2HLFC

Structure of the escherichis coli clc chloride channel y445e mutant and fab complex
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
221
structure length
221
Chain Sequence
VRLLESGGGLVQPGGSLKLSCAASGFDYSRYWMSWVRQAPGKGLKWIGEINPVSSTINYTPSLKDKFIISRDNAKDTLYLQISKVRSEDTALYYCARLYYGYGYWYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAAAASMVTLGCLVKGYFPEPVTVTWNSGSLAAGVHTFPAVLQAALYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Proton transport,membrane protein
molecule keywords H(+)/Cl(-) exchange transporter clcA
publication title Synergism Between Halide Binding and Proton Transport in a CLC-type Exchanger
pubmed doi rcsb
source organism Escherichia coli
total genus 40
structure length 221
sequence length 221
chains with identical sequence E
ec nomenclature
pdb deposition date 2006-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07654 C1-set Immunoglobulin C1-set domain
C PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hlfC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hlfC01
2CLZB 2LFGA 1QBLL 1FLRL 1JNNH 4X7TA 5HGDA 4PLKD 1SMAA 5A2FA 3VXUE 2JB6A 3PIQB 5EA0L 1BOGB 4DVBB 4NN6B 3MOAH 1T22B 4JZNA 3AMLA 2VDNL 1DBAL 4LP4A 4K71C 3W9EA 1WJ3A 3S88L 1MHEA 1NBZB 3QWOB 2O5XL 1BJ8A 3WLWC 5EORH 3DIFB 4R26L 1CLZH 5JMRA 4ODVH 4MGXA 1W2KT 3D69A 3NZHL 4A6YH 1UVQA 3WLWD 4ONOA 5DYOA 3L5JA 3QIUA 3RI5F 1UWEL 1HILA 2P7TA 4PGBB 3BN9D 5D7JC 1P1ZB 1P6AB 2DWEA 5FB8B 1Q9WA 5FKAB 1AE6L 1MREL 1F3RB 5D7JD 2X4RB 4F9LC 3AXLA 1MUJB 1J1XL 5HVHB 3RRQA 1CFVH 4BZ1L 4Q6IC 2UV3A 4ZTOL 4I77H 5EIIB 2VXUL 2E7BA 4E41D 5DD1H 2DQFA 1KIPA 5CJQL 5DJXB 4RAUA 3W39A 3TA3C 4YFLF 3GNML 3HFML 1I1FA 3BZDA 1IQDB 1G7PA 2XQBH 2C3HA 3LKRA 3TA3D 3WS6C 1U3HB 2XXCB 2GUOA 1XF3A 3VFSB 3ZL4H 3QUMA 4NGHL 4ODHL 1XGQB 1MWAB 3INUL 3O4LB 1PY9A 3UPAA 5K9JH 1BF8A 5EORL 4NKOB 3GRWA 3F7QA 4IBLT 5EUOE 4UQ3B 5H35A 4EEEA 4OUUA 5DJZB 1CICA 5C08E 2EYRA 5I1KH 4U1KA 1KF9B 1MAMH 2AK4A 3RTQB 4Y2OA 3HPLA 1T5WA 3JVGA 4NDMA 4LASL 3NFSH 3B8YA 3HRZA 4XNZC 5HYJB 1T6WA 3LDBB 3VA6A 1MFCL 4I77L 3IJYB 4TVPD 1KPUB 4PJHB 1T83C 3WHE0 4L4TE 3IKKA 2Q3AA 4MWFB 1KB5A 1ZMYA 4LIQL 4O4YH 4JGMA 4X4ZA 4H8WL 2APBA 2FX8H 4PIRF 5FUZL 5L2KD 4ONHB 5B22A 3MZTA 3O2DH 1WBYB 2Z35B 3EYVB 1I1RA 3O3DB 4PJFE 4PPTA 1WZ1L 4W4NA 5EFIB 4PJAA 1QEWA 1LO0H 1KJ2H 1WC7A 3O6FB 3KLSA 1K85A 1Z2KA 2D31B 5GGUA 3THML 1RJZA 4PLNC 1DQDL 5C0AA 4GKZA 3WNNA 1Y18A 1U8QB 1C12B 5IB5B 3RX8A 2QSTA 4P46B 3RVTC 4X5XB 4G43B 4YIQA 4HZLA 4YXLH 4IHOA 2VAAB 4HK3N 3PNWA 1LEIB 5TH2B 3RVTD 4Y2DC 5I74B 4AG4L 1A7OH 4A2LA 4I0CC 3SKJH 2QLVB 1NFDA 5EIVA 4NO0B 4Y2DD 1YQVL 3HS0B 1JV5B 3O6KL 1XGRB 3BEVA 1JTPA 4PJBE 3MRCA 1J7VR 3GIZH 4ZPTA 5DUML 3OKEB 3HRPA 3ZDXE 2CLZA 2FX8L 4GAFB 4OAWB 1F58L 1F6LL 3EYSH 5HYIA 5JZ7C 2CK2A 4LBEB 4N0CC 1TTUA 1YA5A 3PIQA 1BOGA 1AHWB 4RIRB 4ORZC 4DVBA 4PRBB 1LHZA 1T22A 4YXHH 1BQUA 1FZKB 5GGTA 3JWDL 2NW2B 4Z7UF 2GYSA 2UVFA 1L6XA 1NBZA 3QWOA 1E6OL 4ZQKB 1DP0A 3WIHA 4W6WB 4H1LG 2EZ0C 3DIFA 3GMPB 3LSOB 4XBPB 4FQXB 1KB9K 2V7NB 4PGBA 5ADPH 1F4YH 1P1ZA 3TT1H 5FB8A 3BPLC 5FKAA 4X9IA 3DSFH 1LNUB 2IGFH 4OF0A 2X4RA 4Z7VF 3ZTNH 5F8QC 3LEYH 1MUJA 5DGRA 5AZEL 4HGWB 1FGNL 3CPLA 2EIEA 3O6MH 4ZG1A 5EIIA 1KN4L 3EBAA 4WDIB 5DJXA 3QR2A 3BSZL 4MAUL 3MBED 1IQDA 1Z9LA 4NCC2 3BOVA 2VITB 1U3HA 3ZTJG 1OSPH 4XT1C 5GS1C 3VFSA 2BX5A 4EIGB 5ISZD 4TOYH 1XGQA 1MWAA 1S5HB 3O4LA 1A7RH 3LD8C 1KBGL 3DVGB 1MCOH 2WIMA 4LPWA 3RL1B 4Z5RB 4JHWL 4NKOA 4WFFD 4L4VD 3NH7L 4UQ3A 1OCWL 5DJZA 1I9RH 2OZ4L 1VPOL 5FHAH 4M93C 3RTQA 3R06B 4JRXE 4ALAH 4JPWH 5IWLC 3FRPG 4ZDHB 1B0GB 4XNYL 3DSFL 5SWQB 4KTDL 4BELD 3G9AB 4OGYL 5I71C 2J8UF 4LAQL 1YYML 5HYJA 5IT2H 1KIQA 2H45A 3GJEB 3IJYA 4KJWC 4ETYA 4JKWA 4CN6A 4OZIB 4FQIH 4MWFA 4KJWD 3DXAB 1VFAB 4X99A 2BK8A 4PY8I 1VGEL 3MJ9A 5EU6B 4D3CL 1L9NA 4PTTB 1VKXB 2YD5A 4P2RE 4M03A 3QJHB 1UM4L 4ONHA 5D7LB 4D8PB 1R3KB 5CLWA 3OJVC 3FQWB 3O11B 1OF2B 1T2XA 5DVNA 1WBYA 2Z35A 3EYVA 3O3DA 1FIGH 5J6HB 4PJ9C 3NAAH 2DQCH 1F2XK 5EFIA 3SCMA 4I2XB 3QHFL 1W72H 3CMGA 3FZUC 3O6FA 2VLKD 4OIIL 4PJ9D 1INDL 3U7YL 1A7QL 4JM2F 3VGHA 1KACB 3U7WL 1BHGA 1TCMA 2D31A 4DUXA 1CLYL 3FZUD 2DQDH 4W6YB 3IFOB 4NQED 1U8QA 1C12A 5IB5A 4P46A 1U3JA 5F72S 4X5XA 4G43A 5HHXL 5HHNB 1ZA3B 3S36X 2BZDA 2UWEF 2VAAA 4QRPE 5TH2A 1OSZB 1LEIA 1ITBB 3HUJF 1NUDA 3O3UN 4PJDB 3S3JA 4NN7C 4AEEA 3HS0A 1JV5A 1C16B 3C87A 1XGRA 2CMRH 4Y16C 1MCQA 3W11C 3OKEA 3V0AC 5T3ZD 1MLBB 4HS3B 4OAWA 4HF5H 5GGRB 2BSRB 3MRKA 4OLUH 4Y16D 1HWHB 3W11D 4W70A 1RUAL 4LBEA 1AFVL 5IHBA 5CCKL 2FH6A 3VFPB 3WJLC 4ISVB 2HT4C 1KCSL 1AHWA 1NCAH 4RIRA 2C3XA 4H5SB 4PRBA 1FZKA 1Q9OB 2ESVE 2NW2A 1BAFL 4PLJC 3A6BL 4MNQE 1FDLL 1T21A 4ZQKA 2JJTC 2QQNH 4RGNB 1CDGA 3SGDI 4FXGB 2MCG1 2DQDL 4PLJD 3N0PB 3GMPA 3X14B 2EDWA 1IGYB 3LSOA 4C4KT 3GSNH 3UZVB 5DT1H 4FQXA 3VXSE 2V7NA 1A7NL 1PSKL 1TJHL 4YBQD 5LAXA 4XVJL 1T03L 2IWGA 1V7NH 1WV7T 5INCB 1KCLA 1Z0MA 1IFHL 2Y7QB 5HGHB 1MELA 4KJQC 1LNUA 5DGQA 4P9ML 5IHZB 5I19H 2XTJB 1MY7A 1RUKH 4JM2C 1GGIH 3I9GH 3OV6A 2IPTH 5CJBA 5CILL 5FEBA 4JM2D 4WWKB 4WDIA 2MOVA 3TCXA 1TXKA 4M1DH 1B0WA 1X6NA 3RI5K 2HA1A 4ZODA 4EDWL 1B2WH 4PGDB 1G9EA 5E95B 1HSAB 4Z76B 4K23H 