5D1ZD

Isdb neat1 bound by clone d4-10
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
230
structure length
230
Chain Sequence
b'QVQLQESGPGLVKPSETLSLICTVSGGSISSSSYYWGWIRQTPERNLEWIGIIYFSGTTYYNPSLQSRVSMSLDRSTNRFSLRLSSVTAADTAIYYCAKPKSRDRGGPGDDYFGMDVWGQGIMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Y10 Light Chain
publication title Germline-encoded neutralization of a Staphylococcus aureus virulence factor by the human antibody repertoire.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 31
structure length 230
sequence length 230
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d1zD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d1zD01
4Y1AA 5CHNA 1UG9A 4PY8J 4PJGF 2OJZH 3MODL 3QSKB 3U79A 3KJ6L 4P4KA 4S0TD 2E9IA 1BZ9B 5E00A 3BDYH 1CIUA 4XPGH 5DEGA 2X4PA 5IBUG 5D7JC 1CE1H 1U3HC 3C5SA 3IDIA 4F3FB 1SHMA 5HVGB 4NO3B 3WIIH 1B2WL 1MVUB 3HE6D 3ROLA 1LP9B 3HR6A 1N0LA 1F3DH 4PJDE 1KEGH 4QO1A 3U0TA 5HI4C 4Z6AT 1P5VA 4JZJB 3MV9E 4JHWH 4MXVE 3MLSL 4MJ6A 2DL9A 1A7QL 4GUPA 3C9NA 3GMMB 4YE4L 1WQVT 4K71C 3EDFA 4X6DE 5DR5L 2CDEA 3QXUA 4JFEB 3WN5C 4XP1H 2UY6A 4I18A 3V2AR 1HI6A 4LGRB 1GCFA 2BCKA 2FZ3B 4P5TD 1IAOA 1FIEA 5DQJB 3NCYP 4Z78A 3U1SH 3C60A 4JHBA 4WHTB 5ERWB 4EJ1C 5GJSL 4B7IA 1C12B 3FO9A 3RFZC 2DS4A 3SE8H 4KHTL 4LLQB 4HWZB 4FG6C 3X12A 1MWAB 3FN0H 3VXUB 2D9CA 2QQKL 3RL2B 4OCWL 2VLRA 3C5JA 1I8LC 1SJEB 1UQSA 4LLYA 2XWJA 4LSRL 1IC1A 4HG4K 4XVJH 3JVGA 1H3XA 2W0KA 4LASL 4KKLD 1CI5A 3RIFF 1QR4A 2GSIB 4M6NH 3FQXA 2W60B 4H8WC 4RRPA 1A4JA 4D0CB 3NCFB 2Y5TB 4KRPD 4L9LC 4U1SA 4M4PA 1ZA6A 1I85C 4R4BB 1S7XA 1VFBA 3RWIA 1LMKA 3OV6A 5C0CD 5DI8B 4ENEC 3B4NA 4MYWB 1B4JH 5J1AA 4H0GA 5EIIA 4P3CH 3VFNB 1KIPB 4AENA 3IDYB 4HGKC 5IMKA 4OFVA 3PHQB 2E7MA 1A5FH 5L88L 2MHAB 2FLRT 1OAXL 1PG7W 4P2OB 4EXKA 2AEQH 4NRXB 1IFHL 1EFXA 5FAAA 4JFEE 4YDIL 1XT5A 3DUUA 3OPZH 4MNQE 5F3HB 4XH2A 1KJ3H 4ZFZB 4RGNC 1IEBA 1HNGA 1BQUA 4X4XB 5GGSA 4IMKA 1X6LA 3ARWA 4JG0H 5AWNH 2J8HA 2Q7NA 1D6EA 2BSED 5HGHB 1FBIH 2Y1VA 5I74B 3T0VA 5I30H 4JRYA 1UM5L 1MAMH 1OW0C 1CR9L 3BWUC 3FCTB 3QQ4A 1QOKA 3G6AA 3IF1A 3V79C 2AJ3B 2WNGA 2YBRB 3TVMB 3SKOB 32C2B 4UTBH 2WLZA 5HDBE 1U93A 3KPPB 2R2HA 2FECI 4KVCL 5D2LA 1LO4H 1TQCB 1U8HA 3M8OL 3C09C 1RURH 2VDNL 1GPOL 2XTJD 2NY3D 5DMJB 4WO4B 4G6AC 2HG5A 1WAAA 2PXYD 3BISA 3T77B 3O11B 3NZ8B 4IIQC 3PV6A 5F21B 5EBMA 4LVNB 1R3LA 3BKJH 3MNVA 4OF8A 4YHIA 5TE4H 1GC1L 4I9WE 5I1JL 3BH8B 4Z7VA 1J0HA 3MA9H 2P24A 3BPCA 4F9PC 3SGJA 5TH2A 5IQ9A 3HS0B 1WZMA 1ZANH 4OIIH 4PY7A 4LIQL 3V6BR 4RQQB 5I75C 1WFUA 3T2OA 1T22A 3ZTNH 3V4PL 4PJXF 4JCLA 3P30L 5DS8A 3TIEA 5HI3C 4MD0B 5K59F 1I9IL 3VWKA 4YQXL 5IMLB 1Q38A 4IDJH 4H8WL 3SE4C 3DVNA 1ZS8B 1MCJA 3K4ZA 1LNUA 2JE8A 4AMKH 3WFEL 3CK0L 1XF4B 3EO0A 5DRXB 3WNKA 1FIGL 1JCKA 3GBML 2ITCB 4OFIA 5GGUA 4WW2F 4L4JA 4MAYA 2I25N 5T33H 5F96L 4JGUA 5KAQF 5E8PB 4KJYB 1Q9WA 2EO9A 3HE6A 4Y0GA 1S7SB 2DQJL 3ARQA 1R5VB 2O5ZH 3CMOH 3TNMB 4HW6A 2BDNL 1MFAH 3GSNB 3MCKA 3OF6A 2EDNA 2E6JA 1MCFA 2JJVA 3HNVH 3O41B 4XPHL 3LRGA 4N8PA 1JYNA 1MCPH 1T20B 1IGML 3UTZA 2FH8A 1NGQH 2Y07H 4TSCH 2J8UA 4PJGB 3K8KA 4HC1A 1R5WB 3P9LA 1M4KA 3RWHB 1Q9LA 1X7QA 3TJHC 4Z7QE 2FR4A 3EYQD 3QUMA 4HDIA 5IB2B 5M95B 5I16A 5DHYA 5FV2A 5D1QD 2OQJA 4ZD3H 4XXCA 3FONA 1BIIB 4WUKH 1JGVL 1YEGH 4P2YA 3RL1B 4WGVB 4AEEA 4ZUVB 5DURD 4LNRB 3EYSH 5JTWA 4Z0XA 1U8QA 2ZOLB 5TDPA 4YHKL 3QO1A 3MLTA 4PGJA 3ES6A 4Z7WA 1A6AA 3LKSA 2J1KA 4R2GD 1L7TH 1HXMB 2EC9U 3DVGB 4LEOA 2XOTA 4KMLB 4JRXD 4OF5A 4JFDA 5GPRA 4CDHA 5ACLA 1PG7H 2ZCKL 5EOTA 5H8DA 4BUHA 3C6LA 1JFQL 3CVHH 2B8OT 2AAVA 1ZEAL 1MCHA 4YHOH 5DJ6B 3MRFB 4FZ8L 5GGQL 1IM9B 4N0CD 3OZ9H 4MWFB 2CK0H 1RZIB 2VL5A 4UAOB 5JO5B 3X11B 3BZFB 3GBNL 5C0CA 2BFVH 2OM5A 1XF1A 4FZEH 4RFNC 1JHLL 1GGBH 3GSQB 3K1KC 5A1AA 4JANB 5D72L 4JLRB 2HVKB 2VZUA 1RJZB 1T83A 2JTDA 2VLKB 3MUGB 3RDTA 1T7VA 5ESVB 3QCUL 4HIHA 3SKUD 1I3GL 2DQEH 3HAEA 2ATKB 4ZDHB 1KG0B 1RU9L 4GMTH 1OT2A 2NMSA 1G7JB 4QRQB 3BGMA 3FB8B 5GS3A 2YD4A 1S9KC 3FB6B 1YEIH 4OZ4A 4PJBB 3DRTB 1FNLA 1NCDL 3ILQD 2XZQL 4GG6E 3DV4A 5ITFA 3H3BC 2Q3AA 4PV8B 4DZ8A 1MHEB 1HWHB 5I8CB 4QWWD 3RVTD 5GS1C 1W8NA 5KSAD 5JW4Q 2F5AH 1ACYH 3EW3B 1ZT7B 4YIQA 4LF3A 5ID1B 4CMMA 1Z9SA 1JMZA 4LARL 4PJ5E 2D7QA 3U4AA 4V2CB 3LV3A 3VFUB 3RWFA 2ZUQC 4XPAH 1Q94A 3QBTB 4OD2A 3MRLA 1YEDA 4P9MH 2HKFH 2A6KA 3MUZ1 5B22A 3DGGA 2UVEA 5FKPA 3ULVD 1E4KC 3LEVH 1FVCA 5I1CH 2VABA 4KI5D 4NJ9L 1AD9A 4Y1AE 1HZHH 2EDXA 1I3VA 3AMLA 3EO1A 5HHNB 4G7VH 2AK1L 3V6FA 5KBNC 1N59B 1D9KA 5INCB 3HN3A 5JHLL 5KSVA 1MSPA 5HYSB 3LQAH 3QIUD 3OKNB 3MOBH 4FQXB 1CGSH 5JHDD 3V9FA 5GS0H 2VLKE 4LHUG 2IPUK 4L8SA 1EUUA 4UI2A 3TO2B 2DKUA 3GK8L 1UKQA 4P59L 4RCAA 3GI9L 1CFSA 1U91A 1V05A 3ARDA 4L3ED 4IOFD 3BT2H 2NY7L 4P57A 5ILTH 3FL7A 4KHXH 2VDLH 1FNAA 1UEYA 4JFQA 4WUUD 4N1HB 5ECJE 4NBYB 4R0LB 5FYJD 5F7FA 5M94B 1CGWA 4N0UA 3OTTA 1AGEB 4M6ML 4GBXD 4MA8L 4D3CH 5IJKC 1WITA 4MDJB 3UCRA 2K1MA 3RGVB 3NBNA 4TULL 2B1HL 5EZOL 3AREC 4G8EA 3MRCB 3P0VL 5IOPB 2XKUA 3BHBB 3GKZA 4K7PL 4WWKA 4O2EB 3FQUB 4ZS7L 2BNQB 2V7HB 4WIQA 4YDVA 1YEHL 3AXLA 1Q0XL 3TZVA 1B9ZA 5TQ2H 2Y23A 1SM3L 2DWDA 4HWBH 2NCMA 