1FBIL

Crystal structure of a cross-reaction complex between fab f9.13.7 and guinea-fowl lysozyme
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
214
structure length
214
Chain Sequence
DIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQKKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDYSLTIRNLEQEDIATYFCQQGYTLPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a cross-reaction complex between Fab F9.13.7 and guinea fowl lysozyme.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (antibody/antigen)
molecule keywords IGG1 F9.13.7 FAB (LIGHT CHAIN)
total genus 41
structure length 214
sequence length 214
chains with identical sequence P
ec nomenclature
pdb deposition date 1995-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fbiL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fbiL01
1CFBA 4OFYD 4MNQA 3JTSB 5HBBA 4QXGL 4AG4H 1QSFD 3AUVA 1EAPA 4P23D 3WNNA 1J8HB 1X5FA 4OF6A 4PJXE 5A2JH 3VWKA 4PJ9C 2X9XA 3N9GH 2XG4A 4PG2C 5I73C 2UV3A 5E94B 4KK6C 3LRHA 4XPTH 1TCRA 3SGKA 3BW9A 4APQB 4LLQB 2YKLL 5C0RL 1KT2A 4U7KA 3QZWA 2P8PA 5L88L 1UZ6E 1A1MA 1F11B 3G5XA 4JM4H 2MMXA 5C0FB 3BPCA 2VN4A 3C6LC 3B9DA 4P2YA 4IOIB 4O2FB 5C0CD 5IB4B 3DV6B 4D0BB 2ORBH 3U48A 4FXGB 4NFDA 3H9SB 3O11B 1RUAL 4JPVH 2W1NA 1Z5LA 5DQJA 1QA9B 2ENSA 3KYKH 1I1YB 1DQJB 5A2LH 1HQ4B 3MOBL 1U8IA 4JB9H 3E6FA 2EDFA 5JLZA 4H20L 2MOVA 1IGIH 3CCHA 4HIEB 3I6LE 1A7OH 3QG6A 3T65B 1CFQB 5DRWB 3O6ML 4OZHE 3LKQA 3OKYA 4PB9H 3FO9B 5JQ6H 1U3YA 1GGBL 5CKGA 2CLRA 2CDEB 1FNFA 1C12A 4K3EL 3WFEH 3UDWA 3FAXA 1M7IA 5DJ0A 4ZMAT 4KZEH 1UZ6F 1KIRA 5IK3B 1XF2B 1LK2B 2V5TA 3HRZB 3OF6A 1FE8H 2DQHL 3E1F1 1Q9KB 4I0PB 4IRSD 1VERA 3D3VD 2VO5A 3EYQC 5E6IA 3ZKNC 1TZHB 2OL3B 4CADA 4TUJA 1OTSD 5T1MA 2Z8RA 1HXYA 3AU1B 3RZWA 5LGJB 1B2WL 1AR1C 2D03H 4ZUUA 4NDMA 1L0XA 1QG3A 3PHQB 5EOQL 3CVIH 5K9JH 4XVJL 3V8CA 4JREB 2XKNA 2GSGA 3NCBB 4J3TA 2A6DA 3ABZA 3MV11 2EE2A 1D3CA 1K8DB 4XP4L 2FZ3A 2XQYK 5HXMA 2FX7H 3QJFA 4LPVA 1DUZB 1N8ZA 5EUKA 5E2VL 1GOFA 3SKOB 5AZ2L 1KTKE 4Y16A 2GTZB 1F4WH 5C70A 5DQ9B 4XPBH 2OXGA 4XC3L 3TESA 4LHUA 2RFXA 3AMLA 4NGHL 4AYFA 1OGAA 4RIRB 4CJ0A 2C1OA 2FX9H 1G9MC 12E8H 1I1FB 5EB9A 5INCB 5BRZE 1WBXB 3PHSA 1BX2A 2AQ2A 3KPSA 4LARL 1KIPB 1QSFE 3UMTA 1T3FB 5ISZD 5IEKB 4K7PL 2V9TA 5DC9B 5J6HA 2P5WE 3IJSB 1P84K 3LEYL 4J3XA 4ZUWA 4M7JH 1WTLA 3B2VL 1UYWH 4CN6A 4E5XA 5C6PB 3MRCB 4JPWL 4N0UE 1UXSB 3G5VB 4HD9A 1A1OB 3JWNC 3BN9D 5HHOE 1PX4A 4Z7QF 5HJ3A 3ULVH 4I0CC 3ILQD 4NJ9H 1P5UA 4RWYL 2RGSA 3P0VL 1XGYL 2VITB 4QRPA 3MLVH 4HWUA 3VWKD 1R3LA 3HUJA 2V5MA 1UQSB 2JIXA 2W9DL 1BVLB 3MXVH 4XNXL 1A6PA 2X4RB 1NEUA 5A3ID 1HXMA 1HOCB 4RAVA 3LKPB 3D39E 2K1MA 3E3QC 3QNXB 1S7RA 4TVPH 3QNZB 1KCLA 2C3VB 3DBXA 2DQIL 4L4TA 4XBGB 3HE7D 1KTDB 5EO9B 4L3AA 3K74B 3ARFD 5HPMA 3GHBL 4HJJH 3ARYA 3TBYA 3I84A 3KXFB 1S9WB 4BZ1H 1AD0B 1CWVA 2I5YH 2NR6C 4KRMB 1Q0XL 2VLKD 3WN5A 3GGWB 4NQDB 2F5AL 4D9QE 4FFWC 4PJAA 4JQXA 5IQ9A 3HS0B 3NCMA 1NCCL 3SGKC 1NFIB 5IOPB 4YPGB 4D0DB 1MPAL 2AABL 3MBED 5FOJA 5J1AA 4MJIE 1A1NB 4JN2A 2BZDA 4TNVK 1P5VA 5CINH 3KXFE 1ZE3C 2ZOKA 4M7KL 4OGAD 4AK1A 4KK8C 2OR7A 3UC0L 2P49B 4GSDL 4FQIL 4NQDE 3PP3K 4LSQL 4UNVA 4QRPD 4MNGA 3GSQA 1MCOL 4KKBC 4PJ5B 5D1ZD 4BUHA 1QVOA 2Q8BH 3SE8H 2P43B 5TE4H 5GS0L 3B9EA 4EBQH 1I1AC 3CX2A 3QYCA 1I1YA 5HHVL 4C59B 1EEYA 1FZOB 1KJ2A 3QIWA 1E4JA 2CMRL 2IPKA 4F7TA 4PP1C 4GW5B 3KYMB 4HCRH 4MX7A 3IKCB 4U2YA 3PV6A 2VDKH 3S4SG 5DJ8A 4AH2B 5JDSB 3B83A 1A7PH 4U1NA 1AE6L 1HNFA 3RWHB 4JHAH 2VRAA 4PLNC 5TJWK 5I75B 3MCKB 2GJZA 2F58L 1T1XB 1M71B 4HKXB 2Y36L 2GJ6D 4K94C 4MD0B 5KVGL 4MD5A 5I8OL 3MREB 3T0BA 1IM3A 3H7BB 4U6HB 2Y9RT 3RDTA 4F9PC 4KKNA 3HZMB 3MXWH 3AVEA 2X09A 4RNRB 5DRZB 4HUVA 2VDMH 5TFSH 1F90H 2O5XL 4G6KL 2PTTB 3V5HB 4WY7L 4L1HA 3WFHA 1NCNA 1TETL 3QCVL 3BWUC 4IOSD 2VDLL 4NM4L 4OCRH 4C56A 1KPUB 1YEFL 4D9LH 3VH8A 1TZIB 3B5GA 5LGJA 3SDXA 2H6PA 5IFAH 2J6EL 5B4MD 2F5BH 2GKIA 3P73A 5E8PA 4WCYL 3ECBB 2A6DB 4NKQB 1HIML 1U8OA 3SJVE 1XEDA 5M95B 4M02A 1OM3L 4LSPH 2BVQB 5DJAA 5I73B 4UT7H 4I4WA 4ZOCA 5LWYH 1BFSA 3GJEB 1M6OB 1JWUB 5CWSA 2BRRH 3B9VA 5BZWB 2VDQH 3SDDB 4M6MH 4H26B 2IANB 2R4RL 5B4MC 1EO7A 4B41A 4G42B 4WUUD 5DQ9A 1JGDB 3TZVD 3RVVC 2H1PH 2ZNWA 1TJHH 2Q8AL 1WQVT 2GJ6A 4KTDL 3DOSA 4NIKB 3L3KA 1C7SA 3EO1A 4P2OC 3QI9D 3WNLA 1IMHC 3SDCD 5L7XH 3G6AB 3F7VB 2E3VA 3RGVB 3RWCB 4LL9A 4PGCB 3U0WL 4LK4A 4RFNC 4X5XA 5C71A 4ODTH 3QUYA 1EJOH 2PKDA 2BVTA 3M45A 3GI8L 3R8BB 4NQEB 3VWJD 3DUHA 4DN3H 1ZEAH 1MY7A 1OHQA 4JQIL 5SWZE 1S7TA 1L6XA 1UKSA 5E9DB 2NQCA 2Z35A 4YUEL 3V6FA 4O51A 5JW4Q 1OAKH 3H3PH 1MCSA 5J3HC 3NFSH 4HLZH 4LCWA 2R0WH 4YDJA 3L3IA 5CIPA 1RJCA 3MLSH 1R5WA 5BOPA 3IAPA 5DD5H 2C3VA 2FJFB 3DBXB 4L4TB 2BNUB 4LDLB 5AEAA 5KN5A 1MJJB 1R3KA 5FGCB 1EV2E 4HX1B 2FLRT 1MFBL 5B3JE 5GZND 4ELKB 1YPZE 1U6AH 5AYUL 1W0WA 8FABA 4NOFA 4DKFH 5IWLA 4TRPH 4XBEH 1SEBB 4KK8D 3ROLB 1K2DA 2Y7QB 4HF5L 4OI8A 2YD9A 3DARA 1T21B 5JHDE 3NH7H 4V1DA 3D0LB 3HR6A 1IILE 3W5MA 4NHUA 4Y4KA 1C16A 2F8VA 5D7JC 1KNOA 1AGEA 2MTPA 1NKRA 4M61B 3JV0A 3TA3D 4PV8A 1G7HA 4PJIE 5DD0H 5IROA 5A2KH 1CXHA 4YHML 4GKSB 3VG0H 4MVBD 4X99B 1NAKL 3JTSA 2XT1B 5JUEH 