5D1ZD

Isdb neat1 bound by clone d4-10
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
230
structure length
230
Chain Sequence
QVQLQESGPGLVKPSETLSLICTVSGGSISSSSYYWGWIRQTPERNLEWIGIIYFSGTTYYNPSLQSRVSMSLDRSTNRFSLRLSSVTAADTAIYYCAKPKSRDRGGPGDDYFGMDVWGQGIMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Y10 Light Chain
publication title Germline-encoded neutralization of a Staphylococcus aureus virulence factor by the human antibody repertoire.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 31
structure length 230
sequence length 230
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d1zD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d1zD01
5J0BA 1I9RL 4X6EB 2VLKD 5HJ3B 4X80H 1U91A 3MV7E 1YMHB 2GJ6D 4YHYC 1PG7L 1D6EA 2XTJD 4BQBA 2P49B 7CGTA 1HSBB 4BH7B 4HUWB 3TA3A 3KPSA 1LK3L 1UEYA 4HMEA 2BRRH 4F37F 1TIUA 1BQUA 4RQQB 1T3FB 2R2EB 2ZNWA 3QO1B 4IMKC 4Y4HC 4O00A 1SVZA 1TTGA 5B3JF 2YPKB 2YD7A 3RX5A 4QNPE 1RVFH 3LN9A 4YBQD 4X4MA 3BKML 4FXGA 4NQVB 1N3NA 3ARYA 4LDEB 1SJHB 2H41A 1FZKB 4POZC 4RAUA 1NAMA 1JZ2A 2AEQH 2YBRA 4PRAA 5D2LE 2PYFA 4AH2A 5IROC 2YSSB 3F8UB 1MEXL 4HUXA 3OQ3B 5KS9A 1OQOA 5F7MC 1NJ9A 2W0FB 4NT6B 5KANI 3CK0H 3VGHA 1AKJB 1OF2B 3D0LB 4FFZL 3MJ8B 3NGBB 4KY1L 4KROC 5C07B 2O61B 5HHNA 3VDCA 5JDJA 4JKPL 5EBLB 1MCFA 3BQUB 2C4FT 1A1MB 1I7TB 5D1ZB 3STLB 4FQXD 3GMMA 2HRPL 2FR4B 2Y06L 5J6HA 1KG0B 1RIHL 1FV1B 3EDDA 5F70A 3HR6A 2FJGB 1B0GA 1EAPB 3BEVB 3ILQD 1RZFH 3N1GC 4XNMB 3RI5K 1T0MB 1RZGA 3PWPA 5FECA 3H9YA 3WFEL 3QH3A 4Y5XC 3KYKH 3L5WA 3VGEA 3HE6D 4IRZL 1UXWA 3P9LB 4JM2F 4R2GD 1IKNA 2BZDA 4GG6B 5E56A 1WK0A 2RCSL 4L4TD 1LWRA 4BSVA 3D39E 3GFUA 1M7IA 2PR4L 3PJSB 5AZEL 1G0XA 5DSCA 5SWZA 5ADOH 5DJDB 1B0WA 3CC5B 3D9AH 1TXKA 3IDGA 5FGBA 5E08L 3AY4C 3CMOH 3O6ML 2VR4A 3CXDL 1BWWA 2EC9U 4MNHA 5IVXE 4OCXL 1DDHB 4GH7B 1NDGA 1KCKA 2EZ0D 1AP2B 3UJIL 4FQLH 3T0BA 2VLMD 2CRYA 4KK9C 4K3EL 4GAFB 1D5MB 2P24A 2EE9A 4HWZA 3TYFA 5EUOE 4L8CA 4BZ2L 5DR5L 1ROWA 1YJDH 4JHAH 4NWUL 5HGHB 4RFEA 1FJ1B 1FGNL 3LVEA 3TZVD 1OP5K 4KJQC 3FZUC 4UTAH 2GCYB 4O58L 5D8JL 4LBEB 3SGDI 4JHWH 2V2XA 5JZ7D 1XCTA 2NLJB 3RVXD 4GRLA 1H15B 4OM0H 3L3IA 3V9FA 1NGPH 2UVFA 4HG4K 3VGGA 1KIQA 1ZAGA 3PDDA 1MHHB 3CPLA 3X12A 3O6FA 5LWYH 5KS9F 2EDOA 4NHUA 2VR5A 3Q1SH 2ZCKH 4X6DA 4LGPB 4KI5D 1FNEA 5T3ZL 2CKBH 1KCRL 1WCBA 3OAZH 4NN7B 2VAAB 5DZOA 1ZANH 4AM0B 5T1LB 5ECJE 1W0YT 2AV7A 5EOCL 5C7XH 4HS6A 4NPYB 4ONFH 1OAZH 1IEBA 1KNOB 1CD9B 2PTVA 1IGFL 1PAMA 1G7LA 5IB3B 4PJIA 4EQ3A 1UZ6E 5L2KA 3X17A 4NGHH 1UWEH 4NKDA 2WBJA 5AWNH 2X4QA 3OXSA 4Q9QL 4AG4L 5FM5M 1ORQA 3BN3B 3MQIA 2Z31B 1JK8B 4UQ3B 3HS0B 5ESQA 4E5XB 2VXQH 1QLFB 1KJ2A 3S88L 3BD5A 4UMGA 2XKNA 1AGBB 3UTTE 1N5AA 1LE9A 1OCWL 1E6JH 4GW4B 3ARFA 3MLVL 3WKMH 5DQDH 4Y8AA 1QA9A 4GKSA 4NQEE 4IOFD 1S7UB 3C5SA 3HPJA 4NUGH 5EU3A 4GW1A 3WIHL 3WFBH 4ONHA 3B9VA 5T5NF 1UYWH 3CFEB 4JJ5B 1YDPA 4JKWA 5I76B 4IM8A 3ULUF 2VUOA 4RFOH 2OS7A 1MRFH 4CVWA 4JG1L 1BM3H 1YY8B 3HPLA 3NFSL 4L8DB 3VXOB 2QJDA 3MMEB 1QYGH 3PXHA 3NOIA 5DUBB 4D9QE 1MFAL 3DUSA 3WFZA 3DMMB 3ET9F 4JRYB 4HV8A 15C8L 1J1PH 4LSUL 4IHOB 1CDJA 3OKYA 1CDHA 3CNKA 3P2TA 4OFVA 2Q76A 2ESVA 4R96B 5C09A 3WUWA 1FBIH 1FNAA 4X9HA 5KSAC 3MTRA 4LLMB 3GMLA 2YMXH 3EO9H 1NLBL 1QG3A 1T21A 4UILL 5F6IB 5HYFA 3MLZH 3H7LA 3T4YA 3I6LD 1E27A 4ODSL 3RUGA 4X7DC 3BIAX 3P40A 1GGBH 1U3HB 1UM5H 4RGMB 5EBMA 5ID1B 2DS4A 5LAXA 2J12B 4Z7UB 4HKJA 2VLLA 2X05A 3OKEA 4TVPL 1X5AA 3F5WB 3KJ4B 4GXUN 3U82B 3LY6A 2HAZA 3D25B 1MCIA 3WNMA 5FO9B 3KPLA 1QD0A 5H37G 1I1AB 2X4SB 1HXMB 1MREL 1INEL 2NY1C 3O4OB 2GTWB 3MRFB 5GJTL 3PABB 4JM2C 4Q0XH 4V2CB 3EUUA 2VABB 2QQLL 3K8LA 3NVQA 1KPUA 5K9OB 4X6DF 3VWJA 1WUNT 1JRHI 1CFNB 1FCCA 2P8PA 3QUXA 4JN2B 1NCAH 5I8OH 2X4OA 1DANT 3ALXA 3BKCL 5A43C 5MHSE 3GSUB 1LO0L 2CGRL 2LU3A 4LCIH 2N4IA 2AEWA 1G1YA 4QRSA 3IJSA 3DROB 4BQ9A 1OW0A 4QTIH 3ZKNC 2ZCLH 3FFDB 2XQYK 4LCWB 4PJIF 2I24N 3FN0H 1JN6A 1T5XA 3JV6B 2VOTA 2A6IB 3O8XD 1EGJH 4HWBL 4K2UL 5GRWA 3TA3C 5GS1B 3MRBA 2DM4A 2ADFL 2ILLA 1S78C 2HT2D 5CFHA 1T2XA 5IW1A 4HJJL 3AU1A 5CJQL 1RI8A 2FX8H 5JHDA 2J6EH 3I2CH 3KPNA 4OD2A 3NFPB 1IL1A 3VFOA 2YPVL 2A9MH 3LN4A 1H5BA 5DRWA 5IR1B 3VFPA 1D9KA 2M1KA 3CCHA 3MRPB 2AJVL 1OLZA 1I7ZA 2ZUVA 4ZOCA 1N5YL 3KR3L 1NEUA 1CBVH 1IGJA 2UYLB 4LDOB 4YDVA 5CSZB 4IJ3C 1VCAA 2R2HB 5JHLH 1KYOK 4XVJH 3GSRA 1L0YA 3BHBA 1EV2E 1AJ7L 4L9LB 1KEGL 3IFNH 4YJZL 4NDMA 4MNGE 1SYSA 2JJVA 5C0CE 4HFWB 3DVIA 3T0DA 4J7RA 1OGTA 1JHKL 4LLAA 3ZE2E 5IB5B 1QFWH 3ARSA 3WV0A 1UB6A 1C5DB 1CICA 4WJ5B 5I1CL 4UV7H 5A2IH 1G7JA 4OGXL 3ZHKA 3SKJH 5I1EH 1T22A 3ULVE 1VFAB 2ICWJ 4P3CH 1QVOA 5DMKB 4PGBA 3DOSA 4K71B 4W81A 2PUQT 1UEMA 2EDBA 2UWEB 3HNTL 3DRTA 4OTXH 1Q9WA 3TJHD 4K8RC 1FFPA 2V2WB 4XP1L 3RUGF 1IAIM 1E6OL 4ODWB 3DYPA 5BJTB 5GGTH 4X4XB 2YS4A 1DR9A 3DUUB 1TPXB 2HJLA 5EB9A 1FGVL 4R4BB 2GJZB 1NAML 1KFAH 3DVGB 4X9GA 5DWUH 1T1YA 2DD8L 6FABL 4HQQL 3QG6B 4LU5H 5TQ0L 1NCBH 5GZOC 5KSUA 4YHML 3UTQB 1IKNC 1A22B 4KUZH 5J3HC 3BD3A 3LCYA 1Z5LB 3B2VH 4NO2B 1W2KT 2CDEA 4Z7VA 4OGAC 1S5HB 1B2WH 1UXSB 5F7FA 4S1RH 4HCRL 3QDJA 2HVKB 2Q7NA 1EXUB 3QCUH 5I1LB 3FCTB 5IKCA 4JFFA 4NFDA 5DYOB 