1FBIL

Crystal structure of a cross-reaction complex between fab f9.13.7 and guinea-fowl lysozyme
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
214
structure length
214
Chain Sequence
b'DIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQKKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDYSLTIRNLEQEDIATYFCQQGYTLPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1 F9.13.7 FAB (LIGHT CHAIN)
publication title Crystal structure of a cross-reaction complex between Fab F9.13.7 and guinea fowl lysozyme.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (antibody/antigen)
total genus 41
structure length 214
sequence length 214
chains with identical sequence P
ec nomenclature
pdb deposition date 1995-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fbiL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fbiL01
2NY1D 3VRLE 3QB7C 1S7WA 4WWKC 1U3HA 3QQ3A 2OL3H 5C09A 3G5XA 3MRPB 4YWGH 2BSRA 1ZEAH 3F7PC 2IPKA 5D7IF 4M7ZB 1INDH 2DTSA 1YPZA 4YDIH 3OKDA 1A7QL 4FP8L 3JV5A 3ZT6A 1KNOB 2IBBA 2VXTH 3BWUC 5F70A 3MREB 1CXHA 4FQXC 1TQBC 4ODVL 4MVBC 3PWPA 3CLFH 4P49A 2DLHA 1BFSA 1VACA 3DROB 2H1PH 3D5OF 3FQXB 4JVUA 5FUOL 1NKRA 5T1LD 5HYJB 1TZIB 2EDOA 3KPTA 3CFDA 3I50H 5I2IA 5GJTL 3ARXA 3C5SB 3SQOL 4MD0A 3TYFB 5IVXB 5I1CL 3OGOE 5C8JB 2CQVA 1V3LA 2N4IA 5CKGA 1U92B 4BSVA 4IRJC 5IB1A 3UC0L 3C2AH 2C3GA 3O6KL 2I5YL 4ZFZA 2G5BA 1IGCH 3U4EB 3BKJH 5I17B 3Q3GA 1CFNA 3OX8A 1A6TB 4QRTA 4HKBA 3VRIB 3WDJA 2ZSWA 4N0CD 2A9NL 4FTVD 4BQCA 5H37G 2LFGA 2F5BH 3DVNB 4U1HB 2E9IA 1ZWIB 3N1FC 3VWJA 2IG2H 3O6FC 4K3JL 4Y0GA 4IS6B 1T0NB 1MJ7H 4DKEH 4RISH 3LN9A 5GGTL 3RHWK 3MJ7B 4D3CL 1ZS8B 3H42H 1KTLB 4XAKE 3V6ZB 1JWMA 2FIKA 4G8FA 5TH2B 5HVHC 3MCKA 1R5VB 3AREA 5EWIH 3V6FB 1S7SB 4XBPA 5KSUA 1LO2H 4GUPA 4WU7A 3SKOB 4JHWL 5BV7L 3G5ZA 2UV3A 5D6DC 1YJDL 3V5KB 2AABH 4Z76B 5T1MB 2FYYB 4FQCL 4OZIE 4NT6A 4P2OD 4QRRD 2O5ZH 4M9OA 4FMFA 1L0YA 3VXRD 1EXUB 5CMAB 5ICZA 4U6VL 3DO7B 2AJUL 2EDHA 2MKLC 2BSSA 4L4VE 4MJIE 1J18A 1UVQB 3BQUB 4YAQA 3K3QA 2YZ1A 4GH7B 2DIJA 1OLZA 3FCTB 1Z3GL 5I1DA 5ADPL 1QRNE 3E3QC 1GIGH 3KXFA 3U2SB 2NY4B 4G8IB 1QBLH 4L8SA 3QI9A 1LEGA 4RAVB 1CLYL 5JZ7C 4PJDE 2IAMD 4AEEA 4BUGA 4QHLB 5DJ2A 2ZKHH 4CMMA 4M93B 2DJSA 3UEZA 4Z78A 3IS1X 2ATKA 4YBQD 3VXOA 1AXIB 2GI7A 3IXTA 1MQKL 3FT4A 1E4XI 3BIKA 2AI0H 4HS6A 4KQ3L 1RVFL 2R29L 1H3WM 4Z0XA 2GJ6D 4M5YL 4YPGB 1UYWH 3TZVC 4X8XA 1EA9C 3UPRA 3WFBH 4J4PA 1MRCL 1WV7T 5HI3D 2D7NA 1GPOH 1EZVX 1A6PA 3SBWC 2IWGA 3CX5J 4XWGH 2DQTL 2YMXH 4WFEE 2XWTA 2ID5A 1KEMH 5DRXB 1A9EA 1LDPH 4GW1B 5CWSA 4ZS6C 1CXIA 3CSYA 4JN1H 3U9PL 4PBVC 4Y19A 2VH5H 1Y6NR 4HCRL 4F80A 7CGTA 4FFZH 4DGIL 1T4KA 2P5ED 5BJTA 4QRUB 5JA9A 1QSEE 3H9SE 3SO5A 4KKCC 5HGHB 4LPWA 4WUKL 3HCVB 3FOMA 1LO0L 3EDFA 2P8LB 4M8QA 5HHME 4OZFG 2DDQL 4JFQA 4LSTL 3HC4H 4ONFL 4L1HA 4ZD3L 4R4NC 1VFBA 1TITA 1YNTA 1UZ8A 1MFDL 3F7VB 4M7LT 1YA5A 5E0QA 5C0IB 5D2LE 1G1CA 3BEWA 4C83B 3RPKA 3ULUF 1U8MA 3WBDA 1CS6A 4KJYA 2FGWL 5C09E 4P59H 1Q9KB 4J8RB 5F89A 3GGWA 4UINH 4P0DA 4JCLA 1AGDA 1YPZE 3MSPA 2NY6D 4PR5B 3QIBA 3CFCL 1BF8A 2WINA 3G6JA 4XPFH 3B6SA 1BJMA 4LSRL 3A67L 1S7VA 4JG0L 4JQVC 3PWPE 4LAQH 3ZDXE 3VGAB 3ZE1F 4R97B 5GRUL 5JIPA 5ALBH 2B2XH 4ODXB 4Y16D 5GRWA 2ICWI 1HIMH 1MRFL 1LNUA 1ACYL 2WLYA 4QO1A 5ISZD 2BY2A 3GMPA 5D1QB 1N5YL 5MERA 3PWJA 2HYMA 1MNUL 3KNBB 2PTTA 4HAGA 2W0PA 1RZGB 1F4XH 2C3XA 2XI9A 3ARBA 4ONHB 5J3HC 3BKCH 3KYOA 4LDOB 4ZXBB 4F58L 1I8KA 3ARRA 2CLZA 3V5DB 4AH2B 3L5JA 3VG0H 3MNZA 1FFOB 1Q94B 4L3EE 4PJXA 3HG1D 5LQBH 2OJEA 3CFJA 3BX7C 2LTQC 4NO0A 5D7LD 2FH6A 4U1IB 5DRWB 3VD7A 5EULV 1YMMA 4QRSB 3G5YA 1RK1A 5BW7C 1OCWL 1NCAH 1MVUB 2FGZA 2UYLA 2VWEC 3P77B 2CDGA 4QXTA 4JFXB 4OZFA 4XPAH 2GITB 5KVDL 5JOPE 2V9TA 1IGFH 5DK0A 3QFJD 4S11A 3D0VB 1UJTA 2XG5A 3RWCB 1MLCB 3VXSB 2Y6SC 3O3EA 4S1SH 4P57B 5ID0B 2X05A 1G7QB 2Z31A 5IEKA 2Z93B 1OGTB 4W81A 1I9RH 3ESVF 2E7BA 4MNQD 3M1BA 1G7MA 1S8DA 4NBZB 1A02N 4KZEH 4F37K 3C6LC 1N0LA 2AKRA 4U6XA 2XYCA 4HWNA 3H3PL 4IOIB 1MFBL 4G8GB 4GW4B 3QDMD 1IKNA 3NZHH 3KVQA 5CEZH 4TSCH 3ZZ1A 5HI4C 1B0RA 4OCRL 3G5VA 3KXFE 3TA3A 4XTRC 3GRWH 3QCUH 4GRWB 4RX4A 5DJCB 5DHYB 1QEWB 4FQLH 1SM3L 3CUPA 1VHPA 4H1LG 5FO7B 1QSFA 3QEQA 1N3NA 4F9PC 3P4OA 4LSUL 5E1AA 1F11B 1I7UB 5I8EA 3OGCA 3WJLC 3FB5A 5FA4A 3X14A 3QUZA 2VDPH 4OLYH 5JLZB 1S7XA 3P0VH 2O5XH 2R1XA 3ZHLA 3E6FA 4AENB 1L7TL 2WIMA 3VFOB 1NJ9A 2YD7A 3D39B 4ELMB 2YKLH 5MEND 4HBCH 3RWEA 1FIEA 1WFTA 1LD9A 4GXVH 2H2SC 3EFFB 2X4PA 4Q9RH 2NNAB 4HLJA 5E2VL 1B0GA 4JM2F 2HFEA 3IFOA 2XIDA 3W0WD 5F96L 3B2VL 3JV0A 1IAIM 1FJ1B 1F5WA 3ULVE 5E8DH 3MNWA 4PTUA 2AEPH 2YUVA 3OAYK 4R2GB 5CGYC 5DT1H 1DBMH 1ZVSA 4LCCB 5INDB 1J0IA 5I19H 2HT4D 1JUFB 4NNXB 1KPUB 2WK2A 1EHAA 2DBLH 2BVQA 4HWBH 2V5SA 5KS9F 3FJTA 3RVVD 1MCEA 2ICEA 2EDWA 5D70L 5HHVH 1U6AL 4BFGA 2X4TB 2EC8A 5EB9A 3KLHC 4ZG1A 3ROLB 4BH7A 3OB0K 3G6DL 3IFNH 1QPPA 2OL3B 2X4NB 3BMVA 4XC1L 3DBXA 4Q9QH 1Z0MA 1YQVL 4PJGF 3QO0A 1VEMA 3BN3B 5JIKA 4UUJA 3W9DB 5CBAA 2ZJSL 4LNRB 4YHOH 4WDIA 3E6HA 5L8KB 4M61B 4NRXA 5CEXA 2EC9T 3G6JE 3L9RB 1YYLL 4JZJA 3QIWD 4CUCA 2X7LA 2DLGA 4RGMC 3K8KA 5BS0D 1MRDL 5I74B 2PO6D 1P4IH 3RTQA 