2X2YA 3OG6B 1SY6A 3MLZL 4MXWH 5I9QB 3MV7B 3ZT6A 4NRZB 4G5ZH 4Q0XH 4QNPE 1XH3A 4WWKC 4O2CB 4EI5A 3VI3F 5JHDB 3FKUS 4JHWH 4I3GA 1X5XA 1HH9B 3QPXH 1FL5A 4PGDB 1AXTL 3ARBD 4UIMB 1ED3A 4Y4HD 5E08L 2BDNL 4M8QB 1KN4L 1L0QA 3QO0A 4PJFB 1X4ZA 3VJ6B 3TZVB 3CLFL 1NKOA 4BH8A 4PJBA 4DGYL 2GEEA 4RMTA 4XMKH 3RVTD 5D7KE 3BPCB 4YQXL 1EZVX 2B0SH 4OIIL 3LQZA 1CDGA 2CK0L 3GBMH 3I3EA 1XCQB 3K81A 3TP4A 1HE7A 3S88L 3LV3A 3SO3C 4PLJD 4JZNA 3QT2A 4IHOA 1BQSA 5HYQA 4XRCB 3QEQD 1HDMB 1P9MA 1FNEA 3V4VH 5DRZA 4S0SD 1ZGLP 4WO4A 5TDPB 2VXQL 3X11B 4JM2C 3DV4B 2WQRA 3RTQD 3WO4B 4HXBH 3QG6B 3ULVD 5MEPA 4WW2F 1KPUA 5I15H 2EYSA 1WFOA 1WBYA 4K3DH 4MQTB 3D25B 3QI9A 3DURB 4D94A 5E8PB 3W9EA 1UJTA 1G6RL 2XN9D 4BKLA 2GYSA 3QH3B 3NABH 1JZ2A 4MDJB 4P5MB 4HKBA 4KV5F 3BAEL 4OZFA 1X5HA 4I0PA 1RSFA 2WWMC 4FA8A 4Z7NE 1F3RB 3NTCL 3SDCC 5ALCH 5JPNB 5ISZE 3JVGA 5C7XH 1J05A 2DLEA 4MXVE 5FUOH 3CX5J 4AIXA 1EIBA 2X89D 3L3OA 3RA7L 4W4NA 4FNLL 2PTUA 1GOGA 3MCLL 4HFUH 4YHLH 1VENA 2BNRB 5GZNC 2PO6D 5GRUH 5DRNA 3K8KA 3GI9H 3RZCC 3BQUC 4P9HH 1JGLL 2AEPH 2YZ1A 4X8JB 2EDBA 1S3KH 1F00I 4QXTA 4UTBH 5DLML 3EYVA 3PE9A 1R5VB 4AEEA 3JTTA 4PRBA 5B39B 3IVKB 1FIGH 1XR8A 2XKUA 4Z7UE 3QBTB 5A16B 1CXEA 3HMWH 1PSKL 4M5YL 2BY3A 1HSAA 2MSPA 2VIRB 3WNMA 1I1FA 3EGSB 4LKCA 2WQ8A 3ARBB 4RGOL 1E0OB 4DVRH 5J6HB 3V4PH 3TYGL 3VFSA 4KHXH 4NN6C 1JGUL 4J3OC 2UYLA 4WWID 1PY9A 1R5WB 4JRWA 2X05A 1ZKAA 4A6YB 5F7KC 4NZTL 4R4BB 2Y72A 3KVQA 4L9DA 2XWJA 2VXTL 2EYRA 4OQTL 3TA3C 3IFNL 4X6DA 2OP4L 4DZ8A 3HUJB 2X5PA 3LS5H 2CUHA 1RZGB 5ADPH 1RU9H 1K2DB 5EU6E 2Y7QA 1KENL 4QHMA 2X4RA 2WM0A 3EO9L 1R0AL 4V1DB 3WHXA 5IROC 3K4AA 5JIHA 4HS8L 4X6EB 2HLFC 3T0EE 2Z8VC 3W0WA 4M1GL 1LP9E 4M6OH 3TBTA 4AZ8A 3DO7B 4LLQA 1ZSDB 5E6YA 3SDXF 4Y4FA 1F5WA 4PRIB 3FFCB 4F80A 2VDOL 1BPVA 4KDTC 3DV6A 3KPRD 4KY1H 4OCXH 1MFAH 3ZHDA 2GUOB 3X12B 4BH7B 4JN2B 5DQJB 1QA9A 3U9PH 5D2NE 1QBLL 2HMID 5T1LD 2ZOKB 2GTWA 5EDXA 1NL0L 3E6FB 4Z7QE 2HTKC 4S1DD 1BVKB 1ADQA 4F7PA 1YZZA 4U3HA 1JZ6A 1A5FH 3T2OA 2FSEB 4OZFH 3GSQB 4H1LH 3MGOA 2FH8A 1NEZA 1IGCL 4D3CL 2WINB 5LAXA 1BLNB 3GRWH 1LE9A 2I07B 3BD4A 4LSTH 1M7IB 5DJ0B 4P2OD 3NCJH 3I75A 1J9CT 2DQEL 4ZG1A 4J23A 3QUYD 4NN6B 3IKCA 1Q9KA 3GK8H 3T2NH 4JHBA 1RV6X 3F65A 1ZVHA 2DMKA 4WW2A 2FD6H 4PJCF 5C0BB 3QXDB 3MOQA 3VXRB 3MCKA 3QCTH 3V4UL 4C4KO 1WBYB 3L5WB 3MNWA 3MRJB 5TE7H 2OQJB 3BP4A 4J4PA 4MJID 3UTPD 2BC4A 2XKNB 1I8MB 2YK1H 4QRRA 5HDQL 5J1TC 1CDIA 2E9BA 5A43C 1DFBL 4MZ3A 4WU7A 1FVDA 2YSSA 1A6VL 1NGYA 4FQLH 3O2DH 5J3HD 1YC8A 1G9EA 3GSNB 3N1QC 3L9RB 2VN7A 3HMXH 1EVTC 2AEIT 9CGTA 1VGEL 4OFIA 3GUTA 1EDQA 2EH7L 4I3RH 1QHPA 2AXJA 2DIAA 1CLCA 1Q9WB 2NZ9D 4TUKL 1MIML 3G08B 4UIKH 4XB8A 4JGJA 5FECB 3MBXL 1A6WH 1BZQK 1T3FA 1EGJH 2DIBA 5SX4H 1RMFH 2FR4B 1FYTD 5ICXB 3U7YH 4N9GB 5ICZB 5GRZA 4PRNA 3F6LA 2DI7A 5D6DC 2AEQH 2ESVD 5F9WB 2DI8A 1AGBA 3STBA 4OLUL 3OHXA 3MRIB 4WIQA 1RURH 5F6HI 3UTQA 1A22B 2FJGA 1QKZL 4GUPA 3EGSA 4LKCB 1DLHB 2OR8A 4XI5D 3GEWB 1JNHB 1UXWB 4KJPD 4LU5L 5IW1B 4GXVL 3DXAB 2GAZA 2E9IA 3IDYB 1IGJA 2UYLB 2XIDA 3BUTA 1KB5L 2ZG1A 2R69H 4GRLD 1EHLH 5J56B 1OPGH 1EBPA 1T7ZA 2NCMA 1O7SA 3D9AH 4XI5C 1T6VN 5EC2B 1FGVL 2FHBA 4W4OA 4DZBA 1NC4A 4ELMF 4O51B 4MB3A 5I8KL 4YPGA 4DGIL 5DT1L 4X6EA 4NQVA 3KYNB 2OZ4L 1AO7A 1YECH 4L3EB 3MNVA 4HX1A 5CCKL 3DRTA 2WUBH 3IXAA 3P9LB 4NO2A 5F96L 5IB2B 4EI6A 1EAPB 4FQPA 5J13B 1J11A 1G9ML 5FO9A 4LSRH 4OLWL 4ZFOL 2NY5L 4DKDC 1S78C 4WUUE 1T21A 2F53E 1GVIA 5A3IC 5E94A 3IDIA 1XMWA 3AS0A 5TPWL 1K4CA 3G9AB 2Y25A 2DWDA 3MYJB 1KNOB 3DWTA 3RZCB 3FOMA 5BW7A 4L3EE 3S36L 2K7QA 3V0AC 1KT2B 1BGXH 1T2QH 3KYMA 3LN9A 2WBJB 4FABH 2IF7A 2QHRL 5DR5L 3G5XB 4RFEB 1LO4L 2R0ZH 5GGSB 3MV7A 3PWJB 1L0YA 1QUNA 1MCRA 2VZ3A 4IOIA 3ELAT 4O2FA 3RWDA 1V7NH 4HKXA 4WUUB 2PO6A 3I6GB 4FXGA 1D9KB 3QAZC 4PTTB 1FFNA 4TVSa 4BZYA 4MD5B 4P3DB 1BM3H 2YN3A 1FRGH 4G6JH 3MJ8B 5FK9A 2UUDK 4ZFGH 3P40A 3MFGB 4R7NB 4Z7WF 5CP3H 3MRHB 4XNUL 3ZTNL 1RUPH 1JP5A 3RGVD 1FPTH 4C55A 2GQHA 4P46D 2WV3A 5ESQB 3TIDB 3L1OL 3LKQB 4X4ME 4LQFH 4NM8H 3I50H 5GS3A 1MI5E 5IHBA 3MNWB 4H1LB 4O2EA 3JZ7A 5DI8B 2W0FA 1CGVA 2WUCH 2QADD 1I8KA 3EDDA 4PBWD 4PGJA 2HFGH 4JEGB 2V2TA 2X1WL 1DBBL 4JHZA 1OAYL 3X11A 5IG7B 4NNPH 4D9RE 3QZWG 5J0BA 1QFWM 4HC1A 5JPMA 5IIEA 4CADB 4PPTA 3A6CH 2HJKA 1E6JL 5KOVC 3W11C 1MLCB 4HH9B 4FFYL 4ZUSA 2BSRA 2PR4H 2VLRA 4K3JL 1GPOL 3QDMB 2WZPD 4Y5YC 5L6YH 4MQXC 3W9EB 4Z6AT 5LQBL 1GGCL 3H2WA 2DMBA 1FVCB 5DYOB 5FA4A 3WS6A 2P5WD 3LH2L 1FIEA 3RWCA 1BIHA 3KXFD 1TNNA 5TE6H 1JVKA 4XX1G 3PJSA 1QLRB 2DI9A 2UY7A 1N4XH 3MRIA 1KCUL 1Q9LA 3TV3L 2ZUVA 5C92A 5CILH 4E9LA 4ZAKD 1JV5A 1XIWA 5C0AE 4GRWE 4PIRF 1A6TB 1S5IL 4XBPA 1MRCL 3ZKXC 3FQTB 1YQVL 1MFEL 3V6FB 5D1XD 2B4CH 5JOFB 3K46A 3PGDB 4HWBA 5DZNA 3U0PA 1R5VA 4WFHD 3L3IB 1ZHKA 2J1KA 3MRCA 2GI7A 3WO3B 5JR1H 1U0QA 1RZ7L 2R56H 3KGRA 2IAND 1KCVH 15C8L 3E8UL 2HH0L 1TVHA 5D72L 1Z3GH 4IRZL 5I30H 1JNLH 5C07E 1DANU 4Y0GA 3QRGH 5EIQA 1WITA 2XWBA 4N8CH 3CSGA 2JIXB 3DVGA 4LQ1A 5DWUH 4M03A 3NAAL 1J8KA 1LDSA 2A9NH 4KI5D 2AJSH 4N68A 4NHUB 1H15A 1YMMB 4QF1A 3DROA 3MRGA 1MIEL 4P99A 5E1AA 4HSQA 4P5TB 4GKZA 2OJZL 1G6RB 4DVBB 1U2HA 4MYWB 1RZJH 3C2AL 1EX0A 4BK5A 