1FBIL

Crystal structure of a cross-reaction complex between fab f9.13.7 and guinea-fowl lysozyme
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
214
structure length
214
Chain Sequence
DIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQKKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDYSLTIRNLEQEDIATYFCQQGYTLPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (antibody/antigen)
molecule keywords IGG1 F9.13.7 FAB (LIGHT CHAIN)
publication title Crystal structure of a cross-reaction complex between Fab F9.13.7 and guinea fowl lysozyme.
pubmed doi rcsb
source organism Mus musculus
total genus 41
structure length 214
sequence length 214
chains with identical sequence P
ec nomenclature
pdb deposition date 1995-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fbiL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fbiL01
1T89C 2AGJH 4PD4K 2GAZB 3JV5A 4S11A 2NXYD 1MFDH 2G9HA 4LSDA 2VDOH 1KN2L 4N1HB 4ZFZB 3BP6A 5EU4A 4PBXA 3C2AH 5E4EC 3RIAK 3ARDB 5JHLH 3QNZB 1D6VH 4OCRL 3VXRE 5T5NG 3N85H 5BXFB 1Q38A 3BGMB 5C0CD 4DW2L 2YC1A 3SCMD 3V9FA 2DWEA 1JHKL 1TMCB 4F33A 4ELKA 5DO2C 4AEFA 2ZOLA 4ELMF 2V2TA 1Q9LB 3NCYS 5C6TL 4JM2C 5GGTH 4K3JL 2DLEA 3GJEB 1U3HD 3ULVE 4KHTH 2NCMA 4E42B 4LIQL 3ZL4L 1YNLL 4XVUD 5E5UB 3REVB 1JRHL 3KJ4B 3IDIA 1U8HB 2V17H 4XHJC 3ZYIA 3CVIH 1T66C 5IKCB 4N0FB 3RTQA 1JPGA 1I1AB 3MRBB 3O6FA 1BAFH 1P4BL 5F1NA 3G5XB 5EOCJ 5FOBB 4ZPVA 3KXFD 3QDGE 4AQOA 3F5WB 2VE6A 4C4KT 4D3CL 4OI9A 4P9MH 1NMCB 5FB8B 4NDMA 2OJZL 3U9PL 4CBPA 1KJ2B 1OVZA 4X6CE 3MRJB 5JW3H 5DGQA 3H9SA 5FK9B 3KPOB 3TWCL 5D7LB 3QEGH 4A2MA 3OX8A 3WS6A 4PLJD 5IB3A 1M05B 4L3AA 2DQIL 1MCEA 4ERSL 1M4KA 1FNEB 4W6YB 5D1XD 4QWWD 4FQLL 1BVKB 5IF0B 4M93C 3CFEB 3NIGF 1QFUL 3UZEA 3TBWA 2EDHA 4GBXD 4IMKA 3LPWA 4S1SL 5D96C 1A9EA 1CDYA 4QRTB 4FNLH 3W82A 1TJHL 4HWZA 3RWDA 1N5AB 4BYHA 2NNAB 2XWTA 3IAQA 4HXAH 3TYFB 4P2QB 5EZJA 3HE6D 1UM5L 1X5HA 2VDLL 1FLTX 4JN1H 1DVFB 2MPAH 3C8HA 3VXME 1DQLH 4NN6B 5D1ZD 1MCOH 3UC0H 2XXMB 4YDIH 3QDGA 1YMMB 4ALAH 3HE7C 5GSRB 2VKXA 3FZUC 1KIQB 2BNRD 4QOKE 4JO2H 2A0LD 1PZ5A 5C09E 1A64A 3MJGX 3GJFH 5DRZB 3EBAA 3ZKXB 4ONGH 1AGCB 1T1WB 2X1QA 3MLRH 4ODSH 2V9TA 4XCCL 5F3BB 4F37K 5IQ9B 4MJIE 1RMFH 1INDL 1FYTD 2Z93B 2NY4C 5K9KB 1X5KA 3C08L 4K94H 3GBNH 1AR1D 4IOSD 5E24E 3VCLA 4WFHE 1V8HA 3PIQA 2KBGA 2B1HL 4LEXH 3P0GB 1K4CB 4GAJL 4LQFL 4LVOB 1A7RL 4P4KC 4IJ3B 4MD0B 4NYLA 2J88L 1WBYA 3EO9H 1G9NH 3NH7H 5EOCH 2IMNA 5DTFA 3QQ9D 4YJZL 3GMMA 4XPBH 2XACC 1IC1A 4KMTL 4U1KB 1QNZL 3RUGF 1UWEH 3KNBA 1LK2A 4EUPA 1WAAA 3VXMA 1YEIH 1KV3A 3AREA 4G6AD 5EN2A 5ICXA 4CVZB 4IRSB 1EGJL 2ILLA 1BWWA 2XIDA 3VXUE 5IP4A 1DSFL 3IKKA 3BEWA 5IBTL 4JRYA 5IB1A 5EIIA 5JIHA 1KPUB 4Y4KB 5ETUB 4YHIA 5FM4A 4QOKA 5FECB 4MB4A 3I6GB 3LQAC 1LWRA 5C09A 3UTSA 3PHQA 1P53A 3FT3A 3VXOB 1N6VA 3QCVH 3HNVL 1P4LA 3OR7A 3RL1B 3DNKA 4IHOA 1CFTA 3SE4C 5AZEL 2W9DH 4Z7UE 1FQ9C 2A6JB 3QWRA 5GGRA 5E6IB 5DT1L 5FAAA 4ZOCA 3FQRA 1CLYH 4W68A 3QDME 5J6HA 4TSCH 4KV5E 4FMKA 4UTAL 3VG0H 1NCAH 1RZ7L 1AXTL 1AJ7H 4KUCD 5EWIL 2B0SH 4JO4H 3U0PA 3C9NA 3KS0J 4POZC 1FP5A 2NY3C 4HJJL 4JY4B 3GSVB 3STZA 4ZFGL 3BUYB 2GCYA 1CS6A 4HC1A 2ENYA 2QSVA 3NIDE 4JANB 5CLWA 5KAQF 5E2JA 2VJXA 5FA4B 2FEEL 5IIEA 5H2BB 4JLRA 4ZO6A 2BCKB 4K2UL 5HI4D 3X14B 1GC1C 1U8IA 1BQHB 4OLVH 5F6HI 2DKMA 1YEEH 2EDEA 2VDNH 4CADA 2NY5H 5KS9A 2YBRA 2YUWA 4YHKH 5K9JL 2IGFH 1UZ6E 4UB0L 4G6ML 4ETQB 3T2OA 3O4LD 4HWUA 2R0ZL 5D5MB 2BXZA 3SQOH 5EUOF 3VD9A 3D69A 4Z0XB 2HFEA 4RBPK 3QDMA 3Q6FA 1C16B 4OZIE 2YA0A 5E56A 4PTUB 1H15B 4HT1L 4RDQF 1ZGLM 5D7SH 1UKTA 1HHIB 1CVSC 3DUHA 1BHGA 2I9LA 4Z7WF 5JLZB 1R6VA 2DRUA 2FYYB 2R1XA 5KG9A 3ARDC 1MIEL 1B6DA 3K8KA 5GSVB 4QYOA 1F6LL 3O41A 3RKDD 2D4FA 4MX7A 4GUPA 2AK1L 2P24A 3JXAA 5GGSA 1DLFH 4U2YA 4MJ5B 1OPGH 3OKOA 3NFNB 1WBXA 3I3DA 2QQKL 3GDBA 5ISZB 5I1HH 4NCDA 1UYWH 2VDML 4YUEL 5B39G 1S7TB 4KTYA 5L88L 2IADB 4XMLL 5EU7C 2XN9D 3LEXB 1R3HA 2EEAA 1JRHI 2WQRA 4BSWA 4OFKA 4NBXB 2EXWC 5AEAA 1FFPA 5DMKA 2IC2A 3RWJA 2PR4H 3KJ4C 3KS0H 5JOEA 5B3NA 2VC2L 1T04B 1K6QH 3OKMB 4TVPL 4N90D 4E41A 3L3JB 3QZWG 4OZIA 1ED3B 4ZUUB 1XAUA 3O3AA 4JN2B 1I1AC 1NBQA 1WFOA 4HUVA 1NGPH 4Y4FB 4ZS6D 5JW4N 4Z5RB 4O02H 5HGAB 4M1DH 1PEWA 1RJLA 5IROA 2Z9TA 1NMCC 1IC7L 1A7PL 4HH9A 5GS0D 3GHBH 5F3HA 5E7FA 1WFTA 3TIEA 2DICA 3QH3B 3BH8A 4KKBD 1TVHB 5IFHL 4U1IA 1JYNA 1S5IL 4LBEB 3FFDB 2VIRB 5IFAL 1CD0A 4M48H 3OKEA 2OL3L 1WTLA 3ZZ1A 4NQCD 4PLNC 4GH7B 3WIFA 3L3IA 3ARGA 1D5BB 3E8UH 1JL8A 3LPFA 4OGXH 4JAMA 3FHAA 4XBGB 2G60L 3RVXD 1DFBL 4PP2A 4JFYB 5KSVA 4WENB 5EU6E 5JHDB 5JW5A 5IMLA 3WJJC 1U8MA 4MXWL 2EO9A 2DS4A 4F7MA 2G75A 5C08A 1DVFC 4TOYH 1HIML 3WUWB 3VFUB 4J2XA 4NZRH 5DEZA 5CIPH 4NUGH 5C0AB 4CVWA 3TBYB 1HQRA 1U8KA 3TESA 5EBLA 1G7JA 2JCCE 2FHBA 2QL1A 4M61B 3U7WL 3UTTA 3ZKXC 1MVUB 4PS4H 2NX5A 2R1YB 2YXMA 3N1FC 4G9DA 1EHLH 1Q94B 4LARL 5BVPH 1G7MB 3SE8H 1KEMH 3ES6A 3V7AG 4O2CB 4HKBB 5E2VL 4GAGH 4URTB 1EVUA 3VJ6A 4ZS7L 3DRTB 5JO5B 4TNVK 5B3JE 1K9TA 2OX5A 3RWGB 1T5XB 3JTTB 3O3UN 3D2UD 5DHVA 4LVOC 1K85A 4IJ3C 2IANA 2Q7YB 3D3VE 4MZ2A 5F89A 1F13A 4JFFD 3GMNB 1IEBA 5CBEB 4K3DL 2AK4E 2LQRA 5F9OL 3ARBB 