3STBA 4JFPA 1C5DB 4M62L 3LOWA 4H1LA 3MGOB 3REVA 5FO8A 2DL2A 3DIFB 1L4IA 1O7SA 1R3JA 1RZ8B 3HNVL 2ZCLL 1T03L 4OF5A 4F7TA 5IMKB 4I0PA 5IW6B 5J9PA 1NGQL 4HK3J 1U8LB 5HHOB 4ZFGH 3D6GA 4AT6B 2NY0C 4FNLH 4OGZA 4PRNB 2RR3A 3B43A 1CT8A 5AUMB 4PP2A 1MIML 3C5ZD 4QGYA 3SO3C 1CBVH 1BVLA 5T3ZD 4G5ZH 4N0FB 1NDMA 5HGBB 4UI2A 1JYXA 1HYSD 1N2RB 5FK9B 1XF5B 5F6IB 1K4DA 1WBYA 5CBEB 2ZSVA 3O9WC 5F3BB 1UKTA 5C0CD 4RZCA 4MAYB 5GGSA 3MV9B 4KROB 3HNTL 3MXWL 3PWLA 4NIKB 3DV4B 4YHYC 2A73A 4JAMB 2IALA 1PJ9A 3T0BA 4XP5L 4GSDL 2C3HA 2EEDA 5H35B 1H8NA 5D8JL 1YMME 3UTTA 4AMKL 2I25N 2XICA 2OQJB 4X83A 1RMFL 3K46A 4CJ1A 4OAWB 1P7KB 2CJUH 3TBSA 3GSOB 1JGUL 2GT9B 1MCHA 3O3DA 1VFOA 4Y5YB 1J8HB 3S35H 4YEEA 5JA8B 4NNYA 3ZKMD 4HWZB 3HMXL 1T21A 4LPCA 3GHBL 2XZQL 2Y1VA 4WO4D 4LCUA 5DTFB 1S5HA 2YK1H 1B0WA 2P5WA 3GMNA 3LAFA 4D2NA 4YDLB 4M7LH 4Z7VA 5ADOH 1MJ8L 4R7DB 5F8RC 4XBEH 3UTZA 5SWQA 3B9KA 4WGVB 1EX0A 3RGVB 4RAUB 1GZPA 3DTXB 5T1DL 3OSKA 4Z7UB 3ULSB 1UXSB 4WV1B 5IMLA 5E8EA 1Q72L 3QQ9D 3QIUC 1H8SA 4HJGA 2VYRE 1IAIH 4ODHL 4PJCA 1VDGA 4BYHA 1YEFL 3PNWB 5D1ZC 4ZTPL 3JWNC 3BWAB 4U1MA 2HLFD 3BW9A 3MFFA 4N8CL 2PYFA 1FNGB 3T65A 1U8NB 4KK5C 4KK6D 4XP1H 2ZG2A 1UACH 4PG2C 3ISWA 2ADGA 5KSAD 3GNML 1QSFE 3QEQE 4MA3A 4YXHH 4Y4HD 4D0BA 4XP6H 3A6BL 2YPLB 3MBXL 4MDIA 1TENA 2LABA 1FO0B 4Y5VC 5J4MA 3LH2L 3C6SB 2ITDA 5DGQA 3T09A 1J1XH 2XG4A 1NCDL 4Q2ZA 2G2RB 1QO3A 2AJVH 3KPSD 4HFUH 2VRAA 1PY4A 5L9DL 4UQ2A 5GRYA 2OX5A 1E6JL 3K74B 5E6IA 5IWLA 4JRXE 5T5FH 4OB5L 5CJQL 1A47A 3CMGA 1BPVA 5A2LH 1NMBL 4NN6B 4IIQB 1G7LA 4XMKH 3GJFK 4KC3B 4X6CA 1FNEB 2R1YA 5IBLD 4WWKB 4PRBB 3FQTA 1YMHB 3MODL 4YPJA 3IU3A 5F7LB 1MPAL 1CFQB 1IEHA 5B3JE 5ICXB 3LKRB 4POZD 2OL3L 4MSWB 4JRYD 4ONOA 5KJRH 1RZJH 3L3KA 3TM6A 1T2JA 5IVXF 2APVA 2Y36H 1EDQA 3LIZH 2VLKE 5D5MA 4K8RL 5FV2A 5FYLD 5TF0A 1INDL 1VADB 3FHQA 4FQXB 1TQBB 2HN7B 4LMQI 4EI5C 3S35X 2FECI 4YDIL 4X6EB 3PGCA 4HUMB 2VKXA 1D5XA 1DQQB 3QPQD 2DQDH 3NCFB 4HFWB 1KIQB 4UDUB 3CLFL 4D9QE 1HQRA 4CVXB 1XGYL 3MBEA 2BHUA 3VMPA 3CFBA 3IDJA 2D31B 3LS5L 2Q8AH 1N64H 1NC2A 4WY7H 1QR1B 2AJZB 2J7LA 4J23A 1U58A 2MHAA 4IRJB 4PGDA 3U0PB 3PJSA 1FVCB 3STLB 1PAMA 1IGIH 3ARGD 3WFCH 5D2NA 3P73B 4PJ7F 1GRWA 1SQ2N 1NUGA 3O45B 3FO1B 4MNGA 5CSBA 2D9QB 4NQDB 4YQXH 4OLUL 1YY9D 3O6FB 1D9KA 3RUGA 4XGZA 3D3VA 5DRNB 4YK4C 3AU1B 4ONGH 3CGTA 3EHBD 3EKCA 3JTTA 2JTDA 4DKEL 2APBA 4RISL 5SV4A 4K94C 5CD5C 5HVHB 2BVPB 3EJZD 3H42L 4KGLA 4PB0H 5IIEA 4O2EB 4WHDA 5C92A 5EWIL 2W9EL 1S7TA 4YFLI 2FB4H 1NL0H 2V9RA 5JW5A 1B4JH 3WV0A 3GSWB 3UTTE 1MJUH 2W59A 5SX5H 5K59F 1P4LB 5DC9B 3HZKA 3HS0B 5I71C 1MH5A 4ZSOB 4TUKL 2VITA 3B9VA 5INCA 2C1PB 3PL6C 3TJEH 2C3VB 5FYKU 4GJTB 5EBLB 5IK3A 3T3ME 1A3RH 2ICWA 5EFIA 2VLRB 2J12B 4Z7VE 2JCCF 2BNRB 5IBTH 5EIVA 3Q5TA 4XZUB 3FFCB 4N8VG 5CCKH 4HIIB 4KJPD 3F7YA 4IDJH 1AQDB 3V0VB 1DANT 1JCKA 2VDQH 2WQ8A 3I6KB 1QBLL 5GPRA 4KI5C 1EFQA 1R0AH 1PW3A 4MB5A 3T8XB 4GG6F 5EBWB 2OTUB 2F54B 2ZKHL 4OF8A 4PJCE 1P84J 1CGVA 1JL8A 4EOWH 4H0HB 4QHNA 2XOTA 4JY6B 5GGRB 3UYRH 4N5UA 2AI0L 2X70B 4PP1C 4G9FA 5F7NC 3TZVB 2YEZA 4HWUA 1L0QA 3SKMA 2D03L 3TBTA 3UJTL 2P7TA 3TPUA 1K85A 4GOSA 2A77H 4MWFB 4LIQH 3V4UH 5DSCB 1WK0A 4L8BB 5EZJB 4OLXL 1GPOL 1N8ZA 2C5DC 1GH7A 2OZ4L 4EJ1C 1LP9F 4XWGL 3UTOA 3EYOB 5BXFB 2NY2C 1KEML 1HHKA 5J12C 1QFPA 4FQPA 4GKSA 2VH5L 3ARDD 2W0FA 4C59B 4FFZL 4P2QD 2P24A 2GTWB 1JF6A 2R4SL 2WUCH 4DGVH 3FN0H 2JJSA 4JVWA 3AMKA 1CXLA 4X4ZA 1VB9A 4FXKB 3QG7H 1KJVB 2A6KB 4YX2L 1UWEH 3DSNA 5ESAB 5JW3H 4PJFA 5IJKA 1N59A 4KV5E 3ZE0E 4X6CE 1KFAH 3OF6A 4AEIH 4PLKD 3HZYA 1ZHBA 1TJHH 3WNLA 5MEQB 3WHXA 1I75A 2NMSA 4PREA 1HHHB 2RGSA 3U83A 4MA1C 1I85A 4Y4FD 3FRUB 3UDWC 1ZGLM 1F6LL 4ZO8A 3VFTA 4MB4A 2WUBL 1I8LA 1JYNA 5F21B 4UINL 5D5ME 3MGAA 5B4MC 4HIHB 5E4IA 3U30C 3QNZA 1ZGLA 5BCAA 2GUOA 2CR6A 2NW3A 2VAJA 4ZMAT 5A43C 1NEZG 4N8VA 5JDJA 4HUXB 2Y72A 3CH8A 4C56A 3WKNA 3UAJC 5E08H 1I7TA 2EE3A 1D5ZB 3TO2A 1EO5A 2B2XL 3D85A 5C0AB 3LEYL 4UU9A 1HIML 4J1UA 2IC2A 5FOBB 4HS3B 4NQCB 3KPOA 4D0DA 1WITA 2X4SB 1OM3H 4V2CB 4IMKA 5FB8A 4OD3H 1B90A 1F4XL 3NOIA 5JHDD 5D2NE 4K94H 5DMKA 3SGEI 3G9VA 4S10A 4F57H 4WHYG 5T1KB 3WFDH 4MNGE 1RIVH 4PRIB 5I8CB 2APTA 3QWOB 2APFA 4HKXA 4X4YA 1OARH 1ZT4B 2LTQB 4BZ2H 5F7WC 3MPCA 3IGAB 4MXVF 5IQ7H 5LQBL 1V5JA 1RZFH 4KJWD 5BRZD 1EVTC 2DLIA 1FZJA 4P3WA 1KC5H 2GFBA 2MCG1 3THMH 1CWVA 1G7PB 4TVPH 3DMMA 5KZCD 5EDXA 5EUOE 3I75A 2AV1B 1P69B 1ERNA 5DVMA 1INQA 1IGFL 4NPYB 5D96C 4QTHA 1I3VA 2IGFH 4X5XA 3INUL 1KPVB 4S1SL 1ONQA 5AD0A 3QRGH 3C6LB 4UNVA 4P4KA 5B3NA 3MUY1 1I9RL 4WEBH 1PKQA 3QUKA 1MHEB 4I48B 1A1OB 2D7OA 2QR0A 1MI5D 4O02H 4HJ0D 2AXFB 2VSDA 5D7LE 2H26B 4CW1B 3OV6A 4GRLC 5FAAA 1IGTB 5CEZL 3M17A 5FECB 3QJHA 4TSCL 1NEZA 3VXSD 1A22B 4ELMF 4Q0XH 5KSBB 1VGKA 4ZUWA 2CRZA 3D1MC 2BMKA 1K8DA 2BC4B 4DTGL 4ZFOL 2IANA 2OK0H 1TCMA 3FO2B 3KAAA 3QFJE 3OAUH 4OTXH 5K9OB 3MLWH 2I9TB 1JHTA 2W0KA 3X12B 1S9YA 1YN7A 3WFEH 1EFXB 1X7QB 4JZNA 4G42A 4K9EL 1MWAA 5MEOA 3BJ91 1BJ1J 3LSOB 2CDFA 3CX2A 3HFML 3FT2A 2NLJA 2COQA 4FFYH 4ZTOH 3P0VL 1WTGT 2BY0A 1AXSA 5J1TC 2B1HH 3KPMB 4HGWB 3QBTB 2G9HB 4P5KA 1OLLA 1FDLH 4M48H 4HHAB 3GB7B 3T2NH 1JP5A 4GXVL 5CINH 