4OD2A 3P9LA 4NO2B 3UBXG 1K3IA 5IB2A 2YD1A 5MHSE 1NMAL 1N59A 2XY2A 2IPTH 5EULV 4QHMB 1XH3B 3QHFH 1D5MB 1FFPB 1NUFA 3FZUD 3NZHL 2DBJA 3WHXB 4PJCE 5F7DB 1K4CB 1EFXB 2IAMC 3ESUF 4QRRE 1YMME 4OZIE 1LVEA 1J86A 5CGTA 3ZKMC 4URTB 2B20A 4M8QA 2A6KA 4KPHL 1NGPH 5L2JA 1FO0H 2XZQH 4OV5A 4I2XE 3KJ4C 4OZGE 1TZGH 3JUZA 3VGFA 1G7JA 4WUUA 1HI6A 3KS0J 4NZRL 4JDVB 2CIIB 3PQYD 1F8TH 2GHWB 5B21A 3SQBA 1IC4L 4NO5B 1K6QH 3T1FB 1SEQH 4MQXD 3SY0B 3VXMB 4MHHI 1RIVL 2IBBA 1B4RA 2BNRD 1RZIB 2AQ3A 2DTSA 3PL6A 5DJCA 2YOCA 5C1MB 1R3HB 3RJQB 3TBSA 3K80A 4LPCA 1K5NA 1N5AA 1WISA 2R0LL 3SE4A 1M71A 4OFKA 2ILLA 4YDIL 3I6LD 4UV7H 4O2EB 1BECA 4HIIA 4NYLA 2IPUK 1LE9B 4YAQB 1AXSA 2YPKB 3CFCH 1T66C 2QHLA 1FCGA 2BVPB 2W0PA 3QH3A 1MFCH 4S2SA 5TDOB 3FO1A 2G5BB 3GSWB 4J3SA 3L7EB 3BKJH 4LCWE 3QG7L 1WK0A 2CUMA 5JW4R 1YA5A 4ZQKB 3U82B 1IEAA 2BMKB 5I1EH 5IIEB 1J1OL 4MAUL 3QRFM 4DN4L 3EIFA 2OL3L 3VH8B 4XMLH 3H0TA 3OJVC 4E0RB 1X44A 2UZIL 1F6AB 4M5ZH 3SDAC 4JY6B 3AC0A 5LXGL 1YEGH 4NC1C 2ZZUT 4D9QD 3V5KA 3T0EA 1QEWB 3U30B 5DMGC 1YMMD 3K8LA 2Q1EA 4OCYH 2O93L 4NO0B 4WRLA 1R3IH 5LVEA 3IJHB 4NFCA 5AAWA 3N85H 5ENWB 1MVFA 5DHXB 3BGMA 1J12A 5IFJB 4LHQB 2YRLA 4ODSH 4GAYA 2GCYB 3GUTB 5IBTL 4AQOA 3SDXE 1T89A 1IAIL 3TO4D 3O6FA 3MLTA 5CZVL 1HSAB 3LDBB 3L3KB 1CQYA 1XIWB 4X5LA 2A0LD 2YC1A 1C08A 2BFVL 1U8KA 5BVPH 3FFCD 1I3UA 1QO3A 2OTUB 1DBAL 5FGBC 5I1KL 1J8HD 1MHCB 2DBLH 1FCCA 5GGTA 4GMTH 5EU3B 2DQTL 5LKNA 2EIEA 3OXSA 2FR4A 1JTPA 4HGMA 3EOTH 5GZOC 3QEGH 1S9YA 4PJDA 2IG2L 2BOBA 3ZYOA 3DO3A 3VU2A 2NZIA 3OHXB 3MLRH 4R0LA 3PDOA 4ZPVA 1TVHB 4Z7UA 1FNSH 2VH5H 3OAYK 2HJLA 3ZTJH 3N1GC 2DYPD 3FB7A 1NAMB 3G5ZA 2CRYA 2E5EA 2XOTA 4U6YA 5DJZB 2XZZA 4QHNA 2ED9A 3RX7A 2A74B 2ATKB 3Q1SL 3OSKA 4J3VA 1X5LA 1XF3A 2HKHL 4RBPH 1LO5A 3ZYIA 1R3KB 1FZKB 4XCEB 5FYKH 1F2XK 4FQ2L 2VLRE 5GGTH 4MLIA 1ZA6B 5D9SB 4NT6A 4PRIA 5GHWH 1DBKL 2NZ9C 4WHCA 3BH8A 1N59B 4OGYH 1RVFL 3SOBL 5D2LE 5CGMA 3MNZB 1SQ2N 2I9LB 3UAJC 1D5MA 1FFPA 1NCAL 1IFHL 5GJTL 1ACYH 5CEYA 5GPRA 5T5FH 5F3HB 4L8SA 2VMFA 4K9EH 3CK0L 4HWNA 3L6FA 1UENA 4P48A 3JUYA 1YYLL 4G8IA 4XP5H 1ULVA 1WC7A 4MA3B 4JFZL 2D0GA 3Q6FA 2X7LA 1QYGL 4R90H 3DRTB 2Q76B 1ZHNB 3RBGA 2CR6A 2NYYD 3GM8A 2PCPB 3MOAH 2Y6SD 5IESH 3QUMB 4I0PD 2AJUH 4IRSB 3HNTH 1W0VB 2ICWJ 3HE6D 2VR4A 3NIDE 2GFBA 4MS8C 3GMPA 1CGUA 3CFJB 1MCKA 4P9HC 4ONFH 3ULUC 1IEHA 3ARPA 1CK0L 2EXWD 2IEPA 3O11A 1VADA 3BPOC 5LAXB 4M7LL 1X6NA 3VXSD 3N50A 2KL6A 3CDFA 3RZCA 1AGFA 3I75B 1FNHA 1EEZA 1KB9J 3T1FA 4R4FH 1D5ZA 4KJYB 1A21A 3ZDZF 3TN0B 3DGGA 5D7IF 5C0IB 4J2XA 4XWOC 1A7QH 3OAYH 1LD9B 1XF4B 3VCLA 3PWJA 2VERN 2VLJD 1VHPA 2CDGB 1XIWD 1JNJA 4XGZB 3I9GL 1N5AB 4KAQL 1LP9F 2P8LA 4CVUA 4H88L 5DHVH 2R1XB 2WWKO 3FT4B 3PWUB 1P6FA 4OIBA 1WEJH 4ZS6C 2YPKA 1FAIL 3UTTD 4X7DC 3OMZA 2ENYA 5DD1H 2NY4B 5CEZH 1I1RA 1SMOA 4WU7B 3MRLA 1L7TL 1U3HB 4YXHL 1V7MH 4JO4H 4DJMA 4Q9CA 2BMKA 4OCWH 3VA6A 4ODWB 3EDEA 1KTRL 1FORH 2ICWB 3C5ZA 4P5TC 3MLPA 1LNUB 2E9JA 3WJLA 4NZUH 3F7RA 1JHLL 3WXVH 2CRZA 2LFGA 4F57H 3V0WL 2GK0B 1MJUH 2VZ1A 2BXYA 1NBVL 1I8KB 1IAOB 1K9TA 4X7SL 5FFLA 5FYKD 1KUMA 5I0ZA 4NWTL 5D8JH 4RAUB 3EFDH 2QR0A 5DS8A 4F7EB 1CFVH 4TVPD 5IG7A 5IKCB 4LBEB 4X83A 1UZ8B 5I18L 3O4LD 1FZJB 5JPMB 1CF8H 4BA8A 3N0PB 2HJKB 1J0ZA 4PJ5E 2D7NA 4JM4L 5FGBA 1CT8A 3VFNB 2OTWA 1LQSR 3VD5A 1WUNT 5F89B 5DYOA 1KIPA 5F7MC 3F8UB 5KSVA 3X17A 5DJ2B 2AXGB 5DFVC 4X4XA 1REIA 4GLRH 1CD1A 1A7BA 5B39A 1OW0C 2XA8L 3HRPA 4RGND 5E5MA 4R0LB 2NNAB 1A7OL 4N8VA 5C07A 5CBEA 5EZOH 5DVMA 1BJ8A 3FB7B 1LO0H 1E4XL 3SPVB 4DZBB 1ZHLA 2CXKA 5DJZA 4NQCB 3PGDA 4QWWC 2XA3A 3MUZ1 5DHYB 3RI5F 2A74A 4YHPA 2HWZL 1L9MA 1F4YH 2ATPB 3E6HB 1I7TA 5ID0B 4U1MA 5F8RC 4HFWA 4NP4L 1BAFH 1IT9H 4HULB 1IGFH 4I0KA 3U4BH 2IADA 5DDHB 4XCFH 4DZ8B 1QACA 3QISA 4H1LG 5ACZB 4P59H 2RCSL 3QXAA 5K9JL 4TSBH 2BVEA 3G6DL 3MACH 4YGAB 1OSZA 3TVMC 4OFDA 3IDIB 3R1GL 2JJTA 4YNYA 4XP4H 2IBZX 5T1KD 2DWDB 2R0KH 3MYJA 3SGJC 3OJDA 3BHBB 3VW3H 4GKZB 3MLXL 4C54A 2KBGA 2NY1C 3EKCA 5GS2D 1QFUL 1XGRA 2MFNA 5CJ5A 5DMKA 1BOYA 1FBIH 4PJ5A 3RWDB 3HLAB 3DI2B 3OZ9H 5KW9L 2CO6B 1QBBA 3AS1A 4LARH 2ICCA 3P4NB 3DX7A 3CDYA 4JG0H 1VADB 3PP4H 3IDMA 2W0KA 4FFWD 2HKFL 1ZMYA 2MCPL 1EEYB 1FZOA 5DQDL 4HLJA 1UYWL 3BSZH 3HE7B 2EDOA 3HPLA 2EE9A 2EYTA 3CFEB 3IT8D 3MRHA 3QZWB 2DKUA 3MYZA 3DUUB 4N9OB 3ULVL 2AW2A 4PJIF 3WKML 4TQEH 5IB4A 1EH9A 1BBJB 4POZD 1B0RB 1HI6B 4KK5C 4PJEE 2DB8A 1ZLSH 2O5ZH 2W0FB 2DM4A 1HSBA 4R6UA 1S9XB 3PWNA 1CDJA 4L3CB 2P48B 4MXQC 4GAGL 4RGNB 3TJHD 4EVNA 4WWKA 2FO4B 3ZE2F 1QFWL 4IOFD 1VKXB 1EHAA 3GBNH 2MNUA 2ICWA 2YD3A 4C56B 3MUY1 4UT6H 3FO9A 3RIAF 1Q0XH 2CKBH 3ORJA 3FZUC 2QEJA 1YN7B 2BSRB 3K1KC 4NQED 4ZO7A 1M1SA 4YAQA 3TT3L 4P4KC 2BVPA 3W2DL 1BD2A 5IK3A 1LK2A 5I8EB 5DJAB 2QR0B 3ARFA 5IKCA 3WHE0 4ZQKA 2R1WB 1F4HA 4GW1A 5CINL 2X10A 3JVGC 5H37G 4F15C 3HZVA 5DVNA 4DCQA 1I9EA 1A7RH 4MMZC 4ZYKA 4WHYH 4GS7B 5CJQH 2DLIA 4FQIH 3T0AA 2MJWA 3EOBB 3X13B 1CT8B 4IRSC 1CLZH 4PRIE 2WAHA 2HT4D 1JYNA 3QQ4B 2NXZD 3CSPA 1CYGA 1I8LA 4CAGA 3IFOA 3B5TA 4YDLC 4XAKE 2F53A 3IETB 3GJFB 3EFFB 1N7ML 3MZGB 4L3ED 4I48B 2RB8A 2GIYA 1U2CA 2B2XL 3BGMB 5SWSE 4GAJL 4V2BA 1MCWM 2GCYA 3WCYA 1Q0YH 3D18A 