5D1ZD

Isdb neat1 bound by clone d4-10
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
230
structure length
230
Chain Sequence
QVQLQESGPGLVKPSETLSLICTVSGGSISSSSYYWGWIRQTPERNLEWIGIIYFSGTTYYNPSLQSRVSMSLDRSTNRFSLRLSSVTAADTAIYYCAKPKSRDRGGPGDDYFGMDVWGQGIMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Y10 Light Chain
publication title Germline-encoded neutralization of a Staphylococcus aureus virulence factor by the human antibody repertoire.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 230
sequence length 230
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d1zD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d1zD01
4UV4L 1HDMB 3BMVA 4XPBL 3BW9A 5HYJB 3BO8B 1AJ7L 4MCZB 2EH8L 1S7WB 4XB7A 1YYLL 1AY1H 5CEZL 3K80A 3LAFA 3RZCC 2OTWB 3VWKB 4WHYH 1A14H 2FO4B 4FQIL 3W0WE 4UNUA 2YK1H 5D70H 4FQXD 4Z7UE 5TQ2H 1G6VK 4JZJB 3OG4B 4NO0A 5EUOF 4D8PA 2LABA 1FZJA 5I8KH 3VXSE 1KENH 3KPRD 1TPXB 5C09B 4JY6A 2EC8A 4L8CB 4WI3A 4NRZA 2W9LA 5EFIB 1AGBB 1P4IL 2DQFB 4WV1C 4S1QL 3V2AR 2JF1A 3Q5TA 2QQLL 4WDIA 2NY5H 5I75C 3BUYB 1XT5A 3HG1E 1BGXL 2X1PA 1I1AA 3NMEA 4DGVH 1IZJA 4AMKL 1Y0LB 3WO4C 1KCLA 4LMQI 1C16B 4PLJD 1QLRA 3MNWA 4MA7H 3SDXE 2X4RA 3ULUH 1ZT7A 3ELAT 1F58L 5BJTA 2CLVA 1HI6B 3CK0L 4FQQA 4KJPC 4AEFA 1GC1L 3RDTB 1S9WA 1VACB 2J8HA 1N64H 1G9ML 1HSAA 5CWSB 1NUFA 4J4PA 1OQOA 1K4CB 5IEKB 3ZL4H 4JFDD 3FFCD 4JM2F 3PDGA 3OPZH 1MCKA 1LE5A 4P2OD 4JFDA 4M3KB 3O3DA 3GSWB 3KLAA 5A43C 5JLZB 1T1XA 5JW4R 3TF7C 4JFED 2FL5B 2XN9D 3OKKB 4C83B 4HV8B 1RZFH 1J0KA 2BVPB 3HE6C 2Y06L 3DRQA 4XAWL 4OFVA 5DC4B 1DEDA 1NLBH 2DDQL 3ARFA 3QZWB 4HJJH 4X0KB 3TFKC 3DV4B 1NMBH 3TYGH 3JV5A 1SJHB 1KTDA 3Q6GL 3QDMB 1RUML 4HUKB 1ZA3A 4RMSA 4BSJA 1YEHL 3CH1B 2EE2A 1YA5A 1KYOK 4WU5A 4ODWA 1U3HA 1IGMH 1ADQL 1L0QA 3QRGH 3T1FA 5EOCH 3ZHLA 4OGAD 4WWID 3V5HB 4DZBA 1OTUD 1T3FA 4RDQG 4XP5H 2NXYB 2P48B 4X6BA 2DIJA 5IB4B 5MP6L 2CLZB 2EYRB 2IPTL 2XYCA 3WIHH 4JRYA 2BSTB 5F7LB 5MEPB 3VGGA 4QRSB 4LSRH 32C2B 4KROC 2E7LA 4HW6A 5INDB 2IBGA 2XWBB 4ONHB 4ZO8A 1YY8B 2IF7A 5E5UB 3MLRL 4U4BA 2PF6A 2DKUA 4WI4A 2P7TB 5EULV 3SE8H 3N1FC 5MENB 4M6OL 2D4FA 3BH8B 4MNQD 4QXGL 4QY8A 1FL5B 2OR8A 2YMXL 4HK0A 3S6CA 4MJID 3O11B 4XP9L 3NIDF 3HZMB 4NHUA 3EYVA 4S2SA 1I7UB 3SGKA 3VXQA 1MVUB 1GHFH 2AJSH 5CIPA 4K3DH 2C5DC 2GHWB 3WD5L 5DHYA 3KPSA 2MOVA 4QHLA 1FNHA 5JDJA 1G6RB 2ADGB 4JQIL 3GSNA 3MRLA 4OZGA 5DS8B 1G7PA 1OGAA 2NY2B 1OTSD 3CFEA 3U7AA 1PFCA 3MJ8B 2W1NA 3D0VA 5GJTL 1MRDH 5MERA 5IFAL 2ZUQB 4WY7H 5DUPL 1XAUA 4Q0XH 2WK2A 3DO3A 3FHQA 1CIDA 4MS8C 2HJKA 3UAJD 5DC9B 2IAMC 4XCCH 5IWLA 5EU4A 3O2DH 4F7PB 3QDGB 4F7EB 4AG4H 4PY8I 2I9TA 1NGQL 4A6YB 2BSRB 3WUZA 1GYAA 1QYGH 2QADD 1RD6A 3QUKB 4DGYH 4DK6A 3CSGA 1NEZB 2W0FA 4Z8FH 1ND0B 4HMCA 5AWNL 4J3WA 4EI6B 1CLZH 4KHTL 1OF2B 5EPMA 4PYGA 1NC2D 4YEFA 5ACLA 2OZ4A 3NZ8A 3ULVD 4LF3B 4HKBA 4O2FA 1NH6A 1S7SA 3FQTB 2UY7A 3U9PH 2DLHA 2WV3A 3GSXB 4GRLD 3RQ3A 3NIDE 2XTJD 5DHVB 1KXTB 2YC1B 3LN5A 3NOIA 3RVXD 2FEEI 1RU9H 4X8XA 3STLB 1OAQL 1K8DB 4HDIB 1S7TA 3MV8D 1ZGLA 3MRNB 4XPBH 4IDJL 3HC4H 4WEBH 1QVOA 5GRUH 4TUJA 3HZYA 3MRKB 4AIZB 2YA0A 1DN0B 3S88H 3MLXL 3W9DB 4FQIH 5DJ6A 1IM3B 4J7RA 3CXHK 1HDMA 5HYJA 2EDOA 2BNRA 4MWFB 1A7NH 1S7WA 4J1UB 4RA3A 4TNVK 2MCG1 4TNWF 2NTSP 3DWTA 1RULL 4X8JA 2CO7B 3VWKA 4PLNC 2FO4A 1N6VA 4HZLB 1A1MB 4O02H 5FEBA 2CRMA 1FE8L 1HEZB 5C09D 4JR9L 5TF1L 4JZJA 5C0BB 3RX7A 4GRMA 2DQEL 2QQLH 1QO3A 5C09A 3QHTC 4KY1H 1BGXH 3S5LG 4L8CA 4K23H 4MX7B 4JY5H 4AMKH 2YRPA 1CL7I 4X4YB 5DQDH 2FBOJ 3WEXB 2Y7QB 2ENSA 4ZFFB 1F58H 3HS0A 2VLKB 1KF9B 3CK0H 2Q7YB 3BYTA 5E99L 1GC1H 4ODXB 3VG0L 1VKXA 3WFDL 4M93C 2DQHL 3HNSL 5IMMB 3H3KA 3OKLA 3RDTD 3UTSE 1TQBB 3GMRB 1JVKA 3CXDL 5D71H 4YFDB 1J5OH 4OF0A 2VLRB 5CD5D 3QEUB 1IGFL 2FWOA 2EEBA 5F7WC 3KYOB 5CWSA 4NC1E 1K4CA 4ELMA 2AXFB 1TETH 1PG7W 3V79C 5EBGA 2AERT 4GMSL 1KCVL 1RIVH 4HBQA 4L9LB 5CHNB 5IT2L 2DDQH 3BGMA 2R9HC 1BJ8A 3FB8B 2FL5A 4LPUA 4C83A 3HMWH 1EEUA 3OKNB 4HV8A 3ARRA 2VL5B 3C09B 3TBWA 2XXMB 5HDOA 4E0RB 2P44B 3IDJA 5IB5B 1DSFL 3E2HB 1OW0A 4G6AD 3IYLW 1B0GB 2NW2B 3AGVA 3HNVH 1IMHC 4OF8A 4CNIB 2DICA 3QDMA 1ADQH 2YA1A 4Z7WF 4Z7QF 1MFAH 1UB5A 2ICWB 3RAJL 3MRBB 3PQYA 3C08L 1U8PB 2CRYA 4UBDD 2OM5A 5CJ5A 2R56H 5MP6H 5E00B 5I66B 5LGKA 1C7TA 5AG8A 4OCYL 2NXYD 3TO4B 3ARDC 2IPTH 3V5HA 4P59H 3DO7A 3HZKB 2BNQE 1WVZA 4OTXH 5JOFB 2EO9A 2VKXA 5IB4A 5L7XL 1F97A 1RK1A 3THML 3O2VH 4XNZC 5F9DC 5IVXB 4L29B 4E41B 3MLVL 1X5YA 2EYRA 1B90A 1EXUA 1TVHA 5HYQA 4NZUH 1S3KL 3WV0A 4NHCH 1PG7H 3B6SB 1DP0A 3W39B 1KTKE 4L8SB 32C2A 1KGCE 3BVNB 1W72A 4GRWE 4ONHA 4E42B 4QXGH 3LOWA 2OYPA 1YN6B 3HTLX 3UPRB 2YMXH 1RZIB 2UZIL 4I3RH 1LK2A 2DQGH 4DN4H 1HZHL 5MENA 5A40E 4LU5L 5T3ZE 2VITB 2GKIA 4OB5H 3PJSB 3S3SA 1LQSR 3C87A 4WUUE 1A6TB 5F1IB 1X5XA 3WD5H 3O3AB 1WIUA 2VQUA 3LVEA 4UAOC 4ESKA 4JQIH 1I7UA 1GRWA 4EZMA 2FRGP 4Z7QE 1FZMA 2EYTA 5F6HJ 1MVUA 1OTTD 1H5BC 3WNNA 4F33B 2AABL 5GJTH 3PXHA 3ESUF 4P99A 2E3VA 2A0LC 1FAIH 1G6RA 2ADGA 4WI9A 5L2KA 4P46C 2VB5A 5KG9B 3MJ8A 2QSTA 2D7QA 3T0EA 2H26B 4I2XA 3HC3L 2AQ3A 4LQFL 1NGQH 4KI5D 1NBVL 4OZIB 3QDGD 5DA4A 3I85A 4U7KA 2WQRA 4XXDB 