3WFHB 2Q7YA 4F7MA 4Q9RL 4YHPB 3BH9A 4ZUUA 3WSQH 2LVEA 3RJQB 5FCUH 1A6ZB 3BD4A 1OAQH 1MCIA 1A3LH 2UWEB 2HH0H 5E8DL 4BFIB 2HVJB 4GKOA 2WP3O 2AEPL 2WQRA 3SCMC 1BQHG 1A14L 3D39D 5DT1L 1C5CH 1DBML 2YPVH 4H0GA 4PJBA 3F65A 3S34L 5I19L 4P4RA 3HAEG 1XGQA 5IB2B 4Z0BH 4RWYH 1R5WA 1NANI 1EIBA 3ETBF 5JXED 1KJ2B 1H3GA 2Q1EA 4WIQA 1RJZA 1LEKA 1DN2A 1FGVH 3DETC 2FNBA 5MENE 2EXYD 4U1JB 3KLAB 3GMMB 3P4NB 2KPNA 2SEBA 3HR5A 2H32B 1IGYB 5C0FA 3CC5A 5CSZB 2OI9C 2OYPA 4Y5XC 4EIGB 4KUCD 1BOGB 4GLRI 2GYSA 4R2GD 4QLRA 4J3XA 2XXCB 5JDSA 3ZYZA 1GL4B 4RGMB 4YHOL 3LRHA 3O81A 5KG9A 2OMBA 1JWUB 5MHSD 3NCMA 4WFHE 3SKJH 3BH8A 1AKJB 3P9MB 4ENED 1CD1A 5JO5A 1PZUB 4UOW0 3WE6A 1P4IL 5CP7A 5FDWA 4PJIF 2DI9A 1JGDA 4OIIL 1GGIL 5LGJB 3MUZ1 1FVEA 1VENA 5F88A 2VQ1B 2NY0B 4FG6C 4RGNC 3MRGB 3TBVB 2XTJE 3FAWA 5IFAH 1X5YA 3NFPB 4OZ4A 4HXAL 3SO3B 3QEUB 4RNRA 5LG1A 3SPVA 4FNLL 3T4YA 1BFVH 2HFTA 4PJ5D 4D8PB 1CBVL 2FDBP 3MRRA 2IH1B 3O9WB 1C12B 1WZMA 4G6ML 5DR5H 2EICA 1RPQA 3U46A 4YHYB 3GMOB 3E0GA 2VLJA 1CF8L 1JZ5A 2XA3A 2YN3A 3LEXA 4H25B 1IGMH 3EBAA 1BFOA 5HDQH 4HBQA 4PYGA 4DUXA 1NBQA 3GUTA 2Q6WB 2PYEB 3QQNA 2Z35B 4AZ8A 3P0GB 3VWJC 5HHOD 5FUZH 4FHBD 1E4JA 2R1WA 4QXUH 2CJUL 1WLHA 4DKDC 5DZLA 3S3SA 5E56A 3HAEA 3S35L 3NTCH 3AREC 3OL2A 3VDCA 1ND0B 2UZXB 1XR8A 1CG9B 2ZP0T 1CGSL 3QHTC 2YK1L 1HKLH 4KROD 4N0UA 1SJEB 5HDLA 2QJDA 3WIFA 3IKCB 5C70A 1FNLA 4M7LL 3RY4A 1PKQE 4U31A 4XBEL 5EU6A 1TNNA 1UM6H 3QIUB 1KG0B 3WNNA 3NIFE 5DJYB 4DGYH 1MUJA 4KRPD 4KKLC 3K80A 3IETB 1UA6H 1SVZA 3BIBX 2CIKA 3F12B 4QKXB 5D7KD 1CFTA 1BMGA 1P7QA 5SWZD 1IAIL 2J8UA 1J8HD 4PLNC 3CLEH 3P2TA 1D5IL 1MELA 4BQ6A 3AAZB 3VXUB 3NIGF 3L3OA 4WFFE 4IRZH 5F9AC 2R0LH 1JYWA 4NO3B 2N1KA 2IANE 2W38A 1ZA3B 1H3PL 3DVIA 4Y1AB 1UACL 4L8SC 3R4DA 3QI9C 4OI8A 3CCHB 3RGVD 2P8MB 2PKDA 4YXHL 4Y5VB 4XP6L 2FHCA 4A6YA 1OTTC 1EJ6A 1YEJH 1WGOA 1IFHH 3NA9L 4POUB 1U3YA 5DO2D 1J1XL 4OLZH 1YEKH 4JVPA 4G43B 2BHZA 5JMOC 3IJSB 1V3MA 1A0QH 1QSZA 3CAFA 4MAUH 1HKFA 4HFUL 3G08A 2AJSH 2RCSH 5A3IC 2AGJL 4YIQB 4J4PC 1HEZA 3FB8B 3RIAK 1VKXA 4HGKC 1FH5H 4H5SB 2DMKA 3IF1A 1XGRB 3ZDYE 1X4XA 1JWSB 3HPJB 1XZ0A 3UJIH 4NUJB 5ENWA 5TGBB 1YEGH 3IYLW 5TDPB 3ULVC 5HTSA 3VH8B 2EDNA 1UXWA 5EO0B 1H5BA 4PJBE 1BD2B 5KOVC 4OKVA 2X41A 4EI5B 1HNFA 5CD3A 5KJRL 1RZJL 2GK2A 4ODTH 3WXVH 3LIZL 5FV1L 4QTIH 2HRPH 1OL0A 1DN0A 3REWB 5ESVA 1S9WB 3EO0B 3UROR 3KPQA 2V2XA 5IHBA 4XMLH 2F74B 1UKSA 1Z5LA 3TBYB 5J56B 3C8KA 3UZEA 1I7ZB 1ZLUK 1OT1A 1S5IH 1M71A 3L3IB 3RU8H 5I1LB 1U41A 4LHJB 1EEZB 1FYTB 3JV6A 2EDLA 4UV7H 3EOYG 1P53A 2EE2A 4GFTB 2IPUK 1JNHB 3QIBC 4WY7L 3H9HA 1GOHA 4AG4L 1U8HA 1XF1A 4MVBD 4LLVA 4JRYE 1IGIL 1QKZL 3PWNA 1HH9B 3WFCL 3UZVB 2HKHH 1W0VB 5FYLE 4GT7A 4MS8D 2H9GB 1F2XK 3JTSA 1AI1H 4M43L 1R24B 3SGKC 1DSFH 1R3HB 4YK4B 3X11B 2GHWB 3KPRB 3GM8A 4PB9H 4HIJA 5E2UH 2Z8RA 15C8H 4ONGL 2X5PA 1W72A 3GIVA 1CI5A 1JN6B 3ARBC 4RGOH 3BP5A 1A64A 5GGRY 4ZAKA 1D6VH 3WN5B 4WEMB 3LHPH 5HYSG 2MQCA 1X3DA 4E0RA 2FZ3B 2EDFA 4RA0C 4PJHA 4HSQA 4JPIB 5KW9H 3VI3E 2NY7H 3SDXB 2IFFL 1JZ8A 2AV7A 5I71B 3EJJX 1ZANH 1G9MC 2FB4L 3O6FD 1B2WH 1NL0L 1B4JL 2CMRH 3OB0H 5FGBC 5JW4N 1I1RA 3SGDI 3PL6B 1JHKL 5HGDA 1AP2A 4FZ8H 1HH6A 4QYOA 4OFIA 3WJJA 5CIPA 1FCCA 1A3RL 5EU3A 4KTEH 4QRQA 3OHXA 3UO1H 4RMUA 4N0UE 5F7EH 1JPGA 1DQMH 5IBTL 3UTSB 2Z31C 1HWHB 4LLWA 5EU6E 5CCKL 5TE6H 3ROOA 2VXVL 1T20A 5HHQB 5IEHA 1LO5A 2XA8H 3SGJA 1X5AA 1U8PB 1IQDB 1R0AL 2QSVA 1N5AA 4QOKA 3A6CL 3TO4A 5GS3A 5T5NF 2L7JA 2V2TB 5F7MC 2J8UE 5DYOA 1G9NL 3SY0B 5LBSL 1PD6A 2J88H 1IKNC 4HUWA 5FKAB 2NX5B 2V6HA 1P6FA 5HDOA 1OP3K 3V52L 3VXNB 1RUQH 4EOWL 2VLRD 4KQ4H 5F1OB 2HJKB 1U8IA 1IKFH 3UYRL 2DYPB 2BNRD 4OV5A 5DK3A 5AAWA 1C5BH 5EIQA 3FFCD 2VLLB 1KLGB 3BHBA 3O3BA 1IC5H 5JZ7D 3FZUC 2YRLA 4F33B 2N56A 1U8OB 2A77L 5IM7B 3V4UL 1UZ6F 2BY3A 2O5YH 1PG7H 2NY2B 1IQWL 1GC1C 4AYFA 5ANMB 1UB6B 2X42A 5J12B 1QVOA 3GDBA 4OGYL 2F54D 2EKSA 3CK0L 2OTWA 3QUZC 4S1QH 4Y2DA 3D69B 4PJAF 3ULVH 3WUWB 4OT1H 3B83A 2WUCL 2DOCA 4KDVA 4MCZB 3CXHK 2YPKB 5EZIH 3DXAA 3I3EA 5HYSA 3I3BA 4P46A 1X4YA 4M6OH 1FBIL 5TDNA 1QFHA 1FLTX 5GS0H 3M45A 4PJXF 4ZS6D 4IM8A 4QRPA 3QULB 5JW3L 1JNNH 3X3GH 5E8OB 1AQKH 4ODUA 4IMLB 4PJEB 1KFAL 1JJUA 4NDMB 3IJHA 4MA1B 3SDCC 4AEIL 2YN5A 1HZHL 1TJHL 5B39B 4ZYKB 3VFSB 4MNHB 1YY8A 3VD5A 3CU1A 3U30B 3CFKA 4R4ND 4DZBA 4PRHA 2BOCB 4JDZA 5EU4B 3O41B 4P2QE 4X8JA 3BP7A 4LOUD 1OW0C 2CUHA 3S5LG 4R90L 1PVHA 4JFHD 1A7PL 1UM4L 4Z7NE 4E41A 2B1AH 5E08L 1NH6A 2GJZA 1WISA 4TSAL 1AGEA 3M07A 4RQQA 4TNWF 2V7HA 1KXQE 1AHWA 3OXSB 1GJIA 1OQXA 1S9XA 4QEGA 4L29A 5ESQB 4UIKL 4JZJC 4NKMA 2JK5A 4OD3L 2F8VA 3GM0A 1N7MH 4UOJA 1NC4A 1QLRA 4LVNC 4L9LA 2I07B 1OSZB 3WYRA 1S3KH 2J4WH 5MEPB 3RTQC 5EPMB 1PDKA 1WFNA 1FG2A 2FATL 3WFDL 5I75C 1RIVL 1YEDB 3QEHB 5C0AD 4TVSa 2V7NA 2EO1A 2RJMA 2DLFL 2E9BA 4BZ2L 5L88L 4RDQF 4E5XA 4I77H 1PG7X 4OF3A 2C1OB 4ISVA 1UWGL 2OR7A 2FSEB 4NQCD 4P2RA 5IQ7L 1RK0A 3BP6A 3OKKA 3W2DL 4H8WL 5E95B 3MRFB 1T22B 1MY5A 1KC5L 4OZFH 1OAXH 4OFPA 5D96B 5T1KD 4PJHE 5KVGL 3QDGA 4TVPL 3EFDH 4TUJA 1CE6A 4PRID 1J1PH 2MNUA 3PGFH 5JHDE 3QXDB 3DX7A 5CEYA 1TZHB 2IGFL 4JM2D 4L3CB 5E1HB 3GSXB 4OZIB 3MO1B 3QRGL 4XCNB 4XBGB 2ZUWA 