4IMLA 5D1ZA 5HYSA 2C1OB 4OM1L 3P3YA 3UTQB 2YMXL 2FL5A 4H5SB 4AEHL 3C8DA 2FNBA 4JG1H 2YC1B 5E9DA 1I7RA 4JRYE 1X3DA 4GUPB 5KVGH 1H0DB 2XN9A 1I75A 3GSOB 4DW2L 4ZUWB 3HTLX 5ETUA 4YHPB 1NDMB 3TC9A 1MHPH 3WFBH 3TA3A 3ULUF 3V7AG 1WT5C 3BQUA 3LQAC 3VFRB 3IGAA 3KLHD 4JKWA 1YEEL 3OAUH 4PY8J 1KSRA 4L4VB 2AKRB 4HFWB 3SDAD 1YEFH 2IADB 3EYSL 2HMIC 2NXYB 1F02I 1UEMA 1YEIL 2E7MA 2J6EH 4JRYB 2GT9B 5ACZA 3ARDC 4BZ2H 5KG9A 3KYAA 5DTFB 2AJXH 4WCYH 5INDA 1JN6A 5F3BB 1HOCA 3GMOA 3TJEH 3ZHKA 4RAVB 1OM3H 4YNYB 3SHSA 1URLA 1S7RB 4J1UB 2YN5A 3BOVA 5L0QB 2BRRL 5LCVH 2A9MH 1JFQH 4G9FA 4HPYH 3KJ4B 5DHVA 2JJWA 1UJ3A 5IFHH 1S9WA 2XFXA 1MCPL 1SYVA 5JXAL 3ULUE 4MXQD 4OCLC 1KELL 3RIFF 3S37X 4ZFOA 3EJJX 4QGYA 4GG6B 1OTSC 2Z0BA 4PBVC 3HS0A 1X6LA 2MQ3A 3FMGL 3HLAA 2VZSA 1G6VK 3IFLH 4EI5B 2ZKHL 5JORB 2MPAH 4GRWH 4HKJB 4DGVL 3DX7B 4K23L 3I02A 1U3ZA 4MNQE 1WWAX 5DJYA 5GS0D 5I74C 1Q1JL 4UIMA 1RUML 5HVFB 4G7VL 2XY1A 3FOMB 5IWLC 4FXKB 5IBLC 2OZ4A 3QO0B 4IEFB 4F7CB 4ODTL 3PWVA 5HI5D 3NPSC 4QXUH 1ZEAL 2GFBB 4F9LA 2VLMD 4MNGB 4G8EA 1RZJC 4PJAE 4YDKH 4R2GD 4RFOH 5T1DL 4W6WB 4JO2H 5FHAH 2ERJC 1QVOB 5ADOH 1D9KA 4PTTA 1S8DB 4P5KA 4IHOB 4NYLB 1OAKL 4P3DA 1DSFL 4I8DA 4IS6A 3FO1B 1UA6L 4GG8B 4PJHF 4UMGA 1H3PH 5HHOA 4EVNB 4HUXB 3FTGB 5TDPA 5DJ8B 5BRZB 3OBAA 2AJ3B 1I1AD 5GSVA 2CDFA 3HUJE 4MS8D 5ESQA 1KXVC 4OUUA 3TIDA 3N1MC 1J1PL 2X89A 3FB6B 4EDWH 4Z0BL 4NC0B 5ALBH 3UBXB 1IL1A 1YN7A 4M43H 3O4LE 4OGXL 3MREA 5DI8A 1R5IA 4F8TA 2EO9A 5C0EA 2QSCL 3MV8A 3T0EB 4E41D 3SDCB 2X4NA 5TQ0H 3ZE0E 4PV9B 5CMAB 3RL1A 4MDJA 4NO0A 4P5MA 5IVXF 3LVEA 3MRFA 4PJBF 4IRJD 3QDAA 3S35H 1NAMH 5KVEL 4ODWA 4QHUA 1J0KA 2WP3T 3WN5C 4N8PA 3JWOL 4K94H 5GS2H 2Y4SA 5JUEL 3CSYB 1DVFA 1CD8A 4FQJH 1UH4A 3D85D 3MLTB 1XF1A 2Q7YB 1JPTL 4Y19E 5CFHA 5IJVB 2P4AB 1C1EL 5FGSA 3GMLB 1A02N 3QQ4A 4HBCH 4EI5C 2ZUQB 2J8UA 4P23A 2X1OA 2D9CA 3VXTB 4NOBA 5FYJL 1WFNA 2F53B 3IETA 1INDH 4X8JA 1KGCE 4LSDA 4YXLH 4HS6A 1TVDA 2PYFB 1FZJA 3HG1D 4G8GD 1TCMA 2EECA 1ITCA 3QI9C 5EG6C 2Z92A 2BHZA 2UZXB 4ONOA 4YE4L 4XZUA 1BIIB 1T0MA 5BS0E 3BEVB 4OD1H 4EI5D 3GBML 4MA7L 1NBZB 3S5LB 3S88H 1A6TA 3EYUH 4JKPH 4TPRH 3AXLA 1OCWL 5BMFL 4Y2DC 2XN9B 5T33L 3KR3H 5KSVB 2W9EH 2NX5B 4ZD3H 5GGVL 2DQJL 3EDFA 5ETUB 1KEML 1BBDL 1JNNL 4IIQA 3TA3B 3D2UD 3WJJA 3PQYA 3QUZD 3TFKD 1VA9A 1VESA 2VZVA 4R4BA 2NNAA 3KNBA 3CUPA 4U0RC 4F2MA 1DVFD 1UADC 5BS0B 4S10A 1WICA 4B50A 2X4SB 3VGHA 4WTZG 2YS4A 3BH8B 3CXHK 5JZ7D 1MI5D 3DVGB 3QQ3B 1JK8B 4NQCA 7FABH 3GJFK 1KYOJ 5IT2L 3QEUA 3U0TB 1OQXA 1R3JA 1F4XL 3DRQB 5I8CA 1MJ8H 4J1UA 1P84J 2FJFA 4HMDA 3WL9A 5E1AB 4K8RH 5E03A 4CUCA 4UNTA 3NGBB 4G9FB 4F8QA 2X7LB 4DVBA 5ALCL 2HYMA 3QXVA 1NMBL 4PJHB 1WCQA 1W0WB 8FABB 3DX8A 4ZNEA 3T77B 2W0LA 1I3GH 2HA1A 1M7XA 3MFFB 3GB7B 1FV1B 3RA7H 2FYYA 3CFJA 4OCSH 4XPFH 4QWWD 4XPAH 4HPOH 4NSKA 3BP6B 3WLWD 3X12A 1CVSC 1S3KL 3O8XB 3DX9B 3NMEA 2XTLA 2PN5A 1OARL 4UTBL 5FKPA 5F70A 2XICA 3BP7B 4G9FE 1QSEE 4HJ0D 1QOKA 4LCUA 1HQRB 4HT1L 3NOIA 4KXZI 4BQ6A 2A6IB 3O6FC 4UT9H 1PVHA 4EDXA 5L2KE 2B1AH 3VXUB 1FG2B 3K0WA 1UACL 3G6JF 4FP8L 5JHDA 2ZUYA 3HNSH 1CZ8L 2F53D 2I07A 2ITCA 4Y2DB 2AK1H 4NO0D 1DQJA 2C3XA 2Z9TA 1I3RB 2QQKL 1MCWW 4GG8A 5B39G 3CFEA 1JRHI 3TZVA 5JLZB 3V6OE 3T0XA 5E24E 3DUUA 2NY3D 1CFQA 5GSVB 1LNUA 2OP4H 2CLRB 3UBXA 3MRPA 2OK0H 3WFDL 3QHTC 4JZNB 2EDYA 1WV7T 1T1ZB 3KPQB 2BC4B 4OJFL 1I4FB 1DBML 1IC7H 1KIQA 2K9UA 5DUBB 5FM8A 4FFZH 3UTOA 4R3SB 3PWNB 2JELH 4S2SB 1QRNE 3QQ9C 4M4RA 1NGYB 3L3HB 5SWZB 3V9FA 4NQTA 4IDJL 4A2MA 1J1XH 3BZDA 3DVIA 1M05B 1KEGL 1TZHA 2OL3A 2ZNXA 3FL7A 3HCVA 5CZXC 1NCDH 4WV1A 1XIWC 4WW1B 1AKJD 5F7EL 1BFVH 3VGAB 3OPZH 4ACPA 4W6YB 3UJTL 1EEUA 1YJDC 1NCBL 4WDIA 4JFQB 4PJ9D 4GXUN 4M7ZC 4F58L 1MFAL 4L4TE 2FBOJ 4WFED 5D2LA 3HR5B 1UWEH 4NPYB 1V5JA 1OQOA 4LGPB 4OZFB 5FYLH 4KHTL 5GGRY 3KPOB 2X4TA 4Y1AB 3U9PL 3AMKA 4JZJC 4GW1B 5DJ2A 4EIGB 5JO5A 5HHME 1F3DJ 3RU8H 2JJUA 3CC5B 4APQD 4KV5E 5CD5D 4N5ED 1AGBB 4F9LC 2Y5TB 4YEFA 1FNGB 4P0DA 2WNGA 5C6TL 5I1JH 4XZUB 2QSTA 1A5FL 1SYSB 1BIIA 1T0MB 2IJ0C 1BHGA 1E6OL 1RULL 3GSXB 5KOMC 1OAXH 4OUOA 3O2VL 5EO0A 2XZCL 5KSAD 2GSIB 1IGCH 4OZGB 1DVFC 1EERB 3VI3E 3OKNB 1ZHLB 1MOEA 5D5MA 3C9NB 5EZIH 1B6UA 2AXHA 1T7XA 4I18C 5EPMA 5C0NC 1FFQA 2DN7A 5FYKU 3F6IA 3UBXI 4PRHE 4EN3C 5T3XE 1SM3L 3IU3A 3CH1A 5HDOA 5HJ3B 3X3FL 4QKXB 4ERSL 4ZNCD 1CBVH 3P4MB 1I9JL 4Y5VA 2HJLB 3ARXA 1KC5L 2X4SA 5EC2A 1I7RB 2WBJD 3G6JE 1FAKT 1N6QH 3STZB 1UQSA 4JZOB 1H0DA 1A3LL 3P11L 1AI1L 4QHNB 2Z93B 5K9KA 2YK1L 3VRIA 3WNKA 2P5WA 1DL7H 5D71L 3DRQA 5HHOD 4R97B 4LSSH 4I3SH 4NQVB 5ILTH 4K3GA 5E8DL 1DQDH 3RAJL 4ZO8A 4RMRA 1IGTB 4LLWA 3C5ZC 2VLJB 5J13C 5I6XC 2P42B 1QSED 3F7PC 2XWJB 4WU5B 1DE4B 3Q3GB 4MAYA 4PJHA 4WTXA 3WN5B 3IXAB 5I9QC 2YHGA 4JFPA 4ELMA 4I3RL 4XAKD 5EO1A 2VKWA 5KG9B 4K7FB 1IKFH 4KJQC 3JWDH 5C0DA 1KCSL 1GAFH 2HT2D 3MNZA 2A1WL 3LIZL 1FC1A 1NFIA 2HFFA 4PYGA 3B2UC 3BRGC 2NY4D 3TPKA 4G6AD 5F3HA 3HE7C 1N5YL 2X9YA 1NCTA 4Z7VE 4TUOB 1QZ1A 3WE6B 4UB0L 1AO7E 4RRPG 5T3XH 3TBTB 3Q6FB 3RPKA 3BP7A 2EDKA 4MB4A 1MRDH 3HPLB 3P30L 3KPLB 2Y06L 4DEPB 2AEQL 2WW8A 1U58A 4Q6YA 1HEZB 3CNKA 1RURL 3VXUA 1CFTB 3ARDD 2LAGB 3VI4F 4KKAC 2HN7B 2ZWLT 4A6YH 