3Q3GA

Crystal structure of a-domain in complex with antibody
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
220
structure length
220
Chain Sequence
DIEMTQSPSSLGVSVGEKVTMSCKSSQNLLYSSNQKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGTGSGTDFTLTISSVKAEDLAVYYCQQYYSYPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/cell adhesion
molecule keywords Antibody Light Chain
publication title Stable Coordination of the Inhibitory Ca2+ Ion at the Metal Ion-Dependent Adhesion Site in Integrin CD11b/CD18 by an Antibody-Derived Ligand Aspartate: Implications for Integrin Regulation and Structure-Based Drug Design.
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 220
sequence length 220
chains with identical sequence C, F, J
ec nomenclature
pdb deposition date 2010-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3q3gA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3q3gA01
3QHTC 1JZ3A 2OJZH 4JJ5A 5IB3B 3BZDA 1J1OH 4U1GB 4ODUB 3VH8A 1EGJA 1F3RB 3O4OB 2G60H 5FYKD 1Q0XH 5J56B 2ITDB 4WHYG 2F5AH 4I2XE 3DBXA 5T1KB 4XBEL 3PWNA 4P23D 2EO9A 1W72H 1A6ZA 5CKAA 2DQJH 4M5YL 3TCLB 1CQYA 1RHHB 4Y4KC 1WISA 4X6FB 3SDYH 4PBWD 3BFOA 1RK1B 2OI9C 1FL6A 1ZA3B 4YFLI 1FSKB 2FLBT 3BP5A 5SWZE 4S1QL 4KDTA 1KF9B 2R69H 1QFPA 2ZOLB 2EDNA 2AQ2A 5I74C 3CSPA 1OPGL 3FQWA 4WCYH 2FBJL 2IAMD 5TE7H 2Y7QB 1BQHG 4EI5B 1Q1JH 3M07A 1HHKA 3G6JE 1A6VL 1XCQA 3CAFA 3JV4B 5BJTB 2YUXA 3OJMB 1E6OH 3TN0A 5EZOH 4K94C 2X4UA 2HTKD 4P5MA 1F3DJ 3P30H 1DN2A 4HWBL 1OTSC 4JPWH 2VABA 1QR4A 1OAXL 1ROWA 4MQXC 3U7AA 1YA5A 1JPGA 2DQCL 4NWUL 4ZUUB 4IIQC 3V0AC 3EYUH 2CMRH 4YXHL 4BQBA 5CEYA 3TM6A 1SBBA 3T65B 5HGHA 3FRPG 4JY5L 4PJIB 5KSBE 1TITA 2EKJA 4HUUB 3WFEH 2PW2B 3CDYA 3PV6A 4Z6AT 4WTZA 4MVBC 3VXNB 4XNMB 4EZMA 4HEPG 3AC0A 4YHKH 3FOLB 3G9AB 5L2KB 5EO0A 4RQQA 2GTWB 3D2UD 3MXVL 4JDTH 5D1QC 2WBJB 4NKQB 5CWSA 3K7UA 1BM3H 3PWUB 4RGNB 3K8MA 1A9BA 5F97E 3BZFA 2ILLA 5SWSB 1DTUA 2NTFB 4PUBL 5JMOC 1CBVH 3D69B 3SKMA 6FABH 5CMAA 2VLRB 2VDRL 4GRLA 4G8GA 1IC1A 2GTZA 3FCTA 4JLRA 1I1FA 3LRGA 3Q5TA 4FTVD 3BPLC 1I7ZA 1MRCL 3MLVH 4UT6H 5IJKA 4HUXA 1XF4A 3C5JB 5JHDD 4G8EB 4JFXA 4PJDE 5CJOH 4Z0BL 1IGTB 2ATKB 5HYJB 4LSTH 5INCA 1TZIA 2YBRB 2IC2A 2X4QB 2E27H 3QP3A 1CTOA 1P1ZA 1PG7L 2GAZA 1RPQA 4NRYA 4X6DE 4F8TA 4G43A 3HPLA 3VFMA 3SE4A 1VADB 3FJTA 1K4DA 3KS0H 1LO2L 1PZ5A 4QRTA 1CL7L 4KTDH 1I7UB 4QRRA 1G0YR 3TBSB 5DD3L 2W65A 1UJ3A 5IF0B 4K3EL 3VDAA 5DRXB 5L8JB 3BGAA 1FFOA 1LHZA 4EUPH 1RUKL 1SQ2N 1SY6A 4XBEH 1W72A 3ESUF 2P48B 4J4PD 4U6XA 4M5YH 3MA7B 4XVUD 5J1AA 5F88A 4JKPL 1Q9KA 3L5WB 1MHEB 4NKMA 3WE6A 3JWOH 4POZC 1YEEL 4S1QH 5CD5D 1KJVB 2VZ3A 4OD2B 4MAUL 2BNUB 1AGFA 4N9GB 2AV1A 1OPGH 1K8IB 2X1XR 4PGCB 5HYSG 2FBJH 4WEUD 3T08A 1IMHC 1X3DA 5A1AA 4X8JB 4WUUE 3NH7H 1GC1C 2NY6C 3W9DA 2RFXB 1WTGT 1A6VH 5EO1B 4JRXA 5D7IF 3AS1A 2DL9A 3SKJL 2DWDB 1RZKL 3FB8B 4HWBH 4OF6A 1OAXH 2IBBA 2VOTA 4YBLC 4NQCD 3L3GB 2DQCH 4NWUH 5IEHB 2R2BB 3F8UB 3MRMA 3ULVE 1OAKL 2ICEB 4P23A 4JFFE 4YXHH 1IC4L 2JCCF 4U1LB 5FUCC 4LAJH 4JY5H 3V5DB 5HVGB 1MQ8A 3IAGC 4M9PA 1MFDL 1XGRA 1WC7B 5DD0H 4MB4A 2FIRT 1G9NL 3U30B 3U9PL 3VXSD 5HVWA 5I1JL 2DOCA 4O2EB 1RVFL 4LMQE 2MMXA 1I1YA 4F33B 4ETYA 3MXVH 3O6KL 2IAMA 2C3GA 3TBWB 3DROA 3SEPA 1P4IL 1FL3B 5D7LD 4MA1B 1RJYB 3LZFL 3SDAB 4IRZL 4QRPD 3BH8A 5CIPB 4XX1G 4P0DA 1XF3B 4PUBH 3RJQB 3RWEA 3BUTA 1NUGA 1K85A 3R06B 1CVSC 2B1AH 2VDRH 4I5BA 4JRYD 4CNIB 3NIDE 1LMKA 1MRCH 5GZNC 4XAWH 4J3OC 5HHMB 4LLQA 4M7LH 3MZGB 3KLAB 5ACZA 5IP4A 3TEUA 4Z0BH 3PDDA 5JW4N 1GSMA 2ESVA 1SYSB 3KYKL 3QWRD 1CTNA 1HEZA 1TQBB 2HJLA 2J7LA 4QHLA 2WWKT 5DTFB 1YJDC 4NNPL 2H32H 2Y5TB 4M48L 4NQSA 1PG7H 5DWUL 4U1NB 5IKCB 5E5MA 5KVDH 4RA0C 3RPIA 4JY4B 4NQVA 2DLIA 3QUYC 1LO2H 3QUML 1CL7H 2W38A 1T1XA 5DD3H 1X4XA 4K3EH 2X41A 1E4XH 3D2UA 5EDXA 4ENED 4QHMB 2EDRA 3DTXB 1RUKH 2P8LB 1KC5L 4MJ6B 5E9DE 3VFVB 4UDTA 4M1DL 3DV6B 1J8HE 1CT8A 4X7SL 1MHCA 5FO9A 5EU3B 3NCYP 4E41E 2WMPA 2WLZA 4XCCL 1LGVA 2ZNWA 3BT2L 1DVFD 2ORBL 2ATPB 3TZVB 5F3HB 4FTVA 1HXYA 1YEEH 4FQ1L 5T33L 3SDXB 2D31B 3ECBA 4Y5YB 4ERSL 3EDKA 4I0PC 4MAUH 3CK0L 3OL2A 4LRIC 5JHDA 4ZPTA 5T3ZL 3LEXA 3C2AL 5DJXA 5IW6A 3MV01 2NY0B 1I1RA 3OAYH 1LE5B 3VXTA 3QIBD 4Y1AE 3PGDA 3QEUB 3GGWB 1ULVA 4PJFA 1IEAA 3MC0A 4KDWA 4RMUA 1ZS8B 2VERN 3SKJH 4P9MH 4HWBA 4PJ5E 3BD4A 1NCCL 2CIKA 2UZIH 4O4YL 4BM7A 4FFVC 4YNYB 4D9QD 2J8OA 3FTGA 1GGUA 5KANI 2AKRB 4MD4B 5BMFL 2DQEL 4EDXB 4J4PA 3BGFB 1YEHL 3VI3E 2X09A 3LCYA 3VFPA 1DBBL 4Y4KB 5IW1A 1AY1L 1MFDH 5AAMA 5C09B 3P9LA 3ARED 2OI9B 2LVCA 5DFWH 2CR3A 1P84K 1WFNA 4WEBH 1CFTB 5GSRA 3LRSA 2XZCL 5I1JH 2D7PA 1T20B 3IJSB 4N1HB 5F72S 2C9AA 1X5HA 3H7BA 3O6KH 3QRGH 1P4IH 3MO1B 4X7TB 5HSFA 3LZFH 3T4YA 3Q5OA 4HKXB 1QO3B 1J05B 1CXFA 4IRZH 1K3IA 4YDJA 3RUGF 2X5PA 3X3GL 3P4MA 5E99L 3NCCB 4PRIE 4OLXH 5C0CE 4DEPB 5HI5C 1IL1B 4JQIL 4XH2B 4NQCA 4L9LB 4DKAA 2GYSA 2YPLE 1NANI 5J3HD 5JW4R 3MUHL 3KJ6L 4EXKA 5E7FA 4B50A 1U91B 4U4BA 4MJ4A 2DI8A 3T0BA 1I8MA 3KYKH 2H32A 3QCUL 1T21A 2YSSA 2HG5B 1FV1A 4NNPH 4M48H 3B3IA 4X0KA 5DWUH 5I0DA 2HLFC 1DEEB 3TESA 2X42A 3ISWA 4WFGD 1IKFL 4PJ7B 5T1KD 4C56A 3QUMH 3IDJA 1CXLA 3K46A 1Q72L 3BO8A 