4PGBB 3ZE0E 2F54E 1H3PL 3QULB 3HFML 2YOCA 4WCYL 5CEYB 4IRSC 4PJIF 5LAXB 2X70B 2PYEA 3VW3H 3CFJA 4PUBH 3EO0A 3Q1SH 4L3EE 3ARFB 5DJ0A 1LEKA 4GW4B 4Y4KC 4DZBB 4JRXE 1CZ8H 2YZ1A 1T6WA 1E27B 2RFXA 3W39A 2CDGB 1WCBB 4PJ5D 3THML 1RZJL 4NQED 2P8PA 2FX9H 2H45A 2V7NB 5GPRA 1ZEAH 5IOPB 4CVXB 3F12A 1NC4B 3GMQA 4NZTL 3PL6B 2H1PH 2YPVL 1DBBH 3GNMH 1W8NA 4J6RH 5IEKA 1DR9A 5E6IC 4AEEA 3FQUA 2Q86B 3LKPA 2YD3A 3ZDYE 2YPLB 1DL7L 5HHMB 5HYJE 4OFVA 5D6DA 2CKBA 1AGEB 1NFDF 4OQTA 3RNQB 1VACB 4G6FB 5FF6B 1KJMB 5EBMA 3D3VA 5HYSB 3OJDA 5D7KE 1VKXB 4OB5H 5JORB 5J1TC 5FO8A 3PNWB 5AD0A 2XG5A 4Q2ZA 4HK3N 1UZ8B 1OARL 4ZG1A 3TN0B 1WEJL 4PJXF 1I9RL 2WINB 1J8HD 1FDLH 2LFGA 1EO5A 3N50A 4U6TA 1LILA 4X5WA 4Y2DB 4K7PH 4HJ0D 4L3EA 4MQ7A 5DJ2B 5J57B 3T2QA 5IB4A 1BEYL 2NY2B 1S9WB 2PCPA 3ULUC 4JRXA 4YHOL 4MD5A 3STLB 1AY1H 4JFED 1QFWI 2CD0A 3MRNA 4U49A 1H3WM 3C60A 4L8BA 3MRHA 3QEQA 1R5WA 3DECA 5KVFL 5DURD 2X7LA 3DTXA 5TJWK 2BVQB 5F72S 3FO9B 3UBXB 1GGBH 1RZGB 2XZQL 1KCSL 4MA3B 2FJHB 3VGHA 1XGRB 2JLLA 3O3BB 4JJHA 5J4MA 4J8RB 3JV4B 1KPRA 2EH8H 4ONHA 5FKAA 2CXKA 4JDZA 5HYJA 4OZFB 3LN5A 2VXUH 1PQZA 4JG1L 4LOUC 4R7DA 4POYA 1OM3L 1IBGL 3V4UH 1UM4L 1YEHL 1KPVA 3MXVH 2W38A 2XWBA 1SBSH 4NJAH 2ZNWA 3KG5A 3VRLE 3EGSB 1I3VA 4XH2A 4DN3L 2RAMA 1OSPL 2I24N 3QPXL 1HDMB 2UYLB 2NLJB 2OK0H 3ALWA 2O93L 3UX9B 5HVWA 3B9KB 3O2VL 5C2BL 3CMOL 2GYSA 3D25B 3TV3H 4HG4J 2OQJB 3BHBB 1U8LB 3G6JE 1MHPH 1NFKA 1KENH 1P9MC 5FCUL 4OLZH 1JFQH 4LNRA 2QQNH 3RGVA 3CVHB 1IKNA 1MFAL 5DRNB 4ISVA 1D9KA 3H8NA 1P4IH 2E7MA 5DJYA 2E7CA 3NFPA 1B2WH 3LSOA 1CXFA 3D0LA 4YPJA 1RU9L 4TNWK 1JF6A 3L5XH 5IQ7L 4YIQA 1N64H 2X9XA 1PYWA 4LSVL 1NGWB 4KKAC 4K8RH 2F53A 5C9JB 1LE5B 3WIIH 1F6AA 3C5ZD 1NCBL 4MWFB 1QP1A 1QSFD 4E9LA 4RZCB 5I1DA 1CDGA 2IBZX 5DEFA 2O61B 1UB6B 5D2NB 2WLZA 3CDGA 4BJLA 4FTVD 1T4KA 2VQTA 3GO1L 5KZCD 1G9MC 2E6JA 4ODXA 4X8JB 5E8NA 5I18L 1N6QL 1BVZA 2B4CH 1KC5L 1H8SA 4XZUA 1I7ZB 4I18A 1S7XA 1QSED 1NLDL 3QDJB 3HR6A 4GXUM 3QFJE 3MLSH 3S9DB 2R23B 1EO8H 3MRCA 5LJYH 3U4EB 2XNAA 2P46B 4U31A 5KVEH 3DGGB 3G5YB 1F42A 2LV4A 4PJ7F 5HGHB 1CLZL 2DWDB 1XIWB 4JPVL 4MA1B 3C6LD 1KCLA 5B8CA 4UMGA 4FQ1H 3SE3A 2VERN 4JHWL 3RL2B 1W0VB 2F8OA 2R2CA 4P57A 4CDGC 3T1FB 4LVNB 4ETYA 5FKPA 2Y5TA 3G5ZA 3U9UA 2BVPA 3PWUB 1NAKH 2P8MB 5IBUG 4PRBA 4Q0XL 2DB8A 1CE6A 2BSSB 5I19H 2EICA 4HUKB 3T04D 4LLDA 1BPVA 2FSEA 4KQ4L 1T2QL 3HG1E 2UZYB 1CDJA 4AH2A 3QHZL 4YDVB 4D2NA 3TM6A 1J10A 2PXYD 4C56E 3GSWB 4OD3H 4B53A 4X6BA 2R0LH 3JTSA 4Y1AB 4OCYL 5I1CL 5LGKA 2XFXB 1P7KB 4F80A 3R8QA 2IPTL 5I8OL 1X5JA 3SPVA 1A7BA 2V2XA 1HH6A 1N26A 2AJUL 1I1RA 3Q5TA 3KPNA 4Z7VF 4PFEA 1YEGH 3ISWA 1A6TA 3GBLA 1FNSH 5FO9A 4ELMB 4ENED 3HAEG 2C3GA 5ACZA 4AZ8A 2DQTH 4Z76B 1NGZA 2DQCL 3ARBC 3V5HB 4YFDB 4NNYB 5DD6B 4HIIA 2AV1B 1R0AH 1KFAL 7CGTA 4LVHB 4P2RE 4JHAL 2GT9A 4X7TA 1I75A 5C7XL 4ZTPL 3ARFC 2ZG3A 1DEEB 3QHFL 5T1LD 1B0GA 3KYMA 1QBMH 1F45A 2UWEF 4UZGA 1JCKA 4PRDA 1CU4L 2WNGA 2FWOB 5IW1A 6FABL 1MI5A 3V6FB 32C2A 2BVYA 3QUZB 3PL6C 4BSVA 5KN5B 4L8SA 1MLBA 3AS2A 4PJBF 2IPUK 1MSPA 3VD4A 2CLZA 2D7NA 4ZXBB 1XR8B 4UV4L 4I0PA 5CJBA 2X40A 4RFNB 3PWPB 1U41A 4LIQE 5C0BB 5IT2H 3EOBB 2DQJH 2WBWB 5IW3A 5L6YL 4X98B 2BY1A 3CLFL 1GGTA 1NAMA 4M62H 3JUZA 3PV7A 3HRZB 5E2UL 3QQ4A 3TN0C 1HKLL 4OD2A 4QXUH 1JMXA 5C0RH 4JG0H 3QEHB 4P2RA 3WJLA 4FG6D 3MMEA 5FUCE 4XP4H 3D48R 2JELH 4Y2DC 5DD0L 4NUJA 5IWLA 4X6EB 2W60B 2NY2C 2GJ6E 3V0WL 4HLJA 5DI8B 3DIFB 3MV7D 5TFSL 2P5ED 4LFHG 5BS0B 3QIWA 4LCWE 1AP2A 4KQ3H 1XF4A 1P84J 4NFBA 4XPHH 1RJCA 2DIJA 4G8IB 2WBJD 5HI5C 4K23H 2R0WH 1C12B 5ID0A 1F4AA 1U42A 1PEZA 1IAIH 4NM4H 5B21A 4RCAA 1DEDA 5FDWB 4OJFH 1TJIH 4CAGA 3BSZH 4KK9C 5CMAB 5GRVK 1E4KA 1OD7A 1LDPH 4AQ1B 3RBSA 1UH2A 4KKLC 3SDXE 4Y89A 2DTML 4PY8I 3DX6A 1ZVSA 3UDWC 3MLTB 2GY5A 3BVNA 5L2KD 1A7NL 3BH9A 4WHCA 3DO7A 4TTDD 1YYML 1MHCB 3KYAA 1ZHBA 5GHWL 4H25B 3RVUD 3B9KC 2EC9T 4HGWB 1ZLWK 1M6OA 3RUGB 1UXSB 2HJLB 1EK3A 2AXFB 2ZSWB 5C0EA 2HFGH 4LCWA 3QO0A 1ZS8A 1PX3A 4WHYG 5D8JL 5HDBF 5FA3B 3DETD 1NFIB 3AY4C 4HUNB 4AM0A 2G5RA 3QUMB 5JMOC 4XNMB 2N1KA 3T3MF 5L8KB 5BJTA 1K3IA 3TBVA 4PJHF 2FDBP 5DHXB 4U6YA 3E6HB 4NQSB 3PV6B 3BQUD 4OZHE 2O5YL 3K4AA 3C5SA 3IF1A 3FQTA 3ZE1F 1N4XL 5I17B 5J06A 2X4OB 2NY7H 4QRPB 3VI3E 4YHNA 2PW1A 2YUXA 4QO1A 2Q8AL 1F2XK 3NCFB 3CXHJ 1UCTA 3S6CA 1TZIA 5I1JH 5E9DE 4K3HA 4FZ8L 2C1OB 4MYWB 3IFPB 2BK8A 5F7EH 1GC1L 2J8UF 1JTOA 1BD2A 1WZ1H 3QCTH 4FQHA 4Y4HB 5D2NC 5T3XE 1U58B 1YDPB 2Z91A 2ZUVA 3BKJH 3M07A 4RA0C 1F3DJ 4KRPD 5H8DA 3HC4L 4P5TB 4JJ5B 1KYOK 3D1MC 4LCCA 4NQXB 4UILH 1JGDA 1EBPA 3LS5H 4WEBL 4WUUE 4M00A 1A7QL 4YO0A 4I77H 1WWWX 4KI5E 3MLZL 4M5YH 2J8HA 3TP4A 1XIWC 5C8JB 4MA1C 3T65B 5DVMA 5C0FA 2BXYA 4PJEF 1I7UB 1OF2A 3CU1A 2FO4B 1WIOA 2AJSH 3EYFA 1QFWM 3WFHB 1BBJA 3IFNL 4LVNC 5AG8A 1L7TH 3QCUL 5EUOB 4JR9L 5IB2A 1RK0A 3BXNA 2VXQH 1FH5H 2Z31B 2MNUA 4OQ1A 3EOAB 1BOGB 1MCSA 3PUCA 4OLEA 3TT3H 3NACH 4G80B 2BX5A 1P2CA 4Z7WB 1YQVH 4L4VE 4XWGL 3FQWB 4U1HB 3GFUA 3E0GA 3HI1B 5F97E 1SYVA 5ESQB 3UXFA 3JWDH 1FZKB 4C59B 1NEZA 1CFNB 2WK2A 3QRGH 3CFBA 3EZ8A 3P4MA 5L8LB 4LASH 5JHDE 1N59A 5SWSD 3EDEA 4DVRL 4F8TA 4MXVE 1KJ3H 5F7DB 4OV5A 2KQMA 4KKCC 3IJYB 