5ICXB 4MXQC 3SDYL 5AWNH 1UJ3B 2V7NB 4NQSA 4WEMB 4F7EA 4D9RD 1I7TB 3KPLA 3F7VA 4A6YA 2BSRA 3JWDL 1RZJC 5HHME 5BXFB 3BP5B 1I3RA 2FX7L 4PJIB 1BD2B 1BQUA 2D9CA 1NUGA 1PKQB 4J3TA 5AZEL 1P7KB 1H3TA 3FQRB 4YHOH 4BQCA 3JTSB 3RVVD 3FO9B 1OAQH 3FQTA 5JR1H 4IRSA 8FABA 4MAUL 2AJYL 4IDJH 5JA9A 3ET9F 4KRMB 1DJSA 1DUYB 4WTXA 3I9GL 5IB3A 2VL4A 2Z31B 3IF1A 3IKCA 4G6JH 4NSKA 3MLXH 3BPOC 3CC5B 2I25N 1K8DA 4HDIA 3MRNA 4QO1A 2GJZB 3W0WB 3PG2A 5CUSL 2OMBA 4JFOB 4Z7UB 3PABA 1RULH 5JNYB 1NL0L 5I1CH 3SDDB 4WWKB 3W9DA 3LQMA 3FN0L 1IM3A 4X6CE 3VFSB 4MWFA 4FG6D 1ZLUH 1EJ6A 1U9KA 2QHRL 4P2QA 5C0BD 1JWUB 2BVUA 5HHPB 3TN0A 5C0RL 4HZLA 1MPAH 1A1MA 2R2HB 3T2PA 3HG1B 3KYMA 1RIUL 3SE3A 2J3SA 3VXPB 2GSIB 1RJYB 4JO2L 4OLXL 4G9FB 3O45B 4LGPB 3VFUB 1KFAL 2CDGB 1SYSB 5ALCL 3SDXB 2R0KL 3F62A 3VFWB 5KTEH 4MX7A 4KUZL 5E8PA 5JPMA 5EBWB 5E99H 4X4YA 5JXAH 1ZLSL 2VLKD 3WEXA 1TTGA 4ZFFA 4HWEL 2DQHH 3HNSH 1FIEA 5HY9B 3CXDH 1U3JA 2DLFL 3SE4A 5DTFA 5FGCE 3UTTD 4ODXA 2VLRD 1A3LL 3GMRA 1OT2A 4G3YH 2EDTA 2VLRA 4AEIL 4Z78B 3UTPE 5IQ9B 4UOJA 3QEUA 4JKPH 5EUOB 1MQ8A 5KSVA 2Z92B 2YPKA 3KYOA 3CFCL 4LGSB 2XWTA 1HHHA 1NJ9A 2ILLA 1UB6B 3QXWA 4EOWH 4KGJA 1MRFL 3B3IB 4IIQB 2G5RA 4N1HB 3ARGA 2ORBH 3JVGA 4ZNCD 2BY3A 5CHNA 4LLQA 4LSQL 2PO6B 3WNLA 1PDKA 5DO2D 4HH9A 2VL5A 3RWFB 2M2DA 3HI1B 4E0RA 3JV0A 2Z35A 3OB0K 3QUXD 4M6ML 1B0GA 2ARJQ 2PXYD 4J3XA 2WBJA 4LCYA 2AK4E 2HT3D 4U3HA 4OCYH 1JMZA 4L4VE 5HVWA 5T1MB 1R24A 3TO4D 2ICWA 4JM2B 4H20L 1U8PA 2OP4L 5L7XH 5I66A 3OAZH 4TQEH 5KZCB 5CZXD 3TO4A 5J13C 3FZUC 1LDSA 2B5IB 3MLVH 5HPOA 5I73B 4TUOA 1F3DJ 2GUOA 2Z8WC 4E41D 4XZUA 4Z5RB 5EC1B 1S3KH 5DQJB 5HVFB 3IAGC 3TP4A 1NLDL 3QXAB 4ODVL 4JHWL 4L29A 4UI2A 3CUPB 5GQBA 2VZTA 4BFBD 4HIIB 1LE9B 4POUB 1VA9A 5JOEA 4NZTH 3UPCA 2R2BA 2VISA 2UZIH 2NY6D 3B6SA 2YD6A 1HHKA 4OT1L 3W39A 1GOGA 4LU5H 2CRZA 3O6LH 5FYKU 1WWBX 4E42A 1RZJH 1EAJA 1QLEH 1A4KB 1YN6A 4O00A 1BREA 5EU7E 3UPRA 1RZIA 1FQ9C 3RIFF 4LRIA 3RWEB 1V5JA 1X3DA 1ZLWK 3VCLA 3ILQC 3ZYIA 4YH6A 1MJJB 5DGRA 2BY1A 1XIWD 4PJEF 1GSMA 2AABH 3RKPA 1A6TA 1MH5A 3K46A 3L5HA 3O3AA 2FSEB 4X7TB 2X4TA 4LHUB 2HVKB 1Z3GH 1GGYA 1BAFL 1N59B 5K9OB 4F33A 3O6KH 1H15B 2WWMD 4L4TE 1DL7L 3MGTB 2WANA 5IHLB 4LOUC 3TVMA 3HC3H 4DKEL 4GG8A 4LQFH 2FGZA 3PP3H 3VE0B 1M1SA 5I1GL 4I18B 4JDZB 3DARA 5KG9A 1EEYA 5AD0B 4CN6A 3SDYH 4GG6F 1SM3L 3VG9B 3ZT7A 3LH2L 1ZSDB 4MNGE 5ANMB 5E03A 4Y2OA 1OM3H 2HTLD 3MRPB 5IR1B 5ID1B 4QYOB 4PRHB 1EMTH 5FM5M 4I4WB 2GEEA 4F3FB 1F6AB 4XPGH 1R3HB 4ETYA 4XXDA 5ICXA 1UJ3A 2V7NA 3EOTL 4KZDH 1PSKL 4F37F 3GMOA 1UCBL 5AZEH 4W81A 4KVNL 1BD2D 3DX6A 3QO1A 3VFRB 4DQOL 2QTEA 4JREB 4JKMA 3HUJF 5BXFA 3BP5A 1CXHA 4WFEE 4NM4H 2AJYH 1P7QD 1BJ1J 1IKFL 2GTWB 4Y19B 4NFCA 4YHYB 3I9GH 3FQRA 4PJEE 2DRUA 3VFMA 2DBJA 3X3GH 4XBGA 1T83C 5CUSH 4NKDB 3SQOL 3QQ9C 1DUYA 3BAEL 3W0WD 2Z31A 3VU2A 1NL0H 4Y5YA 3CC5A 3CDGB 3VWJA 3MLZL 1OARL 1XZ0B 3FN0H 1M05B 3P30L 1A6PA 5HDQL 1VESA 4WWKD 3SDDD 1D5IL 3L9RA 3O4LA 3VXSD 5TE7L 4QRUB 5T1LA 1KPVB 2PYEE 5JNYA 4X80L 5BOZG 3SDDA 4WWKA 4JGUA 3J8F7 5FV2A 4JN1H 4NN6B 4RA0C 4R4NC 2E7BA 4JO2H 4EVNB 1DANT 3B8YA 5F7EH 3HG1D 1KFAH 4K3JH 5DD6B 2Q6WB 4PY7B 2P45B 2R2HA 4KUZH 2ZUTA 5KVEL 5IW1A 3VXPA 2GSIA 3LSOB 3CFDB 4MVBD 4G9FA 3O45A 1XGRB 3PGFL 4OF6A 3HUJE 5DMKB 1T1YB 1SYSA 3TZVA 1OOAA 3ARBB 1NAKH 3EHBC 2DLFH 5EBWA 1VADB 4QF1A 3WHE0 4DUWA 4EKXA 1ZS8B 4JFYA 1ZOXA 4KK6D 1A3LH 1KCKA 2GTZB 5C6PB 5IJVA 2I60L 5GRZA 4KDTA 4NP4H 5L88L 4XTRC 4B53A 5AYUL 4LPTA 1MI5E 5EOTB 1GZQB 5C0CE 1DDHA 1KLGA 5SWSE 3B5TA 1EGJL 5IQ9A 1CD0A 3DV6B 1M6OB 2Y6SD 1UM5L 5EUOA 2Z92A 3FCTB 2IANB 2D2OA 4N1EA 5AAMA 4LSQH 4HGMA 4PGCB 3B3IA 2ZJSL 3V4VL 4IIQA 3MLPA 5TFSL 5E94A 5F9OH 4LCUA 4MAYB 4HEME 5LXGL 1IGJB 2PO6A 1CS6A 1FBIL 4ZFOB 5DRNA 3TH2T 1J05A 1HN1A 4LVHB 5HVHB 3WS3A 3QIBB 1YNKL 4G8FB 2Z91B 3RWFA 5F6IC 3HI1A 1ZLVK 2ITCB 2NX5E 3MXVH 4F57H 1JPTL 4P9HL 4JFZL 5CMAA 2FR4B 1OSZA 4H20H 4NC0B 3MRHB 5C0EA 3M1BB 1FSKC 1LHZA 3FO2A 4YXHH 4JM2D 1NCDL 1FFNB 4XNMB 3GI8L 2OL3B 5KZCD 5T1MA 1LEIB 1BVLB 3OR7B 2PN5A 2OK0L 4QLRA 3SKNB 1FNEB 4P4RB 3UZEA 1TJIL 2CKBA 2C4FT 1AD0B 1NLDH 5E0QA 5D6DA 2YBRA 4K9EC 4CMMB 4ODVH 1JYWA 4GW5B 4JHWH 3GB7B 4GXUN 4FNLL 4K71C 4KQ3H 3BZFB 3GKWL 3P4OB 4MXVF 5DQJA 5JW4N 5ESAB 2C4XA 4X5LA 2NY4C 2P5WE 4QXTA 5SWZA 3CUPA 1R5IB 4M1DL 4WW2C 3KR3H 2DIAA 4WUUB 1RQ5A 1AE6L 3H0TB 3SGJC 2GITB 4MSWB 5CZKA 4Z7WB 1KIRB 3NAAH 4GKNA 1MEXL 1S78C 5CILH 3OTTA 2GYSA 4XP1L 1LO4L 5FUZL 2AJVH 4H8WC 5FYLL 4IMLA 1F4WL 1MCEA 1EHNA 1BAFH 4LHUD 1RFDL 1KXQE 3T4AA 4UB0H 1DL7H 4PJGE 1FIGH 3R0NA 2FSEA 4X7TA 2MNUA 3TA3C 4PJCF 1CFQB 4NJAL 4R90L 2WIIA 1JYXA 1JPFA 1CGSL 5IP4A 9CGTA 5I1GH 5K9OA 3DRTB 1Z0MA 4JG1L 1H15A 4NWUL 1SM3H 5JW5B 3MGTA 4NQDE 1NANH 3LH2H 4UQ2B 3F6LA 1K85A 4NPYB 4JFFE 5D6CA 1KJ2H 4HUWA 4PJBA 4LSTL 4I18A 3UP1A 5AD0A 3RU8L 1I1CA 1P5VA 3EOTH 3ES6B 1ZSDA 5ANMA 3TPKA 5J06A 2Z4QA 4PYHA 3MV01 1UCBH 3MRPA 5IR1A 4DVBB 5ID1A 4QYOA 4PRHA 4I4WA 1R3HA 5IROC 2D7NA 3SO3B 2ZNWA 3DROB 3VFOB 2VIRB 2F58L 5C2UB 4YHNB 1SQ2N 2ICEA 4W4OA 5JO5B 2ADJB 3VFRA 4OM0L 5FCUL 4RGMB 1LO5A 4I77L 3MCG1 1RUKL 1BFTA 4Y19A 3SQOH 2Y36L 4ODTH 5HI4C 5B39G 1CD8A 