3KAAA

Structure of tim-3 in complex with phosphatidylserine
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
107
structure length
107
Chain Sequence
GYKVEVGKNAYLPCSYTLPTSGTLVPMCWGKGFCPWSQCTNELLRTDERNVTYQKSSRYQLKGDLNKGDVSLIIKNVTLDDHGTYCCRIQFPGLMNDKKLELKLDIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title T cell/transmembrane, Ig, and mucin-3 allelic variants differentially recognize phosphatidylserine and mediate phagocytosis of apoptotic cells.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Hepatitis A virus cellular receptor 2
total genus 16
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3kaaA00
1FFRA 4NDMB 3VXUD 4U05A 5F71A 1EDQA 4GRLD 4YHZH 5GGRY 4NWUH 1EUTA 5F1NA 4IRZL 2LV4A 2ZKHL 4PJIB 4TQEL 1L9MA 4G6MH 4JPKL 4K9EC 1AGDA 1FE8L 4RIRB 1FVDA 2XWJB 4MD0B 3EYVA 3OG4B 5IQ7H 3MYZA 5IW6B 3MBEB 1DBML 3DV6B 3O2DH 3F7YB 4UBDD 5FO7B 4NNXA 2A9NH 2DJ4A 4ZFZA 3MRLA 3NH7L 2BRQA 3HZVA 4AZ8A 2D9QB 1F00I 3O45B 1EEQA 1YEKH 5SWQA 1A7PH 2XKNB 1Q9OB 4N8PA 3FOMB 3LN5A 4WHDA 3V6FA 2UZYB 4MJID 4BH8B 4KDTA 2AS5M 3IDIB 4HMEA 3VXUE 4Z7VA 1CLOL 1CZ8L 1NAKL 4IRSA 2D7TH 2FBOJ 4TUJB 1NGYB 5GXBB 1MFAH 3T2NL 2JE8A 2BDNL 2ARJA 4HIHB 1H3UA 4HXAL 2YK1H 5HY9A 2DDQL 2Q86A 5JLZB 3V8OA 5FUOH 3KJ4C 4XWOC 4AT6B 2APVA 1DBKH 5EZOL 3ULVD 3T09A 4PLNC 1X5IA 4PLJD 1RZ8A 4AL8L 1RIVL 5J1TC 1EMTL 1HWGB 2BCKB 4ODTH 1UENA 4HHAB 1DFBL 5DVKA 4FQJL 5C0BA 4RMVA 2HJFB 5EWIH 3QFDA 3GJFH 3PWPB 4L4TA 2H9GB 2HLFC 3NFSL 3CVIH 4NZUH 4MD4A 2YMXH 2VR9A 3MFGB 3VWKB 1YYLL 2WNGA 4MZ2A 3W82A 1MAJA 1VESA 2MHAA 4I48B 1Q94A 1VADB 5I2IB 1QRNB 4UNVA 3D69A 3HPLA 1BJ1J 2JJWA 4WV1B 3HE7D 1OLZA 2IQ9H 4KDVA 4MXVE 3BEVA 3QFJD 2B4CC 2DI7A 1SYVB 2VXUL 3FRPA 1J05B 4Y4FB 4LEXH 2OM5A 1FAIH 1RZ7L 3AMLA 4R97C 4PJEA 4PGEB 4ZXBB 5IB3B 4FABL 2MPAH 2QSCH 4Y16C 1UACL 4GKSB 4MDJA 1YPZA 1CGXA 2IH1A 5KN5B 1A9EA 4NHCL 