB 1DEEA 2NTFA 1WICA 4QXGL 3V52H 4D0BA 1F11B 5IT2L 4G6FB 4XCCL 3IDIA 4J8RB 3L1OL 1X4YA 3CD4A 4UT9L 5SWSA 5IOPB 2G5BB 1CXLA 2Y36L 1PGRB 4MA8L 3NN8A 5HPOA 3DURB 4A2MA 1CU4L 2AEIT 4P46A 4AK1A 2CLVA 2ZZUT 3P9MB 3RVVD 3QAZB 4QRQB 4MCZA 2OL3B 5IVZA 3T1FB 1JF5A 5GZOC 5J1SC 4X4YA 2BX5A 1Q9WA 1C7TA 1U58B 1NMAL 4K3DL 2IAND 5ERWB 2X1OA 5DJYB 5A2LH 3RAJH 2C26A 5HYSA 3MJ7A 1MLBB 4Y19A 1HHIB 4IRJD 5KANI 1IEAA 5FHAL 3K0WA 1YMMB 3FT2B 1CR9H 2DI8A 3H7BA 2VDQH 4PBXA 2YSSB 4S1SH 3QH3A 4PRPB 1GZPA 4LLYB 5EB9A 4JZNB 1DANU 3JWOL 4WFHD 5SX5H 4UTBL 3UYRL 4LSSL 1T1ZA 1DTUA 3WO4C 5DS8A 3QJHA 3OJVC 4DGYH 2X44D 5JHDB 3C6SB 1FE8H 5KVFL 3UZVB 4YAQB 5F6IB 2P8MB 3AGVA 5FIEA 5KSVB 5J89A 1KB5L 3DX6B 1Z0MA 2VLRA 3QI9A 4HLZH 4LCWE 5B38G 3BP7B 1K8DA 5E7BA 4KJWC 5D70L 4KDTC 5JQ6L 3EJZD 4GG8B 3FT4A 5CSZB 3HRZA 2HWZL 3BEWB 4LSVH 3VFMA 5F1KC 5I18L 3QIWB 3T0VA 3HZVB 4GBXB 4M1DL 2DQUH 3S5LB 1JP5A 1SEQH 2BNUB 3VMOA 1F2QA 5CCKL 2EIDA 5EWIH 3BZEB 1MCIA 3CFKB 4IRZH 3C2SA 4GKZA 5DD1L 1AQDA 3NPZB 2R2EB 5IESL 3FRUA 4GRWF 4HKJA 5FO7B 4F9LC 1DQLH 5CBAA 2WP3O 4LOUD 4L9LA 5KTEL 2DS4A 2AEWA 4OZGB 1W72L 3P0GB 1C12B 3L5XL 1V3JA 1YUHB 3LQMA 1CGVA 3LKOA 4M8QB 1DLHA 3BQUC 3EIFA 2R0KH 2CLZA 1QRKA 5F1IA 3CLFH 3DV4A 3Q1SL 5IFAH 3ZSSA 2PCPA 3OAUL 4WU7B 5CZVL 2OX5A 2MPAH 3FOMB 3JUYA 4Q2ZA 2NY0D 3RVTC 1K5NA 2JB5H 3BPLC 1T66D 4X8XA 1P1ZB 2VDLH 2AJYH 5E00A 3T0ED 4MQ7A 4XP9H 4YHIA 1PX3A 2WUBL 2IAMB 2AJUL 3CU1A 4K7PH 1VACB 3MXWL 4XPHH 2EZ0D 2OS7A 4RZCA 4I48A 5DJCA 4DK3A 1I9IL 1T89C 1MCPH 1EK3A 4HW6A 1EAJA 4I18A 3ARGC 2OMNA 5B39B 4FQCH 1P84J 3QUZC 3SE9H 1UB6B 4DJMA 3BAEL 1P6AB 1DDHB 2F54A 4L4TD 4PJAB 3SGKC 5I19L 5GGTL 2ENYA 3BGMA 3IF1B 3U79A 5JLZB 1FYTD 3BI9X 1QLRB 3GBNH 2CSPA 2UZIH 4NQSB 3S9DB 3STZB 4JM2A 3MREA 4OGXL 3FB8A 4XT1C 2PYED 1Q0YL 4QXTB 1GGIH 3ZE1E 1Y6NR 1AD9B 3ARED 2VISA 1ZAGA 2BMKA 4PRBB 2B4CL 2VUOA 4Y4HD 4Z95L 3W5MA 1BJ8A 3MRNB 4K3JL 1LK3L 3V7AG 2NZIA 1PKQA 5LAXA 5JW4Q 1NC2D 4ZD3L 4LVOB 2X4SA 2VLME 3UP1A 5FKAA 1T83A 4NZRH 3ZL4L 1L7TL 3ZE1F 3H7LA 1MRDL 4RDQF 3PWVA 3MYJB 5D7IA 3VFUB 3W0WD 3UBXG 4ODBD 1HH6A 1L7IL 4XTRC 2EH8L 4ZQKA 4X9HA 