2UVFA 4HIXH 3DX9B 4NT6A 4CGTA 3QULB 5I66B 4TULL 1BVLA 1FC2D 2KDGA 5D7LA 4NO2A 4ACPA 1ZMYA 3DX6B 3OKKB 4QRPA 2BERA 2D7OA 1D5XA 1TPXB 4ZO7A 4X7SH 1NC2D 5E4EB 4JZOA 4YK4C 3HUJA 1M6OA 2Z92B 2VITA 1KT2A 1WAAE 2A6JA 3BT2H 4EI5D 2ORBH 3SJVB 4JRYA 4PJEF 4PRAB 2B2XH 2GY5A 3GSWB 5D7KD 4FQ1H 1K2DA 1Q8MA 5T33H 4ERSH 1MH5A 2YD9A 3CK0H 4ELME 2RGSA 5T3ZH 4BFIA 4JREB 3QWRA 2V5MA 3C2AH 4XTRC 4OFDA 1KIRA 1OAYH 4RDQG 1XR9A 2CRMA 4OKVB 4I3RL 4PJ9B 1V8HA 1XH3A 3X11B 4G6AD 2HFEB 1MJ8L 4L5FL 4DGIH 4E5XB 4Z76A 3NCBB 1A9EA 1ZV5A 3SDCB 3G5VA 1NCCH 3UYPA 5BCAA 4O4YH 3SE3C 4HK0A 2ADGA 1JNJA 3ZT7A 3NFPA 3B83A 4AIZA 5BMFH 2DQEH 1F4XL 1AD9B 1GGTA 2I9TA 2XKUA 1QHOA 2D7MA 5L2KD 1CGVA 1YEHH 2WW8A 2VZTA 4JN2B 3LKPA 3SE9L 3CX5K 1G7IB 4P4KB 4PP2A 1DBBH 4LSPL 1BFTA 1AY1H 1UXWB 4PTUB 1DVFA 2WBJD 1JZ4A 2M26A 5HDOA 3W9EB 4Q58C 3LAFA 2WQ8A 5LVEA 5MI0B 4Q7DA 2XZCH 4RGND 1A7QL 2BHUA 2VE6A 3OKYA 2D4DA 5SWSD 4ONHA 3TNNA 1UVQB 1AHWA 1IEHA 1RIHL 1C5DA 2VLRD 1NMBL 5ECJE 4N68A 4QTHB 3QIBA 3UDWA 3MRIA 3J8F7 4JFZL 1VERA 3OAZH 5KTEL 2B5IB 4PGZA 3LPWA 1LP9F 3X3GH 5E99H 3RAJL 5HYJD 4X99A 1CD9B 1M7DB 5EU4A 1T0NA 2EYTA 3UROR 5I8OL 2PO6C 5ITFA 25C8L 5IEKA 4F2MB 3WHE0 5E6ZA 2R4SL 3H9YA 3QDGD 4XWOC 3WDIA 3KJ6H 2OTUA 2PYEB 3QEQB 4HPOL 1JNLL 2ADFL 2DD8L 4MA8H 3UCRA 1VFBB 2DAVA 1BJ1J 2Z8RA 1AQDB 5DFVC 2WIMA 3MOBL 4JE4B 3AREA 5D7IB 5D1ZC 3B2UC 2B0SL 1IKFH 4JZNB 3V7MA 5DRZA 5E2WH 5FM5O 3FQTB 5M7QA 1Q72H 3ULVC 1G7HB 1RZGA 1NCTA 3HZYA 4TULH 1XF2A 3AM8A 1XZ0A 5CZXC 1FZMA 2GY7B 5E1AA 3WS3B 4KRPC 1MCBA 3O3BB 4V2BA 3GUTB 4MNGE 3ZE1E 2FO4B 2KBGA 2JCCB 5I8KL 1OSZA 2Z4QA 3HCVB 4WHDA 3SHSA 2BY3A 4PTTA 5IROA 1QLFB 3D5OF 4ODHL 1KOAA 2FATL 3TT3H 3DETD 1FP5A 2HVKB 1FZOB 1VGEL 4UAOB 2F15A 2I25N 1ED3A 1VPOL 2CPCA 3QT2A 1LK3L 4M6OL 3QHFL 4R2GB 4QHKJ 3KPQA 5IB3A 5IFHL 5HD8C 3EYQD 4ODUA 1UKQA 3GKZA 3INUH 2J8UE 5SX4I 3MRRB 2P8MB 2BNQB 4KZDL 5DJZB 3QDHA 4I3RH 2ITDA 1JIBA 3PDGA 1H3VA 5T1KA 3MBEC 1MJ8H 4WW1B 2R1WB 2AJUL 2WM0A 3TCLA 1O0VA 1NJ9B 2YPVH 1SYVB 4X6FA 5J13B 1OW0A 1RK1A 5DT1L 4NZDA 2IJ0C 1YEKL 3CFKB 4QHUB 5E1HB 1ZA3A 2ARJB 1U8NB 3OKOB 1F4XH 2ZOLA 3E3QC 5IMLB 1NC2A 3WKNA 4BH7B 4G8IB 4LSPH 1QPXA 3VGAC 2Y7QA 4EI5A 4HX1B 4XHQA 4WNQB 4PYHA 4AH2B 2NZ9D 3SDAD 3JV4A 5BJTA 3KNBB 1U2CA 1A7QH 2FBOJ 1FLTX 4XCNB 4LSDA 3CD4A 1RIHH 1YYML 1G6RB 1NMBH 4XNYL 5IR1B 1B0WA 1P6FA 4JFZH 3IYLW 5HHMD 4DFIA 4P2QB 4X4ZA 1Y6NR 3RAJH 3T65A 2AJ3B 2E9BA 4PJIA 4OZGE 2F8VA 4HUUA 2PW2A 25C8H 2P5ED 1BZQK 3VXNA 4XNMA 4QRQB 3FOLA 4HPOH 1JNLH 2XZQL 3EO9L 2ADFH 5L2KA 1MCRA 3WNMA 1RMFL 4OF7A 2GTWA 4GG8B 1FGNL 2FB4L 4XB8A 1CDCA 2XIDA 2WBJA 3MOBH 3GKWH 1M7IB 2CKBB 3I3EA 1S7VB 1I9IL 3AXLB 3PWUA 2EXWD 1K4CB 1VDGA 5SWSA 2NTFA 2XWBB 3VJ6B 2IEPA 1EFQA 4P59L 2VLRA 3TZVD 3RBSA 1QYGH 3GM8A 4J6RH 4PJXE 3SN6N 2FYYB 3C5JA 3QBTB 4G8EA 3MODL 3NIGE 1IGTA 2ATKA 5HYJA 2FGWL 4ODHH 2FATH 4J3XA 2YBRA 2HT2D 2NY0D 3X14B 5C70A 4PGDB 2X4QA 3ARBC 1VGEH 5HHVL 2P47B 5B3JF 2JKXA 1VADA 3IDIB 1LK3H 4M6OH 1I7UA 1DR9A 3TBSA 4P49A 2YA2A 5T5NF 5IFHH 4JPIB 2XPGB 5IF0A 4PY8I 5DRXA 5EOCL 5D2LF 4KZDH 2RCSL 4LHUB 3RUGB 4HBQA 5JOPE 4IMLB 3MTRA 4Z95L 1T1WB 3KPRB 4HC1A 4EDWL 4KI5E 3DMMC 5DT1H 1MHEA 2Q8BH 3QQ9C 4Z7UF 5F9WC 2H2PD 2M2DA 1KJVA 15C8H 4OD2A 1DFBL 4NGHL 2BNUA 2LVEA 4N9GA 5D7SL 1NGWB 4WVRA 4L8SC 1WCQA 1WIPA 4X8JA 1J11A 5MHSE 4OLZH 1QBAA 1CGSL 2H2SD 3IU4L 1U3JA 3I75B 2DWDA 5I1AB 3ARDB 3FB8A 3UTZB 5LWYL 4LCWE 2EE9A 3ZYJA 4Y16B 3H2WA 1YYMH 2XV6B 4TUJB 4XNYH 4AM0B 4Q6YA 2IADA 4UZGA 5I1LB 3GRWL 2APXA 3L3GA 5IEHA 4OQ1A 2R2BA 3D9AH 2ICEA 2OR7A 4UT7L 4M1CD 3ZDYF 3K2MC 4U1LA 4PJEB 4OD1L 4QOKB 3V5DA 3K3QA 4M8VA 4P2OB 2AVGA 4YHPB 1XT5A 3FQUB 3PWVB 4R90L 2UWEF 1WC7A 4M8QB 2EXYD 4P4RB 2NXZB 1F3DH 3EO9H 2XQYG 3EJYC 3PQYE 1VEPA 1RMFH 4O2EA 4DGVL 4YHYC 4RBPH 4F33A 4QXTB 3TBWA 1BWMA 1FGNH 2FB4H 3NTCL 1PKOA 3HMWL 1FL3A 2A6IB 3UTOA 3BKML 4QXGL 5FV2A 1RJYA 3SDAA 3PUCA 3SO3B 2EC8A 4XC1L 1I9IH 1OGAD 2W0PA 2UV3A 1XF3A 1N3NB 3G5XB 4K8RC 1I7RB 2LU3A 3WBDA 1F3JB 4P59H 5C3LD 3R06A 1INDL 1H0DA 4CNIA 1EH9A 1YNTB 5K33A 5CP7A 1MUJB 3KLAA 4NQEB 1DANU 4I0CC 3HE6D 5TH2A 3MODH 2BSSB 5E2UL 1SYSA 2FGWH 5DTFA 3SQOL 1BVKB 2Y5TA 5HHVH 5IT2L 2J4WL 4YHLL 2O5ZH 5IKCA 2LFGA 1PY9A 5ITBL 4ONFH 4PJ9D 1HH9B 3V9FA 4JY4A 3WIFB 1T0PB 5DDHB 1A6TB 3DGGB 4APQC 5B4MD 3T0AA 4NYLB 4M61B 4HMEA 3LB6C 4AENB 5EOCH 3SDCD 4QHMA 5GGQL 1UFUA 5E0QA 1PBYA 2RCSH 2XICA 3DTXA 2P8LA 4MJ6A 5MENB 1LP9B 3VFVA 2EDKA 3DV6A 4Z95H 3JV0A 1ZVSB 1UB6B 2I07B 3BKJL 5EU3A 5F7YC 3MLUL 5ACMA 5TDPB 3C6LC 4P4KD 5ALCL 3AS2A 3ZDZF 3HC4L 3TZVA 1MWAB 5F3HA 5GZOD 1UQSB 2FCBA 4GAYB 1OQOA 3QEHB 3QNZB 3HI6L 2D31A 4RMSA 4Y5YA 3SDXA 1DFBH 4L3AA 3H9ZA 4ZDHB 3KJ4C 4NUGH 2FD6L 5DLML 3GIVB 3EKCA 3F6IA 1ACYL 2CLZB 2V6HA 1LE5A 43CAB 3QEUA 1KV3A 3GGWA 3VXUE 5TJWK 3M1BB 3ZZ1A 1CGSH 1G7MB 1NBQA 1QLEL 1ZS8A 1W8OA 3IU4H 3QDMB 4TUOA 4MNHB 2EDJA 3ZTNL 4RZCB 1PAMA 4MJID 4U7KA 3PHSA 4YNYA 2I27N 3GRWH 1FAKT 2AKRA 4MD4A 3S88L 4GAFB 4HEME 4MQ7B 3QEQD 2PYED 4UT7H 2BSRB 2LQRA 4EDXA 2XXMB 4N0YL 4OD1H 3LEVL 2FNBA 4Y4KA 4KKLC 1WF5A 4WU7A 5C09A 2W9LA 5HVHC 1CFTA 4NZUL 1T20A 3IJSA 3PL6C 4DGVH 4ZAKC 2DMCA 3NTCH 3VGAB 4XCEB 3MO1A 3HMWH 1F58L 