1UXWB 1Y6KR 1A6VL 4MGXA 2EDRA 3K2UL 1OARH 3P30H 3SHSA 1W0VA 4PJCE 1D5IH 5HI3C 2JIXA 4HUMB 2NZ9C 1BZ7B 4HIJB 2R29L 4X80H 1DUZB 5DHXB 4UIKL 3CDGA 3LY6A 2VH5L 1M7XA 3RY5A 1KCSH 4YIQB 2CJUL 2D03H 1XGQB 3AFLA 4FZ8H 4FMFA 4QRUA 5DRWA 3WHXA 1KPVA 5IBTL 4HC1L 4OF5A 1MFEH 1UKTA 4X9GA 1EO8H 5GHWL 3IXTA 1UWXH 3PGDA 4WENB 1KPRA 2WBWB 4PTTA 3RTQB 3E6FB 1PZ5A 4XP6H 5DR5H 3QPXL 5EB9A 3WFBH 3E0GA 5JW4M 4EVNA 3HB3C 4EN3B 3QSKB 4LAJH 2H41A 2OR9L 4L8BB 3RZWA 2Q6WA 4OJFH 3X13B 1O0VA 3BIKB 5J9PB 2JCCF 2FEDC 3ARBD 1AP2B 4UINL 2EDBA 2E9JA 2VLJE 3HE7B 3CFDA 3LSOA 4XNXL 3UTSD 1RURL 1XGRA 3T04D 4NCC1 4GSDL 4P23C 4XCFL 3CFBB 1HQRB 1SYVA 2YHGA 4P5KA 2I60H 2PW2B 5L88H 1CDYA 4B5EA 3NCCB 2H1PL 4UT6H 1H8NA 5J3HD 4J6RL 2UUDH 1EGJH 5BRZE 4D3CL 4S0SD 3Q3GB 3PWUB 3NFNB 3FRPA 3QULB 1EZVY 1IKNC 1CGWA 5D2NB 5BV7L 3QRFM 4K9EH 5GGSY 5EOTA 2HLFD 3S4SA 4AT6B 2ZG1A 1IM9B 4FP8H 3ZMRA 1U8JA 3GHEL 2ZJSH 3DV6A 3MTRA 4K2UL 4MA1C 2AJZB 5TFSH 5K9JL 2IANA 1A9BA 1JZ2A 4LVOB 1N8ZA 5FM4A 4PGCA 5LXGH 4DN3L 3HI6H 4QCIB 4WHTB 1FBIH 5LWYL 1YNTB 2H2SD 1RJCA 3H2WA 4OKVB 2F53B 4KK5C 3QAZC 3ZDZE 1N26A 1N6QL 1YNKH 1OAZL 1FNAA 3C5ZD 4LLUB 4MAYA 1JPTH 4L4VB 4P9HH 2VE6B 4RGOH 3MO1B 2HFGL 3L95B 4ZFOA 4EXKA 5DGQA 5I8CB 4S11A 1HKFA 1LK3H 3BP6B 1NCDH 1X4XA 3QIBA 2Z91A 4G8FA 2R0LL 1RK0B 4H8WH 4OZFH 2BNQD 4M5YH 4ZO7A 3VXME 4F7TA 1U8LB 5J12B 3TEUA 4QTIL 3QEQE 2FR4A 5CSBA 4PRBB 1T5WA 3MPCA 3MRHA 2XPGB 1LNUB 3I75A 4KPHH 1FFNA 2A77H 4AL8L 3GKWH 2OL3A 4DEPB 2DD8L 3OR7A 1MJ8H 3IJHB 5ACMA 4D9LL 1YMHB 4U1LB 4XAKE 3WXWL 3BPLB 2AEIT 1U0QA 4P4RA 4ZTOH 1AD0A 2G9HB 4GUPB 1KGCD 2W59A 3HR5B 3U1SL 4CMMA 4RNRB 5EZJA 4PB9L 4P57B 2X70B 3ILPA 2APVA 5ESAA 1AE6H 5T3ZD 5F97E 1P9MC 1CE1H 2WNGA 3SDCC 3TIDB 3QG7L 2X4PB 1R5IA 4WUUD 4XX1G 2ZUVA 4PLKD 4Z7OE 1UGNA 4P5TC 1GGIL 3BGFB 3CFKA 2D31B 2ESVE 4GAGL 5I1LB 5ACZA 1AR1C 4M7JL 2I24N 3H0TA 5BQ7A 3L1OH 4U2ZA 4ZPTB 1KB5B 1F4WH 4I8DA 4MSWA 3BJLA 1IAMA 1JUFB 4WW1B 4Z7WA 5CAYB 4U49A 1RFDH 1U36A 2W60A 1HCFX 2VDLL 5F7FA 4KKAD 4NKIH 3A6BL 5D96B 4LCCB 1T20B 1B9ZA 3NCFB 2XY2A 4NJAH 4R90H 4Y5XC 1CVRA 5FA4A 1CGSH 1W0WA 4XH2A 3NPSB 4KFZC 4NQEB 4YX2H 4JG1H 1IEAB 5IV2A 4WVRA 1HNGA 4GKOA 4ENEC 1CFQA 1U6AL 3AMLA 1INEH 3GSOB 1DBAL 2OQJB 4LSTH 4V2CB 3EYUH 3DRTA 1P84K 3FONB 4NFDA 5JW5A 2VRAA 4EI5B 4UQ2A 4PJDF 5HHMD 3UBXB 3L3GB 5GGSB 1X5LA 4OCSL 4OQ1A 3QZWG 1I8LC 3CVHA 1OTUC 3ES6A 2BHUA 3QUMB 2F58H 1YMMB 5HGDB 4OCMC 3LQAL 4DVBA 1A5FL 3GSQB 3QJFB 1T66D 4PJEB 4I77H 3QXTA 1RUKH 3PNWB 1Q9WB 3DROA 3D25A 1X5AA 2C3GA 1MJUL 3V6ZA 1YDPA 2P8LB 3D0LB 3TESA 4M3JA 3PDOB 1X5JA 4R7DB 5B4MD 1IGCH 1UXWA 2R29H 3C5JB 4YHPB 2PYEB 4UIKH 4I3GA 3RKDD 2VH5H 3FKUS 4GG6B 4OV5B 2CJUH 4KWUA 2R4SH 3EFDL 3HI5H 3VMNA 4HIJA 1BZ7A 1YEGH 4HC1H 3RWIB 2ZSVB 1DUZA 5GHWH 5H8DA 3UX9B 2NXZC 2EH7H 3ULVL 4YIQA 1HIMH 4PJDE 1IBGL 3L3JB 3RTQD 1A64A 2DF3A 4NZDA 5EU6B 2OR9H 3L3DB 4UOW0 1XF5B 3AREA 4FTVB 3HUJB 4EN3D 5I2IB 3IDUA 4LSUH 4YK4C 4LASH 2VDRL 5LKNA 4UINH 3G5ZB 4EN3A 1RURH 2BNUB 3ZDXF 5C9JA 1H3XA 1KJ3L 4JDVB 4L8BA 4F37K 3HE7D 5I76A 3X13A 2R2EA 4APQC 4QRQB 3BIKA 2PCPB 5J9PA 5L6YL 4UQ3B 5CGYD 4P2RE 4LDEB 1FO0A 1UA6L 4YE4L 4DOHE 2H1PH 5GGVL 1FLRL 4XNUL 1BBJA 3CFBA 1WBXB 1MI5B 3UTPD 2QADC 3EBAA 5CP3H 3RZCB 4JFXA 5J1SC 1Q9LA 3DTXA 4P0DA 1NBQA 4Y4KB 4FXKB 5KSBE 1A4JA 1DE4B 4IS6A 5ETUA 1Q94A 5F6HI 4Z76A 5BV7H 4U6HB 1C08B 3WIFA 1HNFA 1NDGB 3ZKNC 2Q87A 3DETD 4FHBD 1O5DT 5GSVA 3VFNB 3ZDYE 1FHGA 3GHEH 3Q3GA 3NFNA 4K2UH 2IQAA 5K9JH 5D2NA 3TO2B 2VZUA 2G75B 4WV1B 4AT6A 1IM9A 3WS6A 5I75B 3OX8B 3RIAK 1NEZG 1NCUA 4KKLD 2AJZA 3DURA 4DCQB 4PRPE 2CDFB 1LP9A 3WO4B 3BN9D 4HWBA 1N6QH 1RUQH 3NFSL 2GK0B 2X89D 2KQNA 4QCIA 4WHTA 1TXKA 2AK4D 3RWCA 1YNTA 2HFGH 3RNQA 3PWJB 2F53A 5IQ7H 4L4VD 1I8MB 3UC0L 4LLUA 4QTHA 2PKDA 2AJXL 4G6KL 1NQBA 4QTIH 4L4VA 2QQKL 3MLUL 4ORZC 3MO1A 4U6VH 5F1SA 3U36A 3WJJC 4IRJA 1WEJL 1JGDB 5I8CA 3QDHA 3MREB 4HUUA 3D1MC 3CSBA 1RK0A 4XRCB 4AL8H 1U8LA 1MHPH 2F19L 1ES0B 1NC4B 4HGKC 4NUJB 4D9LH 3GBNL 1ZE3C 4HUVB 4S1SH 1FN4A 4PRBA 3NA4A 2ATKB 3O3BB 3U1SH 43C9A 4J3SA 2YRLA 4PB9H 4WO4C 1TCRB 2P5WB 2A74A 3RBGA 3HE6B 3CSYA 1UEMA 2UVEA 3QFJE 1YMHA 1XCTB 5TJWK 3U2SB 4CVWA 2G9HA 2DYPA 3NCJL 3NN8A 3HR5A 4RNRA 3WDJA 1HK6A 3B9AA 4ODBD 3FN9A 4P57A 1P2CA 4TSBL 2X70A 4GAGH 2CR3A 1WCQA 2CSPA 4M7JH 2J5LC 3SDAD 2C1OA 2YR3A 4TOYL 3MRCB 1OAYL 1OLZA 2I07B 1J87A 2D31A 4LCIL 5DD3L 4DTGL 4EUPA 1MJ7L 5TDOB 2VDKL 4N0UE 1ZVSA 4ZPTA 3JBG7 4M1GL 1Q9OB 3H9SA 3C6SB 1JUFA 4WW1A 5IEHB 4L4TD 4E5XB 1OSPH 4Y88A 1QBLH 4EQ3A 2VZOA 3QXVA 5MEOB 4LCCA 2VN7A 1T20A 1T1WA 5BZWA 5I71C 1A21A 1EUTA 4IOIB 4XNYL 4NQDB 2BRRH 1J8HE 1U6AH 5CP7B 4RMTA 3UYOD 4XPTL 2GY7B 4N8CH 4NQEA 1J1XL 4KROB 1IEAA 1K2DB 2Y9RT 2CD0A 1HHJA 2A9ML 1NCNA 1BVKB 3RGVC 3BX7C 4DWHA 2ZUYA 1DFBH 3C2AL 5D7JC 2OQJA 4EI5D 1WT5C 1FGNL 5GS3A 1YUHB 4EI5A 3TH4T 3ROOB 2EKJA 5E7FA 3L3GA 3W9EB 3MBXH 2GFBA 3ARWA 1I3GL 1A5FH 4JRWA 4WFED 2VDPH 2ZOLB 1NANI 3MJ9A 1G6RL 1D5ZB 2EC9U 1MNUL 1FVCB 1YMMA 1FGVH 5HGDA 1MJUH 3GSQA 3QJFA 4PJEA 1EBPA 3O2WL 3SEPA 1Q72H 1Q9WA 2WW8A 4PP1D 3FO0L 4PJCB 4RMUA 4NCC2 3X17A 4X9FA 1MCOL 4FQHB 2C3WA 3OJVC 1QP1A 2P8LA 