4MDIB 1IQDB 2AI0L 2DDQH 4Q9BA 3QQ3B 4G7YL 1P4IL 5F7KC 4HUMB 5E8DL 4PJXB 3RJQB 2AJZB 4O58L 4FTVA 5DD1H 1GYAA 2SEBA 2I07B 2VN7A 3SDCB 2FLBT 1FFNB 4MCYB 4ZTPL 3WYRA 1NGXA 3WLWD 2J12B 3FZUD 3TN0D 1T5XA 3PP4L 2NXYD 2EDOA 1NL0H 3WBDA 3MLUL 3D5OF 3IU4H 1JV5A 3SPVA 4ISVB 3CJJA 4CN1A 4KZEL 2DYPD 5EN2B 3PWPE 4KJPC 4LCUA 3S5LG 2OP4L 4JRXA 4JO3L 4XCCL 5LGKA 1ZWIA 3BEWA 4OZFA 3S88H 5HD8D 2HN7A 5H2BB 3TBYB 4NQEA 5MERA 1EERB 5E7FA 5JNYB 1SY6H 5D7SL 1VPOH 3VW3H 3MYJB 1YDPB 5ESQA 4OV6F 3VG9C 4O5LH 1NANI 4EUPG 3MRNA 3HE7B 1PSKH 1Q1JL 2JCCB 1Z0MA 3KDMA 1H15B 1SYVA 2MPAH 4V1DB 1CFTB 4KMTH 1ED3A 3GSUA 4GW1B 4KY1H 1HKFA 2QQQA 3P9WB 4FQ1L 1FYTA 2HJFA 3O2WL 1U3JA 3UZEA 1H3PH 5FCUL 3CLEL 3EJJX 3FT2B 1S7TB 2AXFA 1TVBB 3GSOB 3L6FB 4I0KA 3QA3A 4H25A 4JE4B 1OTSC 4PJ8D 2ARJQ 3WE6B 5FGCB 2FJFA 3CFJB 4H1LA 3W82A 3ARGC 4MNGA 4ZUUA 4DEPB 3LPGA 3REVB 3ALWA 4HULB 1WGOA 1BIHA 3KGRA 2EYSA 3Q6GL 4OLZL 3T08A 3PABB 4UDTB 3D87B 3VDBA 1IC4H 4I3SL 3RKDD 4E41D 3KHOA 3VU2A 1QNZL 2P43B 3RVVD 2R29L 4MQ7A 5K9JH 3OR7B 1MLBA 5CIPH 1VACB 3RWJA 4J2XA 4Z7VE 3P11H 4M5ZH 5JW5A 3SCMD 5DJ2B 2RFXB 4X8JB 4DKFL 2HLFD 4L29B 4M5YH 5L7XL 3SE9H 5SWZA 2IPTL 1CE6B 5GRJL 3FQWB 3O6FB 1A6PA 4H5SA 4Y4FB 4YHPA 3KYMA 1DLHA 1KC5L 3FRPA 5A16B 5C09B 1HYSD 4FFZL 2R15A 2X4RA 4PRBA 2W9DL 3RZCD 2NTFB 1ZHNB 3KR3L 2DM7A 5F1SA 3OR6A 3EYOB 3WNPA 3R8BB 4R4NC 4IMLA 1QA9B 4JY6A 2Q3ZA 5C0DA 4XTRD 4HT1H 1QG3A 4G42A 3OB8A 2Y36L 3ISWA 4MAUL 3ULUL 3MRDB 2BNUA 5BOPA 4QHUA 2PR4H 4I48B 1I7TB 2DQHL 4NKIL 1NCBH 3D1MC 3U9UA 3MRIA 4HIEB 1BX2B 2X6MA 3UAJD 2IPKA 3MRRB 4F7PA 5HVHC 4XX1G 2R2EB 4WUUA 4PGBB 2O5XL 4JM2F 3BIKA 3KJ6H 1H3TA 4NO2A 4GBXA 5C0BB 1YC8A 1L6XA 4HUWB 3MPCA 2J8UE 5BMFL 3JBG7 3QDJD 1KPUA 1CGTA 4GG8B 3BP4B 2R2BB 4IJ3B 1A6VL 1B2WH 3PV7A 3I75A 1RULL 1KPRB 2D31B 3SDXA 2CUHA 5C0EB 3N1QC 4CDGC 5DHXB 5FECA 4KTDL 3LVEA 2VAJA 3MLSH 3NA4A 4NZUL 2BSTB 1PKOA 3LQMA 1A7QH 1HH6B 3ZE1F 2OXGA 3STZB 4YE4H 1BF8A 5DR5H 3LKRB 4U6VL 5KG9B 5EC1A 1TZGL 1ETZB 3VI4E 4X6BA 5JR1L 1RZ8A 5D1ZC 3OGCA 1U8MA 4OLUL 3IDJA 1A3QA 4YDLC 2UV3A 2HJKA 5C0CE 2AEIT 5GJSH 4L8BB 3JV6A 4P2OC 2AK4D 3PWNB 4NQTA 2DYPA 4KHTH 2BERA 2Q76A 4PRPD 4ZXBD 2QQKH 4OCWH 2BOBA 1MCIA 3L95A 4LSPL 4QOKB 5IMOB 3HPLA 4LSRH 3W11C 4ZUSB 4LASH 1EHXA 2W0FB 2GHWB 5TDNA 3O2VL 5I74C 4UINL 4MJ5A 5C0NC 3MV8B 2FEDD 4JGJA 1JWSA 2OL3L 1P7QB 2CMRL 4DN4L 2W1NA 1JZ5A 5GS2H 1HCVA 1S7RB 4P3DA 2IH3A 4EUPH 3OKYA 3ZTJG 5IM7A 4NQDD 3DHMA 3KJ4B 1H0DA 3QH3B 4H20H 2PW1B 1Q9OB 5FDWB 3QWOA 1R3KB 3FFDA 1H3UA 1CD0A 3ZKNC 5A2IH 1V7NL 2FB4L 3NIFF 4FFYL 1K2DB 4GAYA 4PRHB 2VE6B 4UTAL 5L88H 1OAXH 4PJ8A 4OCYL 3NTCL 2A73A 1IFHH 2BY1A 1EEUA 3BYTA 4U3HA 3JV0A 5MEOB 4YDIH 2XZZA 2Y72A 1JF5A 4LHJB 4GRLC 3EGSB 3VFRB 4U33A 4X6FA 1ZLWK 1EX0A 4OF6A 2JB6B 2XTJE 1KLFA 2Z31D 3TV3L 1A21A 1UXWB 2YEZB 2Z0BA 3WJJA 5HGBB 3VXNB 1UZ6E 5CCKL 5DJCB 5FA3B 1I7UA 4X98B 4JZJA 4BUGA 4XHJD 1CXLA 1CR9H 1CICC 1OF2B 4ETYA 4YDKL 2DJUA 2H8PA 3SCMA 3IAPA 5C6TL 5GSVB 1KCSL 3X13A 3LZFL 3E3QE 4NP4L 2RHEA 1FH5L 4U6XB 1J05B 3VXSD 4KVCH 3BJLA 3G9VA 3ESVF 1OAQL 3M8OH 1A7BA 2DIJA 2GJ6D 2VDNH 1GPOH 3U36B 3U9PL 2EDWA 1S9YB 5E6ZA 4PJ7F 3P9MA 3MR9B 4Q0XL 4HG4J 2P5WB 4LLQA 1N6QL 3N1MC 2YPLB 4FQHB 4HWZA 5DEZA 3BE1L 4J8RB 5GIRB 1MWAA 3VXUA 1GC1H 3C2AL 3SDAC 3RL2A 4XP5L 5I1JH 2JB5L 4QXTB 3GJFH 2FNBA 1PZ5A 1LK3L 1CD1B 1RZJL 4LIQH 4DCQB 4JZOA 4LVEA 4UQ3A 3V4PH 3IS1X 5IW1A 3P30H 2YD7A 1E27B 4FQPA 1I9IH 4YQXH 4H8WH 1NC2B 3U30C 3WFEH 3L9RB 3B9KB 3CK0H 3QDJA 1I1AD 1AGFB 2N7AA 4NUGL 1FIGH 1VFMA 3GBMH 1HHJB 1AIFB 3VFNA 4LSDA 1I7RB 5F96H 4DQOL 3CDCA 1KIPA 2NZIA 2DQJH 1BJ1J 1BP3B 1M7DA 5EU4B 4WDIA 2YA1A 5FCSH 4LEXL 4QNPF 4Q9QL 2BDNH 4NN5C 2LFGA 3KPRD 3SQBA 2MHAA 4LRNL 2XQYK 5I66B 2YUWA 4NRXA 3TH2T 4XNXH 4NN7B 4XPHH 5DRWB 4YEFA 1NMAL 1IGMH 3INUL 5F3HA 4EI6B 1QLFB 1FFOA 3BWAB 2DRUA 1F13A 5ITBL 1NGZB 2AEWA 5GGVY 1ULVA 2BXYA 1ORSB 4X4XA 2HYMA 4LQ1A 2NZ9C 5KSBE 4KJQC 4MSWB 1YY9C 5HGHA 1MI5D 2V9QA 4YXHL 4XNMB 1Q72L 3TCLB 1JZ2A 2IFFL 4JY5L 3FCTA 5B8CA 2AK4A 4YNYA 2YPLE 1JGVH 2LVEA 4YUEL 4BQ9A 3SOBL 3DX7B 2YBRA 1I1CA 1H3GA 2FJHA 4PRPA 3SKOA 4ZXBA 32C2A 4OCNC 5CUSL 3B9DA 4YHKH 5DJAB 2ICWB 3KPPA 5E0QA 1A6TB 1RZGB 1F3JB 3RUGB 4KDTA 1RUAL 4LCWB 1J10A 3MACL 3PF2A 1I1YA 3QIWD 5HYJB 2YOCA 2ZCKH 1YMMB 5HHVL 2IANB 3Q6FB 4HLJA 2WK2A 1JFQH 1XCTA 4NKMB 2GTWB 3UMTA 4XGZA 2DJ4A 1KACB 1ZEAH 3UP1A 2FD6L 4FZ8H 5GGQH 5KSUB 4LPUA 3MLWL 3ZTJH 3SJVD 3T77A 1M7XA 2QL1A 4NQDA 3T2PA 3GBNH 2AQ1A 2VH5L 4W6WB 2JIXD 3BH8A 2DB8A 4NDMA 3VE0A 3NAAL 4X5WB 1JHLH 3PXHA 1IGJB 1YPZF 2C3HA 4UT6L 3HS0A 5D72H 2FJGB 4FQJL 4RQQA 1I75A 4PRDB 3OKDB 3QZWA 5IK3B 1NUDA 3QCUH 3QXVA 1I3GH 4MD0A 1XZ0B 3HA0A 4OIAA 3QPQC 5IMLA 3KS0J 5ACZA 1RU9H 1ZS8A 4Z5RB 1T3FB 2B5IC 4UDUA 3ULVE 4KROB 5E8EA 4G8FB 1UM4L 1NAKL 3MJ7A 4KI5E 3N9GL 1NCDH 4FQXC 2XZQH 1KJMB 4HZLA 4I4WB 4W68A 3ARYA 1EHAA 2XA3A 4KJWC 3MJGX 1JPSL 2PUQT 3EDDA 3TN0B 4ODBD 4D0BA 4GLRH 4Y2DB 3HC3L 1HE7A 4LARH 3IFOB 1HEZB 5JHDE 5IFJB 1CFNB 1CVRA 2XN9D 3LB6C 1PLGL 3QIBB 4KFZC 4WNQA 2VQTA 4B0MM 3RGVC 3VXRD 1UJ3C 1FVEB 2CJUL 1SJHA 1XH3A 4L3AA 3VXSA 4QY8B 3FN9A 4KUCD 4PJGA 4L3EE 3BAEL 1R5WA 