4WEBL 4YFEA 2GQHA 3LMJH 3MJ9A 2GAZB 2R0ZH 4L4VB 5BVJB 3HUJE 4GRLB 4N0CC 4MJIB 1DBJL 1RZIA 1ED3B 4PGEB 3VRJB 5K33A 3QUMA 1AFVL 3O2VH 4M3JA 5EO1B 1WQVT 4M7JL 2Y6SD 5EO9A 2EH7L 1DDHA 5CS7A 2BSTB 3B2UD 2C4FT 4BK4A 5TDOB 5FYKH 1QRNB 4Q0XL 1J87A 5C6PB 1A1MA 4P99A 5HSFA 4PJDB 5D7JA 2OK0L 4GKZA 4QOKE 4R8WL 5I1IH 3OAUL 3V0WH 2AK1L 3M8OH 5C6TL 4R3SB 3LEVH 2H3NA 2DWDB 5E5RB 1ORSA 1AR1C 4Z7QF 5FA3B 4ZQKB 5IGXL 3RNQA 1K9TA 1MI5E 1BIIA 4FFYL 4ZTOL 1DE4B 4WJ5B 1ZHLB 4H26A 5EA0H 5D7IA 3LKSA 3P9LA 3KWWA 3VWKD 3PABB 4J3WA 3BEVA 3QEGH 4NCC2 1RIUH 2OLDA 3NH7H 1IMHC 5CINL 4U6YB 1XEDA 2CRYA 3MRQA 2DQUH 2ZUXA 4JQIL 1QSEB 3H9SB 5FCUL 3SCMB 1OAQL 4FQHB 1T7XA 1WCQA 1A3LL 3L7FB 2HH0L 5DJ8A 3DXAE 1IM9A 3MR9B 2DMCA 5DHVA 1F4WH 4OZHE 1M4KA 1C5CL 4K07A 2YPVL 1M7IB 2H2SD 3PHQB 5FUCE 3PQYD 1EAPB 5DJZA 5KTEH 3RNKB 4Z0BL 4QRPE 1U95B 1D5BB 3IXAA 4NHCL 5KSVB 5D2LB 1FGVL 3OAZK 3HTLX 4KZDH 4Y89A 1JPSL 1RUPL 4U7SA 1S7WB 1IAOA 2OI9B 5ID1A 3HE7A 4X7TA 4D9LH 4Y5XB 4OI9A 4YHMH 3CDCA 1L9NA 5C09B 2FJHB 3G5XB 2BSRB 5CGYD 5LCVH 3RL2A 2LE9A 4RMWA 1ZT1A 2NQCA 1YPZB 5HHPA 1Q0YL 5TF1H 4AQ1B 5DF0A 4OBRA 1EGJL 3HKFA 2D0FA 3ARYA 3PWPB 2NXYD 4RFOL 1M05A 2EIDA 5DVOA 4DFIA 1VACB 3E1F1 3LD8C 5IG7B 1IM3A 1L9MA 3IDYC 4RGNB 2AW2A 3U6RA 3CFDB 1IZKA 5I2IB 4KTDH 2XNAA 4MD0B 4LU5H 4NJAH 4DN3L 1OWWA 5IFAL 4NCC1 4OCSH 1A7BA 4YDKH 3FO9A 25C8H 4BSVB 5IB1B 4JDTH 4HX1A 5SX4I 1AKJD 5D2NC 4ZFZB 2G5BB 2PXYD 3VJ6A 3Q3GB 1CFNB 4QRTB 4HKBB 1CDBA 1CDYA 2ZSWB 4BSWA 3RWJA 1RJYA 4YUEH 1NCTA 1XGUB 5DUPH 3R1GH 4LLUA 3BUTA 4NQTA 4L3EB 4CU6A 4NQSA 9CGTA 1AR2A 3C87A 3VWJB 3L6FA 1YEIH 1IGML 3AGVA 1XF3A 4P2RE 1D9KC 1A21A 3HZMB 2NY0D 3IDXH 4LSQH 1JFQH 1ZOXA 5CILL 1F3DH 4U1SB 1G7IA 5FUZL 4Y16C 1DBBL 4CU7A 4HUNB 3CSBA 4DK3A 2FIKB 1A6UH 5DEFA 4G8FB 1EBPA 1MFCL 3AREB 1Z2KA 1OAKL 4QXUL 4JANB 2IQAA 1G9EA 5KSUB 4LLDB 4WCYH 1O5DT 4JJHA 4N90E 4XHJC 4WU7B 4GBXA 3UTPE 2CIIA 4PJ5E 1QFOA 3HMWH 1HKLL 5BOZG 5IESH 4GAYA 1KBGL 1X5FA 2PYED 1F02I 1YC8A 3MV8A 1UM6L 3RIFK 4WW2F 3SN6N 5ICZB 3SQBA 1YNKH 3X17A 4JDVA 4DGYL 3C5JA 5K9KA 3DI2B 4NO2A 4EI6A 2FRGP 4YAQB 4NHUA 1UA6L 5L0QC 3TWCL 3GMRB 4YLQT 4LNVA 2BZDA 3CLEL 4TRPH 1T2QH 4ZPTA 5I1DB 2B4CC 3KXFB 4L8SB 1NPUA 1R3IH 2MTPA 3QI9B 1LEGB 3MLUH 5T3XD 5KN5A 3KR3L 2YA0A 3LKQA 5DJ2B 4CMMB 3W5NA 1A3QA 4Z7WF 4J12A 2OR9H 4LLQB 1EHLH 4Z78B 2ATKB 4L8DA 3IXTB 4PY8J 1I9IH 3FT4B 4GMSH 3TIEA 4HS6B 1FZMA 1IFHL 1AO7A 1C7SA 3ZLQC 4YHKH 3O8XA 2RFXA 3LS4H 4UV4H 4RRPG 1T2XA 3VXUD 4D0CA 4OLZL 1YEKL 2B7DT 5D7IE 5D7KE 1A0QL 4MAUL 1H3UA 5SWZE 4WUUA 4Y1AD 2AJSL 2RCSL 1CDJA 5CWSB 3CSYB 2KDGA 4K2UH 4G3YL 3ZT5A 1HDMA 1Y0LA 3RUGF 5I1GH 4QT5B 5BJTB 4LK4A 1ACZA 4GXUM 1YEGL 2CPCA 1RUKH 2JIXD 3FOMB 2JJSC 1KCUL 4JFDA 1AGBA 2QBWA 3L5XH 4M8QB 4KHXH 1F90H 4KY1H 1WAAF 4AJ0A 1TZGH 4NZTL 1KCSH 1VFBB 3EW3B 1YNTB 1UADC 1MREL 1UZ8B 1BQUA 3GBMH 1W2KT 3WXVL 5J11C 4YJZL 2VKWA 4QTIL 1KCVL 1MHCB 2X4RA 2HRPL 3WHE0 5IJKC 1E4XH 1E28A 4KMTH 5GZOC 3LN5A 4S2SA 1CIUA 2FO4A 1FLRH 2I9LA 2C7UA 2XWBA 5F89B 2J6EA 3D18B 4BM7A 1I85C 1BM3H 5HHXH 1AGDB 2ITCA 2VDOH 1TVHA 3RU8L 4AQOA 1XGPB 2FECL 3QUXD 5JOEA 3QIBB 1I8LC 3DGGA 3ZYJA 4LCIH 1BD2D 1DQJA 4UV7L 3G6JB 4EI5D 1J1OL 2H8PA 2ADJA 1S7VB 4KDWA 3V6OA 4OQTA 1OF2B 4L4TA 4LGSB 3U7WH 4U1LA 2DI8A 2QADD 2EDKA 3V8CA 1ZVHA 1LNUB 2HT4C 2HKHL 5E94A 1AGFA 3GMPB 4ETQA 5IW1A 1KB5A 4KPHH 4AM0A 5MERB 1I1AA 2Z9TA 3DWTA 2R2HA 3QR2A 1E27B 2PTTB 1FYTD 5JHLL 1YUHB 5EZLA 2XTJC 4IMKC 3ARBB 4EUPG 1UEYA 4P5MA 5E2UL 5I0ZA 2VZTA 15C8L 2F19H 4RRPA 3KYOB 4X7EC 5D1XA 3H3BC 4RGOL 1I8KB 1WBXA 4E9LA 2CLZB 2V5TA 1D6VL 2HLAA 3LHPL 3MNZB 1FZOB 2OJEB 3EUUA 3CFJB 5E2TH 1EAJA 4I3SL 3QIWC 1CFSB 4NO0B 5AYUH 5KW9L 2NY7L 4EBQH 4CMHC 3KPLA 1S9VA 1CTOA 5KVFH 2DQGL 1YMMB 5GRXG 3G5YB 3KPRD 1B2WL 2APXA 1RK1B 5DEZA 3UZQA 2UYLB 1X5KA 2FHFA 5DS8A 4QXTB 1TETL 3UJJH 4OZFB 3B9AA 2EIZA 1V7NH 1DR9A 2J8OA 5E6YA 1A9BA 3TIDA 5FHAH 5M95B 4ELKB 1MCQA 2Z31B 2B4CH 1Q9LA 2OR8A 4KTEL 4PJFF 1RFDL 3GSNH 4NCDA 1W8NA 4BSJA 3UO1L 4OD1H 5F7EL 1DQML 2Y23A 1S8DB 2DM7A 2EEBA 3I3DA 3MV8E 3PHOB 4P4KC 1HYSC 3ARVA 2AKRB 4U6XB 2QQLH 5B21A 5TE6L 2XA8L 3SDYH 4WI3A 2CRIA 2DJ4A 1A7NL 1NUFA 4S1DC 4RBPH 2E7LC 1NFDF 4GXUN 4UDTA 1BVKA 5IQ9A 1CLOH 4LVHC 1B0RB 3HRZA 3RWGA 2EZ0C 5F1IB 3G5VB 3L5WA 2BSED 1BBDH 2G75A 4QY8A 4KQ4L 1N4XH 5FIEA 3UTSD 1C5BL 1QSFB 3QEQB 1I3GL 5D72H 5KVEH 4RMTA 3P4OB 2CK0H 3U4BH 4N68A 3CFIC 3ZKMC 5I8EB 3OGCB 4MMXC 4WO4C 1UEMA 3FB5B 4NYLA 1ZHKA 3X14B 3MC0A 4PJEF 3QUZB 3FHAA 3TT1H 3ZTJG 4F15C 1S7XB 4P2YA 4YR6A 3WS6A 1AGCA 4OM0L 4R9HA 1SJHA 1UKQA 4JHAL 3ULUE 4EUPA 2ICWJ 1MCDA 2NX5D 4PP1D 3CU7A 2P43B 3MRLA 3U36A 4Z77A 3QT2A 2HKFH 3RWEB 2VZ1A 2VL5A 3QQ9C 5E2WH 3V5HA 2DYPD 4OT1L 3ZMRA 4PJGA 2RAMA 4WUUE 3BSZH 4MJ5B 3L7EA 1LD9B 4JKMA 3K2MC 5EZIL 4PLOB 4JRXB 1TTGA 4C4KO 4X99A 1B0GB 3JUZA 4O58H 2HFEB 2NY2D 4B41A 1X5LA 5GS0L 4JY4B 4NZUH 3GFUA 2PF6A 5FXCH 1FL3B 3X3GL 3MNWB 4PTUB 1F42A 3LV3A 3ARUA 5KSAC 3MRBB 2R56L 4DUVA 2YC1A 4JFDE 1E4WH 1ZVSB 4NM8H 4HXBH 3MV7A 1AY1L 4HK3N 1IEAA 3CVHL 2D0HA 1AC0A 3TT3L 3OKOA 3S36H 5GGTA 1LE5A 2VLKB 4HUUA 1W72L 2CLRB 2BVQB 3IB4A 5CJBA 5IOPB 4HV8A 4DVBA 2Q76A 3EYQC 2ICEB 3CZFA 