3D0LA 3MJGX 3OKEB 2R2CA 4LVEA 4XVUD 4OFIA 4JKWA 5GGTA 2PYED 3BD3A 4R7DA 4F15C 2IAMB 3EFDH 4OZHF 1BQHB 4A6YL 2YN5A 1CFVL 2DQTH 1MCSA 4FQ2L 3V0VA 4ZOBA 1D7FA 2SEBB 4AM0B 1QG3A 3QPQD 1DBML 1ZT4B 4GG6A 5GS2H 4OV5A 1IBGH 1XGYL 3MNVB 4F7CA 3RWIA 1IE5A 2ZSVA 1A9EB 4KU1A 3RVUC 4XI5D 4PJ5E 4NN7C 4AH2A 3MLWH 2VDRH 4ODSL 1G7IA 3OAUL 3MGAA 1OAXH 4Y4FC 3QBTB 1F00I 5EU6A 1KJ3H 1CGXA 4GBXA 3L3DA 5IVOA 1XF5A 4FTVA 4U1HA 3WJLC 3WUWG 1YEKL 5HHNB 5T5FL 5L6YH 5FGBC 2FYYB 2ZZUT 1NGZB 3FHAA 3MOAH 4YE4H 5D1ZB 4N5ED 5C6WH 3KDMB 2P8PB 1IAIL 4XHQA 2BOBB 3V0WH 4BM7A 1MI5D 1ORSA 4TSCL 3RZCD 1WZ1L 5C0CD 3V6FB 4N0RA 1CICB 2DJ4A 3LS4L 3MMEA 3RRQA 1C1EL 1WBXA 3TIEB 1GGBH 3N0PB 2NNAA 4LAQL 3MC0A 4IM8A 4OZHE 3L6FB 4Y4KA 3O2DA 2NMSA 1JNHB 1WFTA 5KVFL 1Q0XL 3BPCA 2EKSA 1C08A 3FQWB 1AIFB 5IIEB 1G84A 3STZA 1SEQH 4U1SB 1NDGA 4HSQA 3ARQA 3VRJB 2NYYC 1G9NL 3F7RA 3VFNA 1MSPA 3FAWA 1DQLH 4R2GC 3G5YB 3TO2A 2WIMA 2G75A 4U0QB 4WV1A 3NFSH 3OX8A 1I1FB 5EA0H 1ACYL 5IB2B 2JCCB 1EO7A 5LG1A 1DQQB 4DCQA 4JKLA 1DR9A 1BX2A 4N0FA 5CSZB 3H3BC 5E8NB 4HUNB 4JB9H 5E1AB 2LAAA 1NGYB 4KJPD 3VXMB 4M93B 2QQKH 1P6AB 3HKFA 2ZKHH 3PWJA 3QEQB 4ZNEA 1WEJH 1T80A 1L4IA 3MFFB 1I8MA 3MODH 5TE4L 5EZLB 1DZBA 2F19H 1SJXA 4XVJH 1J9CT 4IHOB 3WLBB 3GBNH 4GS7C 4UT7L 2EEAA 2EIDA 2LFGA 3M8OL 5F7HA 3QYCA 1NC4D 3GJFH 3MREA 4QRPE 4LCWB 4XRCA 3BP7B 1ES0A 1YPZA 4NUJA 5GS0C 4HUVA 2P5WD 1Z9MA 5B8CC 3HE6D 3I6LD 2ATKA 3O3BA 3KPTA 4N9GA 5FHBL 3DYOA 1G1YA 3NH7L 4KKCC 1BMGA 1CQYA 1TCRA 3OJDB 1MHCB 3TFKD 5I1DB 5M94B 4EEEA 1HXMB 4G8GB 2BSSA 1ZLUK 4HKZB 3IFOB 4WW2F 2ESVB 3DUUB 2B1AL 1A7BA 4TOYH 3N1MC 4X6DA 2AS5M 4LLYA 1OB1A 3IETB 2P42B 2UYLB 3LKRA 4LCIH 3V5KB 1FNGB 2LU4A 2NQCA 1V7NH 4MA3A 3UJTL 3HC0B 5DFWH 3I3EA 3NABL 3MRCA 2V9RA 4PRAB 4KGLA 4M1GH 4MD0B 3LMJL 2COQA 4O51B 3ARDB 1RUAH 1PD6A 4ZUVA 5TDOA 4BYHA 4XNYH 5HGBB 5FK9B 1ZK9A 3I50L 4JZOB 3LEYL 1DEEA 4E5XA 4NQDD 4XPTH 1TJHL 3OB8A 1J1XH 4RMVA 1KSRA 3QISA 1U8MB 2YD4A 1KLFA 3NVQA 2A73B 4JFFD 4YNYB 3I2CH 5L8LB 2A9MH 4KROD 2YKLH 3LIZL 1IARB 1FFOA 4RFEA 1OHQA 3C2AH 4OIAA 5HGAB 3VDBA 2F54E 4NWTH 1K2DA 2DMCA 5JDSB 1FGNH 1BVKA 2ATPB 5J11C 4YDKH 3P4MB 3C60C 2EEDA 5DUMH 5HGHB 1E0OB 5TE6H 4HGWB 1QRNA 3IS1X 1O7SA 3PL6B 1UT9A 3G5VA 5C0GB 1MNUH 3GBML 2ITDA 3OKOB 3W9EA 2NTFB 3SOBH 3IDNB 4MXWH 1UXSB 1ADQA 3O2WH 3C8KB 4N8VB 3F58L 1D5ZA 1H5BB 4PJ7F 3FO0H 3LKSB 4C4KO 2AJ3A 2DTML 4MJ5B 4HMEA 1MCOH 1RZ7L 2R69H 1D3CA 4P46B 1CBVL 4NQCE 3BWAA 5AG9A 1RUPL 5DEGB 3W5NA 3FN3A 4UU9B 3KYAA 4OLVL 4U1IB 4MS8D 4Q9BA 4M6NL 1RJZB 2NY6C 4FQ2H 1V3KA 1A6AB 1JI1A 2GQHA 4PG9B 2JJTA 5TPWL 3OAZK 4LEXH 1XR8B 1DBMH 5JTWA 4M43L 1FORL 3MR9B 2MMXA 2IAMA 2APTA 3F7QA 4ZSOB 2FJFB 5KOVC 1S9XA 3OZ9L 3ULSB 1ZGLM 3B83A 1AC6A 3BDXA 1XIWC 1U95B 4ODSH 5DHVH 3OAUH 3U4BH 3IGAB 4CU6A 3SBWC 5E6IC 2BSED 2EDEA 5A2KH 5FYKE 4AIXA 2O5ZL 4YAQA 5KVGH 2R4RL 5DWUH 3VGFA 1A9EA 1UCTA 4Q2ZB 1S5IH 2DWEB 4H25A 2D3VA 4R4BB 2VLJD 1X6LA 3B9VA 3ZHKA 2BJML 3QCTH 4P2RB 2NCMA 3I84A 4UIMB 1IJ9A 1RI8A 2JJUA 3FTGB 3VGHA 4XCEB 4DOHB 4LSVL 2H2PC 2VYRE 4YXKH 2FYYA 2DKSA 4TSCH 4LHUG 1MAKA 4XVSH 5D1ZA 5JIHA 3BEVB 4KRPC 1D5MB 5BRZD 1C1EH 4FXGA 4HJ0C 1RHFA 1EO5A 1KIQB 5IOPB 1T6VN 2ADIB 2FBJL 3BE1H 5GZOC 5I9QC 4BA8A 5KVFH 3V6FA 2P8MB 1CICA 1MIEL 4X99B 1JF1B 5GXBB 3OKMB 5L8KB 1G9NH 1U8NA 3L6FA 43CAA 3PP3K 2GW5A 1JNHA 5BZDB 5JXEC 3LEVH 4LSSL 1AIFA 4PRPB 4GT7A 3IB4A 3QWOA 4XCYA 3VRJA 1H3UA 1ACYH 4FABL 1KTLA 3RUGE 4DZ8B 2X41A 1L7IL 4LLWB 4YHIA 4NQUA 3PWPE 1SJEB 1WCBB 5CKGA 1LEKB 4XMKL 3V8OA 4B0MM 3KPNB 3TBSB 3BKYL 5GRWA 4N0YL 4IRZL 3K2MC 1JYVA 4ZXBC 2JCCA 5DJXB 1AGEB 2AVGA 3VDCA 4WFGE 2GJ6A 3VXMD 2EE9A 3QEQD 5CSZA 5TE4H 1SJVA 4N5UA 3M8OH 4XBEL 1JRHL 5LBSL 1MAML 4XAKD 5EZLA 5I6XC 3EGSB 3L3OA 5KSAC 3TBYB 4IHOA 3N1GC 3WLBA 3O3UN 4X5XA 2AJUL 3BIBX 5DD1L 2VABB 5DD5L 3A6CH 3FL7A 3G6DH 3NH7H 5LQBH 4LCWA 2NLJA 4Y1AA 2R9HD 3FT4B 2FHBA 5LGHH 4MZ2A 2W0PA 2BVQA 3ECBA 1WWAX 5EIIB 3U46A 2QSCL 2ESVD 5ID0A 3QHFH 3OJDA 3QUZB 5FA3A 1PQZB 4X4MA 2KUTA 5I1DA 2DMKA 4CU8A 4G8GA 1KG0B 1CU4H 2VKWA 2KQMA 3IFOA 1VENA 3RPIB 3RWDB 2ESVA 3DUUA 3RWHA 3NABH 5IFJB 1AXTL 3V7AE 1Y18B 4N0UB 3EJZC 3LMJH 3IETA 3QG6A 4HS3B 3V5KA 1VGKA 1UEYA 2R0ZH 4HKJB 3HC0A 4U33A 2AEPL 2F8OA 3ARDD 4PRAA 2GAZA 3RL2A 3LEYH 4M7LT 4QT5B 2OBGA 1B6UA 1TJHH 5J13B 3R1GL 4X6FB 3CX2A 5A2FA 3UYRH 4M7KL 5INCA 4UDUA 3FRPG 5HGBA 3NCBB 1S7UB 4CVZA 4NBXB 4TVPL 1U8MA 4YNYA 4HLZG 4PJFE 4U2YA 1SBBA 4XPAH 1BFOA 3GK8L 4TULH 1BIIB 1FL6B 5E9DE 2I26N 4G42B 4JDTH 3Q5OA 1IVLA 2ATPA 4NDMB 3SN6N 3P4MA 4K3GA 1UKSA 3PWLB 1I1YA 4PY8J 4X7FC 5HGHA 4QRRA 4HGWA 3V6BR 3QWRA 3PL6A 3QUYB 3D85D 4U31A 4Y2DD 2FB4L 1ED3B 5F7DB 3OKOA 2DTMH 3J7HA 2NTFA 1RZ7H 3O6FC 2HRPL 5GIRA 1EH9A 2VZVA 1QFOA 1X9QA 4MDJA 1U58B 1AO7E 3ZHDA 4P46D 4H1LH 5SWQA 4Z7NF 4QRTA 1MIML 4J12A 1XF2B 3WYRA 4P46A 1TIUA 3RY6A 5FO9B 3LKOA 1NSNH 5E4IA 4EDXA 4AQOA 2C7UB 1IFHL 2APFA 3EDFA 3ARYA 3OZ9H 5D7LE 2BOCB 5CZVH 4G6FB 4MXQD 3A0OA 5ITFB 1WISA 3QA3A 3U83A 5JUEL 2WWKO 1JWMA 2D0FA 2B4CC 3G6JF 4HIHB 4ZSOA 2FJFA 5FB8B 1DQTA 2R4RH 1HQ4A 3ULSA 5DVLA 4NBZB 1A47A 5JHLL 1FLTX 3CAFA 5DD0H 5IMLB 3IGAA 3T65B 4NRYB 