2DQFA 2GEEA 2NX5D 5JW4M 4NJ9H 4WUUE 5GJTL 5FYJE 2X70B 2GJ6A 2NY6C 3T2NL 2H45A 4BYHA 4GQPH 4KKBC 1N2RB 1BIIA 3IAQA 3DYPA 4KI1A 2AK1H 2DQGL 2YS4A 4ZUVA 3T0ED 2HT4C 4WW1B 2DLFL 5JHLH 4X9FA 5IF0B 5AAWA 2ARJB 3BEVB 3RNKB 1BQLL 4GJTB 4ZOCA 2WP3O 1ZHLB 3DVGA 3GK8H 4JRWA 4P59H 2FO1A 3X14B 3GI9H 4P2CG 3MCG1 1HILA 1RQ5A 1T0PB 1HHKA 5DEFB 2CIIA 2NY7H 5DJ6A 4Y19B 1IM9A 5J1TC 4RMQA 4IRSB 3UTSB 3TBVA 4BA8A 5L2KB 1A1NB 5D5MF 5JO5A 3BZFA 2LABA 1CQYA 1KXQE 3G5YB 4M6MH 1F8TL 4MA8H 2AEPL 2ZPKL 4F9LA 2VR4A 4OFDA 1GZQB 4J3TA 3WS3B 3D6GA 4TULH 2B1HH 5EZOH 4XBEL 4PJ7B 3P0VH 4JLRA 2HVKA 2V17L 3V52L 2HFGL 3MUGA 4K7PH 2ICWI 1TLKA 5FOBA 4ZS7H 2LTQB 4CVWA 3KPRA 4NO5B 4ZDHA 1YEHH 1KG0A 3IT8D 1Q0XH 5GSRB 4WU5B 1SM3H 1BWMA 4FXKA 5C08D 3FB8A 5F44A 2AI0H 4PJBA 4Z76B 1JGDB 4NO0B 4G7YH 2P5ED 1P4IH 4FQIL 5FO7A 4G43A 5E8DH 5TF1L 4O58H 3HE6C 3NMEA 2VZ1A 1MHEA 5C0JA 4LGPB 3MC0A 1M7IB 4FXGB 1A7OL 1MI5A 2Z9TA 1A8JH 4UQ2A 5C9JA 4ZTPH 2C3GA 1OAUL 1ZT7A 3PP4H 1AKJB 4XWGL 1JYXA 1WEJL 3QUYD 3CU7A 3MLUH 3EJZD 5ICYB 1QPPA 2CQVA 1DBJL 4BFBD 5HY9B 1G1CA 2WUBL 4HWEL 3VFOB 2IJ0C 4KZEH 4DEPC 3DYOA 4POZC 4P5TC 2OP4H 4JO3H 3QIWA 4ODUA 4XCCH 3BD4A 3DTXB 3VGAC 3SGDH 4RAUB 1YQVL 1QBLL 1A64A 5HHNA 5C0FB 4JQVC 5D7SH 3REWA 4PRNA 4JY4A 2APVA 1N59A 2X1XR 4CVXB 2DWEB 3DX8A 5IFHL 1LWRA 3AROA 1S7UB 5HYSA 2JIXA 3RBGA 4TVPL 2X4OB 2KKQA 5CEZL 1Q1JH 4FABL 3LS4L 3MBED 2ZSWB 5DC4B 4E41E 5K9QG 1QP1A 4Q2ZB 1KFAL 4KKLC 1Z0NA 3UBXG 1IVLA 4HKZA 4YC2C 4FQ1H 2RCSL 3O2WH 1ZK9A 3LHPL 2RAMA 2DQCL 1UKSA 4FFWD 3ZT5A 5FCUH 3H42L 3CLEH 2QHRL 5AEAA 4NIKB 3FQNB 1IGTB 2EIZB 3TWCL 4TNWK 4KRPC 1A7RL 4R0LA 4ZS6D 4ONHA 1OTTD 4BH8A 5I0DA 5J6HA 4ZPTB 1QFWI 4MDJA 1JGUL 1MCKA 2DLEA 4PTUA 2G5BB 1S9WA 2R1YB 3VWJB 3MRCA 2P49B 3QULB 3OKLB 2I26N 3BHBA 3Q6GH 1WBYA 4OLZH 4NKOB 2BVQA 1QFWM 4O2EA 5L8KB 4GRWH 2HRPL 3OBAA 4I3SH 1D5BB 1QNZH 2YMXL 2R29H 1MCBA 2ESVB 4WJ5B 2IQ9L 3MJ6A 4C57C 5FGRA 2XN9A 3BQUD 4MDIA 1IQDA 5IMMA 1CLYL 2NW2B 2L0DA 3VXRA 4DWHA 3QQ3A 4DKFH 4PJXA 4URTB 5L7XH 2IPTH 3ET9F 5GRJH 3LY6A 4E0RB 2PTVA 2LU3A 2NX5A 3AY4C 3QNXA 4MZ2A 4AT6B 3MV11 4UT7L 3SDCA 1BJ1H 1KC5H 2W91A 1FFNA 4MCYA 3NFSL 1QSFD 4FFZH 2DI9A 5B21A 3RY6A 5IVXF 5C3TA 3KXFB 3WCYA 4WW2A 2W9DH 3QDJE 1JZ8A 2VLLB 2VZVA 4OD1L 4U7KA 4ISVA 3KR3H 4NRZB 2WBJD 3BH9B 2VXQL 4Y16D 1G84A 1AGDB 2ZNXA 4OUUB 5LVEA 4HIJA 2Y36H 2WANA 4MAUH 1EXUB 3ULUH 4HKJA 4HC1L 2BHZA 1AO7D 4K3JL 4WENB 4NKIH 2DQHH 2XTJC 2Z91A 3QUML 4KPHL 4OZHB 2NY3C 3FO1B 3TBYA 3AUVA 3WS6A 3TCXA 2PXYC 4KKAC 2O5XH 5EU6B 3VXPB 5F7DA 3MYJA 1MCCA 2A6JB 2P8LA 3L3DA 1J5OL 1FN4A 3HE7A 4ELMF 4IRJD 5BMFH 4JO4H 5H35B 1BAFL 3G6JF 2X4UA 4OZGB 1F58L 4YWGL 3IDMA 1EEYA 5EULV 3L3IB 1H15A 3E3QC 2YXFA 4V1DA 4L8SC 2R56L 3THML 1XEDA 2ZJSL 3H9YA 1A6VH 1KIUA 2AK4E 1RULH 5ABDE 4X5XA 5FYKD 1TVBA 4JVPA 3L6FA 3KPNA 4KTDH 5C08A 1DQTA 4AIXA 5C07D 4NZUH 3WE6A 5CP7B 3E6FA 5EO1B 1NBVL 2IPUG 2CRYA 3RU8L 4U6VH 3B8YA 1TZGH 5DHVB 5LKNA 4HEPG 5JR1H 4UDTA 4GOSA 4LKXB 3ABZA 3KXFE 1HSBB 1WV7T 5AZ2L 1UA6L 1BGXL 4OLUH 1JL8A 2ATPA 4F8QA 4R96B 4NQDE 3QUYA 1CVSC 2ZUXA 3KS0H 4HXBL 4NZRL 1JZ4A 1QFOA 3HLAB 1EBPA 5DJZA 2ZUWA 3S8WA 5F7LB 5JXAL 5DJ2A 2RFXA 1KJ2L 3L3OA 4L29A 4WY7L 1EVTC 2W38A 4M7LT 1CE6A 1SBBA 1W72H 3O6FA 3EYFA 4Y4FA 4LSPH 1JNNL 3EYQC 4OZHE 2DQUL 5CLTA 5A16A 2VWEE 5D1QC 2PW2A 2OK0L 3O2VH 4UINH 1T0NB 2EYRA 5D6CB 3B2VL 2OL3H 1RJYB 2CMRH 4DN4H 2NTFA 1ZHNA 3LQZA 3GUTB 3EYOA 4JFOB 3WFDL 4Y7MA 1F4AA 3ZKMD 3ULSB 3MRDA 4Q6IC 4I0PD 3W9EA 3MRGB 4RAVA 4I48A 5HYQB 1G7HB 1JWMB 2FB4H 2EDQA 4KMQA 3UDWC 5C0IA 2C4FT 1PGRB 1T0MA 4FFYH 3ILPB 3IXTA 2OZ4A 1GSMA 3AM8C 1IAII 3O8XD 4UTAH 5HHPB 4OCYH 3F58L 3NTCH 1BZ7B 5EZIL 3QXTA 3RWCB 2CKBA 4WV1B 5HGAB 1I3RB 3VXSE 4PRIB 1E28A 2LE9A 1C5DA 5E95B 1RZFL 5GGRY 4NNPL 3H7BA 2NY1D 3AMKA 3H3KA 4PJIF 1FLTX 3R4DA 3R0NA 3TV3H 1JGEB 2A9ML 4AEHL 4LPXA 4HIIB 4OZIF 5E4IA 1KPRA 2D31A 5CCKH 8CGTA 4WHYH 1KOAA 4L1HA 5I2IB 3OAYK 3IETB 3PGCB 3SE3A 2O61A 4YDKH 1NEUA 1SYSB 2VN4A 3ILQC 5BZDA 1S9XB 5C6TH 1KCSH 3LZFH 4S1DD 1G9NC 4NP4H 3UPAA 1IKNC 1FH5H 4LDEB 3MLVL 1ES0B 4MD4A 1NBZB 2BNRB 3RVTC 5KG9A 2JJTA 5KSAC 1F5WA 4L4VD 2QSCL 4JM2D 1PQZB 1QSFA 3UTQB 2HJLB 3MRQA 43C9B 1OAQH 3RGHA 3O3EA 2YWYA 2M8XA 1KBGL 1OCWL 4X4ZA 4JR9L 3U9PH 3ZYIA 4BZYA 2EDTA 1P6FA 4L8BA 4YHYB 1RY7B 4Q0XH 2Y25A 2E9JA 2D0GA 4WCYL 4Y16A 1RK0B 3BE1H 4PJ9D 3C2AH 3ULVC 5DJYB 4XP5H 1MHHA 3K2UL 4KI5C 1R0AL 3Q1SL 2JB5H 1AO7A 4QOKA 4QRPD 1NCCL 5IMOA 3SDDD 3U7YL 1S7QB 5IBLD 3JWOC 1S5IL 3KPRE 4Y4KD 4ZUSA 1LK3H 1RZJH 1X4ZA 2E6QA 2W0FA 2XWBB 2AVGA 3MV8A 4UBDD 2FX7L 3HNTL 1J1OL 1CXHA 1MEXL 2CO6B 4ACPA 1FVDB 4P46B 4AIZA 5JPMB 3HFML 5DFTA 3QIUC 4G8GA 4IRJA 1XF3A 1INQA 3WEXB 4NUGH 4APQD 3CC5B 3QH3A 5IVXB 1Q9OA 5FDWA 1MI5E 4O2FA 5CWSA 5ALBL 2YRPA 4K9EC 4YGVA 1VDGA 1I4FA 4PJAF 4DQOH 4OUOA 2QSVA 2QHLA 4ZQKB 1JHTA 4L4TD 4PGDB 1AGCB 4PRHA 4YH6A 5SX5K 2PTTA 4LEXH 4Q9QH 3IGAA 4F15B 2VE6A 1EHLL 2BZDA 2R23A 4LRNH 3PL6B 5TQ0L 5DK3A 1EGJA 4GBXC 3FFCB 4NFDA 1S78D 2BNRE 3VFGL 3MMEA 1NMAH 3P3YA 2DICA 3INUH 5CINL 1T7WA 1KNOB 2G2RB 5D6DA 5ITBH 1UGNA 4JQXA 1J1PL 4NQVB 1AI1L 5BZWA 2Z8SA 2GT9A 4WI8A 4AQOA 3UJIL 3ZKSD 