5JZ7C 1NBVL 4LCUB 2AGJL 5TGBA 3BD4A 4ORGB 4U33A 1CGSH 3WV0A 1AIFA 1H0DA 1G7PA 5ADPH 2YPKA 3BE1H 5F9JA 1MFDL 3TO4A 3L9RB 4YXHH 4KK5C 3MA7A 2VDOL 4LVHC 5F1IA 4AG4H 4NCC2 3ULVH 1P1ZA 5D70H 1F4YH 4JFDD 3C2AL 5AWNH 1C1EH 1KJ2L 1RJYB 4UNTA 2CGRH 5JHLL 1TVBA 1XGTB 2ED8A 1S7RA 1D6VL 4PB0L 5HJ3A 2FX7H 4Z78B 4PRHD 3RPIA 1F3DH 4M7ZB 4OIIL 3L3KA 4PV8B 2EDXA 1JE6A 3HNSL 4LHUD 3HI6H 1ZVYA 2EYRA 3O6KL 2R9HD 1BLNB 5T3ZE 4H8WC 5GGTL 4W6WB 1TITA 4RFOL 3VXRD 1RJZA 1T1XA 4ZXBC 1MCFA 2NW2B 3T2PA 4X4XA 3N06B 4PRIE 4D0BA 1N2RA 2ARJB 4J1UA 1IEAB 4RFNC 4B0MM 1Y6MR 3T0EE 5DLMH 4HLZG 2NR6D 2VDKL 2YS4A 5GRVL 1R24A 4OZ4A 5JDJA 4FN0A 3CVIL 2A83B 3IU3A 4PGCA 2FECL 5DJZB 2LVCA 3VXQA 2W0FA 4V1DE 3J7HA 4P3DB 4CW1B 2QR0B 1BAFL 3CDCA 3MV11 3GMPA 1IGIH 2O5XL 4TVPE 1VFBB 4RQQB 4DZ8B 3O4OB 3T0WA 1FNAA 3ARSA 2HKFH 3OXRB 4NM8H 3UYRL 4P9ML 1MJJA 3WCYA 2MQ3A 1UEYA 5JW3L 3N1MC 3UPCA 5DVOA 1R3LB 3VG9B 1UJ3B 2NXYB 4RAUA 3T4YB 3NABH 2DI8A 1BP3B 2EYSB 1AXSA 1RHHB 4EUPH 1WSST 1EZVY 3KWWA 1AFVH 4JZNB 2X05A 2EXYC 2R39A 5C0CB 3P4OB 3LIZH 4R4FH 1XGQB 3SCMB 4CMHB 5HVFB 4H26A 3OR6A 4Y5YA 1CFVH 2P48B 4FNLL 5TE4H 3AROA 1YEKH 2JJSC 1VADA 2X1XR 5H35A 5D2LE 1YA5A 1A22B 5GZNC 2CRIA 2H26B 4LHQB 4HXAL 2CUIA 4A6YB 3SBWA 4ZSOA 3MYJA 3QB7C 2PTUA 1U3HB 1OB1A 3WMSA 4CKVX 2AABH 4PJFE 5JPMB 1DQLL 1JI2A 1BFOA 1P7QA 4J23A 1KLGA 3S7GA 1IQDA 3P0VH 3D0VB 2QV2A 2MWCA 1VENA 2OTWB 3WNLA 4QHLA 3HS0B 4QLRA 1DQJB 1IGJA 3FO0H 4HZLB 4ONGL 3AAZA 4RFEB 5FYJH 4Y5VA 3VXMD 1FZJA 1CICD 4L9DA 4G7VH 4ODSL 1ZGLP 3QUYD 4HC1H 5J6GB 5KVMC 4GRLA 4PJIB 3FAXA 1CXHA 2CRZA 3FT2A 1RMFL 4LF3A 1FLRH 3KXFB 5JPNA 3ABZA 3GBNL 1TTUA 2FCBA 1TQBB 4XC1H 1ZLVH 3SDAD 2AXGB 4MA8H 4LEXL 3VI4E 4B7IA 2OL3A 2BNQD 2XQBH 3V4PH 3S36H 3EO9L 1NGQH 1MRFH 1G9NL 3DVNB 1CQYA 4MJID 5F1SA 5JXEA 4HIXH 4NKQB 4LSPL 1UB5A 4AIOA 5EZOH 3W81A 3L3HA 1GZQA 5H37G 4WFHD 5D1XB 1UWEL 1UM6L 4NQVA 2V9RA 5J12B 4N9OB 1YEIL 3CLEH 3L7EA 3HAEA 2F19H 3ULUL 1QLFA 4GBXB 1NFDB 1MJ7L 1FFQA 2KDGA 3IDJB 4Y4HC 4Y19E 1A14H 1I8KA 4MA7L 4MDJA 5I74B 1A3QA 4NKDB 3L95B 1PG7H 3Q0HA 3F62A 3PXJA 3HE6B 2GTWA 4LLVA 4PJXB 1S3KH 3NBNA 4H88H 1U91B 2CO6B 5EU3A 5HYEA 3HB3C 3QCVL 4P5TC 2EDDA 4PJGA 1CN4A 3VXUD 2V5RA 3GSOB 2W9DL 1H3GA 5CZKA 1IGCL 4OM0H 5DD5H 5SWZE 2WM0A 3WXWH 4NO2B 3WUZA 1CLYL 2BNRB 3D6GA 3TZVD 4BKLB 3F7YA 1DBKH 2HAZA 4TSCL 4OLYH 2HTLC 1NCAL 5E8OB 1AJ7L 3S5LA 4HZAA 4WWKB 1K5NA 4O58H 1A47A 3O3EA 3C87A 3L5WB 4PJAE 5H94B 5K33A 5I76B 5C3TA 1TNMA 1FYTB 3MV8A 4R4BB 3RZCD 1XCQA 1C8PA 1FFNB 4YGVB 3GSUB 4GOSA 1ULVA 3KPQB 4OCXL 1Q9WA 2ZCLH 3AFLA 4PBWD 5DS8B 5JUEL 1NMAH 3VFSA 1GXEA 1VGKB 2ATPB 5E94B 1OP5K 1MVFA 2F9BT 2NTFA 4RAHA 4CU6A 2WSKA 1EJOH 2J6EL 3UTPD 1X6LA 3KHOA 1XT5A 1YEEL 2VQ1A 2Y1VA 5GGVL 2BC4B 2IGFL 4XGZB 2VWEE 4OZGF 3O3DA 2R2EA 3FOLA 4J3SA 4DKEH 5SWZA 4UAOB 3QSKB 3TCLB 3CDYA 7FABH 4HIHA 1Z2KA 1ZWIB 1UACH 2RCSH 3QUKA 1CGWA 2ESVE 4GW5B 4HK3J 4X4YA 5KANI 4Z0BH 2VAJA 1DP0A 4UQ2A 1WT5C 1OGAA 5D7SL 1BFSA 4PJAA 1JBJA 4YR6B 3MOAL 1G7IB 3MOBL 4EBQL 3MO1B 2IFGA 4G8EB 2EH7H 2CK2A 3CSYB 3MRPB 1R5IB 4M7ZC 1OPGL 4QRRB 2EE3A 1X5GA 1NDGB 4XNUL 2AEWA 3MFFA 3TNMB 4PGJA 1U95A 3BRFA 5I1HL 1G9ML 3OKLA 4QF1B 3TPUB 2VTFA 2C7UB 4WHTB 3U4AA 1ND0A 3OPZH 4XXCC 2H6PB 4FQIH 4J4PD 2HTKC 3CH1A 4ZUVB 4KDTA 4IMLA 5ICZA 1BWMA 4WFGE 3PABB 1YJDC 4JPWH 3UTZB 2PR4L 1CLOL 2FECI 1F4XH 4JCMA 5D7JC 3BKYH 4PLKD 3SKMB 5CD5C 3WO4B 3LB6D 1SJVA 4XBPB 2ICCA 5MENE 1KELH 2F5AH 4JHZA 4L9LA 4NO0D 3DUUB 4YE4L 4KH2A 5KOMC 4TVSa 3FONA 3O4OC 3O2DH 3RWFB 2YRPA 3P2TA 5I1LA 4M1DL 1PD6A 3OMZA 5DHVH 1FL5A 4LSRH 2H32B 4DKAA 1T1ZA 2W07A 4PJ7B 3NCJH 4LP5A 4YWGL 3QO1A 1UJ3C 2NXYC 4PJCF 3VG9C 4JHBA 4PJDE 5D9SB 1KACB 5ITFA 1U93A 3W11C 4FXGB 1I85A 4JRWA 3RWIB 1QO3B 4QY8A 4JFOA 3GUTB 3C6SB 4X9HA 4DK6A 3SCMC 4CMHC 2HN7A 2EDKA 3E8UL 3LH2H 3M1BA 4OGXL 1QR1A 3EW3B 3FFCE 4HFWA 4XNZB 2ZG1A 1Y0LA 1JWSB 5MENA 1NLBH 2O5ZL 4Q7DA 1U3HC 4TOYL 3ARRA 1F90L 3GSNL 3O45A 3SJVB 4BQ6A 3TH4T 3CPLA 1E6JH 4WTWA 5C0GA 1XF5A 4NZRL 4ONFL 4XVUC 4Z7VB 1A0QH 1T66D 4P99A 5EU6D 1TZHA 3MLWH 4NKOA 4OQTH 3O6LH 3P77B 5FGBC 2MFNA 3T77A 5FHAL 3KR3L 3CCHB 3T3PE 1IFHH 1HCVA 4I1NB 1EHLL 1YPZE 2IFFH 3D85D 1KEML 2APXA 1QA9B 3FN0H 4GAGL 4GO6B 1JTTA 4OSUL 5J9PB 1TQBC 4D0CA 2Y06L 3QI9B 4FZEL 4XP5L 2HP4A 2UWEB 2A6DA 3AU1B 4XB7A 5CP7A 1T20B 2FZ3A 3BWAB 5BZWB 2JTDA 3BIBX 4MCZA 3ZKND 4U6HA 2R15A 2HVKA 2D7PA 1D5XB 3FHQA 1RK1A 2Z92B 5TQ0H 1J5OH 4E5XA 5F9DC 1T89A 4PJBB 2G5BA 1S8DB 2XPGA 5D1XC 3ULVF 4QWWC 2CK0L 2DYPB 1RAMA 4NQCB 4PRPE 5J12C 3G6DH 2N7AA 1RPQA 4AT6A 3PGDA 4EN3D 4GBXC 2D7TH 3OHXB 3VW3L 3EKCA 5F1OB 2ZUYA 3LY6A 1T83C 4R8WH 2L0DA 5GGQH 5I74C 3HHRB 1Q0YH 4HJGB 2UV3A 1CZ8L 4ZFFB 4HG4K 2AK4D 3FTGA 4ZUWA 2F54D 3HE6C 2FX9L 5FM5M 4LSUH 1CGUA 2YSSA 3HE7D 1IL1A 4LLUB 1T2XA 4KY1H 2H1PL 2ZUSA 1DBBL 1EFXA 3GNML 3FQXA 4EIZC 4JM2A 5KJRL 2H3NA 4X6CF 3L3GB 1OTSD 2A0LC 5IUSA 3PWVB 3VWKD 3E3QC 1MCWM 5MEPA 2OJEB 3IRZA 4JCLA 4WWKC 1X5XA 4PGDB 4OB5L 5DJXA 4O2EA 2DBJA 4OUUA 1QSZA 3KPRE 4WY7L 5DJ8B 4FQQA 1NGYB 4WI2A 4GRWE 5HHQB 1MEXL 4HEPG 1S5HB 2BSTA 3BPOB 3VXTA 4HWBL 1JZ8A 1BQHG 1D3CA 1FDLL 4XNXH 3K4DA 5ANMA 2PTTB 1ZTXL 2XZCH 4K7PL 4UT6H 