3BKMH 1S78C 2YWZA 4LNRB 4ZFZB 4QXGH 4PRPE 4OZHE 4HKXA 1QO3A 1J05A 3NACL 4XC1H 1WICA 2NY1B 1KPUB 3WO4C 4NQDB 3STZB 5K9QG 4HBCL 3EOTH 4CUCA 5BOZG 5DJAB 1N0LA 3V6BR 1IL1A 1INDH 4L9LA 3RU8L 1AKJB 2KZ1B 5M94B 5H37H 1U91A 2F53B 3B4NA 5E2UH 3BIKB 4RA3A 4YXLL 3SQOH 2HG5A 1ZAGA 4GG6E 5IT2H 2W59A 2E9IA 2J4WH 4JQVA 4Y19B 2BNQD 4YHLH 2NY4B 4OGAC 3ARTA 5ITBH 4IS6B 2AEIT 1DEEA 2E5EA 5HI4D 4PJ7A 3I6LD 3DX9A 4PD4J 4DOHB 3C09C 3DX7A 1OTTD 5I66A 1S9YB 4P46C 4MS8C 4OIIL 4NBYB 5GGQH 2R4RL 4M7LT 3UTQB 4Q9CA 5DUBB 1ERNA 5IVXF 3DX6A 1YEGL 3OKKA 3GMNB 2R29L 5KZCB 3BKJH 2WK2A 1DL7L 4F15B 4E9LA 2Z92A 5ALCH 1O5DT 3HG1E 2E6QA 3O3UN 5C0BE 3HC4H 3SJVA 4GT7A 4PRAA 3LKNB 3GSWA 5ESAB 3HI6H 4FXLA 2D2OA 3KPMB 3U46A 1V05A 3KYMB 4J12A 4TSCL 1ACYH 4NJ9L 2VXUL 4OKVA 3BIBX 4PJ9A 2RB8A 3X11A 4P2QD 5JO5B 2XTJC 4E5XA 1L0YA 1UGNA 3SDCA 3W0WD 4UB0L 2LTQC 3MJ6A 5AZ2L 3SY0B 2NY5C 3S88H 4L3EB 3QIWB 4BFGA 1AD9A 3HE7B 4RGMC 3V52L 1WJ3A 2ICWJ 1FVCB 4N0YH 3RIAK 2FH8A 5DVLA 1G7IA 3LEVH 4P4KA 2XRAL 5KAQG 4ETQB 1UXWA 2PN5A 3QPQD 4PTUA 5EOQH 2OCFD 5K9JL 3W9EA 4LPCA 5FFLA 4NZUH 2LV4A 2F19L 4CVXB 1I8IB 3OKMB 2X4OB 1UVQA 4KI5C 3FN0H 1F58H 4QTHA 5EA0H 2ZSVB 5HPMB 5L2JB 3LKRB 1WZ1L 2EH8L 1G6VK 3SBWA 1II4E 5KSVB 3MJ8B 1M7DA 4HBCH 4MJIA 1IGCL 3PHQB 3RKPA 4F2MA 5FUOL 3TYFB 4NJAH 3RQ3A 2CLRB 3VRIB 1A6WH 2FX7H 3RU8H 3UYRH 5GRVK 1KTDB 1LO3L 3QEQA 2PYEA 2JJSC 4KKCD 3QDJE 4XBGB 5FHBL 2Z35B 5DEGB 3RVVD 3F65A 4YXLH 3IF1B 2ZUVA 3G6DL 5CJBA 2EDOA 3I2CL 1AQDA 3C5ZC 1KYOJ 1U93B 5GS1C 1VESA 5D7IA 4LHUD 2BOBB 4UOJA 2H6PB 4JZNA 1NGXB 4ZG1A 3FQTA 1HKLL 1FAIL 3EFFA 4N8VG 2BSTB 1G7HA 3KPRD 2O5YL 3SO5A 2CRIA 1HYRC 4OIIH 3WS3A 2R4RH 1AQKL 1NUDA 1ZT1B 3EJZC 3O3BA 1BREA 3GUTA 2FO4A 2JCCA 1YEGH 2I5YL 1DL7H 3OZ9L 3PWLB 4LLUB 4I3GA 4Q74A 4UQ3B 1NMCC 1QLFA 5HYIA 5SX5K 5IMKB 2HVKA 1FZOA 1MCIA 4N0RA 3HI5L 2DJSA 4KJPC 4ZSOE 4UT9L 3C60C 4Y8AA 1ZEAH 3ARDD 4HKJB 1YY8B 1JJUA 4Y16D 2HLAA 4JM2C 4TSCH 1I3UA 3MRRA 4NJ9H 5ICZB 2KH2B 2P8MA 2VXUH 2BNQA 4IOFC 1TENA 5DJZA 5IHLB 1UKTA 2JB5L 1FE8H 2JIXB 1YEDB 4NP4L 4WW1A 4B53A 2R1WA 3CSYB 3FT4B 4QOKD 3V7AE 1NJ9A 5KBNC 4P2OD 1SYVA 5IFJB 4UB0H 1KIUA 5CSBA 3P0GB 1MFCH 1U36A 3CFKA 4QHUA 5AZ2H 1KULA 5DSCB 2VH5L 3NMEA 1MWAL 2YD5A 1U8NA 3OKOA 5DHVB 1MREL 1IJ9A 5IMLA 1Z5LB 1OARH 3F7PC 4QWWC 3B8SA 4BH7A 1FYTE 3C6LB 1T5XB 4KKBC 4TNVF 3QG6B 2GITB 4HX1A 4WNQA 3RVTD 5E03A 2NY2B 2PKDA 4AH2A 4O51B 5K9JH 3Q0HA 3C8HA 3CH1B 4K23L 3KNBA 4PJGF 1LD9B 2F19H 1OHQA 4JAMB 4YHZL 2B1HL 4XCNA 1EK3A 3S37L 5FKAB 1G6RA 3IGAB 5IR1A 3O9WC 3ARFC 2EH8H 4P2QA 1C16B 3FB7B 4NQED 5I6XB 4NNXB 4UBDC 3QH3B 3OGCB 4FOMA 4L4TD 2AJ3A 4KMTL 5A2KH 4WUKL 5HYFA 3W0WA 4N0CC 1UWEL 4OCLC 1ZKAA 4PV8B 5FUOH 4MHHG 5CBAB 3L5XL 1CICB 4QRQA 3BISA 1NSNL 3HA0A 5FHBH 3O11B 3WUZA 1PVHA 4CMHC 3QNYB 5E7BA 3I2CH 1AXIB 4CVUA 2Q3ZA 4N90D 1A6AB 3VWJC 4AK1A 1M7IA 2CKBA 5MEND 1XF1A 3NCMA 2DTSA 1S7VA 3AXLA 3FO0L 1HKLH 1FAIH 2MPAL 1PD6A 1K4CA 5F6IC 1JCKA 2XWBA 3VJ6A 2APFA 1EFXB 1AQKH 1D9KB 2XN9B 3JTTA 3DPBA 4NKIL 5TDOA 2I5YH 5J1SC 3VRLF 3MLSL 2W0LA 2FYYA 5BV7B 3ME0A 1N2RA 5JZ7C 1DQQB 1H5BB 3E0GA 3X14A 4LP5A 4PGDA 3E6HB 5DJCB 5IVZA 4XPGL 4OZIF 3HI5H 1E4JA 4UT9H 1KLFA 4RMVA 2CUHA 3IDIA 4JO1H 1F42A 3QDMD 4XT1C 4MB3A 5I1HL 5JW3L 1IILE 4X4ME 4ODWB 2NLJB 4JPIA 2XPGA 4GKNB 1HCVA 1N6QL 3PIQB 4LCCB 1N5YL 3VWKC 4TRPL 5GIRA 3ZSSA 4LHUA 3RUGA 1UWXK 3FFCB 4IRJD 4IMLA 2X70B 4NP4H 1T1WA 3KPRA 2YD6A 1LDSA 4G7YH 2OMBA 5FYJU 2MTPA 2VO5A 4LBEB 1C8PA 1BJ8A 4QCIB 1LEIB 2ZUUA 5F7FA 3VXOB 2VH5H 4XNZC 3FQNB 1NMAL 3IETB 3OX8B 5F7EL 5DRNB 1OWWA 1MREH 1NFIB 3VI4F 2B4CL 2A0LC 1NGWA 1A3LL 5C0NC 3QJFB 7FABL 3TJHD 2QQLL 4K23H 4R7NB 1F02I 2NY1D 4WENB 5I1AA 3I75A 3ARDA 4YHZH 4YGAB 3UTZA 4NQDD 2B1HH 1AXTL 3CNKA 4Y16A 3S37H 3TVMC 5IVXB 4MD0B 4TUJA 4LSVL 3H3PL 4AM0A 4U31A 5I1LA 2XKSA 1BIHA 1N59A 1AKJD 4KK6C 1L4IA 5JQ6L 4M1GH 2F53D 2Z8SA 1BFOB 5D2NB 4PJEA 4QOKA 4KMTH 4YPGB 3RY4A 4PBXA 3T1WA 4WUKH 4P2OA 4ZD3L 3RZCB 4YHPA 3FQUA 3TT1L 3ZHKA 1UWEH 4Z7VF 2A74B 3PWVA 2NY4D 3MNZB 4AEFA 3C9NB 4M8QA 4P4RA 2P7TB 1NSNH 2DQTL 1H3TA 3TH3T 1WBYB 5DK3A 4QXTA 5ACLA 1HSBB 2O5XL 2A6IA 4LASH 1UEMA 3VGHA 2MPAH 4DUVA 2ZUQC 5I1CL 4JGUA 3RTQC 1N3NA 3RWHB 3G5XA 4WFFD 4W6XB 1F3JA 1YNLL 1U6AL 1BGXL 4NDMB 1RZ7L 3MFFB 5H8DA 3D1MC 4ZOCA 4YDLC 1UH3A 1YNTA 3GSXA 4NKIH 3IU3B 4WW2F 1R5VB 1TJGL 1MUJA 3BEVB 4NQEA 5DUPL 1XIWC 3MLSH 5IWLA 1QSEB 4RNRA 2BSSA 2HT3D 4L4TA 3GHBL 1KEGH 1ZGLM 1BVKA 3T09A 4XPGH 2X40A 3D18A 5IV2A 4KGJA 3MQIA 1AH1A 3CH8A 1HH9A 3BAEH 2AEQL 2C4FT 4W4OC 3WIFA 2P1YA 1A6TA 3DGGA 5I1HH 5F7DB 5JW3H 4K7PL 4FZEL 4M61A 1ZA6B 1N6QH 1RU9L 2WAHA 2AABL 4AENA 1N5YH 3VXRB 4TRPH 4JZJC 2WNGA 5GS1B 1RY7B 3F58L 5MENA 1LP9A 1X6NA 2R2CA 3UTPE 1A5FH 4L3ED 1SJEB 3QIWD 1NEZB 3HE7D 2AEPH 3Q3GB 1ZVSA 1UB6A 1IAII 2I07A 3D3VB 3KLSA 2GT9B 3HKFA 4FZ8L 3U79A 4AQ1B 3GSOB 4PFEA 1MWAA 2X7LB 1NMAH 1UQSA 1W0WB 2QV2A 4GAYA 3QEHA 3QNZA 5DQDL 5F7EH 2VL4A 4X9IA 4ZDHA 5KSBF 5HI3C 3HR6A 4XRCB 4L8CB 1IRAY 2YZ1A 2FJGB 1NMCB 4ELKB 3GIVA 4FS0A 5C0FB 2CLZA 4S11A 1A3LH 3ALPA 3CU7A 3K74B 7FABH 3BOVA 2QQLH 1CLOL 1S7TB 3M1BA 1ZGLB 1DLFL 1G7MA 3QDMA 4HWZB 4EN3C 4MNHA 4N8CH 4RZCA 1GCFA 1MQKL 