1UJTA 3SJVE 4YXHH 4EN3B 5FA3A 1Q72H 1Z3GL 4X98A 4OCLC 3TBWA 2IFFH 4JY5H 1OF2A 2XXMB 5F9OL 3EYUL 1XGQB 3B43A 4YUEH 3SOBH 5IG7B 5GSVA 2NY5C 1QRNB 5JQ6L 1P7HL 5CUSH 4U6XA 4LLWA 3N0PB 4E9LA 4YXLL 1KULA 1RUAH 5H94B 5IEHB 1NH6A 2WP3T 4PGEB 4TUJB 3MACH 3WLWC 2EDBA 3TN0C 5B39B 5HHVH 1VKXB 2GCYB 3QDMD 3I6GA 3GSXA 1TPXB 4Y2DC 2EE2A 2FD6H 3FT4A 4WI2A 5EO9B 3MLWH 4HUUA 1TTUA 4IEFB 2P5WA 3GFUA 4KK6D 3QRGL 2VH5H 1WIPA 5ICXB 3JUYA 3ULVL 3HC4L 3NAAH 3L5WA 1Q9KA 4QHMB 4I0PA 1HHIB 1DL7L 2V7NA 2VXTL 3P73B 3G5VA 4R7DA 4UT6H 2HFFA 5HD8C 3ARZA 4UT9H 4QXWA 1TZHB 1CD1A 4FQJH 3JWOL 3LEXB 4KDVA 1WF5A 1YEJL 1FJ1A 1RHHB 2XN9E 1E27A 4LBEA 4OQTA 2HRLA 5HGDB 3KLSA 4MHHI 2VISA 3VXRE 1NC2A 3RP1A 1QLEL 4JDTL 3L9RA 5K59E 1RJLA 1AGFA 2QADB 2NX5E 1MHPL 1OTUD 1NAKH 1UM4H 2NXZB 3N9GH 4MVBD 5F1IB 1EHNA 1N4XL 3PUCA 1AIFA 1I7RA 4K9EL 1JPSH 4GAFB 1UB6B 2GY7B 3BZEB 3RIFK 1MCWM 4F2MA 2D2OA 3LEYL 3T0EE 5EU3B 4ZNEA 2WINA 3QDGB 5HHMB 4N8CL 5FYJL 1QRKA 3HC3H 4PJ8C 1KJVB 5HPMA 1YN6B 4C56D 4HX1B 1PD6A 3SDYL 1BQSA 1WWWX 5LAXB 1R5IB 1PLGH 2JJWA 2X1PA 4OCSL 2ZSVB 1HYRC 1X5YA 2CJUH 1H5BB 3G5XA 1NGZA 35C8L 4JM2A 3BAEH 3BGAA 4NC0B 5D70L 3FB7B 4Y5YA 5DD6A 1X5HA 3RKDC 3IRZA 4MSWA 4ZUWB 3RVVC 3HI6L 5IHZA 4XNMA 1QHOA 3TCLA 5E5UB 1U8JB 5AUMA 5J6GA 2H1PL 1V3JA 3HZYB 3SCMC 4D9LL 4B41A 3DX7A 2DQGH 2HLFC 4PJ9A 2DLFH 3TA3D 2OI9C 3UTTD 3MBEB 2O26U 4EKXA 4OZIB 5C8JB 1BQLH 4F7EA 4QRPA 3SDDA 1X5AA 1RZGA 1CD9B 1F3JA 5E6YA 4PJEB 1J7VR 5IR1B 3QNZB 4LCCB 3FOLB 3QISA 3PXJA 1FNGB 4LOUD 3T4YA 2IANA 4U1NB 2GTWA 3RZCC 1IJ9A 1DBAL 4YK4B 3I6LD 2P5EE 3EJYD 4HS8L 3MXWL 4OFKA 1BD2D 3TM6A 5LQBL 5E1HB 1NUNB 1EJOL 4XTRC 1F8TH 4WEMB 5FYJU 1WFTA 2AEPH 2ZPKH 3VJ6B 1FDLL 1GAFL 2P47B 1B6DA 2RB8A 3WDIA 5J11C 1CGVA 5EUOB 4P2RD 3DV6A 2VXUL 1IGJA 1A0QL 1C08A 4XBEH 4KQ3L 1KN2L 1JGLL 2FJGA 2PN5A 1NMCB 3JZ7A 3UAJC 3SKJL 2V17H 3V52H 2HFGH 4L4TA 5SV4A 3OKDA 3QDGE 5IK3A 3ARFB 5BVPL 2XY2A 4M1CD 4U2YA 4DOHE 3KPMA 4HCRA 4XVTL 4QKXB 1KCKA 4Z5RA 12E8L 5EU5B 4AYFA 4AH2A 2UY7A 2DQIL 2QV2A 2CIKB 1U8PB 3DSFL 1F6FB 3FB5B 1WIOA 3VMPA 4FQIH 3AS3A 3QXDB 5TF1H 3VXMD 5JPNA 5DWUL 1DVFB 1LEKB 4G80B 3SGKA 1ZA3B 2W0PA 1A7OH 3CDYA 4K7PY 4NCC1 5CSZA 2XY1A 2FEEI 3WFHB 1OAUH 4L8CA 2HA1A 3D18B 4JDVB 2X7LB 4XWGH 3HAEG 1WEJH 1HEZA 3OXSA 4GKNB 2FDBP 2R2CA 3IRPX 1DBJH 4NGHL 2WUBH 4HWEH 4HK3J 1FVEA 1BFOA 2VIRB 4QY8A 4WRLA 3I9GL 1LGVA 1F97A 3A6CL 1PEWA 3UJTL 2UYLA 4U0RB 2B1AL 1HOCB 4Z7OF 2DLIA 2XQYG 3QDMA 2NY4D 1CT8A 1JYVA 1YQVH 1M71B 4K55A 3P4NB 2Q6WA 1E4WL 1ERNA 5DJ0A 4MMXC 3V6OE 4UB0L 1QSEB 3GKWL 4UMGA 1TIUA 2C1OB 5IFHH 4ZAKD 1KPVB 2YN3A 3L3KB 4MJID 5EUOE 2CDFB 4S1RH 1FGVL 2RR3A 3BEVA 4TVPH 1OGAB 3RNKA 3BUYB 3K74B 3LS4H 4K7FB 3O4LD 1ZHLA 4FABH 5L0QC 4KDTC 1LO5B 4JREB 1JNJA 1KFAH 5JXED 1IGIL 1H3WM 2RCSH 3LHPH 1P1ZA 5DEFA 3PDDA 2DQCH 4ODWB 4XCFL 3H42H 3KPLA 2QHRH 3W39B 5FHBL 4IRSA 3TWCH 1A7RH 5L2KA 1A1NA 5JDSB 3EUUA 1MUJB 4BH7B 3OJ2C 3MUY1 3PWVA 1CL7I 3DVIA 4YFDB 5IWLA 1JGUH 2GITA 3C5ZD 3WS3A 9CGTA 4N9OB 1QSFE 4PJ7A 1JF6A 1BOGA 3HKFA 4RMRA 1VGKA 2B4CC 1N6UA 3NCJL 4X6CB 2HRPH 4YZFF 1TNNA 2VWEC 1VFUA 4NO5A 4ODVL 1I3UA 4OKDA 5GSRA 1MHCA 2YMXH 4C56A 2IQ9H 1LD9A 3QFJA 3T4AB 4N1CA 1WAAF 1RUML 1CLYH 1VFAA 1DN2A 1JGDA 4NO0A 4A6YL 3C8KA 5C86A 1T80A 2WWKO 2Z31C 5T1MB 1FCCA 3CPLA 4PS4L 3BGFB 1ZT1A 4GXUM 3CFDA 1M7IA 4FXGA 5JORA 4UT7H 1T1ZB 4Z7UF 3NFSH 4J3VA 5IT2L 2DN7A 1UWEL 1I9RL 4HJGB 4XHJC 4YHLL 3QPXL 1PJ9A 1LEGA 1ZLWH 4CMHB 4OD1H 5ICYA 3T09A 3UTTA 5HY9A 3VFOA 5HHXL 2VXQH 5F9JB 3N1PC 4NPYB 3QRFM 3VMOA 2ICWJ 5IFAL 3O3AA 5D7IF 4HC1H 1G7IA 5FYKE 3D85B 3L3HB 4LVHB 5F7EL 5CBAB 4K3JH 4FMFA 4RAUA 3DI2B 3MRMA 4KPHH 3QUMH 5JLZB 2YC1A 5C07E 5I1DB 1N26A 3LKOB 1QQDB 5EOCL 5C0FA 4Y4HD 2ZCLL 5D1XA 1C5BL 2EIBA 4H26A 1MIEL 3IJSB 1YECL 1S7UA 1J5OH 2X4OA 4P2RA 1BAFH 1LO2L 4YWGH 2DMKA 1F58H 1OPGL 4M3JA 2ZSWA 2EDEA 3O6LL 4Q2ZA 2R56H 5SWSB 3THMH 2IBZX 5DUPL 4PIRF 5CIPB 2ZJSH 3D2UD 2NY2D 5IVZB 3S3JA 2BSRB 4OQ1A 4FQCL 5IB5B 3D69A 3ZHDA 2IGFL 3I6KB 4OZFG 4LPTA 1L0YA 2KUTA 3WKML 1ZT4B 4JFXB 1OP3K 4TUKL 2X4NB 4NHUB 3G5ZB 5BS0D 1DUZB 1P84J 1I1AC 4S11A 3QUXD 1DUYB 4XNZB 1J8HD 4S1QL 3BDXA 1NBVH 1F02I 2P8MA 4PJCF 3VXMA 3K1DA 2R1YA 3N50A 3JV5A 3VWJA 4G9FB 3RU8H 4Z7WF 4U6TA 5MENB 3KYKH 4NKOA 2YA0A 4JKPL 4ZUTB 5KOVC 4JFZL 2ZNWA 5H37G 1WT5A 1D5BA 2PO6A 3ARBD 4OI9A 2B4CL 2CLVB 5AZ2H 1R24A 1BGXH 3V6ZA 3HAEH 4PP2B 2ESVA 1DQDL 3E2HC 4WJ5A 4LHUB 4HXBH 4NZRH 1YPZA 3GSVB 1B0RB 1OGTB 3R06B 5GRZA 5I8EB 2NW2A 5JXAH 4TNVF 4HJ0D 1KJ2H 3T1WA 4WY7H 3B5TA 3OAZH 4H1LG 4Y4KB 5HPOA 1JNNH 3VFMB 2MQ3A 2WIMA 2DQUH 3I02B 1D5XB 2OK0H 1QSVA 2P48B 1HDMA 3EYVB 3KAAA 3B2VH 1VFOA 3H2WA 5MHSD 4F8TA 4L9DA 4XI5C 4HK3N 2IALB 3M17B 4MJIA 4NRZA 3CLFL 1HH9A 5EB9A 5IHBA 1O5DT 4IDLA 1ONQA 2Z35A 5DRZB 1AGDA 1TFHA 3BD5A 1CTOA 3MYZA 3WFDH 3KPSB 3QDHA 1G7MB 4ZNEE 4XRCB 3QI9D 1WBXB 3FO1A 3D48R 4OCMC 5L6YL 2GAZB 3FRPG 3R1GL 3JSSA 5L9DH 3O9WD 5D2NB 2CH8A 3HUJB 5I1EL 3Q3GB 3WNNA 4JFFD 3F58H 3VGHA 4IHOA 5EZIH 2F54B 4GW4B 3B3IB 2X05A 4L4VE 1FNSL 1RZFH 3QUZB 3B2UC 4NNPH 5T1DL 5MENE 4IOIB 1F00I 3MNZA 4RGMC 3NIGF 1B3JA 1ZHKA 3L5HA 2A9MH 1IEAA 5JW4N 4AEHH 3UROR 