3O0RL 1BF8A 3KWWB 5IW3A 5E99H 1I7UB 4JGMA 3CZFA 5ERWB 1ZLWH 1S9XA 1SMAA 1QNZL 1OP5K 2NR6D 2VXUH 1OWRM 1YNLL 5D7IA 35C8L 3VRJB 1CCZA 4NQXA 3DGGB 1IEBA 2G75B 5C0IA 1KLUA 2V9QA 2FO4A 1MY5A 3BZFA 4KKBD 5D1ZC 3TCLB 2FHFA 4KROC 3RWHA 3P77B 2H2PC 2FSEA 4F3FB 2ZJSL 3OKMA 3MGOB 4U0RB 1TJGH 3BT2L 2P8LB 2D31B 5FDWA 1PKQE 2WINA 4Q7DA 1CG9B 1GH7A 5C3TA 4QNPF 3AY4A 2JK5B 1EXUB 5DD3H 4JY4A 1YQ2A 2C26A 3O2DA 5I8EA 3KPSD 4ALAH 5I19H 1X5YA 3MRLB 2OZ4H 1ETZB 2BSTB 4LVHC 1CICC 3QSKB 5CCKH 3C5ZB 4ZUTA 5KVFH 4LHUG 2OBGA 3SE9L 2VLRB 5D70L 5T3XD 2ICWI 1EPFA 5IW6A 5E8NA 2NY5H 4QRRB 3AAZB 2BY2A 1RUKH 3B9KC 2D7MA 3MUGA 2QQQA 1MAMH 5D2LB 5TPWH 4AIOA 4Z77B 2YSSB 1XR9A 2YXFA 3MA9H 4X9BA 3OAZH 2MQ0A 3H3KA 4LBEA 1P6AB 4DKAA 2DMCA 4GRMB 1AC6A 3CC5A 1BGXL 1T2QL 4ZO9A 1CTOA 5HGAA 5B8CA 1P1ZB 4G6ML 5F9DC 3P0YH 1CGSH 4K7PX 3ZLQC 4YXKH 4IMLB 1BQHG 3WIIH 1MFNA 1J10A 1JV5B 2YR3A 1T7YA 2A73B 1T20A 2DLHA 3HKFA 4H8WC 5SV4A 1X5IA 3OQ3B 5I71B 3GSOA 3BPOB 3ILPA 4WNQA 2OR9L 3T0DA 3S4SB 4Z7WA 3QDGE 3FFCE 1HYRC 3LPFA 5E4EB 3OKDA 4X5XB 1BFTA 4LCYB 2Z92B 4AY0A 2YUWA 1FH5H 4OT1H 2WK2A 4YFLI 1UFUA 3H9YA 4KRLB 1S7UA 4RA0C 1MREH 2VQUA 3IRPX 4PFEA 4AEIH 4EEEA 1HKFA 5TH2A 3P4MA 1RFDH 1JHKH 3TWCL 1J7VR 3UTZB 3NCCB 3AXLB 4GRLC 4JRYA 1QBAA 4WUKL 5HGHA 2BHUA 4YX2H 3THMH 5EORH 4DUWA 5SWQB 2NX5A 2YD6A 3EYFB 1S9VB 4DKEH 2GAZB 5DHYA 5E7BA 1QHOA 2P5WB 4LCWB 4TULH 2YEZB 3NCFB 3PGFL 3QFJE 4WHYG 4XWOD 5KN5B 3WIFB 1MJJA 3LMJH 4LPTA 3A6CL 1J0IA 5DDHA 4WO4C 1UCBL 4J3WA 4U0QB 4S1QL 3WUWA 4MNQD 5H94A 4GO6B 3VFGH 4LCIH 2X4UB 1IM9B 3RWFB 2FBJH 3L3GB 1OSZB 2XQBL 1GRWA 3DVNA 2VSCA 3CFIC 2DD8L 1IQWH 2NY7L 4KRNA 2AGJH 4E41B 3MNVB 3W9DA 4R26H 3F12B 4ZTOH 2ZUSA 3DVFA 4S11A 3L5HA 1T5XA 1U58B 1Z9OA 3KJ6H 3T77A 2DQGL 3HN3A 2JB6B 5CZXD 4GS7C 5CILL 1GHFH 4NRZA 4EXPX 2FYYB 2J6EA 1RZFL 3C08L 4D9RD 2HN7A 3TIEB 1ZV5A 3O2WL 2HRPL 1YJDL 1S8DA 1LK3H 3WXWL 1F3DH 5FYLD 5F7LB 3AB0B 3KDMA 1CXIA 4Q9RH 2DQCH 4FQ1L 4L8SC 4PJFA 1RZIA 3WDHA 5JR1L 2VC2L 1I9RL 4N1HB 1WF5A 3K4ZA 3TCLA 4EDXB 1MAKA 4RFEA 15C8H 5GGSA 5C0RH 5D72H 1Z3GL 3RY6A 4F3FA 3VWJB 1G7IA 2B7DT 1XCQA 3HI5H 4BSWA 4PRDA 1Q72H 4QHKI 3R0NA 1IL1B 1BZ7B 4ODUA 3AGVA 2E27L 4XNMB 2A9NL 1HSBB 2JK5A 2WIIA 2R9HC 1HDMA 1EFXD 2YPVH 2Y6SC 2F54A 4F15B 3VMOA 4X6CA 3V6ZB 3L7EA 1I85A 2P24B 4XP9H 2BSTA 5EZLB 4UILL 4MQ7B 2JJSC 3ULSA 1OAUH 3EO0B 1ORQB 4CU7A 2N7AA 2RAMA 4EUPH 1ZTXH 3QUZB 3MRPB 4CW1A 4OSUL 3SGEH 1N6VA 4PB9L 5E7FA 3NN8B 3I85A 1WBZA 1EGJA 4Y5XB 5I1AB 5I75C 5FF6B 3VFWA 2A83B 3ARFB 4QT5B 2PYEB 1M05A 3GSVB 2DKMA 2EZ0D 2HAZA 2DQHH 4KPHH 4OKDA 5EU4B 3EYOB 4LEXH 4M93C 3RDTC 4F9PA 5EN2B 1DP0A 1MWAL 1LO2H 5JHLH 4PRHD 4O5LL 5EH1A 5A40E 1GC1H 1C08B 3C09B 4LOUD 5EOQH 1T20B 1NGZA 2VDRH 1I9IH 3ZL4L 1F8TL 3O3AA 3SGDI 3GFUA 3GJFA 3HNVL 4QRTA 5ESAB 4LLMA 1MJ7H 1SEQL 4Y4HB 3JTTB 5SWSD 4PRBB 5IF0A 1MNUL 2DDQH 3LQMA 5EBMB 3IVKA 4H20H 2Y5TA 5FYJU 3I6KB 2CH8A 5AZ2H 3O6MH 3UEZA 2PO6C 2F74B 5JQ6L 1H9VA 1FLTX 1MCLA 2VAAA 4XBPB 1NAMA 3BVNB 3TBWB 4K3EH 5HDLA 2DIJA 2ERJB 2AJYL 4PY8I 5F9JA 5TGBB 12E8L 5E56A 3LKRA 1S9VA 4EUPA 4GMSL 3U0PB 2FHCA 3O81A 4LDOB 1MFCL 4KJWC 2F8XC 5MEQB 3PDDA 3LEYH 3HC3H 3D48R 3H42L 3LEXB 2FATL 4P2RB 4L4TD 4Y2OA 1RZ8B 4MAUH 3REWB 2D4FA 4XMLL 4X6DB 2OYPA 5E9DE 3UJIL 5FV2A 3WUWB 4NJ9L 4RWYH 2QQLL 3A6OA 4JZOA 4XB7A 4XVJH 2C1PA 3OKKA 4OCNC 5GIRA 1ZANH 4KJWD 3VRIB 4NQEE 5CEYB 1SJHA 4NSKB 1T03H 3NFNA 1OB1B 3EBAA 3CDGB 3SKNA 5JIPA 1CGTA 1WC7B 4LLWB 4TOYH 1G6RA 3OL2A 1HQRA 5FGCE 3PXJA 1YNTB 2AJZB 2DQIH 4GQ9L 1X5KA 4Y4FB 4B53A 3OG4B 3D39A 3ES6A 2JB6A 2VL4A 1J0HA 1UWXH 5D4QA 3QUXD 4K55A 4PJ8B 1EFXA 3RIAK 1U8MB 4LVEA 4HAFA 1AGFB 3MLYL 5E2JA 2BNQE 2ADIA 1I8IA 5KS9E 4F7CA 4O9HL 3GSUA 5L2JB 1BVKA 3LPGA 4F7PB 2UVEA 1XT5A 4XH2A 1FNSL 5H8DA 2BJMH 5HD8D 1F6FB 1S9KC 3LZFH 5JQHC 3MLVL 4LSQH 1NEZB 1BZ7A 2WBKA 3RHWF 3BKCL 4JDVA 1T1ZA 3KPQA 1RZKL 4LIQL 1TQCB 4OTXH 2J3SA 5D7IB 4RISH 2NTSP 4UBDC 4JKKA 5C0BA 3CXHJ 3PQYE 5GGTL 4QTHA 1QFOA 1WGOA 3VMNA 3K2UH 1DN2A 4BQ9A 4HEPG 2NMSA 4U05A 1JF5A 3MRJA 4HIIB 4CU6A 2WLZA 4Z9KB 5C2UB 3LEVH 4IM8A 1HKLH 1KIRB 2X4NB 5L8LB 3A67L 4YBLB 5I8OH 4I9WD 5TDOA 3D2UB 4V1DD 4FMKA 1ETZA 3MXWL 2X4TB 2R4SL 5KVDH 3GSVA 2VDML 4B7LA 2PNDA 3ET9F 5E2WL 4G6KH 4LRNH 3MOAL 3QDJA 5AAMA 3H0TB 3ALPA 3KPTA 2AJUL 1AO7D 1P4IH 2N7BA 3GMRB 3KS0H 5E2UL 5ESVB 4ZUUB 3M17B 2VDLH 3H9SE 3VG9B 5L9DL 1QFWI 4OCRL 4ZTPH 4KTYA 3PL6C 5T3ZL 5MHSD 3GSNL 1H3VA 1NFDA 4GG6E 2E7BA 3BZ4B 3G08A 3MUGB 3WIHA 2Q8BL 4PJFF 5C09E 2J8UB 4P23B 5TE4L 4Z95L 1KJ3L 1OVZA 4X4XB 3T08A 5ENWA 1CDYA 5IR1B 1ZS8A 5LWYL 3LB6D 5J11C 1YEDB 1P1ZA 2VDKL 5K93A 4BYHA 3SKJH 3S6CA 5JW4M 1DJSA 4JHAL 3O6FB 4PJCB 1U8NB 4K8RD 1OTUD 3I9GH 1PY4A 1N3NB 4U1LB 4OZIB 1WBXA 2VAAB 5FIEA 3MRBB 3STZA 3DPBA 5DUPH 3OXSB 1U9KA 3IJSA 1VEPA 3UXFA 4MCZB 1S9YB 4PJDB 1KFAL 2FEEI 2ATPA 3E6HA 3U83A 3VD7A 1NDGA 1I7TB 3QULA 1IGTA 1P53A 4EXKA 3LEXA 5IMMB 4U1MB 2HT4C 4NZDA 4Z7UB 3KNBB 2J7LA 4KVCL 5GXBB 5DK3A 1RZ8A 1JGVL 3ARED 3LN4B 3UTSB 2AERT 3GI8H 1VFAA 4JFXA 1T2XA 3S3SA 4U6YB 3QQ3A 3PNWA 4XNQA 4DOHE 5EIVA 2ZCHL 3CXDH 3BGAA 1VPOH 3OR6A 1NLBH 1OY3B 2A6JB 5D8JL 5I8CB 3WE6A 1XF3B 5DEFB 2R0WL 