2ZSWB 4JHZA 5GRJL 5I0ZA 4Z18A 3EDEA 1AXTH 1Q9LB 3SGJC 4ZOEA 4JKLA 4LSVH 3MV8B 1T1YB 4FXGA 2ZUXA 5B38B 1SVCP 3ARWA 5I76B 4O58L 2BSRA 3ULUE 3UPAA 5JQ6H 1VACB 2R56L 3MLTB 3QFJE 3HC3L 4ZD3H 3IFPB 3TT1H 1T89A 1NAKL 4PJDF 1F8TL 3Q1SL 2R0ZL 3UBXA 1JUFB 2ZUWA 5BS0E 1RZFL 2DQTH 3VGEA 1U0QA 2R9HC 2RHEA 4X6DF 3U7WL 1TMCB 4NKDB 3RY6A 1TTUA 1QNZL 5TQ2L 5GSVB 2O5XH 4XCEA 1B9ZA 1T22B 4XCFL 3IVKB 3EDDA 2XQYK 2PTVA 4ZFZA 4LNRA 4OFIA 3UTTD 2CDGB 5DMYA 1GPOL 3CX2A 3H6JA 5C8JB 1KPUA 4P5TC 4XHJD 1RUQL 4NQDA 3STZA 1EZVY 3NOIA 3VMOA 1E4KC 4O02L 4LEOA 5DJAA 1YNLH 1U6AH 1BGXH 1RZ7H 1MPAL 1IM9D 1UYWL 3LV3B 2DLEA 4MWFB 3AVEA 4OCRH 3MBXL 2WSKA 5TPWL 3MRFB 1AKJA 5B8CC 1TJGH 3KWWB 5DUPH 5I2IB 4PG2A 5HHQB 1OT1A 2YHGA 3KR3L 4KPHL 4XB7A 3UJTL 3VFSB 3QO0B 2F53A 2FJHB 3BIKA 3GHBH 3QJHB 3S5LG 1K9TA 5TFSL 5I19L 1QFOA 4X83A 5IBTL 2VQ1B 4PJGB 1NEUA 3BWUC 3IS0X 4IS6A 5TGBA 3UJJH 3NIFE 2AEQH 3HLAA 1SBSL 4K7PH 2NY3B 4EQ2A 4JQXA 1RU9H 3HHRB 2AABH 1S9YA 4FRWA 4KUZL 4M62L 1TIUA 4JB9L 2W92A 3LOWA 1CZ8L 5DUBA 5FCUL 3F58H 3U4BL 2CK0L 3VMNA 3GMNA 4KQ3L 5FA3B 5IIEB 3HZMB 4I9WE 1PZUB 5BV7L 4G8GE 4FZ8H 2DIJA 4LDLB 2NY2D 3LKNA 1O7SA 3BYYA 5ESAA 5DQDH 1A7PH 5C6WH 2Z91B 2DWEB 4IMKC 4KJWC 3KPMA 2LU7A 3KYMA 1FPTL 4KDVA 3AROA 2HKFL 4LAQL 2GJ6D 1JZ7A 1CLOH 1IARB 4QRRE 4WGVB 1DLFH 3DOSA 4A2MA 2HH0L 3B9KB 4FG6C 5JO5A 5B39G 2ZG3A 3HAEB 4Q9RL 1MQKH 4NN6B 4ONOA 5GRJH 1UXSB 3VDCA 1GL4B 5DZNA 3W5NA 1G0DA 3VRJB 4ZS7H 4H0GA 2K3TA 1QD0A 4BQ8A 3SY0A 3IFNL 2AK4E 2CGRL 1CICD 4L3EA 3QIWA 3HE7A 4LPWA 2YA0A 2NX5B 3CVHL 4O58H 5K9QI 1FVCA 4Z8FL 2R56H 5DHVH 4RGOH 4C58B 1CF8L 2ZG1A 2VLJD 4ETQA 1NAKH 4O2FB 5I15L 1F8TH 2DI9A 5A2FA 3Q1SH 2R0ZH 4Y2DD 1ZLUK 3RWJB 1RZFH 2F74B 4CVXA 4OV6F 4XXCA 1I8IA 3U7WH 1I1CA 3OKMA 5EIIB 3WYRA 2X4OA 1QNZH 5TQ2H 1FNEB 1EFXD 4XCFH 3L3DB 3O4LB 1D9KD 3VXMB 5BZDB 2XN9D 4JRXE 2ZSVA 4LVOB 3SGKA 5HPMA 2FH6A 3LKRA 5L2JA 3BX7C 1HI6B 3IRZA 1GPOH 3ILPB 5AG9A 1E27B 4MNQB 5KSVA 3L3KB 1RUQH 5FM4A 5FYKE 4AMKL 2DB8A 4O02H 3PHQA 4Z7UA 1HN1A 3HPJB 1B4JL 1MPAH 4OUOA 1UYWH 4Y88A 3QFDB 5HHPB 3TYFA 3MBXH 3L9RA 2CLRA 4M4PA 5TPWH 3VRIA 1KTDA 4XBGA 2YKLL 4X9FA 3KR3H 4KPHH 3UJTH 2Z35A 5DEGA 1MCHA 4D0BB 5TFSH 5CKGA 4UIMB 5I19H 3L3JB 3T0EE 1U93A 4HS3B 3BQUB 1R0AH 2BOBA 5SX5H 3LS5L 1NGXA 3FFCD 4OZFH 4GSDH 2NTSP 1B3JA 4N5ED 3VCLB 2BSTA 1LWRA 5F44A 4LVNB 5DUML 5J06A 1IZJA 3ULSB 4KUZH 1AC0A 4KZEH 4HUVB 1C12B 1OP5H 1CZ8H 1ZT1A 4OCXL 5FCUH 3U4BH 1UA6H 2CK0H 1FZKB 3ALWA 4KQ3H 5I1DB 1FO0L 4UTAL 3TCXA 4N0UE 1EUUA 2VMFA 2ZUQB 3PWLA 4LLUA 4UQ3A 4Z7VB 4GS7C 3ARPA 2KPNA 4P48A 4YHIB 5DC4B 5GGTA 5DFTA 3VI3F 3HNSL 1NCUA 2ESVE 3PP3H 3WNKA 4HKJA 1C5CH 3TBYB 3T04D 3M8OL 4V1DB 1YY8A 1BHGA 4JCLA 1FPTH 2HKFH 1QSFB 5ICZA 4LAQH 2VJXA 1JI1A 2P43B 4JM4L 4U05A 1DQML 5J89A 4P3CL 2HH0H 1TVHB 3NCEB 1YEDA 1A2YB 4UTBL 4NUJB 3CSYA 3U36B 4K94L 3FT4A 2A83B 4CN4A 4PG9B 3RZCD 3RWCB 3N1MC 2NXYC 5IFJA 3GJEB 3I02B 3AGVA 1YUHA 5DSCA 3OG6B 2CGRH 4K7PX 5DHVA 4Z8FH 3CVHH 5J8OA 4HJ0C 4UUJB 1Z5LA 4H88H 4OGXH 3ZKXC 3EIFA 1T5XA 4QEGA 4FTVE 4N1CA 1V3KA 3UPCA 5I15H 3MLRH 4O51A 3QUZD 5JHDE 3CH1A 4XPTH 1JF5A 1LD9A 1OLLA 1CFSB 1BFVL 4JAMA 4J7RA 4LGRB 4D0DB 3LQAL 1MVUB 4PJFE 3FKUS 5FKAA 3IGAA 2GJ6A 1WV7T 2W9EH 5JOEA 1UCBL 1C16A 3ARGB 3FB7A 4YZFE 1WEJL 4NNXA 5EBMB 3QH3A 3OGCA 3MMEB 5E2JA 3SGEH 4AMKH 4Z77B 5ID0B 2G5RA 4LMQI 2HFTA 4E42B 5IK3B 1DQJB 1F4HA 4FA8A 5CBAA 3CFDB 5ERWB 5T3XL 4ZS6C 1CICA 2YKLH 1FNHA 4D9LH 2VLKB 3QZWG 1WWAX 5FEBA 1B6DA 5I8EB 3O11A 2JB6B 1A6AA 4IRSB 2BSED 3LS5H 4Y2DA 1KENL 4NN7B 3LQZA 3H9HB 4HMDA 4NM8H 5HHNB 3D3VD 4RRPG 5DUMH 3HB3D 3PWPD 4FQHB 1EFXA 4S1DD 4OJFL 1D9KA 4MQXD 2XN9A 4OCXH 4KY1L 4KAQH 2DYPB 1FO0H 1N4XL 2IMMA 3GJFK 1YY9D 1U8PB 4KDTC 4UTAH 3BN9C 4P5TB 1WWBX 1DQQA 3HAEG 1H5BA 4PJDB 3E6HA 5DJCA 3ZKMD 4P2RD 2VISB 2R8SH 3HNSH 4FFWD 4MVBD 1ZK9A 1BOGB 1UCTA 3TN0C 5FXCH 4XC3L 2HTLC 1I4FA 5C0EB 5HHOB 4YGVB 1YPZF 1MI5D 5E8EB 3M8OH 3WNPA 4ODWA 2NLJA 5BQ7B 4GKNA 2EIDA 5IGXL 1T7YA 2WUCL 3PIQA 2V2XB 4LCCA 3EAKA 4H8WC 4JM4H 3ZKQD 4C56E 4NPYB 3MV8D 1DQMH 1GC1L 3FFCA 1OT2A 4P3CH 3S36L 1BP3B 1EXUB 2X70A 4OIAA 3DVGB 2IH3B 4K94H 2QHRL 3RL2B 3QI9B 4LBEA 5D7LE 3BRDA 2ERJB 1JGDB 4QCIA 5T3XD 5KVGL 3TP4A 1LEIA 3VXOA 1S9WB 3FQNA 1G7PB 3IETA 2Z0BA 4N0FB 3JVGA 3OX8A 4XP5L 5IB1B 3REVA 5DRNA 1NFIA 2MHAB 1A7RL 3IKCB 1MCFA 4MHHI 4X6EB 5C92A 2Q76A 2BP3A 4R7NA 1UACL 2X44D 3LDBB 2EDTA 3C5SA 3QSKB 3BWAB 4LFHG 3LQAH 2LAAA 4YFEA 5IVXA 4MD0A 1J8KA 4GRLC 4KK8D 2ICWA 4H1LB 1ZTXL 1UCBH 5IJKC 3B6SB 3FRUB 1I1AB 3CDFA 1WEJH 3WEXB 4M00A 1BFOA 5IM7B 5D2NA 4EJ1C 3ZE1F 4YPGA 1PLGL 3RZCA 5I1KL 2A74A 3MNZA 3SE4C 5T3XH 4FMKA 2P7TA 1T3FA 4H20L 3IDXH 1BPVA 1XGUB 3C6SB 2NY3D 4JFYB 4Q0XL 1UJ3C 1WBYA 4LRNL 3S3JA 1HSBA 1U3HB 4YLQT 5D6DA 4Z0XB 3QUZA 2GI7A 5EWIL 2J8UF 5INDB 1KENH 2VZUA 4YIQB 2P45B 5J12B 1S7RB 3RWHA 4LIQH 1CS6A 4NDMA 3MFFA 1HQRB 4OJFH 3TO2B 3W82A 5LQBL 2DTML 4KY1H 1A7OL 3IU3A 1N4XH 1R5VA 2Z8VC 3BEVA 5EB9A 4MGXA 5J11C 1QSEA 5D5MF 4MX7B 1NAMB 2DKMA 4Z7OF 5H2BB 3WSQL 1DUZA 1K6QL 4J1UB 3CZFB 5L88L 3B9KD 4XC3H 5FYJL 5F7DA 5AWNL 1ZA6A 4GLRH 3S96A 5IGXH 2WUCH 5KW9L 4HG4K 5D6CB 3RNQB 5GS1A 3UYOD 3MLZL 5FYLE 1GC1H 3TFKC 