3QXWA 2IMMA 5CUSH 5EC2A 4BH7B 3Q1SH 3DYOA 2B1AL 4E42A 2VDNH 5L2JA 4LKCA 3TFKD 2YBRA 3QO0B 2E3VA 4UUJB 5CBAB 3RDTD 4WDIB 3E6HB 2ARJA 5B4MD 3IFPB 5CEXB 3D2UB 4JZJB 5IB3A 3W82A 5AEAA 3V6OE 4LVNB 1ROWA 1KOAA 4L4TE 1KIPA 3H9ZA 4HJJL 4YDJA 3RTQB 5TE7H 4JFPB 3UAJD 3MLVH 4J6RH 3VFGH 3RWIA 1UB5A 3REVB 5I75B 4LSSH 2QEJA 1DZBA 1JGVH 1AXTH 3OB8A 1S3KL 5BVPL 5CLWA 1KN2H 1Y18A 4X7FC 1KTRL 3MLPA 1KF9B 1FN4A 5FGSA 4HULB 4JG1H 4QXGH 4N0YH 1I8IA 3ELAT 2VE6A 4PP2B 3EYVA 1BVLB 3QPQC 1KLFA 3EGSA 1NDMB 2QKIB 3O4LA 2FX7H 3CNKA 3K8LA 5T1LB 3BXNA 3WS3A 3ABZA 1WBYB 2X4OA 2ZSVB 4RMQA 4FABH 1JZ6A 2FEEL 1OAXL 5GGSB 1FZKA 3FB6A 5J57B 3PWLB 2A73B 2IALB 1XIWD 4K55A 1JYVA 1DTUA 3HC3H 3PGFL 5T3ZH 2DQFA 2F53D 3UTTB 3ARGC 4CDGC 5CHNA 5E6ZA 1IC7H 3TBSB 5IUSA 2HP4A 4HCRA 1UH4A 3KG5A 3O3DB 4V1DD 1JV5B 5TE4L 4NBXB 1T21B 5JR1L 1A7OH 1MCWW 2M1KA 2R0ZL 1YY9C 4LCUB 3F5WB 1S5HB 2BERA 4Y8AA 2IADB 3GMNB 4XNQB 3O2VL 4Z7VB 1NMCC 3KYNA 5DK2B 3S36X 3E8UH 3ECBA 4LFHD 3UTZB 5JIIA 5SWQB 1L0XA 1MFEH 4S0SD 4X80H 2D7TL 5FYKL 1U91B 3FONB 2DS4A 3OXRA 5E8EB 5IMLB 4MA7L 3QNYA 3RRQA 4HJGB 2FR4B 5I73C 5I1IL 2A0LC 4HZAA 1IT9L 4YDVA 5EORH 4PJCB 3M8OL 4L4VD 5EU5B 4GRLD 2CKBH 4MJID 4U1MB 3BW9B 4HEME 3MFFB 2D7MA 4JE4B 3T65B 1KACB 4UT9H 4WHYH 5HYJA 2ADGB 3L3DB 3V2AR 4MA3B 4D0BB 3H0TA 1QRND 3C5SA 4WGWB 1F97A 2Y7QA 3TYFA 5IVXA 1BFTA 4FFWC 1FNFA 4BQ8A 2ATPA 3L95A 5KS9E 4NFCA 5FFLA 2RHEA 4F37F 3QEGL 1U92A 2XQYK 3I6LE 1RIUL 3OJDA 3C08H 4Q2ZB 3U4EA 1QO3B 5I17A 1KELH 3VRIA 4EQ3A 1JZ3A 2KZWA 5ILTH 4UQ2B 4PJGE 3F7RA 4FQ1H 2XPGA 3TN0A 1RUMH 4IS6A 4Y4KA 5C0RL 1T0NA 2BHYA 3ORJA 2BP3A 5DVKA 2BNQA 1AD9A 1ZS8A 4WFED 4X6CB 3QNXA 5HDBF 2R1YB 5DUBA 2MKWA 2CO6B 1OAUH 3FQTB 5TH2A 2HFGL 1R5VA 1HI6A 4PJ7A 3V6FA 3MV7E 4D9LL 3SKOA 4YHML 1QSED 1O7VA 3H9SD 3SCMD 1B6DA 3L3KB 4HZLA 5LCVL 5J0BA 1T1ZA 1H5BC 1MOEA 1YEEH 5HPMA 5HHMD 3QCVL 2EE9A 1M6OB 4PG9A 1H9VA 3JWOL 4NSKB 3NPZB 3PGCB 1F4AA 2O93L 1EXUA 3ARDC 1KCRH 2R0KH 5TF1L 3OJVC 4HIXH 1D5XB 1CTNA 3LD8B 3RZCA 4R0LC 4B50A 5KAQF 5I9QC 1UVQA 3BQUA 3IDYB 5FYLH 1RURH 1MIEH 3PQYE 4M6NH 1U3HD 3BISA 5DLML 3FCTA 5DI8B 3CFBB 3IDJB 5C09D 5T33H 3T0EA 2UUDK 5GXBB 3QUYA 4G8IA 2WLZA 1QA9A 4M7KH 1NC2B 4RAVA 4R26H 4LKXA 4KTDL 3WNPA 1WCBB 1U58B 4TNWK 5C0BA 5DRZB 4PGDB 2DQJH 4LU5L 4NJAL 3W9EB 4PJ8A 5D2NB 4NZJA 4OCSL 4TOYL 4UB0L 25C8L 1FG9C 4O4YH 2F15A 4Y4FC 3PWPD 4MNGB 2DB8A 1A5FH 4NZDA 3BVNA 4OCWH 3MRCB 2AXJA 2HTLC 2VZVA 1OGAA 4AL8H 1D9KB 4XHQA 5DUPL 4FG6D 4NWUL 1O0VA 3QWQB 1YEIL 3IDXL 4Y16B 3DHJA 4LSQL 1JFQL 5FYJL 4OZGF 4OGAD 3GIZH 3VW3H 3ARFA 3QHZH 4GG6A 1A6UL 5EUOB 1MCKA 1CGXA 3MYZA 3Q5OA 3C2SA 1U42A 4WCYL 1DLFH 5HGHA 5SWSA 3P4LA 3HCVA 1RHHA 4FQIH 3HZKB 2P8LA 3HMWL 3VWJD 2E8YA 5C9JA 1HCVA 1MH5B 5IESL 1RUAH 1KYOK 4QCIA 5FKPA 3ZYOA 5JMRA 1LDSA 3MYJB 2FBJL 5JQ6H 2BJMH 3GI9H 2OP4H 1U3JA 4LHUG 5IK3B 3H2WA 5L0QB 1YNKL 1LP9A 3DHMA 5D7LB 4C83A 3ARED 3WJJC 3LRSB 1CXFA 1JPTH 5JOPD 2XFXA 3GSNB 5IVOA 5B38G 3F7YB 3NA4A 4TRPL 4JLRA 2Q7NA 3QFJB 4TTDC 1KN4H 4FQQA 3SGJC 4KKLD 4I4WA 5K9JH 3HC0A 1RJLA 2OR9L 3TO4C 3VA6A 3VE0B 2HA1A 5A2IH 4QHNB 2JJTA 4GMSL 3VFRB 3WHE1 1IZJA 2LAGB 4YH6A 2WP3T 4LL9A 1ZTXH 2ENYA 4U6TA 2YEZB 3TBTB 5D1QA 5DD1L 4YHKL 5DD0H 1NLBH 2P7TB 4HC1A 4UILL 3TPUB 3LS4L 5ITBH 3KXFD 3KNBA 2PTUA 1I8MA 4KKNA 2K1MA 3QI9D 3FL7A 3PWVB 3MLZH 5TQ0L 4QNPF 3TLRA 5IVXE 3WNOA 2N7BA 1T0PB 1Y6MR 5DURB 1N8ZB 5F7DA 1OTTD 4HDIA 4ONHA 4LSVH 4QHMB 4L5FH 1HHKB 2GSIA 4GKSB 4K2UL 3O2WH 1CICA 1NDGB 2W0FB 5GS1A 4ZXBA 2P24B 4F2MA 1WEJL 5I1GL 4Y2DC 5DXWA 3CVIH 4KVNH 1U8KA 4UBDC 1K2DA 4XNZC 1RUKL 2L7UA 3SKUD 4OF6A 3L5XL 5BOPA 5A3ID 4HMCA 5J11B 4J4PD 4KHXL 3T4AB 5AG8A 5I30L 4P23A 1DL7H 1L6XA 2BNQE 1N59B 2V17H 5FUCC 4JKPL 1QFWM 4NQXB 1ZHBB 4JFXA 1G6RL 4Y19D 2BK8A 4MMZC 4NQEA 5HVGB 4PJ7E 5MENB 3IAGC 4KMTL 4JY5L 2ADIB 3RWCA 3ULVD 5ID0A 4LEOB 2Y25A 4LHUA 3VFTB 5GS2D 3N0PB 4RFEB 1BM3L 5HHXL 2VDOL 2YD3A 3QNZB 4HKJA 4JB9H 1Z9SA 1V8HA 2NW3B 4LCIL 3GK8H 5DDHB 1HINH 4N8VB 5B38A 1I7TB 3HMXA 3DRQB 3TO2B 4G8GA 3U7YL 4G80B 3U7WL 3D85B 4S0TD 4YGVB 5A16B 4XP9H 3T0EE 4KPHL 3MLRL 5F7YC 1Z9MA 2LV4A 2XTJB 5FB8B 5K59E 2HG5B 5DQJA 4ETYA 5C0BE 5AWNH 3QIBD 4MLIA 5TFSH 4OSUH 5E99H 3NBNA 2VMFA 3CSGA 2A83A 1F11A 4P9MH 1I7RB 3N1QC 1OB1A 3DYMA 4K7PL 4L9LC 1YEHH 4XVSH 1BP3B 3MLYH 5JLZA 4O5LH 4X4YB 1WWWX 1OGAE 5HY9B 3QIWB 3SE9H 4I18A 2JCCE 4GQ9H 4AENA 2YUZA 5BS0B 4CMHB 1FRGH 3WD5H 5EBMA 4FS0A 3VFOA 3ARZA 3QJFA 4R4BA 5E2TL 4ELMA 2AEQH 1S7QA 5MP6H 5AYUL 2NXZD 2ICCA 3SDDA 5KVFL 5SX5K 1FZJB 3MRIA 1IC4H 2GFBB 3ARBD 3WKML 4GG6E 4K71C 3LRGA 4ZPVB 3TVMA 1V7NL 5AZ2H 3GSRB 2FX8L 4LEXL 4QTHB 1K5NA 3QDAA 1RJCA 4FRWA 5FHAL 4CVZA 5SWSE 1ONQB 3K8MA 5AD0B 5GRVL 4LCCA 4YHLL 1T1YA 4P4KB 2YWYA 2LU4A 3GSNL 3DGCR 1JUFA 1PKQB 3QUKB 4NO0D 4OD1L 4DKFL 2WANA 4NNXA 3RWHB 1MAMH 1YMMD 3D25A 3QXAB 4JFYA 3LKOB 3SGEH 4UQ3B 3T1WA 4XXDB 4ZO9A 1LP9E 3SDYL 4LVHB 5F6HJ 5IHUL 3BZ4A 3ZKXC 2X4TA 2FX9H 4NKIL 3WLWD 2VZSA 7FABH 2D7QA 1GCFA 3OR7A 3QJHB 3IDIB 4CN4A 1NEZB 3OG6B 2OL3A 1VGKB 4ZUWB 2NYYC 2Z31D 4KAQH 2UVEA 2BMKB 1K8DB 1BBDL 3H3KA 4KWUA 1JHLL 1N4XL 5C3LD 3RX8A 4M61A 2HVKA 2M8XA 3L9RA 5KVEL 4JPKL 4WO4B 5D72L 1S9YB 