4X6CA 4ODUB 1KXVC 5B8CA 3ULUC 4K9EL 5DRZA 1JYXA 1AC6A 3HLAA 4K8RL 4QRQB 1R3JA 4P49A 5FGBC 1YUHA 3SCMD 1BQHA 4QXTA 3VD4A 3NCYS 4UT6H 5I9QC 1ZS8B 2EDXA 2DM2A 2WLZA 2FO1A 3CUPA 3MJ9H 3KLAB 5F7NC 3RZCB 1NCWL 2Z92A 2IEPA 3BP7A 3DYMA 5C0AD 1R5IB 3DX6B 2VISA 5EC1A 4GKNB 4JEGB 4PY8I 1IKFL 2XZCH 1Q9KA 3JSSA 3VFMA 5CEZH 3VXRD 2FL5A 4M1GL 3BP5B 4OM1H 2H3NA 3UJTL 4IRSB 1TCRA 2BDNL 1IQDB 1KBGL 3U9PH 4GRLC 4YE4L 1A6TA 1KULA 3O3AA 4H26A 1FL5A 4PJDB 3DVFA 4EOWH 3ULUL 4KKBC 1H0DB 3O6FC 2NX5A 4JZNB 4P2RA 5EO1B 5EZIL 1WTGT 2D03L 2NXYB 2VSCA 3QXDA 5I66B 4GQ9L 5JW4R 3KPRB 4ZYKA 4IOIA 4FQJL 3NIFE 2F58L 3NIDF 4XI5C 3KLHD 4UB0L 1BD2D 1IGTA 4JG0L 1EEYA 5SWSD 1SEBA 4BM7A 3BUYB 4ZUUB 1JF6A 5IK3A 3O2VH 1MWAH 2CDFB 5J12C 5GSVA 3E2HC 2Z8WC 3MREB 4NM4L 5FYLH 3QFJE 3QDGA 5HXMA 2VDMH 3PWLA 4FXLA 4HKBB 2N56A 3INUL 1OAQL 3Q6FA 1A9BA 5EA0H 2OYPA 5K9QG 2DLFL 2CMRL 2WBJC 4DGIL 4P46A 3T0ED 2HFEB 5IHZA 4N8CH 3I50H 1G7QA 5I0DA 2W59A 2E27L 4NO0D 2VDNH 1MCOH 4M62L 2Q8AH 4BKLA 3X3FL 5T5FL 3ARFC 4FTVE 3VFVB 3HZMA 1CIUA 4GMTL 2DL2A 2HN7A 1OM3H 4WUKH 1AGCB 4O5LH 4XP6H 1AXIB 3MRQB 5HPOA 2VDQL 4Q6IB 4LVNC 4NQCA 4X6CF 4RIRB 4APQB 4YHZL 4I3RL 3HI6H 4LPCA 2V5YA 2GSIB 3DBXA 3B8YA 3EO0B 4GRWE 4L3EA 4XC1H 5ISZA 1U0QA 2ERJB 3T65A 3HE7A 5D5MA 1WWCA 2AQ1A 4OZ4B 2AP2A 5HYSG 3HFML 3N9GH 5JXAL 2AJUL 3MV8E 4OT1L 3IU3A 3G5XA 4ZODA 3O9WA 4D9LH 3OB0H 4LLQB 3CDCA 5EZOH 4PJ9A 4CVZB 3MZTA 1I3UA 2EDQA 1W8NA 4HDIA 4DN3H 3D69B 3SJVD 2B2XL 4HS3A 4QXWA 2VXTL 3WSQH 5EN2A 2ARJB 1LD9A 3LN5B 5ICZB 1J0IA 3QEUA 2JCCA 5LCVL 1JNLL 1TCMA 3C9NA 1TQCB 3IDYC 3QRFM 3RI5F 4O2FA 4ZXBD 3S4SA 1R24A 1OGAA 2QHRH 2X42A 2VUYA 1G6RA 3TVMB 1QPXA 3G6JB 1JFQH 4NP4L 4POUB 4TNWF 4CU7A 1HEZB 2ZCHH 5F9OL 2HYMA 3VWJC 4EVNA 1RIVH 1JNHA 3QUXC 3PQYE 3VE0B 1IGYB 2NXZB 4OZHE 5DUML 1A6VH 4BUHA 5EBGA 4AK1A 2R1YA 4KRNA 3TBTB 4NKOB 2VL5A 3MLXL 1NUNB 1PSKH 2P5EE 4PJEB 4R0LB 4NQVA 1OW0C 4KGJA 4P9HH 1HYSD 4NUJA 4JPVL 2G75B 1Z2KA 4S2SB 3WE6B 2D4FA 5JPNA 3VU2A 1OSPH 4FABL 1S7WA 3I84A 3VFNA 4TNVK 3ZDZE 4MCYB 4V1DB 2HG5A 1CE6B 3MRLB 3KXFB 5J8OA 5GRJH 3BRFA 1Y18A 5D72L 5DD1L 1JIBA 1H5BC 3HI1B 3LRGA 5DO2D 4HIXH 1EMTL 4P4KA 2FECL 2EH8H 4ISVB 5ALBH 5C92A 1OQXA 3SEPA 4YXLL 2DIAA 4LSTH 3QXUA 1A1MA 4HX1A 1JZ6A 1YEGH 4Q2ZA 3A6CL 1A14H 4KTDH 1CXFA 3P0VH 4PJ5B 4PY7B 3OJDA 3IU4L 5BCAA 1KG0A 5I1JL 5BS0D 5HDLA 4P23B 1QBBA 5D5MF 4LL9A 2BNQA 4JRXB 4YHLL 2V9RA 3EOBA 2VQTA 4Z18A 1MCDA 4PGZA 2UUDH 3ZSSA 4G6KH 4C57C 1T03H 5D7LD 5KVMC 3QUYD 3KYAA 5ICYA 2OL3L 3BRGC 4JZOA 2J2ZA 3SO3C 3QA3A 5D93B 4PTUB 1P4IL 1YEKH 4AT6B 1KTKE 5K9KA 4F3FA 5HHOE 3O2WL 4P2OB 1BGXH 2JCCF 4ELMA 1Q72L 3U83A 1ZGLP 3UYPA 5D1XB 5IBTH 1ZWIA 4RCAA 4U6XB 5CEXB 4P4RA 5E00A 4HIHB 3C5ZD 5C2BH 2ZJSH 3VGAC 1KTDB 1UJ3B 3QZWG 4OAWB 4GLRI 5DF0A 3UTZA 2XN9B 1CU4L 1IGIH 1WZ1H 4ZFZB 3MJ7B 3BGFC 1DEEB 3KAAA 1B4RA 3S5LA 4H88L 1E28A 5FA3B 4P2QB 3O3EA 5B8CC 3T77B 3CFKA 3MBEA 3G9VA 4G6FD 3LMJL 4F7CB 5B38G 4Q9RH 4WI9A 1REIA 1F8TH 4HW6A 3FB7A 3IDJB 1KV3A 4KWUA 2A6DA 3EKCA 1V3MA 3E3QC 3GMQB 3TLRA 3EJZD 1U42A 1FN4B 1U95A 3T2PA 3ZL4L 4RMVA 2D0HA 3OKLB 2Q8BL 4QYOB 3N85H 1UCBL 3EYQD 3JZ7A 5E5MB 1KJVA 4G3YL 5GS0D 2CLRB 2WIMA 5C0RL 3QWOB 4DGVL 3KLSA 2VLKB 3IFOA 1MY7A 4BSJA 2GJ6B 3SE9H 2JJSA 1NMCC 2DQDH 4TTDD 5IT2L 2FATL 1VKXA 5DVKA 5ANMA 5HDBF 1G9NC 3QP3A 5BQ7B 3HHRB 4WO4D 5KSVA 1NFDE 2DMKA 4WWKD 2DQIH 3OB0K 5CP7B 2CKBA 1SJVA 3BDBA 5KZCD 5GRUL 4LHJB 4K7PY 3D2UD 3Q6GH 3QQNA 4JJHA 1FSKC 2FGWL 4LKCB 1MCHA 2Z8SA 2M8XA 1YNKL 4U6TA 1EAJA 1YC7A 3S96B 2W9LA 5DJ6B 2MCPL 1S9VB 2AJYL 4KGLA 2ID5A 5DT1L 2I07B 4MMZC 3BZFB 4UUJB 2XWTB 1A2YB 5HGBB 1ZLVK 2VXVH 2AXFA 2C9AA 4PP2B 2HLFD 1N6QH 3AFLA 3MRGA 2D7TL 3VI4F 1HH6B 2DL9A 3MJ6A 1PD6A 4ZTPL 4WFFE 4ELMF 2JIXA 3BYYA 1I7RA 4WEUD 1G9NL 3O6LH 3U79A 3EOTH 4P46C 1UACH 2BHUA 5GGVH 3S37L 1UENA 1X4XA 2BX5A 4U7MA 1F00I 1AGEB 3AVEA 4ZUVB 1A4KA 2R2CA 2WNGA 1EFQA 3WBDA 2ICWB 1A64A 5E2WL 1XF1A 5DD6B 3H9SB 1JPGB 4PJBB 5CCKH 3RFZC 4NQXB 4YHKL 5CBAA 5EULV 4F7TA 1YECL 4NJAH 1L6XA 1S7SB 1PVHA 4EXPX 5EU7E 3U2SA 1OARL 3P3YA 2BSSA 1D5XA 3G6AA 5EO9A 5JW4M 1HHGA 5I1AA 1CGYA 2WQ8A 3P73B 1I9JH 4OB5L 1ZLWH 1MELA 3G5ZA 2Z91A 4PRID 4L4TB 5GSRA 2P8MB 1D5ZA 3RWEB 4GUPB 4WFGE 2SEBA 2VDLH 2WW8A 3HE7C 3K7UA 4FZ8L 4X8JA 1FHGA 3WFDH 3EYOA 4NRXB 5FYKE 1PFCA 3GSNH 3BZEA 5HGDB 1G1CA 2EYTA 3O9WC 3VXSD 1WBYA 1BREA 4PJ9C 1U8PA 4PBXA 3QISA 4A6YB 4HGWA 4ODTL 5E94A 5FCSH 2D9CA 3QUZA 1J8KA 5ENWA 1KXTB 1XGPA 2OTWB 3AREA 3LS4L 1SEQL 1MJ8H 2J8UA 2FJHB 1HINH 4FG6D 3WNLA 4J8RB 5EFIB 4CMHB 1S3KL 5EORH 7FABH 1NC4D 3DROA 3V0WH 1R0AH 3FQXB 2HP4A 3UDWA 5I17B 1FC1A 2OJZH 2DJUA 3R1GL 1FAKT 4FN0A 3RIAK 5J6GA 2B5IB 3L3DB 2EIBA 3TZVB 3ZTNH 4OD3L 4N0UB 2NYYC 1L7IH 4XCEA 3M45A 4K94L 3G04A 2NY7H 4LEXL 4BQ6A 4ETQA 4OI7A 1T66C 4NKMB 4XBPA 4ZOEA 4PUBH 1RK0A 2V5SA 1I9EA 1Q9OA 5JIKA 3SQBA 3MV7D 3K4ZA 3QEQD 3RWIA 1KXQE 5T3XE 1QPPA 1EGJA 1XZ0A 4QT5B 4Y16A 4EN3D 3KGRA 3L1OH 4NNYA 3FMGL 5B4MD 5K9JL 1FIEA 2J6EA 4M7LL 5DEGA 5I1DB 2H2PC 1T7VA 4HH9B 1PLGH 2R0KH 4KVNL 3VW3H 3I6KA 4JGJA 2GUOA 1U93B 5CSBA 1FZJA 1K8IA 1CFQB 4LCCA 4OLYH 5DK3A 4HUKB 3D85D 1G6RL 5L6YH 4ZFOA 