2OXHA 4OJFL 3C8HA 1BF2A 2HH0L 3QG6B 3TGXA 1ZHBA 5EFIB 4P46C 3TO4B 4K3HA 3IDNA 1JBJA 3ZSSA 4QRPE 5CP7A 2H3NB 2F58L 1G7QB 2A83B 3DIFB 2YUVA 3V5DB 1G7PB 3BJ91 5EORL 1A9BB 3NFNB 3UO1L 4C83A 5IESL 5IB3A 2GI7A 3JTSB 3O2DA 3UPRB 2YPVL 3MLVH 3ZE1E 4HMEA 2C3XA 3DXAD 4YBLC 5DHVA 5GISL 2QSCH 4D0DB 5JIKA 1P7KB 4EUPB 4ONGL 3V5KA 1FZJB 2A74A 1JPFB 1KBGH 2WLYA 4ZFOA 1OCWH 4JR9H 1TETL 4H0IA 4ZO6A 3I3BA 3PL6C 3MA7B 4MA1B 1U2HA 1BVLB 4WCYH 3PIQB 4PGZA 1FFQA 4F7CB 4GKZB 1V5JA 1T04A 3K2UH 2QKIA 1C16A 4FA8A 3QEQD 1R0AH 4G6FB 3Q1SH 1NCCH 4S0SD 4LLDB 3U7YH 4AM0B 4M03A 4H88L 1S5IH 3E6HA 2PYFB 2GW5A 4DGYL 1Y6NR 2HVJA 3MFFB 3MJ8B 5F1OB 1T0NA 1N3NA 3DROB 2FX7H 3HNTH 1J1OH 4WW2C 1MEXH 5D6CA 3T0EC 3PHSA 1P2CB 5D7JB 2A6DA 3D39D 4DZBB 1U3HB 4NRYB 2CXKA 1LDPL 3U4BL 5I76A 4MCZA 3MLPA 3RWDB 3MGAA 4QT5B 4PP1D 5ALBH 1VB9A 3ULSA 3D2UA 2BJML 1WICA 3IFPA 1R3IL 3S96B 3PWJA 2C3WA 3BW9B 4OZFH 4JCMA 3GMLB 3WS6C 3ILPA 2YUXA 5TDOB 4K7PX 4K71B 4MX7B 3W9DB 2BVEA 3Q48A 4HH9B 1EHLH 3GMRB 5D7IB 5TQ0H 5DRNB 1J8HA 1BZ7A 3WN5B 3RWCA 2BOCB 4WV1A 5HGAA 1I3RA 5JOFB 2Z8VC 1KYOK 3VFGH 1KLGB 5CINH 4W6YB 2UUDK 1JRHI 1A47A 1INEL 3VFPB 1J1PH 2G75B 1AI1H 5H37H 1MFBL 1JGEA 3ARBA 3LS5H 3BD3A 3UJIH 5AYUL 1Z3GH 5I2IA 5KN5B 4X80L 2ED7A 3IVKB 4XBGB 2Q86B 5F9OH 3VD5A 3EYUH 4FFVD 2FBJL 3VFWB 3BO8B 4JFPA 3WXWL 2YA2A 2QADC 5TPWL 5JQ6H 2NXZC 5GXBB 1KB5A 3MBXL 1G9NH 2AJXL 2X4QB 1ES0A 5F88A 1MOEA 4ZOAA 3DARA 1Q0YL 2HJLA 3UTQA 4UV4L 1C8PA 3DURB 3SY0A 1GRWA 3DETC 3CGTA 4WFHD 4L9LB 3QFDB 4PJCB 5I1KL 3EJZC 1BD2B 5BVJA 4HS3A 4LPCA 2IAMD 1RK0A 4M62L 3GBLA 3S35X 3OKMB 3QRGH 2NY0D 3WIFA 2ICEA 5DJYA 3KVQA 4KDWA 4X9GA 2W0LA 3ULVH 3HC4H 5FUOL 5HHOD 3P2TA 1DL7H 2VXTH 4U1HB 2QSQA 2AP2A 4N0FA 4CN4A 1GJIA 3JWOH 2JJUA 4C56E 1YEJH 1HHHB 1UXSB 4TRPL 1FVDA 3CH1A 3KWWA 5JPMA 1D5MB 2YPKB 5DJDB 2F19L 3PWLB 1CGUA 4OGAD 1QLEH 2RJMA 4JDTH 1FL5B 1ZGLA 3WEXA 1HN1A 3RWGB 3MBEC 3ZHKA 3QT2A 4NNYA 2JJSC 5EDXA 3SGEI 5IVXA 2G5RA 1N4XH 5CKGA 3EKCA 2EC9T 1NKRA 4K9EH 3M07A 4FFWC 4ZQKA 5ACMA 2XICA 4PGDA 4BELD 1AGCA 3LEYH 4RWHA 1AHWA 1OTTC 3UTTE 3AU1B 1E4JA 1QVOA 4N8CH 1K4DB 2V5RA 5CJXC 1A2YB 4XC3L 5FYJH 4CKVX 3DX6B 1FO0A 5D9SA 3FFCA 1FPTL 4LIQE 1NGPH 4LDLB 1U0QA 3SDYH 4XX1E 5GGVL 3V6OC 4QNPE 4RMSA 4U1KA 3BP5A 4OCSH 2AXGA 3DXAA 4OAWB 2G2RA 3C09B 3WDHA 1JTTA 3H8NA 2CUMA 35C8H 4J6RL 5F89B 5D70H 1TJGL 5DZOA 3I6LE 3ECBA 3H9SD 1CLCA 1K8IA 3HI6H 3PQYB 3V4UL 4Z9KB 1BD2E 1FC2D 4EI5A 5HI5D 3BQUC 5M7QA 4X9BA 2H32A 3NCYS 2A1WL 2H1PH 1F2QA 4D9LH 3IDGB 2FSEB 4P2RE 5DT1L 5IG7A 4U7SA 3T3MF 3G04A 1VESA 3F8UB 3V0WL 5I75B 5ISZD 1S7WB 3SBWC 3WLBB 4QRRD 4O2CB 4S2SB 3RQ3A 1DVFC 4KV5F 4LL9A 4Y8DC 3R0MA 1JF1B 4TUJA 1D7FA 1QEWB 5B39A 2GCYA 2H26B 4RGOL 1FC1A 4HS6B 3IAGC 1ZLUK 3LQAC 1QFPA 3MRPB 1DBAH 3X17A 1JNLL 2UWEB 2X1OA 5EO9A 3WJLC 2OMNA 2WBJC 4J4PD 1J0YA 1CXFA 4Y16C 4HS8H 3MXWH 1A1OA 1IC7L 5LQBH 3LSOB 1EJOH 2HFEB 2WIIB 2OCFD 5JIIA 1FDLH 1GAFH 4JDZB 4QHMA 2BC4A 1QO3B 1T1YB 1HHIA 2VXUH 1LEIB 1A0QH 4KQ3H 1KN2H 2CXGA 1JGLH 1TZHA 2I24N 3MO1B 3SKJH 1G9EA 5DC9B 3S7GA 2V9RA 4LP4A 1RHHA 3I2CL 1YPZE 4KK9D 5BW7C 5BVPH 1UCTA 5HGDA 3S9DB 4OF7A 4XP4L 1F4YL 1CL7L 1MLCB 5KVFL 4HK0B 4XVTH 1MY7A 5IJVB 2DI7A 5TGBB 12E8H 4GRMA 1MCDA 2DQIH 2W65B 2VL4A 3HZVA 5DDHB 2BHYA 1KCRH 3DSFH 4LSTH 4MXVF 3IFNL 5F1IA 4G6JL 1AXIB 3P0GB 5DWUH 5F1KC 1U8OA 2WWKT 1UB6A 4X6DF 3BZEA 1FZOB 1UM6L 2LU7A 4MD5B 4PB0L 1X6NA 1T1WB 4PTTB 4TVSa 5BXFB 2C3VA 4MJIE 3SKNB 1YN6A 1ZTXL 4TUOB 4XMLL 4Y88A 3RNQB 5CJQL 4HUVA 2J5LC 3O4LE 2CKBL 2X4SA 2X44D 1R3HB 2NNAB 4NGHH 4OGZA 1PKQA 2Z92B 2ZSVA 1H5BA 1IM3B 4PV9B 2BVTA 4JQXC 1SMAA 3I9GH 3A6CH 2RIKA 3UJTH 5T3ZD 4JJ5A 3FB7A 4NQXA 4UIMA 3HCVB 3S98A 5D7LD 4W4OA 4M8QB 2B1AH 5DZLA 4D9QE 4JPWL 2BY2A 5T5NF 3HRZB 1KIQB 1E4WH 1WZLA 1Y0LA 3A0OA 3X3FL 3B8SA 5KS9E 3HZYA 3ETBF 4RFNB 4UB0H 3GKWH 5IVNA 3UBXA 2DL2A 3MROB 1BBJA 3T8XA 4X8XA 4X7TA 1BEYL 3GO1L 4OZIA 1F11A 1FGVH 1MFCL 4DAGL 1LK2A 4S10A 3F7YB 3HR5B 3OB0H 5DUBA 3CVIL 4QHNB 3MV01 3TT1L 2Y06L 5BRZD 1N8ZB 3QNZA 5GGSY 1IGIH 4LCCA 5CS7A 5C0RL 1HQ4B 5E94B 1LP9F 4LLMB 4XCFH 2MWCA 4R97B 4O00A 1KTLA 5FHBH 1HHGB 3RWEB 3IKCB 5DVOA 5T1LB 4GXVH 5GS1B 1OB1A 3ZKMC 4ZSOA 5D5ME 4I0PC 1NFIB 4NNXA 2DI8A 3HHRB 5DC0A 3ARFA 3FTGA 2ZWLT 3NCJH 3QCVL 2FO4A 2ZUQB 5ENWB 3EDEA 4ODVH 3O8XC 1SVCP 4ZYKB 4FQQB 3TEUA 3OX8A 1T2QL 1C7SA 3W0WD 1SEQL 3BZ4A 2Q7YB 4LPWA 5EU5A 1OQXA 1TTGA 1RUMH 5E2TL 1U8PA 3FB5A 4A6YH 2NY1C 3PNWB 3RVUD 4I0CC 5JW3L 1T89A 1K6QL 1VENA 3H9SA 3BUTA 3WHXB 5HDBF 1XGRB 4LRIA 5IT2H 5FYKL 3WFHA 1I9RH 2CRMA 2CLRB 1CU4L 4YHLH 3D18A 5DD3L 3C6SA 5J1SC 4YAQA 3QPXH 1PY9A 4PJAA 1HXYB 3BKCH 1EGJL 5IKCA 3IKKA 4S1DC 4XNZC 1JZ7A 5HHXH 5DK2A 1EEZA 5EUKB 2IF7A 3UC0H 4JM2C 5IFAH 4HFUL 1CDHA 5F7EH 3DMMB 1HOCA 3TJEL 3C60D 1DE4B 3GSWA 5BS0E 5J7CC 1INDL 3CFEB 3SKMA 4XP6L 3C8DA 4ZTOL 3V7AG 1HSAA 5E6ID 1DQQB 1U8KA 2ZCLH 1K4CB 3O45B 3P4MA 5AG8A 1C5BH 1QSEA 2XWTB 3AREB 5EO0B 1MIEH 1UCBL 1I8IB 1YECH 1KPVA 1TNMA 3L3KA 2CDFA 4JFYB 5SV3A 1OGAA 3DUSB 1YJDC 5DD5L 3SDDC 1LO2H 4GKSB 3BUYA 3MV7D 4K7FA 1OPGH 4X0KB 2ZKHL 5HHQB 3O6LH 4Y4KC 5EH1A 2D4DA 3OKOB 4PJHB 2XNAB 4XXDB 5DUPH 