4ACPA 1FORH 5D7JC 5FM4A 1D3CA 2CK0L 3ARTA 4JZNB 2PW2B 4G42B 5F72S 4F15B 1QFWH 1MWAB 4HK0A 5EH1A 5MEOB 2CKBB 4MZ2A 1T5WA 2XQBH 3TT1L 1VPOL 3DIFA 1NBZA 4XPGH 1KSRA 3FT2B 2NLJB 1NMAH 3S96B 1RZ8A 2AVGA 4YE4H 4YXLL 5IW6A 3CZJA 4XNUL 2DF3A 3VG9C 1NBVH 3V4VL 1U8LA 4P5KB 5C0GA 4KRPC 3TA3D 4RX4D 2HKFL 4AT6A 4CJ0A 3FZUD 3NACL 4ZO6A 1SHMA 5AUMA 1QSFD 3QEQD 1S7UB 5DWUH 4F7MB 3TCXA 2Q7YB 4ALAH 4ZFFB 3BH9B 4ZUUB 3TESA 4MJ6A 1N2RA 1X5JA 1XF5A 4DN4H 5KSAB 1IAII 3QUZD 5EOCL 5CBEA 4NZUL 2NPLX 3KYKL 4G6FD 3DSFH 5F3BA 4XMPL 1KIRA 4GRWH 4MAYA 4PJIA 3MV9A 1CDHA 1N6VA 3RGVC 2FWOB 3PP4H 1E4WL 4NM8L 4HXBL 4PJBB 4P4RB 1XGQB 4CBPA 1FL5A 1OAZH 4M4PA 1FFRA 2VDMH 3S36L 1R5WB 1Q9WA 1WF5A 4M9PA 1RJZB 1LEKB 4JFEA 1HWGB 4LLMA 3GSOA 5DO2C 5C0NC 2GT9A 4NQEE 4Y5YA 2F8OA 3WIIH 2SEBB 3DI3B 4NKQB 5CUSL 4PGBA 4I3RL 1OWRM 4L9DA 5F9JA 3S9DB 4LF3A 2A9MH 3N9GH 3RVWD 3CC5B 4OJFH 1G0XA 4HT1H 2HFFA 1EH9A 4DVRH 5H8DA 5D9SB 1GYAA 2DIBA 4QHUB 4MXVE 1CLZH 3S7GA 1CZ8H 1PX3A 3AROA 1UXSA 4N9OB 2VABA 5J1SC 4UT6H 1CD1B 4JO2H 5JO5B 5F44A 1WZKA 2W9LA 3FB7B 5CP7B 3ESUF 5FDWB 4JRYB 4M8VA 3VFGL 3MLVL 4J6RL 3MACH 1JGDB 1EBAA 4LSSL 3PNWA 2EE6A 1FNSH 5DFVD 1FVEB 5AZEL 4D9QD 3BGMA 4I3GA 5F88B 2J5LC 4OF7A 1U8NA 4JM4L 1SJVA 3RY6A 4OZ4B 1GHFH 1QOKA 3RI5K 3WIHL 3SPVB 4QXGL 2FH8A 3T4YB 2DWEA 2YPLA 3BPNC 3LVEA 1W8OA 4KKAC 5ITFA 4R4FL 4HW6A 3T3MF 1BGXH 4OCXL 3RTQD 2FX7L 3WUZA 5L2KA 1ORQB 4CVUA 5BZDA 3WNKA 3BKML 3C6SA 3U46B 5F1NA 4I9WE 4U3XA 4HUVB 3VGHA 3LEXB 3NFNA 5I1JH 3W11D 1BFOB 5ALCH 3DX9A 4ELME 4I0PD 3LQZA 3GUTB 3ARGB 2A6DB 4PY8I 1BZ7A 5T3ZL 4XVJH 4KUZH 4BKLB 2OZ4A 1NGYA 5F9DC 2VQTA 2R1WB 1IC7L 3MRMB 1BQHB 3IFLH 4MS8C 5E8PA 1A1NB 4IIQA 5KBNC 3O11A 1QTYT 1FNEA 1Z0NA 35C8L 1NMCB 5HVWA 1NBYB 3QUMH 3H7BA 4WWKA 4PRBA 1XR8B 4O2CA 3FFDA 2VR4A 2HWZL 4N0UB 4OUUB 1ZVYA 4GBXC 5D71H 4MSWA 5EU6B 1C7TA 2YSSB 1FSKC 2H41A 3UTTD 5I73B 5DUML 4FQXA 4U6HA 3T3PF 4ZUSB 5LGHH 4GRMA 1V05A 2CIKB 2F53E 1CFTB 1DQQA 1P7QB 2VXQH 2J8UB 4QWWC 1IAKA 4HFWA 5GJSH 3TCLA 4BH8B 4DAGH 1KIQA 4BQBA 1MCOL 3ZSTA 2CKBL 4CVXA 2P5WD 2BCKB 2I60H 4V1DE 2VZ3A 3B9KD 1CLCA 4CU8A 1J86A 3K4ZA 3AXLA 3DX6A 4F7EA 4P9HC 1RAMA 2UY6A 4W70A 2ORBH 5GRZA 1QR1A 2AJZA 3T0DA 2DBJA 4IRJA 3U0PA 1G7HA 2BNUB 1FVCA 3STLA 3O6LL 4JO4H 3CH1B 4S1RH 4DCQB 3ILPA 3FO1A 1AR1D 4L8CA 3C08L 3O0RH 4NQDA 5I1KH 1KELL 2AK4A 3ULUC 1BQLL 4DZ8B 2L0DA 1BBJA 1K3ZA 1ETZA 5DRNA 1HEZB 3AU1A 5T5NG 3CXDH 1VKXB 1RUML 3IF1B 3D0LA 5H94A 3P30H 1FQ9C 1AIFB 3PP3H 3WO3B 5ENWB 3TV3H 3MA7B 3PHSA 1F3DJ 5I1HL 5I18H 2VDLL 1G6VK 4NUGH 4PJIE 5IFJA 2RQ8A 2XQYG 5HGAB 1OSPH 4WWID 5D6DA 4X0KB 4IDLA 4Z18A 1CYGA 2LU3A 1UXWB 1H5BB 2P8PA 4OKVB 1CR9H 5F1KC 3DOSA 3GSWA 4K7PY 5CD3B 3V4PH 2I27N 4GKNB 1FO0H 3HS0A 3ARDB 4TQEH 5E6ID 4JFEE 4P2QB 1DN0B 3BE1H 2VOTA 1BX2B 5ESVB 1QLFA 4R0LB 4YEFA 3EYSL 2HAZA 1KCRL 5I9QB 2R0KL 1JGLH 2V2XB 3O2DH 5EBLA 1Z5LB 1M71B 4OKDA 3AS1A 3JV6B 1DUZB 1MIEL 3EO9L 2YD5A 3V0VA 2GW5A 1D5MA 4WHCA 3BN9D 2CXGA 4NWTH 4M7KL 1P1ZB 3TPKA 3L1OL 5FO9A 1U8HB 4LLVB 2OTUA 4Y4FB 3BT2L 1B3JA 3PWNB 5C0EB 5EUOF 2ARWA 3RPIA 1TXKA 1QR4A 2XACC 3HB3C 1WC7B 4MA8H 5FHBH 4JY6A 2Q8BH 2X70A 5EU7E 3TZVA 3HN3A 1R3KB 3ZTNL 4ZFOA 3MBED 1KXVC 3EOBA 4P48A 4LOUC 3L5IA 4HIJB 3MA9H 3SBWA 4MWFA 2VR5A 1NC2D 3S88H 3GIVB 1X5HA 3HI5H 3MQIA 1T0MA 4JFOB 5L2KE 3QZWB 1ZAGA 5D1XC 5BXFA 2E9JA 3GIZL 3VW3L 4NQVB 4E0RB 1LWRA 1PG7W 4PJHB 2AJXH 5IMMA 4XNMB 3UPAA 1DANU 2VSCA 5JHDB 4KVCH 4MD4A 2DJUA 3NIGE 1DLFL 2AEIT 1GGCH 1D9KD 1HHIA 1KJVA 2A6KA 5EZOH 3D3VD 1J10A 1DBAH 2AP2A 4FQIL 3RVXD 4EXPX 5HGDB 4PGCB 4TULH 1RUAL 4HH9A 1HH6B 2X89A 1NFIA 3WNMA 4QYOB 1T66C 5JQ6L 2BJML 3GI9L 5J7CC 3HUJB 4ZUVA 1MSPA 1Q1JH 3AMLA 5EU3B 1IEBA 2BY1A 4QRQB 4XHJD 5MEQA 4RDQG 3OHXB 3HLAA 1JPGB 5BRZB 4X5WA 1JPTL 4PJAA 5IR1A 4LLWB 3FRUA 4JGUA 3ROOB 1T20B 2R69L 1LO5B 4R7NA 5KZCB 2HJLA 4P9HH 3BD3A 3RWFB 1WIUA 2QL1A 4QOKB 1N5AB 4XT1C 3TO4B 3LDBC 1SYVB 5F9WC 1KN4L 3UBXG 2QSCL 3WLBA 5K9JL 5DYOB 3BUYA 3GMQA 3A0OA 2NW2B 1G84A 4JM2C 4NN5C 1U8IB 3ULUH 1F3RB 5FOBA 5HXMA 1MI5B 1QFUH 5D6CB 5J6GA 3PWUA 5EIIA 3BHBB 5DD0L 3O3BB 1NLBL 1ZLVH 2BFVH 1B9ZA 1W0YT 3ZL4H 2BVOB 4KHTH 5KANI 4G6JH 5JPNA 1WIOA 3MLZL 3GBNH 4PRPA 2CLVB 1C8PA 5C2UB 1QVOB 2AJYH 3NIDF 2EKSB 4M6MH 2OTWB 3B2UC 2YD4A 4LSVL 4Y2DB 2Z4QB 3QWOA 2AK4E 1ZSDB 1RULL 4XC3H 1T1WA 1K8IA 4KK8D 4XNZB 4HKZA 3R0NA 4G9FD 2YOCA 2F5AL 1EEQA 4KVNL 2MPAH 3AS3A 3DXAB 2IFGA 2X2YA 4PY7A 1T6VN 1T1XA 2ESVA 1QPXA 4OZHB 3PF2A 4JJ5A 3WXWH 1UH2A 3OPZH 2YD8A 4LDLB 4PYHA 5DURD 3BIAX 4QRPB 4RIRB 5DZNA 1DL7L 2DM2A 2WV3A 2AXGA 3F58H 1ZHNB 3IJHB 2DMBA 1W0WA 4JN2B 2AV1A 4XH2A 4YZFF 4Z8FH 3P11H 2Q86B 4NPYA 5C7XH 3WEXA 1YY8B 3T1FA 5IVNA 3QXVA 5I66A 3EZJB 3VWKC 4NN7C 1KB9J 1J5OH 1FFNB 3C6LA 4DZBB 5CJ8A 4JDZB 4X8JB 3BP7B 1P5UA 3MGTA 2PW1A 1FYHB 4JB9L 5F8QC 1REIA 4O9HH 3GK8L 2R0WH 3GO1H 1E4KC 5GZOD 5E70A 3RIAF 3OF6D 5IHLB 4X6DF 1KTDA 4R96A 3FQUB 1DVFA 2ERJC 5BV7C 4RQQB 1KCLA 2V7HB 3LQAC 4D94A 1YJDC 1T80A 1Q8MA 3UBXA 3GKWH 1LVEA 1S9XB 1E6OH 4XP9L 2A74B 3BKYL 4L29B 4LSPL 3PE9A 4Y19E 2BC4A 3MUHL 4F9PA 2EDEA 4RCAA 3ZHKA 4NKMB 2JK5B 3IKKA 2I9TA 1MCJA 4TPRH 1NC4B 2B0SL 5AWNL 4L9LB 5TFSL 