2DLGA 2X89D 3PP3H 4HC1A 4AZ8A 5DFVD 2YD9A 2YEZB 6FABL 1P5VA 1S5HA 3TC9A 2DICA 5DUPL 3DVGA 3LMJH 4HQQL 1I3VA 2EH8H 4YPJA 4Z5RA 3RL1A 3U4BH 4KDTC 4JKPH 1RMFL 1NGPL 2PNDA 4X4ME 2B8OT 2VISB 3R06A 2R15A 4KUCD 3T3PE 3SGJA 1PQZB 1B0GA 5I1IL 4PJ5E 5SWQA 3LKQB 3SN6N 2ITCB 1YN7B 4EI5B 4JFHD 1J1OH 1Q0XL 5DFTA 1H3WM 3GJEA 2IPTL 3C09B 4OZIA 5JW4R 4CJ1A 1KCUH 4NNPH 2XG5A 6CGTA 3DXAA 1RUML 4HK3J 3TNNB 3WO4C 1VFAA 4L1HA 2J8OA 5SWSE 5D96C 4NQDE 4Q0XH 1FNAA 4RNRB 3SHSA 5EU6A 2ZNXA 4FFWC 5EUOF 4LEXH 4GH7B 4U7KA 3S5LG 4DQOL 1VKXA 4FQCH 3QJHA 4OIAA 3RPIB 3TBSB 3IF1B 4WY7H 2F74B 3MJ6A 1R3KA 2D03H 4FFWD 4OBSA 5D7LA 3TO4C 4D8PA 1NLDH 3FQWA 2EDTA 3CUPB 4X7DC 2HFGH 3O11A 3HE6B 3JBG7 5C3TA 4Y5YB 5J6HA 2EDOA 3TO4D 1MCLA 2V17H 2ZUQC 4I2XA 1MF2H 4UOW0 3BP5B 1NCWH 3RUGB 4MA7L 4BSVB 3Q48A 1AIFA 4CMMB 3C2AL 4CAGA 1XMWA 3S3SA 3IFOA 1NUNB 2I24N 1QSEE 3C5ZB 1VB9A 4CU7A 4LMQI 4QT5A 1CDHA 4KJPC 1JYVA 5HHNA 1ZA3A 3VXPB 1MH5B 1OSZA 4X5WB 1I8IB 4KJPD 1KTRL 4XPAH 2VN7A 4PJFF 3N85L 4NQCE 1C16A 1YEDB 3N9GH 3BRDA 4KKCC 4YHML 3KYAA 1QBMH 1G6VK 1MLBA 2VN4A 4HS3A 5T1LD 5I0ZA 5GGRA 2BSRA 4KKCD 4PUBH 3OF6D 1DQLH 3EKCA 5GGVL 2FGWH 1UFUA 3VFPA 4Y19A 3MR9B 4ISVA 5C1MB 3U4AA 3UTPE 3FFCE 4H5SA 1NCBH 5IHUL 1Q9OA 5GQBA 3I6GB 5JOFB 2ZG1A 4RBPH 3FHAA 3L3IB 5HGAB 1G0YR 1UB5B 2IQ9H 1A9BB 4FXGA 4QHMB 3WJJC 5I6XB 2XY2A 1LP9E 3ILPB 3X14A 5IVXB 1IGYA 3UC0L 2VDKL 4R7NB 4OQTH 4HS8L 3ZDXF 3ZE1E 1MCFA 1OARH 5INCA 4R6UA 2Y7QA 5HGHA 1S9YA 5IHZA 1BD2E 5DQ9B 4JVPA 2YUXA 5KSVA 4X9HA 1CG9B 1BLNB 3FOMB 4LPXA 2DAVA 2HN7B 3DVFA 1GPOH 5T3XD 1ULVA 4WWKA 4L4TD 2DDQL 4PUBL 1DBBL 4N8VG 1LO5B 1E4WH 3FL7A 4YDIL 2FGWL 3H42L 4R3SB 3KR3H 4KHTL 4PGDA 1JHLH 3A6CL 3FT3B 3OGCB 5DVLA 4KDVA 2WBJD 1FAKT 1RU9H 2FBJL 4M1GL 4Z76A 4LL9A 4WUKH 4RA3A 5J12C 2XZCL 1FYTE 1EK3A 1F45A 1B3JA 1N0XL 2V5TA 2YEZA 5FM5O 4LCIH 1UJ3B 3MRMB 3KHQA 3GM8A 3LEVL 2N7BA 4QKXB 4KTEH 3OHXB 4OF3A 1FC2D 4H88H 5DSCB 3VFGL 3LRHA 1IKNC 4OLVL 1MCHA 3MV11 2VISA 1PZ5B 5ITBH 4MAYC 3RWCB 1I7UB 1PQZA 2YD4A 4I5BB 2R4RH 5D2LE 1BVLB 4MAYD 5EC1B 4Z78B 2ITCA 1YN7A 3ROLB 4EI5A 4XP6H 2VE6B 4OLWH 4MJIE 3RWDB 4J12A 4J8RB 4W81A 4JZOB 5BZWB 4WO4C 1D5IL 2W07A 3RL2B 4GXVL 3OJMB 4L9LC 3T0WA 3TNNA 4EJ1C 4ZFFB 4MA8L 3L3HB 2AQ3A 4KK8D 4RNRA 4MNHB 1JHLL 2J4WL 1WAAE 3SGEH 5C0CB 3T1WA 3RPIA 3TBSA 3IF1A 2F74A 4NQUA 2NY0C 3CUPA 2AV7B 3HE6A 3EYUL 2ZWLT 1B90A 4Y5YA 2NY0D 3BISA 2VDPH 4C56B 3BP5A 3IDYB 3RUGA 2MMXA 4RGOL 2MKWA 2OSLB 2CKBH 3NABL 4BSVA 5HYSB 5ITBL 3DLQR 2XIDA 1MCSA 2R4RL 3C5ZA 2X4OB 1TQBB 5E9DB 2XWTA 1DEDA 1OB1B 2YRLA 3VXPA 1MH5A 2NY6C 3A67L 2PF6A 4NP4L 4HZAA 5GGVY 3SDCA 1I8IA 1QTYT 2HRLA 4OLXH 3V7AG 3MRQB 3CZFB 1YEDA 2Q8BH 3I75B 1CXFA 1MFDH 4GS7B 1MCJA 5LKNA 3QISA 3AY4C 3N1GC 1N5YH 2IANE 1Q72H 5C0BB 4ACPA 4XPHL 3HI6L 3QCVH 3MR9A 4XMLH 4LDEB 5IIEB 4MSWB 4JFEB 5E2UH 4OD3L 4P0DA 3I6GA 5JOFA 2O5YH 4QXWA 5I1GH 3VG0H 1FNFA 3L3IA 4MJ4A 4X8JB 3PJSB 1UB5A 4HIXH 2I9LB 1A9BA 3ULSB 3PGFH 4QHMA 4U4BA 5DD3L 1N64L 3FMGL 3G6JE 3ELAT 3ILPA 5IVXA 3P30L 5J11C 3K3QA 5DC4B 2AJVL 3GSOB 4QRUB 2MHAA 4R7NA 2JB5L 1LO2H 5EH1A 4OCXL 4OM0H 1LDSA 2Z8WC 1DBJH 4R8WH 4H0IA 5GS0H 1IAKB 4P57B 4QXGL 4JRXD 3CFIC 1T2JA 2B1HH 2Q76B 1UCBH 1T0NB 4NSKB 3ZSTA 5DQ9A 1X5IA 2A77H 5L9DL 5CZVH 1CG9A 3ARZA 1BLNA 3HE7A 3FOMA 5F89B 2HN7A 4DOHE 4YAQB 4HT1L 4NKIL 4UT7L 2PW2B 5CKGA 5DMGC 4CN1A 1JFQH 4C58B 4R2GB 3NGBC 1LE5B 1TTGA 1LO5A 5DMGD 4MA1B 2AJZA 4ETQB 4YFLI 1GCFA 4R3SA 4F8QA 3UYRH 1GGBH 4I0PD 3OGCA 1JGLL 3FT3A 5HHME 4NBYB 4LGPB 1U91B 1JI2A 2QQKL 4P2RD 4CW1B 1UJ3A 2W0FB 3MRMA 1CWVA 3R0MA 4WU7B 2P46B 1I1CA 3OHXA 4OM1L 3FTGB 5DSCA 3T2NL 4GXUN 3FB7B 2AXJA 4JAMB 3IDUA 1T0MB 3TT3L 1PZ5A 1RJCA 3D18B 4N0YH 3RWCA 1H8NA 1I7UA 3BGFB 4B0MM 1LO4H 4I5BA 1G6RB 1T3FB 1AD0B 3KS0H 1BVLA 1S9VB 2VLRE 5DRWB 5EC1A 4Z78A 2A77L 2DQJL 4C54A 3ROLA 4JO4H 2AJUH 2VE6A 4ORGA 3BD4A 3WBDA 4XAWL 4J8RA 4QRPD 4JZOA 4R4BB 5BZWA 4O5LL 3K7UA 5BS0B 1NMCB 1MRDH 2J2ZA 3RL2A 4FP8H 4P5TC 5E03A 4JY4B 4PFEA 4ZFFA 1OP9A 3HA0A 4HGMA 3SOBL 3L3HA 2BNRB 4MNHA 5TPWH 3JZ7A 5ESQB 2WV3A 1U0QA 4UTAH 1G7LB 5C0CA 5L88H 3KLAB 4BQ8A 3IS1X 5F1IB 3W0WE 1PJ9A 2WWMC 3N1PC 3X3FH 5A2LH 3IFPA 4QHNB 5I2IB 1D5XB 4C56A 2WWMD 2BXZA 3QIWC 1FSKC 1KEMH 1UWGH 5DO2C 1ZLUH 2ESVD 2YUVA 2APVA 2OSLA 4MNQD 5D7SL 1N7MH 3QXWA 4PJCE 3QIWD 5HYSA 4P9HH 5DO2D 5EU4A 3TM6A 5E8PB 5TQ2H 4QY8B 3NIGE 3C6SB 1FH5L 2G5RA 5E9DA 1QRND 3VXSD 1OB1A 3MLUL 2AJUL 3KPTA 3TZVC 4RFOH 2VXQH 3MBXL 4G8FB 1MVUA 2RB8A 4HMCA 4HDIB 3TZVD 2IPUG 5BJTB 5ICZB 3QZWB 5KSBF 4M3JA 3MRQA 3CZFA 3VGAB 3I75A 4Q9QH 4X7SH 4E9LA 1CU4H 5I0DA 4GKNB 3S34L 1F3JB 3ZKQD 3K1DA 1CL7I 3M8OL 5DK2B 5C0BA 1NCTA 1IGML 4JCMA 4S10A 3T3ME 5C8JB 1IRAY 5F97E 3WS3B 3MV9E 4JRWA 2XQYK 4KFZC 5IIEA 5FCUL 4MSWA 3LV3B 4JFEA 3UTSB 3HG1B 1DBKL 4M02A 3KAAA 2OLDA 4JFQB 4X8JA 1EGJH 3QQ9C 3PJSA 5F21B 3H3PL 5IGXL 2I9LA 3ULSA 5H37H 5TE7L 4G9DB 4DKAA 3QQ9D 1IM3B 3BRFA 4F2MB 3GSOA 3HZMB 2HVJB 4QRUA 3CLFH 3RIAF 3QFJA 1KXVC 5BVPL 5CJXA 1IAKA 4KKNA 4DKEH 1UXWB 5ESAB 2IBZX 3GJFH 1QR1B 2Q76A 4NSKA 1T0NA 1NMAH 1X5XA 3EOBA 4RMRA 4PJ5D 7FABH 5D2NB 3S6CA 4N0UB 1CR9L 4YWGL 4Z7WE 1U93B 5F89A 5JHDB 4CUCA 1NCCH 4YAQA 4OJFL 2XPGA 4PD4K 