1F8TL 1AKJA 1VGEH 3U7YL 3VD5A 3MYZA 4JCLA 5DJ2B 4GKSB 4Q2ZA 2DWEA 4R4BA 5DLMH 4U1GC 4LSVH 4P2RD 3RHWK 5DJ0B 2K9UA 1QPPA 3B9KA 4KKBC 1NGWB 4TRPH 1L7TH 2G5BA 4GMTL 3DECA 4UIMA 4MNHB 1T22B 5C0NC 2HKHL 1YN7B 3GHBL 3FT2A 4XCEA 3T0XA 1IL1A 3PHOB 1YEIL 1JGLL 5DK0A 4OZHB 2Q20A 2DQIL 1CK0L 2WP3T 4Z7NE 3QIWB 4KUCF 4P3DB 1ORQA 1MIEH 1D5MA 1QFWM 2R1YA 2XA3A 3S5LA 1KJ2B 5T1KD 4OLUL 4H5SB 1HH6B 4TN9A 1A1NA 4LPWA 3D3VE 4PB0H 5BS0A 4X99A 1ZVHA 1NPUA 1P7HL 1JF1A 2V5SA 3TNMB 5D1QD 3OF6D 2CUIA 2PW1B 3G6JE 4PRPD 1L7IH 2LV4A 5E8OB 2Q8BL 5HHQA 5BZDA 3OF6A 4PRPA 1T89A 4OD3H 4IMKA 2VOTA 3X14A 3QDJE 5IBUB 3BKYH 4N0YH 4IRZH 3FB5B 1JHTB 1URLA 1UVQA 4LLWA 4D0BB 2N7AA 2V6HA 4F9PC 1WCBA 5F1NA 1LEKA 5I1HH 3WSQL 2H32B 1FVDB 4PUBH 3KPNA 1EV2E 3QO0A 2HJLB 2V5TA 3CLEH 5DXWA 5DJXA 1AGEA 4L1DA 4PGEA 5D2LF 3IXAA 5F44A 1JRHH 5LBSH 4JVPA 5I19L 4BELD 2FEEL 1NCCL 3QI9A 4OF7A 2Q76B 3RWGB 3CZJA 2E27L 5A16B 2E6JA 2AJUH 3BSZH 3CU7A 1TQCC 1SVCP 2VAJA 3KNBB 3MV7E 3ZE1F 1IC4H 3KVQA 3V4PH 3EGSA 3TBYA 2W0KA 3KWWB 3S36X 3NIFF 4HBCH 3GSVB 1J1OL 2VABA 4JHZA 3INUH 5JIPA 5C3LD 4R7NB 2QSCH 5DMJB 4PLOB 1YQVL 1WITA 1BZ9B 2VUYA 1TZHA 4ZAKB 4ZFOL 2F8VA 1AD9B 1UWXK 1DVFA 3GNML 3G08B 4POZC 3FFDB 1AI1H 3DX8A 5IB1B 4G7VH 3EKCA 5EOQL 1S7XA 4M7LH 4HQQL 3JUZA 3QUZA 2RFXA 5F6IB 3QNXB 3RWDA 2AEPH 2X09A 3CDYA 1CL7L 5F3BA 1S8DB 2OL3L 1Y18A 1FSKB 1F4XL 2XWJA 2JB5L 3R1GH 5KS9F 5DQ9B 5FGSA 2FJGA 5D2LE 1RZKL 4ZQKB 5E56A 1T7WA 3FZUD 3FOLB 3GSUB 3D2UB 3G5XB 4K71B 2F54B 3V4UL 1QACA 3ARXA 3U7WL 4BH7B 5D5MA 2KL6A 4J4PC 4O58H 1FG2B 3RNKB 3ZE1E 1HINL 2UUDK 3KJ6L 3QJHB 1S7UA 5T3ZL 1QUNA 1P4LB 3IU3B 4LKCB 2NY4B 3NIFE 3GK8H 5DF0A 2V9TA 5I8EA 4KI1A 3P77B 4WW2B 4Q6YA 2IADB 4GAJH 2B4CH 1CDGA 2QR0A 2VDNH 4U7MA 1H3PL 1UACL 3OJMB 1JN6B 2AXGA 2Z8VC 4PJXE 4ZD3H 4Z9KB 1FL6A 3OGOE 4YR6B 2FB4H 2UWEE 3ETBF 1OWRM 4MLIA 5C0AE 4QNPF 4HFWA 3ILQD 4WIQA 4HS8L 3ARFC 3PWLA 5EORL 4OZFB 5EBMB 2X9XA 2J8OA 4JGJA 1Q0YL 5CBEA 3QUYA 5F88B 1EJOL 2IC2A 2IFFL 5IFHH 4ONFL 4OZ4B 5F7DA 2V2XB 3TA3B 2V2WB 1MIMH 1CWVA 3H9YA 1U2HA 4R96A 3LDBC 5DVMA 1N5YH 5EZIH 4XMPL 3CVIL 1E6JL 3VRIB 3VFTB 1U58A 3GO1L 3VA2C 2ZUXA 1SY6L 1IFHH 3PIQB 1BJMA 1T7XA 3H9HA 4FQCH 4CMHB 1FYTB 3OV6A 5JHDE 5A3IC 4PLKC 1U8OB 3O41A 4LARL 4WI6A 4G6FD 4RSVA 5FO9A 5D72H 5HHOE 2C7UA 5M95B 3TBTB 5JPNB 2Y5TB 4PJ5D 3QCVL 4JGMA 5ITFA 3AS1A 1EIBA 2C3HA 1IQDB 1QOKA 4HIHA 3SKJH 5FB8A 4JQXC 1WUNT 1UQSA 5I1JL 2E7LC 4LPCA 4CW1B 1CCZA 3IDYC 3S35L 3E1F1 1OAKL 2GJJA 2YS4A 1QSEB 2APBA 3UZQA 2AV1B 5J1TC 5IMLA 1QEWB 1YJDL 4QNPE 4NRYA 4JM4H 2QQNL 4PJ7B 4NO5B 4V1DE 3KPMA 3DIFA 4BH8A 4S10A 5F9WC 3OR6B 4OM1L 4QOKB 5DJ0A 5DT1L 5I18L 1JPGB 2I9LB 1JGLH 4LRNL 1CFTB 3QQ9D 2JELL 2QQQA 1T83A 3SGKC 3MRQB 1AHWB 5JIIA 4DKAA 3PHOA 4OLUH 3N85L 3ABZA 5F7MC 1UWEH 3EDDA 1IAII 1R3IH 2P46B 3QIWA 3MJ7A 1KJ2A 4LLVB 4Z18A 4R4ND 4X4XB 2CXKA 2OTPA 1VSCA 3OSKA 4ELKB 5BCAA 3T0VA 1JE6A 1EFQA 1KLUB 4P4KC 5IHUL 3PWPB 4NNPH 3UBXG 3BZ4B 5IWLC 1F11A 3D39E 4P2CG 1NMAH 3IDGB 4U6YB 4PD4J 2ZP0T 2WMPA 3UTQB 4Q9RL 3VJ6A 2YD3A 2HT4C 4L3CB 1CG9B 3ARVA 2QEJA 3ZTNL 3EHBD 2B8OT 1S7QB 1YEJL 4BUGA 1OCWL 1EEZB 1B4JH 4P23B 2OMNA 3V52H 3MRGB 1JHTA 4RRPG 4B7LA 4D0BA 2VLLA 4LLAA 4MJ4A 2D0GA 1NCCH 2HJLA 3DPBA 3UEZA 4HLZH 1JZ6A 2E27H 4XTRD 3M17A 4QRPD 2FGWL 4ETQB 1UZ8B 4OD2B 4ONGL 1FFQA 3LEXA 1ZT1A 3BP4A 4WFFE 5KJRL 3BI9X 5HXMA 3Q2CA 3QCUL 2OCFD 1HSBA 5MEQA 1J1OH 4R0LA 4XPHH 2OXGA 2Q7NA 5L8JB 4YBHA 1R5VB 5CBAB 3IFPA 3P0VL 4MA1B 1LD9B 3DMMA 1YQVH 4OLWH 2MFNA 4Y16B 3BPNC 4I0CC 5AEAA 5CGTA 3VXOB 3GSVA 5F7NC 3GNMH 5E08L 5TDNB 3PV6B 1QNZL 3EYOB 2WP3O 2W0LA 1CLYL 2ADFH 5EOCJ 4UTBH 4JZJC 4ZAKA 1I8IB 2P47B 1WBYB 4W4NA 5BMFH 1MLCA 4F7MB 3G08A 2XOTA 3FFDA 3SJVE 4NOBA 4LPVA 2DM4A 1AY1L 1PEZA 5DVNA 3GMMA 2UVFA 1A14L 2YUZA 2YK1L 2JB5H 5TQ2L 1W0YT 3MRRB 3KPRB 3C6LA 1J7VR 2VDOH 1S8DA 5F9AC 1KEMH 5BV7B 4UZGA 4GRWH 4JRXA 1ONQB 1FCGA 2ERJC 1VFBB 4HIEB 1UM6L 3V4UH 3D2UD 4O9HL 4YGAB 5KOMC 1EGJA 5HDBF 3RI5F 3CJJA 2HN7B 1FG9C 2F54D 4Z7VF 1HINH 3KJ6H 3IFLL 4PBVC 2XG5A 1LMKA 5T3ZH 1KACB 5EN2B 1R3JB 3MACH 2HP4A 3G5XA 1CGVA 3V0AC 3PHSA 3PUCA 2NY4D 4ZUUB 3GMLB 3RNKA 1FG2A 2CGRL 1TDQA 2MPAL 1G7LB 3QJHA 1H3PH 4XMLH 5C6TH 3TCLB 4RZCB 1UACH 1P4LA 3IU3A 4KJYB 1GOHA 1ZWIB 1MUJB 3P77A 3WN5A 1NFDF 2IADA 4P5TB 1KB5L 2V5MA 4PRDB 3BRGC 2IALA 2AEQH 4Z0BL 2Z8RA 1JF5A 5E4EC 3SGJA 3ZL4L 1S78D 2A6DB 2R23A 4Y0GA 4KHXL 1Q0YH 3K4DA 5IBLC 1OL0A 1NAML 1U91B 5C07E 1EJOH 5DVKA 2IFFH 3AAZB 4ONFH 1BLNB 2Y25A 1AO7B 3ZYOA 5DEFB 4OZFA 5EBMA 3PP4H 4Y5XB 4X7CC 1RZGB 4XMPH 3TA3D 5JIKA 1E6JH 5L2JB 2XNAB 1U8IB 1RZFL 3SGEH 1CFSB 2EE6A 1QSFE 2V2WA 2K7QA 4QHMB 1MLBA 5D7LB 3MLYL 2DOCA 5HDBE 2XZQL 1NMBL 4LARH 1AQDB 3VFTA 1FYTD 4KK8C 4Z7VE 3T8XB 3SDAC 3R8BB 3DHMA 1FYTA 5DURB 1EFXD 1U8OA 3QUML 1Q9KB 3ARPA 1XF4B 5B39B 5I1JH 4TTDC 5EO0B 1JGVL 5JPNA 3QRGL 1IGYA 2Y5TA 3S35H 5EOCL 4LPXA 1KULA 4XP5L 1V05A 5E8EB 3DHJA 5C08A 4QHUA 3H7BA 1IQDA 1YJDH 3L7FA 4I9WD 1ACZA 3WIHL 2DQCH 2E7HA 1QSEA 3KPQB 5DT1H 5TDPB 3O4OC 2J1KA 2J8UE 3ZYZA 3RL1A 4GQ9H 4LRNH 4HIXH 3VXUE 5HI4D 5EO1B 2V5RA 2LVCA 2JELH 4GAFB 4PJ7A 4LSRL 3EYFB 4K7PX 3OR6A 4PJAE 4QOKA 