1XCQA 4UBDC 3TBTA 1WBZA 2F53B 3PHOB 4FQCH 4XWOC 1MREL 4MS8D 2IGFH 2VR5A 2E7LA 3WKMH 3GJEB 4TUKH 5JDSA 5FYKU 3P4LA 1X44A 4NQCB 3WO3B 4APQC 4UUJA 4S1QH 1CFQA 5HYSG 4XB7A 1NQBA 1S5HA 2ARWA 4JKPH 3NN8B 5MHSE 4JFZH 3FRUA 2B4CH 4LFHD 4OQTL 5DMKA 1LVEA 1DEEA 4Z7QF 1DQDH 3MRBB 3GGWB 4JPVL 3F7VB 1GVIA 3SO5A 4ELKB 3QUZC 1MCWW 1BVKB 5T1MA 5SX5H 2CLZB 5BJTA 2VUOA 5D7LA 3VH8B 1EBAA 4JRYD 4PJDB 3MXVH 3P0YL 3MV9B 4JFFE 4HJGA 3VG9B 4PR5B 3M1BB 4LNVA 1JN6B 3MCLL 1MJ7L 3KYNB 3TO4C 4PG9A 5CEZD 1KB9J 4GRWE 2EDYA 3CLFH 4CW1B 5F9JA 1V3MA 2JELL 3BN9C 1TTFA 1XGYL 4PUBL 2FIRT 2EZ0D 5CBAA 3SGDI 5DD0L 2OSLB 5JLZA 3FT3B 1LE9A 5I1DA 5L6YH 3R1GH 4X4ME 5FF6B 3ARGB 2YHGA 4PG2C 5J9PA 5I1EH 4KK6C 3IJSA 2FIKB 5KAQG 5I8OL 3QJFA 1RV6X 4F57H 5DGRA 2BVUA 1FNSH 1JYWA 4XPTL 1YJDL 1V3LA 3CX5J 4HV8B 4FN0A 5T1DH 1KIRA 3L3JB 2P44B 5SWSA 4ELME 2ZOKB 2GIYA 3G6JE 1KLUB 3VWKD 1HNFA 4YFEA 3I6KA 2D7PA 4OJFH 3P40A 2HH0H 4JFXA 5FO9A 5I9QC 3W0WA 3ULUE 1W72B 2RBLA 2FRGP 4RIRA 1BWWA 2AJVL 4YHNB 1I7ZB 1OTUC 3QEQE 4MVBC 4MAYD 2F58H 1JRHL 2MNUA 3UO1H 5EORH 1S9VA 5E8NB 1SJVA 5IESH 1YYML 4HPYL 2R4RL 4G9FA 2YPVH 1AR1C 3H0TA 3BZDA 5FFLA 2OL3B 5F93C 3V95A 1H9VA 2UVFA 2H2SD 5GISH 4R7NB 1DBKL 4JKMA 5FO8B 3I3EA 2CLVA 2OR9L 3D39E 3GSRB 3OF6D 4ONGH 5I8KL 3DUHA 4CU6A 1WC7A 1T7ZA 1TETH 1ZGLM 1X4YA 4UIKL 1DSFL 1FZKA 4HCRL 3GSVA 1B0RA 1MCQA 1OGTA 2AABL 4MNQB 1EDQA 1Y6MR 2R8SL 3VRIB 3VFVB 3JV4A 3CXHK 3LKPA 1NAMA 5HVHB 2CR6A 3RX5A 3VFMA 4H88H 3I02A 4PD4J 5E6IA 5I18L 1WCBA 4DGYH 3LH2L 1RIUL 3GIVB 1GC1C 3CFBA 3AS1A 4PLJC 4U6HA 4GW5A 3DPBA 3TA3C 2DM3A 4BFIA 4K2UL 2B20A 1LDPH 4P5KB 3U4BH 2LU4A 2GYSA 5I0ZA 3MV7A 5DRZA 3QDAA 5EPMB 4PJBF 4U3XA 1MCLA 5IB1B 2N56A 4JFDD 3V0VB 3KPSA 3LN9A 5DSCB 1G7MA 2BJMH 3C6LD 4LOUC 5GGTA 1PYWA 1R3IH 2FYYB 3LIZL 5DGQA 4MB4A 3RIAF 2ILLA 1JPGA 5T1KB 2DLHA 3H9HB 5D2NA 3EJYC 5GZND 3HUJA 2BVOB 4B50A 3WUWB 2AKRB 2V2XB 3Q3GA 1PKQE 3F12A 2AV7B 4GW4A 4RGND 3LOWA 3EFFB 3CSGA 3BRDA 3L3GB 5D1ZB 3KLAA 1WCQA 2CPCA 3RDTD 3VCLB 4YDLB 1INEH 2OLDA 2N7BA 1MFBH 3T0XA 3U6RB 1BFTA 1JTOA 4M1CC 5AYUH 2I27N 4XC1L 3QG6A 3GMPB 4PJIE 4P4RB 4E5XB 4X80H 3MUHL 2GQHA 3MOAL 5E9DD 2FBJH 2HT2C 5HHOE 1G7QA 2A83A 2DQTL 3V5DA 1G7PA 3WXWH 2JK5B 5TPWH 3ZO0A 5D8JL 3JTSA 3MBXH 2AJXH 3GM8A 4DVBB 2R9HD 5KZCB 2DD8L 5K93A 4S1SL 5EBWA 1QR1B 4CADB 4D0DA 1Q0YH 2GUOA 3U2SB 3FQTB 1RUQL 4P23B 5IW6B 3TPUA 4R90L 1CS6A 4HQQL 2YKLL 3QXAB 3ZYZA 5I1KH 5F1NB 5K33A 5AYQA 4HMCA 1U3ZA 5IROA 4ZSOE 2IADA 4M62H 5EC2B 1BECA 1KCUL 2XRAL 3HG1B 1CDBA 5FUOH 4KAQL 2EIDA 3TIDB 3FO0L 4LLDA 3WSQL 4U1MB 3PG2A 1QLRA 4X6EA 4AM0A 2D7MA 2PYFA 1XIWD 3ZDXE 1IL1B 1K5NA 3MJ8A 4R8WL 2BVPA 1VEOA 2CDGB 1SJXA 1D9KD 3W2DL 4NWTH 5F3BA 4IOSD 4TRPH 3ROOA 1P2CA 1HQRB 4GRLB 4Z7NE 4ZAKC 2F19H 5J06A 4HHAA 2PYED 4DZBA 1U3HA 5DK0A 3QHZL 4Z7UA 5K9QI 4ETQA 3T1FA 2WMPA 2E6PA 1ND0A 3G08B 4KRMB 3WD5L 5JXEC 3ARDD 1UVQA 4JPIB 3MREB 4XT1C 4GXUN 1CICB 4ZMAT 3GMLA 4I2XA 1FNHA 2EDJA 3T65A 4XCYB 2NLJA 1XF2B 4HH9A 4XC3H 3OKEB 5D7IA 3O4OC 5DRNA 4F33B 3WN5A 1FPTH 5ISZE 2BOCA 2I9LA 4WFGE 3EHBD 4U1IB 5CMAA 5EZJB 4QRRE 3HI1B 3C5ZC 5GGVH 3WIHA 5EZLA 3S36L 1JNHB 2Z93B 1U8NA 2LAGB 4WWKD 2G75A 1MPAL 4J6RH 3FO2A 2IBGA 1TJGH 3NCBB 4G8IA 3TZVD 2HLAA 3V4UH 4LAQL 3SDAB 1Y18B 4BSWB 4JKKA 3IVKA 4XBGA 2Q86A 2A1WH 3D3VD 4L1DA 1I8LA 3VFWA 5CJBA 3HG1E 5DT1H 2GTZA 1DQJA 4GG6B 3CDGB 3U0PB 5ICZA 4FTVD 4PJFE 3L7EB 1PDKA 3ZT6A 2JCCF 3V0WH 3DRQB 4HBCL 5I17B 3QG7L 5CZKA 3DURA 3GRWA 4P2QB 4K94L 4OKVB 4PREB 3U30B 4RGOH 4PJ5B 1ADQA 1NC4D 1I85A 4PJCA 1Z5LB 2J6EA 1NEZB 1JNLH 2PCPA 4TTDD 1KELL 3V5HA 2P42B 1IC7H 5MEQB 1F2XK 1ZVSA 2E8YA 1K8DA 4Y1AB 1NBYB 5CZVL 3KPQA 5CHNB 4U1HA 4NQED 4NN5B 4P4KB 3NA9L 4Y4HC 3LD8B 3I2CH 4BJLA 5DEGB 2X4PB 4XP4H 1F4YH 1CL7H 2R1XA 2A0LD 2YPKA 1QHPA 2M2DA 3PWLA 5KVFH 4BK5A 4RDQG 4CUCA 4O51B 5ELIA 4HKBA 5T3ZE 3RWGA 4ZO8A 5D7LE 5MI0C 3IFNH 3RX8A 1FYTD 3U0TB 1G0DA 4G6JH 2NY2C 1FFRA 1TJIL 4XZUB 1OW0A 4MJ6B 4OT1L 1UM6H 1OY3B 4GUPB 4PB0H 3C9NB 2A2QT 3BPLB 3VI4F 4R97C 4UZGA 3QUXC 1A2YA 1YNTB 2CDEB 5E9DA 4XMLH 5E99L 4BSVA 2GSGA 2VB5A 1HI6B 5CJQH 4JO2L 5F8RC 3NIDE 2CKBH 5BRZE 2BCKB 1IAOB 6CGTA 4OAWA 1D5IL 4Z78B 5DUML 1NFDE 4P2QE 5F89A 4WHCA 2MJWA 5DFVD 1MNUL 3FO9B 4YPGA 4G6KL 4NWUL 4IIQA 3K7UA 4JPWH 3P4OA 4G3YL 4OCRL 3X3FH 2VLRB 4U6YB 3UZQA 4HJ0C 3H6JA 1UQSB 3RTQD 5SWZD 4F9PA 1FV1A 1U41A 1BEYH 3QCTL 3GO1H 5C0AD 1MFCH 4A2MA 3BRFA 3O2DL 4X99B 3CVIH 3WLBA 1S7VA 1YEFL 4NT6A 1G0XA 3FQXB 4S2SA 3TT1H 2Y06H 4DUWA 1A4JB 3PGFL 2DJSA 1XIWA 2XXCB 3SE4A 1I1FB 1ACZA 3W0WE 5C0RH 2B5IB 3IXAA 4HS6A 3RWIB 1VFBB 1FNEA 4ZFOL 3TFKD 3CSYA 2DMCA 5HBBA 1NLDL 2PYEA 4LLAA 5EIIB 1NGYB 4KK5D 1G6RL 1MAKA 3CU1A 4CNIB 3PWPB 4AENB 2HFEA 2WIIA 2D0HA 4JDZA 1GOFA 5IMKB 2IH1A 1EO5A 4I3GA 1TCRA 3QI9C 2Q1EA 5EBLA 5CEXB 5JUEL 1HWGB 1T6WA 1NCWL 3DMMC 4HPOL 3O9WC 3QWRD 3FQRA 3N1GC 5F6IC 1EFXB 3QCVH 3DX9A 3GMQA 2J2ZA 3DUUB 4XH2B 1T2QH 3VFSB 1UJ3B 4HK0A 4BZ2L 1SEQH 2X4TB 5TGBA 1IEBB 3Q5OA 3KLDA 1BM3L 2I9TB 5E2TH 2ADJA 5CGYD 1U3YA 2NY6B 4R26L 1AY1L 1UWXK 1K6QH 3PDOB 1FZOA 3IF1B 4MD5A 3LKQB 4GS7B 1MIML 5FYKH 3MGOA 1CU4H 2OYPA 2VLRE 5DD3H 3D3VA 4TUOA 3RNQA 