5D7KD 3TJEH 5DF0A 3V0VB 1U8QA 2PKDA 2HWZL 4KZEL 2ZOKA 2PTVA 4JQVA 4MNHB 4S1DD 4RIRA 5B4MD 3OKNA 4RAVB 4G9FD 4JDTH 4N8CH 3S37H 2YUVA 3IDGB 4KK6C 5C9KA 2ORBH 3MJ9A 4WIQA 2V7HB 2A1WL 4OCSL 2IAMD 4G6AC 5HVGB 1K2DA 1Y18A 4GAFB 1GGBL 3BEVB 4M8VA 1RUAL 3GHEH 1MFBH 1XCTB 5M94B 4UAOC 5I1AB 1KB5B 2IH3B 5CSZA 5T1MB 2GSIB 1NCWL 4PJ5B 4L1HA 2VXUL 5CZXC 1T21B 1IM3B 2CIKB 5EUKA 1DANU 4HBCL 4L4TE 3HR5B 2E9WA 2JK5A 4MZ3A 3MYZA 4YHZH 3NCBB 4WV1A 3FL7A 2BFVH 4XNQB 1U2CA 2AKRA 3MXVL 3P30L 1R3JB 1D5IL 1SM3H 4PJHB 4HS3B 4PG9A 5DUBA 5I66B 3V6ZB 4GG6A 2NY3D 1T1YB 5MEOB 1TTGA 4CNIB 3RBGA 1JZ7A 5L2JA 5AUMA 3LRSA 2AEQH 5I2IB 3CD4A 3C8KA 3HPLB 3GKWH 3SGJC 3TV3L 4ZQKB 5CZVH 2D03H 4MNGB 1QEWA 2OR9H 1MHPL 1KENL 2Z8VC 2C1PB 3BP7B 4XX1E 1J8HB 2APTA 3T1WA 4OBRA 1ZA6B 5E1AB 1FVEB 4OLZL 2J8UB 2QQNL 2EDWA 3RX8A 4NQDB 1DE4B 4WW1B 3WO4C 1P4IL 5C0DA 2P1YA 1GZPA 1B2WL 1EFQA 4QNPE 1VHPA 2MQCA 3JV6A 4NWTH 4P4KA 4L4TA 2WMPA 5DURB 4LLMA 2JIXD 3ROOB 5EOQH 4Z7UF 2X4TA 3NGBB 3RY5A 5BZDB 4KXZH 4KV5F 1P7HL 4Z8FL 5DWUH 3SHSA 1ONQB 1SYSB 4Z7OE 2EDQA 4PJEB 5LWYL 3VFMB 2GUOA 1HSBB 4X5LA 5A43C 3FB6A 1QHPA 5JOPE 1D5ZA 3U7AA 2D7MA 3LV3B 3MJ7A 1JYWA 3NIDF 1X4YA 4JDVA 1LHZA 4CMMA 3RKDC 4W70A 1SEQH 5F88A 2M2DA 2UY7A 3SE4A 2HLAB 3EYVB 1EO8L 3TLRA 3DYOA 2VLKE 3WUWG 4D94A 4XNZC 4I2XA 1YEJL 4EDWH 1CT8A 2E7BA 3GK8H 5HGDB 4NKIH 4HXBL 4QTHA 5EB9A 4KHXL 4IRZH 4MJ6A 2VLMD 2VLRA 1I8LC 2QADD 3QFJD 1LO0H 1FIGH 3OTTA 5AZ2H 3IDNB 4MNQA 2C4XA 3ECBA 1S7VA 4LSSH 1OAYL 4U05A 3DRQB 2V2WA 4F3FA 1NAKL 4M7LL 2VSCA 4NO5B 2DJSA 4JFPB 4XB8A 5DUML 5GXBB 5KVGH 4OZIF 1I7RB 5I19L 4GRMA 5IR1B 1BZ9B 1NAMH 5ILTH 4H8WL 2GQHA 4X7FC 3HRPA 4ZS6C 4XHQA 5GRWA 3MNVB 2MMXA 2R0LL 2BMKA 4YNYB 1E0OB 1WIPA 2FGWL 4DQOL 1T0NB 3QI9C 3OXSB 1KN2H 3C5ZB 1KNOB 3D39E 3HG1D 1QSFB 3H3KA 3I2CH 3PJSA 4EDXA 1YEGL 5MI0B 1CGVA 3B3IB 3FOMA 1FNSL 4OCRH 5HHOE 4C56D 1JPSL 4Q9CA 4BH8B 4DW2H 3EUUA 5GQBA 2WIIB 2N7BA 2ADFH 1H8OA 2GAZA 4HWEH 5KZCB 1JHKH 2YK1L 3RY6C 1R0AL 1GH7A 2X89A 5IJKA 2HFTA 1QSEB 1QHOA 3U7YH 2WWKT 4F57L 1JNJA 1ORSA 3RVXC 4P2QD 35C8L 1V05A 2N4IA 3C2SA 1NH6A 3HPJA 3ARDA 4NO3A 4GG8B 5BXFA 3BGMA 3ZL4H 5KSUB 2MHAA 5E1HB 3VFRB 5E2TH 5B39B 1HI6B 1BJ8A 1U8JB 3MNZB 4LLYB 1Q9LA 3H9YA 4A2LA 5HYSG 4EVNB 4WEUD 3GJEA 3U46B 1MCRA 2DBLL 4E42A 4R4NC 4W4OA 4K9EL 5IMMB 3DV6B 1JWUB 1CXEA 3REVA 3QZWB 4G42A 2DQJL 3MA9L 4MQSB 4D3CH 1U8HA 2OJZH 3U9PH 4M62L 3CXHK 2IBBA 2VZ3A 4AL8H 3TBSB 1KCVH 4RX4A 1A7OL 4N0FA 3BPOC 4PG2C 4FFYH 3PWNB 3TWCH 1I1AA 3MRBA 4IOFC 2EDJA 4QXUL 4QXGH 4Y5XB 3EDKA 2FR4B 3FB5B 5FOBA 3T0XA 1FRGH 3F5WA 1AC0A 1RULH 4MDIA 4F58H 4FQLH 3P0YH 1J0ZA 1KJ2A 4Y2OA 5GGUA 3MRJA 4U1SB 4DFHA 1BQLL 3EYUH 4IRSD 4EI5D 2VXTL 4S1SH 5D7LA 4KQ3L 3FKUS 2D9CA 1G7HB 2ATKA 3X3GL 1MHHB 1TJHH 4KJYB 4XPHL 4AEHL 1M05A 4OZFG 4DGYL 4Z6AT 4NZJA 1GGYA 2RHEA 1T6VN 2GJ6D 1FNEA 2YHGA 2JCCF 5T1LB 1L9MA 4NM4L 4PD4J 3QDAA 3RJDA 1BVKA 5IF0A 2D0FA 3CFEA 2QSCH 5C6WH 4OJFL 1TJIL 3IT8D 1Z6JT 2C3XA 3S96A 2HG5B 4QRTA 1RVFL 1I4FB 1LDPL 1N5AA 1CFSB 3LQZB 1IGMH 2NNAA 3MRIB 2SEBB 3WJJA 1M7IB 1H8NA 4P2OB 3N1QC 4XC3H 4XWOC 3TYFA 5B3JF 4JVPA 4WTZG 3I84A 1DVFA 3U0TB 1BZQK 1YUHB 4H20L 4CU7A 3U4BL 5BVJA 1INDH 3OAYH 3QG7L 1L0YA 1YMMA 4OFYD 5GSRA 1KIQA 1XGUB 3OGOE 4L8DB 4XAWH 3L6FA 5D7IE 2XT1B 3F7PC 4WU5B 3VDAA 2B1HH 1Q9OB 4GXUN 4JKLA 3ZE0F 3OF6A 5DRZA 2N56A 1CBVH 1QLRB 2HFGL 3ARQA 1A7RH 3GGWA 1AGCA 1RSFA 1MCLA 2J88H 3TH2T 3S4SG 4J3UA 3BPCA 5F3BA 4KMTH 4RNRB 3VH8A 4CJ1A 4M1CC 2IG2L 2Z93A 4HJ0C 4U7SA 3QIUD 4U1MB 4W6XB 1IGTB 5HYFA 3MV7B 1BX2B 2P5EB 1M7DB 4DN4H 1K4CA 1L6XA 3BZDA 3WHXB 1DSFH 4MD0A 5DJAB 5IBTH 3VFTA 2RBLA 2WBJB 3NGBC 4P23B 1L6ZA 2X4RB 2VL5B 1KIRA 4LSQH 3T0BA 3ZDYF 5I1JL 2H2PD 3OSKA 3GZKA 3LKNB 2EDOA 3WKNA 4CVZA 1WZ1L 3DURA 3QCTL 5INDB 2OI9B 3NIFE 5T1DL 1KPUA 3AS0A 4PTTB 4Y4KA 5ETUA 5E5MB 3QAZB 5D7IA 2ENSA 1W0YT 5FECA 3I6GA 3BKJL 4IOIB 4XVSH 4XBEL 5E9DD 1AXTH 2NY1D 1KIUA 3UZVB 1S9KC 4CN6A 2WUCL 3VXOA 5L2KB 4QXTB 5IV2B 2VLJE 3DXAE 4G6KL 3RL1A 2VISB 3PWJA 4HJJH 3K8LA 1U8NB 4ZFGH 3QBTB 3U36B 5T3XD 1E4XL 5IGXL 4IM8A 5E6IA 5IHZA 3SGKA 4M5YL 2CIIB 1FL6B 1TDQA 2FD6H 4WGWB 5GISL 3WS3B 2AJSL 3QQNA 4O4YH 4OZGB 4JY4A 3GSVA 4WUUD 2P5WB 1L7TL 5E08L 5IVZB 4F9LC 4KI5D 3H3BC 1TVDA 1DBAL 1Q0XL 8FABB 4MHHG 3LEYL 2VXQL 3IJSB 1JHLL 3FCTB 5FA4A 4UB0H 4Y4FD 5H2BA 4G6MH 1I9EA 2BCKA 1O7SA 3KPLB 4NGHH 3NACL 2VQUA 6CGTA 1UXWB 3TT1H 1X7QB 1YQVL 3DYMA 5IEHB 5C07E 3CGTA 3VFOB 4ZFOL 1WZKA 1SVZA 4D9RD 5CHNA 1A6ZB 4HT1H 3DGCR 1T0MB 3JWDL 3IXTA 4F7PB 3VRLF 3QRGL 3C5ZC 4LASL 3MUZ1 4YHLL 4LGRB 1S7QB 2OSLB 1FHGA 5MI0C 2BNUB 3MLUH 5D5MA 3O9WB 4M4RA 4PJ9D 1MIEH 5IESH 3EAKA 4L4VD 4M02A 4MMXC 3REWB 4L1DA 2AK1H 3STBA 1C16A 3B5TA 2BOCB 2E9IA 4PTUA 3G6JF 2ITDB 5ADPL 3HZKB 4KRPB 4YXHL 4LK4A 2X1OA 5D1QD 5I6XB 4G8FB 1HHIA 4AG4L 5JHDD 5ADOH 3RWCA 3KPSE 3VGDA 5D70L 1F4YL 2VDMH 4YUEH 5AWNL 4FFWD 2FYYA 5L88H 1QRKA 3UEZA 4XCNB 5GSVA 2BHUA 1QUNA 2C3HA 2PUQT 1H3XA 4JKPH 4MCYA 3T4AA 2UVEA 4WO4A 3HI6L 4YBQD 3I75B 2NYYD 2VC2H 5ISZA 3V8OA 2PO6D 4TVPH 1EAJA 2VSDA 1S7TA 4F7MB 2IADA 3CX2A 3BW9B 4WW2A 2BDNH 3LEXA 2J6EA 3QR2A 4IS6A 1N0XH 1FZOB 4BFIB 3MREB 4PJCB 3AXLB 2ZUTA 