1NEZA 4P23C 1YQVL 2NX5D 4F37F 1WCBB 3Q3GA 2H26B 3D3VA 2GT9A 1J8HB 2F54B 2QHRH 3E2HC 3B9EA 3FT2B 4XCYB 4XXDB 5KVGH 2C3XA 2X7LA 4E0RB 1W0WA 5C1MB 4XP5H 1NH6A 4XRCA 4L8CA 1IBGL 3MLXL 2N56A 2FJGA 1A7RH 4ELKA 4JCMA 2IAMC 2CDEB 4GS7B 5C0FA 4D0CB 4XX1E 3O4LD 4PLJC 1N8ZB 5GGUB 3BJLA 1S7TA 1ZGLA 1UACH 4Y1AB 4KKAD 1DQDL 4B0MM 1MI5A 3RJDA 4UNTA 2ZSWA 2HTKC 5IMMB 3N1GC 4QY8B 2Z8WC 1Q9LA 5C07D 2Y25A 3NGBB 5CP3H 4WFGE 1JE6A 1ZTXH 3MV8A 4ZQKB 2V9RA 3B5TA 3DI3B 1T1YA 1IFHL 1SMOA 3ZTJG 5K9OB 5B38A 5E00B 3RWGB 5I76A 1FQ9C 3DSNA 1VACA 3BKYL 2NW3B 3MLTA 1PLGH 4PJXF 1IKNA 2QBWA 3IFPA 1BOYA 5I1KH 5IMOB 3BQUD 2E7MA 3V7AG 5FYJD 4H20H 4JGMA 4OFVA 4WO4D 4Q0XH 4LRNH 4NKDA 1SJXA 3ZKXB 5GSVA 3OTTA 1T22A 43C9B 3IVKA 2AJZB 5EWIH 2CDGA 2DQIH 5FKPB 1J12A 1D6VL 1KB5H 1JWSB 1JYNA 2VN4A 3KS0J 1GHFL 1Z9SA 1R24B 3O2WL 5LQBH 1WT5A 5A2JH 2DTMH 3LV3A 4MWFA 4OLWH 1A7OH 4KI5F 4YEEA 5CHNB 1P4BL 1LDPL 4AEHL 4GW4B 5I2IA 5F96L 1NCNA 5HHQA 5KVFL 1CE6A 3VFSA 1JVKA 3QO0A 2FJHA 4PJIE 5IG7B 4V1DD 3QJHA 4G6FB 3LKQB 1F97A 3WSQH 2VQ1A 4PJGA 1RJCA 5GRXG 1K6QH 4BZ2L 3VA2C 5L88H 2Q20A 1SEBA 3BMWA 5FYJH 3CDCA 5TQ0L 1CFQB 5KW9H 3MRQA 3GMLB 2QL1A 1QFHA 1YN7B 3MLZH 4X7CC 1HYSD 5SWSE 5FA3A 3HNTL 5IIEA 2BC4B 2KL6A 1UC6A 5SWZD 4J4PC 4CJ1A 3NPSB 4DQOL 4XVUC 2VLRE 4O9HL 2OYPA 2VXSL 5ESQB 1Q0YL 5F1SA 4OGYL 1ZE3C 5CD5C 1MRDH 4H1LG 2IGFL 1P5UA 2Z91A 2DWEA 1QBLL 2CXKA 4K71C 1IBGH 1WWCA 4YHML 4HCRH 1IQWL 3G6AB 4AIXA 3A67L 3I6GB 1WWWX 3B9KA 3ARGD 3TN0B 1HNGA 3T0XA 3HAEA 1U95A 4LF3B 1UXSA 3X13B 4C4KO 3VRJA 1B0RB 2RR3A 1GAFH 2IBZX 2W1NA 1C7TA 3Q2CA 3KHOA 1IFHH 5F1IB 3DYOA 2NX5A 2VLKD 5EU7C 2WUBL 1P4LB 4G6JL 1GOFA 5HGHB 1DDHB 2VWEE 5GRUL 2J3SA 2RBLA 3UXFA 4O2FA 4IRSD 3PV6B 1TQCC 1YPZB 1O7VA 3EDFA 4Z7WF 4WHCA 3RWJA 3TO4B 2F74A 4Y7MA 5L6YL 3T3ME 1QFWM 1MCWW 3GBML 3VG9C 5EIIA 3FONB 1FNEA 1FCCA 5J6HA 1NLDH 3L3DA 3O4LA 5CWSB 5FGCB 5BZDA 3BPOC 3MZTA 2ZZUT 2OX5A 2DYPD 1HI6A 1D6VH 3GZKA 3ILPA 1A9BB 1E27A 4MNQA 3L3KA 1GHFH 3VGFA 1MRFL 5F8RC 3O2WH 4TUKH 3HPJA 1YMME 2AI0L 3FCTB 3QFDA 5HHPA 1I7ZB 5I1IL 1LDPH 4AEHH 5F96H 5HHOD 1CD8A 5KVFH 1XF4B 1GJIA 4ENEC 1MIEL 4D0BA 3QUXB 4MA3B 4URTB 1TFHA 2XY2A 5AEAA 5I9QB 3L3JA 2GAZB 5IFAL 3CFEB 5MP6L 4HS3A 3BQUA 2G2RA 1KIQB 4BZ2H 1RZKC 2YD2A 5DMGD 4AT6B 3VCLA 3UC0L 2AJSL 1FNAA 5DURD 3GNMH 3QI9D 2BY1A 2ADJB 3ULSA 1T03L 4HUVA 1C12A 3OAUH 1EBPA 1A4JB 1FZKA 4JG0L 1HSAB 3STBA 5I1DA 1W72B 5E8PB 4EKXA 3HNTH 5MEOB 4DQOH 3QYCA 4O9HH 5J1AB 4Z7VA 4YHIA 2VXSH 1Q0YH 1DVFC 3QRFM 1NAML 1HH6B 1I8KB 5HHME 1G9NC 4OCWL 4OGYH 2Y07L 1JK8B 4H0IA 4Q2ZA 4WUUD 4Z7QE 2IGFH 3DVNA 3L7EB 5D71L 1QBLH 5FO7B 3TBYA 4YHMH 4V1DA 4PJAF 5L0QB 1AHWC 4OCNC 5DJ0A 4NOBA 2MCPL 3QIBC 1ZANL 3A67H 3KYOB 3UDWC 1JZ8A 1G84A 4YEFA 2C7UB 4X7FC 3CXHJ 1TVHA 1I1AD 4NZTL 4POYA 1KBGL 1CU4L 3OKDB 1A2YA 4NUJA 4CBPA 3U82B 3G5YB 3BP4B 2A83A 4PG9A 3ZHDA 3RWCA 2W91A 3GJEA 3I02A 2AXJA 3TYGL 2J5LC 2OJEB 5D5MB 3MRCB 5C71A 5LXGL 1T66D 2WUBH 4UUJA 1FNGB 5GRUH 1U3HD 2FHBA 3AREC 2UYLB 2IMNA 1NQBA 3SDXE 4KKNA 3MSPA 4FQLH 1ODAA 1X9QA 2BVEA 4K9EC 5L6YH 4NOFA 3GBMH 4D0DA 3AM8C 1RIUL 1MVUA 2EDEA 1F2XK 5EU5B 2BZDA 3SKOB 5GGSY 1QBML 1KYOK 5KANG 3ARGA 4ZFOB 1EEZB 5EBMA 4NFDA 5IROC 2FEDD 3ULVH 1MRFH 4Z77A 4IOSD 5ID0A 3VH8G 2V2WB 4PJBB 1DQJA 1KIPB 4HAGA 5IK3A 3CFDA 5ERWA 5J3HC 3ABZA 1BFSA 3H3BC 2VLKA 5I8EA 2K7QA 1FBIL 1OTUD 4U1GC 3GB7B 4HMCA 2VDLH 4S0TD 1DANT 3O4OC 5C09E 2JB6A 2BX5A 2EDYA 4ZNCD 5IFAH 4IRSA 5MP6H 1ZLVK 1WFOA 2V5TA 4BQCA 1S5HB 3UC0H 3ZSTA 3H9HA 1T1XB 4IDJL 5HHNA 1M7XA 4YBHA 3D87B 1J8HD 2F54D 4FQHA 3WN5B 1KB9J 4EUPB 4NO3B 1OW0C 1MFBL 1T03H 3P0YL 4DW2L 1FSKC 1RFDH 3QIUB 2UUDK 1MCLA 3EJJX 2DYPA 2EDWA 2VDMH 1U8PA 1OP9A 4MQSB 3GMQB 1NGPL 3UZVB 4F3FB 4PJDA 4EI5C 3JZ7A 4BK5A 2VISA 2FX9L 4OCWH 4ISVB 2Y07H 4NQUA 4X6DA 5T1LB 4Y1AD 1BOGA 5D71H 5HHOA 5C0EA 4YGVA 5E8EA 2AJXH 1C5BL 3CJJA 2IPTL 2V2XA 2MCPH 3VXPB 5HJ3B 3PGDB 4PJ7E 2IALB 4NPYA 1Z9OA 4DVRL 1QLRB 1CK0L 4G6AC 4WTZG 1DN0B 5D70L 3VXQB 4NZTH 1EXUA 1KBGH 1CU4H 2YRZA 4HQQL 4FQXB 5IBUG 3DVGA 5CEZE 2IH3A 3RL2A 3QI9A 2CIKB 4OFYD 1JZ5A 3G04B 1S9WA 3TYGH 1G7PA 2EYSB 4N0FA 2DQHL 5IB1A 3SCMB 3MRBB 4RFNC 5LXGH 2MHAA 3SJVE 5DJ2B 1MCKA 3IKCA 2APWA 4LSSL 4PRNA 2WBJC 4X6EA 5F1KC 5D9SB 4XNQB 4KXZI 1G7JB 4WUUA 4TVPL 1WUNT 4RGNC 4MXQD 3LRSB 5IBLD 4DAGL 1P7QB 2GFBB 4K71B 3V6FB 2I26N 3BP6B 3P73B 3BWAA 3UMTA 1CXHA 3GSQB 4XZUA 4KGLA 3RPKA 5E2VL 4PRID 4JKMA 4H1LA 1TZGL 3B6SA 1I1AA 2YPLD 4F7PA 1J88A 3WEXA 5EBLB 2V17L 1RIVL 1H8SA 5IM7A 1MLBB 1EIBA 4G6FD 4K8RL 1GGCL 4ZNEE 3ZE0E 3ROLB 2WWKO 1XGUA 3C6SA 1FBIH 3BD5A 3FL7A 4JFYA 4KRMB 2H32B 2YSSB 2E9WA 1FV1B 4BZ1L 5C9JB 1U3HA 2VZ1A 1KG0B 2AAVA 4Z0XA 1J1PL 3CZJA 4Y4FB 4YFLF 3VXSB 4BUGA 4YIQA 1FIGL 1S7RA 2P42B 4OI9A 3MNWB 2Z93B 1LVEA 4Y5XB 1MFBH 4GXUM 5JA9A 1HQRA 3TO2A 2VWEC 4DW2H 3HMXL 2KZWA 3NCJL 1J87A 4XBPB 2PCPB 2A38A 4LP4A 1XEDA 5ICXB 1CD1B 3UJIL 3UZEA 4R97B 3HUJB 4YDKL 3VFGH 2BK8A 3DETC 4MX7A 1NAMA 1H3PL 5H2BA 4Z7WB 2C4FU 5EOTB 2FX9H 2ZCKL 4TVPD 3UAJD 3QEQE 1CLCA 1U8KA 1JGVL 4J1UA 3CZFA 2YRPA 3TWCL 1MH5B 1YEJL 1CXEA 5EU6B 2OJZL 3EYQC 1C5BH 5F70A 5D6CA 2XWJB 5D7IE 3PF2A 2HYMA 3QUKB 3R1GL 5DRWB 3RNQA 2ARJQ 