4E41A 2VKWA 3VD9A 4FFYL 3GRWH 1HIMH 4P4KC 2E5EA 3N1PC 5IMLA 4G8IA 1HHKB 5ADPH 3MUZ1 3BAEH 3IKCA 4TUOA 3UZVB 2GK2A 3T8XB 1X7QB 2ZUWA 3NZ8A 2FH8A 2HJKA 1TZIB 4UIKH 4XP9H 4KV5E 4NZTL 4LSSH 1WV7T 3QQ9C 3VFSB 1FG2B 2G2RA 3C8KB 4RGNE 2G60H 5IMMB 2YD6A 3C6SB 4X80L 1WITA 3FQWA 3IF1A 3ZT7A 5AZ2L 3KPOB 4ODWA 3MOBH 3OZ9H 4E0RA 4L4VB 1KIPA 2F53E 3GUTB 2BRRL 3AMKA 3C2AH 5DQ9B 3O4LE 4HS8H 4PJ7B 4POZD 4P2CG 9CGTA 1XF2B 3EYUH 3L3KB 2XKUA 3P9WB 2GY7B 1RVFL 5J1AB 1ORSB 4MB4A 1ZHLA 3OJMB 4Y7MA 4Z7NF 1FLRH 2NY3C 5GGTA 3E6HB 1LQSR 4Y0GA 3ARGB 1CT8A 4KROD 4Y2DA 1WLHA 5E8DH 5SWQB 4CMMA 1EXUA 5DEZA 1P1ZB 2J8UF 4DK3A 3ZDYE 2JE8A 3A6OA 1F11A 3GMRA 2R2BB 4M3KB 4Y1AB 3VFWB 3QG7H 4LFHD 4P3DA 1F90H 4ZUSA 3U36B 3L9RA 5JPMB 4I0PA 3HMXH 3MNWB 4U05A 4LSVH 5C6TH 5F96H 3SDXA 4HWNA 1S7RB 1DL7L 5DMGC 4X7FC 5C9JA 3FQUA 5GJSH 5HI3D 3I6GA 3ARBB 1H3XA 3ARDA 4WI7A 3WN5A 2QEJA 2BVOB 3MBEC 3RWJA 3J7HA 3L7FA 3MJ9A 1I8IA 4M48H 2WP3O 3KYKL 3X11A 1IEHA 5DJAB 3R0MA 1YEEH 3MRIB 1KPVA 1C7SA 4JFDA 4YFDB 5BRZE 1BJ1H 1YJDC 1KB5B 4FQHA 4FFWC 3MSPA 1VEOA 4PRHE 5F7KC 4W6XB 4F58H 1GRWA 5HYEA 5L2JA 3H3PH 2A9NH 3GJEB 1EHXA 3GSVA 3FO2A 4LF3A 1WFNA 2EYSB 2AJXH 2E3VA 2JJSC 1DEDA 1HE7A 4KK9D 3HAEG 3JV4B 5CINH 3D9AL 4DKEH 4UAOC 3DPBA 3RA7H 4QRPB 4OFYD 3CMOL 1T1ZA 3W81A 1QEWB 2QL1A 4NZJA 4KU1A 3TP4A 5GZNC 3U1SL 3D18B 4UT7H 4PIRF 4KJQD 1OSZA 4Y4KD 5F88B 4MNQE 1YYLH 2E7HA 1KJ3L 4G8GE 4PLJC 2Y7QB 1QSZA 4KKAC 3RHWK 3PWJB 1ZSDA 1FCGA 1QBML 1MWAA 4HULB 5I15H 3IDIB 5FV2A 4LPXA 2EDRA 3E8UL 2BSRB 4LFHG 2ZOLB 4XBEL 4D0DA 3EW3B 5JTWA 1U8IB 4UTAL 5MENA 5FHBL 5IVOA 2P5WA 4O02H 5A2LH 4H5SA 4A2MA 3BJLA 4MZ2A 1NGPL 1GHFH 2YEZB 4ODXB 4NN6B 1ND0A 1A0QL 2BVPA 2I27N 5C8JA 5LWYL 4PJAA 5T33H 2HVJB 2X4NB 3EO0A 5EU6E 3GIVB 4M7KH 4MSWB 3OR7A 3QIUB 2ZCKL 4OV6F 2PO6A 2CKBL 3SDXF 1XGRA 1QRKA 2ZKHL 4YDIH 1J05A 1XF3A 3K80A 4JPKH 5DFTA 3QDMD 2C3GA 5C7XL 3G9AB 3PWVA 1OAZL 2ADJA 4CU6A 1G7MB 5HGAB 5KSBE 3LS5H 3UPRA 4U0QB 4M7JH 4MJ5B 2WMPA 3GGWB 1MJUH 1U3ZA 4EUPG 1VDGA 4M5YH 5E0QA 3WL9A 2VXUH 5AWNL 2HFGH 1LP9B 2VXQL 1J0ZA 4QHNA 3KYOB 2RB8A 4NRYA 5DQDL 5KN5B 3I75A 5D7SL 1HSAA 1WZLA 2NCMA 1F97A 4FA8A 3G6JA 3NTCH 1OPGL 2NY4C 3DYOA 3TF7C 1PQZA 3QUZC 5E7FA 4G5ZL 3HB3D 3WFBL 3REWB 3FQRB 4Y19B 4LNRB 3RWGA 3SN6N 5E8EB 1UYWL 2GI7A 4HJGB 3MLTA 1P5VA 2XRAL 3AREC 3G5YA 1BWMA 1DUZA 1HOCA 1ED3B 2QQKL 1BM3L 4IDJH 4LLWA 1V3KA 1MAJA 1QYGL 2XNAB 12E8H 1CFBA 3QULA 2X4PA 4HEPG 5J11C 5DEFA 1J1PL 4D9RD 3UDWC 1SYVB 1T83A 2GKIA 3AAZA 3VXRB 4MHHI 3VMPA 5HYSB 1FBIL 5MHSD 2V5RA 2YN3A 2YMXL 2ICCA 3TCLB 3GI8H 5HYJA 2AK4E 3VXTA 2NY2C 4JANA 1KT2A 5D96B 4JM2D 3LKNB 4GAGL 3HI1A 1GGBL 2QADC 4Y5YA 4GAJL 4HUUA 3LQMA 4LEOA 3MOQA 2YD1A 2ZUTA 5DGRA 3B9AA 5GS2H 4XAKD 4Y16C 4KH2A 2LE9A 2PXYA 1NKRA 3Q3GB 4FQCL 4OZIB 3VD7A 3HN3A 1TJHH 1P9MA 1QFUH 5T1KD 4J1UB 5SWSB 5I1HH 4OZFG 4P5KB 4PJAF 3WIIH 3U30C 4LAQH 5J4MA 4LCCC 5E6IB 2FSEA 4B7IA 3ZKND 3WHE0 5HYQB 2VLRA 3LOWA 3LSOA 5IW3A 3TH2T 1A1OA 4YFLI 1N59A 2Z35A 3KPSD 1LHZA 5GPRA 5E9DE 1S78D 5GGRA 4TRPH 4LCIL 4R4FH 1S9XB 3K2UH 3I3DA 3RVUC 3CSGA 1PEWA 4O2EA 4QTIL 3ESVF 2WANA 1MRDH 5FK9A 2RHEA 4NO0B 4OFPA 1K85A 1K8DA 1RJZA 1OOAA 3ZSTA 4R8WH 3ULVD 3P11L 2VN7A 1F4WH 3CLEH 4WI6A 1IAOA 2IH1A 2FX8L 3I2CL 1OTSD 4PJHA 3RIFF 2NMSA 3TH4T 2DYPA 4WUUA 4YHIB 2ZP0T 3VFGL 5EU5B 3VFTA 4FP8H 4JO1H 1M71B 4KDVA 5C0GB 1AHWA 1R5WB 5C3LD 3OXRB 1S7XA 4ZFOL 1BP3B 3TC9A 4MAUH 4AL8H 4TN9A 4N9GB 4Y2DC 4D0BB 5IFJA 5JHLL 4KJWD 4J2XA 4XVJL 2OQJB 4QHKI 1NDMA 4HUVB 3IFNL 1RMFL 5I30H 4GXUM 2DM7A 3BH9B 4TULH 4JREB 1FVEB 2VC2L 4P99A 2F74B 4HAGA 5DJZB 3DIFA 5DVMA 3VXUE 4PRBB 1BQLH 1QFWL 4X98A 4DKFH 4I0PC 4KRPB 3THMH 4UV7L 3FJTA 1U2HA 4Z7QF 4C56B 3ZYOA 5BVPH 1AQDB 3CVHH 3QIBA 4OF5A 3DX7A 4P3CL 3I85A 1YN6A 4UQ2B 3OKLA 1ZT4A 2NTFB 3BD4A 1CWVA 4JFQB 4OTXL 4YZFF 5GZOD 3BJ91 4Z76A 5HHXH 4LCYB 2CLRA 4J6RL 1XFPA 5J3HD 2GFBA 4PFEA 4ZXBB 3ARDC 4TSAH 4YPGA 5GGTL 3WN5C 5TDNA 4MD4A 3B3IA 4JFZH 3K1DA 4OGAD 2YC1B 4XZUA 5GISH 2RR3A 4PJ8B 5DWUL 1U6AL 1M6OA 3GJFB 4GG8B 4LU5L 3GSXB 3I02B 5F1SA 4NKQB 1NCBL 2MPAH 3EDEA 1LO4H 1A6UH 3DSNA 1IAIH 1BVLA 3B2VL 1YMMA 3BI9X 2CJUL 1RHHA 1B2WL 3IDMB 2V7HA 4S1RL 3W0WA 3VXMA 3QZWB 4L4JA 5IESH 3MROB 3MNVB 2E9WA 3QCUL 4MXQC 4ZOAA 1CQYA 2VL4A 4KFZC 4TVSa 4X4ME 2A74A 2BERA 3NCBB 4F9PA 2CD0A 2L4OA 3MV9E 3U0PA 3TO2B 5TE6H 3ECBB 1OT1A 3NPSC 4K3DH 5FDWB 4TTGA 4UUJA 4UT6L 2XWTA 1UCTA 3QEHB 5B38B 5I19H 3VRJB 3AXLA 2I26N 5I18L 1YPZA 1JGDA 4U1MA 1NMBH 2YA2A 4PJHF 5BXFB 1C12B 4QLRA 5J13B 5EC2B 4XAWL 4KKBD 2XZCL 1NUFA 4G8FA 4WU5A 1NUGA 3O3DA 5CEZL 3O6FD 5LBSL 2OCFD 4FQXA 3DGGB 2L7UA 4OM1L 3C09B 4NQXA 3U9PL 5IQ9B 2Y07L 4YHOH 4OZGE 3HE6A 1A6AA 5D7IA 5DRNA 3NCMA 2R8SH 5AYUH 1B4JH 1DTUA 3QUYB 3RVVC 5F7HA 1MHCA 1DBKH 4EBQH 4ORZC 1GYAA 1G6VK 2DF3A 1FNLA 2PO6C 1MLCA 1KEMH 3WHXA 4PJFA 3ALWA 3V4UH 4CNIA 2Y5TB 4MJ6B 5IBUG 4NCC2 1RZ7L 2AW2A 3SDCD 1G7IA 4NQDA 4QOKA 2V17H 1T0PB 4GSDH 4ODHL 5T5NG 5TJWK 4OCSH 4AIZB 2NW2B 4TOYH 1Z6JT 2H9GA 1EZVY 1MCSA 5F3BA 5FYLL 4UBDC 3T4AA 3MV8D 3QWRA 3C5ZB 1DBBH 2UZYB 3MFFB 3OBAA 5FYJL 1FIGH 5IM7B 1U58A 2AKRB 3GSNA 5I71B 3PWNB 4DVRH 5F1IB 2WP3T 1AY1H 