3RNKB 1WZMA 3V5DB 3ME0A 2XXCB 3BP6B 3ARUA 1LNUB 1A7PH 5EU4B 5T3ZD 1T04A 1X5IA 2EECA 5CEZH 4DUVA 3SKUD 3CZJA 3L3JA 2FRGP 3I6LE 4EOWL 1DQQB 4ZUUA 4JN2A 4XI5C 1VFAB 3ZE2E 1Z0NA 4Y5XC 4PRID 5FGCB 5HDOA 1QZ1A 3QWQB 4I3RL 3T0ED 2Q87A 4Z5RA 4NM8L 3HMWH 5SWSB 4KTDH 2V2TB 2R0KH 2OL3H 2E8ZA 4LP4A 3TO2B 1G7QB 2YWZA 1EV2E 2BY3A 4V1DD 1VB9A 5A16B 4XRCA 3UO1L 1DFBH 1XGPA 2YD7A 4LBEA 3FFDA 1IAII 4U7MA 2VIRA 4MXWH 4I0KA 4JFDB 1YNTB 4ZNEE 3CX5K 3L3OB 5HTSA 3HAEH 5E99L 3R06B 5EORL 3MRMB 3KYOB 1HIMH 4S2SB 1JPGB 1ZLUK 2FL5B 4WU7B 4TULL 1M71B 4XBGA 1CFVL 1YEKL 3CFCH 4JFYA 4LHUB 2QKIB 2WIMA 5HHPB 1JV5B 5IVOA 4GQ9H 2VOTA 4NJ9H 5HHMD 1Q1JH 3VXRB 5IJVA 3W0WE 4Z18A 1FZMB 3WIHH 1RHFA 2AABL 3WUWA 3VFUA 3G9VA 3OX8B 1T5WA 1ADQH 5E2VH 3LS4H 5C0AA 4ZS7H 4HS6A 3V2AR 3TBYA 4NZDA 2VZSA 1I9IL 2AERT 4M61A 3WDIA 3B5HA 3FO0L 2I07B 1K8IA 1MVUA 3BKML 1AKJA 1U8PB 3V6OE 1Q94A 4Y7MA 4FG6C 1A9EB 4U0QB 2X44D 1G7MA 1XF3B 4HKBA 3S8WA 2KQNA 3DRTA 5F9OH 4XC1L 2B8OT 4FXLA 3RWGA 4KDWA 1T5XA 3JTTA 4WCYH 5DA0B 3FO2B 2XQBL 3SY0A 1NC2D 1NGQL 1MRFL 2Q7YA 1FFOB 1MCPH 4HIXL 2F15A 3QDGB 1RI8A 2B2XH 2WBJC 4I9WE 5KSBE 4P23C 1KCKA 1VEPA 3THMH 3L5JA 1EZVX 2CUHA 3W0WA 4D9QE 3ARBA 4PGBA 4F7EB 5K9QI 4X6CB 1ZT4B 3VWJD 1F02I 3QULA 4KRMB 4TUOB 2F19L 5CEYA 5CJ5A 1YY9D 2PW2B 2YPVH 3GSNA 2X70A 5LAXA 2OI9C 5HI3C 3JSSA 3ARFA 1LE9B 4DZBA 4HIEB 4N0CC 3QAZC 4FOMA 1E27A 3BGFB 4RBPH 4BK5A 1DL7H 2CDGA 3VCLB 4TQEH 3PIQB 1MHEA 1HE7A 1IAMA 3OBAA 5EO1B 3BP4B 3V6OA 1EVTC 4CVXA 1NC4A 3I50H 2HFFB 3DHMA 1NGXB 3PL6A 4Y19D 3B9KD 1WBYB 5DD5L 5E2WL 1Z3GH 3WXWL 5FYKH 4EI6B 3AGVA 2EIZB 5I8EB 2Q86A 1DBKL 3RVUC 1S9YA 1I9RH 2YPLA 4XMPH 4YXLH 2Q76B 2VDPH 3QISA 1KJVB 4QGTA 1LK2B 4EUPB 3VXMB 1G1YA 5FF6A 4O58L 2ICWB 2VN4A 3AREB 5HYSA 1KIPA 3DETC 1EJ6A 3OGCB 5JORA 5D4QA 3ILPA 4XTRD 3BEWB 1X5LA 3PNWA 3TFKD 2ZUQB 2HKHL 5IB1B 1H5BB 4GKSB 1UZ8A 4QOKB 3MROA 4ORZC 1FPTL 3TN0A 2VDRL 3GIZL 5KVFH 1JNLH 5C09B 2WINA 3OB0K 5GS2H 2ZCLL 3FT3B 1AH1A 1IGFL 3T0AA 4Y2DA 1KCUH 2ZSVA 4WHYH 2BVOB 3OR7B 2XZQH 5DJ2A 3TBTA 4HIJB 4MJIB 5FYLH 4HF5H 2D4DA 1EJOL 2FIRT 3SDXF 3STLA 3KPPB 4YDLB 5TDOB 4M9OA 5C0IB 1I8IB 4JG1H 3ZSTA 3HZMB 2ADGB 1OM3H 2X4QA 1IBGH 2BVQA 1UM4H 1YEHH 3FO9A 1C7TA 3UBXA 4MQXD 3U0PB 4WGVB 4DKEL 1RZGA 3O9WC 4MA3A 2FJHA 5EOTA 3STZB 1OCWL 3O3BA 5GGSY 7FABL 2VUYA 3U6RB 5DK2B 5BV7H 2DLHA 1UACL 1PY4A 3QDJD 3VXNB 4DN3H 4KRPC 1OSPH 4TYUA 4RGNE 5CJOL 5I6XC 5EC2A 1MCNA 4JLRB 3VXUB 4LKXA 4ZTOL 3O2VH 1HILB 1NUGA 5FFLA 3CMOH 5ECJE 1XIWD 2APVA 1U8IB 4U3XA 3P11H 3UDWA 2EH7L 3TZVB 2ESVD 3V0AC 3QNXA 4OZHF 3EGSA 4CADB 4O5LH 1BREA 2DM7A 5FCUH 5EU5B 4D8PB 4HWBA 1HDMA 4HUMB 2WP3T 4YXKH 1MFAH 4WTZA 4Z7UB 4YH6A 3VI3F 2E5EA 2A74B 3D69B 2ZZUT 3G04B 3RZCB 3IFOA 3OPZL 3D25A 4M5ZL 3QDMB 1ZT7B 2XTJE 4O9HH 2OQJA 3BHBA 3TJHC 1U8LA 2CR3A 4I4WA 3CUPB 5IQ7H 4QRSB 3DSFH 3AY4A 4LSVH 5I1EH 3JWOC 4JPWL 4NOBA 4Y1AD 1G84A 1F4XL 2P8LA 1A6VH 4KWUA 3BRGC 3KHQA 5DRNA 5I8CB 1RZIB 1ZANL 5JMRA 1HCFX 1JMZA 2UY6A 3BN9D 2F5AL 3T0VA 2ARWA 3O41B 2Z4QB 4MX7B 1NCUA 5E8EB 3MRRA 1FV1B 3IVKB 1AGDA 25C8L 2FH6A 3VFGL 1GAFH 5CGYD 5HDLA 3O2DL 4WFGD 1P69B 5KW9H 1YYLL 5JZ7D 1NGWA 1WBXB 2MTPA 4X80H 4KI5F 1W8OA 5I18H 5DYOB 1N6QH 3NCMA 5K9OB 5IG7B 4J3VA 1AGBB 5C9JA 2Y7QB 5BRZE 4IBLT 4MWFA 3X13B 2GJZB 1NLDH 3A6BH 1R3HB 1CFBA 4RZCA 3RVTC 2O61A 1UB6A 5DMKB 1T22B 5D93B 2CXGA 1PKQE 3T08A 5GS0L 4YBHA 3LOWA 5DD3H 2Z8RA 1CLZH 2HVJB 3P73B 4OF6A 4JPVH 2WV3A 4ZYKB 2A73B 1EUUA 3QQ3B 4OZIB 2VLLA 3O3AB 1I7ZA 4JHWH 3QUZD 4X7DC 2AJZB 1XGYH 4DVBB 5HPMB 2R23A 4TSBL 3QIBD 3U4EA 1NDMB 2R9HC 4UNUA 1NLBL 3D18B 3DARA 4HUXA 2DWDA 4NKMB 3PWPD 4KQ4H 5DRWA 1T2QH 3DMMD 2IH1A 4OGZA 4LAJH 3BH8B 3RL2A 3WS6C 3T1FA 2FX8L 1A0QL 4MXVF 3FFCD 4KJPD 1J1OL 5I1CH 3MLWL 5T5FH 3PWUA 4OQTL 3WDHA 2ADIA 2DOCA 2P8MA 1JGEA 4V2CB 3QNYB 2IPTH 3OKEB 2F74A 3ULVC 1ACYH 2AJUH 2X4PB 3L3IB 3WIFB 2Y23A 1IFHL 4NO0B 3MBXL 1ZGLB 2IFFL 3WNKA 4IMKC 5DMJB 4YDVA 1PKQA 4Y16A 3FN0L 3GSWA 3MRDB 4HLZH 3HI5L 3TA3D 2DQCH 1XF2B 2XFXA 1P7KA 1F58L 1J0KA 2G75B 1JF1A 1OAKH 4G6JL 2DLTA 3B9AA 4LPTA 5C7XH 1EERB 1D7FA 4ELMA 3LRGA 3QHFH 4MJ4A 1J5OL 2DQHL 4G5ZL 4M7JH 1HQRB 1OL0A 1U8KB 2EZ0D 2EDTA 3MJ9H 1G7JB 3V5HA 1GJIA 2AV1A 1ZE3C 1CU4H 5ESAB 4HUWB 4P5KB 1EAPB 4UUJB 4P49A 4HV8B 2COQA 2MCPL 5FHBH 4G9DB 4R8WL 2YEZB 2ZWLT 5HHNA 4LRIC 2BSRA 1O0VA 1DEEA 3ES6B 3SDDA 3VJ6B 1YY8B 3BGFC 3CSGA 5IMKA 3IJHA 2Q8BL 1OW0C 4PRPD 1AO7E 2HH0H 3X12B 2FWOA 2AW2A 1LP9E 3V6FA 2F5BH 5KN5A 3V7MA 3VA6A 3CLFH 4ZOAA 3RWEA 3LDBB 2W65B 5EU6B 5D6CA 5E2UH 4LVEA 3QEUA 1IEBB 1HKLH 3HUJE 4CGTA 3RVWD 4ZXBA 1XR8A 5GJTL 5MEQB 4UINL 4LRNL 4DWHA 1NUDA 2DN7A 3AREC 3QUYC 2X4UB 2R29H 1P6AB 4X98A 3CFJB 2ZUQC 2VDQH 5SV4A 1SJHB 1H5BC 1LEKB 3RDTD 3B2VH 5F7FA 5L9DL 2JCCB 1KTRL 2AJ3B 2FJGA 1DQTA 3W39B 1J8KA 1IAIM 3QUXA 1ZSDB 1J86A 3QEHA 4XNXL 4C55A 3MV9E 5DEGB 4N1EA 1QRNE 1RUPL 3F12B 2XZCL 4UT6L 3GMQB 4X6EA 3MRQB 5D2LF 1A1OB 2W60A 1KG0B 3KPRD 3P4LA 3GI9L 3RAJH 2LU4A 3FMGH 5DFTA 2J1KA 5DI8A 5BS0A 5F44A 4JDTL 4M6MH 4X4ME 1W2KT 3S37L 1AO7A 4PJFF 3H7LA 4Y4HD 4DKFH 4UIMA 1LP9A 1F3RB 2K7QA 2CKBB 4EN3B 4NOFA 4G8IA 5EBMB 2F8XC 1IJ9A 3D3VB 3P3YA 1MFBL 2XWJA 5FO8B 