2R2HB 1EGJH 1NDGB 4DW2L 1NCTA 1R3HA 3HZKB 4J3UA 2C7UB 3T3PF 4YR6A 5MEPB 2QR0B 3IJHA 1TXKA 4JN2A 1FP5A 3HCVA 4HFUH 2HG5B 5DJ8B 3ZLQC 3TJEH 3PV6B 1NC4A 2AS5M 1INDH 2XKNA 1R3LB 3MNVB 4ZTOH 4U7MA 4Z7VB 1GOGA 3ULUC 5TH2B 5IVOA 5IQ9B 1UCBH 3BVNB 3OHXB 3F7YA 1KB5L 3HR5A 4JFHD 4YO0A 5DD5H 5FHAL 4QHNA 5DS8B 1R6VA 2ZKHH 1REIA 1CLZL 1UH4A 1N8ZA 4JQIL 5B3JF 4XVUD 1DANU 3DVNB 3S35L 5TF0A 4HIXL 4POYA 1DCLA 2ITDA 4LLMA 2H6PA 1MREH 5DJXA 3HRPA 4NCDA 3BSZL 5F7WC 2D4FA 5GGUB 1HHGA 1VCAA 3HE6B 3RWEA 1IILE 2EXWD 4MA7L 3HPJB 4PP1C 4JRYE 1IAKA 2CKNA 2VLJD 3O3BA 4YEEA 2R1WA 3S3SA 5FK9A 5DTFA 1UADC 1N6VA 4JG1L 4TVPE 5CEZE 4DTGL 1OVZA 2P46B 2EE9A 4PLNC 4WTXA 4OQTH 4ZYKA 4FQQA 3UTZB 5D2LE 4U2ZA 4Q9CA 4X7DC 2J8UB 4RDQF 4JPVH 4YZFE 3P9LB 1U36A 1E4KA 4P5TB 3DLQR 5AWNL 2WQ8A 4HDIB 3QUMB 3VGAB 5C0GA 2OTWA 3PNWA 3RI5F 4AIOA 1WAAE 2J4WL 1L9MA 1RD6A 5CP3A 2E7HA 1XR9A 2AV1A 1XGRA 2EEDA 4TTGA 3P0YH 5I1HL 4Z0XB 1A6UL 1U8QB 3MCLH 1MJ7H 1Z9MA 1A6AB 3LKSB 1FZMB 1FO0L 4Z7UE 3RTQA 1HXYA 2VITB 4JFED 4M61B 1CF8L 1T5WA 4V2BA 5C0AA 3R8QA 1RAMA 2BSSA 4YC2B 2JELH 1XGYH 4PUBH 4QCIB 2CSPA 4KRPB 2VL5B 1DE4A 2EH7L 4QRTA 1X5XA 2D7NA 5C0CB 2A9NL 5CJ8A 3O6ML 4K3DL 5IJKA 2D7TL 1N5AA 3DBXB 3VXUD 5LXGL 2IAMC 2XWTA 3AREA 5EO0A 1I8IA 2AGJL 5I8OH 2QEJA 4JFYA 4XPTH 5FYLD 1YJDH 4X0KA 5HHQA 1U8LA 3HAEB 2B0SL 1BVZA 2XNAA 4XXDA 4KI5F 3MODH 3QWRA 4R3SA 4OGXL 2IQAB 4YJZL 1JTPA 1KJ2B 4OZ4B 3FJTA 3GJEA 2FHCA 4RWYL 2UZXB 5FGBA 5FEBA 2VDOL 2AJVH 5ANMA 4DZ8B 2XFXB 4Y5VC 4NQCA 5I73B 1X5KA 1XF5A 5CD3A 2IEPA 1YZZA 2VQ1B 5E03A 3WFBL 1JRHH 1PX3A 1I8MB 2ERJC 1YYMH 4HPYH 2R4RH 1MCRA 1M1SA 3LKNA 1CTNA 4ZNCD 4E42A 3J8F7 4QXGL 3RUGF 5DQDL 3LV3B 1IRAY 1DBKH 2OR9H 5I8KH 4Z7WE 3MQIA 1Q94B 4OD2B 4P2OD 3MRLB 1YEDB 3GMNA 4BFEA 4AG4L 4UIKH 3DGGB 1WWBX 1DSFH 4HCRH 2UZYB 2AABH 5HYIA 4JFDE 3O0RL 4ELKA 1G7LA 2R8SH 3VRJB 3LAFA 3U0WL 2XTJB 2I5YL 2NY3B 5FKAB 4B7LA 1M6OB 3EO1B 3VH8A 2PXYB 2VDML 4PJDA 4LRIC 3DO7A 3GI8L 1OM3L 3MV9A 1EH9A 2NTSP 5I18H 4PR5A 3LH2H 1RIUH 2EEBA 3TBSB 2ZCHL 2IBBA 3KYNA 3TVMD 4XCEB 5I71C 5E8OA 3VXOB 4LVOC 3NGBC 1C7TA 3WNLA 4X6DA 4L8SB 4B5EA 5KVGL 4K2UH 1RZKL 1RZJC 1NUFA 2IC2A 2L4OA 1X5IA 4P57B 1W0WA 1X5ZA 4Y5XA 3T0DA 3GDBA 3ARTA 2V5TA 3LIZH 7CGTA 2ORBL 2OSLA 4YHML 4WO4D 1XGPB 4L8DA 3WDJA 4P23C 3EOAA 5E9DE 2F8VA 2WBKA 4J23A 1YY8B 5FF6A 3ARGA 4J4PC 2AJYL 4X4YB 1NDMB 1D5ZA 2H2PD 3SGEH 4CRPA 2VLJA 3RVWD 4HV8A 2WAHA 1ZLUH 4D9RD 4YDVB 3TZVB 5F9WC 4KK9C 1WIUA 2DWDB 4ESKA 1PW3A 2E7LC 2NW3B 4XC1H 1BZ9A 5C3LD 2FGZA 1W72A 5ETUB 2KH2B 1I8KB 3MOAH 1YMHB 4F3FA 4NO3A 2SEBB 2DQTH 1MVUA 1IC5L 1LP9A 3HMXA 5D1QB 5D8JH 1T21B 2BXZA 1MFDL 2DD8H 2OL3A 1T5XB 2CRZA 4S1SH 3WO4C 1UM5H 4HLZG 5DURB 3OAUL 5FO8A 3T04D 3OG4B 1RUQH 2OR8A 3GSRA 4R90H 4HQQH 2YKLH 3GMMA 1F6LL 3NCMA 5GZOD 4R2GB 3CMGA 4PLOB 2Y4SA 4JFEA 4LCUB 4ZOBA 4MNQA 2MQ0A 3RA7L 4JRXB 4Q6IB 2CK2A 2CGRL 3VFVA 3VI3E 1KCUH 3BEWB 2XRAH 4OZFB 2FZ3A 3EOBB 4OI7A 1RUKL 5DQJA 2F9BT 5MERB 4H0HB 3LMJL 5KSBB 4KAQH 1LILA 3FO0H 1XAUA 4WHTA 3WSQH 4N0UE 5ERWA 5ESQB 2F15A 1C12A 2APXA 2UZIL 4R8WH 3MRNB 3W2DH 1TITA 4P99A 1SYVB 1U42A 4KVNL 1SJEA 3FAWA 1ED3B 3GSUB 4TNVK 5CZXC 3QHZH 5AAMA 2HJFB 2X89A 5IB1A 3V0VA 3WD5H 5DSCA 3WHE0 2GSIA 1G9MC 2FYYA 2W60A 4HUNB 4D0CA 3QA3B 4H25B 1MFNA 1IM9D 2ZG2A 3D3VE 2Y5TA 1DZBA 3H9HA 4R4BA 3FHQA 2VYRE 4FTVE 4CU7A 2BVOA 5DI8A 3WUWA 2AKRA 2V2XA 3J7HA 3ZMRA 2WWMD 2AV7A 2EYSB 5KSAB 1EFQA 4IS6B 3S36H 3GM0A 2OTUB 3I3DA 3L3GA 1EO7A 4LQFL 2VLKD 3T0BA 4KJQD 4Z77B 1YY9D 3PHQA 3CFKB 1MPAH 1MLBB 1FNFA 3U6RA 4P4KC 5IB4B 4P2OA 1ZKAA 3LD8C 4M43L 1NBQA 5JW5B 2DDQL 1OQOA 4P4RA 5TE6L 4LAQH 5KVEL 3LCYA 4JRXE 1Y6KR 4ZFZA 4H5SB 4NQSB 3T0AA 3MLZL 4YHPB 1DLHB 4NQEE 2EH8L 1KCVL 4HAGA 4DVBA 3HZMB 1F90L 4PRBB 4HBCH 1QR1A 4ORZC 3QG7H 1SMOA 3NABL 4C55A 4IM8A 4K94H 1LO3L 2XT1B 3QIUB 2AJ3A 4R4FL 3BPLC 4IMLB 3TVMA 4JY6B 5JHDB 3NZHL 5C0DB 4WHDA 1WTLA 3ZL4L 3VGGA 1KELH 3NPZB 4I18C 1FYTE 7FABL 3I84A 5IBTL 4U05A 4QHUB 1GGCL 4L3EB 3U9UB 3MRIB 5LBSL 2IPKB 5T3ZL 4F7PB 2CRIA 4WUUB 1FLRL 3C60C 4U1MA 5CZVH 1K85A 3ARVA 1WTGT 4WO4A 3BKYL 3O11A 1IL1A 3GB7B 4NO2B 3NZ8A 4GBXB 4MNGE 3NA9H 3F62A 4O5LL 4N5UA 1IGCL 3JWNC 5T5FL 1UB5B 1UC6A 4GRLA 1YYLL 3ZE2F 4FQXD 4QTIL 3JVGC 3I75B 4M7ZC 3AB0C 2YD3A 4RNRB 4UOW0 2GFBB 5FECB 1G9ML 2X9YA 1FSKB 4MS8C 4OT1H 3ZDYF 3UTOA 5SWZE 5HVWA 5DRXA 1XF4A 3I85A 1J88A 4XCYA 4J12A 1XF2A 3O81A 5C0AE 3ORJA 2ITCA 5E99H 3RGVD 3JTTB 4U1IA 4JO2H 5E8PA 1N64L 2D7OA 3HI1A 4KJYA 5EZJA 4X6BB 1RZ8B 1S7SA 3I50L 4LDOB 3OGCB 4GH7B 1R5VA 1U8MB 1D5IH 2NXYB 5DUMH 3ARUA 2DBJA 3TNMA 2AW2A 2BNQD 4MQXC 4HLZH 4FS0A 3GSNA 3CCHB 1MNUH 4KKBD 4M5ZL 4RMWA 4G6KH 4NWUH 5AG9A 2DYPB 3O41A 4OZHF 2Q76B 1BQHB 2HT4D 4G3YH 1T20A 1Y18A 4OCRH 4BSWA 4FOMA 4JPKL 2BOBB 1M05B 1TVDA 1WISA 2M26A 4KKCD 3U0PA 4BZ1L 4IMKC 1YA5A 1D3CA 3RWHA 3QCTH 1N5YL 1CZ8L 5C2BL 5TDNB 1EAJA 2DF3A 3O2DH 3SDCD 5IB2A 4MJ5B 4PBWD 1JWSB 4OZGF 1YEFH 3PGFH 4M9PA 4OKVA 4P3DB 4PREA 3RL1A 4GS7C 4PJ5A 1JJUA 4RBPH 4LNRA 5IM7B 4Q9RL 4KV5E 2FGWL 5ANME 1NEZA 2ZOLA 4BKLB 1H0DB 3U7WL 3F6LA 3QWOB 2CUIA 3EBAA 2HT3C 5C6PB 1JUFB 1G6RH 2EKSB 1HXMA 3QJHB 4NOBA 1EAPB 2EZ0C 