5I1EH 1YEEH 1JPGA 1XCQA 4OAWA 4HLJA 1U93A 2NZ9D 1E4XH 3L5WB 5LAXA 3SPVB 2Z93A 1AHWA 3D3VB 4RFNC 1G9EA 1GGCH 1I9EA 3EJJX 4RWHA 5FCSH 4Q9QL 3G6JB 4NIKB 4LLVA 1GHFL 2AJSL 4X4XA 3T0EC 3PWPD 3FB6A 3QDJB 4Q9RH 2LTQC 1F90L 3HB3D 1K4DB 4ELKA 3LN4B 4YK4B 1KLUA 1KPUA 1FNFA 2JE8A 2HMIC 2VZ3A 3IDGA 4JHBA 4U6YA 2IMNA 4WFGD 5D9SB 1T5XB 3UTQA 5JORB 3LKPB 3IJYA 1CG9A 4APQB 2H3NA 1KIPB 3HA0A 2CIIB 4Q0XL 4P23D 3VFPB 4X9BA 1D5XB 5DJAB 3GGWA 1S7QA 2EDKA 4XCCL 5DMIH 3RJQB 1NBZA 4RAUA 3O2DL 3P2TA 4P23A 3MRGA 1M71B 3NTCH 2FGWH 2QADB 1II4E 4YUEL 3ALPA 5DJDA 4ONGH 1QYGL 4IRSC 5KVDL 3S36H 3MA7B 2Q3ZA 5KJRH 4Z8FL 2C3XA 4X6EB 3T0WA 4ETQA 2FZ3A 1UZ8A 3U0WH 1BQHG 3EZJB 5EU3B 4OD2A 1XFPA 3P0VH 4HC1A 4L3EE 1WSST 5DUBA 1IKNA 1JI2A 2KDGA 1DQDH 2P5EE 4H0HB 3U9PL 2NY0C 4YDJB 1IT9L 1JRHI 1K3IA 5E08H 1QNZH 1R5VA 4M61B 3I6GB 2UV3A 1CLYH 4G9DB 4WJ5B 4Y16A 3NGBC 4TSAH 1U3ZA 2O5XL 1EAPB 3HC4L 4KK5D 4K94C 4WEBL 4YC2B 1FH5H 2YWZA 3KS0H 5GRUL 1X5FA 1IAKB 3PV6A 3F5WB 4OLEA 3EYOA 3JV6B 3S88L 3TN0C 1XR9A 4JFQB 3O3EB 3SE3C 3MUGB 4KRLB 1I8IA 1WBYA 3MNZB 1A7NL 4ZOEA 4K3EL 5CCKL 5D2LB 4NYLB 4FQXA 1R6VA 1MELA 1JIBA 1UM6H 4O02L 4O9HH 5CP3A 4ZUTB 3KPRA 2DQJH 5CLWA 3T0DA 3ZT6A 1AXSA 4J2XA 3UPAA 3IFLH 2W9DL 3LKNB 4JANA 4P5MA 5HDLA 3IVKA 4KY1L 5ILTL 3RWJB 4C56E 1AQKL 3SE4C 3U4EB 1VFBA 4K23L 4JY5L 4WO4B 3ZE2F 3EDEA 1HH9B 3E3QC 1TJGH 3SKUD 1F3JA 2WM0A 5DQDL 3NA9H 3BDYL 2CGRH 2MPAH 5E9DD 1R3JA 5EN2A 5FDWB 2E9WA 2HJFA 4M8QB 3CDFA 4NCDA 1E28B 4ZPVA 1J0ZA 4UNTA 4KMTH 5GZNC 1KB5H 2DWDA 4P9ML 3LRGA 2G2RB 3SDCD 3GMLA 1WAAE 1G7LA 4Z0BH 3NCYS 5C0AB 3TCLA 2J5LB 4OSUH 4P5TD 5FF6B 1J5OL 5D71L 3FAXA 4KHXH 1AR1D 2EDLA 1NAMH 3ARGC 5JQ6H 4ZFZB 1G7MB 4UUJA 3FFCA 2YD5A 1JMXA 4P2OA 1IGTB 1AO7D 5KS9B 3GUTB 4AZ8A 1TETL 2VC2H 1U91A 3UJJH 5C0FB 2IBZX 1RIVL 3GJFB 5I71B 4JFEA 2XN9A 5DZLA 3E2HC 1OGTB 3MLYH 4Y5XA 2XZQH 2WBJC 5JHDB 4ODUB 4ENED 5L2JA 3HMWL 2XNAA 3REVA 15C8H 5D7LD 4F80A 4PJHA 4D2NA 1QA9A 1T0MB 1CFSA 4OGXH 1M7DB 3B5HA 3ZE2E 3RGVB 2OJZL 2CMRH 3UDWA 3W11C 3GJFK 5D7JB 4Z0XB 4F8QA 1Z5LB 3QUMH 1AQDA 3VMOA 2DN7A 4RMQA 3HNVL 4OCRH 2RCSL 5DURD 5HGGS 1OPGH 3T8XA 1JGVH 1JYNA 4BZ2H 1OVZA 3OKYA 1MFAL 1KBGL 1Q9KA 1KV3A 2QKIB 1XF4A 5B39A 2Z9TA 2R56L 4MD5B 2X4QB 1AC0A 1LEGB 5ISZE 4V1DB 4BSVB 3MCKB 1P4BL 4XBPA 4Q6IC 4P59L 4OTXL 4U0RC 2KZWA 3SKMB 1QQDB 3O2VL 4P49A 2AKRB 4PV9A 4YHKL 5TH2B 1I7ZB 1X7QB 4R97C 3KPQA 5TDPA 5ECJE 4NZUL 1F2QA 3TYFB 4NHCL 4LRIC 1PG7L 6CGTA 1BOGB 4F15B 1QFUL 5D7IF 3FQNB 3K8LA 2A2QT 3D3VD 4FFWC 4I3RL 4Q9QH 2DQGL 4DN4L 3BMWA 3L5WA 4JY4A 3SPVA 4MNQA 4CGTA 3D3VA 2NXZD 4MJIA 4OB5L 2CPCA 1MWAB 1F90H 4ZO9A 3TVMC 5FYJU 5F9JB 4S1DC 2GK2A 1CDIA 1JL8A 4NN7B 4MMZC 3QDJD 3IJSA 3TM6A 5FYLE 2O93L 4IEFB 3BZEA 2YPVH 3QDJA 2C9AA 2FD6H 3LN4A 2NY1D 1FAIL 5DJYA 3CFIC 5H2BB 3C5SB 3NZHH 3X11B 4APQD 1JTOA 5KBNC 2JB6B 1UJ3C 3GIZL 4Q9CA 1QSZA 5D9SA 3WKMH 4GJTB 2M8XA 2IH3A 4N8VG 4YUEH 1JGEB 1KIPA 2CIIA 4I13B 1D5XA 5DJAA 4UTAH 4F2MB 5GS1A 5KVDH 2QJDA 1JP5A 1JK8B 3DXAE 2HYMA 1QFWH 4JZNB 2O5YH 3WFEL 5E2TH 2E6QA 4KUCD 4HWUA 4M03A 2R0WL 1MCDA 1VFAB 2ZNXA 3MV7D 3DUSB 4HAGA 3K1DA 4HJGA 3FQXA 5D7IE 3ZKND 4MB4A 5GS2D 1CXFA 3BKCH 4YPGB 1NC2A 1A02N 2YXFA 3VH8B 1IT9H 2VXSH 3SY0A 3MBED 5EU3A 4Y5YC 4GRLA 3VWJC 4G5ZH 4YHOL 2XKNB 3F7PC 1H3VA 5JR1L 2O5XH 1X5KA 3W2DL 1RAMA 1F5WA 2CK0L 3MV8A 4G6JL 4WHDA 4M61A 1FL3B 4F58H 3IDXH 4G9DA 4WJ5A 1DCLA 1EAPA 3BO8A 1GIGL 4MCZA 1QHPA 1IQWL 4K3EH 5CCKH 1IAKA 5K9QG 1NGXB 1K8IB 1RIHH 2D7MA 3JV6A 2OTWA 2Y72A 5I1CL 2N4IA 1WFNA 2BVYA 3O3EA 4JFPB 4PP2B 4JFHE 3HN3A 3VW3H 3MNZA 5EH1A 4NN5B 1ETZB 5D2LA 4D9QE 3TZVC 4GS7B 2W9DH 2V2TB 3WFHB 5ILTH 1AQKH 1MPAL 3BQUC 2N56A 5EFIA 1AGBA 4MLSA 2DQFA 1MCPL 4CADB 2DKMA 4WO4D 3BDYH 3BUYA 3LKNA 3OJ2C 5FOJA 3WL9B 3RWJA 5KTEL 3U4EA 4KDTC 2IEPA 4ERSH 3S37H 1PY4A 1Y0LA 5JXAL 4PTUB 1C16A 4P9MH 4HXBH 4OCNC 4OFDA 4M8QA 1HI6A 3UTTB 2HVJB 5C0AD 4WI2A 5D93B 3RDTA 1W2KT 1VACA 4Z95H 1J10A 5IEKA 3GJEB 5FF6A 4G3YL 3QQ4B 3HPJB 4IIQC 2J88L 2VXTH 3OXSB 4J3OC 4HPOH 1YECL 3EOAB 4JKPL 4ZFZA 1G7MA 5K9KB 1MREH 3GSWA 4NKQB 1S9VB 4MB5A 2PO6C 3LN9A 8CGTA 1QSFB 5JLZA 4GLRH 4EOWL 4GRWF 5KS9A 3GUTA 1GCFA 3OKKA 2X4NB 1D5BB 1LO0L 4G6MH 5F8RC 2Y07H 2ORBL 2BVPA 1OAUH 5JHDD 4Z7VB 5C0FA 1N6UA 3WO3B 4L9DA 4ALAL 1OGTA 4HCRH 2OJZH 2BY0A 3QZWA 4X0KA 4X7EC 3DV4A 4MQ7B 5HHOD 4PG2A 1RSFA 3QH3B 5IJKA 2PTTB 2BC4B 3RGVD 2RCSH 1SJHA 3MA9H 5D7JD 3QUXB 1T0MA 3RI5K 1M7DA 1A7QL 1HHIB 2PXYB 1AGCB 4XC3H 3CH1A 1XMWA 5D7JA 3C60B 1KBGH 4Z0XA 3UTOA 3CMOH 5D6DC 3SGEI 1NFDB 2OSLB 1VEMA 2V17H 4KQ4H 1P4BH 3BH9B 1J1PL 2VLME 1N5AB 3U6RB 4V1DD 2VZSA 4MQXC 4K7FB 5B22A 4K7PH 3VXUB 4TQEL 5ADOL 2X4QA 3ZT5A 5DK2B 5LCVH 1LEGA 4YHKH 4V1DA 2CLZA 3D48R 4BSVA 4M7ZC 3VRLF 2BSTA 2DL2A 4JPVH 2DLGA 1A7RH 3SKMA 2APWA 5MEPA 1QQDA 4YQXL 4QRSA 1ZVYA 2BDNH 4HT1L 5INDA 1QFUH 1X7QA 2XWBA 2NY6B 4GFTB 1YY8A 1G7JB 4NZTL 1UM4L 4MDIB 2Z0BA 4R9HA 3TYFA 1BVZA 4HF5H 1HOCB 2XY1A 5T3XE 1BOGA 2P7TA 3BEWB 3O6LL 3WUWB 3BH8A 4WCYL 1RZJL 4S1RH 1ZHNB 1QLEL 1FL5A 5D1XC 2IWGA 4Y2DC 3TPUB 3O11A 3D39D 1XIWB 3RVUD 3HZMA 3O81A 5E6IB 4NFBA 5JW4Q 2YEZB 5FKPB 4JRYE 3T3PE 3X12B 1AR2A 