4N8CL 2WSKA 3JWOL 2VDNL 1MCOL 3GI9H 4C4KT 2CIKA 4X4YB 2E8YA 5I16B 3K81A 1TTFA 3D87B 1N64H 4MYWB 1JNNH 3UTSE 5IF0B 5C08A 1MH5B 3IS0X 1ZLUK 2W9DH 3L3DA 3IGAB 4G6FB 5GS0H 2HLAA 3ZE1E 1GAFH 1UQSB 4WUKL 2WQRA 1OM3L 4XP6L 4O5LL 3NCJL 3SBWA 2YWYA 3NA4A 2ESVD 1P69B 1WAAE 1NBZA 1AO7E 5JORB 1C08A 1O7VA 4U1LB 4KZDH 4PRPE 4WHCA 4RDQF 2X4UB 2APXA 2AVGA 3PF2A 1AR1D 3LDBC 3N9GL 3EGSB 4R7DA 4DAGH 1YPZF 4XXCA 1T83C 2A2QT 3O45B 4NCC1 5C0BE 4RZCA 2FJFA 4EXKA 1P4LA 1Q38A 5EZOL 2BK8A 1EJ6A 4U6VH 4YO0A 2VLJA 4DN3L 5LGJA 3NFNB 4WI2A 4P9HC 3V0VA 3NCFB 4LLVB 4Y5YC 1UM4H 2CIIB 3VWJD 4MQ7B 5AYQA 5ETUA 3WEXB 4N5ED 3FHAA 4WIQA 5KZCB 4ZO8A 3QUXD 2PXYC 32C2A 3B6SA 5CJXA 3D2UB 5ACLA 3BSZH 5D7IF 1B0RB 4AY0A 4X0KA 1IQWH 3SKOB 1P9MC 2QHRL 3CFDB 2A6KA 3EYVB 5F21B 3CFBA 1T04B 3BW9B 5BV7C 1CDIA 3GRWA 4QXGH 4YK4C 2EDTA 4R90H 2ED8A 1GZQA 1FAIH 2ZCHL 3KJ6L 2IGFL 4M93C 1CYGA 1NMAL 4PJFF 4LKXA 1T5WB 3QUKB 5DQ9A 3ULSA 5HPMB 3GKZA 4GAYB 4WU7A 5DVOA 1W0WA 5FDYA 5JHDD 2I9LB 2OI9C 4ZSOA 2Z4QA 1WBZB 5TH2B 2Z93B 4ZUWA 2PTTA 1X6NA 4PJCB 1FO0B 3ALPA 1CG9A 5FO8A 3HR5A 5IHUH 5CILH 4LVOC 1U41A 2E7MA 1OSPL 2FIKB 2X4RA 4K7FA 5MEOA 2XKSA 1DCLA 3QIWB 4PG2A 2VIRB 2J7LA 5DK0A 3TYGL 3LB6C 1FH5H 5D7KD 5F89B 2DI9A 3EFDH 4JGUA 1XH3A 4HIXL 5LKNA 2EH8L 4MXWH 4OD1H 1AHWC 1GJIA 1P7QD 2DQUL 4PRIB 4W4OA 5JDSA 4QHLB 4MJIE 5LGKA 5I1IH 4LSTL 4PYHA 1DQDH 2A77H 3Q5YA 1II4E 5HI4C 1OAYH 2QTEA 2ADGB 4XHQA 5DHYB 1KIRB 5IFHL 1A14L 4KTDL 4S0SD 4XWOC 3P0VL 1DFBH 1Z3GH 2H8PB 3C60D 3EO1A 3ZLQC 3F7RA 5D1QA 3HMXA 4F15C 3VXSB 3BZ4A 5EG6C 4G9DB 1R3HA 2W92A 4U1NB 4YR6B 4PGDA 4U6YB 3V6ZB 4WVRA 5D9SB 1T03L 3QIBC 1YQVL 3SGDH 3WLBA 5DQJA 2W60A 1CIDA 4XRCB 2VAJA 2XXMB 4D0CA 1QFOA 1RY7B 2LVEA 1YEKL 4JFEE 2Q86A 4JKMA 4UDTB 4B5EA 1NC4B 5KVEL 3DXAE 4S1DC 2LABA 1JV5A 3FOMB 1FL3B 1O7SA 1MFBL 1G0YR 1CLCA 1BGXL 2XTJC 1JE6A 2D3VA 1CS6A 2FIRT 3H9HA 3O8XA 4KDTA 1M7DB 4RMQA 5IBTL 5B3NA 2X7LB 3V6OA 5HDOA 3AM8A 4JFFD 3PGDA 1L7TH 2AJZB 4X9FA 4J23A 1CFVH 4FQIH 1YEIH 5DFVC 2W38A 4EDXA 2R56H 2ZJSL 5C2BL 4KMQA 2Y36H 1KELH 3NMEA 3QEQB 1JUFA 1JZ5A 1ZV5A 4YBQC 3CVIH 1I8LA 2NY5H 4OLVL 1GVIA 3RPIA 3M1BB 1QRNE 2F9BT 4LHUD 4EN3B 1UH4A 43CAB 1K3IA 1WZ1L 3BGAA 4N0FA 2DWDA 1KLGB 5F1OB 2D0GA 3UBXA 8CGTA 1G7HB 4TSBH 2XWJB 2ZUXA 3BP4A 1AGFB 1EEZB 4F9PC 5TFSL 3RPKA 3X3GH 1RUMH 3NCEB 5INCB 3RL2B 4Q9RL 3TN0A 1ZA6A 1F8TL 2VE6B 2HT4D 3KHOA 1U8MA 4YHYB 3MLRH 4AEFA 2DQFA 4PG9A 5HHQB 4HC1H 1KLUB 2IBZX 5KTEH 2HFTA 5TE7H 4Y4HB 3N85L 3IYLW 4UV4L 4XCYB 3FFCB 2JJWA 4FQXC 2B7DT 3O2DH 1BFOA 3PV6A 4NZRH 4UT9H 1FORH 4X5XB 3U48A 1CLZH 3SE9L 1EO8H 3D6GA 1F13A 1RFDH 4Z7OF 1QSFE 1A6WH 2DQDL 4WFFD 3OGOE 5L8LB 1FYTA 3ILQC 3OKMA 3HAEB 5BOPA 3HE6C 5K59E 2DQIL 4P59H 4JY5H 2HJFA 2A73A 4R2GC 2IANE 4PJGB 1PKQE 5HVHC 2DQTH 4XCNB 3S6CA 5E1AB 3QXAA 4KROB 4ERSL 1HI6A 4OLZL 4S1SH 1IM3A 4BSWB 3GMPB 2YUVA 1F45A 2KQNA 3IAQA 4P46D 4RNRB 4ALAH 1JBJA 2I25N 2J1KA 2DQGL 1QSEE 1T20B 4LQ1A 4Z7VE 2EDKA 2F54A 3VFRB 4ZPVB 2VXVL 1TJIH 3SCMA 3CJJA 1N6QL 3TBVB 5AD0B 1BQSA 5DJYA 3P4MA 4JDVA 3ME0A 4QHUB 2VQ1B 3D0VA 4X7SL 3V5KA 3U6RB 4Z9KB 2EDDA 4LHUG 1RUAH 3KDMB 1JRHH 3O6LL 4Y5XB 5GGVL 1UACL 4KVCL 3EJYC 1BBDL 4I2XA 2ATKB 5C0AA 2LU4A 2EIZB 2BY1A 3P4OB 3ARRA 1HCVA 2XZZA 5DUPH 4L3ED 1ETZA 4X99A 4U2ZA 5ISZD 5CCKL 2XXCB 3HE7D 4JO3L 4AJ0A 4NNXA 5I8CA 4NJAL 4M1DH 1PYWA 2FECI 2AGJH 3SBWC 4U1HB 3O9WD 3QXWA 4PBVC 3RVXC 1LNUA 2XZQL 1I9JL 1BZQK 2QHLA 4A6YL 3VXPA 1IAMA 1HXYA 4ZD3L 3QI9A 2VDLL 1MAMH 4LLUB 1SY6L 2HKFH 1NANI 1CGTA 3WFDL 4EUPB 2XPGA 1W0VA 1DLHA 4XVSH 5DJ0A 4XXCC 5IOPA 1BD2A 4U1SB 1XGUB 3TPUA 4UZGA 5D6DA 3W39B 4WNQB 1EHNA 4DUXA 4PRNA 5EIIB 3FB5B 1OGAD 3M17A 3MYJB 4NQSA 5DURD 4CN4A 2XIDA 1L9MA 1NGYB 4ZFGL 1DVFA 3FOLB 1C8PA 1XF5B 5D2NE 2NYYD 4JFOA 5TE4L 1Z9MA 4XPHH 3RJDA 1MJ8L 5HDQH 4ZDHB 5ID0A 1BZ9A 5M7QA 2Y23A 3QQ4A 1G0DA 2H32B 5CJXC 3ZKSD 5EORL 1T66D 1R0AL 2PYEA 4S0TD 3T0EA 3S7GA 5FUCE 5IG7A 3MLWH 1VADA 1Y0LB 2OJZL 4NM8H 5H35A 3FT3B 1KPRB 4E42B 4ONGH 3HRZB 1L6ZA 3CH1A 1DN0B 4KK8C 4LIQE 5FGCE 1OB1A 3TNNB 4PJXA 2NY7L 5JUEL 1W72B 4ZFFB 1JHTB 4HIJB 4PUBL 3IXAA 1QKZL 2JJUA 3EFFB 1K4CB 4ZUTB 1T1XB 4MXVE 4N1CA 1CD1A 1VACB 1MHEB 1QHPA 1GPOH 4P4KD 1HHIA 1VESA 2VDPH 3H0TA 3I3BA 1PLGL 3TJEL 1BOGB 3HC3H 3VW3L 4LCUA 4MDIA 3MCKA 3AS2A 3FT2B 2BOBA 4PG2C 5IJKA 3QDMB 3QQ9D 5ESVB 3LQAL 2V7NB 3JXAA 2PW2B 4WWID 4OZFB 2BNRA 3GRWL 4G9FE 1HIML 1QTYT 2DDQL 2Q3AA 4QRRB 3SJVA 3N50A 1CXKA 2O26U 1U8NB 2BNQD 2VKXA 3DLQR 4W4OC 4ORGB 4HMCA 4XP9L 4LSSL 2G60L 4M03A 1TDQA 1NLDL 2MMXA 3PWUB 3WXWH 3MOBL 3OZ9L 1YNLL 5D1QC 2NY3D 2VDOL 5DA4A 2C7UA 3C2AL 4MD0B 4Z7WE 3CVHA 4HS8L 1MJJB 3EYFA 4YC2C 3HUJA 3F7YB 2FLRT 1Z0MA 3MRMB 5CWSB 5EPMB 4DFHA 3EYUL 1LILA 4NN5C 3I02A 1S9WB 4DCQA 5KSAB 1FL6B 2BSTA 3WNKA 4IDLA 3FQNA 3U0TA 1K2DB 4HHAA 3B2UC 1S9YB 3V79C 1RV6X 2CRZA 4DN4H 4AEIH 4L8BA 1NH6A 1IRAY 3MRCA 5TDOB 5BRZD 3L3OA 5DMGD 5FUZL 3D3VD 4NO3B 3O8XC 4KDTC 1FVDB 3IJYA 2C1PB 3V6OC 3CU7A 3QG7L 2HT2C 3L6FA 3AM8C 1I8KB 5JNYB 1J8HA 3ECBA 1F90L 1R6VA 2X2YA 1N8ZA 2YRLA 4PRHD 1BPVA 2NY1B 3HMXL 3RVWD 1DQQB 4LSVL 4JM2B 5INDA 5F96L 2X40A 4KJYB 2YD9A 1I8LC 1QFPA 2AJ3A 5A16A 