2PW2A 4KAQH 1CU4L 4LOUC 1XEDA 2VSDA 4AEFA 4BSWB 1LE5A 4CMHB 2EDFA 2EDEA 4ZS7L 2H2PC 3P73B 4ETQA 4KI5C 1LP9F 4G6AC 5SWSD 4GLRH 4NQDD 5DEGA 4JFXB 5F6IB 2H2PD 5GRVK 2ICES 1U91A 4XCNB 3ZE1F 3V5HB 1W0VB 4CW1A 4XB7A 1RUQH 3S35H 3L6FB 4WU7A 3CFCL 5C0RH 4GRWB 4AL8L 3FTGA 4UMGA 1UM5L 4KGJA 3RZWA 2E3VA 3FB7A 3TFKC 2WQRA 3AM8C 4JAMA 1T0MA 2DLHA 3TFKD 5DMYA 2I5YH 3D18A 4HUXB 1NGXB 2JIXD 1G6RA 1T3FA 1AD0A 1QSED 5DRWA 4APQC 2H26B 1ACYL 5EBMA 4PRHB 1RZKH 3BKYL 1OTTD 1E28B 4R7DB 5AAMA 4LSTL 3V5DB 1U2CA 4R4BA 5AUMB 3PXHA 4APQD 5IB2A 5BS0A 4PJIE 1KENH 4YHLH 4NWTH 4TQEL 2VR9A 2BHYA 3HHRB 4JY4A 4NQCD 1E4KA 2BNRA 4LCCC 5ESQA 1G7LA 3KLAA 4RGMC 4RMUA 2QHLA 4OZHA 1TETL 5F1IA 2CXGA 4MX7B 1JGUL 2HYMA 3S35L 3CZJA 5L8JB 1JYWA 2Y9RT 4LHQB 2HKFL 4JM4L 1KOAA 4OIBA 2P8MB 5D2LF 4QHNA 1A6VL 1JPTH 5I2IA 4EXPX 1D5XA 1EEYB 3UTPD 4JFFD 1JGVL 3FFCD 4PJGE 1FPTL 4G7YH 1SQ2N 3SJVA 1PGRB 2HTLC 1S8DB 4HCRL 2I5YL 3D2UD 5E8PA 3GSUB 5DC9B 2LVCA 1B9ZA 4JVUA 2HTLD 4OF7A 4QY8A 3TH4T 5E24E 3VI4E 3C6SA 4Q9RL 2VDML 1WAAF 4JPVL 5T1KB 1TENA 2DQUH 3GHEL 4HDIA 4P23B 3QCTH 3E8UL 4YHLL 5BJTA 5LQBH 3VD3A 4RDQG 2NY1D 5ICZA 1KCVH 5IMOB 3GFUA 4LHJB 4TSBH 2HKHH 3BWUC 3QUYC 2L0DA 1HCVA 4GKNA 4LK4A 5AZ2L 3VFUB 1F3JA 3QUYD 1CLOH 1WK0A 4Y1AE 1TVHA 5DK2A 5C8JA 1R3HB 3WS3A 1DLHB 3KYOB 4OB5H 1MI5B 1FORH 1MHHB 1J9CT 4OCWH 3LV3A 1T7XA 1P7HL 5LG1A 3V8CA 5E6ZA 1FYTD 5ALBH 2G9HB 4JFQA 4G6JH 1H0DB 3A6OA 3L7FB 2VUYA 4WCYL 2CJUH 4G9DA 1IM3A 4F2MA 3HZMA 2HVJA 4F33A 4J6RL 2XFXB 4U6TA 3KXFB 1JTOA 1NFKA 1QFWH 3MXVH 5E6IB 3B3IB 1YEEL 4HWEH 1FZMB 3H2WA 5KVFH 4X6BB 1C08A 2VR4A 1UXWA 2R0KH 3FT2A 5ESAA 5GGSY 1QR1A 3IYLW 2VDRH 3DV4B 1D6EB 2YZ1A 1BMGA 5D2NA 4U3HA 4N0UA 1NAKL 5D1QC 1JL8A 1U93A 5JHDA 5KVGL 3CVHB 5ELIA 1UYWL 4MJID 2OI9C 4IRSB 4LARL 4EDXB 4BSWA 5MENB 2IMNA 2KPNA 4HBQA 1S9WB 3G5XB 4I18C 4K9EH 5IFJA 4LQFL 4OI9A 1UEYA 4M6NL 3P73A 3G6JF 5CJ8A 1D5MB 3UYOD 1LDPH 4JFXA 4OCWL 1UWXH 4U1LB 4XCNA 1JYNA 2JJWA 3V5HA 3UJTL 5BOPA 4JGUA 4KZDL 4K3JH 2G75B 3L6FA 1CE1H 3IFLH 2CK0H 2HT3C 1PZUB 1FJ1B 3LKOB 3JXAA 1V7ML 5T5NF 1BGXL 5JIPA 2HT3D 1RZJC 4G8GE 3ALWA 3NMEA 4PY7B 2P45B 3MXVL 3K80A 4O2FB 4HUXA 4ZFGH 1M6OB 3AGVA 3OR7A 1NGXA 3E2HC 4XPTH 4GAGL 4NHCH 1FZJB 4OQ1A 4K3EL 2H26A 2YUZA 4PRHA 3MGTB 3TJEL 2R56H 1JWUB 4R7DA 1E28A 3BIBX 2W92A 3V5DA 1BF2A 1J5OH 4GSDH 1U95B 1CGYA 4PP1C 5HYQB 5EZJB 5F3HB 3WNMA 1NC2B 1E6JL 3LS5H 3RY5A 5D8JH 1ADQL 1CS6A 4WJ5B 2PR4L 4OF5A 3P2TA 1H5BB 4XC3H 4MX7A 3C8KB 1KLGB 4N0FB 3DRQB 1G0XA 2IAND 4K3JL 4XP9L 2V2TA 2P8MA 4R4FH 2NZIA 3MOBH 1EEYA 3GSRB 4M7JL 2DTMH 3IJHB 4GG6B 3H0TB 1A21A 2QJDA 4DN4L 5C92A 2EDNA 3K4AA 1MIEH 5HI3C 5JQHC 2KBGA 1MPAH 2ADIB 3ARDC 1S8DA 5E8DL 1F4WL 2WUCL 4JDTH 5DS8B 5HI3D 2FO1A 3M07A 5CD5D 2F54E 3ARDD 4XPTL 4K71B 4YX2H 4KRLB 4H0HB 2ZKHL 4LGRB 5T1KA 4OZGE 3DX9B 4JG0H 4HWBH 4WI8A 1YMHB 4P23A 4WFEE 5IFHL 5IMOA 5D7JB 3NCMA 2DIAA 2R23B 4LCUB 2IG2L 3LHPH 5EBLB 3VFUA 4P9HC 3NA9L 1GIGL 2R1XB 4PJCF 3MA7B 4XC3L 4E41B 1R3HA 1DLHA 3KYOA 1MI5A 1MHHA 4R4FL 2Y06H 5ILTH 2BY3A 3CDGB 4XNQB 2XTLA 3KGRA 3TA3B 5EU3B 4OCMC 2G9HA 4PV8B 3B5GA 5CEZL 5ADOL 1H0DA 2QSVA 3MYJB 3L7FA 5DJ6A 3WFCH 3GUTB 3GI9H 2DYPD 2GFBB 3GHBH 4GKSB 4MNGE 5F9AC 4FQPA 3OKNB 3IU4H 1T1WA 5T3XL 1C1EL 3KXFA 4RSVA 5GGQH 5E6IA 3B3IA 1FZMA 5FUCE 2Z0BA 4X6BA 1EJOL 2K9UA 3WE6B 1EH9A 3V6OA 3T3MF 4DKFL 4O58L 3B2UD 3DV4A 1D6EA 3KJ6L 4PJAF 4GRLC 1JRHI 2VLRD 2DQEL 2OCFD 3O4OC 3CVHA 5TJWK 2YWYA 1XGUA 4HAFA 3O3BB 4GRLD 5KTEH 3CAFA 1HCFX 1HIML 4IRSA 2M1KA 4OI8A 4EDXA 5MENA 1RJLB 4JPIB 4GJTB 4HLJA 1S9WA 2V5RA 3G5XA 2RCSL 4GW5B 4RZCB 1T6VN 3CFDB 1XT5A 3F58L 4KRNA 5KAQF 3RIAK 3TYGL 1ETZB 1J11A 3VD4A 4U1LA 1J10A 3V5KB 1GHFL 1YQ2A 4S1QL 3W0WD 1U8IB 2G75A 5BMFH 1KTDB 5L2KB 2QADC 4LAJH 1GZPB 4JR9H 3VH8G 1FJ1A 1XZ0B 4Z7WF 1UXSB 3LKOA 2QADD 3WHE1 4K7PH 2XWBB 3VJ6B 4WI2A 4PY7A 2RJMA 3MOQA 4UT9H 1H8OA 5J1AB 1JZ6A 4O2FA 4UV4L 1M6OA 4NFDA 2CR3A 3P40A 2LAGB 3CU1A 2GTWA 1A3RL 2X05A 3VI3E 3MGTA 1MY5A 1JWUA 4JO2L 1OY3B 4Z77B 5A40E 5K9QI 4E5XB 1MNUL 5GRVL 2BDNH 1OAQL 1U95A 5EZJA 5F3HA 1JRHL 1MFEH 3E3QE 3QUXC 1NC2A 2WM0A 1H3VA 4J3UA 5CP3A 2R29H 1T66C 2Y25A 3L9RB 3F7RA 5JW3H 1RQ5A 4WW2F 1CDUA 3QUXD 3EOTL 4M48L 4Y2DB 4P4KA 1T66D 3DNKA 2J12B 4R0LB 4G3YL 1H5BA 4K94H 1UACH 1AI1H 5I8KL 3C8KA 1KLGA 2ARWA 3O6LH 4N0FA 3DHMA 3DRQA 1FN4B 3E1F1 2FEEI 3DX7B 3MV9D 1I85C 1RZKC 3GSRA 5E2VH 3IJHA 1ZHKB 4GG6A 3H0TA 2Z9TA 2LE9A 2VB5A 1IAMA 4FTVE 1DL7H 2FX9H 1G9ML 1NEZB 2ADIA 1NCNA 4PJIF 5KANI 4XCFH 5DS8A 4MDIB 4OCYL 3ME0A 2H3NB 1P9MA 4HKJB 3TBWB 3I2CH 2E6PA 4LVHC 4IIQC 3IS0X 3S4SB 5F1OB 5I8CB 1QLFB 1YMHA 2XZZA 3V4UH 3KDMB 4YE4L 2JE8A 2IH1B 2JCCE 2R29L 4HV8B 3MRPB 5D7JA 2MQCA 1FNHA 4LCUA 3BPLB 5EBLA 1KC5L 5CEXB 1QOKA 2VKWA 3FN0L 2R1XA 4F9LA 5JPNB 3MA7A 1GXEA 1V3KA 4E41A 1T1ZB 3WNKA 5IJKA 1TQCC 3S37X 5DUBB 3GI8H 1AQKH 3QI9C 3VI4F 3CDGA 4X6FB 3MBEB 4MDJA 4XNQA 5E2VL 4P3CL 3TA3A 5EU3A 4Z95H 4YHPB 3QI9D 5JHLL 4PV8A 2FEEL 5IEKB 3Q6FB 1PG7W 3MYJA 4WW2C 3GUTA 4HWNA 2GFBA 4GKSA 3WS6A 4HFWB 5IG7A 5ISZB 2XOTA 3EYFB 4GMSH 5LWYL 3HC0B 5KOMC 5GS1B 3OKNA 4MQ7A 4A2MA 3DWTA 3VFVB 1MCIA 4L4VB 1M7IB 4D9QE 1DTUA 3LKNB 3WE6A 1UJTA 2D4DA 5D93B 4H1LH 