1E4XI 4Y4FD 3HFMH 5C2BH 5F9JA 5HBBA 2CIKB 4JPIB 3S3JA 1N3NB 2LQRA 5DS8A 3EYSH 4I18C 1OLLA 5I74C 1HKLH 1Z3GL 1D6EB 4AEEA 3C8DA 3GIZH 3O6KL 4C55A 1K5NB 4FQJH 4YJZL 4X6CF 2HFFB 5IESH 1IEHA 1QR4A 4HZAA 2F9BT 1PW3A 3KXFE 5H2BA 3VRLE 4H1LB 3X11A 2JB6A 3WFEH 2IPKB 5H37H 4F7PA 4KRPB 1PAMA 3QDGA 2R0WH 1FDLL 2VUOA 1JGEA 4W4OC 5GGQH 1OM3L 3K81A 4RAVB 4WFFD 1EHAA 4CUCA 4KMLB 4F2MA 1MY7A 1EMTL 4C54A 3QUKA 3DVNB 5I9QB 4XPGL 1NEZA 2ARJB 1FNSL 1ND0A 4L3EB 4NO2B 3WFZA 3KPSE 4EI6A 3TWCH 4KZDL 2P5EB 1OF2A 1XF3B 4XB8A 1VFAA 2YN3A 4OZGE 1OGAE 4LF3A 1P7QB 2NYYD 4Y4HC 3GSXA 4LHQB 4NM4L 4PFEA 4R2GD 4U3CA 5DHVA 2YC1A 3W2DH 1J86A 2CK0H 2X4SB 2GI7A 2XKNA 3STLA 2XIDA 3X3GL 1WZMA 3SJVD 1GIGH 1IQWH 4PR5B 3MRKA 4AIZA 1DLFH 2OJEB 4ZXBB 3HHRB 1EVTC 1DN0A 4JPKL 4EDWH 1FL3A 3VXSB 4LKXB 2IPUG 1T1ZB 1HWGB 2ZCKL 5DJ8B 4QWWC 4J1UA 4KRNA 4BKLB 1RPQA 2VO5A 2X44D 1KJMB 3N06B 1H0DB 4JFPA 4JN1L 4PP2A 4ZOCA 5GGUB 1HEZA 4C56B 5D1QC 5I6XB 2B1HL 5C0BA 2AP2A 1MCPH 2VXUH 5KSAB 4LEOB 3L5IA 5F7EL 4TPRH 1CTNA 3QP3A 4K3JL 5DI8B 5GS0D 3U0PB 1DQML 3KLHC 1XF1A 1AGDB 1FV1B 4KKCD 2Y7QA 5DZOA 2XA8L 1WC7B 3VXNB 2E6PA 3HLAB 1PGRB 2FATH 2IJ0C 1NAKL 3WL9A 2RAMA 1N4XH 2VLKA 2W9EH 4ELMF 4YGVB 5BW7A 1NCWL 2Q7YA 5HYJE 2BNRE 1Q1JH 4PTUA 4UT9H 2DQDH 1F2XK 4BZYA 2WUCH 5IMMA 3IKKA 3U82B 1I3VA 4H26B 4FQLL 4MJ6B 4OUUB 1R5WB 1INDH 5IBUG 5C07D 4RX4D 3UTTA 5K59E 3Q1SL 2J88H 4NP4L 1A7PH 4O2CB 1YECH 4RX4A 5C09E 3MRIB 4I3SH 4KJWC 4LDOB 4H88L 5ADPL 1ROWA 2AXFA 5K33A 3HPJA 1OQXA 3P0YH 4R8WH 4QHKJ 1BOYA 2EIEA 1QSFD 1LO0H 3IFNL 2L7JA 5K9KA 1E4KC 4MAYC 1GPOL 2RGSA 4ALAH 4CN1A 4L9LA 4YLQT 4G8EB 4KJQC 1QBBA 3FB8A 4LVHC 5HVHC 1QFHA 3OKNA 1D5BA 3QIBC 1QTYT 2OR7A 5F9OL 2BFVH 4BQ8A 1HCVA 5BO1L 4OFKA 1A7QH 1V8HA 4RWYL 5AAWA 5IB5A 1FC2D 4MQ7A 2NW2A 3LHPL 3QH3A 3VD9A 4MCYB 2BC4A 5FXCH 4F9LA 5GISH 4CNIA 3NACL 3C60D 3QUXA 4ELME 4I0KA 3VFGH 2PXYA 5ISZB 1J1PH 3FT3B 2R39A 3MXVL 5EUKB 3UBXI 4F57L 3P9LB 3MRBA 3GMQB 1OD7A 1NFDA 3ESVF 4YXHL 2OSLA 5E00A 4BK5A 5ADOH 4BFGA 3L3IB 2XT1B 3VXUD 1ZTXL 3HZKA 1N5AA 3O6FB 1OWWA 3U6RA 5H94B 4KTEL 2CR6A 5IM7B 5JOFA 1MHEB 5JOPE 3SCMC 4YQXH 5IVXA 2A1WH 3JTTB 4E41A 4KQ3L 4R4FL 4HT1H 5CINL 5DVOA 5FIEA 1UM4H 3W81A 1JHKH 3VI3E 2W65B 3QDME 4LIQE 4L8SA 2E9IA 3HCVB 3BVNA 1MCFA 2X4UB 3HAEG 1A7OL 3KR3L 4WCYH 3O8XC 1G7JA 5CSGA 4MDIA 3PQYE 3K0WA 2VSDA 1CYGA 1HOCA 1CDUA 3TBVB 1MCHA 3BEWA 5H35B 2VITA 1IRAY 3B43A 3WUWA 3NAAL 3PJSA 4RMRA 4OCXH 5F1IA 5E6ID 4XHJC 4OI8A 5CILL 3VXTB 5ESQB 2AJVL 1XIWA 4P3WA 4JO1L 4WEUD 3D6GA 2YEZA 4ZFGL 1DQJB 4AENB 2G60L 3X12A 4UB0L 4U1GB 2ICES 1FIGL 4JPIA 1N3NA 1WGOA 1KUMA 5C8JB 2H2PD 4G80B 2CUHA 1D6EA 2H8PB 4N9OB 4OZFG 1E6OL 1K5NA 3DXAB 3MRMB 5EIQA 1A1OB 2H26A 1FDLH 3T77B 3TGXA 4KRPD 1TNMA 4NJ9L 5MENE 3DSFL 1KJ2L 4LLMB 4OZIA 4HJ0D 4H1LA 3WIIH 1T21B 5D7IB 1FNSH 4I48B 4TUKH 5GZOD 1P6FA 2MWCA 4L3ED 1I7TA 3RBSA 4RAVA 4JN2B 3I02B 2P5ED 4UV7H 5C0JB 3M45A 4XP4L 1RY7B 2ARJA 1ZA6B 2VDQH 4PJIA 1BD2A 5JXED 5DJZB 1PKQA 5L2KE 2HTKC 5EDXA 3MV9E 1P7KA 3JTSA 1P7QA 4QXUL 3FO9A 1BIHA 4CRPA 3T0EE 3TCXA 1C5CH 5DFTA 5B3JF 4ODTL 1CLCA 4I2XE 4YHLH 1CLOH 5I1KH 5CEYB 4IJ3C 2X4SA 4JPKH 1UJTA 3L3KB 1S7RB 4HG4J 2VWEC 1D6VL 4ZXBD 2GJZA 4KK9C 2ZCKH 3W0WA 3P0GB 3E6HB 4JFOA 4NO3B 4Z7UA 3NPZB 4PR5A 3EDKA 3GMNB 1XGTB 3BT2L 3JWOC 5J89A 3AREC 2I5YL 3P11H 2EDHA 3VXSA 2B2XL 1KCSL 1U8KB 1IZKA 4DAGH 2D03L 5DJ8A 4FZ8L 4CJ0A 3VFSA 2B1HH 5T33H 1MFEL 3JZ7A 4C56D 1EO8L 1KJMA 1JWUA 3AVEA 5KSAD 1TQCB 5HHPA 4XP6L 1DQMH 2EDDA 5DR5L 3HG1A 3WFBL 2X05A 1CDCA 1RJYA 3CPLB 1BQSA 5KSAA 5HVGB 3VFUA 5GRYA 2XA8H 4FFVC 2CDGA 1UYWH 3SDXA 5FO8B 1FPTH 1L6ZA 4OJFL 3VFWA 5E2VH 3U0PA 3UTSB 2P1YA 1NCWH 3OGCB 5HYEA 5IK3B 1AGDA 1NMCC 2X10A 1B6DA 1FV1A 4NO0B 3VXNA 3HNTL 2ARWA 3MQIA 3RY4A 3CX5K 5HY9A 5T1DL 4FQLH 2YZ8A 1JNLH 4YGVA 5B3JE 2XQBL 1QFPA 3Q1SH 1F13A 5FM8A 5IUSA 2QSQA 4P2QE 3MLTB 3EJZD 5AZ2L 3WS6C 1C5BL 1U2CA 4UT6L 2HLAB 4YDLC 4H88H 1R5WA 4KTDL 5ADPH 4XWGL 4MYWB 3LCYA 4Z78A 2HWZH 3IFNH 4O2CA 4LVOC 4XPFH 4K9EL 2JJSC 1GPOH 1UB6A 3WNKA 4GH7B 4TNWK 2VQTA 4FP8L 3VI4E 5BVPH 4O5LL 5F7UA 4M8VA 4G7YH 4OFYD 1BM3H 4FQQB 1A6UH 3G04B 3EAKA 1B0RB 2MQ3A 1S9WB 5KANI 1P69B 1HSAB 5BO1H 4OFYA 1HYSC 4G8EA 4YDIH 12E8H 4RWYH 2CXGA 3F6IA 3HI6L 4IRJC 2X2YA 3T08A 3LHPH 3C5ZB 3E3QE 5DYOB 3NACH 1JGUL 4GLRI 1HYRC 3O3DB 3KLAB 4NGHH 2VLRE 5IGXL 4RGOL 1T1XB 2BNQB 5ISZD 4PJGF 1LK3L 5CJOH 2VR4A 4H8WL 3VGAC 4M5YL 4UILL 3DRQB 2XZAH 5E7BA 2F5BH 5ISZA 3V7AG 1ZTXH 2OX5A 3TJHC 2HKFH 4NUGH 1YC7A 3ARFB 4JM2A 2BVEA 4KTEH 3GMQA 1EERB 2R1WB 4KPHL 2P49B 3O6FD 2NY5C 3L3IA 2A77L 3IU4L 1KTDB 3BESR 4R4FH 2VDMH 1ZA3B 2YZ1A 5CINH 5HYIA 2D9QB 4NBYB 1MJ8L 3O6FA 3QQ3B 4Z5RA 4GRWB 3CVHH 5H94A 5EC1A 1MHEA 4ZTOL 3LDBB 3QXAA 5E6ZA 4M00A 4WU5B 4R26L 4ODWB 3ULUC 4GO6B 3JTTA 4PREB 3T2QA 3EO9H 4HIIA 1A7OH 1LE9A 2ZUWA 2EDNA 5K93A 2W65A 3AS3A 2FH8A 2IFGA 1CE1L 3QQNA 3BN3B 2ZUSA 4ZUWB 4LDLB 4LK4A 4LCCC 5E2UL 2FCBA 1A4KA 4M5ZL 3VDAA 3EOYG 1F4YL 1UH3A 3L1OL 3RWEA 5I0ZA 4JO1H 4YBQC 1BQLL 1MFDL 4G8IB 5H35A 1MJJA 3IDIB 4ZFGH 3FQUB 2G60H 4NKIL 1VPOH 3DGGB 4QEGA 3VXTA 4LHUA 2HVKA 4NT6B 3KXFB 1N59A 4Z6AT 4KKBD 5F9WB 