4WWKD 1QFWL 5I75B 2ZKHL 3OXRB 4HZLB 1WCBA 5DJYB 4TSBL 2H26A 4Z76B 4DCQB 5I16B 1J8HA 2F54A 4K8RD 3SDYL 5DJDB 1U8IB 3FT2A 4XCYA 2JCCE 4X8XA 3GIZL 4XXDA 2ADGB 4E0RA 1P5VA 2CSPA 1GGBL 1HQ4B 3U30C 3TO4D 1NUFA 1CDJA 3OMZA 3SDDB 2VR5A 3C2SA 5TE7L 4TNWK 4LSSH 4D0CA 1L6ZA 1BBJB 3C8KB 2NZ9C 1N8ZA 3IAPA 4MA1C 5GGUA 3SDAC 2EKSA 4Y1AA 1E6OL 5AZEH 4DAGH 5FECB 1J0HA 4YE4L 5IMMA 4QY8A 3I3DA 2H8PB 4LHQB 3U4EB 1KELH 2WQRA 3QIBB 1KJ3L 4PRHB 4ZQKA 1TZGH 2GKIA 3NBNA 1FFQA 3IJHB 4PB9L 5K9OA 2E7BA 5E00A 3RWGA 3EYUL 3NZ8B 2J2ZA 1ZLWK 1TQBC 1RIVH 3QUXD 4IEFB 2IANB 2NW3A 3S35L 5HDQL 3F7RA 4K8RH 4OFYA 1GGCH 5IMOA 3TH4T 3WFEL 2FR4A 4EUPG 2J5LB 2ADIA 2AGJL 4PJAB 1TVDA 1MIML 4DKEL 3MREB 1LQSR 3CSBA 1S9KC 4BZ1H 4JDTL 4QRUB 5C0AB 1W8NA 1TCMA 2EDDA 3QUMB 1D5ZB 5FM8A 1OD7A 5FKPA 2N7BA 1RUPL 3CMGA 5CLWA 3U0TB 3L3IB 2EXWC 1FIGH 1JWSA 4ZO6A 4U1IB 4ZFOL 1CBVL 5DF0A 1R24A 3AY4A 4NBXB 1G7LB 3FMGL 3TZVC 4PRIA 3HMXH 1ADQH 2Y5EA 3NCJH 3RRQA 4WGWB 3T77B 4NO5B 4NZRL 5FV1L 4Y5YC 5CHNA 4OTXL 1OSZB 1RURL 4GW4A 3UJIH 4FQPA 2R2EB 2BRRL 3T4AB 2J88L 5IG7A 4YDKH 2HT2C 1S7WB 2NY0C 2C4XA 5ANME 1H3PH 4OLVL 2WBWB 3LKQA 1KN2L 2ZCKH 3W2DL 1MLCB 4FMFA 3JV5A 2CLVB 3TWCH 1YEJH 1TNMA 4KTDL 3KPQB 1CFQA 3GMLA 4P9HL 2DRUA 3RDTB 1AXSB 3R1GH 3WUWB 1YN7A 2EDLA 3HN3A 1QFWH 1NGYB 2HAZA 2ZKHH 2BC4A 1I9EA 3BGFC 4WDIB 4TSBH 3OXSB 3K1DA 1LK2B 5TF1L 1U92B 3EO0B 3RGVB 5ESQA 1DSFL 3GIZH 5IHBA 4PJ8B 3JWOL 2VXQL 3BPCB 2H2PC 1GGBH 1ZHBB 2B39A 4P57B 4OCMC 1DLHB 4S10A 1D6EB 3K0WA 1NC2B 2R0LL 3IFOB 3GEWB 5GS2D 3DURB 1HINL 3O2VL 3VDBA 1G0XA 5I18L 3F7YB 1RAMA 3G6AA 3NH7L 3I6GA 5KS9B 5DQJB 4ZFGL 3CIQA 2H2SC 2ZPKH 4OBSA 4RMTA 4YE4H 3MROB 1Z0NA 1U3YA 4JPVL 4A6YL 4CN6A 4LF3A 1SMAA 3X13A 3U2SB 5D1XB 4RIRB 1B0RA 4DEPC 3RUGE 4XPAL 1KJ3H 3M17B 4L9LC 1P7HL 1HWGB 4PB9H 5F1IA 1EEQA 4Y4HB 2GUOA 4M1CC 1BQSA 1HXMB 2G5BB 1P4LA 4OB5L 4WI4A 2NYYD 2HMID 3S35H 1DDHA 5HDQH 4JQVC 3FO1B 1EHNA 3BEWB 4N9OB 4LU5H 2E6JA 1YPZA 2EXYC 4PIRF 4YAQB 5DD0L 2AGJH 3Q6GL 2DKSA 1X5GA 3TO4A 2J1KA 4RFNB 1MIMH 4DKEH 5A16B 1UENA 3FONA 1KJ2L 5GS2H 1EPFA 3G08B 3O2DH 1CLYL 5DJ6B 3QIUD 4Q6IB 4MLIA 2C26A 3EW3B 4LLDB 4ZUWB 1RUPH 3ARYA 4DVBB 1TPXC 5CZVL 5E4EC 3PNWB 3B5GA 4OGZA 1U3ZA 2EZ0D 3HMXA 2B1AL 3FMGH 5EOCJ 1OF2A 4NZRH 4XAWL 5T1LD 4OTXH 1RURH 4M7LL 3HE6C 2BRRH 4PJEE 4QOKE 4JREC 5F7KC 2J88H 3QUXA 4MA3A 4LCYA 3MLYL 4OLVH 4LSQL 1LO5B 1KN2H 3CFEA 4FFYL 5KVDL 3W2DH 4PJ9C 1KIQA 3QDGB 4YPJA 4AT6A 4JFEB 1E6JL 5B4MC 3ZYZA 2FECL 3OSKA 1I3GH 4R0LB 4IHOB 4FQXD 5C0DA 2AK1H 4P9HH 1E4XL 3SDCC 2ADJA 5KVMC 2Z31B 4RMQA 2KUTA 4YDIH 1A4JA 3ES6B 5I73B 5BXFB 5FF6B 1HSAA 3SCMD 5E8PA 4MNGA 3VFWB 5MEOA 4X80H 2YD1A 4P4KC 1RHFA 4F7TB 1IQDB 5TF1H 1MCOH 2OMNA 4G6MH 1P84J 1DSFH 1HH6A 3ULUF 1I8KA 4GAJL 3QXVA 2VXQH 3LEYL 4NQEE 4HUMB 1LE9B 3DJ9A 1JK8A 5MI0C 3L7EA 3EZ8A 2WBKA 1P7QD 5F9OL 5FO7A 2R0LH 4F9LC 3HNVL 1F13A 1HINH 3O2VH 1FFNB 3VD9A 2C3HA 1KCLA 4LCWD 4P5KB 5I18H 3R0MA 3KYOA 2C7UA 4ZFGH 2B5IC 3SBWC 3QXDB 1AJ7H 4P9ML 3OKDA 4A6YH 2R0KL 4JPVH 3FT3B 1LO0L 2AXHA 3G5YA 4ZYKB 2XA8L 3BP4A 5F9AC 2UZIL 4Q97A 5MENE 1LP9E 2MJWA 4XPAH 2IADB 5M95B 3EJZD 4BELD 2OJEA 4LLYB 4M02A 2YUWA 5D5MA 1KJMB 3MRCA 3MNVB 4KV5E 3WJJA 1DBKL 4R4BB 2XQBL 5LAXB 4ODVL 3T8XB 4OB5H 1FNGA 3VGGA 4KH2A 4M4RA 1R3JB 2UYLA 1JRHL 2PNDA 2QR0B 2OZ4L 4UINL 3Q6GH 4WEBL 5CGYD 1AP2A 4Y4FD 4OI8A 2FEEI 1KJ2H 3NIFF 1L9NA 3QRGL 3F7VB 3VFNB 1J0IA 2CKNA 1CLYH 1FCGA 5EU5A 3SKOA 1SHMA 3TBTB 5CJ8A 1EEUA 4IJ3B 5FDWB 1CGXA 5CZVH 4HGKC 4ZFOA 1EEZA 4WI7A 3QCVL 5DZLA 4OLXL 1U2HA 4UAOC 5L8KB 4OV5A 1H0DB 4Z5RB 2V2WA 4PJBA 1KIPA 2WP3O 2YN5A 5CP7B 1QFUL 2AV7B 2X05A 2XA3A 4R2GC 1A0QL 3LY6A 5TH2B 5EU6D 1RJZB 4HXBL 1DBML 3GB7A 2EDBA 3MLYH 2WWMD 4G5ZH 2CDFA 1WZLA 5CEXB 4LSQH 3H9SB 1JWMB 2P5EB 3MV9B 4FFYH 5HI4C 3E3QE 4NHUB 1S5HA 1E6JH 4GMSL 1QA9B 2DDQL 4HIXL 3S35X 1R3LB 4HW6A 2V5YA 1OTTC 3WN5A 2E6PA 5J13C 4EUPA 4NO3A 2EDFA 4L1HA 1AGDB 3CCHB 3QIUA 5DA0B 1GZQB 4NQDE 3KPNB 2H41A 4YQXL 3CX5J 1CGYA 3GMQA 4F7EB 4NM4L 3PDOB 1GXEA 4F3FA 4JY6A 3SDDD 1VKXB 3SGDH 1RD6A 5EC2B 1EHXA 3DWTA 4N0CD 2CUMA 3P11L 4GAJH 2B2XL 3LEYH 4ISVA 3DYMA 5T1LA 1EO7A 2F53E 2IPUG 3MOAH 5F9OH 5D93B 3HNVH 4Y19E 1OAYL 1ZSDB 3BRFA 1OAQH 3VXPA 4BA8A 1A47A 5HJ3A 3MGAA 4YC2C 2IALA 4PRHD 1QLRA 4NN5B 2DLFL 1GGYA 1DN0A 3VXQA 4A6YA 4TUOB 1IGYB 2R0KH 1IT9L 4DGIL 4FQXA 1LO0H 1R5IB 3FN9A 3V5HB 2XA8H 4HFUH 2IAND 2OXHA 2DBLH 1OAZL 3F7QA 3G04A 1HHJB 1NDGB 3GSNL 4GMTL 2EYSA 4U6YB 3SCMA 1UWGL 3MRBA 1DBKH 2XQBH 5CJQH 1ZT7A 4DKFL 4ODVH 5E6IB 1U8QB 5DJ2A 2HWZL 5GGVH 4K3JL 4K7PY 5JW5B 3QQ4B 5C0AD 4WU7B 1EHLL 4CRPA 1FVEB 5D9SA 1JRHH 4XNQA 2OZ4H 4UINH 1G7JA 4PRPD 1P7QA 2GFBA 2ED7A 3O45B 4ZPVB 4XPHL 3BP6A 3P73A 3V6FA 5AUMB 5ESVB 3GSQA 3P4LA 2HN7B 3FAXA 4G3YL 2YRLA 2ED8A 5ILTH 4QGTA 5ENWB 1KNOB 4I18B 1P69B 5DGQA 3BDBA 3QCVH 5FCSH 5EBLA 4LEXL 2E7LA 5FK9B 1T04B 4OKDA 1VFMA 2XI9A 1MLBA 1Q9OB 4HIJB 3IDYB 3HRPA 4KVNL 3O0RL 3OB8A 3CDGB 4L3EE 3HTLX 1QFUH 1MJJB 1KGCD 4KKCC 5T3ZD 1TZHB 4OSUL 1A0QH 4LLVB 3ROLA 3RVVC 4MA8L 4HXBH 1DBMH 1H3UA 5EUKB 4G9FB 5HBBA 3RDTD 3WLBB 5C9JA 1DQLL 1KG0A 1EO8L 2H1PL 5HTSA 3DI2B 4Y4FA 5E2WL 4GMSH 2DDQH 3VXSA 2OL3L 3QWOB 4C55A 3DX7B 