2PCPA 3CU1A 4G42B 4QEGA 5I75C 4PJXF 2G9HA 5BO1L 2YPLB 1J18A 4YIQA 5DMIH 2GAZA 3QWQB 1KB5L 4G8EB 5T1KB 5C07E 3SOBH 2XQBH 3VGBA 1XR9A 5AUMB 4G8GD 3TN0C 2YD2A 4K55A 4M48L 4XMPH 5BS0A 4OJFL 1YEEL 2IAMD 1U91B 3FB8A 1D6EB 3U7YL 4CJ0A 3TA3B 3KPSB 3QCVL 3FN3A 3ULVH 3MACH 1M1SA 3ES6A 2DAVA 2QSTA 3MUGB 5D7LA 2MJWA 4LP5A 3CDGA 1MUJA 2WUCH 1A1NA 1CGWA 3W5NA 4DZBA 5GZND 1CF8H 1FRGL 1PJ9A 2A9NL 2C4FU 3TJHC 2YKLH 1TMCB 4PLJD 2P7TA 4P48A 2AJXL 3IS1X 2RBLA 4C58B 2Y6SC 4GG6E 1N3NB 5CINL 4DKEL 3WS3A 2ED7A 3RA7L 2BVUA 1FZMA 4IJ3B 3DHJA 5CMAA 4JPIA 1J86A 3B9KA 1AI1L 4RAUB 1NAMB 1N6VA 2YBRB 1T7YA 4UT7L 4PRAB 2B1HL 2PYFB 3NAAH 1HDMA 4AH2B 1YYLL 4HUXB 1F58H 3WJLA 5KS9B 1NJ9B 4KK6D 1XIWD 3HUJF 4MHHG 5I15L 3VGFA 1Q8MA 4XPFH 1N7MH 5HHNB 4YGAB 4KHTL 4U1IA 3S5LG 4ONOA 4XX1E 4O02L 1L0XA 4U1JA 1OTUD 3SCMC 3GMMB 1P6AB 43C9A 5J1TC 1GHFL 3L5HA 5J6HB 1I9IH 1B0GB 4QCIA 4UINH 2MFNA 4Z78A 1RZGB 3PWPB 5FECB 1NCTA 1EK3A 1VA9A 3QH3B 4YQXH 3L5WB 5T33L 3HG1A 4HG4J 8FABA 1A4JA 1GZPA 1PGRB 1N2RA 4M7KL 2Q87A 3BO8A 4NC1E 3ORJA 3CZFA 2IJ0C 1UXWB 1T0NA 1D3CA 4YDIL 3BN9D 4BSVB 4JPKL 1BF2A 4MLIA 5D7JA 4HBCL 5C86A 5IBUB 1M7IB 4KKLD 4RMWA 5DSCB 4JFHD 1TETL 1RJYA 5SWZB 5HVWA 3DUHA 4M7JL 2VN4A 4OFIA 4WO4A 2VWEC 3IFPA 1MJUL 4U0RC 4WWKA 3IDGB 4M5YL 3NIGF 2VXUL 1E0OB 3QQ3A 3QUZD 3QI9C 4XNUH 5I9QB 4MNHB 4J3VA 2AK4D 1NDGB 3KLHC 2BJMH 3WHE1 2YZ8A 5D6DC 2P24B 3DVNA 3V7AG 1GL4B 3BW9A 3NTCL 4HWZB 4CN6A 3TYFB 4F7EA 4I0CC 1OAXH 4L8CB 4RFEB 5I0ZA 4FRWA 2B1AL 1DVFC 3QCTH 5KBNC 2R9HC 1KENL 2R1XA 1YEJH 2V2XB 4NSKA 5KJRH 1XCTB 3W11D 1DQML 3T3PF 4GRLB 3L3IB 1KIQB 3T0EC 4JDTL 3ZE0E 3VXQA 3CPLB 3X12B 2QADD 3O6FB 3RY6A 1WICA 4M5ZH 4NHUB 1KIUA 3OR6B 5E9DD 4Y16D 5J06A 1UVQA 3ZTJH 1KC5L 4X6DB 2MSPA 2WUBL 5CJBA 1FNEB 4MA7L 1TJGH 5ILTH 3GIZH 5J89A 3GI8L 4AZ8A 3JWDH 1WCBB 4JRYE 3WO4C 4ZAKA 1E4WH 1L4IA 3MA9H 5HY9A 1NGZA 2AV7B 4HS6B 5J12B 5DFWH 3E2HB 5DD3H 1IEBB 4OCWL 5EIQA 4E41D 4PGCA 1U8LA 3D48R 1G7LB 1YEDA 4PJIB 1TJHL 1ZKAA 5L2KB 1Q0YL 4I9WE 4NKDB 2WBJB 2X4QB 3OXSB 4GLRH 5I1HL 1ORQB 4NOFA 3RVUD 1K6QH 1JWSA 4LAQL 5IJKC 1WZKA 5ESQB 3MLYH 4Z7UE 1KJ2B 2FBJH 3ESUF 2XKNB 5IBLD 1N5AB 3WLWC 1LE9B 3ARFB 4R4NC 1LEGA 1QA9B 2AJSH 3VDBA 6CGTA 3HC4L 4GKSB 4F57H 1MAKA 4TRPL 2R0ZL 4R4FL 3C5SB 3HPJB 5EU3B 3K2UL 4KZEH 4KAQH 4GW1B 4YEFA 4YGVA 4LVNB 1YDPB 3U46A 4FFVC 2APWA 5MEQA 4R8WL 1CGXA 3HPLB 3BMVA 1SBBA 1F4WL 4ZS7H 5FM8A 3DUSB 3LQZA 4HV8B 5KW9L 1A7OH 1IC5H 2Q20A 3FO9A 2DQEL 3MZGB 1U92A 3SDYH 2ESVB 4LCWE 1CQKA 4XNQA 5C09B 4UI2A 3BKYH 3WUWB 1BAFH 4JO1L 1JZ3A 3L5JA 3GMLB 3MV7A 2ITDA 2OZ4L 1T21B 2XACC 2IG2L 3T4YB 1E27B 4KQ4H 2BRQA 3RUGB 2AV1A 4PTTA 4MQSB 2P46B 4EN3A 3IDXL 5H2BA 4NCDA 1H3GA 4X6BA 5EBMB 1KLGA 5LAXB 4XMKH 1EPFA 4HKJB 2VLLB 3MNZA 1CXLA 3OKEB 2BHZA 2X9XA 3CFIC 3K8MA 5IB4A 3QUMH 4F80A 3IDYB 3KPLB 5M95B 1MCPL 1ZHKA 2GSGA 1BQLL 1DSFL 4DKFL 3D85A 3ARDD 3RL1A 1ZTXH 1WEJH 1SJEA 5JIIA 5DO2C 4MDJA 1RJLA 1KPUB 5F93C 1N0LA 3B43A 1EFXD 3VWJB 5D2LA 2P8PB 4Z5RA 3QUXB 3NN8A 1Q1JL 3QUMB 5HHXL 2X4OB 4UNTA 4OQ1A 1LO5A 2BVQA 1PY9A 4QRSB 3IJSB 1DE4A 2Z0BA 4HC1A 2UWEE 3OKNA 4MXQD 5LQBH 1JNJA 1T5XB 2BHYA 1HNFA 2MPAL 3MRBB 2F8VA 1LO4L 1A6UL 1QHOA 3PP3H 5IW1B 1IAIL 3AU1B 4Y4FA 4MA3A 5JHDB 2DI8A 3KPNB 3O2DA 4OD2B 1IL1B 3L3JA 3VFOB 3LN4B 3PIQA 1H5BB 5DRWB 4WW1A 5CGMA 3VFPB 3OPZH 3CCHB 1I7ZB 3TO4A 3T2NH 2X9WA 1IGJB 4YDVB 2B39A 5TE6L 1FNSL 3B9KC 4K3DL 4QWWD 2DKUA 3BGMA 3GSRB 3BHBB 2FZ3A 5CHNB 5I19L 3PP4H 4NDMB 2AS5M 1SYSB 2VQ1A 1I1YA 2P5WD 4PB9H 1KCUH 3QEGL 3WJLC 4ELKA 1ACYL 1OGTB 1P7QB 4K3JH 1NMBL 4EQ2A 2C26A 25C8H 2X70A 1UB6B 1MCLA 5F7YC 1G7JB 1NBYA 1V3LA 3UJJH 2EIZA 1T22B 3FAWA 3K74B 3TBWA 3G5VA 3R06A 1QVOB 3RVVD 3UP1A 4W4NA 3BE1H 4PGBB 5IVXA 3SO3B 4YFEA 2PO6D 3DRTB 1Q9WB 1FFPB 1X4YA 3T2OA 1UWGH 5ERWA 5C6WH 5JOEA 3FB6A 2YD4A 1S9KC 1BFSA 2JLLA 5TGBA 5EUOA 5AYUL 1B4JL 3EJZC 4QNPF 3UTSD 3QHFL 4EBQL 1DBKL 2OK0L 2ZOKA 1T1YB 1VPOH 4FNLH 2Q7YA 1KEML 3V4UL 5KSUB 4P0DA 5F9JA 5GS0C 4BZ1L 4GBXA 3VGAB 4PJDE 3PDGA 2Y72A 1U8QA 4YEEA 5JXED 5CEZE 1AO7D 2CDEB 5FF6A 4GSDL 5D7JC 4OCSL 5D2LF 4CN1A 4PB0L 4TTDC 4HXBL 4WHDA 3QDJB 4XCCH 1WBXA 4MS8D 3KPRE 3BGFB 5IKCB 3ARZA 4JFFB 2VDKH 4XGZA 4KC3B 4X6CB 2NW3A 2ITCA 4MQXC 4WO4C 5B8CB 5DRZB 3HLAB 4WWKC 1R3JB 4Y4KA 4I3GA 1YUHB 4JO4H 4NWTL 1BQHB 1JF1A 5CS7A 4ZDHA 2ZUYA 4DVRL 2H2SC 3OMZA 4OF8A 4WCYH 3H9ZA 1AY1L 1N0XH 5SV4A 4AIXA 3AS1A 3CUPB 4OQTL 1J0KA 5FGSA 3V6FA 2IADA 2YUWA 2Z92B 1JNNL 4IRJD 3O11B 3BP7B 4KTEH 3FT3A 2W9DL 2VISB 3O6KH 3CFCL 5EC1B 3CH8A 5GS0L 1GAFL 1Q9KB 3H42H 3VFMB 1J1XH 2VZTA 3DX9B 2FL5B 1J88A 2EIEA 1NMCB 2H3NB 1RIUL 4HIJA 4O9HH 1WISA 1TCRB 2I60L 3QHZH 5HYJD 3UTTA 4UOW0 3NABH 3P9MA 2VH5H 5DHXB 1A6TB 3BX7C 3O3AB 4H26B 1FL5B 2AEIT 4NJ9H 5FYJE 1MRCL 1CFTA 3MODL 4M61A 4NQEA 2NX5B 4P2RB 2J88H 3RY6C 4OI9A 3T3ME 3BPNC 1IC4H 3QXDB 2G5BA 3GKWH 4ZYKB 4IOIB 1NSNH 4U6VL 1BVZA 1WGOA 4HWUA 2YHGA 4DEPC 1OT2A 4J3WA 1IGTB 1FSKB 1EEYB 2P44B 4GO6B 3RGVA 5BW7A 3BH8A 1D5IL 1SEBB 4QY8A 4ZAKC 5CEYA 5IK3B 3ZKXC 3K3QA 5IVXF 3W2DH 4LGSB 5GSVB 2VLRD 1MQKH 2J5LC 3OKDA 1J11A 5JO5A 2OLDA 3QDGB 3PWLB 3HMWH 4LLYA 2ARWA 3Q6FB 3CSYA 5FYKH 1A9BB 