5HPMB 5D7SL 1FFRA 1KBGH 1CF8L 5MERA 4PG9B 1NC2D 1TMCB 3AS3A 3QPQC 3FONB 3GGWA 3TLRA 1XGRB 1EEQA 2VUYA 3MFFA 4YWGL 4M8VA 3RWFA 4XNZB 5AYUH 4WFEE 4U6VH 1AFVL 1QBML 1GJIA 1WCBA 3NCYS 4KMLB 2NY6C 3L6FB 3BP6A 1DQTA 3K2MC 4WI3A 2OJEA 1WFUA 4QXWA 4FFVC 5FCUH 2HVKB 2EYTB 2HTLD 3GSUB 1U8QA 3W11D 4Z8FH 3ETBF 4DN3L 5DD0L 4J4PC 1FG2A 4JQIH 1OAQL 4PS4L 4OZ4B 4MXWL 2PO6B 2NY4C 3I6GA 5F8QC 3ISWA 1A6UH 1RJLB 5E1HB 5D1QC 2ITCB 3ULVE 3IU4H 2HTLC 1D5ZB 3QPXL 2V17L 4OM0L 1BEYH 5F7HA 5ACLA 5DD5L 5E6IC 1KN4H 2QBWA 3JV6B 1LD9A 2R2HA 3UJJL 1IT9L 3RTQA 1MFBH 5D2NB 5CLWA 2AK4E 4J6RL 1XFPA 4TYUA 1CR9H 4RGMB 4DKFL 4YQXH 3BDYL 4KK9C 2CRIA 2J88L 2R1XA 3FT4A 4OIIH 1KJMB 1Y18A 4XVTH 3MLUL 1L9NA 2AEWA 2YA2A 4FZ8L 1BD2B 1OSPH 3CGTA 5HI5C 4HUVB 3Q5YA 4TSCL 1Q38A 5DD6B 5GGQL 1NBYB 2OSLA 2EE6A 3L3HA 3NCEB 5SWZA 4NN7B 4X9FA 3SDDC 3VFVA 2R1WA 1IQDB 4UQ2A 4NJAL 4YHMH 3HZVB 2VISB 4DCQB 5B8CB 4FG6C 1UC6A 5MP6L 2W92A 3QDMA 3FB5B 4PJHE 2XACC 1Z9SA 4M48L 3GIZH 1WIOA 3ECBA 3SCMB 1C5BL 1WBZB 3AREC 1OTUC 4NPYA 4I18A 4JG0L 3IFOB 3VFWB 5FF6A 1M6OA 3BPNB 4YLQT 5C0CE 2PYEA 1YPZA 4I48A 4KI5F 4Z7WB 3ARGD 4Z7VA 4Y89A 3BAEH 4S1SL 4LCYA 1QR4A 4YHOH 1S7QB 4EKXA 2KKQA 1QLRA 1J5OL 3N1FC 1QSEB 2QJDA 4DGYH 2VQTA 1YEKL 3QXTA 5HYSB 3O9WC 5JTWA 3RUGA 2IH1A 3ARBC 4LSUL 5F89A 2CJUH 3RFZC 3UTZA 2GSIA 2Q3ZA 1YN6B 2V7NB 5CZKA 2YD2A 4FNLH 4GH7B 1HYSD 2IAMD 3G6AA 1G0DA 5GRXG 2W9LA 3HAEB 1VFMA 5E0QA 4K71B 4GW4B 4P3WA 3DLQR 4LVNC 1P4BH 3SBWC 2V7HA 3TT1L 2VXQH 3QO1A 3HE6A 2ZCKL 3WIFA 3ARDB 4HXBL 4QCIB 2A77H 5CBEB 4UT6L 3RY6C 3LRGA 4N0UA 2EEBA 1LEGA 2X4UA 1TFHA 1D6VL 4HXAH 2VOTA 1A14L 3GMQA 4YDJB 3OR6B 2D7OA 4F33B 2AP2A 4NBXB 5IV2B 3MRGB 4KHXL 1SY6H 4NUGH 2VLJA 1FHGA 4XHQA 4WVRA 4U7SA 4XNYL 1UJ3B 5GRVL 2EKJA 3EOYG 4WFHE 3DXAE 2FECI 2Y07H 1KGCD 1ND0A 3D87B 2X40A 4ELMB 4GG6A 3VGAC 3RL2B 4OQTH 3S3PA 3LKOB 4GRWF 1UCTA 1M4KA 4HFUL 4YHLL 3LS5L 3D0LA 3BX7C 3VD4A 3NFNB 3I02B 4CDGC 4GBXA 4JO3H 1C16B 4FQCH 3K4DA 2I25N 4NHCL 1TJIH 3WD5H 3CVHA 4XP1H 3S3JA 1FYTA 3UZQA 3GNML 5CUSH 4MA1C 4XCYB 4H0IA 1MF2H 4JFOB 2GW5A 3MRNB 3L3DB 4OV5B 4U2ZA 3FJTA 3IDXL 4M5YH 5DEGA 3REVA 4HWEL 4N90E 4PRDB 1RQ5A 2VJXA 2XG5A 3D85B 1FL3A 4OCXL 4QTIH 3Q0HA 2XPGA 2VLLA 3VXMA 1P7HL 4AMKH 1IEBB 2G75A 2COQA 5EZLA 1GZPB 4NZTH 1K5NB 2R2HB 3LB6C 5CKAA 2AJ3A 2Q86A 4XHJD 5F1NB 3EO0A 2SEBB 1NL0H 1ORQA 2HFTA 4JFFB 3C60D 5D6CA 3FB6A 4LMQE 2IGFL 4ZXBC 2CXGA 3QP3A 4R8WH 3MV9D 1AXSB 2BY0A 4HJ0C 1NC4D 2IH3B 3MV8B 3V52H 4JY4B 4J3UA 1UEYA 5TDNB 3KLSA 4HS8H 3GRWL 5I1AA 2B8OT 2D7PA 3PABA 4EJ1C 2OSLB 2EDNA 4ONHA 4Z7UF 4M62H 2A9ML 2VXSL 1D9KC 3QAZB 4UQ2B 5CEXB 4QHUB 4JPIA 1GYAA 5MEPB 25C8H 1O0VA 3WSQL 5HD8C 4ZUTB 2PF6A 2VISA 4B7IA 3GK8L 4S0TD 1YDPB 5BQ7B 1F6AA 1G0YR 3D3VE 3TJHC 3BDXA 3D25A 5E8NB 1A3RL 4AL8L 3DURA 4LCWD 4HMCA 4KY1L 3IFLL 1KLGA 1C5CL 3T1WA 1N0LA 5JXEA 2ESVE 1XR9B 3IJHA 5D6DA 1MI5B 5GGUB 4Z7VB 1JBJA 1EJ6A 4LGRB 1MRFL 4LLVA 5BRZD 5MEOB 3VXUE 4ZYKB 5KSBE 2OX5A 3IDGB 3IKKA 4Z7NF 4OZHF 3M17A 4UV4L 3L3OB 4RFOL 5T1DH 2YRPA 3ZE1E 1VGEH 1MFDH 3ARRA 4K2UH 4OFYA 3ROOB 1U8KB 5IVXA 1A4JA 3C8HA 5FA3B 4D3CH 5F9JB 3UYRL 5J12C 5EU3A 4W81A 3S5LG 4OFVA 4V2CB 5B22A 3NCJL 3SN6N 4WNQB 4UIKL 3EJYC 1UWGH 5IR1A 1EZVY 2DQEH 1RMFL 2G9HA 4MJ6B 1XR8B 1BF2A 1BVZA 4KMQA 4KJPC 1V3JA 3D18B 4PJ5D 5D1ZB 3LS4L 5TH2B 2BCKB 3B6SB 4PD4K 1N3NA 4U1LA 5BS0A 2CLZB 5GISH 1HZHH 3G5ZB 5TE7L 2EDJA 1ZT4A 1IGMH 4W70A 4RGMC 3ARBA 1LEGB 1VACA 4PLKD 5HDQH 4GBXD 3S7GA 1NDMA 1RHHA 1JGEB 1WIPA 2O5YH 1AD9A 4A6YA 3IGAB 1LO5B 4PJXB 1MCBA 3WKNA 2EDHA 5HVGB 4L4VA 3JWOH 4K94L 3J8F7 5I66B 1NLDL 1BJMA 1RJZA 1U8JB 2JJSA 4NT6B 3FQNB 1CE1H 1XF5B 5I1CL 3QUZC 3TFKC 4RQQB 1FV1A 3MV8D 5GZOD 5EWIL 1JHTB 3RPIB 1A0QH 3L3GA 1AJ7H 4L8SB 1ZT1A 4L29A 4Y7MA 3DVNB 1CU4L 4NO3A 3MJ7A 4BM7A 2XI9A 4LASH 2D3VA 5E4IA 3P2TA 3BZEB 3W0WB 5IMOA 2J4WL 1NH6A 5FKPB 1PLGL 5I17A 4TSAL 5ABDE 4JKMA 5F7UA 1H8SA 4IRSA 3UAJD 1NUNB 2X4OB 1YEJL 3M8OH 5GS0C 1JYVA 4WJ5B 1QFPA 2P46B 4KTEL 2B4CC 1XGQA 4XX1E 1DDHB 3EYUL 2V5RA 3MV9A 1AQKL 3X3GH 1GSMA 1W8NA 3BESR 4XTRC 3KDMB 2R1YB 3LRSB 3ARGA 2XPGB 2IFFL 3SGDH 3KAAA 4X80L 4CL7A 1FDLL 1KEMH 3FT2B 1JPGB 1ZA3B 5DK0A 4Y19D 4PY7A 1GZPA 2HT2C 4U6XA 3DETD 3LD8C 5F1NA 2W60B 1G7IB 2QHRH 1DLFH 1LO4H 4P5KB 4ODUB 1CN4A 4KQ3L 4POUB 1I4FA 2F8OA 3E2HC 1TXKA 2WIIB 3RKDD 4R3SA 2I60H 1LEKA 4X6CB 3NZ8A 5MENE 4HUXA 1UT9A 4G7YH 1N0XH 4N0CC 2GITA 3JV6A 3VXNA 5ECJE 3G6JA 3ULSB 3RTQB 4WV1B 5DA4A 2X70A 4OD3H 1PBYA 5AYQA 4CN1A 2JCCE 4M6NH 1RIHH 2OQJA 3BP4B 4U7MA 2YBRA 4WDIB 4NM8L 4JFQA 3NN8A 5DK2B 4ZS7H 4XPFL 1I8MA 3QHZL 3PDGA 4X6CE 1NBYA 3QXWA 4X5WB 3MRFB 3VFMA 1NCWL 4UDTB 2EC9T 4K9EC 5DMIL 1KV3A 1IQDA 2J5LC 4Z0XB 2QL1A 1ZOXA 4QRQB 4OB5H 4Y4KC 4NNPL 2CGRL 4K7PY 3MSPA 3LN5A 1FNGA 1DVFB 2IALB 4KUCF 2R0ZL 3VFPB 2DJ4A 5HHXH 1UACH 1SYSA 2WSKA 2XZAL 4KUZL 4N1EA 4S1RH 4YC2C 2Q7YA 5JA9A 1S5HB 3TO4B 2NW3B 4FFYH 2WWKT 2OTWB 3RRQA 3FRPG 4BQ8A 1NC2B 4OFPA 5EO0B 3OGOE 5A2IH 5JOPE 5JNYB 3WO4C 4MA8L 2EDXA 2IBZY 2BVUA 2H9GB 1FGNH 1ES0A 3GIVB 3Q6GL 1VGKA 1TPXC 5LQBH 3FQUB 4ZFZA 3OB0K 4JN1H 3UTTE 2PYFA 4DUVA 3IFPA 1CGYA 1CD1B 4OCMC 5EOCL 4RX4D 1T0PB 2G9HB 3O6KL 4MJ6A 