25C8H 3EIFA 4ZFZB 2HJKB 4NFBA 1A3LL 1BIIB 3MUHL 4LSVH 4M93B 3VWKD 4YXKL 4AJ0A 4BSJA 1WCQA 3O3BA 5JXED 4I3RH 1R5WB 1QSFE 1C7SA 1RJLA 4JPIA 1FFOB 4IEFB 1KGCE 4FXLA 4GW5A 5I71B 4RZCA 3CFDA 4Z7UB 5EOCL 2ADFL 5TF1H 1ETZA 4KZEH 3DI3B 4G7VH 3SKNB 4W68A 4NT6A 2I9TB 1A1NB 4ZO6A 4YGVB 3LPGA 3V5KA 4U1GC 3PE9A 3O2WH 5JTWA 2ATPB 1Y6NR 1U8IA 1KTDA 5T5FH 3DGCR 5L2KA 4BYHA 1GZPA 1FL6B 2OJZH 3F6IA 5GRUL 1XZ0A 3QHZL 3RWEB 4HFUH 4Z7VB 3ZTJH 2XWBA 1UZ6E 4NZRL 3WFDL 3FHQA 3VJ6A 4X6CE 4PJ9B 1FQ9C 2VLKB 5J1AA 1U8KB 3W9DB 1BFTA 2JK5B 5IBLC 1HYSC 4GBXC 1RVFL 2OL3L 4BQCA 1HHHB 1RIHH 1WBZA 2VERN 1RIUH 1MQKH 1AJ7L 5IBLD 4GBXD 4NQEB 5I1EH 4F58L 4Z77A 4E5XA 2F19L 3FB6B 1IGFH 2XA3A 3IDMB 2IAMC 1FAIL 5EU7E 2WWKO 2V2WB 4DGVH 4JN1L 2J6EL 3L9RA 2IAMD 1IAII 3ISWA 3MLSH 3AAZB 4Y2DA 3DURB 4O02H 4K7PY 3ARFC 4M4PA 1QFUH 1NCDH 3B8SA 1D5BB 4QO1A 4R0LA 2DBLH 1A6AB 4NN7B 4ZD3H 4Y1AD 1FN4A 5MP6H 3SCMD 4Y16B 1C8PA 3LN9A 3RDTC 3DX7A 4OT1L 2FWOB 4EOWH 1TDQA 2NZ9C 3DVIA 1ZHKA 1AC6A 3MV01 3RDTD 1KXTB 5EIQA 3PWPE 2J8UB 3SDDD 2IBBA 2X1XR 3QIBC 4KC3B 5GS2D 1NEZA 1MOEA 5F9WC 2W91A 4MDIA 3QIBD 1YC7A 2V2XB 3KHOA 1V05A 4HKJA 3TBWA 3I02B 1IGJA 3P4NB 3S4SA 1KJ3L 3MUJA 1MJ7H 4KHXH 5B3JF 2JJSC 3IGAB 5I8CA 3OPZH 2R0LL 3KDMA 1HHGA 3NPSC 3BDYH 3MLVH 4LKCB 2ZPKH 1G9NL 2IH1A 2WLYA 4RFNC 4HV8A 3MRPA 2GJJA 1F5WA 1OAYH 1B0RA 4D9LH 1X9QA 1KN2H 2JTDA 4I3GA 5CEXA 3QPXH 2WUBL 4AK1A 5AG8A 5JPNA 2QSCL 3OR6B 1IAIL 4JM2B 5J1SC 1T1ZA 2D7NA 5DUBA 5JIKA 1LE9B 3ABZA 4ZNEE 4UINL 4X6FA 1PX4A 5CS7A 4GAYB 1BQLL 3FCTB 4I9WE 4YHPA 3ARXA 3GK8H 4OZGF 4Y4FD 5IEKA 3Q6FA 3VFRB 1WWAX 4A6YB 1MFBH 2UWEB 1BFSA 3HZVB 4HFWA 5ISZA 3HUJB 3EYFA 4UV7H 3HC0A 5GS1A 2MKLC 4HXBH 3CIQA 3PV6B 4UAOC 1TZIB 5I1HL 4WGWB 3AS0A 1NH6A 4L4VA 1M7IA 4G8GD 1YEJH 1A6WH 2NQCA 3Q6GL 4YQXL 3BKMH 4KHXL 2A9MH 3AVEA 4YBHA 3WSQL 1I8MB 4ZFZA 4HWZB 2HJKA 4U33A 4Z6AT 1RPQA 5IV2B 1BIIA 1KTKE 3BH9B 2WINB 1B4JL 3MQIA 5IWLA 1R5WA 1BEYH 5DZNA 2NY5C 5FDWB 1FFOA 1L4IA 4Z7UA 2APWA 5E5RB 2ICEA 3D87B 4J23A 2FATL 2R39A 4N8CL 3SKNA 2I9TA 3OB0H 3QZWG 1A1NA 4YGVA 1BZQK 3TBVB 4NM8H 2ATPA 3SGEI 4QXUH 3G5VB 5D96B 3ULUE 3NCFB 1MCCA 3O2VL 1FL6A 3JV6B 4OLYL 3O9WC 1DSFH 5AYUH 3MLWL 3OKYA 3RWEA 3QFJE 2DKSA 1FO0L 3TO4B 5GRJL 2FCBA 3O9WD 2C7UB 3K2MC 1JZ8A 4KGLA 4PJ9A 2VLKA 1SBBA 4QTIL 1YEJL 2Q6WB 3RKPA 4OSUH 2ZUQB 3V6BR 1U8KA 3W9DA 2JK5A 2Y4SA 4YHOL 4WHCA 4WI6A 2F54D 8FABB 4F7EB 2DLIA 4S1RL 3VFOB 4NQEA 4L8CB 1ZTXH 1KEGH 3FB6A 1SJEB 4LSUH 3U2SB 5F88B 1QVOB 3KPOB 3L5IA 1XCTB 3IDMA 3DRTB 1KELH 5I75C 1DDHB 2Z31D 2V2WA 4UOW1 2NR6C 4WFED 1DQQB 4M62H 1HSBB 3AUVA 4HCRA 3AAZA 3BKCL 3DURA 2NR6D 5DHVB 2A83B 5TDOB 1KV3A 3QHTC 1D5BA 1C5DB 4KROD 4WFHE 1A6AA 4ZNCD 5T1LB 4Y16A 3QWRD 5IVNA 1AY1H 3AU1B 2FWOA 2ZUWA 3QCUL 4LCWE 5EOQL 5HTSA 3V0WH 3TF7C 3SKUD 1DSFL 1XGYL 3NCBB 4L3EE 4KK5D 3VI3F 5HYFA 4BZ2H 5I8OH 4YK4C 5DLMH 1N6QH 3HC4H 2DI9A 3CSPA 3WJLA 5HY9B 4RISH 4LSPH 4M7LT 5JW4N 3X12B 4J3OC 4KQ3L 2V2XA 2XXMB 4HEME 3I02A 4MB3A 3BDBA 3MLZH 3UJJL 1Y6KR 5FUCC 2ZOKB 4JDVB 2OR9L 4K94C 1X5GA 2YMXL 4FABL 2JJTA 3EUUA 5HPMB 2AAVA 2H1PH 5EUOB 3P0VL 3IGAA 3ULUH 4NJAH 5F71A 3M17B 2YR3A 1R3JB 2V5MA 4LKCA 5L0QC 5BV7L 2ZUTA 4M62L 4X6EB 4XCYB 2WP3T 4YUEH 1LK3L 4XHJC 1G7MB 3TGXA 4Y19D 5TQ0L 4JM2A 1JTTA 4NZDA 4L4TB 4XHJD 5FXCH 2AEPL 2DS4A 4L9DA 3U79A 3SJVE 4GAYA 5D6DC 3FCTA 1XIWC 2WBJB 3NN8B 4QHKI 4IS6B 3VFRA 3HC4L 3RU8H 4A6YA 2UWEA 1CD8A 3HZVA 5T1DL 1XIWD 3HUJA 2H6PB 2ZUSA 5J12B 1HWGB 2JCCF 3PV6A 5D70L 1TZIA 1YC8A 4PJFB 4JQVC 3VXTB 3MLZL 4UTBL 3DI2B 4GKOA 5DRZB 4N5UA 4HG4K 5TGBB 4NJAL 4WI5A 4UU9A 2CRZA 3JWOL 1FNEB 4M7LH 1NSNL 1I8MA 3KPLB 3CX5K 1A0QH 3LH2H 1A02N 4GUPB 2P43B 5TFSL 2JLLA 3BH9A 4KY1L 2WINA 3LRSB 4CKVX 4MAYB 3WUZA 5FYKE 3E3QC 4QRSB 3GSWB 4HXAL 2V9QA 1QFWM 5FDWA 5GJTH 1MFAH 1XGTA 3TP4A 3Q1SH 3MCLH 1RZ7H 4OFYD 1NKOA 4HGKC 2W9DL 1K3ZA 4QRQB 1KCRH 2CUIA 4L8SB 4PJBB 3TBVA 3CD4A 2EE9A 3MJGX 3BP7B 4O2EB 3WKNA 3JV6A 5A43C 2GITB 2QEJA 4IOFC 3VXUA 1DQML 2HH0H 5DD5H 1IT9H 2NY0B 3TO4A 2C7UA 2DMBA 4M43H 4FQ2L 4FTVD 4IOFD 3LKPB 1FE8H 1HH9A 1PVHA 4EI6B 2Q6WA 1A47A 2F15A 1YMMA 1TJIH 4NJ9H 4D94A 8FABA 4TUOB 4XWOC 4F7EA 1WWWX 5EPMB 3VFOA 3V7AE 3OJDB 4L8CA 1U8PB 2YPKB 3LIZH 4CRPA 5L8LB 4XWOD 1H3TA 5KJRH 3U2SA 5F88A 3H7BB 2HJFB 3KPOA 1XCTA 3DRTA 4W4OC 3EDDA 3VMPA 2Y36L 2D0GA 4H20H 4ODSL 1DQQA 4FFYH 1HSBA 5MEQB 5GRYA 3ULVE 4LFHG 3O2DA 5DHVA 2A83A 1NGQL 1UZ6F 4GAJH 3G9VA 1C5DA 4X6CF 3JV5A 1VESA 4HBCH 1VDGA 4NRYB 3HCVB 1S7WB 4LSRL 3AU1A 2W9EL 3GBLA 3OF6A 4IOSD 3EO1B 2KZWA 5FYKH 3T0EE 1MRCL 4JB9L 3R4DA 5EZLA 3ECBB 1B6UA 5BZDB 2FRGP 5E99H 1J1PL 5EO0B 2IQAB 1XR8B 3NIDE 4XBEL 3X12A 5C70A 1WWCA 4BQ9A 3FO0L 2NY7L 1S9XB 4MXQC 5DWUL 3VD9A 3BP4B 4WI7A 2ZOKA 4JDVA 4JO1L 3RWFB 2A38A 2GQHA 5HPMA 3SDCD 3WHXB 1K6QH 1OP3H 5EUOA 4D9QD 3GEWB 2C4FU 5J11B 3M17A 5C08A 4DWHA 1R3JA 1NGZB 1JZ2A 5HDBE 4JRXB 5JW4M 3PWVB 4NZTH 1OW0C 3NCEB 1Q1JH 4X6EA 2YOCA 4XCYA 3SE8L 2ZSVA 2H32B 4ZUVB 2NPLX 4S1SL 1S7TB 3HAEB 1ZLWH 1QSFD 1G7MA 4AT6B 3GBML 4FNLL 1KGCD 1HDMB 2UY6A 2D7MA 1Y0LA 4L4TA 4GFTB 1JZ7A 3S36L 4OCSL 1XH3B 3QH3B 2Y6SC 4DGIL 2L4OA 3S9DB 4HG4J 3VDBA 2Q20A 3WD5L 3NGBB 4WEUD 4XZUB 4I0PB 2WBJA 3NN8A 1QLRB 