2P46B 3LB6C 3PGDB 4OSUL 3QA3B 1RV6X 4NP4H 4WFHD 5ERWA 1EFXA 1OP5K 4C56D 3EYFA 5CEZE 3I6GB 3LPFA 4P9ML 2VZUA 1FG2B 3MJGX 4XP4L 1WWBX 4U0QB 4AEFA 4XVSL 3MLYL 4OCYH 3D85D 2CR3A 4LASH 4O5LL 4KMLB 1KXTB 4WNQA 4GQ9L 2LQRA 4E5XB 1FRGL 4ISVB 1EPFA 4P2RB 2Z8SA 3BP6B 3OKKB 2AEQL 3MV01 4KU1A 2XTJD 3G6AA 2NXYC 4HHAA 1ES0B 2CRMA 5MP6L 3QRFM 4K71B 1SEBA 4HWEH 3ZDZF 3Q2CA 1IC4L 1YNLL 4PUBH 4J3VA 1HN1A 3MRHB 4JFZH 1CE6B 4TUJB 1MF2H 5GRJH 4L3AA 5AZ2L 3NCJL 5CJXC 4HC1L 3DX7B 5CEYB 3IDUA 2HVJA 5EOCJ 4PJ5B 5GHWH 1MQ8A 1MCWM 5F93C 1MCFA 2X4QA 1MHPH 3SDAA 2R8SH 4UNUA 4MD5B 1NGWB 2PXYC 4CADB 4M1DH 4TNVK 1UZ6E 4LP4A 3B9EA 1P9MA 2YS4A 3ZKXB 5C0DA 2UUDH 3RQ3A 2BXZA 3QUMB 3DMMD 2NR6D 1VSCA 4U1JA 4K23L 2WIIB 3DPBA 3MNVB 5EO9B 3WDHA 4PJAE 2JE8A 3S5LB 7FABL 3LN4A 4U7MA 2VDRH 1QACA 1BOGA 2AQ3A 3SJVA 1A1MB 1IBGH 4RA3A 4KKBC 4FP8H 4KAQL 1GZQB 4P4KD 5D7JB 4GKZB 4ODVH 4BFEA 1EHXA 4S1DD 3P9MA 4PJXE 3CPLB 2H3NB 1QFWL 3S4SG 5ETUA 2EZ0D 4RMRA 5FUOH 3RNQB 4XPGL 3VG9B 1BIIB 3OMZA 4JHBA 3LKNB 4KRPB 1HK6A 4HH8A 4CKVX 5GJTH 3SQOH 4YHNB 2VQ1A 5I1AA 4YE4L 4AK1A 3MRGA 1CK0L 5D7IB 3TBVA 1KPRA 2GKIA 3LKSB 4WFFD 4AIZA 3QPXL 1NBVL 5A2FA 2IAND 3NFPA 5SWZB 4PRPE 2B8OT 3BEVB 4LSDA 1I3RA 4B0MM 4WRLA 4NBYB 3UC0H 2Y4SA 3RJDA 2I5YH 4MDJA 4ALAL 1AH1A 2J2ZA 3O9WA 1C12A 4YHIA 4Z95L 2O61A 3HI6H 3MRQB 4DN4L 1U8QA 3GMOA 2VJXA 1FGNL 5DJ8B 1IM9B 2RIKA 1DUYB 5EOTB 2KL6A 2ESVE 3EDDA 2GIYA 3PP4L 5FM5M 3TN0C 1KCKA 3MXVH 2CH8A 4QGTA 2DQHH 4Y4KC 3STZB 3IXAB 2VDML 4DQOH 4ORGA 4I2XA 3B5HA 5ID1B 1H15A 1IAOB 3HE7B 4X7TB 4JHWH 5BV7H 3WIIL 1RI8A 2P48B 3LQAH 1F6FB 3QG6B 4PD4K 3N9GL 4WEUD 4N8PA 4FQCH 1ZT1B 5HHPB 5GGQH 4HT1L 1ZLWH 3PG2A 4DVRL 5IP4A 1I9EA 3QIUA 2DIAA 4U6VH 3EYQD 5DJYA 3SE4C 3C60A 3V7AG 3DECA 1M05B 4UT6L 3IETA 3IU4L 1CE1L 5D1ZA 4JO2L 3F12A 2HJFA 4K3DH 1X5ZA 3RZCC 1IM3B 4PTTA 4XAWL 3MACL 2J5LB 2D3VA 4O51B 5ADPH 3U6RB 2QSQA 1F4HA 1EV2E 5IJVA 1JPFA 1QLEL 3QFDA 2XNAB 2DQCL 4WVRA 3S4SA 3MRDA 3T0EC 3V95A 3T04D 4AIOA 1KJ2H 4U1NB 3BPNB 3QUYC 4U0RB 2HTKD 4WFGE 2ZOLA 4YO0B 1TIUA 4Y5VA 2YHGA 1MQKH 4HX1B 4WW2A 2H32H 4JKWA 5SV3A 3VJ6B 1RVFH 2R29H 5E9DA 3BO8B 5FGCE 3U48A 4C54A 4YWGL 1ZEAL 3QUXC 4EZMA 3IJYA 2NTFA 3NCEB 4LLUB 1WUNT 4LVOC 3VFNA 3GSUA 3L6FB 5CGTA 4G43A 5I1JL 1MRCH 4NOBA 3T0AA 1NCBH 5B8CC 1WWCA 2VXTL 3BGAA 2P1YA 1G7IB 1G7JB 4X7SH 4XVJL 4KUZL 4YIQA 3U9PH 3J8F7 2QADC 3ARSA 3JSSA 4MQXC 4W4OC 5DEFB 4H5SA 1SY6H 4Z7WA 2XXMB 1FVDA 5E24E 4ODWA 3ARFC 2XN9A 4DGIH 3IFLL 4PRDB 1JWSA 2IQAB 3HPJA 3FAXA 2H1PL 4NUJA 3IDGA 4GBXB 4Z7QE 4LCWA 3I50L 4KXZH 5TDPA 2CIIB 2VLJD 1LO0H 1FSKB 4GAYB 2G60H 5D71L 2F9BT 3TBWB 3JBG7 4X4XA 4Q9CA 3MV8B 1ZGLP 5HJ3A 3FT3A 3C2AL 2GEEA 4JDVB 3C5JB 3H7LA 1IGCL 4X9GA 5K9KB 3BKJL 4NO2B 4EI6B 3VFVB 1TJIH 2MQ0A 3REWA 1T7YA 2OM5A 2FGWH 5KANG 4I1NB 2VDKH 5GJSL 4DAGL 4ZPTB 2F5BL 2IG2L 5I1LA 1NAMH 3SJVE 1EEZA 3VXMA 1MJ7L 3KHQA 5DJ6A 2I60L 1CCZA 4C4KT 4PJ9A 3LKQB 5EU6D 5C0JA 4FFVC 2GSGB 1JF1A 3A67H 4JG0H 1JNHA 1WAAA 4L8DB 3WN5C 2ORBL 2A0LD 3AFLA 3BPLC 2OJZH 1LO2L 1MRFH 1HH9A 1ACYH 2WBJA 1W0VA 1P7QD 2JJTC 5T3XH 2AABL 1MNUH 3CXHJ 4KRMB 2O5ZL 3E2HC 3TNMB 4OV6F 3F8UB 1R3HA 3QQ4A 3ZSSA 4WUUB 5CZVH 4H20H 2FCBA 1M7XA 3TNNB 1UH3A 4M02A 4FFWD 3CXDL 3WUWG 1IARB 1BF2A 3PV6A 1B4RA 2P5WE 4EDXA 1HDMB 3A6OA 4F58H 3P30L 2IBZY 1CDIA 4NRYB 4WENB 1CICC 5GS1C 3TV3L 3B3IA 1GIGL 1UJ3A 4JFDB 1AGBB 1OSPL 3I9GH 2A1WH 5HYQA 1KT2B 3GSQA 5ICYA 4KJQC 1U8JA 3F6LA 1X9QA 4WI4A 5GQBA 1X5GA 3CDGB 1FO0L 3PL6A 4TQEL 5B39G 4P23C 2X4RB 1E28B 2P47B 3LN5B 4S2SB 4XXCC 4I2XE 3BE1L 1PKOA 2C3WA 4PV9A 2FO4B 1CD9B 3OKNB 2C7UB 3O2DL 1WJ3A 1YYMH 1UYWL 2ITCB 1TVHB 3U0TA 3WFBL 2UZIH 3GSVB 1AE6H 1HHJA 3DGGB 2OBGA 4H88H 2YUWA 2YMXL 1DQJB 4POYA 5IHZB 4EN3A 5HHQA 3IDMA 1LDPL 1CGUA 2H8PB 3H3PH 4JN1L 1EHNA 1U8PA 4L4TB 4U1LB 2EYRA 2G5RA 4M1GH 4Q7DA 1TCRA 4NO5A 5JORA 5E94B 3ARPA 5FKAA 4ETQB 5IW1B 1KB5B 4AM0B 4P5TA 1I1YA 5DJ0A 5JIHA 5FHBL 3HC4L 5F9OH 4G6AC 5F6HI 1KLGA 5A2KH 5EZLB 4F7CA 3QWRA 4F33A 4P5MB 2R15A 5DVLA 3R06B 4F9LA 1F8TH 5D1XB 3HUJF 1WICA 5E9DE 3HI5L 1TLKA 3TFKC 2EEAA 4N9GA 2HLAB 1NFDA 2DQIH 4J3UA 4P59L 3RDTC 4RWHA 1L7TH 1CD8A 2HT2D 4NC2B 2HTLD 2KBGA 2AJXL 3WUWA 2QV2A 3RGHA 4I18C 4X9HA 3KPLB 1S9VB 5DQ9B 4KVCL 1HOCA 2VTFA 4LPTA 3WFZA 4XPFL 1GGCL 1FCGA 5J89A 5EZOL 2OCFD 4LAQL 3SDDC 1DBAL 1YDPA 4Z7WE 5ALBL 5F96H 3B2VH 1FV1A 1OAYH 2XN9E 1FAKT 1AC6A 1FFQA 2EIZB 1HQ4A 1A9BB 4ZAKD 3TIDB 3VFPA 4IMLA 5IKCB 4PJEA 3TVMC 4JRWA 4LCWE 1Q1JL 1Q9LB 5B39A 3UDWA 4ZYKA 3VFSA 1KJMA 4MXQD 5ECJE 2ZUVA 4X9FA 4G9DB 4ODBD 1QQDA 3LDBB 2BOCA 4Y2OA 3BKCL 5F9WB 4P9HL 5D70H 3GI8H 1U6AH 4C58B 2DL9A 4OI7A 4UDTB 1BVKB 5IQ9B 1JK8B 1XIWC 4JM2B 2WBKA 3G6DH 3RUGE 3VG0L 1BLNA 2FEEI 4NN5B 3D3VE 3PDOB 2KQNA 3V7AE 4FQ2H 3UCRA 2G75B 4QY8B 2ZJSH 3VXME 5B22A 2PTVA 1A7RH 5C07A 2NTSP 5TJWK 1YYLH 4K8RC 4OZHF 1QFUL 2B5IC 2JB6B 1EGJA 1EJOH 1WAAE 2WSKA 4LRIA 4TTDD 5ESQA 1NCAL 4AIXA 4EDWH 2J1KA 1MEXH 2MQ3A 4XPAL 1ZHKB 1KENH 4M62H 4QOKD 3IDNB 3MZGB 3GBNL 3TO4D 5KS9B 1HSBA 2I07A 1OSZA 3RIFF 1AGCB 5MEPA 4GRWF 3HNVH 1SJHB 4M6ML 2Y5TB 2ZCLH 4U1GC 4EUPB 3JXAA 4P3DB 3W5MA 4JZOB 3MRLB 3U36B 4Z77B 3RL1A 1LK3H 5DA4A 1DQLH 3V5HB 