1QSEA 1EVUA 1UM5H 3CMOL 1FPTL 2VZUA 1WSST 4N8VB 1KLFA 3BEVA 3I50L 6FABH 4DAGH 5CD5C 4P4RA 3SPVA 2V7NA 1ZLUH 4PJ8D 2V5YA 4YHYB 1H5BC 5IW1A 1RD6A 2BSSB 3GMNA 1OAZH 3N1PC 4J7RA 1QRND 3IS1X 1IGJB 1ZAGA 4PJBE 1PZUB 1MWAA 2B4CL 5L0QC 4IIQB 3MC0A 1BQUA 5ID0A 2RIKA 3VXSA 4P2RA 5BO1L 4MJ5B 4R96B 2XRAH 2VAJA 3D3VA 1AY1H 3VRLF 5F6HJ 3FONA 3MLWL 1MEXH 5GRJL 3SQOL 4K3JH 3B5HA 4NC2B 4LLDB 4K7FA 3HPJA 4NCDA 1JK8A 2X4QB 4A2LA 2IQ9H 2HFFB 4YHKH 2KQMA 2Y23A 4PRPB 4N8CL 3L5XL 1RHFA 3EDKA 4L29B 4F33A 4NQUA 4PP2B 1LWRA 1XGTA 4HKZB 4KHTH 4KI5E 2FB4L 2VDPL 1INQA 4W6XB 5IHUL 1W72L 1OD9A 2ZCLL 5I17B 2H3NA 4RAHA 3BYYA 3H7LA 1CLOL 1YNTA 1CXLA 5K9QG 3QIBA 2EC9U 4WJ5A 3TV3H 3B9AA 1CFTA 2E7CA 1MVUA 1P7QA 4QXGH 4PJ8A 1MRCH 3QIBC 1T6WA 1JF1A 2DLFH 2ZPKH 3N9GL 3IDMB 5ERWA 2R1YA 2QTEA 5ISZA 1I8IB 4XPTL 3MA7A 3V79C 4L8BB 5D2NC 1LMKA 1U93B 3V6OC 1DBJH 5FEBA 1EHXA 1RZ7H 1KCVL 4U6XB 5TQ2H 5D7LE 5DA0B 1KC5H 4M9OA 4HWBH 2OI9B 5FKAA 1S7XB 1PJ9A 2CR3A 5F9OL 5DWUL 1QPXA 1KJMA 2VL5B 2I27N 3ZT5A 4YIQA 5SV3A 3MJ8A 5FK9B 4NZRH 4L3CA 1LEKB 1I3RA 1RUAH 5ILTL 3RAJH 3EDJA 3VXNB 1RIVH 3VG9C 1VKXA 2Q86B 1YNKL 1QFUH 3DSFL 2D7QA 4L4JA 4NKMA 5H2BB 5D7LB 5DO2D 2EEDA 3CFDA 4ZOAA 2IH3A 1GGIH 5D1QD 3NZHH 3AREA 2P7TA 1HNGA 2ZUQC 1WZMA 4JO1H 4QOKE 5TDNA 4KRPC 4E41E 5CHNA 2JE8A 3B3IB 5DVKA 5HY9B 1J0JA 3TNNA 3HCVB 3OWEA 4G3YL 3O9WB 4PYHA 3PP3H 1YDPA 4GJTB 4HH9A 2IALA 1NANH 4HGKC 2VXVL 2Q3AA 5KZCB 4DN4H 2P5ED 1HCVA 5C8JA 1B2WH 2D03L 3RUGB 5E4EC 2QSVA 4X6DF 2YPLD 1RK1B 5E99L 4DK6A 1YY8B 3BEWB 2NY0C 3KYKL 4X7EC 3CH8A 4X9IA 2UWEF 1TITA 1ZS8B 1KJ2H 4X9HA 4M7LT 4P2CG 4E42A 1CL7I 3UPAA 1S7UB 3C5SB 4XMPL 3G04A 4ODBD 3WIHL 4Z7OE 4UDUB 2VR9A 1F4WL 4ODSL 4H5SA 3LD8B 5IM7B 1TJGL 3BT2H 3HI6H 4POZC 4OZIA 3MRQB 5DZOA 4DFIA 3RUGE 4R97C 1UB6A 3OKNA 5SWQA 3EYFA 5EPMB 4KZEL 2EIZB 5BVPL 1T2JA 1DBAH 3INUL 3UTTA 5JMRA 3U6RB 4ALAL 2HLAA 4U1HB 4RDQG 3WLWC 3FAWA 4Q9QH 5D7IE 4M6AA 1MHEA 4JJ5B 2CLZA 1CL7L 4YHZL 3UTSA 4ZSOE 3MV01 4XVUD 1VFAB 4JFXB 5F7FA 5ICYB 3PUCA 1HH6B 3CVIL 2Z8WC 3HPJB 2YUVA 1JYWA 5DTFA 4UTAL 1WZ1L 4PJIB 5KTEH 1E28B 3C2SA 3FQRB 1NPUA 2IAMB 3GMOB 3ZMRA 2FGWH 3KLHC 4ISVB 2OTPA 2FWOA 3TBVA 2RR3A 3MV7E 1GIGH 4MSWB 4KQ4H 4E41A 5E2VH 3CVHB 1ZVSB 3X14B 4TVPL 2XFXB 3F12A 3UYOD 5I66A 1RJZB 1U8JA 4XCYA 1G9NL 2G5RA 3AS2A 4GRWB 1XF5A 1NFDE 2CKNA 5FYKL 5EO1B 4WHTA 3WIIL 4O02H 4XC1L 2J2ZA 1PG7W 3WFCL 2F5AH 1YUHA 1YPZF 4XP6L 2BFVH 3RI5K 1ZT1B 1RVFH 2LV4A 3SOBH 3D5OF 2DBLL 4H25B 2OCFD 4Y5YA 1ACYL 4P23C 2OJEB 1U95B 2OR9H 2C4FT 2AABH 3EOTL 3T0VA 3GM0A 4AQ1B 1MCFA 1FH5L 1MREL 2VH5L 4G8EB 4LFHD 3VWJA 4OLVL 3FN3A 5D6CB 3P0VH 1OGAD 4FS0A 1JHKL 4HUWB 4YHNB 1DDHA 1IM9D 4JE4B 4Y1AE 2YUZA 3KWWA 5KVMC 2W9DH 3KYOB 2OMBA 5M7QA 5EORL 3MXVL 1DN0B 4XNXH 3KLAB 3VDBA 2JKXA 1GGYA 1CK0H 1KPRA 4TULL 1W0YT 1B88A 4U1JB 3VMPA 5CSBA 5FUZL 2YZ8A 4XVSL 5HHNB 4FOMA 1KLUB 3V0VA 4IIQC 4DTGH 5BV7C 3P77A 4KUCD 2CDFB 2AV7B 4OUUB 4BZ1L 3OKMB 4Q2ZA 1A7QL 1YMHB 1CLYL 1G9NC 1A7PL 2EICA 2I5YL 3I3DA 4GG6F 5GHWL 1UCBH 3B9KB 4CW1B 5FDWB 1UM6L 4KAQH 1NCCH 3V6OA 2JB5L 2XTJB 2C4FU 2FLBT 1MPAH 5E9DD 4JM2F 1G84A 4JANB 3RL1B 5FXCH 3ZE1F 1K85A 1MI5A 3OF6D 2NY7H 3GKZA 2X4PA 1BQHA 3DETC 1L7TH 5EU4A 1INEL 5ANMA 4HH8A 4LLUA 5DJXB 4JFFD 1FL6A 4JY6A 5CSGA 2YBRB 3NVQA 5DFTA 4D9LL 4NZUL 3SJVD 2YD8A 3QWOB 5GGRA 5LGKA 3O2WH 3ROOA 5IVXB 1U91B 4Q97A 1KB5B 1MJUL 4Z7OF 5HDBE 2DM3A 1RK1A 2HLFD 1P2CA 2LE9A 1FLRL 4X4ZA 4X6FB 1G7MB 1HIMH 5D96B 5ESAA 4CU8A 4GRMA 4FQ1H 2CMRH 1CFVL 4JFDD 1U36A 5IF0B 1U3JA 5B3NA 4J8RA 3LN5B 1VFOA 1AE6H 1X5GA 3O4OC 2BCKA 3B6SA 1A6AA 2BVOA 3NA4A 4PJ7B 1IBGL 4OLZH 1F2QA 4YK4C 5IM7A 3OX8B 2VTFA 4HIJA 2A73A 4H88H 1OLZA 1E4WL 3FO2B 3JWOC 1JWMA 1A3QA 4ORGB 2H9GA 1L7IH 4UINL 1ES0B 3GIVA 1DEEB 1YY9C 2BVYA 4KTDH 5TGBA 5C3LD 3BN9C 3L7FA 4EUPB 2YPVL 3S4SA 4KKCD 1PDKA 5KAQF 3LSOB 2HLAB 5MEQA 4YFEA 5JW4N 2V7HB 4YXHH 3PQYB 2NY6D 3ARDA 5F7YC 1TETH 5ITBH 1AHWA 4NKIH 1FORL 3D39D 1EJOL 3HMXA 1E4XI 4FFVD 2LTQC 3HA0A 1ZTXL 3WXVL 1IAMA 5EFIB 1AGDB 3QEUB 3GMNB 4U1SB 1OGAE 2ATKA 3GMQB 4YUEH 1G7PA 1OB1A 1JPSL 3S37L 4LNRB 5IV2A 3ULVC 5DJDB 2FWOB 1FC2D 2F54E 4HIHA 4JFDA 5T1KA 4D0CB 4MJ5A 4R96A 4M6ML 4XXCA 2R4RH 1ZA6A 5IGXL 1ND0B 5I1LB 2H1PL 4I5BA 2H2PD 4WHTB 2Q8AH 3RVWD 1IM9A 2VDNL 3T3MF 5JXEC 3MV9B 1JTOA 2RCSH 1CXFA 5KS9F 1T83C 4GBXB 3JXAA 4G8IB 6CGTA 1INQB 3R1GH 2IMNA 4LPXA 2CO7B 3A6BH 2R0KL 4ETYA 5EU7E 5DVOA 4PY7B 1R24A 1W0VA 3NIGF 1QPPA 2HT3C 4TNVF 2CRMA 5HGBB 1TQCC 3GMPB 2DRUA 4OLYL 3FN9A 3TIEA 5E5RB 4YHIB 1LO3L 3MV9E 4NN5B 3D85A 3H3PL 4Y16C 3OZ9L 1DN0A 2DQDL 1F42A 4NQSB 3NFSL 3ZSSA 3DUSB 5SWSA 4K71C 3NZ8B 4GT7A 5AZEH 1AXTH 1F4YL 3BIAX 3QR2A 3IJYB 4LAQL 2CK2A 1SVZA 1WZKA 4JDZB 4HGWA 4QHLA 4XCCL 3VGDA 2FATH 1OP3H 4NP4H 2SEBA 4JFFA 3U4BL 4Q2ZB 1U6AL 3CLFH 4XCFL 3EYQD 1B4JL 1QSVA 2VYRE 4DOHB 3V7AE 2Z31A 4XBEL 3DX6A 4XNMA 4TQEL 4HF5H 3AM8C 5D7JA 1KIQB 5DUBA 3HHRB 1A6ZA 3OXRA 5HI3D 1A7NL 3NH7L 1IAKB 3V6ZA 4CMMB 3V5DA 3PABB 5KJRH 2P24A 3K8MA 4UDTA 3WS3B 2D0FA 4G80B 4Z0XA 2FEDD 4G9FD 4XXDB 4WW1A 4EZMA 3QDJB 1NAKH 3FT3A 3QUZA 1FL6B 3MLZH 2AJVL 2GK0A 2DQUH 3QJHB 4ZSOA 1HHHB 2CKBL 4Y4HC 5E00A 1ZWIB 2Z31C 3F58H 