4PP2B 3CX5J 3GSNB 4IS6A 4OLZH 5CD3A 3DO7A 4P2RB 1DVFC 1I9IH 4CJ0A 1AXTL 3ULVH 2H6PA 3BT2H 1EO5A 4HIHB 1GC1H 1OLLA 4M5YH 4PJFA 4CDGC 3VXTA 3O81A 4XRCB 3OZ9H 4HPYH 1Q8MA 5DRZA 1KIUA 2FJFB 2LV4A 1WBXA 3HE7D 1FNEA 2PW1B 2P8LB 1TZGL 3KPLA 3MRIB 5C6PB 4GUPA 2X2YA 3QUML 1HN1A 3DYPA 3LRSA 3JTTB 3MJ7B 4MAYA 3TCLB 4QRSA 2EKJA 5EU7C 4LPCA 5E1AB 5C07E 1ERNA 1U9KA 4M5ZH 4HAGA 2PTUA 4YPGB 1V5JA 4YHIA 2DD8L 3GRWL 4QRPB 4LNRB 2GSGB 4XNUH 4PG9B 3IDJB 3MJ8B 4QRQA 1AD9B 2A2QT 4WO4A 1JN6B 3O0RH 1SYSB 4JFZL 3VGBA 4PJBA 4L9LA 1FZOB 4L1DA 2GTZB 1VFOA 1DR9A 3D0LB 3BP7A 3D85D 4M00A 4O2EA 1O7VA 1NJ9B 1SMOA 4FFZH 2GITA 3AS1A 5TE4H 4FA8A 3MLRL 2KH2B 1L6ZA 4DTGL 3VFWB 4F3FB 3PWPD 2MTPA 1KB5L 4XP4L 1YY8B 5HHVH 5IBTL 3LKPA 4KRMB 4EVNB 5GPRA 4L4JA 4GOSA 2ESVB 4MNQB 1P4LB 1QSVA 3QIWB 1FSKB 4TUOA 4UDTB 1BFVL 2B0SL 2ZP0T 1EO8L 1S5IH 3OJDA 1IC4L 8CGTA 2YPKA 4Z7QE 5C7XH 3ZE2E 3MPCA 4X7EC 1QRNB 3VXSB 4NQTA 1CGSH 3H7BA 2HJFA 1OAKL 2VNCA 1BQSA 4CVUA 3ULUF 3GMRB 1IGCL 5GGTH 5MEQA 3TZVB 3TNMB 3TVMC 4XPGL 2MCPH 3WIHH 2D3VA 3TVMD 4MQTB 3VFMB 4XP1L 5KN5B 1RHHB 4NRYA 4OF6A 3HCVA 1S7WA 4TULH 1NAML 1S7VB 1KUMA 3FKUS 3EO1A 1OPGH 1BM3H 2CIIA 3AY4A 1AXSB 4FQQB 5IUSA 1KYOK 3GBNL 3ECBA 4HJ0C 3BUYB 4CGTA 4MVBC 3QUZC 2WZPD 2IQAA 1XR8A 4F9PC 1YEFL 3OKKB 4Z0BH 15C8L 4HJ0D 5GZOC 4MVBD 1GGCL 3QUZD 4M6MH 1S9XA 1FFPB 5CJOL 3BP4A 5E08L 4V1DE 5KW9L 5GZOD 5HHOE 3BDXA 2K3TA 4WHDA 4Y88A 4LKXB 1JCKA 2HRPH 5HDQL 1G7HB 1QFWI 3EO9L 3RAJL 1NGZA 4UILH 4JRXA 3PWVA 3U9UB 4K55A 5GGTL 1F8TH 3H8NA 2VL4A 5M95B 1MWAH 2JKXA 4PJ5B 4DAGH 2OP4H 4ZUVA 1ZVSB 5C6TH 1S7TA 3HAEA 1FCCA 5FA4A 4L29A 4EN3C 5D9SB 4AT6A 1HDMA 2COQA 1M7XA 1C5BL 4BQ6A 4M8QB 3KPNB 4ZSOE 3B5TA 1Z9OA 4LU5L 1A8JH 5E70A 1XH3A 3QH3A 2EE2A 2WW8A 1G7IA 4ZYKA 2BVQB 4XZUA 5SWSB 4NQDB 3ULUC 1QLRA 3GSNA 3BKJL 4J7RA 4P2RA 2VXSH 3K8MA 3ULUD 4HIHA 3MZGB 1MJ8L 1O5DT 2VDQL 5D1ZC 3QFJD 3BZ4B 4X9BA 2D7TH 4OZHF 4XRCA 2LU4A 3DUUB 4LP5A 3WFHB 5C86A 5D1ZD 5JOEA 1YEIH 1LEGB 2FJFA 4LNVA 1H15B 3S3PA 5HPOA 2AQ1A 3LCYA 2PW1A 5EZIH 2P8LA 2DLTA 1NEZG 3MRIA 1FBIL 2JIXB 1WZMA 2X1WL 3JTTA 3MJ7A 3V52L 1QSEB 3CSBA 4FQLH 3TCLA 3L3OB 3KJ4B 2A9NL 5E1AA 1A1OB 1JPGA 2FHBA 3IXTB 4YPGA 1FO0B 4GW4B 4J3TA 2NX5E 4QRPA 4LNRA 4APQB 3S4SG 1PLGL 4KTYA 2GSGA 1P69B 3IDJA 1MJUH 3JWNC 4JPKL 3MJ8A 4MJ2A 4NQCB 1AD9A 2EEAA 4JEGB 4EBQL 1JN6A 2V5YA 5FYJL 1PW3A 3KYMB 4WFHD 1FZOA 5KSAD 1YEKH 3D0LA 3MUY1 3OAUH 5E2WH 2H9GB 1NJ9A 1LILA 4LCCB 2DQHH 1V3LA 4LPUA 4LCWD 4RGMB 4L3ED 4JFDE 3VFWA 4F3FA 4LSQL 1YY8A 2XA8L 4JFFB 1P84J 2AJXL 35C8H 4CVXB 2AK1H 4EVNA 1PG7H 3FFCB 1H9VA 5GHWH 3OB8A 5I18L 2ESVA 3BH8B 4MNQA 3MJ9L 2Z4QB 1P4LA 3QIWA 2BRRL 1MRFH 4H26B 5F6HJ 2B39A 3D2UB 3NACL 3ARYA 4G42B 1LP9B 3HMXA 4PYGA 3UPCA 1BQHB 4WW1B 2VZ3A 3VXSA 1EEUA 1YEGH 4ODTL 4LRIA 5J57B 3KPMB 2AEIT 3ZYZA 3QEGH 1LD9B 1NLBH 1KYOJ 2YPLE 3GMRA 3MRGB 1FFNB 4I4WB 3TZVA 5FF6A 3TNMA 2BVUA 2NY1B 3FAXA 1T1YB 3U48A 5IQ7L 3S7GA 1AR1C 2AJYH 1ZT1B 1D6VH 1JPSH 4JREC 2MQ3A 3MRBB 4AYFA 3VFMA 5KN5A 1RHHA 4G8IB 1E0OB 1AR1D 4S2SB 5EC2B 3QUYB 1S7VA 3QXVA 3L95B 4Y5VC 2DM2A 1A14L 2C1OB 4WV1C 2DQHL 1I3UA 2EEDA 5F1KC 4CVZB 1AXSA 4FQQA 3SJVD 3ZHKA 3FOLB 5BV7B 4F37F 3BUYA 5E7BA 4ODBD 2AK1L 1FYTB 1RURL 3OKKA 3FO9A 4GQ9L 5KBNC 1DBML 1GOGA 1FFPA 4LVEA 1YPZE 2VR5A 4OTXH 2PO6C 5GJSH 2HMIC 3ESVF 1HI6B 4JFPB 1KFAL 2Q3ZA 4LKXA 4X4MA 1RIVL 1YEGL 2PO6D 4X7FC 4D0CB 4Q9CA 1SVCP 2HMID 3QULB 4QLRA 1HZHH 3U9UA 4NZUL 1U58B 3EOYG 4PJ5A 2YD6A 5D2LB 2OTWB 2W65B 5FYKD 1ZVSA 4PJDE 43CAB 2W0PA 4LSSH 1UT9A 3NIDF 4MJIB 3IKCB 4YHKL 3ARGD 4M8QA 5FECA 3KPNA 4FZEH 5F96L 5L7XL 5DMJB 2D0FA 4XVSH 2CKNA 2OI9B 3MRRB 3NIFE 4I13B 3ZDZE 4L5FL 1P4BH 4PB0L 2BVQA 5SWSA 3BRGC 2YD3A 2CO7B 4NQDA 4PRIE 3CXDH 2ID5A 3JUYA 4OQTA 4WNQB 4U1NB 3TYFB 2OMNA 4ZO9A 3BZ4A 1IEAB 2R69L 2YPVL 1A6PA 2WQ8A 2E27H 2LU3A 3WFHA 5EZOL 1LEGA 1ORQB 2NY5L 1CICC 3LN5B 3AM8A 3CDCA 2R8SL 1QQDB 4HC1L 3MRHB 5D7KE 2JIXA 5L6YL 3JVGC 1ZLVH 1QSEA 3G5YB 3ALXA 2APFA 3AMKA 1T7YA 3L3OA 2DQIL 2IFFL 3P9LB 1A1OA 3BGMB 3IXTA 4UT6L 5ACZA 3E2HB 4QHLB 2GW5A 3ULVC 3BEWB 4GW4A 1GC1C 4APQA 2AXFB 4ZOAA 1GGTA 2Y5EA 32C2B 2E7CA 3PWLB 4NQCA 5B4MC 4ZOBA 5IBUG 3KYMA 4JHBA 3IAQA 5B4MD 3OKLB 2O5ZL 5FO7A 3EFFB 2H9GA 4LCCA 5SX4I 3T0EC 4XMKL 3W5MA 2IANB 5I15H 4ONFH 1MEXH 2H2SC 5JORB 3T0ED 1OAUL 4MXWL 2A1WH 3PG2A 4CVXA 3FFCA 3HZYB 2H2SD 2I25N 3CU7A 1U92B 4HUUB 3BH8A 4NBXB 2Z4QA 5HBBA 2DBJA 1AC0A 4H26A 5FUOH 2EE6A 3D2UA 4Z7NF 2BNUB 3G6JB 4G42A 2EDLA 3ARDB 1LP9A 1OHQA 1BQHA 1CDYA 4WW1A 5M94B 1NL0L 1YEHL 4ZAKC 3KPMA 3PL6C 1LD9A 2EO1A 3QQ4B 1HQRB 4OFKA 5DHYB 3MRGA 4ZAKD 1FFNA 1HHKB 2YD7A 5BO1H 2R0ZH 1ZA6B 1C5CH 3MRJB 3PL6D 1NBYB 1BD2A 1IM9D 1T1YA 1MAJA 4WENB 1ZT1A 2ZCHH 3Q2CA 3DSNA 4DOHB 2AI0H 4G8IA 4Q6YA 5DR5L 4NQSB 4S2SA 5EC2A 3RZCC 3QUYA 5HGDB 4WWID 2APTA 3L95A 5DQDH 1CE6B 5LBSH 5DMIH 2C1OA 2KQMA 2R4SH 3RZCD 4CVZA 4ONFL 4Z7QF 3ZE2F 1E4XI 3GM0A 4JZNB 3FOLA 2A1WL 3IXAB 5JA9A 1FYTA 1WFOA 1OAZH 3HNVH 3BI9X 2Y07H 4N90E 4OCLC 1QNZL 2HWZH 5CGYD 2DYPB 5B38B 2YD1A 1VFMA 1A64A 2W60B 5DYOB 2AXGB 4M3KB 1HI6A 5CSZB 4JFPA 4OCRH 1HE7A 1NANH 3FB8B 1R3LB 4D0CA 4KQ4H 4TUKH 1RUPH 2R1YB 3CMOH 5ACMA 4X6DA 3O8XC 1E27A 1U58A 