2DTMH 2OS7A 4C83A 2XV6B 1FNGA 4BH7B 5TDPB 3K4ZA 2AK4B 5H37H 4PRAB 5FDWA 5FO7B 2F54B 1YYMH 5F70A 3QRFM 1HEZA 4GXVL 3M17B 5CMAA 3LQAH 2JJSA 4YHZL 4X5WB 2C5DC 2BFVL 3SOBL 4L3EB 4MQ7B 2R2BB 1KN4L 5I1KL 4JRXB 4G8GE 3K2UH 5IB5B 3TZVC 3IXAB 3MRNB 3VI4F 2FGZA 3VWKB 3KYKH 3MV9A 3PDOA 4L4TD 2VZVA 4OUOA 1MHCA 2GK0B 2X7LB 3DTXB 4HK0A 1TNNA 2AEQL 1VSCA 4R26H 2MKLC 1S7UB 4H25A 3RZCC 2LAAA 2Z31D 4HGWA 1KPRB 2D03L 3RUGA 2HJLA 4X4MA 2AXFA 2ZSWA 2R69L 2OR9L 5DQDH 1QFPA 5HYJB 3OAZH 5FA3A 4LMQI 1CVRA 1NFIA 1CD9B 1Z9LA 1T7ZA 4AIXA 3TIDA 1RZFH 4XNMA 3U2SA 3UJIL 2OMNA 1LO2H 3E6HA 4NQSA 3MBED 1GC1H 4NWTL 5I17A 3ELAT 1J1XH 2X4OA 3BPLB 4JQXA 5CEXB 4FRWA 4CL7A 3IYLW 2IAMB 5EOQL 3K81A 1JNHA 4QRPA 4HDIB 3UAJC 3QJHA 5T1KD 5FGSA 2RIKA 1G6RB 3HC4H 2C1OA 3OAYK 3IFPA 3HKFA 2VXSL 5DWUL 3FRPG 1IQWL 4LCIL 4WEBH 2V9QA 4H5SA 4FMFA 1A7QH 4PJAF 1FE8H 2RGSA 5D93C 4U2ZA 1YDPA 1JI1A 4NBZB 3RGVB 1A6WL 1MNUL 2JB6B 1CD1B 4ISVB 3UPRA 4HQQH 3EYSH 4LDOB 4XT1C 4P5TA 3DV4A 4JJ5A 4ACPA 4NQXA 1ETZB 3A67H 1GGUA 2IPKB 3NOIA 4X9FA 5JOPD 3X3FH 1B0RB 4EDWL 4FFVD 5A2JH 1A6PA 1WBZB 4U4BA 5C8JA 4IRZL 4J4PC 3T65A 1SJXA 1CE1H 4JM4H 1JP5A 1TZGH 3PQYE 2FO4A 3WFHA 1FIGL 1A9BB 3CDFA 5DEFB 2VLKD 4LSSL 4FXKB 4PLKC 3O0RL 2ZPKL 2E8YA 4KVNL 3RVVD 3G6JB 2M1KA 2X89D 1ZHKB 2CR6A 1BOGA 1S7XB 4I18B 5LGHH 1D5MA 1MJ8H 4G80A 2JIXB 4Z7WA 1T03H 3FQWA 1NBVH 4Q9BA 1JN6B 3GBML 1MELA 1E4JA 3RX7A 2BVUA 1FFRA 1CFNA 4FQ2L 3W11D 3I2CL 2MOVA 1KJ2H 1JGLH 4QHNB 5F7DA 4PB0H 3UYOD 5FKPB 3DVIA 3G5ZB 3KJ6L 5DMIL 2BVPB 3QYCA 4LCUA 3UJTH 2FO1A 1ACZA 2XA8H 3H9SE 4ORGA 2ADFL 1XMWA 4HWEL 4OIIH 3ARTA 4PRBB 1CR9H 1CE6B 3L9RA 2Z8SA 4ZUSB 3HNSH 1HYRC 3D39D 3IB4A 3PQYA 4I3GA 4LLDB 4NFDA 3O6KH 4PJ8A 2FSEB 3QWOB 3U7YL 1U8OB 3UCRA 4JKMA 1ITCA 1IM9A 4RFOH 5HHOD 5ALCL 3TF7C 1XGTA 4Z78A 1FO0B 4RGOL 5E2TL 4PV8A 2V2XB 1KYOJ 5TDNB 1LMKA 2VNCA 3PG2A 2VDKH 4MS8D 3FT4A 2QADB 3QFJB 1DDHB 2E7HA 3RJQB 3LDBC 1DANT 1DTUA 3ETBF 3PP4H 4TUKL 4XXCA 2NW2A 2O5XH 2ZCHH 3DUSB 4NP4H 4ZFOA 1ZHNA 3D87B 4LU5L 4HIIB 3MCLL 5I30L 5F93C 3UYRH 2DMKA 4PJDF 2YZ8A 5D7JA 4HUUB 4R6UA 3VGGA 1ZHLA 1MFNA 1HHJB 4AL8L 2A83A 1KCVL 4UOW0 5DJZA 1PLGL 4CW1A 4P3DA 4FFYL 3V8CA 1B0GB 2QR0A 1A21A 1ZLWH 4QXGL 2OTUB 1AD9B 1E4WL 2Q1EA 3FAWA 4DZ8A 3VFNA 4IEFB 4E0RB 4LEOB 3ZKNC 3HG1B 1GVIA 1FRGL 3OXRA 5DC0A 3KLAB 1RULL 4C56B 4F58L 3P0YL 1CK0L 1TPXB 3T09A 1A3LH 3EYUL 2GW5A 2Z0BA 3T4YA 3B2UC 1DUYB 4FQPA 5D6DC 4EN3C 2EYSA 5ALBH 1OP9A 1RHHA 2XG4A 4MAYD 1ERNA 1HH9B 4JZNA 1WAAE 4N68A 5C0CA 3BPNB 3P4OA 3SCMA 1EHNA 1XGQA 3QQ4B 2QSCL 3BZFB 4G7YL 3T3PF 3ZKSD 4WVRA 1JZ5A 1YPZF 4KKNA 3GMRB 4P2RB 4JRYE 1NBYB 2Q7NA 3SO5A 3MZGB 5I15H 3BP5B 2ZUWA 1IAKB 1IGML 2H26A 4NUJB 4EQ2A 2Y07H 4XC3L 4A6YA 1TCMA 3UTSE 1U3HA 3NN8B 4WWKD 1OTSC 3VWKC 3TEUA 1AP2B 1NMBH 1IMHC 3WE6B 1XF4B 4WI4A 4HMDA 4XAWL 2OTWA 3CFIC 4DOHE 3HS0A 5FGBA 5ID0B 4HZLA 1SVCP 1CBVL 4HCRA 4RFEA 1RIHH 1VDGA 2WAHA 3OKKB 5J6GA 4NCC1 4PJIA 4LSPH 5F71A 4U1GB 5FYJE 4ZAKD 3KXFA 1RIUL 4LLQA 4KK6D 1LD9B 1UM6H 2AXGA 1QVOA 4XP6H 4S1DC 5B4MC 4DN4L 3ULUH 4J3WA 4EI5B 1MJ7H 3HCVB 4JFZH 4EEEA 3BH9B 3BPLC 4M4PA 4MA7H 3DVNA 2IAMC 3MX0A 4KXZI 1WGOA 2C3VB 1ZHBB 2GJ6B 5D1XA 5CZXD 5INCB 1H9VA 5KS9E 1RQ5A 4LSQL 1J88A 1M6OB 4HKXB 4LCWB 1Z9SA 4GBXA 1NFDA 1SMOA 1F11B 1IGCH 3IDJA 1T83A 4NKDA 4YGAB 3L95A 4GRWF 4XCYA 4YPGB 3RGVC 4X7SL 4XVSL 1A1MB 1XZ0B 3HE6A 3MCKA 1X5AA 1AQKL 4PJXA 3O6ML 4QRRD 1U91A 3V4VH 4AK1A 5D1ZA 3GSOA 3OKDB 2XOTA 4P59L 2UVFA 2W0PA 4NO2A 2ERJB 1JZ2A 2BNRA 2APFA 4BKLA 1CDUA 2PW1B 3SDXB 4OCXH 5GRZA 5JUEH 5E8OA 2FD6L 1INEL 4FQXA 2VLJD 3DXAD 3P40A 3O8XD 3L5WA 1YEDB 4O4YL 5I76A 3KDMB 5EBWB 2X2YA 2J6EH 1FYTA 1FFNA 3X17A 1I3GL 5GGVH 2KKQA 3BKCH 3QIUB 3GSUA 3KPQA 1FVDA 3K80A 5DS8A 4DFIA 2AJYH 5E8DH 4Z7NE 2IMMA 4ODBD 1VGKA 2ATPA 4I18C 4NGHL 3G6AB 5E94A 2XI9A 2BSED 3TT1L 4E41E 2BVEA 2IJ0C 4TNWF 1ORQB 1I9JH 2P42B 5TQ2H 1A02N 1A3RL 3GMOB 3WEXB 4F7TB 3QA3B 3JWOL 5DQ9B 3TVMD 5JA9A 4OZHB 4UOW1 4UDUB 3SE3C 3MLUL 1OF2B 3MOAH 3ZYZA 1WV7T 3MOBH 5IESL 4EBQH 1CF8L 5C07D 1MCIA 2KZ1B 1ZWIA 4GW5A 5IB2B 5E9DB 2NY1B 1RK0B 4ZO9A 3BXNB 4XNUH 5GRJL 1FBIH 2CJUH 1DBJL 5ADOL 4F2MB 1G9MH 4U1LA 4YR6A 3O4LE 2GSGB 5CAYB 1FG9C 4RGMB 3MO1A 3SJVD 1FJ1B 4G8EA 3GSXB 3CSYA 1R3KA 4I0CC 4QNPF 3MRPA 4JKPL 12E8H 1R5IA 5SX5K 4TUJB 3ARZA 5DHYB 1FORH 1NEZB 2FLBT 2ZNXA 3NCCB 1CLOH 3KPSD 3TNMA 3VE0B 2QADC 1N59B 4APQD 4WUUB 5J1SC 2X4NB 4QF1A 3RWHB 3TPUA 3SKJH 3SGJA 2AXJA 4OBSA 1UKQA 3IETA 5C08E 2BDNL 3MNWA 2H6PA 1G7LA 4YE4H 4ZUVA 1N0XL 3CFKA 2R8SL 1RZKC 2HT2D 4Z7OF 5CS7A 3PABA 3UTZA 4MD4B 5F1IB 5ABDE 4LPVA 1P1ZB 3QI9D 2W92A 1D6EB 3SKMA 3WL9B 5CEZL 4XBPA 1TVBB 3UTTE 2H9GB 2I25N 5CUSL 4LMQE 2NX5E 2OR8A 4LLWA 4YWGH 3SKNA 3RPIB 4I3SH 4XNYL 4GSDH 2PYFB 3RWFA 4ZD3H 1HHGB 3HMWL 4KI1A 4KTDL 2DIBA 1E6OL 3O4LA 4JB9H 1MLCB 2R0KL 2EYRB 4ESKA 4PJ9B 4QXWA 5C0ND 2DYPD 2F8VA 4XMKL 4L4VB 3LQMA 1TPXC 2G2RB 2H32A 4PJ7A 5CLTA 4AJ0A 2A9NH 2IANE 3PDGA 5D1QB 5B38B 4G43B 5D9SA 3RQ3A 4OIBA 2O5ZH 1QO3A 1R24B 2E7LC 3FRPA 4IDJL 4PGCB 3GSNH 2BOBA 1F90H 2OXHA 2JKXA 3C6SA 2X1PA 3BPNC 4NN6C 1QD0A 2IQ9H 1MCWW 3GMPB 4ONFH 2PYEE 3P4NB 2WLYA 1CFQB 4OV6F 3CFCL 2DJUA 2E9BA 