4U1KB 1RUMH 3MNWA 4Y89A 1NBZB 2Z93A 4Y5XA 4FQQB 1NC4B 3RGVD 5I8CB 1FH5L 4ZFFA 1CWVA 4PJ8D 4HFWB 3DRTB 1FGVL 4J3WA 4XBPA 2PCPA 3AB0C 5ICXA 2E7CA 1CD1A 1Z0MA 4YQXH 1OGAB 4F9PA 3RVWC 4NM4H 2X4SB 5GGSB 3TT3L 4OAWB 5C0JB 5IJVB 4ORZC 1CCZA 4Z7WA 5EOTA 3P11H 1QKZL 4XWGL 3CU1A 1WBZB 4Q9QL 2JE8A 3ARDC 3EUUA 3HE6B 5EU6A 3H0TB 1PX4A 3U46B 3INUL 4Y16C 5D1XD 1TETL 5AD0A 2XWJA 4PLOB 3QUKA 2O93L 5DRWA 2X9XA 2OTPA 4WFHD 2DLFH 3V4UH 4Y4HD 3OXRA 4HZLA 4P2CG 1IT9H 5DJYA 1PEWA 5I16A 4DCQA 4P2OC 1MF2L 2YPVL 5DJDA 1U8IA 4YZFF 5HGAB 1OAZH 4BFEA 4TVSa 1YECL 4L1DA 1ZHLB 3J7HA 3GSNH 4GMTH 3T2OA 2EEBA 2NXZC 1UWGH 1HQ4A 4HLZH 4DKFH 3DUUB 2P46B 2DIBA 3SDDA 2HWZH 4K3JH 4GBXD 1EHLH 1FN4B 2OZ4A 3RVTC 3UTSB 3GMMB 1BBJA 3C8KA 1JTOA 4AL8H 3GM0A 3SO3C 1U41A 5DVKA 4UI2A 2P8PB 1MFAH 5FECA 2ZUYA 4ZTOH 3OGOE 4XPHH 2H8PA 1DQTA 4HS6B 1MEXL 4GQPH 3U4EA 4G3YH 1YN6B 4M03A 4PRHA 4LPYA 3IJHA 3JUYA 2EE6A 5IWLC 4KUCF 3NZ8A 3S3SA 2VZVA 4LEXH 3S97C 4MJIB 1P2CB 2VZSA 1MY5A 4R8WL 2IANA 2WZPD 4O5LL 1XMWA 5BRZE 4KVNH 3O0RH 3QFJB 4EOWL 1Y18B 3D39B 5IUSA 4ZOAA 4JFED 4OSUH 4PJAA 5BW7A 3Q6FB 3MREA 4BH8A 3QAZB 4XVTH 4WI6A 5F93C 4QRUA 1DQLH 5C0AA 1XF5B 2Z31D 5F7NC 3GKWL 2DLTA 4QO1A 1EO8H 3PE9A 3QUMA 1D5ZA 2H1PH 4PRPA 3U0TA 3L3IA 3EFFB 2OL3H 4ESKA 4U1IA 3WIHL 3F5WB 1FH5H 4X98B 2HT4D 1ZHKB 1G7LA 3ARZA 3T77A 1FGVH 5JDJA 1QYGL 5E94B 4NO5A 1JGUL 4J6RL 2QJDA 3SOBL 3WDJA 1S9XB 2R2EA 3T4AA 4GUPB 4R26L 3MRDB 1JYWA 3BMVA 1S7WA 1L0QA 4PY8J 5C0RL 1MLCA 1QKZH 4XWGH 4LQFH 2VB5A 2CLVA 1L6XA 4Q9QH 2GW5A 1A22B 5CUSL 5HHXL 1Z2KA 1D3CA 4PV9B 3FAWA 1TETH 2HLAB 3RDTA 3WFCL 1AXSA 3WUWA 1B6UA 4LOUD 1NGYA 5F8QC 4PPTA 4IRJC 4JVPA 3NZHL 4WDIA 3OXSA 4MCYA 4FFZL 2VDPH 1LK2A 1U92A 1MF2H 3EO0A 3RGVA 1T89C 2V7NB 1FYTD 1YECH 2Q8BL 3GSNA 1H3WM 4G6KH 4P3DB 4PJ8A 4XMLH 3BPCA 2NR6D 1NLBL 1X44A 1ZHBA 15C8L 6CGTA 4P57A 3QXUA 1DLHA 1D6EA 3IFOA 3RY6C 3DURA 2O61B 5E6YA 3MYZA 4U0QB 4QT5B 4F37K 2VRAA 3OV6A 3F7YA 3MV7E 4PJCF 5J57B 5DHXB 3PXJA 3TJHC 2PXYB 4OLZL 5KS9A 5DQJA 4NO0B 2NY1C 1OVZA 2A73B 3MROA 1T6VN 1F6LL 3A6OA 4JKWA 3U2SA 1MEXH 1R6VA 4RIRA 5D1XA 4H25B 2AXFA 4TOYL 3LRHA 4XVJL 1J0JA 1VEMA 3NA9H 5IQ7L 2IWGA 3GSRB 3M17A 4HKBB 1Z9LA 4WI3A 4XVSL 4RAVB 4YC2B 4XMPL 4MXWL 5DQ9B 4PG2C 3D9AL 4Y4HA 5KG9B 2AK4B 3BXNB 1Q94B 1HXMA 2G5BA 2E9JA 5JDSB 4R8WH 4O5LH 1GGIH 5E8OB 3DVFA 3W0WB 3MR9B 3FO1A 2NY4C 3H9SD 1IGML 3BEWA 4EOWH 3MV9D 2DMBA 2JJUA 4GQ9H 4YAQA 3AAZB 3RIFK 5F89B 5LCVL 5DMJB 4I4WB 5A16A 4JQXC 4HF5L 1E0OB 1XR8B 1PQZB 3WS6A 1EBAA 4GBXA 5B3NA 1IM3B 3G08A 5DJ6A 4Q6IA 5HYQB 4LLDA 4ZUWA 4XP6L 3CLFH 4LNVA 5HDBF 4DVBA 4F15C 3PNWA 4ONGL 5CZKA 3WIHH 5IVXE 2ZCHL 2XOTA 4A2LA 1BF2A 3OJ2C 4KHTL 3LMJL 3JTTB 5C3TA 1AE6L 5TDOB 1JGUH 2XTJE 3SOBH 4ZXBB 4J2XA 2B4CC 3QISA 5D2NE 3RNKB 4DZ8B 4F7CB 1N2RB 4R26H 4F57L 1RQ5A 1K8DB 4Y5VB 3PGCB 3GMOB 5DD5L 5IVZB 2UZYB 4TPRL 1LO5A 2O5ZL 5C0RH 4ONFL 3QDGA 4MLSA 2X6MA 3T0EB 1INQB 1LEKB 3QNXB 1FZJB 1X5ZA 2ZUSA 4JFEA 5CUSH 5HHXH 1IGIL 4R0LA 4IHOA 3N85L 1A7BA 1INEL 1X5FA 3O6FB 4U6TA 1FG2B 1JHLL 1BF8A 3ELAT 3WFCH 5GIRB 5CBEB 2Z31A 2DM2A 2R1YB 3ES6A 4O00A 5BXFA 1P9MA 1CG9B 1WLHA 4U49A 5FF6A 1B88A 3QIWC 2NNAA 3HE7C 3VFWA 3NZHH 3S34L 1JP5A 5E6ID 4FFZH 2BY2A 5F7WC 4W68A 4F7TA 1IQDA 4N0UB 3DARA 4GRWF 2VKXA 1J9CT 4OZ4B 2DLHA 1BQLL 2P49B 1LE9A 1QSEE 3IJYB 4KC3B 4MJ5B 1CL7I 1NLBH 3AB0B 3IDNB 4ZSOA 4XXCC 5IQ9B 3DXAB 3EHBD 5KSAB 4NUGL 1FFNA 1T83A 2AP2A 4P5KA 3MGOB 1V5JA 1BBDL 4CVZA 3SGKC 3T3PE 4JANB 3ALXA 3QXDA 2Q7NA 4JHAL 3CMOL 1H15B 5JW4M 3FT3A 3VXRE 3RI5K 2VXVL 4ZYKA 5F6HJ 4TOYH 4XVJH 1U8JB 4F7MB 5IQ7H 3D85B 4JFHD 4XVSH 1N59B 3VFOB 4LLYA 2XY1A 4XMPH 1KJMA 4MXWH 3D3VE 3MNVA 1NCDL 4MJ2A 4R4BA 4X9BA 2IBZY 5LAXA 3T8XA 1A8JH 4NWTH 4G9FD 2H3NB 4ZUSB 3HI1B 1FYTA 1IGMH 1R3JA 1V7NL 5E4IA 1J10A 5E56A 1A7NL 2QR0A 4GO6B 4PJIF 5JA8B 1YC7A 1OGTB 5LCVH 5DO2D 4AEIL 1R3HB 3EYOA 2A6DB 4HF5H 1N7ML 3I3BA 1NC4D 5ADOL 3F7VA 3EYVB 1EGJL 3VFNA 2YXMA 3RIAF 2QSQA 3TBTA 1KPRB 4XP6H 5FDWA 3WIHA 4PGJA 5AAWA 3ARUA 4XHJC 4ONGH 2ZCHH 3TF7C 2APVA 3OF6D 3EOTL 1Y6KR 4U7MA 3ULUL 4KHTH 32C2B 3LMJH 4Z5RA 1AE6H 3GSXB 2AV7A 3OAYK 4RNRB 5JHLH 1CYGA 4F57H 1RJZA 1T7ZA 4L4TB 1JGEA 2F58L 1PG7W 5DD5H 5CEXA 4TPRH 3D18B 3H9SA 5IV2B 1JWMA 2P5EA 2QLVB 3MV9A 1JHTB 4RWYH 4NHUA 1QA9A 4UIKL 1IGIH 3UTPD 1R3LA 3N85H 4R4FL 1INEH 2E3VA 1C08B 1JHLH 1HKFA 3K8LA 1AGDA 3CCHA 2Y72A 1YEIH 3W81A 1GZQA 3KPNA 3S34H 3RX7A 2CIIB 4F7EA 3CXHK 3PDOA 3RP1A 3ROOB 1VKXA 1BQHB 5EC2A 1MSPA 3UTSD 2NY2C 4HIHB 1BQLH 4Y2OA 1G9MC 1BAFL 1KXTB 3VD3A 1EO5A 4ZS6D 3RY5A 1UKSA 3DX8B 3OKEB 5GGRY 2JF1A 2E8ZA 2NY7L 3JWNC 2BOCB 4PJGE 1ZSDA 2FIKB 4X4MA 4B41A 3MCG1 1BBDH 3T3MF 2YUZA 2BDNL 5I6XC 1IGYA 4JHAH 4HD9A 2L4OA 3CMOH 5HDLA 5A2LH 2QQQA 4KVCL 2VXVH 1R5IA 3V5HA 3LHPH 3ULUD 3KYNB 5T1MB 1HHJA 1TCRB 3QFJD 2OBGA 5MERB 1NDGA 2AERT 1JPFB 1LNUB 3D39D 1CICC 4U6YA 4PR5A 4FXGB 4IRJB 3ZYOA 1NCDH 3TC9A 3E1F1 2W60A 4OF3A 5JIHA 5BS0D 5E6IA 1U8QA 4PB0L 1X5XA 5EUOF 3KVQA 3NABL 5JW5A 3QQ4A 4RDQF 5EOQL 1FVEA 1V7NH 4GAGL 1A7NH 4U2ZA 1B4RA 1JTTA 1UM5L 4Y2DC 2GHWB 3UBXB 4MAYB 1EMTL 2WLYA 4AEIH 1N7MH 3O45A 4ZPVA 3ZDXE 1B0GB 4YHOH 2DQFB 5AUMA 5ESVA 5ADOH 4RMWA 1EGJH 