5GGSB 5D2LA 4L8BB 5D71L 2OTWA 2VLRB 2W65A 3O8XD 4IMLB 5C07D 43CAA 1TJGH 4BFBD 4GRLB 4MJIA 1CF8H 2AI0L 3G6DL 3IKCA 3O4OB 3MNWB 3MRRA 5JQ6L 3QRFM 1P2CB 3ZT6A 2FJHB 4AEHL 3SPVB 4BK4A 2J88L 4NUGL 2NTFB 3IAGC 3QUMB 5I76A 4F80A 1WAAA 2FX7H 2X1QA 3N06B 5JXAL 4QYOA 4K8RL 1OAZL 1WSST 4WNQA 4U1NA 4XPBH 1UC6A 3W0WB 2P47B 3IRPX 1E4XL 1T80A 3SE3C 1IEAA 3GJFB 5FHBH 1YN6B 2QADB 2VQTA 1ORQA 3DGGB 5I1CL 4OCRL 1L7TH 3LN5A 4KUZH 4XC1H 2FIRT 4PJCB 4YDKH 2BFVL 1QQDA 4OGAC 3MRHA 2AABH 1SJXA 2EE3A 3L5XL 2ZCKH 3G5YA 4OGAD 3P9LA 3BGMA 1CBVH 4YEEA 1K4DB 3U9PH 3W5NA 3V4PH 4ELME 2DQTL 3U0TB 3BEWA 2BSSB 1KB5B 3ORJA 4ENEC 2AXFA 5DJYA 1RULL 1UGNA 32C2A 3PWLA 4ENED 1N4XL 1QBLH 3QUXB 1FLRH 5CHNB 1IQWL 4NKDB 3RVWC 5JDSB 4KVCL 3OKLA 3OTTA 5E5UB 3EFFA 3KPPB 5B3NA 5JNYB 4NOBA 5C71A 3RVWD 1NQBA 1YJDL 3L7EB 4PRPE 3GO1L 2IANA 3ZLQC 4P3DB 1RK0B 3LQAL 5JORA 4PJAB 1QEWB 3MV9B 2VDNH 4MA3B 1DBAH 2N4IA 1NGYB 3HZYA 3O6FC 2GIYA 3S88H 2QHRL 1U92A 3EGSB 2O5XH 4HUUA 4DN3L 1J0JA 1SVZA 2OXHA 3PGDB 4R26H 4RRPG 2BNUA 4WEMB 3G6JA 3NZHH 4MLSA 4V1DD 2XQYG 1NAMB 3ARDA 1WCBB 2VYRE 3O3AB 1UWEH 5HHOD 2EDJA 4P46C 1Q9LB 1AE6H 1MREH 1EIBA 4LVHB 1EA9C 2ITDA 3QQ4A 1HQRA 5I74C 3U83A 5DHYA 1ZKAA 1HHKA 1WT5C 1J1XH 4IIQB 4BZ1H 4ZTOH 4P4KD 1ZA6A 3TPUA 2Z92B 3MRJA 1BVKB 2VXUH 5EU5A 1NC4A 3ZHDA 4Z7WB 2I60L 1FCGA 5CJQH 3GNMH 4NQSA 3HFMH 4NO5B 5GGRY 1CE6A 4RDQF 5DTFB 1OP3K 5IFAL 4XBGB 3BMVA 1RZFL 3RA7H 4NGHH 4ODHH 5AG9A 1TQCB 3IXAA 4Z0XB 3INUH 1YMME 2YBRB 5JOPE 3QI9B 5F9OL 2NY4C 3RNQA 2DYPA 5DEZA 1P7QD 5B38A 4G6MH 4XMPL 2W60A 2NY4D 2QQLL 3HI5L 2AXGA 4LLDB 4WW2B 1WZKA 4FQXC 4HUKB 5CSZA 4OV5A 2VZTA 5M7QA 1IKFH 2X4SB 4NRZA 3FB8A 5E00B 1R3LA 1KLUB 2AW2A 3RNKB 5KVEL 4LASH 2R1YA 1ZHBB 1OGAE 5C09E 4F7TB 5GGSA 4L8BA 1MFCH 2VLRA 3CPLB 4WTZG 4XXCC 3MLPA 3GMQB 2J5LC 4IMLA 3CDYA 3VWKB 4RWHA 3OAYH 4GRLA 2NX5D 4UNTA 4LIQH 3MNWA 2F5AL 4PJIB 5LVEA 2HT2C 1DZBA 3HZKB 4H8WH 1P2CA 1YPZF 1A5FL 1XF2B 2FJHA 5FUZH 5D7IE 3SPVA 2HT2D 5CP7B 3RA7L 2NTFA 1H3UA 4R96B 3DARA 1FP5A 1U8OB 1WZ1H 1DN0B 3W0WA 3LKSB 5DQJB 3PUCA 3WXWL 3GJFA 4JFDD 1XAUA 4Q2ZB 4U1GB 5LCVH 4G6ML 4WRLA 3PDDA 1YN6A 3THMH 3DGGA 2FIKB 3REVB 1S78C 2ZJSH 4P5MB 4KKAC 3BVNB 1IKFL 1DQDH 4PJCA 4L3AA 4LSDA 5ANME 3SGJC 1S78D 3NIFF 1BBDL 3ZDZF 4IRJC 4KKAD 2IBZY 2ZSWB 3IJSB 4LPTA 3GSXB 3DBXB 1KIQB 4GBXB 4IRJD 4AG4H 1K4DA 5EO1B 4TYUA 5E2JA 3U0TA 4KXZI 2BSSA 3CLEL 5EN2B 4PBXA 2YPLD 1YQVH 3O6KH 4X99B 4PY8J 4P2QE 5ALCL 3BPOC 5DUMH 2XZAL 2IAMB 2ICWB 1FRGL 5J8OA 3QUXA 1F58H 2Y5TB 5CHNA 4N1HB 4NKDA 5JDSA 1I9EA 3ZKMC 3KPPA 1H3PH 4HIIB 3HAEG 5JNYA 3VXME 4Y1AB 3L7EA 1JE6A 3SCMB 3K8KA 4FRWA 4XX1E 1ZVYA 3ZKMD 4P3DA 1HK6A 1RK0A 3MV9A 3NVQA 4MA3A 3F12B 3JWDH 5LCVL 3IT8D 3SQOL 1NGYA 3ARUA 3CK0L 2FD6L 3RDTB 5BW7C 3EGSA 5IEHB 1E6OH 1I85A 3ARPA 3SDDB 2ZJSL 3PHQB 1OP5K 3PGDA 4FHBD 3QIBB 1JMXA 1NAMA 1WCBA 2B2XL 3O3AA 1EERB 3IDXL 1VGKB 5F9WB 3U1SL 1Q9LA 2OBGA 1FC1A 2ZUVA 2NXYC 4NYLA 3SDYL 3T0XA 4IIQA 5AZEH 2NXYD 4RFEA 2E5EA 2Z92A 1FGNH 1BVKA 5BOZG 4YFEA 5C3LD 4Z7WA 1KN4H 3VDCA 4Q9BA 1J0IA 3NPSB 1MCKA 2VZSA 3MRKB 5F7UA 4RFNB 1JHKH 3BSZH 4MAUH 4NO5A 1H3PL 2RBLA 5JZ7D 5IKCB 1CDIA 5L2JB 3P11L 5DTFA 3PWNB 3FO1B 4N0CD 5I17B 2BJMH 4XBGA 4OZFB 3S97C 4AIOA 1PYWA 4PRID 2XZQL 4RWYL 2EC9U 4Z0XA 2YBRA 3QI9A 1T21B 1KBGH 4Y4FB 3T0BA 4JHWH 4X4YB 2MNUA 4CN4A 3MODL 3NH7H 4TVSa 4NUJB 1OCWH 1W0YT 2EZ0D 1I9JL 4LLDA 4WW2A 1MHPL 1VPOH 2OZ4H 5LAXB 4PRNB 4QRRE 4L8DB 2X4SA 5E00A 4G8GB 1KLUA 4UAOB 1EEQA 2Z8SA 4XNYH 3RNKA 1GL4B 4OFVA 4PTUB 4KTDH 1ZHBA 4OGYH 4LAQH 4HK0B 4QHUB 1YYMH 4WEBL 5D7KD 4F7TA 4MB5A 3TBTB 3AROA 3GMQA 1T5XB 1HNFA 4N5EC 3EDKA 4FQ1L 3VWKA 5GRZA 1ND0B 2DB8A 5JXEA 2GK0B 3LY6A 1KJVB 4N5ED 1JHKL 3UO1L 4HUVB 4PJIA 1VGEH 3HZKA 4K3DL 5D72L 4D3CH 2E9WA 1XF2A 4UB0L 4V2BA 2BJML 2ZCLH 5CP7A 1G6RH 1RSFA 1UM4H 3T4AB 5FYLL 3V2AR 4Q97A 4KVNH 4R96A 2P24B 1U8OA 1L7IL 4EUPB 5GIRB 1DN0A 4OZ4B 3LKSA 3QHFH 4MCZB 5DQJA 1ZHNB 4PB9L 4OIIH 4Q2ZA 4U0RC 1G0DA 1EMTL 4O00A 1INDH 2Z93B 3U7YH 1A7QH 3U7WH 1CLYH 2FIKA 3O9WB 2ED8A 3ARTA 4PJGA 3REVA 4U7SA 4P5MA 3BVNA 1ZWIB 1OT1A 1SM3L 4OD1L 3F7VA 5F7HA 2ERJC 3IJSA 2ZSWA 5HHXH 5DHXB 2F54B 4JG1L 3QFDB 3MC0A 3GSXA 3DBXA 3EDEA 1K5NB 4GBXA 5JIHA 5EO1A 3HC3L 5EBGA 2IEPA 2B4CL 5EN2A 2UY7A 4OZGB 4ODWB 1J86A 3B83A 2EH7L 2Z31B 4N9GB 3RY4A 4OFIA 1F90L 1WF5A 2IAMA 2ICWA 4E42B 4JZJB 5I75B 2Y5TA 2ZCLL 1G6RL 1PFCA 1RUAH 1AFVH 5CCKH 4KVNL 4KROB 5LXGL 4HIIA 3WDIA 1AO7E 2HVKB 3ARFA 4Y1AA 4ZUTB 2CRIA 1KCSH 1AGCA 2KKQA 4X5LA 2XACC 3F12A 1XR9B 1BAFH 3A6BH 3VRLE 5TE6L 5INDA 3RDTA 5T33L 1FDLH 3CJJA 1EHLL 2XKSA 5IEHA 1CIDA 4ELMF 1AIFB 3SDDA 1WEJH 5EWIH 3CVIH 3PHQA 4QGYA 1IC5L 1R24B 4F7PB 4TSCL 2DKUA 4N90D 3LPWA 2MPAL 4MNGB 4YK4B 3QIBA 1A7NH 1PSKH 1GAFL 1TJHH 5CIPH 4NQXB 5IVOA 1T04A 5E56A 2A0LC 4XVJH 1T03H 3OWEA 1VGKA 4QT5B 3HNTL 1WIOA 3G6AB 1IFHH 3GSVB 1I1AC 3Q5TA 2DRUA 4P9MH 1MSPA 1FGVL 1I1AD 2QSQA 2ILLA 4M6OL 3B9AA 1S7XB 5CILH 4U3XA 2OQJB 3QNZB 1Q9KB 1MVFA 4UI2A 5L0QB 4PG2C 4KUCF 1KB9J 3QEHA 4GMTL 4EDWH 4Y19B 5IKCA 4Z9KB 3SDXE 1F4HA 5L2JA 4M7KH 3PWNA 3FO1A 4DZBB 5I17A 4OZFA 2HT4D 6FABH 2VXTL 4MJ5B 2EKSB 2ORBL 5F7FA 3SE9L 4Y4FA 5DUPH 1WEJL 5EWIL 4HQQH 3CVIL 