1IQWL 5EUOF 4XNYH 3QNZA 2ZSWA 3CX5J 5JW3H 1RK1A 4P46B 4QXGL 4R90L 5IHZB 4RMSA 1G7QB 1XF4A 2AI0H 1KOAA 4L29A 4BKLB 3HZMB 3MRMA 1D6VH 4L9DA 1T4KA 2HN7B 3G6JE 3LB6D 3U7WH 1VEPA 1DBAH 3W5MA 3F6IA 4NQCB 4PGEA 5IHUL 4H1LH 4OSUH 5CILL 3FO1A 1ZHNA 3DBXB 4L3EB 5ISZB 3T65B 3UMTA 3EDKA 3HE7B 3MRRA 5D5MB 2ZG2A 4PJEE 4S1QH 4BQ8A 1FH5L 3IU3B 1A5FH 3G5XB 4IOSD 4JFED 4XWOD 2MWCA 5DGQA 3O9WB 3EFDL 4JY6A 3VXNA 5JLZA 3DXAD 1DQQA 4MXWL 4OD1L 4QXUH 3BWAA 4PJ9B 3V4VH 3M8OL 1UZ6F 1PX3A 5JW5A 4V1DE 3PDOA 3R4DA 5T3XH 4HDIB 1V7MH 3KXFE 1DQDL 2VXSH 4HS3B 1OP9A 1H8OA 2J4WL 1OAYL 4JVWA 1GXEA 5EN2B 1LD9B 2BY3A 4HK0A 3NPZB 1DFBL 1Z3GL 3QEUB 2JCCB 5C0EA 5FFLA 4G8EA 1WT5A 3VG0L 3C9NB 2OP4H 2O5XH 3EOAA 3QJHA 5EDXA 5FYKU 4O2FB 1J10A 4S1DD 2B4CH 2OR7A 3S4SB 1R24B 1OGAB 2NY5C 3SDDA 3MO1A 1G6RB 1FVCA 4JDZA 1JYWA 3RY4A 1WFTA 4C59B 3PL6D 4PJ5E 3K2MC 4EVNB 1ZGLM 3MUGA 1BLNA 1JNHB 3N1FC 4MNGA 3U4BH 4JRXE 5DFVD 2KBGA 2R1YB 5C0CA 1DUYA 2DMCA 3SKMA 3DO7A 2VL5B 4ODBD 1YMMD 2H45A 2VZ1A 4XBGA 1G9ML 3W0WD 3VXMD 4NUJB 3S35H 4X9IA 1L7TL 4JLRA 5JPNB 3GNML 1CFVL 1U9KA 1YEIL 3OB8A 1S7WB 3VFNB 3UZQA 3SDAA 3K46A 2Y36L 4Y4FC 1KELL 3DTXA 2HG5B 2FO4A 3CVIL 1Y18B 1NFIA 1P7KA 4FOMA 4XWGH 3RNKA 4P4KB 1LK2A 4XTRD 5KAQF 3TO4C 2D7QA 5C2UB 4TSBL 5HI5C 1JGLH 1IFHL 1I9RH 4QGTA 1FFOA 2OTUA 3X3GL 4N90E 1ZVSA 2IAND 1UWXH 3HTLX 5E4IA 4HX1B 3ARUA 2P4AB 4Q2ZB 2XN9E 3KPQA 1IGMH 2CLZA 3AB0C 2MTPA 4JCLA 5KG9A 3MLRL 4P2YA 3OJDB 2IQAA 4HC1L 1EBPA 2DJ4A 4P2QE 5KTEL 2BNQB 1C5BL 3BPLC 5IMKA 3EOBB 3LHPH 1QSED 1NGXA 4LVHC 3RKPA 2APBA 5JQHC 5TDPA 2X4TA 2BMKA 4TNWK 4U3CA 4UT9L 5HI3C 4NZRL 5ICYB 2HKHH 1U8KA 1CLZL 1EO8L 4JZOB 1RFDL 3QA3B 1JGUL 1A6WL 2NY3B 1K9TA 1MNUH 4TUKL 2CK2A 3ARWA 5F7LB 4WY7L 4H8WH 2XYCA 5K9KB 4F3FB 4HT1H 4NQDD 4GKOA 4QOKD 4J3OC 2VLKE 3MOAH 1JPSL 4JY5L 2GJ6E 3LD8C 4ELMB 2Y1VA 1ZWIB 5CJOH 2DQTL 4P4RB 1YY9C 5E00B 3QWRD 1X3DA 4YNYA 1OAUH 4GBXC 3QB7C 1GOGA 1Y6MR 2AABH 1LEKB 5EUKA 3EJYD 3OKKA 1C7TA 3D3VB 4UTBH 3UTZB 1UB5A 1PBYA 4X7CC 4J3XA 5DA0B 1TJIL 2EEDA 1GIGH 3GSWA 5C08D 4RDQG 3S5LB 3WFEH 1E28B 3O3EB 5F71A 3ZE2F 4ZPTA 3L95A 3CFKB 3MBEB 1JTTA 1AE6L 1XGYH 4I18A 1J87A 2C5DC 4IRZH 4Y4KC 2DLEA 3GBLA 1RUAL 1JRHL 1BBJA 3ULVF 4LMQE 2FBOJ 3FB7B 3A6BH 4N8VA 2A6DB 3FRPG 4L5FH 1RUPL 3IETA 5DUPL 1U95B 5DDHA 3BKJH 3QFJA 5FA4B 5AZEH 3LRSA 2EH7L 3E6FA 2CO6B 1KJVB 1PG7W 2BP3A 3OR6A 4U49A 4LPYA 5CD3A 3ZYIA 1HQRA 3IFOB 3A67H 5E08H 4ESKA 2B0SH 1ZVHA 4UAOB 3CXDH 5CZKA 5IB2A 1VKXB 3MGOA 4BYHA 3H9SE 4O4YH 4PJBE 4XB8A 2VLJD 4FTVA 5ANMB 2R15A 1GGTA 3RJQB 5CBEA 5KSVB 5IFAH 4KK5C 4L1HA 1U8JA 2OSLA 5E5UB 4XVSL 2VZUA 1ITCA 5IW6A 2CKBB 3JTTA 3SDCA 2W65A 3PXJA 4L4TE 3VJ6A 3GM8A 4Q9BA 4DQOH 1WZMA 3RGVC 2DLHA 5GRZA 5TF0A 5BW7C 5D8JH 1WTLA 3X14A 2YRZA 1NC2A 4CBPA 4XPHL 3MV8A 4KK8D 3QAZC 1G7PA 2GY5A 5HDQL 3LKOA 2AEPH 2AXFB 1K5NA 4HK3N 1W72L 3BVNA 3MRGB 1OY3B 3W9DA 1JPTH 1CGSL 5TPWL 1FNHA 3BT2L 3MPCA 2JIXB 1I7RB 4G9FD 3MRJA 4M9OA 2P42B 4ONGL 3CFJA 4TSCL 1A4KB 1F2XK 2VLME 5I1KL 5IIEA 2DQHH 5EOCH 5E1HB 5DJXA 3HB3C 1OP3H 2EDFA 5CBAB 4HGKC 3VH8A 4F7TB 4MX7A 3RX8A 3TT3H 5FB8A 4N0UE 4RFNC 3JWNC 3HZVA 4F33A 3U2SB 2BSSB 1D5XB 3G6AB 2FNBA 5EO9B 1HHGB 5I1AB 1GPOL 1HQ4A 2D0FA 3NIFF 3G5ZB 2Z91B 2LV4A 4OF0A 4W70A 3HC3L 5GSRB 1D5ZB 2GJJA 3S88H 1BVKA 4RRPG 3PQYA 4OZHA 2SEBB 1JVKA 3X13A 1TITA 1ZHBA 4X8JB 4ZTOH 3TBYA 4UU9A 5CAYB 4RWHA 3EYOB 5A2KH 2VMFA 3AROA 3BZEB 2P5EA 2EYTB 2Q1EA 4KI5E 1J12A 3KYNA 1XT5A 2FD6H 5D1QD 3E0GA 3WIHH 4DOHB 1WBYB 4KQ3L 5EZJA 1U8PB 3HZKA 4NFCA 1C5CH 2QR0A 4HGWB 1CDUA 2NY4B 5E94B 2Y5EA 3QUZB 1KN4H 5AEAA 2W0LA 5ENWB 4JG1H 1FNFA 1XGPB 3QUMA 2DQJL 2CRIA 2CLVA 3AREB 1MFAH 2J8UB 3WXWL 2A6JA 3BIKA 2QSCH 1WT5C 2MOVA 3B2UD 3FN9A 2P1YA 2YXFA 4C55A 5A1AA 3QPXH 4FQPA 2V6HA 5L88H 1FNGA 5B39A 5J11B 4I77H 3F7VA 4LMQI 3SDDC 4YXKH 1CTNA 5J6GB 1NLBH 3F62A 4XCEB 2BNUA 4GJTB 1BMGA 4L4VE 3G04B 1UADC 1JGVL 1RZJC 2XWBA 4GRWF 4ETQB 4PJ7E 2NY2B 4M6AA 1MCCA 2F8OA 4XBPB 4OLWH 1RK0B 3VRLE 3QJFA 1Q9OB 1NEZA 5D1ZD 1I4FB 3LEXA 2QADB 4JB9H 3P0YH 3RWIB 4C54A 3MRKA 4GOSA 2ICWI 2NY6C 1XZ0B 4Y16B 3AC0A 4WI8A 3ZO0A 3ULVC 3ISWA 4NNYB 5I74C 1OTSC 1JWMA 5DEGB 3TESA 3V4PL 4JFPA 5CHNA 3I6KB 2NPLX 3SDAC 5L7XL 3DURA 1U3JA 3TN0D 3U30B 2GUOB 1CD0A 3RWHA 1FZJB 1F6LL 1K8IB 4LCCB 4U6HA 1BZ7A 5GGSA 1P7QA 4WTZA 4Y1AE 5HHOA 2JELH 4ZFOB 4W6YB 4E41B 1LO0H 2CGRH 2UVEA 1WCQA 5DHVH 5IMLB 4G8IB 4JAMA 4KJWC 5CJ8A 1PX4A 5ACZA 5C0JA 3IKCB 4TUOB 4R7NA 1NFKA 1DP0A 5GGVY 3SOBL 3NZ8B 4JFYA 2HJKB 2ZG1A 3C60A 2VR9A 4HWBH 4XMPL 2G2RB 4LSPH 3MCLL 4U1GC 2ADFH 3T0XA 3FQWB 3IF1B 4MQTB 3VWKA 2Y6SD 1J5OH 4E0RB 1X5KA 1KIPB 2YPVH 3ULVL 5IWLA 4OZHF 1FYTD 1HYRC 5E5RB 1MI5D 1RULH 2F19H 1S7TA 2WUCL 4FQQA 3HNSH 5MP6L 3R8QA 2YKLL 3OAZK 5C0NC 1EVTC 3STBA 3L3GA 1X5YA 1ZHLB 5CIPH 3EDJA 5E2UH 1AJ7H 1CT8B 4Y2DB 1A3RL 3ZDZF 1K4DA 4CMMB 2N7AA 4Z0XA 4HEME 3NAAL 1UH2A 1S5IH 1F11B 3OAUH 3TPKA 3GMRB 4HZLA 2HFFA 2F54D 5I1CH 1U36A 5F7UA 4P3DB 5JIHA 4ZUSB 3L9RB 2IH3A 3CX2A 4I0PB 4ODVH 4QRPE 3WS6A 4LHUA 4N1EA 3SDXB 2JB5L 4XPFL 1JI2A 1N7ML 3P4NA 4R6UA 5GRYA 4XP1H 3O11A 3GEWB 1NFDA 3RY5A 3UBXG 4GFTB 1E6OH 4IMLA 4M8QA 5C9JB 