1MCDA 2R39A 2AJZB 1LK2B 1NBZA 5D7JA 4HUMB 3D0VB 3PWJA 3B9AA 3VH8B 1E6OH 3ILQD 1J8HD 1EPFA 1ES0A 3EFDH 1NKOA 3WFDH 4YFDB 3FFCA 1MCWW 3U9PH 1L6ZA 3RUGA 3X14B 5FEBA 3P3YA 2NXZD 4NQTA 5LBSH 2C4FU 5TH2A 3PWNB 3OZ9H 2MSPA 4OZIB 3KWWB 4DK6A 4MNHB 2BY2A 4FXGA 5HYJE 1R0AH 5JIPA 5HYQB 3K80A 3AS1A 1G9EA 1NMCC 4PJGE 5HI3C 1O7SA 1JZ5A 1FFOA 3T08A 2YD7A 2XN9E 1U8HB 1IKNC 2FRGP 3SJVB 1KELH 3RWJB 2X89D 4Y1AE 1DQJB 4GAFB 3V6FB 2DIBA 5DUPL 4M7LL 3VFOA 2C7UA 1BOYA 4UDUA 1IC7L 1U91A 5ISZB 1YY9C 2GJ6D 4NWTL 2XFXA 5EOQH 5JQHC 5JW3H 1JPGB 4PJGF 1GGUA 4XC1H 5HHOD 1U8MB 3BN3B 2Z35A 3K2UL 3RGHA 1NFDA 4LCIH 5CEXB 1HHJA 3D48R 1U8JA 3R4DA 3ECBA 3O4OC 1AE6L 3L3DA 2XWTA 2ZP0T 3ROOB 1E27B 3IYLW 1ULVA 3DO7B 4KRPC 3H9HB 4QLRA 5ADOL 1TJIL 2F8OA 2NY6B 1QRND 2WINB 1S9WB 3MLRH 4P46C 3I02B 3GM0A 5IMLA 4K94H 3GRWH 2OI9B 2I24N 3VWJD 1W72B 5IJKA 2OJEB 4UI2A 5A16B 2YPVL 1ED3A 3RVUC 4RGMC 4EOWL 2HVKB 3QPQC 5KBNC 1N7ML 1C16A 1DSFH 5MHSD 2V2XB 2E7HA 1G9MC 4NRXB 1ZSDA 2OCFD 3DROA 2VLKA 1BX2B 2Z93A 4GOSA 2Y4SA 1JHLH 2VDOH 2VB5A 4AENA 1MNUL 2XZZA 3BGAA 1YECL 3FO0H 1CTOA 1I3VA 1EIBA 2VL5B 5JW5A 5FK9A 4H26B 3TJHD 1A1MB 3KHOA 5EU5A 4YX2L 4Z78B 3IJYA 4TUJA 4C83A 5L0QC 4X7FC 4ETQA 4U6VL 4G8GD 3GSQB 1A6PA 1GHFH 2YPLB 4PJFE 5C0CA 3SDDA 2CK0L 3G04B 3QI9C 1MFCH 3U0PB 1BD2B 3PNWB 2F9BT 3G5ZA 3TT3L 4P4RB 3P73B 1ORQA 4PRIE 1TTFA 3ULVL 2ESVA 3FO2A 5TDPA 1INDL 1F00I 3T65B 5KSAD 5K9OA 1G1CA 4OBRA 3SGDI 5I1GL 1ZKAA 3K81A 4LL9A 3VWKC 3C9NB 3CUPA 4PJFF 4WUUB 5E2UL 5CHNA 1E6JH 3MV8E 1KJVA 3Q6GH 1OARH 2E9IA 3NA4A 4ONHB 3MGOB 1T6VN 3MYZA 4N8CH 3KR3H 4QOKB 2Y9RT 1AGEA 4HUUB 5FM5M 4ONOA 5B22A 3FQTB 4HJGB 4EBQH 5AG8A 4R4FL 1GXEA 3OMZA 1VHPA 3RTQA 4LHUD 2X5PA 5D9SA 2C1OB 3UTSB 4HSQA 5BVPH 1OLLA 2VABA 3FN0H 4L9LC 2L4OA 2QHRH 2FB4L 1RZFL 3SDCC 3NCYP 4JDVB 3U7WH 5EO9A 4U0RB 2DKMA 3MUGA 3L3KA 4QTIL 1RUKL 3GRWA 5T1LD 4ZFOA 4Q9QH 5C0DA 4KTDH 1NLDL 4L8DB 4FQQB 5E8NA 3WKML 4YDIL 4PJHB 1MVUA 4WFFD 4I0KA 3D25B 1F6AB 1MCRA 3E0GA 3DYOA 5IW6A 3KPNA 5FB8A 4NQXB 1T80A 4NP4H 4K8RD 2MMXA 2CXGA 3UBXI 4F58H 3GMOB 2NQCA 4KHXL 1I4FA 5B3JE 3CXDH 4R2GD 4MDJA 3STLB 3BE1L 