4YX2L 1E6OH 4E9LA 4OQTL 3WDIA 4QY8B 5C0ND 5BVJB 4LNVA 4WTZG 1KTRL 3DXAD 3ORJA 1CGYA 1INEL 4NJ9H 3DSFH 1MCCA 4HFUL 3JWOH 3VE0A 2H8PA 4JDZA 3EYUL 4DGIL 3PXJA 1S5HB 5HHMB 4Q97A 1SBSL 2AGJH 5CIPB 3ZKQD 1A1OA 3T77A 3KPSB 4RGNC 1JHLL 4PPTA 3ZTJG 4LLMA 2EZ0D 5E24E 2APXA 3GSNB 3MRLB 3VXRE 1T21A 4F3FA 1F6AA 4XP4H 3CFEB 4I48A 1YEDB 4B50A 2AI0L 3LRHA 5C7XH 2D0HA 5MERB 3EO1B 4JN2A 3I02A 4F8TA 1QPXA 5C0JA 4QXUH 1JFQH 2BVOB 4P4KB 2HJKB 3NIGE 5JW3L 1WFUA 1ZA6A 4X98B 5EU4B 2GTWA 4NZRH 1YEFH 1QZ1A 2H32H 3LPWA 1U8QB 2I9TB 5E6YA 1CIUA 1L0XA 1D6VH 3KHQA 1DBBH 5MI0C 3WLWC 4NKDA 4X6CB 2ED8A 3V7MA 1IGCL 5EPMB 2AXJA 5CEYA 3BT2H 2ICCA 5IF0B 4JFHD 4M48H 2I5YH 3L3KA 1S7RA 3G9VA 2B2XH 4HKBB 1XZ0A 4O2FB 1M05A 1S7SB 3TT3L 4D9QD 2XG4A 4EIGB 3R0MA 2R4SL 3HI5L 4KZEL 5IKCB 4NRXB 1XGTA 1YEGL 4GBXC 4LPYA 3LN5B 4GXUM 1LO2L 2X40A 1EHXA 4PS4H 2EH7L 1HIML 1ZGLB 3B2UC 1DBJH 2WLYA 3UJIL 3Q0HA 4TUJB 3HZYB 4BFEA 4A2MA 5KSUB 4OGYL 5DD6A 3ZDZF 4PY7A 3MUY1 3MZTA 3QEGH 4LSUL 3GM8A 1RZ8B 4LBEB 4LASL 1QBML 3K4ZA 3HPLB 3CPLA 3BPNB 2BNRB 2RHEA 5DMKA 2B7DT 1T1YA 3HNTH 5FGCB 4X8JB 3ARBA 3T2OA 5FO8A 5T1DH 4NO0D 3MJ6A 3UTSA 3O0RH 3OGCA 4Y4KC 4DVRL 5I30H 2XQBH 4POZD 5IK3A 4JPWH 3O4LE 1VADA 5CJXC 3OBAA 3S34L 4GRMB 5AZ2H 1ZS8A 1C5BH 1QO3B 5FV1L 2BK8A 2GTZA 4KTDH 4LL9A 4XWGH 1T2QL 3S8WA 3QEHB 3BDBA 4H0GA 3HAEH 3MLTA 1I1AD 1BBDL 5E2WL 1GZQA 2HLAA 2XTLA 4L5FL 5IVNA 1MFNA 4K8RC 2WUBL 5I8OL 4IOSD 4O5LH 3HS0B 2ERJB 1M6OA 4G9FE 3K74B 3FCTA 1BP3B 1VKXB 1QKZH 5HTSA 4OIIL 3OKLB 3MOQA 4Z7OF 2VTFA 4EUPH 5F89B 4J4PD 3G04A 1B0RA 5F96L 1JGUH 1RUQL 4KC3B 2AK4B 2FWOB 3ARSA 1IGJA 4ELMB 1ULVA 5IGXH 1H8OA 3C5ZA 4YBLC 4HH8A 3QNZB 5DYOA 5IQ7L 35C8H 2VLMD 3RVWC 4UILH 1KCRL 1HE7A 3WXVL 2ITCA 1T03H 4YEEA 5E4EB 4U6VL 3BGMB 1FNLA 2BNQA 3FB7B 1MOEA 3M1BA 5EUOE 3ARFD 3IU4H 3KPPB 4XNMA 2ED9A 1MHPL 4LNRB 3TBWB 1LEIA 1BVLA 5T5NG 3IDJB 3SKNA 1FNEA 4S1SL 2R1WA 4R26H 2L4OA 4GW5A 3GB7A 3FMGL 3BZFA 4OFPA 4FOMA 3P4OA 3MJ9H 1U3HD 3QQ3A 1YNLL 3G6AB 5T3XD 1UB5B 3AY4A 1A6ZB 1GC1C 5FYKH 3PQYB 2DM3A 4Y8AA 1MCLA 1G9MC 4PREA 5A3ID 3LPFA 5F8QC 3CNKA 3SDAB 3DYPA 5E2UH 5F71A 3DO7B 3BHBB 4EBQH 4WUUA 4M5ZH 1F4YH 2GITA 4JRYD 1RK1B 1BQLH 1MFDH 2OLDA 4ZUWA 1KIRA 1EXUB 5HHXL 3X3FL 1TVHB 5GGTH 2MKWA 1U3YA 5HYQB 4L4TB 1NAMB 4PD4K 1UKQA 3ALWA 2Q8AH 4G8IA 1PEWA 5C0DB 5ESVB 4JQXA 4LMQE 5GRVL 4PJBF 3IDIA 5EG6C 1J11A 5MHSE 1W72B 1OSPL 1QBLL 3FQUA 3MCLL 4OQTH 3DGGA 3ZSSA 3KXFD 3O4OB 2W92A 2CK2A 2BRRL 1LK2B 2I27N 4MNGB 5SWZE 1WK0A 4NT6A 4HFUH 3KXFA 4ZTPH 5K9QI 3BRFA 4N8CL 5HHVH 4DGIH 1LGVA 1SBSH 1Z2KA 4TVPE 1CGTA 4N8PA 5BVJA 1NCBH 4NPYA 3OXRB 4JG0H 1JHLH 1DFBL 3O6ML 5EWIH 1SY6A 4NM8L 3KPSD 1FZMB 1BFVL 2EYTB 1S5HA 3H3PH 2AI0H 5DFVC 1OGAD 4RFNB 1BFSA 2EDQA 1KJVB 3MBXL 3MXWH 3TNNB 3CU1A 2VDPL 5L2KB 3MV9B 4KMQA 5JW3H 1YEDA 4PBWD 3V8CA 4P4KD 4XWOC 3FRUB 2VIRA 4YHNA 1F4HA 2EDWA 1OP5H 3T0EB 3F7YB 3VFOA 1I85A 1FGVL 3EO1A 1B4RA 2LTQB 4I2XB 5JO5A 2JJTC 2ADJA 1Y6NR 3U0TB 3RIFK 2BVOA 4L1HA 4P4KA 2HT4D 1Q72L 4X98A 3F8UB 3EDJA 3BXNB 1GAFL 4NQSB 5KSBF 1FP5A 1U8QA 4PJBE 3KPLB 3F7VB 1T7ZA 1F6LL 1CZ8H 3TT3H 1I3RB 4X6CA 3U9UB 5ANME 3ZDYF 4KZEH 3EJYC 2DQTL 5IF0A 4PRHE 1LO2H 4K8RH 4IRSB 1FC1A 1XGQA 8FABB 2LU3A 3UJIH 3LS5L 5IKCA 4NRXA 1T2XA 2D7OA 1JZ8A 1RVFL 5IB3B 2VSCA 4OGYH 3H8NA 3IF1B 3IKCB 3RTQA 4NSKB 3E6FA 6FABH 3MLWL 1QBMH 4Y19E 1OAXL 4UV4H 5D1ZC 2NY0B 1AJ7H 1JBJA 2EH8H 3PABB 2NY1C 1G0DA 2Q86B 5KSUA 1YYLH 5FYJE 5HYJD 5CEZH 2DI9A 2BNRD 2EXWC 4WUKL 3K8MA 1RZ8A 4LBEA 4DVRH 1AP2A 3HPLA 3VWKD 3HE7A 3S34H 3NGBB 2GY5A 3B2VL 3HRZB 5F70A 1CICC 3MOAL 5J57B 5IW6B 4P2QB 2LAGB 1HQRA 3BKJL 3V0WL 7CGTA 2VNCA 5C0CB 3FJTA 3N1QC 3TN0B 1T2QH 5SWSB 2PW2A 3KYMB 4ZS6C 3BD4A 1P4IH 1WBZB 4S1QH 2P43B 4M1CC 1BBDH 5E2WH 5FECB 3B9EA 1GGBL 4L5FH 2WUBH 1GGUA 5ENWB 5I8OH 2DB8A 4WFHE 3PWUA 5F3HB 5E8PB 5JPMB 3QEHA 3QULA 2X1XR 3MBEC 4CKVX 1SEQL 4OIIH 3KAAA 1FJ1B 2E9BA 1KNOB 2BMKB 1DQLL 5DTFB 5F96H 4RIRB 1G9MH 5EA0L 3GEWB 2PR4L 5ABDE 1RV6X 2NX5B 3VH8G 5F89A 4OKVA 3VGBA 1K6QL 2X89A 4K7PY 5KSVB 1Q38A 2AK4A 4KVCL 2YPKB 3LB6C 1KCRH 2XWTB 4JB9L 1HHHB 3WXVH 1NJ9B 3BYYA 5HPMB 2LE9A 2VE6A 2ZKHL 4PJ9C 4I5BB 3L95A 1QD0A 3QNZA 3QFDB 3BP6A 3ARGB 2X5PA 1BPVA 3MODL 2Y06H 4CVUA 4XAWH 2DQUL 5IBLD 4XVJL 4LLQB 3V6OC 5JOPD 5LVEA 2XPGA 3FB7A 3ZTJH 1U41A 1A6WL 1LNUA 2IANE 4HH9B 5HI5C 3Q6GH 3FMGH 1RUMH 3KPPA 4LNRA 3IJHA 1GOFA 3HZVB 1YNLH 3QDMD 4HWNA 1YEHH 4U1LA 2Z35B 4LSDA 2JJVA 3PHQB 2DAVA 4GUPA 5TGBB 1XGPB 2WBJB 4LCYB 4QGTA 3AU1B 3QB7C 3PQYD 3P9MB 2Y23A 3G6AA 1R24B 4KK8D 5E95B 3GMPB 1A6ZA 4HEPG 3AUVA 2XZZA 3TIDA 2X4PA 3SDAA 4TUOB 3X3FH 5HHXH 4CVXB 4TVSa 1M4KA 1V7NL 2GUOB 3BHBA 1X5IA 4XZUB 5I1LA 4TTDD 5JMOC 3REWB 4YFEA 4PJGB 1X6NA 1KB5A 4U05A 3MCLH 5JZ7C 1RUAL 4Q6IB 2R2BB 3Q48A 4L4TA 1NAMA 2VISB 3MLRH 4U0RB 1HHKB 5C0DA 1E4JA 4JFFB 5ESVA 4M6OH 1KCUL 1R0AL 3LD8C 1JWSB 1TVDA 4AK1A 5MEND 3I2CL 4R97B 2YKLL 3GSOA 4MNGA 4XP9H 3O6MH 4DKFL 1I3UA 3B4NA 4NM8H 2E8YA 3PL6C 3VCLB 4NWTL 3VXRB 1BFVH 5KW9L 1PLGL 3FONA 1MH5B 1D9KC 4JO3L 2V7HB 3OXRA 4KDWA 2X4TB 3UBXA 4YDKL 5GGSA 1B2WL 3RVTC 4Z7WE 1MWAL 5DUML 4QHKI 5TE6L 5L2KD 2FHFA 3MV9D 2NY2D 3QUMA