3FQUB 2CRMA 3I6GB 3PGFH 4Y2OA 3LKPA 1O5DT 2FEDD 3ARDB 3T1WA 3DX9A 3WN5B 2OXGA 2R1WA 1XGQA 5DZLA 3T1FA 4M6OL 4I18C 3SE4A 6FABH 4HQQH 1AC0A 5HHVL 3RWJB 4BFEA 1Z0NA 3L7FB 3G6DH 1I8IB 5FO7A 3SKUD 4XXDA 3X11B 1EFXB 1MVFA 1RZ8A 1KPVB 1F2QA 1KJMA 4JFDB 3NA9L 1HHJA 2Z31D 4CJ1A 4KTYA 2LU7A 1MCNA 4HCRH 3LEVH 3U4AA 2L7JA 4FQHB 3QI9D 1MLBA 4OV5A 3OGCA 4PBWD 2X89D 2AXGB 5L2JB 4MJ2A 4K9EH 4LOUD 5LVEA 3GSVB 3RQ3A 3FO2B 2EKSA 4LF3B 3RX7A 1HH9A 1NBVH 1X5JA 4EZMA 3C6LA 5GHWL 4KUCF 4OBSA 4OLUH 3NPSB 3SY0A 1T1ZB 2FYYA 2XA3A 1SM3H 4XNUL 5GS2D 1DVFD 2X1XR 2QKIA 4GMSL 1OSZB 4PV8A 2R9HD 2BJML 5HD8C 2EIDA 4JRYD 4UNVA 1IC7H 3JWDC 1IKFH 3SDCC 2BOCB 5F1NA 3WNPA 4NO5A 1ZSDB 4XB7A 1A6PA 1MWAB 2PYED 3UC0H 4QHMA 1OAXL 3K8KA 1DQLH 2A1WL 3UJTH 4R9HA 1LP9E 1KBGH 5JQ6L 4ENED 3QCTL 4DVBA 2ENSA 3Q5OA 4D0DB 1ZXQA 4YAQA 5MENB 3RWFA 2R0LL 5J9PA 2P5WB 1FDLH 1YEJL 4I9WD 4H5SB 5KJRL 3EBAA 3BDXA 5BZDA 3LV3A 1ND0B 2PW1A 1J1OH 4Y19E 4FQJH 2B8OT 2BVPB 2F58H 5C8JB 3NBNA 4M5ZL 4I48A 4PJAB 5IQ7H 4YLQT 1MJ7L 3OR7B 3V5HA 4XMLL 2PO6B 3F12A 5D6CA 3DHMA 1XGRB 2DJSA 3JWDL 1Q9LA 1J05B 1XF3B 4NM4H 3TBSA 1E4WL 2XA8H 2R0WL 5FOBA 3MA9L 1NFDF 1ZLSH 3VI3E 3VXRE 2Y9RT 1M05B 1S7VA 1KJ2L 4H1LA 3PWVB 2ADJB 1QBAA 3INUH 2BNRD 2YUZA 1CZ8L 2V2TA 3WLWD 4R26H 3WXVH 4R4ND 2CMRH 3IVKA 3UPRB 3V8OA 4DGIH 2AK1H 1AR1C 1EO7A 3V7MA 3QNXA 3WL9B 4LCWD 2MCG1 5C71A 5HHMB 4HWEH 1P4BH 5T5FH 1HKFA 3CX5K 3MLYL 4OGYH 1JMZA 2FBJL 4Q97A 4FFVD 4QHNB 5C3TA 3U9UA 4NRYB 5DS8A 4OZIE 3VD5A 2HT3D 5DLMH 1QR1A 3I75B 4D8PA 1HSAB 1VERA 4PR5A 5I6XC 2VDQH 5LGHH 3OJVC 1Q0XL 5SWSE 4DJMA 2MQCA 4YHZH 4NZDA 1I3RA 3RWDA 1PQZB 1AD9A 3RWGB 3WFHA 1EIBA 1KGCD 4N5EC 2EDEA 3MXVH 2FX7L 3G5YB 3MLTB 3SGJA 1DUZB 1HOCB 3PHOA 1PZ5A 3HFMH 4A2LA 4LLWB 1UZ8A 4ZS7L 1I75A 4M9PA 1LVEA 1S8DA 4DW2L 3QULB 2X4PB 3LDBB 1BJ1J 4WV1A 5DEFB 5EZLA 1IC5L 4J3UA 3AAZB 4PGJA 3SDYL 2CSPA 1F6AA 3BKYL 1BAFL 3N1MC 4X5WA 1IM9A 5FKAA 4NBZB 1A7NH 2EXYD 4WFHE 2FDBP 4WHYH 3FONA 1J8HD 1JYVA 2VXTH 4CADA 5HYJB 1EX0A 3VG9C 1JMXA 4M7ZC 4HLZG 3VXTB 3S35X 4YDLC 2BFVH 2YA1A 4JANB 1KT2B 4WTXA 2F53A 4PLKC 5BV7H 5EU4A 3O4LA 3MR9A 2AAVA 4Y5YB 4HUUB 4EEEA 4LEOB 3TIEA 4XMKL 4N9OB 1B88A 2LFGA 1NCNA 5F9AC 1INQB 2PXYB 1AXSA 1OWWA 3QUML 4BFBD 3ZT5A 4NP4H 2CK0H 3BWUC 5F9OH 1WJ3A 1ZTXL 4DZ8A 1NGQH 2XOTA 4FQ2H 5BV7B 4YK4B 4MWFA 4F7PA 2FSEB 3BEWA 5DUMH 4BH8A 4JPWL 2DWEA 2VLRB 4M93B 3MGTA 3LSOB 5J1SC 1A1OB 1N59B 5AAWA 3UCRA 2Z35B 3KWWA 3ZYZA 5GGRB 4RMTA 2OI9B 3Q2CA 5K9QI 4C56E 4NC0B 3QPQD 2KUTA 5F8QC 2WLYA 4O51A 3C60C 4O2EB 4NNPH 2NY0C 2WK2A 3HI5L 5DC9B 4URTB 4LSRH 4WW2A 4FABH 5GS3A 5FK9B 3VWKC 1K8DB 1RJZB 2F8XC 5LQBL 2IPTH 1CDBA 1W8OA 4EI6A 4LVOB 5L0QC 5C0FA 5D72H 5DD1H 5IWLC 5DJCA 1IAOB 2IH1B 3B9KD 4PJHB 1LE5A 4R3SA 2DYPB 4WUUB 3RP1A 2G5RA 1WWWX 3T2QA 2Z9TA 3OPZL 3P4LA 3VFTB 3RWCA 3ZDXE 4G80A 5EOTA 1AHWB 4YHPB 4M6MH 4RA3A 1S7XB 1LEKA 1TZHA 5BRZA 3A6CH 3BP6A 1NANH 3D3VA 5IFJB 3BXNA 4IRSD 4NYLA 1NDMB 1ZA3A 2W0PA 4PRHA 4YHLH 3V8CA 4PB9L 4F15B 1KCUL 2MHAA 3DIFB 1DBJL 1H3TA 25C8L 1WWAX 4HPOL 3UTOA 4QRTA 4X98B 2NXYD 2H6PA 2OL3H 3WS6C 3UJJL 3KPRD 3WCYA 4KV5F 3FQTB 4WDIA 3QIBB 3DX7B 2IPUG 1YN6B 1MVUA 2WV3A 3BE1L 3HG1D 1ZT4B 2YZ1A 5FA4A 3JUYA 1CL7L 1CE1L 3MBXH 3VMOA 5MERA 4MNQA 5CKAA 4Z76B 4G8GA 1Q72H 2HT4C 2GFBB 4DKDC 2IAMA 2R4RH 4YPGB 5TDNB 4MD4B 3B3IB 4UOW1 3B5HA 3SE4C 5C0DA 5D7JD 2XTJB 4XZUB 3PHSA 4JN1L 3SQOL 1M6OB 1AXTH 1VPOL 2WM0A 4FNLL 5A2FA 5IHLB 4G6JL 1TENA 4MQXD 2P8LA 2R69H 1UT9A 4JQVA 4Q58C 1JI1A 3OAYH 1LDSA 1BVLB 1YMMB 4MCZA 2H2SD 5CP3H 3RIFK 1RHHB 3W9EB 1WIOA 2IWGA 2V7HB 4I5BA 3ZDYF 3W0WB 3ZHLA 3VXMB 4G6ML 3GSOA 2DICA 4UIMA 2M2DA 5EU6A 2F15A 3VRIA 4JM4L 5HGGS 3C6LC 4JO2H 4MZ3A 2A74B 3TNMA 4W6WB 3U0PB 2DMBA 4JO4L 4ZNEE 4G43A 5E8OA 4WW2F 4Q6YA 3DV4A 2CXKA 3ZL4H 3AXLB 1XIWA 5F7DA 1YPZB 4LHQB 1XCQA 5IEKA 4G3YH 1JGDB 5EU7C 1ZT1A 4U1MB 5C0RH 4DGVH 1A6ZA 5KSBA 1EJOH 5DD5L 4X6FA 1QP1A 3L3HA 3BPOC 1KLFA 4YWGL 1FFNA 3H42L 4G8FB 1J1XL 3O3DB 2QSQA 4WU5B 4FQXB 5IMOA 2I5YH 3EYSH 2F5AH 2H1PH 1BIIA 4XP5H 4EJ1C 4XP4L 2XG5A 3QHZL 2HH0L 3S36H 3NABL 2VH5L 3HE6B 1A6AB 4NJ9L 5D7IB 4ZAKD 3PNWA 1I3VA 5DRNB 4OLEA 3C5JA 2O93L 1VFBA 4R2GB 3O41A 5IJVB 1MHCB 5LJYH 2J3SA 5GQBA 5HVHB 3GKWL 2ZPKH 1NSNL 1MLCB 3WHXB 4CNIB 4PJFB 1H8NA 1ZOXA 2MCPH 2AJYH 1CLOH 1F5WA 4Y5VA 1G7IB 4NQDB 3SKNA 4QOKB 3TH3T 1E4XI 4U3XA 4J3SA 4KRLB 1XR8A 2D7TH 2H9GB 4HUNB 1MQKL 5CZXC 3K4DA 4DKAA 5F3BB 1J7VR 4ZTPH 3T4AB 3JTSB 1MQ8A 2EDNA 5F3HA 3V95A 3HMWL 1JPST 1CN4A 5IV2A 4YFLF 1I1RA 5FYKL 3K1KC 3ZHDA 2CH8A 4XNYL 4L8SA 2DTSA 2AK4A 1U58B 2UZXB 3GSNB 3NACH 5JW3L 5JW4Q 3WIHA 2AI0L 2CIKB 4YHKH 2R23A 4V1DD 1MPAH 1LEIA 2E9JA 2UUDK 5C08B 4OBRA 1SBSH 5KANG 1OD9A 4F2MA 2HLAB 1DBAL 4LPUA 1SMAA 3MRDA 1YQ2A 3GO1H 4U7SA 1NBZB 4MD5A 5E8NB 3SGJC 2OJEA 1CDYA 2ZUQC 3QIWC 1C08B 4OSUL 4FZ8H 4GW5A 3U0WL 2B4CC 1I4FA 3AGVA 2LTQC 1I1FA 4YX2H 2V5TA 3LIZH 4PJ5D 5L8KB 2AXJA 4XPBH 4LIQH 2WIIA 4WV1C 4S1QL 5CUSH 5E9DA 2EICA 2R39A 4R7DB 1OAKL 4I8DA 4PJCE 3WYRA 1EZVX 4ODTH 4RZCB 2FJFB 3OHXB 5KSBF 4JY4A 1P4LB 1ONQA 1E4JA 4RGNC 4YO0B 2VLJB 1V7ML 2Q3ZA 5LGJB 5M94B 1RU9H 4XVTL 2VXSL 1T89A 1VGEH 5DI8A 