3L95A 1U92B 3EW3B 3CDGA 1RK0A 5SWQA 4ALAH 2A74A 1LE5A 4P23B 4D9LH 3KXFB 2BVQB 1WK0A 5F7MC 1X7QB 4I18C 5HHVL 3BWAB 1JGEB 2FYYB 1JWUB 1GGCH 4GG6A 3JV6A 4GXVL 3NPSB 5BCAA 1V3LA 3IDYB 1OOAA 5AD0B 1PQZB 4KDVA 4QRSB 4KU1A 1ZHBB 3MR9B 1I1FB 4W70A 1CT8B 2VIRA 3F58H 4F7MB 1FGNH 4JM2C 4MAYC 1PG7H 2X70B 4NC0B 3G6AB 3LQAH 4M7ZC 4LVHC 4Z77A 3MLYL 4Y4KA 1BQLH 2D2OA 3CFBB 2A38A 4PRNB 2HH0H 4YGAB 3FN3A 4MB3A 4ODXB 5CBEA 1D3CA 1UYWL 4WI6A 4ZUWA 1DR9A 2J7LA 3O3UN 3U4EB 1AR1D 3EGSB 3UYOD 5MERA 2BSTB 1BQHB 5DHXB 3W2DL 3MLPA 1VPOH 5CUSH 3WCYA 3JWDL 3CSGA 1HWHB 4HMCA 1ZT7A 2J8HA 1KT2B 2E6QA 3FFDB 2VLJE 3RY5A 3U36A 3BPNC 1ZHLA 4XNMA 2YN3A 1RZJL 5JXED 3L7EB 4GXUN 5I9QB 3B3IB 1KJ2A 1U8KA 3HPJB 1PYWB 5T1DH 1K9TA 2NY1B 1IRAY 3EOAA 4YBLB 5DURB 1MHHB 3QIBD 1JZ2A 2FD6L 5D7JC 3HZYB 1ZLUK 1HEZA 1HYSC 4UDTB 3IFNL 2EKSA 3OKEA 4GKNB 5J11B 4TUKL 4GQPH 4PR5B 3E3QE 5D96B 3RI5F 2A2QT 3MGTB 4E41A 4BH7B 2Q76A 4LNVA 3V4VL 4TSBH 2DQTL 4R7DA 4XCYB 1P69B 4NQDE 4GUPB 4C56B 5CILH 1KGCD 3O45A 4W4OA 1OAKH 5HSFA 1U8QA 3PQYA 3FB7A 3R0MA 5KJRL 1FLRL 2EEBA 1FNSL 3SO3B 4F7EB 4LLDB 4DCQB 2VAAB 3TO4D 3PWPE 1BEYL 1A4JB 4OCXL 4LHUG 3KG5A 5TE6H 1S3KL 3B9DA 1QZ1A 4X80L 5DUMH 4QEGA 4WFED 1RJLA 5D2NE 4HIXH 4NO5B 1F4WH 5BV7L 3MLZL 3MACL 3JXAA 2VR5A 1JI1A 1KJ3H 2ZUVA 1HXYA 3ZSTA 1YPZA 2LU4A 4LLMA 5H94A 2ENSA 4OJFL 1YEEH 3MUY1 3VXSB 4X4MA 3S3JA 1ZTXH 3WKNA 4N9GA 3K8MA 2ZCHH 5IJKC 2EH7H 4NWUL 4LARH 4MJIB 1KJMA 4Y2DD 4JCMA 1GGBL 1Z9SA 1YN7A 4OIAA 4OCWL 4MA7H 1JK8B 5F7NC 5C0AD 3SEPA 1A1NB 4L3ED 5GS1C 2K1MA 4RBPK 2X1PA 5BXFB 5K9JH 1PG7W 2ZSVA 2D7TL 3O41A 1A7QL 1VCAA 1IVLA 2H32B 3GGWB 3MRMB 3INUL 5LCVH 3WHXB 1H9VA 5SWZB 4MNQB 4R90H 4NHCL 5DRWA 2M1KA 3UMTA 2BSSB 1QSFD 1DN0B 3GHEH 4PRDB 4X7SL 2D03L 4RFOL 4P4KA 1BVKB 4ISVB 2GAZB 3FOLB 1MOEA 2E8YA 4EXPX 5DD5H 5HVGB 4E5XA 1HYRC 1MRFH 1S78D 4LPCA 3BKYL 4U6YA 4X9GA 3D9AH 1P2CA 5HYIA 2YEZB 2YD5A 4ZS7L 2CO6B 2GTWA 4YDVA 1D9KB 3VCLB 4P2RB 2NX5E 2XACC 1ZWIA 3E8UL 1CN4A 4Y4FB 3WUWA 3NH7L 4LP5A 4XP1L 3VRJA 4JY4B 4TTDC 2IQ9H 1ZANL 4KKAD 4XCFL 5DJXB 2ZCKH 2VSDA 3EZJB 4N0CD 1VFOA 4KK9C 4ZOAA 3O6LH 1W0YT 5L7XH 3DARA