3VW3L 3FN0L 4IBLT 1D9KC 4TN9A 5A3ID 2HN7A 5EA0L 5MEPB 1BD2B 2XYCA 5ENWA 4Z78B 4WV1B 1KNOA 4I18A 1SY6L 5BV7C 1DUYB 3D0LA 3WFZA 4DZBB 5FK9A 1T04A 1H5BC 1Q9OA 4LEOB 4HIJA 4NKOB 3VRLE 3ULUH 4Z7NE 3CDGA 4I77L 4NJAL 2BVPB 2NX5E 1A6WL 2FX7L 4L3CA 4LHUG 3UYRL 2ARWA 1MJJA 4KMQA 1TZHA 1T7WA 2DL2A 4LLVA 1ND0B 1QOKA 4OCYL 5EBGA 1ITBB 2F58H 4PJCB 4G9FA 5EUKA 4LCCC 3WLBA 2J12B 4K2UH 2YC1B 4G42B 5TGBB 4LSRL 3HLAB 4N5EC 3RA7H 1NANH 1N0XL 4UIKH 5E8DL 3QWOA 3LN5B 4R4FH 2BJML 4U1KA 3ZE2F 3O4LE 1NBZA 2RJMA 3VXME 1CDHA 4FQQA 1NC4A 5I8CA 5FAAA 5C2BL 4C4KT 3MOQA 3WLWD 1NDMB 4HFWA 1MFNA 3DRTA 4R4NC 3JVGC 4MNQE 4JFDE 4LKCB 1M4KA 2A6KB 5HYSB 1OGAA 3LKSB 1QRNB 2JJTA 4ZO8A 2X4SA 5GGSA 5DMIL 3OF6A 4OAWA 5C0JA 5IJVA 5ICYA 2X9WA 2VYRE 4XNXL 5I17B 1KACB 3QXWA 3VD4A 4X5XB 2PXYD 3VI4E 4UNVA 1BAFH 4BYHA 4U1SB 4NO0D 1WBZA 1F4YL 3MUZ1 5TF0A 3HE6A 1ZEAL 2NZIA 5FGBA 3H0TA 3SDXF 3QWQB 2NY7H 4V2CB 1WITA 5MEQB 2IPUK 3K81A 3LIZL 5JIIA 1PJ9A 2BDNH 5EORL 3D48R 4F58L 4RAHA 1FE8L 2AK4D 3O6LL 4PYGA 5EFIB 3NAAL 4KVCH 5D2NC 1H8OA 3RZCC 5ISZB 3GRWA 5HGAA 2ENYA 1MFCL 1MELA 2EDXA 3UX9B 3SPVB 1ZHLA 2D0GA 1GH7A 1D5MB 1URLA 1J1XH 5EZIH 4M93B 4Z7VE 4TTDD 3DUUA 5LGKA 1OARL 2DQGL 4PB0H 1XGPB 3TV3H 4MB5A 2DM3A 4GOSA 3NABH 1A1OA 1S7QB 5D6DC 1FN4A 3UTSA 5JOFB 2P24B 3GMMA 4XP4L 4GAGH 3QUZC 1UM5H 4BKLB 1EMTH 3LSOA 2P8PA 3AFLA 1AR1D 1UADC 4F9LA 1QSFE 5D2LB 4HS6A 4U6VL 5JXED 3VW3H 5IHUL 8CGTA 3QG7L 1YN6A 3VFUA 2P44B 3F12A 2BHZA 1I8LA 2YD3A 4ZXBD 1SY6H 3TFKD 2XWTB 2MFNA 4PS4H 2X9YA 5J4MA 4GRWB 1P2CA 5L8LB 1FYHB 3RBGA 1UZ8B 4Z7UB 4KWUA 3QFJA 4I77H 3H8NA 1EVTC 3L9RB 1Y18A 3D39A 4PLKD 3T0ED 3WKMH 2EDQA 3F62A 1U9KA 3GMPB 3F6LA 3Q6FA 4OCYH 5BS0A 4K3DL 3O6FD 4QRSB 3U0PB 3QXTA 1OAUL 2D7NA 2AJYL 1XF5A 3P77A 4PLJD 5BO1H 4LSRH 2FWOB 1HOCB 1N0XH 1X5KA 5E8DH 4KK9D 4PJ7F 2BJMH 2JTDA 1CDBA 3HB3C 2XNAB 3F5WA 3MYJA 4X98A 3OJDB 4S1DC 5C2BH 1ZHKA 5FYKH 2ZG2A 5JPMB 5ID1B 4ALAL 3UTTB 5E94A 3T2NL 1CDUA 1YY9C 4D3CL 4OM0L 1S9XA 2MCG1 1M1SA 4GUPA 3DXAD 3MRDA 2ESVD 5KSAD 3RX5A 5DMIH 4C83B 3T0DA 4XNXH 2AW2A 2UWEB 4D8PB 3ZKMC 3ZL4L 1TJHL 1IM9B 4FFWC 3MUY1 4L9DA 2PTTA 2VLKE 1OM3L 5F9JB 1A3QA 3FQRB 3BD3A 5C0IB 3FZUD 1F4YH 2GJZB 4JO1L 1MCDA 3RVUD 5JPNB 1Q9WB 3P4OB 3LQAC 1JPTL 4PV9A 3MXWL 2Q8AH 4MZ3A 2BVUA 2X4PB 5D96B 3LIZH 1HILB 4DKDC 3D85D 3DECA 5D8JH 2QADB 5EORH 4F58H 1OQXA 3V4VL 3O6LH 4FP8H 3UBXG 4KJQD 3NAAH 1U8MB 2OR9H 4ZODA 4G7YL 2PUQT 5GRWA 1FNLA 4R9HA 1IKNC 1UT9A 4LCUA 4GKOA 2V7NA 1YUHB 3MJ9L 5SX4H 2DKUA 3FB5B 1TTFA 4P3DA 2JK5B 5CJ5A 5KJRL 4HV8B 4B7LA 4OI7A 1IEBA 5D7JB 1BECA 2DQGH 4XPBL 3V2AR 3ZE0F 2EEAA 2O61A 2X4TB 1I85A 4M7ZC 4QT5A 4YBQD 3K80A 1S8DB 3QB7C 5I30H 2Q6WB 3GO1L 4XP4H 1I9RL 2PXYA 1KCUL 5HHOE 4NO0A 2GCYB 2A73A 4CMMB 2VAJA 4ZMAT 3PGFL 4KK5D 2YZ8A 4H25A 2XXCB 4U6VH 4KK8C 1WT5C 5IHUH 3UP1A 4PY7B 2GJ6B 3QG7H 4HKBA 3GSRA 4RAVA 2V5RA 4J8RB 2BVQB 5DD1L 3L3OB 5DQ9A 5KG9A 2AK4A 3BXNA 1Q94A 4M1GL 3MCLL 2XG5A 5JDSA 3S3PA 5E8OA 4LVHB 3MR9A 4JFQB 4PJHF 1XFPA 1J5OL 3AAZA 1KFAL 2QSCL 5F89A 2NY3C 4I4WA 4K3DH 5FO8B 1G7QA 1XR8A 1PQZA 2VLJB 1OAUH 9CGTA 4QXUL 4S1SL 1AI1L 4BJLA 2AJYH 1IM3A 4OCSL 4KUCD 5GS0L 3LPFA 2YOCA 4LASL 4OZFB 3TA3B 5HYQA 4Y2DB 4Y8DC 4YDVB 5FUZL 2D3VA 3LQZB 3WL9B 1T2XA 4JHBA 5JORB 1EAPB 3PHOA 5JXEA 3FO2B 4ALAH 1TTGA 1YMMB 3B2VL 3T2NH 5EZJB 4D3CH 4OM0H 1YMHB 3BE1L 4ZXBA 4DZ8A 5EUOB 4F7CA 2FL5B 3RNKA 3EOAB 4YFDB 5L7XL 2OXGA 1K8DA 1WK0A 4Y5VA 1KEGL 1F45A 2WANA 2RQ8A 3GMOA 3PGCA 3O8XB 3ZL4H 1TJHH 3PP4L 4WHYH 4FQJL 1OM3H 3BAEL 3T0EA 1INQA 1LEKA 2EICA 3QNXA 3B9KC 4C56D 1FZJA 1I4FB 4IDLA 4NN6C 1JPTH 3MXWH 4JO4L 2FSEB 3O6FA 1FG2A 1EHAA 5CBEA 2R1YA 5F1NB 2B7DT 1EZVX 1CG9A 1A5FL 2J6EL 5F7UA 3V4VH 1PKQB 1HHHB 3O3DB 5T5NG 2AEPL 3RHWK 4N0UA 2QQNL 5C08B 3BW9B 3MJ9H 3EDJA 4OZ4A 3N50A 5KJRH 3MRGB 4U3CA 4R6UA 3K4AA 4K3GA 3ZKND 3IJYA 4RBPK 4MJ5A 2VQUA 3CVHB 3IDNA 4MAYD 3WO3B 3NFNB 3REVB 2A2QT 5IQ9A 1CR9L 3DXAA 4XPBH 2Q7YB 5KSAA 1WSST 1Y0LB 3V0VB 4HUNB 1QEWB 1CVRA 4KRNA 4RSVA 5GS0D 3MGOA 5HXMA 2GSGB 3GO1H 1CGWA 3U1SL 1I9RH 4LVOC 2Q76B 1KCUH 4KRLB 1RJLB 4JANA 1BD2D 1W0VB 4KKAC 2EE2A 4N8CL 5JR1L 1H15A 5I71B 5FYLL 3C5SB 4K9EL 1M71B 3PGFH 2QEJA 5CGTA 4CJ0A 1U8JA 1AR2A 1PYWA 4F7MA 2ICWB 4HH8A 3D85A 3VFOA 3R4DA 4DFHA 2GK0A 3DO3A 5DD1H 5CJXA 2F54E 3MCLH 2X10A 2H3NA 3DUSB 3BGMB 1FL5B 4JKPH 3HI1A 4ZUSA 5K59F 3BQUC 3I50L 1J5OH 4NC1E 1KFAH 1OGTA 1T3FB 2QSCH 3MACL 4X6CE 1R3HA 4WO4C 2A6DA 4LVNC 4EQ3A 3GSVA 4MYWB 4QXUH 2BMKB 4S1SH 1AI1H 3EYVA 4OCSH 1ZWIB 5GS0H 1UM6L 2VR9A 3QUZB 5JUEL 4NNYB 1KPRA 3T1FB 2DI7A 2NCMA 5FUZH 4M9OA 3X3FL 1RZKH 1QRND 1BLNA 2BNRB 1CGTA 1FLRL 2FHFA 2EECA 4OIBA 4CU7A 2DF3A 3QEGL 3O3EB 32C2A 5D4QA 2CO6B 1FO0B 3B2VH 4OCRL 4ZO9A 3FQXB 4OM1L 1OAKH 2ICCA 5CILL 1G1CA 3BE1H 3WNLA 5C0GB 1IC4H 4NBZB 3WJLA 1FRGL 5L7XH 1JN6B 4MSWB 4OLEA 4L4VB 4X7DC 3PP4H 3ZLQC 1ZHNB 4FQJH 1DUZB 1JHTA 3UJJL 1G9NH 3PJSB 4KROD 3U9PH 5FYLD 3MLPA 1RVFH 4JO4H 5I74B 3S96B 2AS5M 3G6JF 1C08A 5ISZD 4WW2C 4JVUA 1N5AB 4HK3N 1HYSC 2YMXL 2J6EH 1UJTA 2CIIA 1S7SB 4J3SA 3TNMB 3ROOA 3PWPB 1BQHA 3MJ9A 2QQNH 4CW1A 3X17A 1KN4L 4UV7L 4BK4A 2FO1A 2XZZA 2R2HB 4HIHA 3KPSB 3DX8A 3OKEA 1A7PL 3RFZC 3NA4A 4IIQB