4JZJA 1P2CB 5CHNB 3KHQA 4WEBH 4YFLF 5AG9A 2NY1D 4IMKA 1RJYA 5DQDH 5JO5B 2H2SD 3P9MB 4LLVB 3RVTC 5IHZB 1TTUA 3NIGE 1CIUA 3IDGA 5C9KA 1T04A 4DQOL 1RPQA 2BJML 2OMNA 4PLJC 3VFNA 3GSXA 3KPRE 1A7RL 1MCDA 5DGRA 5IVZB 3OTTA 3D69B 5FUOL 2ARWA 4HIJB 2YWZA 5FM4A 4P4RB 2N1KA 5D5MB 1FQ9C 3GHEH 2XXCB 1XCTA 3MCLH 3R06A 2BSSA 4NN5C 4JFEB 4QRTB 4PRAA 2ZSVB 1EHNA 3W82A 4Y4HA 1X4YA 1MWAB 1JGLH 2AEPL 4WEMB 3RP1A 1HN1A 1T1YA 1QFWH 5IMMA 3C5SA 2AI0L 4WFGE 2CIKA 43C9B 3TEUA 5I15L 4GAJH 2BY1A 1I1AA 4WI4A 2ZP0T 4HBQA 5DUML 5LGHL 4RMVA 2VKXA 4JFFE 4QYOB 2G2RA 3PNWB 4XNQB 3LKRB 3TT3H 3ZTJG 5FOBB 1BJ1H 3A67H 3BPLB 1RHHB 4BSVA 4DVRL 2I9TB 4UUJB 2DM2A 2W38A 4DW2H 5KVDL 4PJXA 1A9BA 1TVBB 3HFMH 3ZKXB 5JW5B 2XN9E 2P5EE 4D8PA 2NX5E 2DJUA 3L3JB 4WU5A 4JJ5A 1DE4A 4KDTA 2H32B 5C7XL 1P4IL 4JFPB 4U49A 5ICYA 3QIBB 4FQHB 5IHLB 4RQQA 4CVZA 4RMQA 4ZTPL 4WEUD 5K9QI 3QCUL 2D7TH 5KAQG 1YEIH 4CMHB 1T5WA 2IAMA 4WFFD 4YZFF 2HJFA 1RU9L 1II4E 4N1CA 2QKIA 4JFYA 5I1IH 3CPLB 3OJDB 5IMOB 4Y1AD 1CXKA 1JPFB 2VE6A 3DJ9A 3BKML 1OL0A 4M1GH 4MWFB 1MCQA 1Q0YL 1R24B 2C7UB 1EMTL 5IFHL 5DMKB 1N26A 4PUBL 5HGBA 4OM1H 5IMLB 4NQCE 4HK3J 4YC2B 3ULVF 1JUFA 3HC0A 5FCSH 4ZDHA 5FKAB 1S7XA 3OGCB 1AGCA 3MGTA 4H25A 5DEZA 3MRKA 5E95B 1KN2H 3NA9H 4DGVH 1JGUH 1JPGA 1ZA3A 3VRJA 1Q1JH 2YPLB 4OLXL 4MXVF 3BZFB 4JDZA 4WI8A 3RGHA 1JZ3A 1YEEH 3OAUL 4YGVA 4XH2B 4TTDC 4KDVA 5DURB 3C8KA 4R7DA 4YFDB 1BBJA 1MAJA 1PEWA 4QXUL 4YBLC 5F1SA 2LTQB 4G6FB 1YYML 3DX6B 4HUMB 4BZ2L 3E3QE 1Y18B 4JO2L 3SGJA 4NN7C 4HW6A 2DJSA 4J4PD 4MJIA 3CXDL 1EXUA 1DQML 3CU7A 4HC1H 4J12A 4NNXA 4JFDE 3UP1A 5BV7L 4HMEA 2NY3C 1QLEH 5DD6A 5HHNA 5D1XA 4WWKB 2GITB 2EKSB 3WS3A 3VFVB 1H3PL 3T8XB 2L7UA 5HHMD 3LPWA 4QTHB 1NFDF 3BJ91 3S96B 3FT3B 2FD6L 3HI1B 1KXTB 3I2CL 5CIPH 5C0GA 5EZJA 1TPXB 4Z0BH 5DK2A 3TZVC 4ONGL 3JV4A 1XGUB 3JWDC 4PLOB 4Z77A 4K23H 4NKOA 1QRNB 3BEWA 4JDTH 3VFMB 1CE6B 1RUMH 3MJ6A 1YPZB 1D5IH 1RIUL 3U1SL 4Z78A 1QD0A 3HG1A 4G8GA 4HJGB 5JW3L 3RWGA 3S35L 2EIBA 2O61B 5J9PA 5ESVA 4O4YH 3EOBA 4ODHL 3VFPA 4PJEB 2BOCA 4MNHA 4YDKL 1BOGA 1X5AA 1OAQH 3MCG1 4PS4H 1S5HA 3LHPL 1CFSA 2IH1B 5GRVK 3QWOA 5GGRB 3BZ4A 2LAAA 2ZG3A 3WFZA 1H5BA 4JRXE 3MBEC 2UUDH 4PRPD 1XCTB 1K4DB 3R06B 4JFEA 4N5EC 1IGYA 3MX0A 2V17H 4OM0H 2CD0A 1INDL 1YEDA 5JDJA 2B5IC 4C56E 1G7QA 3T2NL 2YWYA 3HE6B 3U7YL 3QUXA 3B43A 1E27B 5C6WH 1C7TA 5DFWH 2FL5B 1AH1A 4P46A 5EOTB 4PB0H 5DJ6B 4L8CA 1D5BA 1E4KC 3BDYH 1L4IA 4HIXH 5IQ7H 3MLUH 4MA7H 1IC1A 3PWLA 5CEZE 5IEHB 4TPRL 4NQCD 2G60H 3FQRA 1ADQH 1DFBH 4Q6IC 2YEZA 2F15A 4KMTL 4LU5H 2H45A 2ADJB 3QUML 4GXVH 4JVUA 5E6ZA 3PF2A 5GGVH 2NY3B 3FOLA 1NAML 2W65B 4FQXA 2YD5A 5JIKA 3ARTA 2HVJB 4Q74A 3D3VB 1OPGL 1BJ1J 3CLEL 1ONQA 2BXZA 4GOSA 5MP6H 1P9MC 5H94B 3AROA 3WDIA 5BZDA 3RL2A 4PG2A 2X4QA 2QSQA 3WJJC 1C5BH 1C1EH 4KI1A 4PJ9A 4PRPA 2YD7A 4HBCL 3MBXH 4EN3A 3HUJF 5FHBH 5E8OB 4BUGA 2H41A 4X6CF 1ZLUK 3RUGF 5T1LB 4MB5A 4PG9A 3BE1L 2R2EB 3HAEH 1NQBA 4JFOA 2H32H 1ODAA 5AWNL 5D7LD 1TNMA 5D1QB 3PG2A 1MVUB 2WUBL 3MZTA 3ZO0A 3HZYA 1I3GL 5JORA 1WCBB 2DAVA 1G9MH 5HYIA 5T33H 4OCSL 4X9GA 5IBUG 1DANT 5ISZB 4C83B 5IJKC 2NXZB 4OBRA 1HHJB 2HVKA 2LQRA 3TT1H 2FX8L 1U8QB 3MODH 4LLAA 4QRPE 5EBLA 3UX9B 4YGVB 4XCNB 2EO1A 1AIFA 4KZDH 2A2QT 3VRLE 3B8YA 2A77L 3RWJA 4WI9A 4OZ4A 1IC5H 2APTA 3B9KA 2B1AL 3FB8B 5CJOH 1CIDA 1CVRA 1PW3A 1RJLA 2E7HA 1Q9OB 5CAYB 4JY5H 1V7NL 1T22B 4NQSA 3UPCA 1HHGB 1A14H 1F4XH 5DT1H 3U4AA 4JANA 1LDPL 2ZOLA 1PG7H 5D1XB 3IJYA 1ZGLA 3MUJA 4QHLB 5BRZA 4LNVA 4KGJA 2QQKH 5CEXA 1S7VB 4XNYH 3QXUA 1N2RA 4TTGA 4LGSB 5D7LA 4MAYD 1JZ5A 1LE5B 3VGEA 3L1OH 1R5IB 2ID5A 2VLRD 3QFJD 3Q5TA 3UO1H 1A6ZB 5DXWA 2OK0L 1T83A 4HPOL 3WFDH 4LHUD 2BSED 1FVEA 4QRRD 1KB5A 5I1HH 2WUCL 4JO3L 2A83A 2EXYC 4JKLA 5GGUA 4OQ1A 4ZFFB 4PRPE 5HY9A 3PXHA 5L2KD 2JELL 4HG4K 5LBSH 4YK4B 3NBNA 4TVPE 5AD0A 1S7WB 3L95B 4J8RB 4APQA 1F4AA 5EN2A 1ROWA 3QUKA 2I26N 3FB5A 1C8PA 3B9KD 1OOAA 1EUUA 1XZ0A 4PJ7A 3SCMA 1F11A 5IJVA 1CICA 3TYFB 5FA3A 2XTJD 4I18B 4ORGA 3EZ8A 1A2YB 2KDGA 1GGCH 3L7FB 4LLMB 3MJ9L 2OLDA 4GXUM 3RNKA 1EO8L 3LH2H 1ZVYA 4LEOA 3BIKA 3RX5A 3CVHL 1RUPL 1S7QA 3QQNA 1BQLH 5DGQA 2AQ1A 1FYTE 1AHWB 4HZAA 2EDRA 1ZT7A 5IVZA 4G8FA 3BH9B 1N4XL 1NBZA 4P9ML 3MRQA 4R2GB 3S5LA 3SDYH 1D5BB 5I1JL 1YN6A 1RULH 2LVCA 1ERNA 2R8SL 2R23A 1DBMH 1X5JA 4UOW0 2CDEA 2XZCH 2N56A 2EIZA 3FQXB 1YQVH 3IXTB 2MQCA 2ED7A 5EZIL 2I24N 3IDJA 1JGEA 2ADJA 5F6IC 5DJDA 3QIUB 4JPKH 1J1XL 1HINL 3ARZA 5EA0H 4FQXB 4QCIA 3CUPB 1JCKA 3GRWA 4YDLB 3REWA 4NQDD 5BVJB 1OP3K 5BXFA 8CGTA 1RUQH 4Y19B 4JQXC 1BFVL 3E8UH 2HH0H 1T66D 2UWEA 3FQNA 4JM2A 3X3FH 4I5BB 1GPOH 4N0UB 1CBVL 4MJ4A 4ORZC 2G2RB 3TNMA 5L6YL 1JHTA 3RPIA 3QRGL 4PJIA 3O3BB 2NLJA 1SJHB 4LCCC 4U1IB 3BP5B 4R0LC 4IBLT 2R29H 4BSVB 3CDGA 3MJ7B 3SKNB 4UUJA 1DQLH 3FN0L 1FJ1B 1DL7L 4OF7A 2WWMD 5JW5A 3IRZA 3S34H 1ZVSA 5TE6L 1K8DA 5E8DH 2AS5M 4K3HA 5C0JB 4XPGH 3BGFC 3DX8B 2OJZH 1DUZA 5EUKB 3D39B 1SBSH 1YEHL 2X4OA 4X8XA 5DRXA 4O58L 1BD2E 4UV4H 3BKYH 3GB7A 4I77H 1KTLA 1RZJL 1HHKA 4W68A 4YJZL 3SBWA 4LHUB 5DF0A 4AG4L 1S5IH 1T5WB 1VEMA 4KVNL 4YHIA 1IKFL 3RVXD 1WJ3A 3M1BA 3QHFL 2FRGP 2FJHA 2HFEB 2EDTA 4LDEB 1FNAA 3DX9A 3O8XA 3BRFA