4XVTL 1WFUA 4X4YA 1YUHB 1XIWB 4HWBA 1RMFH 4JFYA 3SY0B 2EYSA 4HPOL 2OMBA 1FIEA 1NGPH 4NUJA 3VFNB 1ZHLB 4MQXC 4LLQB 4PRNA 1P5UA 4L8DA 2CRYA 4U6XA 4G8GA 1S9YB 3ROOB 3NTCL 5I1IH 1A4KB 4PTUA 2WSKA 2YD8A 4HK0A 4QHUA 5KSVB 2XKUA 2R9HC 4QTHB 4KJQD 1Q0XH 4LVOC 3I6LE 3TBTA 4C55A 4IOIB 4GRWH 5IMKB 1XCQB 1T5XA 1QHOA 5KOVC 2R9HD 4XNXL 3RBSA 1ND0A 2GK0A 3PGCB 1KJVA 1RUMH 3CSYB 4HUVA 1TVDA 4PGJA 1VFBB 1NGWB 1REIA 1HKLL 1WIPA 4M7KL 4DQOH 1INQB 1W8NA 1EAJA 3T4AA 3WUWB 1I7ZB 3MV7E 1U8LB 2BMKB 2P24A 3PP4L 4HLZG 3B9KC 5CINL 2VZVA 4EUPA 5GIRA 1UJ3C 4OZ4A 3QB7C 4MCZA 3QP3A 4PRPD 1ZHNA 5JR1H 3OSKA 4LMQE 4UBDC 2E9JA 3B9KD 3KPRE 1JZ3A 4U05A 1A6UL 2Z93A 4C57C 4H1LB 3BIAX 2NY2C 4UBDD 4MA7H 3S37L 3OJ2C 4NZJA 3C2AH 3O9WA 4FTVB 3DTXB 2GSIB 1ZWIA 1CK0L 2NY2D 4JHAH 1A9EB 4H8WC 4HIEB 3T2QA 3BGAA 2F58H 2F54A 3QFDA 5D7IF 1K5NA 3T04D 3N85H 1RY7B 4OZGA 3W81A 3WLBB 4ODWA 4LLYB 1HKFA 1A6ZB 3KG5A 2Z31A 4N9GA 4YHMH 4QOKE 4E42A 2JCCB 4KI5E 2AGJL 4JZJA 1OAXL 4X4XB 4U1JB 1UM6L 2P49B 4PS4L 5GGVH 5LGHL 4F7MB 3TPKA 3I50L 3VXUD 4BA8A 2HVKA 1ZANL 4ZUTA 3QQNA 1ZLSL 3MA9H 3QWRA 3FFDB 5JR1L 5LGJB 1EO7A 4J4PC 5IHUH 4OFDA 1R3IL 1XR9A 5GSRB 3BPNB 1QLEH 5E4EC 4J4PD 4P2OC 1YMMD 5JOPD 3L3DB 4F7PA 1R24A 3U30C 3IU3B 2BHUA 4JHAL 4P2OD 3UC0H 3SEPA 4MNGA 2VDKH 4MZ2A 5FYKU 4AMKL 1JGDB 4NQXA 4HS8H 2XWTB 2FEDC 2F58L 2FGZA 1TQBC 3G6AA 3GSVA 2FEDD 3ALPA 3SDCB 3MFFA 4U31A 3E6FB 1OGAD 4KPHL 5C09D 5MEPB 1K9TA 3JWDC 2OR7A 4IRZL 1CD9B 1S7XA 3D25B 2OQJA 1OM3L 5J0BA 3QNZA 1SEQL 3KPSA 3PABB 2SEBB 1Q9KA 3TV3L 2DDQH 1DBBH 1CLCA 2B5IC 2IADB 1QSFB 2FDBP 5CEYB 1IE5A 1GYAA 4YDIH 3H42H 4KHTH 1U8NA 3A6CH 4DZBA 5D5ME 2FBJH 1LO3H 1EVUA 3MA9L 4M1GH 4U1SB 3X3GL 2XZCH 5EUKA 3U0WL 1N0XH 2A6IB 3CFKB 5E2TL 3V4VL 1QLEL 4XGZA 3LEVH 4MJ5A 2EKSA 3QO0B 3STZB 3OMZA 1YUHA 3LOWA 3VFGH 5D6DA 1LWRA 1XIWA 3VD7A 3SY0A 4OLVH 4PJBF 2MHAB 3VFNA 1ZHLA 4M4RA 4LLQA 5C08D 1IEHA 2GY7B 3ROOA 4X6CB 1O0VA 2F9BT 4JQVA 1A4KA 1MCRA 2CR6A 4HUMB 1TNNA 1CTNA 3UBXI 4M7ZC 1QBBA 3HE7B 1IZKA 4QTHA 3NOIA 4IOIA 5IMKA 1XCQA 5SX5K 3KYKL 1PKQE 2DLFL 1D5IH 4W6XB 3PGCA 4PV9B 4GXVH 1IVLA 3CSYA 2DMKA 2AJZB 1VFBA 1NGWA 4MA8H 1XFPA 2PTVA 4P2QD 4MA1C 4OFYA 2J4WH 1LO3L 1INQA 5LJYH 1U6AL 3WUWA 4DKDC 2DQGL 1I7ZA 1L9MA 2WBWB 1U8LA 1ZAGA 2BMKA 3EYUH 4TRPL 1ODAA 2IPKB 2VH5L 3CVHL 3RGVC 3VXMD 2V6HA 3D85B 1U41A 4X9GA 3RGVD 4H1LA 4RGOH 5CP3H 4XCCL 1JGEB 4DJMA 3NABH 3PWPB 1CZ8L 4FTVA 3DTXA 2EDRA 2GSIA 4YR6B 4YHZH 1CFSB 4X6DE 1A9EA 4P59L 4HIEA 2C9AA 3E6HA 3ZT7A 3VXRE 1EFQA 3A67H 4ORGB 4NP4H 3FB5B 5TDNB 1XGPB 2ZNWA 3WLBA 4LLYA 1NMCC 1A6ZA 4WO4D 5HD8C 2BXYA 2JCCA 4EZMA 1J12A 4M9OA 4W4OA 4X4XA 3CXHK 4U1JA 3WN5C 2C4FT 5HD8D 3RWJB 4FZ8L 4DZ8B 1BVZA 4JJHA 4F7MA 4XPHH 3HI6H 3TVMB 3H9YA 3IFPB 3FFDA 3MV8E 3VW3L 5LGJA 4OD3H 3B2VL 4Y4HC 1IC7L 1JNLL 1U42A 5GSRA 2YRZA 3W2DL 3I6KB 1DLFL 1M4KA 4LPVA 1M71B 1FNGB 3OAZK 4Y4HD 3HI1A 3L3DA 5DD3H 1N64H 3FMGH 2HLAA 5EU4B 4YHZL 2FECI 3P30H 3IU3A 1VCAA 2AJVH 2WAHA 4HSQA 3QEUB 1JGDA 1J87A 2JB5H 4DGYL 3QUZB 3FRPA 4OCXH 3UP1A 2X41A 3LS4L 4QRRD 5FGRA 4QXGH 1MVUB 2LTQC 2HFTA 3QXUA 2CPCA 2GJ6E 4OFPA 2NY6D 5L9DH 3E6FA 2PKDA 4K7FB 2R2BB 4AM0A 2AS5M 5MEPA 1WWBX 5JUEL 4HT1H 3D25A 4ZOEA 4PGEB 1UEMA 4NKIH 4UT7H 4R4NC 3BFOA 4MXVE 3K46A 3PABA 3VRLF 2SEBA 5TF0A 1OT2A 1A7PL 1NMBL 1OW0A 1QSFA 2IADA 5CEYA 3S5LB 1T7ZA 3BXNB 1JHTB 1JGLH 3CNKA 3RHWF 1ZEAL 4JY6A 4U1SA 4DFIA 2CGRL 2ARJB 2QQKH 1CQYA 2A6IA 3CFKA 4PYHA 5TDPB 5KG9B 4OF8A 4OM1H 5FO8B 2F53E 3QO0A 4CU8A 1H8SA 1OTUC 2Q7YB 3T0VA 2DIJA 3T2NH 3AS3A 5F7DB 3STZA 4D0BB 1PDKA 3RIFF 1OTUD 4OGXL 1RZGB 2KQNA 2DKMA 1DVFA 3QFJB 3TT3H 4YC2C 5D1ZB 4X6CA 5SWZE 3FJTA 3EOBB 3SDXF 2DQJH 3RY6C 4EQ3A 1PX3A 3CH1A 4R97B 4LLUB 3OKDB 4I3SH 5DVMA 4N1CA 4XAWH 2XPGB 4O5LH 3WIFB 3EOAB 2EXWC 1JZ4A 5HGBB 4ERSL 4PV9A 1WVZA 3SOBH 2EXWD 4CMHC 4QNPE 2BSTB 2PCPB 3F7YA 2NMSA 5DEGB 2ZUUA 3TO2B 3N1MC 1CTOA 3F6LA 2CXKA 2Q8AL 4UIKL 4K7PX 2IPKA 4N68A 4B53A 1AO7D 3T0DA 5KSAB 1ZT4B 4HS6B 3D85A 1R0AH 1N3NB 4OCNC 3O41B 2ATKB 1FFQA 5DJ0B 4LCWB 4TVPL 3WKML 1JGEA 4L3EB 4U0QB 5D7SH 1RZ8A 3DX8B 3PWPA 3SGKC 4YR6A 5DA0B 2DL9A 1CFSA 4DW2L 4JKLA 4Q7DA 4J1UB 4I8DA 1PEZA 1FH5H 3MLUH 1SY6L 5EBMB 3L3GB 4I3SL 1Q0YL 3FB5A 3MBXH 5TDNA 1MFNA 5ENWB 3LVEA 3SBWC 1XGPA 1FL5B 5IB2B 4MZ3A 5DD0H 5IR1B 4Y5XC 3ZKXC 3VXOB 5J7CC 1PD6A 5I1DB 3EFDL 1OTSC 4P5TD 3S34H 1X5ZA 5I30L 2M2DA 4OZHB 3RWJA 4DZ8A 3M8OH 3T3PF 1IGMH 3TVMA 2X1PA 4TSAL 1MCPL 3DETC 3D1MC 5HVFB 4JREB 5FCUH 5IB3B 2C4XA 3HTLX 2KDGA 1R0AL 1FVCB 3DETD 1Q94B 4ZNEA 3QG7L 2YA1A 3I6KA 3C60C 1DBKH 1I4FA 1WZLA 2YKLL 4Y5VB 1M71A 1FNGA 3H3PH 3SJVB 5IGXH 4BK5A 5IOPB 2VLLA 1RFDL 3D3VE 4WV1B 3C60D 5TE7H 2R2HB 1D7FA 4YBLC 5MHSE 4Y8DC 3QEUA 3QUZA 2X10A 4KI5F 2JELH 4F9PA 3IDNB 5BVPH 4G8EB 4F15C 2BY1A 5DD0L 1WIUA 2PO6B 4J2XA 4K7FA 2R2BA 1CR9H 2DM3A 4YWGH 4TNWF 3I3DA 4AEIL 3WO3B 2PXYC 3I6LD 4OJFH 4PGEA 3TJHC 1J0HA 2VDLL 1YNKL 5A1AA 2PXYD 4JN2B 4ZS7H 1QYGL 1MCEA 1TVHB 3S5LA 3K74B 3BXNA 1JHTA 1P4IL 4XCEB 1M7DB 2D7OA 3R1GL 3ARGB 3EJZC 5IVZB 4EN3A 2YS4A 4YDVB 1CL7H 2ARJA 3L3KB 2VIRB 3JUZA 4YGAB 3KPQB 2DM4A 3EJZD 1WISA 2MWCA 3MV7D 5TDPA 3RWHB 5KG9A 3CFCH 4S1DC 4L3CB 3RWIB 4AL8H 5FO8A 2YD2A 1AR2A 