3V0VB 2FLBT 5DRXA 2IPKA 2XG4A 5ETUB 4S11A 2RFXA 1P2CA 1MFCH 2GITA 1A7PH 3R1GH 32C2B 35C8H 1F02I 2ED9A 3B6SB 4PRIE 2OP4L 4P2OD 2O5XL 3WD5L 4X0KB 3AMLA 3STZA 2A6KB 2FHCA 3LKQA 3CFBB 1KTRL 2KZWA 3RGHA 2VJXA 3H7BA 1HHHA 1RURH 5DHVA 3RTQA 1GZQB 4DFIA 1INDH 3VA6A 4LKXB 3ULSB 2IBGA 3VXSE 3DX8A 1J0HA 4CVXA 3LRHA 4WU7B 4HWBA 2XN9D 5I2IA 1W0WB 4OGZA 4Y4FD 1UM6H 5GGUA 4ZSOB 3VXUA 2Z4QB 2LVCA 2GK0A 3B83A 5K9JH 4ZUWB 1I7UA 2PTTB 3MXWH 4C83A 1HNGA 4WW2C 2XT1B 5DC0A 1CG9B 5FO8B 3HR5B 2EDHA 3RDTA 1M7XA 1CD8A 1WIPA 4MAYA 3TO4D 5HI5D 2X4RB 2AEQL 4K7FB 5MEOB 2I9TA 2NTSP 2VYRE 5T1MA 5DK0B 5E4EC 1LDPH 2ICEA 1AIFA 5CIPA 3T0WA 3KS0H 3CK0L 3D39D 2AERT 1XH3B 2IALA 3OF6D 4OCYH 2C3XA 4HH8A 4XH2A 4H8WC 4NZTH 4NKIH 1IILE 4P5MA 2ZG3A 2FB4H 1JGLL 5IEHB 4UDUA 5JDSB 4KKCC 5AZ2H 3QEQE 1JCKA 2W1NA 3CZJA 1XGTA 1IGML 2CUMA 3EO1B 5D1QB 5MEPA 3RVWC 1S7QA 3BZ4B 1I8MA 1RZFL 1WC7A 1R3HB 4YC2B 3LHPL 2HTLD 1EFXA 4OKVA 4PS4H 4PGDB 3IDNA 5DTFA 3MV9A 4NN5B 5TF1H 3VGDA 2K7PA 2HKHL 3WLBB 5DQJB 2W60B 5E03A 1YY9D 3TV3H 3GMOA 4D0CB 1MNUL 2Q86B 4F7MA 2AXGA 4GBXD 2P45B 4H8WL 5F7WC 4HT1L 1JV5B 1RZKH 4HIEA 2IAMC 3FFCE 4I4WA 5ADOL 4HFUH 2DLIA 1ZLWK 3RRQA 4LASH 3MOAL 1JP5A 3H9HB 3O8XB 2UV3A 1VFUA 2ADIA 2IC2A 5FKPA 5CJOL 3PGDB 4HCRA 2EYRA 3DRQB 2ZNXA 1DL7H 2VNCA 2X10A 4JQVC 4EDXB 1OAUL 1D5BA 4HXAH 3MUJA 5TQ2H 1JUFB 1C1EH 2AABL 2RIKA 4OZGA 2LQRA 4FQLL 4PJGE 3RPIB 2BOCA 4UTBL 5I75B 3H9SD 5HVFB 3OTTA 1B3JA 3OWEA 4N0FB 2VO5A 4X7TA 2DWDB 3OX8A 4JR9H 1GIGL 1YJDL 3LH2H 3UBXB 4JHAL 4YBLC 3BP4B 1XGYL 4P57A 1DLFH 3TN0B 1ZA6B 3GZKA 2KH2B 2X1QA 4JHWL 4QF1A 1MCJA 1U8MB 3A6BL 4WFEE 3WUZA 3PHQA 4KK6C 2KPNA 2WINA 1XIWC 4OM0L 4L5FL 5E24E 2DQFB 4PG9B 5I73C 1TVHA 3BKJL 3UTTD 5IVZA 2C3VA 4K23H 3HA0A 4KK5D 3Q1SL 4XNZC 4NQED 4BK4A 5E2VH 2IMNA 1BFOB 1OTUC 3PV6B 3A67L 4KPHH 2B0SL 1ZANL 2ATPA 1FYTB 3U1SH 4O4YL 1MI5B 3VFUA 1M05A 3OKMB 2QQNH 3RGVD 5AG9A 1KN2H 4ONFL 2MQ0A 3UTSA 1KJ3H 5KVFH 5IFAL 1F3JA 4D9QD 4QGYA 4P5TC 4DTGH 4KI1A 2HJFB 1QBMH 2A73B 3REVA 1GH7A 4NGHL 1UWEL 3BN9C 4KKNA 3VDAA 1WAAA 5E8PA 1QNZH 3E8UH 5JXEA 1AO7A 2FEEL 5HBBA 3QXAB 4XBEH 3RVTC 4DQOL 1HI6B 5FHBH 3FTGA 1VSCA 4PRPA 1IM3B 4KKLC 4Y5VC 2NNAA 1E6JL 1JGEA 1TTUA 3BMWA 3WKML 2GHWB 5T3ZE 2F54B 1NQBA 2HRLA 2NZIA 5C1MB 2AEPL 3SCMB 4U4BA 1R3LA 1UFUA 3ZT6A 1A0QH 4NUGL 1QO3A 5C0BA 5DJYB 3P4MB 4JDVB 3BUTA 3D0VB 1JPTL 3V5KB 4PRDA 5DMJB 3C8HA 1OVZA 4L8SC 1YN7A 4HIIA 4RFOL 1D7FA 3WIFA 1MRFL 1U3YA 4IRJA 2ZKHH 4I2XB 4IIQC 5C0AB 4WHTA 1R5VA 1YEFH 4OCMC 4LNVA 1GGYA 2DQHL 1ETZB 4X99B 1N4XH 4OZGF 1A9EA 3T08A 3FRUA 3RBSA 5I1GH 1CVSC 3TT3L 4NNXB 5I8CB 4N0YH 3TT1H 3ARVA 5ITFA 4S10A 1PYWB 1H8SA 3EO9L 3W11C 1FG9C 1YNTA 1LNUB 3MLZL 3Q48A 1MFDH 3D5OF 2P48B 5J56B 3GBMH 4H20H 2Z8RA 4ZQKA 4U0RB 4H0IA 3UTPE 2VQUA 1UM5L 3KPPA 3VXPB 1HXYB 3QI9B 2PTUA 3KYMA 3T0AA 4ZTOL 5FV1L 1F6FB 5C70A 4AENA 4L4VD 5D7SH 3WKNA 2XPGB 1INQA 1JL8A 1W0VB 1DLHB 5DJ0B 3MV01 5C0IA 5IOPB 1OPGH 1I3GH 1BD2B 3GB7A 1Q94A 1I1CA 2FD6L 4J4PA 3SPVA 3TPUB 2D7PA 1F42A 4G5ZH 4Q0XL 5E95B 1RZIA 1U8OA 4PRNB 1C5CL 1E4KA 2XRAH 1QQDA 3SDDD 1KN4L 3M17B 3QDME 1KTLA 4NQSB 1IE5A 4XHJC 4XVUC 1T89C 1DVFB 2QQKH 4JFOB 3ARGD 5B3JE 1NCAL 2PN5A 5I8OL 2CR3A 4YXHH 5FXCH 5ID0B 1BZ9B 2VDRH 2BVEA 3QQ4B 4QRRE 2GT9A 2QSCL 5K93A 2E6PA 3IFLH 3QPXL 5C0CD 2KKQA 2PYEB 3T0EB 5L88L 4FXKA 4I77L 5EIVA 4Y1AD 2ZCLL 5BVJA 4HLZH 5IG7B 4YXKL 1VADB 5H35B 3ZE1F 5IBLC 4TVPE 3FN0L 4MJIA 1KCVH 4RX4A 5EBWA 4EI5A 1EGJL 2NY6D 1IBGH 1WAAF 3CH1B 3RTQC 4HKXA 1OB1B 4GAGH 5KAQG 1MIMH 2J6EL 4PJXB 4GAJH 4CW1A 3WO4B 2A9ML 3SDAD 4OLWL 3KPMA 1GC1H 3IXAB 2JB6A 4FQCH 3P0YL 4JB9L 1JYNA 3FT4A 3ARBD 4YHPA 1GCFA 3TCXA 3HZYA 1CBVL 1CD1B 2J8OA 4PREA 1HHIB 3H0TB 3RDTC 1AD0A 4MAYC 4KMTH 5HYIA 3F7QA 4LCUB 4MDIB 4YUEH 4D9RE 4JFEA 3MCKB 4CL7A 1IT9H 2BOBB 3DXAA 1IARB 1EDQA 4IS6A 2BNRB 2JELL 3BZDA 2EXWD 2IFGA 2FWOA 1U8HB 3SJVB 5I1EL 3SKJL 3FQTA 1VB9A 3DNKA 3ETBF 4M00A 1IEAA 3QNYA 4LSPL 2DN7A 4Z77A 3P11H 4XAKE 5C0ND 2YPLE 4QRPD 1QRNA 1J5OL 2OL3A 4XPTH 2C7UB 4YDJB 3VFGH 5BZWA 3CVHB 1RULL 2F19L 3PL6A 3EYFB 4ZNCD 1KFAL 3HUJB 3QBTB 3HNSL 4NZUH 5E99H 1NPUA 4NRZA 3MRHA 4DCQB 1BJMA 4KUZL 4L3CA 2BSTB 3KPSE 3FQNB 5I8EA 5E2UL 5GRVK 3U0TB 4HHAB 3VCLA 2NQCA 3GM0A 1RMFH 3MJGX 3W9EA 1EH9A 3MA7A 2VC2H 1AGDA 4L8BB 4NHCH 5C6PB 3MRCB 1VGKA 2VZOA 3L3OB 4MVBC 5DXWA 3IB4A 4QRUA 1S5IL 3OAUL 3RKDD 3IJYB 1SHMA 2JJTA 3L6FB 1B9ZA 3QO0B 2X5PA 4OUUA 1J8HB 5EO0A 1DQJA 1N8ZB 4ODVL 5HHPA 1QSFA 5CP3A 5ESAB 4PP1D 5INDB 3QFDA 1J0YA 3NZHH 1NGWA 3MJ9L 3QIUD 4D94A 1BIHA 4K9EC 2JK5A 3F65A 1JZ7A 2AJ3B 5A16B 4LLDA 1T7ZA 4U1KA 4J6RH 2PCPB 1HILA 2IQ9H 1JPFA 3FRPA 5H94A 5KS9E 2G9HB 1AFVH 2IANA 3PGFL 4YIQB 1PKQA 3QFJD 4QWWC 4RMRA 2GAZB 4YBHA 2JF1A 5F9WC 3KNBA 1U6AH 3P77A 1XR9B 2E8ZA 1KF9B 3G6DL 1F3DH 4NFBA 5BS0B 1ES0A 1JJUA 2D31A 3FB8B 1T1WB 5MI0C 1QSEA 4EOWL 5AG8A 2CJUH 3ES6B 5LG1A 4FTVD 5D7LB 3LEVL 5DD0H 3CDGB 5IJVA 1MUJB 5DZNA 1A1NB 4N5UA 3S36X 3PWPE 4GXVH 4DZBB 4JZJA 2E7BA 4I0KA 4XPAH 5HD8D 2P7TB 1NBVL 4BFIA 3TWCH 5IB1A 3UROR 2COQA 2EEBA 3QYCA 3WS3B 4Y19D 1RAMA 1OTTD 3O2VL 1MWAL 4PLNC 4HKZB 1FZMB 5CMAB 4JPIB 3B9KB 4OLUL 3L5XH 3UYRH