4KZEL 4PJGB 3CD4A 5HD8C 3MROA 4EVNA 4X99B 3NZHL 2IMNA 3MRFA 1T22A 2ZZUT 5L8LB 3RVUD 1XR9A 2WWKO 5CGMA 1JRHH 3HHRB 4PLJD 5I8OH 2NY3C 3LV3B 1A4JA 5ACZA 2R2EB 4Y2DD 3VWKB 4NN7B 3GRWL 4XP5H 1FC2D 3QCUL 3MV7B 1IVLA 4Z8FL 1IEAB 4FQLL 4UBDD 4FZEH 1UG9A 1NEUA 1TZHA 3WL9B 4L3CA 5HHNA 1HSAB 4HUUB 1CFVH 1LE5B 3DXAD 1J5OL 3GHEH 2VZOA 2D4FA 4HV8B 4DVBB 2Q76B 4XBGA 1CL7H 4KUCF 4P46D 1WBZA 2VDPL 4OLYL 4G9FE 1Q0XH 4ZOEA 4NC1E 1N6UA 5EC2B 1GGUA 2GAZA 4O9HL 5BVJA 2O5XL 4QRPD 2R0WL 2ERJB 5BV7B 4UIMA 1ZT7B 3W39A 3VRJA 4E42B 1XCQA 1JTPA 5L2JB 1MJ8H 2YKLL 2Y06H 2YBRB 2FO1A 4HBCL 3PQYB 5HGGS 2ARJB 3VXPA 5T1DH 1CGYA 1GGBH 1E6OL 5IB3B 3G04A 3JZ7A 4PRHD 1KIPB 1QUNA 1RY7B 4YDJB 4YXKH 4CVWA 4X9BA 4R3SA 1T89A 4E41D 5BZWB 1Y18B 5DD6B 1EO8H 2DWDA 1TNMA 1EZVY 4DJMA 2ED9A 4ZQKA 4JGJA 3VI4F 4LARH 4LASL 2X1XR 4PJFE 1MHHA 1T04A 1I8IB 1UT9A 1A2YA 4U1KB 5EU7C 3SKNA 1S9KC 2NXYB 2DBLL 4M5ZH 2VE6B 1ITCA 4G6KH 4HWBL 3RY6C 3DV6A 2OMNA 3DURA 3EGSB 4O2FA 3ZYIA 5HHVL 4IBLT 5KAQG 3LH2H 1FL6A 5IVZA 4OLWH 3BXNB 3WS3B 1NC4D 1ADQH 1NCDH 4R6UA 1NFDE 3VXTB 3IFNL 1U3HC 1QHPA 2C4FU 4Q9QL 3OKEB 4WW1A 1FZKB 4PUBL 3QDJA 1J0YA 3FB6B 1KB9K 4JFZL 5IB5B 1MF2L 5GRJL 3KPNA 2Z91A 3VGFA 4FQHA 3U79A 1E6JH 3L7FA 3O3AA 5GRVK 4C56E 3MR9A 4OB5H 5CJQH 4F3FB 2PXYB 5CHNB 1A6WH 1ZA6A 4P2RD 3VGDA 3MLXH 1MHPL 2F8XC 3PHQA 3NN8A 1U95A 4M1DL 2ZUQC 3MODH 3IT8D 1MPAH 4RBPK 1I9JH 3SEPA 3QDGD 3KYNB 4Y5XA 3ECBB 3KS0J 4HIEB 4ZFGL 2BOBA 2FJHA 4N90D 1PQZB 3DARA 4I5BA 3UTPD 4K8RH 5DA0B 5CP3H 4OGAC 2VDRL 4LDEB 3H9YA 32C2B 4G5ZL 3OXRB 3ALXA 1IBGL 4G8EB 3QNYB 5IMOA 2P4AB 2LU7A 4OFVA 4YDVB 4Z5RB 2C26A 1R6VA 4ZNCD 4HQQH 3JUYA 1EUUA 1XGYH 5IG7A 4Z7UF 1IJ9A 2XV6B 3TGXA 1NAMB 2CDEA 2NYYD 1RZKC 3LS5H 5C07E 1IGJB 5F71A 5IV2A 5IB4A 3MZTA 3H0TB 4XPTH 2Y7QB 1NGXA 4XPHH 5D7JD 4GAJH 2ATPB 3L95B 5FYJD 2VXUH 2FLBT 1TVBA 3OJDB 4OFYA 2Z92A 3B8SA 2E7MA 1P2CA 5ADOL 4OLUH 3HI6L 1XGUA 1YECH 2XPGB 4L3EA 2OSLA 4FA8A 3SE3A 3TN0B 4MGXA 1NCNA 3HZMA 1XFPA 3MMEA 4RFNC 1TVDA 4Y4KB 4BFBD 4U1SA 3UTQA 4OBSA 3MUGA 3MXVL 2BNQB 1AD9B 2DQHL 2PNDA 3QNXB 5DUBB 1UCBH 4DQOL 1HI6B 4PJ7B 2W9EH 4JANA 2FEDD 4LLDA 4XP1L 5L8JB 4JREC 3LQAL 4HZLB 1T1ZB 3KHOA 1IM9D 5HPMB 4TUKH 4GO6B 5GGQL 4WHTA 4PG9B 4K3GA 2E8ZA 4J7RA 4NKDB 3MLTB 5C0ND 2W9DH 2JIXB 4OZGA 3MOAH 1T7WA 2A6IA 3RZCB 1RHFA 4LBEA 2AJVL 5BO1H 3VCLA 3MJ8A 3GMRA 3DYPA 4K3DL 3HE7D 5BMFH 4IOFC 5I16B 1N26A 3T0EB 2I24N 1JTOA 3QUYB 1QA9B 2XRAH 5T5FL 3VD9A 4LKXB 3KPPB 4OQ1A 5C0BB 1KJ2L 2OS7A 4PJ8B 1D6EB 4XMKL 5K93A 3K1KC 4LLQA 1NUNB 3WO4C 4MCYB 3QUXB 3IRPX 3BVNB 2XKUA 4LVOB 1MY7A 2NZIA 5F3HA 5F7KC 2D03H 5A1AA 3QXTA 1OGAB 1WVZA 5DQDH 3UJTH 2JCCB 2Y36L 5B8CB 1CGWA 1QBBA 1GGTA 2BVEA 2QADB 4OLXH 1NCBL 5EN2A 2OZ4H 1FAIH 1VGEH 3VD3A 4KKAD 2DQDL 2JJVA 4X7SL 3ARFB 3ZHDA 4K9EC 3O4OC 4NKOA 4GG6B 4U05A 1F6AA 1SY6L 3QDJE 2R4SH 3AVEA 4QT5A 3PIQA 1XCTB 5SWSB 2Q8AL 4MQ7A 1N64L 1RHHB 3FQWB 4YX2H 2E27H 4JKKA 2VIRA 5C9JB 3QHFH 4XVUC 2G60L 1OTSC 4F7PA 5FKPB 4QCIB 4WI7A 5DZOA 3HE6A 3QCTH 4QF1B 2CO7B 3N06B 3Q6FA 3BZFA 1LP9B 1MHCA 1AJ7H 4YQXL 2GK0A 1TJIL 2Y07H 3NCCB 2XFXB 3CVHA 2NXZC 1RZKH 2VDKL 2WUBH 4GBXD 3D18A 5HBBA 4JLRB 1OP5H 4JR9H 1G1YA 2HMID 5GGUA 1NAML 1NCUA 1XGPA 4N1HB 1K6QH 5C08A 3EOAA 4FQQB 4RSVA 3ZKND 4I4WB 3VMOA 3MV8D 3HC0B 2FJFA 2ZWLT 1RJLB 3BPLB 2VLJE 3L3GB 4PB0L 1OF2A 2VXSH 4HF5H 3LEYH 5HDBE 4QWWD 1U2HA 2OJZL 4QHKJ 4Q74A 2QQNH 4JHZA 2AJ3B 4LMQE 3SGKA 2EYSB 3E2HB 4RGNE 4LGPB 1MJUL 5T3XL 2XZAH 1E27A 3GJEA 1I8MB 4B7LA 4CNIB 3ILQD 1KJ3H 1YUHA 5F7DB 3TJEL 5CZVL 4H20L 4HDIB 3WLWC 3LKPA 3B5GA 4ZDHA 4JGMA 1SMAA 5CAYB 2FJGB 2GSIB 3KYMA 4NOFA 1CICB 5GS1B 5I76B 4F2MB 1AO7D 1UCTA 2DN7A 1QBMH 4IDJL 4LCYA 3AS0A 1U8KB 3ULUD 1FZOA 1K2DB 2VDQL 3GJFA 3O8XD 2KUTA 1CFSA 1PZ5B 3I9GL 5FGBA 2A1WL 2PETA 3BFOA 1H0DB 1HXYA 1VFAA 4WUUD 4P23B 5GIRB 1AD0B 3C9NB 4XI5D 3R8BB 1T3FA 2PCPA 3T77A 4NQEB 2CUMA 4WI9A 2R2BA 5CJ5A 2VISB 2GY5A 1F2QA 4XRCB 3INUH 5H2BB 3TA3C 4ELKA 1GAFH 4LHUB 3V0AC 5I15H 1YYML 1M1SA 3DJ9A 4LIQL 1XF4B 4JFDD 4NNPH 4HKJB 2UZIL 5H37H 1AE6L 5E8NB 2YXFA 4Z7OF 2V2WA 3PHOA 4H88L 5B38B 2W60B 4OZGE 1FC1A 3KJ4C 4F8TA 4U4BA 5GS2H 4DGVL 3FN0L 1ZK9A 4M1GL 3OR6A 3P9WB 1DVFC 1M7DA 5F1IA 3QG7L 3HRPA 4Y8DC 4DTGH 2A6JA 1UWEL 3VFMB 1C08B 5DQJB 5F9OL 2VAAA 4JFFA 3FQRA 4HG4K 1BZQK 5E7BA 1EUTA 2A83B 4K9EH 5I1EH 1OQOA 3RVWC 1OB1B 4L4TD 1F8TL 2EDQA 3RDTB 1R3LA 3TJHD 5GISH 3HFMH 4APQA 5GGVH 3F6IA 3HB3D 4I18B 2DQIL 3UX9B 5EBMB 1I1AD 4K7FB 3QJFB 4R4BB 4TTGA 1S7QB 3PDGA 1IL1A 4EXKA 1J9CT 3KGRA 4RMSA 3SDDB 4X9IA 4MJ5A 1I3UA 3UP1A 5IT2H 3MRIB 4IOSD 4JRXA 4YGAB 3IAPA 4WU5B 3BZEB 4J2XA 4ZUTA 2CGRH 5D1XD 5DFVC 3HZVA 3TVMB 1OAYL 3VMNA 4JY4A 3SDCA 1FL3A 1K5NB 4UZGA 1A4KA 4CVZB 1WFUA 3MRBA 1A14H 4IRSA 1OM3L 5CLTA 1T1YB 5D93C 2ZOKB 3S34H 3BPCA 3QH3A 2DKMA 4K94L 4KK9D 3D25B 4JFYB 4QNPE 2VLKA 3SDAC 4F57L 2CLRA 1OW0A 5IOPA 1VA9A 2IF7A 5DMYA 1XIWB 1EVUA 1T66D 3GI8L 3BZ4B 1P9MC 1V3JA 4NC0B 2F53B 3W11C 1OARL 2IEPA 5MI0C 5IROA 1G9MH 3OR7B 4I0PC 4GG8A 2JELH 1LEIA 2YD6A 1RZFL 1NCWH 2PUQT 3HPLB 5J6HA 4FQ2L 3OKLA 2B5IB 4V1DB 4LLAA 1ZKAA 1RZJC 1A7RL 3IFPA 2HVKB 1I4FA 3D2UA 5C08E 2H2PD 3CMOH 3I02A 3THML 1EJOL