4OIAA 4RRPG 3V79C 4YAQA 4TRPH 3Q5YA 4R4ND 1IAOB 4GQ9L 2BRQA 2PO6B 4NJ9L 1Q1JL 1JWSA 5FHAH 3KR3H 3U1SH 3CJJA 2F58L 1NL0L 1I1YA 1WWAX 3Q2CA 3WIHL 2XN9A 2C9AA 4MSWB 3VRJA 1LEIB 1I8LA 5EFIB 4RAUB 1ADQL 5GRUH 3LS4L 1YMHB 4Z7VA 3RKPA 1TENA 4OSUH 4R3SA 3O2DA 1FC1A 3CZFA 2Y06H 4IOFD 1DCLA 3MPCA 4FZEH 3EOTL 4J7RA 4XP5H 4BZYA 2P44B 2YRLA 3KWWB 3CCHA 4ODWA 2I60L 4PRIB 3DROB 4H0HB 4U1NB 1HQ4B 1W0WA 5JA8B 4NFCA 3WLWD 3T0EB 4U1GC 4Y5YB 4M8QA 5ELIA 1VADB 5E95B 5J9PA 1V3JA 5JIPA 2OTPA 2CK0H 4IIQA 2GITB 2UWEA 4V1DB 3SKOA 3QXUA 3VXPB 3AU1A 1T20A 2R4SH 5BZWA 1OB1B 4EI5C 3IGAA 4S1RL 2YD1A 1P7QB 1D5XA 5IK3B 3PGCB 5FUCC 2Z92A 1MCPL 1IQDB 1VERA 4FQJL 2B2XL 1OP5H 1DLHB 1PFCA 3LCYA 1JZ6A 1IILE 1S8DA 3QEQE 4NQCA 4KROD 4B50A 3RY6A 1RUQH 1A4JA 1TIUA 1RURL 1FZJB 4PBVC 3OHXA 4XWOD 2EKSB 15C8H 3EO1B 5KJRH 3FT2B 1LK3H 4HJGA 4I9WD 4K7FB 4LF3B 1I3RB 4JFFE 4MMZC 3S3PA 1MCKA 5CJXA 5F6IB 4D9QD 4TQEL 4P4RB 1C5BH 3AB0B 3E1F1 1SMAA 3T8XB 3I50L 1AGFA 4LLUA 4WY7H 1Z3GL 2IWGA 5FYKL 2FEEI 5D2LB 3MUGA 1MEXH 2ERJC 1MRCL 3L3HB 1GZQB 3L3GA 3JWNC 4HWBH 4XMPL 4YXLL 3PWVA 2VDPL 2BRRL 4L5FL 4BQBA 4NQEE 4EXKA 3BAEL 4PJFB 3X11B 3M45A 4M1CD 1I7TB 1ZTXH 1QLFB 2HWZH 4NQDD 1UA6H 4ODHH 5DJ8A 4KZEH 2JB5H 3QFDB 1I8KB 4JZJB 1A2YB 5HHQA 4DGVH 1AQDB 3FB7B 2NW3A 1S5HA 2RR3A 3PDDA 3ZDZE 3QIUC 2GEEA 2R2HB 1JNLL 3CVHH 3D2UA 1TFHA 2A1WH 4OCSH 1VGEH 1KCUL 2PTTA 1NC2B 1RUAH 2VITB 1MWAL 3HC3L 5FYLL 1QG3A 4JFFA 4HF5L 1QYGL 4X9IA 1L9NA 2BJMH 3P9WB 1NCWH 4ZPTA 4FFZH 3KVQA 3OWEA 4RAVA 4RWYH 1HN1A 4Q6IB 3EYOA 3QG6B 4HBCH 3IDGA 3TNNB 2H2PC 1U0QA 3ET9F 3VWJB 3KLDA 2R4RH 5EZIH 5LCVH 5KSAD 3S5LB 2V7HA 4RWHA 1AE6L 4KJQD 2DQEH 3BEVA 3JVGA 4MLIA 1OLZA 1XCTA 3P30H 4JKWA 4H1LB 5I1AA 1V3MA 5DC9B 1D5IH 2YRZA 2E6QA 5D7IF 1KB5A 2IH3A 2F53E 4WFFE 1XCQB 5BV7L 3QXDA 2GSIA 4JFEE 3B6SB 5LQBL 3Q6GH 4PJ5A 2DQFB 4NQEA 1T21A 1IM3A 2CIKA 2NY1C 3MRFB 1RY7B 1MY7A 4Q74A 5CCKH 3LN4B 3HR5A 4TSAL 4UDTB 3ZT6A 3WN5B 4QRUB 4Y19B 4XNQA 3FB8B 3A0OA 4N0UE 4RGMC 5J56B 1KULA 3P11L 4FHBD 1I1CA 4HS3A 1ZLSH 1IT9H 2NY0D 1YEFL 5I66A 4O5LL 3V6ZA 1T1YA 5MEOA 4DCQA 4CNIA 1L7IL 5DZNA 1IZJA 1HK6A 1FN4B 4YXKL 3S36X 3O3DB 5I2IA 3P9LB 1J05B 3N0PB 5SWZB 1DUZB 5ESVA 3S4SB 3DX7B 4Z7QE 3HPLA 4KI5C 4N9GB 4O9HL 2AP2A 4HIHB 1PW3A 3ZT7A 1J8HA 4NRYB 1ZA6A 3DSFL 5E1AA 5F1KC 5BOPA 4Y4FC 3LHPL 1FVEA 5I1EL 1BM3H 3NIFF 1INQB 1T7YA 4JPIB 1A6VL 4PJAB 4GFTB 4K07A 1DE4A 2VMFA 4WW1A 3L3DA 3VFVB 4JFEA 1PG7X 2B1AL 2XTJD 4Z8FH 3VGAB 1GAFL 5LWYH 4FS0A 4UT7H 4JFQB 3ROOA 4RMQA 5KW9L 2AS5M 5ENWB 1LO5A 4N0UA 4X80L 1A6AA 1GHFH 4PJ9C 4U1JB 1PZUB 3H0TA 5B22A 4L29B 1S9XB 3A6BL 3OZ9L 4PPTA 5HYQB 3BX7C 3EJJX 4LPUA 1ONQA 5DJ6A 1SYSA 4PJEA 5D1QC 3BYYA 3VFMA 1EEZB 1HSBA 2MCG1 4WI9A 3W5MA 4GAYB 1YEJH 5DD3L 4FFWC 2FIKB 1KCRH 1AI1L 2OZ4L 3CXDH 3LV3A 4LHUG 43CAA 4HXBH 3OAZK 4KHXH 3MV01 4M43H 5EPMB 4DUXA 2ESVB 3FN9A 4K8RD 5BRZD 5MHSD 1WUNT 4QGYA 4OLUL 1XGYL 3AUVA 2HLAA 4OF5A 1OAYH 4KC3B 5FUOH 2BERA 4YBQC 2NYYC 4M7LH 5I1LB 1GOGA 1KT2A 5DUMH 5BW7C 2PO6C 3TGXA 4FTVE 5HGDA 5ERWA 4WW2F 3ZHLA 1GOFA 1FGVH 1FL5B 3EDDA 4W81A 4H8WH 1MI5E 1O5DT 3U79A 4HX1B 3QO1B 2HLFD 1UT9A 3IDNA 4YC2B 1LEGB 4F9LA 2FGWH 4DQOH 4XI5D 5T5FL 4OI7A 4NO5A 4JFPA 1I7RA 2J12B 4L3CB 1ACYL 5GZOD 3NA4A 1MCCA 5IR1A 3R1GL 1OSZA 3BDBA 2HN7B 1QR1B 3T0EC 1JPSH 1YN7A 4UTBH 4Y5YC 2EC9U 5A40E 1QQDB 2VAAB 1V5JA 4HFWB 1T7WA 3SDDD 3K8MA 4C58B 1ZK9A 1T0NA 2YK1H 2WUBL 5MENB 1T80A 3OXSA 3PWLB 1J11A 1OAKL 3C5ZA 4KTEL 4F57H 1QSFA 3UTQB 1UWXK 3CPLB 35C8H 3B3IA 3HNTL 5EO9B 1XF5B 1G6VK 1HXMA 5JQ6H 4BH8A 1NPUA 4M7JL 1TZHB 4M3KB 1NEUA 2V5TA 4FTVA 3MJ9L 2WIIA 3ILQD 4NKOB 5FM5O 1G9EA 2UUDH 4PYHA 4X8XA 2CDFB 4CU8A 1QLEH 1QSEA 4NC1E 5FHBL 2DQGH 4P2OD 5DQJB 4PJDB 2QSTA 4PGEB 3QIBB 1JPFA 4GG8A 2DBLH 4P3WA 1JUFA 2HT3D 3A6CH 3LKOA 5F6IC 5KSUA 4K9EH 2BY2A 2CLVA 3KPMB 4D0CB 3ZE2F 3AB0C 2X41A 3EJZD 4MB3A 3VFRA 5B39A 2HH0L 1HI6A 3C6LA 4X99A 5J0BA 4F8QA 3DMMB 4H0GA 3MA9H 4Q9RH 1NSNH 2F5BL 3FJTA 4KZDL 1U8JA 3MNZA 1EEUA 4LLYA 4EUPG 4WJ5A 2L4OA 3DPBA 3FFCB 1A7OH 5JXEC 4EVNA 4Z95L 1W72B 1U92B 2IBGA 4OF8A 3DV6A 4HFUL 4AT6B 1CL7H 3QZWA 3SDCA 4C4KO 2YMXL 2GFBA 5I8KH 2R29L 1SEBB 1JVKA 2QHLA 4O2FA 2XKNB 2VDQL 4CN4A 2PXYA 4JZJC 2RB8A 3TPKA 3B2VL 3TA3B 1BQLH 1YNKL 2VXTH 3PWNA 3FTGB 4ZUWB 4Y5XA 3HZYB 3X3GH 2P4AB 1ZA3B 4AEHH 4MVBC 3FB5A 4DGYH 1ES0B 5DRXB 1YPZB 3C5JA 3H3PH 4P23D 4DAGL 1AD0B 1BF2A 3IFLH 3RAJL 3BT2L 3FMGL 4BUHA 5E0QA 2JJTC 4U1SA 2H3NB 4M6ML 4Q6IC 3V7AE 2IQAB 5HI3D 1VFMA 3VWJC 4DKFL 2HMID 1RVFH 4KJYA 1QRND 3L7FA 4N0CD 1YY9C 3G9AB 4V2BA 5DJXB 1U3ZA 4ZNCD 1J18A 5T1LA 5BOZG 4H20H 5IFJA 1HXYA 4TPRH 3U4BH 4PRPB 1BD2E 1KTKE 3QG7H 1XH3B 3MGOB 4N0YH 3LQAL 2P45B 1Z9OA 3WN5C 3KAAA 1CFSA 3LQZA 5BO1H 1G6RL 1M7IA 3G08B 4UBDD 2OR7A 4X5XB 3W9DA 3ZKQD 3K2UL 4RIRB 3OKNB 2A38A 3KYKL 1UC6A 4RRPA 2P5WD 5IMOB 1QBBA 1BJ1J 5DUPL 2IG2H 1N3NB 1RZJC 3ZDXE 43C9B 4BZ1L 3VDCA 4R26L 4L8DA 1Y18B 4ZODA 5KSBF 4XTRC 1BF8A 3TFKC 4WU5A 3NA9L 3S35X 3RDTB 1Q9OA 4G8GD 3K0WA 3IRPX 4DUWA 1QLRA 4OKVA 3MLYH 5DQDL 4NC2B 1XFPA 1MFCH 4ZO8A 4DJMA 4RNRA 5I9QB 5IW6B 3MODL 1T7VA 1QKZL 5BMFH 1EIBA 4WV1B 3KPRB 1RZFL 4X7CC 4GRWB 1LO2L 5HGBA 3U0WH 