2Q7YA 1UM5H 5F7DA 4D0BA 2J8UE 3PHSA 5CBAB 5IROC 4WI3A 3KPRD 2UZYB 4F33B 2H8PB 1RZGA 1FV1B 1NBVL 2G60H 2JELL 3PWJB 3NZ8B 1JK8B 4JFOB 5D1ZA 1C08B 3FT2B 5E6IC 3I84A 4JY5L 4F57L 3PDGA 4R90L 4WVRA 4PJEE 3S8WA 1ACYH 5D5MF 3K2UL 1JIBA 2OS7A 4LLUA 4U6VL 2LAAA 3OKDA 3BKYH 4MLIA 2VC2L 1BJ1J 3NPZB 4JRYE 4LFHD 5CWSB 4AENA 4LSTH 3MLXL 4LRNL 3WIFA 3EOAA 3H3KA 1BOYA 4WUUE 5HGBA 5D6CB 4TQEH 5IFJB 4LOUD 3FONB 2BSTA 2PCPA 5JW4Q 1TIUA 4QOKD 2J3SA 3V7MA 4KI5D 3TO2A 5AD0B 3UAJC 1CL7L 3GKWL 4G6AD 5F7EL 1TETH 4DVRL 3C08L 1U8MB 3D5OF 1JGUH 1IGTB 5FM5M 3UAJD 2HKFH 1UQSB 4JM4H 1K2DA 2P5EE 5KSAA 1X5LA 1ZT4A 1A6VH 4HS6A 3BD5A 1FNSL 1X3DA 1N3NA 1JGVH 3ARBC 3O41A 3BHBB 2ATKA 2I07B 5DJ0A 4LCWA 1FPTH 5FGBC 3ARQA 3QDAA 2BY2A 4L3EA 2AERT 3ARBD 3T0EB 4IDJL 2G60L 4G80B 3DX8A 4HCRH 3VA2C 4OZFG 2BVYA 4WHYG 4ODXB 3OR7B 3JTSB 2HFFB 4J1UA 4Q9RH 1ZOXA 2VDMH 1DCLA 4UDUB 3L3GA 4JPVH 1W8OA 2ZG3A 5DURD 5ENWA 3UJIL 3GHEH 1FL5A 3E8UH 5IR1A 4O9HL 3D9AL 1CIUA 2BSED 4JO3L 3VXOA 1J8HE 3NCJL 2CUMA 3WNPA 5I1DA 4ZAKB 4Y4KC 5AZ2H 2AEQL 3PL6B 3VMOA 3L3JB 1IM9B 3OG4B 2CLRA 2XN9E 4Y4KD 1H5BC 4X6DF 5F7NC 5C0GB 3WFBL 2V2TB 2EDYA 5IMLB 5IB3A 1JZ5A 2BP3A 4ONGL 1F97A 4KU1A 1FVCA 1Q94A 4PLKC 3CX2A 4U3CA 5F70A 3RZCB 4Y5VA 5IOPA 2CIKB 2Y23A 3BZFB 4WV1A 3T77B 1HXMB 1DFBL 2R2HA 4WCYH 5C2BH 5F9DC 4NIKB 1UKQA 3UXFA 2R2CA 4XB8A 1JNJA 4J6RH 5T3ZL 2AJSL 1UA6L 4EUPG 1P9MC 4TPRL 2UZIL 5F1NB 3RPKA 3IDNA 1YEEH 3BMWA 4G8EA 2B1AH 2BVPB 3BAEH 4N1EA 1YDPB 3EO0B 1BIHA 4XPFH 12E8L 2VLJE 1NAKH 1BD2D 2PO6A 3BN9C 2AEWA 2XV6B 5KVGH 1UYWH 1WTGT 3X13B 3WDJA 2P8PB 1EX0A 2YXMA 3NA4A 4ZOCA 5FA3B 1MLCB 2YK1L 4PBWD 1YNTB 4LARH 4JN2A 4LQFH 3O8XB 4M6NH 4X80L 5C07B 2X4NB 5CMAB 3AC0A 4XCEA 5CUSH 1IGIL 1M7DA 5IVZA 3ARGA 5IJKC 4YDVA 5IESL 2GK2A 1SBSL 3L3KA 2VIRA 1YZZA 5T1MB 3KPQA 3UJTH 3X11B 3BIKB 4KZDH 3RWHA 4NWUH 2WWKT 1JNNL 3FQRB 4L3CA 3RWIA 5DJ6B 2CSPA 5C2BL 4PD4J 3IDIB 5CBAA 1F42A 1V7MH 1T1WB 5EB9A 1BGXH 2H8PA 3MOAL 1FV1A 3QDHA 4MXVF 5DC0A 2VUOA 3HR6A 3PWJA 3NZ8A 3TN0C 3KWWB 3STBA 1JK8A 2B1AL 4JFOA 3RHWK 3BAEL 5ITFB 4XPFL 4GAGH 1MHCB 3TN0D 4K3EH 1CLZL 2VSCA 3PP3K 3TJEH 3BPCB 4ODVL 3VXRD 4A6YL 5CWSA 1XGUB 5F44A 5JA8B 2AQ2A 5D1QD 5D6CA 5CEZE 2C3GA 3OKOB 1CFTB 1E6JH 3RIFK 5I66A 1BJ1H 3FONA 1ADQH 1CFVL 5CUSL 2PR4H 3TH2T 4BM7A 5T3XE 5AD0A 5GS0C 3G08B 3FQXB 1U8MA 5DD1L 4C59B 1IGTA 4NWUL 5GS0D 4XP9H 1UQSA 5L8KB 3EZJB 3BP6B 1BZ9B 4M7JH 2XQBL 3P0YH 3L5HA 3BHBA 3UBXB 3MV8D 1ZSDB 2I07A 2E8ZA 3QDGE 3T4YB 4DN4H 1V3MA 1FVDB 2BNQE 5F7MC 3H6JA 3ZL4L 3T0EA 4G80A 5E8DH 1F4WH 1I7RA 2WUCH 5DHVH 4ODXA 4PRAB 5FGSA 3JTSA 2HFFA 4QNPF 3UTTE 4DUVA 1A2YB 5K9JL 1KPVB 2GTWB 1U8HB 4UDUA 2ZKHH 4HKXB 4V1DB 5I1KL 1EEZB 1O7SA 1MAML 1G1YA 4XTRC 4B50A 3H9SE 5HHOB 2E8YA 2IMMA 5IFHH 3U36B 2GJ6D 4XTRD 3KLDA 1XF5B 4PP1D 3NFSL 5ACLA 4ZAKA 2GY5A 2IG2H 5IB1B 4RMQA 4POUB 2VWEC 4P4KB 3PL6A 3L3JA 3NA9H 1IM9A 1GIGH 1QRKA 5FIEA 4PJ8C 3JV0A 4R0LC 5C0GA 1FG2B 5KS9E 5IMLA 4PJ8D 4O4YL 3P0YL 4ZSOB 3RZCA 3AFLA 1AH1A 4G6FD 5CEZH 5ADOH 2CIKA 3BZFA 3T77A 5C0JB 1HXMA 3O2DL 2F53D 5CLTA 3WUWG 4LCYB 5T3XH 1C1EH 4UQ2B 4P49A 1LO0L 1KJ2L 5FK9B 5F1NA 5CKAA 1P7QB 1IJ9A 2BVPA 1YDPA 2NY4B 1EJOH 3EO0A 4DKFH 1EUTA 4O58H 4ZO8A 1QZ1A 3KJ6H 4HW6A 5SWZD 3ZYIA 2DQEH 1X5JA 3EDJA 5EOCJ 1NC4D 5DD6B 3X13A 2P8PA 4RBPK 5CFHA 1HIMH 5FA3A 1MLCA 4YXLL 1YNTA 5E1HB 2RCSH 2CRMA 3F58H 3O8XA 5C07A 4Q6IB 1A7OL 2X4NA 5CMAA 3TYGH 3SKJL 4UZGA 2NX5B 4MS8C 1HOCB 2J5LB 3NIGF 3H9HB 5C0FB 4MDJB 5E8NB 3D6GA 3GIZL 5HHMD 5T1MA 1GHFH 4MS8D 4S1QH 3MBEC 3X11A 5HXMA 3BIKA 1FLTX 3EYSL 4TNWK 1ZS8B 2YXFA 3FQRA 1EDQA 2XNAB 3OKMB 4QXTB 5IG7B 3IDIA 5DI8B 1BBJB 3MROB 5BRZE 4MQ7B 3I3EA 4YXHL 4JFDB 1HHJB 4UV4H 3KWWA 2DTSA 5ITFA 4RQQB 3SE3A 5I16B 1MHCA 3ZMRA 4UNVA 1A3RH 5D93C 3BPCA 4JO2H 5F3BB 3KPSE 1MNUH 3QAZC 1OAQH 5ADPL 1F4YL 3TT1L 1JRHH 1CFQB 3OKOA 4LVNC 1CFTA 4IRJB 2JJUA 4XNZB 2IGFL 2W9LA 3ZTNL 3LEYL 4H25B 3EOTH 4M48H 4PBVC 4DK3A 2YPLB 1X4XA 4NT6B 1KTLB 4G3YH 3G08A 1KPUA 3O6ML 4PJHA 3DUSB 3FQXA 5I8KH 1OLZA 1DE4B 2C1PB 3HNSH 1NUGA 4Z7OE 1M1SA 2DMCA 4IMKC 3BPOB 3LZFH 5GZNC 3BP6A 1BZ9A 4PJEF 3UBXA 4TUJB 1ZSDA 5GZND 3T4YA 3TWCH 1S7SB 1BPVA 1FVDA 1OSPL 3BWAB 1G9MH 5LGKA 1N6VA 4ZFOB 4RA0C 3D3VD 4TOYL 4OCYH 4PRAA 1A7RL 5MHSD 1MCOL 1A2YA 1KPVA 1U8HA 1WBZB 1D9KC 4HKXA 4V1DA 1YPZB 1EEZA 1I9RL 1D9KD 2P5WE 4LHUD 5FHAL 5HHOA 4ALAL 4JPWL 4YE4H 1EFXD 3U36A 5DFWH 1EHAA 1XF5A 4G9FE 4FQJH 5IB1A 3TESA 1KC5H 2NXYB 4X83A 5IT2L 3FN0H 1K8IB 3Q0HA 1WT5A 1ZVHA 3WFEH 2B7DT 3HNSL 4FQIL 4OBRA 4NO0A 1FG2A 3LZFL 4NM4H 3ZDYE 2XT1B 4ZSOA 1ZK9A 4P3CH 3TWCL 5JHLH 4N9OB 4JQIH 5IK3B 2EC8A 5C0JA 4MMZC 4PRIB 2H32H 5MI0C 3QUKB 5LWYH 1MAKA 1FIGL 3HAEH 3HB3C 3ARSA 3AS2A 4ZS6C 3NAAL 2DQCL 4LPYA 4LCYA 2X5PA 4HKBB 1W72L 3QRGH 4UQ2A 4GG8B 3HB3D 5FK9A 1CGTA 1IGJB 4ZS6D 4ZUUB 1P7QA 1TTFA 4Y8AA 1BECA 1NEUA 4PJ7E 3CC5B 4G5ZH 3V79C 1HHGB 4YBQC 2YHGA 4XBPA 1JVKA 1A3LH 1QRNE 5DD6A 4YXKH 4FQJL 1B0RB 4JRYD 4PJGF 1EHXA 2CO6B 2H41A 4ZO7A 1IILE 3MTRA 4WUUD 3DUHA 5EOCH 2ADFH 4Q6IA 3WFEL 3REWB 3ILQC 4XXCA 4HGWA 2NX5A 1HOCA 1IL1B 4NM4L 3TEUA 3ARVA 2CMRL 3H9HA 5C6WH 1Z3GH 5C0FA 5E8NA 3ILQD 3R0NA 4EIZC 1RJYB 4HF5L 1ACZA 1GOHA 4OLUL 4OUOA