3SDXE 4WTZA 1J87A 4GAYB 1NBYA 1NAML 2E9BA 5JUEH 3MRFA 2NYYD 3QUKB 4XCNB 1T66D 1NCWH 5KW9L 4MWFA 4PJ8B 1RZIA 2A73B 4HPOH 2VJXA 4LLUB 2QJDA 3X11A 4I8DA 4M1GL 5B39G 2VNCA 3AC0A 4D2NA 3HE7D 4X6FB 4BZ2H 1ZGLP 4O51A 3SGJC 3GSQA 1KGCD 4JANA 5IGXL 1BM3H 4V1DD 5FB8B 2XTLA 5I1AB 1NCAL 1RJZA 2VLKA 4E41B 1MQ8A 5ESVA 4LPYA 4NBZB 4R26H 1I7UB 3QAZC 5EU7E 3VWKC 1AY1H 5GGTL 2ATKA 4XZUA 4M02A 5HTSA 5GRUL 2H8PB 2KZWA 1G7JA 3SCMB 4QRQA 3RRQA 1P4LB 1MIMH 3X13B 3FB6A 2OI9B 1YNTA 1UH2A 3DRTA 4JFHE 2VAAB 4MZ3A 4MAYC 1OP9A 4UU9B 4DW2H 4PV8A 4POZD 1T2JA 5I8CA 3ALXA 5TJWK 1OSZB 1QFHA 3UZVB 2H2SC 3RZCB 5ID1A 3P9MB 4HF5L 2QLVB 1DQML 4C54A 5FM5M 2P8PB 2V6HA 3VFUA 2MTPA 1WUNT 1QBBA 5IP4A 1DP0A 4U6YA 1IGYB 3DGCR 2VLJE 4N68A 4N8VB 3SHSA 5J11B 3P77B 3S34L 2DIBA 3O6FD 4TPRL 3F6IA 1PZ5B 4Y4FD 2YD8A 4JZOB 1IZKA 1KB5H 3V4VL 5FHAH 4UQ3B 5C09D 2J3SA 4X99A 5IW1B 1CLZH 4XXCC 4NJAL 4JQIH 1I1FA 5DMYA 3S35H 3NOIA 4HIXH 1DDHB 4QTHB 2GY5A 2J88L 5L8JB 5INCA 1T03L 3QDJB 3BSZH 4A6YB 1AR2A 3OKNA 3ZE0F 4H20L 4FQXA 1AJ7L 1NGYA 1LP9E 2Y6SD 3LRHA 4M6OL 4XNUL 4CNIA 3PWPA 1WLHA 1F4HA 4ZOEA 3TO2A 4MA7H 3EOTL 4CJ1A 5IV2B 1M7DB 4Q97A 2EE6A 5J8OA 3C6LC 5DMGD 4WDIB 3S4SB 2H41A 5A2KH 5CEXA 3K80A 1KSRA 4MLSA 4JG1H 2FH6A 1RIVL 2KDGA 1QKZL 4DTGH 5GZNC 4K23L 3A67L 1AGEA 1JVKA 5C0BD 5DZNA 1WFOA 3VFSA 3RGVA 1FFOB 1L0QA 1UJ3A 4L3CB 2X4TA 3B9AA 2I9TA 5IOPA 2FBOJ 1T83C 3RDTC 4U31A 2YR3A 2Z8WC 3FQUA 3WNMA 2BNQA 2V7HA 3F65A 2J4WH 1C5CL 3PDOA 2D03L 2F74B 5B8CB 1A3LL 2AK4B 4PB9L 4YNYB 3K8LA 3TYGL 3LKQA 3VXUE 4RAHA 1ZAGA 4ZFGL 2FJHB 2KQMA 5I1HH 4PRPB 4ZXBB 1A6UH 3H3PL 1FO0H 5FYLE 4G6ML 1NDGA 2AJZA 5L0QB 1ZOXA 2LAAA 1CF8H 5I73C 3WIHL 2VDKL 3GHBL 3HZKA 3GIZL 1IKFL 2XACC 1I1YB 2I07A 2R9HC 5DMIL 2C7UA 2Y7QB 4CGTA 1XCTB 2QR0A 4A2LA 5MEPA 4LP5A 4PGCB 3WHE1 4WGWB 4XGZB 5DJ8A 1IAMA 4KKAD 4YBQD 2EH7H 2I60L 5FUZL 4NQDB 4XB8A 4YFLI 2A9NH 1L7IL 3O6MH 4K3DH 2EDLA 4NDMB 3VA6A 2H32H 2P45B 3VE0B 2D7TH 5EN2A 5LXGH 5E4EC 2AGJH 5T3XL 3BVNA 4QOKD 2P1YA 3OHXA 3W5NA 3QZWB 4WU7B 5H2BA 4KUCF 1J9CT 4YPJA 1RVFL 2B0SH 5JNYA 1QFUL 3RKPA 1XIWC 5ACZB 3MV8D 4N90D 4X7CC 3GRWL 1P7QD 1YDPA 1D9KC 4WI3A 4UDUB 4OGXH 1ADQL 4XVSL 5E8EB 3VRLF 3MJ7B 2J6EL 4G8GD 2JCCA 3B6SB 4RWYH 4HZLB 2VDOH 5C2UB 2Z31B 1CFTA 1C1EL 5F9DC 3HPJA 3IYLW 4GW1A 5FUCE 3B83A 4I13B 3WFBH 1JK8B 4XHQA 3ARDC 4D0BB 4OLEA 3FT2A 1S7TA 3MSPA 4PRHD 3GSOA 3MJ9A 4AEFA 4QXGH 5B38B 4PRPE 5DQDH 4XNXL 1CFBA 2VRAA 3CFJA 2PNDA 4QHLB 4WNQB 3EHBC 1SJHB 1XH3B 3REVA 3NFPB 3VXSB 2AXJA 4AG4H 5B3NA 1PBYA 2DQFB 1UFUA 3L5IA 4P5TA 3RPKA 2R0ZL 3O0RH 4O9HL 5A3ID 3PABA 4WWKC 2GJ6B 3U0WH 1TENA 2I5YH 3TZVC 1MFEL 3OR7A 2VDMH 4JQVA 1VACA 3GI8H 1OM3H 1GIGL 4M48L 4X8JA 3TT3L 2ZCHH 2W59A 1FZMA 2GJZB 5IHUL 1H3VA 2VITA 1XGUB 3FQWA 1IMHC 4M61A 4D9RE 4LLVB 2CD0A 4N9GB 5KVGH 1RZKH 2HAZA 3KLHD 5C09A 1NPUA 3WFCL 3D0LB 3NVQA 1HILB 1IBGL 2N1KA 1UACL 4KRLB 1HHKB 2CIIB 4UOW1 2F5BL 4QCIA 3TBVB 2ORBH 5LG1A 4YHMH 1X9QA 1I1AB 5E1AB 3UJJL 5LGJB 4MNHB 4TTDC 2P5WD 1QA9A 2YPLD 3T0WA 1QUNA 2VO5A 4R2GC 3DBXA 1EA9C 4B53A 2AJYH 4JB9L 4JVWA 1PVHA 3CSBA 4MLIA 4TSBL 5ADPL 2EXYD 1EEQA 4QRSB 1I7TA 5FOBB 1V7NH 4HIEA 1BX2A 3KPRB 4N0CC 3MRRA 3S6CA 5JMRA 2R2EA 4PGBA 3E2HB 1XR8B 4FXKB 5C0BA 2IQAA 2MCPL 1KJ2A 1NC2D 2A0LC 4HUWA 4PJGE 2DBLL 2BVYA 3B9KD 5FO7B 4G43B 2Q87A 4MJ2A 5DLML 2CO7B 4GG8A 1ZXQA 3HNSL 2XFXA 2GJ6E 3AY4A 5C0JB 2VQ1A 3BP4A 5J3HD 2R2BA 1MI5B 1I8MA 4UQ2B 1IC5H 5C9JB 4DGIL 1OAZL 4WI4A 1MFDH 2OX5A 4YLQT 5C0EA 5EWIL 4W4NA 2NR6D 5DYOB 4PJEF 3OAUH 2AJUL 2BSTA 1HH6A 4ORGB 3STZA 1BFVL 1TMCB 3LKRA 1BFSA 5SX4I 1OHQA 4QWWC 3RA7H 1ETZA 3QIWB 1CD8A 4ODUB 3VRJA 4RX4D 2CGRH 4AY0A 2N4IA 5FXCH 4PLKD 1V8HA 1RUKH 1QYGL 2Z4QB 5FKAA 5DFVC 1M6OA 3LMJH 2PXYA 3SJVB 1DTUA 3D25B 5EUOF 1A4KB 3REWB 4PRNB 4JY4B 5F70A 4UV7L 3DX8B 1GHFL 1UWGL 3PWNA 5DVKA 2UZIH 2EIEA 2JIXB 1N6QH 3TBSA 5ADOL 1AC6A 3RTQC 4XCEA 1GZPB 1IE5A 3VXOA 3VGDA 4CN6A 4KVNH 4GFTB 4HKZB 4RGMB 3ARSA 4LCWD 4OM0L 4Z8FL 5HYJD 4ZO7A 1YMMD 5HXMA 2IAND 1SVZA 1P7QA 3AAZB 4ONHB 1OLLA 4PJBE 4BH8B 1S7RA 1XGPA 3TFKC 5J6HB 4AQ1B 3IFLL 4F58L 4MMZC 1YY8A 3F7QA 4F7MB 1FHGA 1NJ9B 4KK5C 4PTUB 1S9WB 3MZTA 2WZPD 2PW1A 4X4YA 1NDMA 1OWRM 3V7AE 1R3KA 1A7PL 1AQKL 2WW8A 1WBYB 4YBLB 5F7UA 1ITBB 1RHFA 2BVQB 4N1EA 4IOFC 1U6AL 4R6UA 2VSCA 4LQFH 1K2DA 2ADFL 2HTLD 5C92A 5I15L 2VUYA 2XN9B 4J1UB 5IMMB 2NW3A 4M43H 3VXRB 1WFNA 4P48A 4KROD 5ETUA 5MEOA 3K4DA 5TE6H 5FGBC 3BXNB 1I8KA 4ODTL 3EGSA 3VFRA 5KVEH 3DHJA 2NX5B 1YMHA 5JMOC 3QNXB 2XA8L 2JB6A 3MLZH 5IHLB 5CGYC 2EDDA 1EPFA 4HFWB 4AZ8A 2EO1A 1UXWA 5D1QA 2YEZA 2EH8H 4MXWL 1T21A 1KCVH 3VXNA 5HGBA 3FKUS 1F90H 4QRUB 5DJCA 3AFLA 1BHGA 4WW2B 2ADIB 1LO0L 3T0EB 1ITCA 3NABH 4Y2DD 1FSKC 3DECA 1LO3H 2R0WL 4N0RA 4R4FH 4LFHG 3NZHH 4GKOA 1BJ8A 3QIBD 2QQNL 1QACA 1V7ML 1J05A 3ZL4H 4HIJB 1UWXH 3DI3B 4HKJB 7FABH 4Q6IA 4CJ0A 3ARPA 5IBTH 1BJMA 1SEBB 1GGCH 3EOBA 2Z91B 3SEPA 3FZUC 5HDQL 5LBSH 4OB5L 3UDWA 5KSBA 2NXYC 5IBUB 1K3IA 5T3ZH 1FLRH 5F7NC 3AM8A 3U36A 5F7DB 4NC2B 1S9YA 5EU7C 1JI1A 2P8LB 1WZ1L 1H8OA 2V2TB 3BKYH 3MR9A 3L3DB 3MRKB 1CBVL 2DM2A 1ORQB 2YPLA 4FQHA 1FN4B 4J8RA 5GIRA 4X6CF 1IGCH 4BFGA 2X4UB