2AV7B 3MV7A 1BX2A 1HWHB 1LO3L 2DD8L 2VN7A 4KAQL 2H8PA 4PG9B 3B8YA 3O9WD 1J1XL 3VGAC 4O51B 5DJAA 3MZTA 5T1DH 4HGKC 2VRAA 2DDQH 5L2JB 4B41A 1CYGA 2WBJA 4MQXC 1KLFA 3O11B 1U6AH 2V5MA 3F7QA 3MRKB 4XBEH 3UYPA 3QDHA 5IBLD 3C8KB 2VL5A 5KVDH 4M7LT 2WUCH 1T0PB 1NJ9B 3NMEA 5IVXE 4IRJD 4G6KH 3LKNA 5INDA 4GS7B 1FE8L 2RJMA 2VWEC 1E4XH 5GS1A 5IGXH 4PTTA 2EYTA 2FBJH 2BHYA 2Z35B 1UH3A 5E8PB 4IOIA 5TH2A 4HQQL 3EYSL 1PSKL 5C0DB 5GISH 5L2KA 2V5YA 5IV2A 3WFCH 3JV6B 2VISA 4L4TB 1U8NA 2C4FT 3A67L 5JR1H 1NCDH 3U36A 2VH5L 5E08H 1JHTB 1UEMA 1DBAH 1Q0XH 2X4TB 1FAIH 4I5BB 3X3FL 3TJHD 4PR5A 2CIIA 1JPST 3LEYH 2IEPA 1JHLH 2EIDA 3M8OH 3DVGB 3WS3A 3IKCA 1CE1L 1F8TL 4JM4L 1TZGL 1IARB 4JFHE 3RHWF 3MQIA 4R96A 3HTLX 4OZGA 4JO3H 1EH9A 5A2LH 1BJ1H 4YC2C 5DJCA 4P46A 3FB6B 1HZHH 2Y25A 3GSQB 8FABA 3U48A 2Y6SC 1I85C 4HH8A 1YJDH 1H3TA 3IJSA 3MJ7B 3FCTA 5IVXA 3BN9C 4QRQA 5E6ZA 3DVFA 4JDVB 4M1GL 3BQUA 4YHLH 3MBEB 4NT6B 3BIKB 4HMEA 5GIRA 5LGHL 2EEDA 3KPLA 1MJ8L 5CGYC 1AXIB 5CWSA 1A1NB 1X7QA 1T03L 4GLRH 1F3JB 3CFDA 4JZOA 4C57C 4LSTH 5T33H 4CVUA 2I9TB 1RZKL 1A6ZA 3B9VA 3NVQA 5T1KB 2XY1A 3RVTD 4F7PA 4HW6A 2Q20A 4K3EH 5J13B 2I26N 4PP1D 4QTHB 3UTOA 2OM5A 4FABH 1S7QA 2BNUA 1JGLL 1S7WB 3L1OL 4MNQB 4AEIH 3UJTL 3RTQD 2NY6D 5LKNA 2V2WB 2XA8L 4F3FB 1RZ8B 1XR9B 2BOCA 3O6FD 3EFDL 2CLRB 2ITDA 1CR9L 4GKZB 3GIVB 4GRMB 4B5EA 4G8FA 1TJGL 3QUZC 1TQCB 3ROLA 1C08B 2Z8WC 3QIBC 4XCNA 1NANI 1NBZA 3H9SD 1Q9KB 5TE7H 3HC0A 4N1CA 1GPOL 4LQ1A 5EZLB 4A6YH 3DMMC 3QXAB 2D31B 4YHMH 3I75A 4EDXB 3KYNB 2VLKB 1KB9K 1S7SB 4ZSOE 3ULVD 4KJPC 4EOWH 4I8DA 1AHWB 1EEYB 3PP4L 3AS3A 3P9MB 5DK0B 2ZCHL 4NP4L 2ADJB 3GB7B 5HGGS 4PRHE 4I3RH 1FZOA 4BFIA 5I0DA 3MREA 5F7YC 4PJCA 2HT4D 3AXLA 2YA2A 3RNKA 2H2SD 3V5DA 4F15B 4XVTH 2A6IB 1ORSB 1LNUA 4HCRH 3HPJB 4NO3B 3TA3C 3VFPA 1DQQA 1VFAA 2ITCB 5CEZE 3B43A 5TPWL 3UO1H 4Q9QL 2ID5A 2MHAB 1E28A 3QDGD 1UWGL 4JFXB 5AYUL 5SWSA 3BDYL 3MR9B 2LU7A 5E99H 5EORH 3TO2A 1G7QA 2ICEB 1A3LL 2EZ0C 3BI9X 4TULH 5A16A 4RISH 5CGMA 3D39B 5ALBL 1FL3B 2V6HA 4G42B 1SJEB 4JFDA 1YNTA 5M95B 3L3OA 5HHOB 1BGXH 3R06A 3MRMA 4OGYL 2EDLA 3KYOA 4LPWA 4S2SA 1OGTA 4PRHA 1WF5A 2FL5A 4WU7A 1KOAA 2AQ1A 1M71A 1S9VB 4WUKL 4WWID 2M26A 1EMTH 4OT1L 2D2OA 5I15L 4LHUA 1I9IH 4J3OC 2QKIA 5HHPA 2ZUXA 4I48A 1JV5A 2Y07L 4OF3A 4MDIB 1MUJB 3VXRA 4TTGA 3BKMH 1HHKA 1FZMA 4AMKH 5GGUB 5IHUH 4JQVC 3RVWC 3ARED 5DSCB 1U3JA 4PJGE 4P5MB 1NMBL 1SBBA 3BMWA 2ATKB 3BRDA 4JRYD 2I5YH 5HVHB 1ZAGA 1KTDB 4QOKD 1UG9A 2DLIA 3IDMB 1FG2A 4GKNB 5C09D 3UTSD 4LKCB 3RDTC 4BQ8A 2I07A 1U8PA 4U0RB 4NSKB 1RIHL 3SO3B 1WICA 3HA0A 1C5DA 3S96B 3QWRD 1XF3A 5I9QC 3MV8E 1BZ7B 3OJVC 3SN6N 4WFEE 4WV1C 1LVEA 1WCQA 2XKUA 4KVCH 2ICES 1N8ZB 4XP6L 4QTIL 4XXDB 5A2IH 3FO2A 1F6FB 4JFZL 1LP9F 3FQNB 5BVJB 3L5IA 1FFOA 5FYJD 1WZLA 2IALB 5JOFA 4MAYB 4HHAA 2J2ZA 2AEIT 3HUJF 3L6FB 3G5VB 3K1DA 4F7EA 3Q3GB 1JYVA 4X6CA 3DI2B 1ZT4A 1DZBA 1CXIA 3V5KA 4M6OL 2W0LA 5LGJB 4TUOA 2BNQE 3WO3B 3WIHA 2OP4L 3GGWB 4FQXD 4OD1H 4U6XB 2PW2A 4UQ3A 5E2WH 4GS7C 1R3IH 4LRIA 1LE9A 3BPCB 5F8QC 3WBDA 2YWYA 3VH8B 4HIEA 3CX5J 1ADQA 4S0SD 1Q72L 1HHHB 3VDBA 5HD8D 1OW0A 4LHJB 5EO1A 3BP4A 4JPKL 3V4VL 1OGAE 3S88L 1OAUL 2HFFA 1NGXA 4K71B 4J3TA 1VA9A 4ZO7A 1NCCL 2HKHH 4M7KL 3DX9B 3VFTB 4EI6A 3QDMD 2EIZA 5I8EA 1FPTH 2VDRH 2FEDD 3GIZH 5E03A 5F9AC 5FYKE 3OB8A 2Q76A 2Z31C 3EYQD 4YDJB 5J1AB 1KIRB 1KJVA 1IGFH 5FYJU 4ZDHB 3K7UA 5MERA 1CICA 2ICWA 3MUY1 5T3XL 2XQYG 3QUYA 2YN3A 3VMNA 3OGCA 3DURB 3RRQA 3NZ8B 4ZAKB 1J9CT 1H5BA 2R1WA 2VABB 4GKSA 3BKCL 3DYPA 5D7IB 3PXHA 5ITBH 3SDAA 5EULV 2Y9RT 3W9EA 2BNQA 2AJYL 5E8DL 3MBEC 2BVOA 3GJFB 4PY7B 5TF1H 4HKZB 3UAJD 1YN6B 3PWJB 1OCWH 4HIJA 4MJIA 1GGCL 3HN3A 4OLXH 5AAMA 3BUTA 3KPPA 4F9PC 5IHZB 5TQ2L 1I9JL 5TDOA 3KLSA 5C0IA 5FYLE 3AMKA 1I8IA 3VFWB 3QP3A 5J13C 2GKIA 3HZMA 2ADGA 5CJOH 4RSVA 2LU3A 1K3ZA 4ZTOH 5C0JA 2H32H 1MRDH 1U9KA 2KL6A 4FA8A 4E41D 3U6RA 4QT5B 5DK2A 3UTPE 4XCFL 1MPAL 3VXNA 3S34H 3WLBB 1T3FB 2A77H 2KPNA 3MGTA 4EIGB 4UI2A 1FBIL 2CJUL 3INUH 1BBDL 1TQCC 3VXUA 4JY6B 1HILA 4M5ZH 3RIFF 3ZTJH 2Y72A 4AYFA 5GGVY 3TZVA 4FFVC 5E00B 12E8L 5CHNB 3V52H 5FUZH 1SY6L 3WFEH 3IU4L 3IXTB 1ZLUH 3VD7A 1QFWL 1FORL 2P7TB 5EU5A 4D8PA 1TCRA 2VLJB 3DXAB 4R0LB 4WNQA 5BCAA 1L0XA 1R5VB 3O8XB 3GMLA 2AEPH 4Z7UA 1ZANH 1F97A 5IM7B 3SKJL 2A74A 3G04A 5L7XH 3RZCA 2FATH 1MWAA 1AHWC 1ZT7A 1KLUA 4OCMC 3ARGD 25C8H 3FO1B 3VFGH 3CUPA 3IDXH 4QRSA 3RVVC 1GGIL 1YYLH 1CG9B 5JNYA 3PHOB 5IJKC 4OKDA 3RWCB 2Y36L 4F15C 5I8CA 1RZIA 5HDQL 5C08D 2Z4QA 1HOCA 5E8EA 4I3SL 4P9HC 1FV1A 3IVKA 5LBSL 3TVMB 4MCYB 2ZUUA 4GSDL 3RU8L 4PREA 4ZD3L 5T3ZL 3T4AB 5GS0H 3LD8B 1HNFA 4WO4B 4U3HA 4JB9L 1OTUD 1JYXA 5DYOA 5C07B 3WNOA 3UTTD 5K9OA 5IG7A 1DN0B 1AGBA 2GK2A 2Y7QA 2NX5D 4WW2B 1HYSD 4YHPB 3X13A 2PNDA 2A9NL 2GJZA 3Q5OA 4W4OC 4OF7A 1OWRM 4IS6B 4TSBH 3H9HB 5EO0A 5F7KC 3SE9H 4RMUA 1T22A 1C5CL 3SGDI 1JWMB 4WI3A 2EKJA 2XKSA 4M6NL 1IVLA 2HVJA 3P73A 1CD8A 4MXQD 4ZYKA 3LAFA 2A73A 3QQ3A 1OT1A 3HZVB 2AJVL 4LCYB 2IQ9L 5I0ZA 1NKOA 1MH5B 2IAND 2AJZA 4DVBA 5HPMA 2FX8H 1J1OH 1WC7B 3KPSB 4MS8C 1NDMA 4APQB 4TRPL 3U1SL 3D18A 4NKMA 3K3QA 4J4PA 3MBXH 2VZUA 2PYED 4RMRA 2X4SB 4XRCB 4BFEA 1K8DB 1XGPB