1CGUA 2VDMH 5E5UB 4NFCA 2F54B 2VXQH 3IGAB 3WXWH 1KPVB 3ZE2E 4Y19E 2Q6WA 2CXKA 1E4WH 1M71A 1ZEAL 1A3QA 3S8WA 2Y36H 5B3JE 1R3KB 4XCNB 5MEOA 5LAXB 1CGSH 1CWVA 1E4JA 3UTQB 1QSEA 2XTLA 1W0VA 2GTZB 1QBBA 4JZJB 1LO0L 4WY7H 4PV8B 4BZ1L 4P3CH 5LCVL 3SJVE 1MRDL 5FOJA 4Y2DD 3U46A 4NQVA 1KTRL 2J6EH 4KRLB 4QRSB 4ERSH 3FB6A 1UXSB 1DEEB 1LK3L 4IOIB 3MRHA 5E9DE 2UVFA 4LMQI 2P7TA 3OR7B 1NDMA 5KS9E 3M17B 1FYTB 1NBVH 5EN2B 3UTZB 3KAAA 4K23L 5E2TL 4P57A 2CLZB 4QCIB 5BRZA 1I1FA 4CJ1A 1P84J 3MTRA 2I9TB 1T20A 4JFDA 3MOQA 5T3XL 3LKNA 4Z18A 2P7TB 1D5BA 5I8OH 1MFDH 4OKVA 4LHUG 3BZDA 4WWID 4HEME 3KPPB 5F21B 1MQKH 1OTTD 3LN4A 4P2QD 5HVGB 1JK8B 2ATPA 2EICA 1T4KA 5EOQH 1T1XB 5IVOA 1BQLH 2IADA 4FXKB 5SWSA 1T83C 4M8VA 3HPJB 5DJXA 3CDFA 4RSVA 5KJRH 3LKOA 4X4XB 2VABA 1W0WB 3DSNA 5JO5B 2D7QA 3RAJH 1NFDF 3QUKB 2YRPA 4WCYH 3C60C 4N0CC 1MPAL 1QBMH 3RPIA 4PBXA 3CLEL 3V4PH 5F1SA 1UWEH 5T1DL 4LKCB 2WMPA 5FYLL 1U95B 1NDMB 3QYCA 2FX8L 4KQ3H 4NRYB 3MXVH 5IUSA 2JK5A 5DO2C 5HHOA 5IJKC 4OZFG 5DT1H 1D5XA 4NC2B 1NBYB 3WSQL 2C1OA 1EO8H 3KJ4B 4PIRF 2FEEL 4I9WE 2E8ZA 1MNUL 1H5BB 5I76B 2FBJH 3DRTB 4XMKL 4LCCB 4M62L 1RUKH 4ZUUA 1FL3B 3ZL4L 2XKSA 5C09A 3D25A 3QPXL 4HKBA 5I9QB 5LVEA 1GJIA 4K8RH 4JEGB 4X5LA 3TFKC 3RFZC 4KRPD 4OD3H 1ZTXH 4I2XB 2NXZC 1UEYA 2WIMA 3VW3L 4MX7A 2ITDB 2NY3C 2PETA 1DQTA 4J23A 3JBG7 3IVKB 3EDFA 1T7YA 1DQQA 3RIFF 3DX8B 4XH2B 1QFWI 4ZD3L 5CEXA 2QQQA 3RVVD 4LHJB 1YEHH 3S35L 1HH6B 2P8PA 5E00A 4XVJL 1CE6B 4PP1C 1KN4L 2X9XA 4LCYB 4YX2H 1KFAL 3PNWA 1HHIA 5D2LA 4PPTA 5D1XB 4XI5C 4Q0XL 1SEBA 1QLEH 3BMWA 1T1YB 5IEKA 5B39A 1HHHA 3ESUF 2RFXB 1SBBA 2XWTB 1AJ7L 5BOZG 2BVEA 4ONOA 4RFEB 1H3PH 5AZ2L 2Q7YB 4NUJB 1OAYH 4K7PL 5I1CH 4KQ4L 3F12B 4FQCH 5I74B 2XWTA 5KSVB 2HH0L 1HHGA 1OM3L 4M9PA 5A2JH 3DGCR 3QDAA 5DEGA 2NPLX 3H9HB 4XX1E 3DMMA 1INQA 3FCTB 3N9GL 3FRUB 5DO2D 3BEWA 5C0GB 1J5OH 3SKNB 1IAIH 2P4AB 3MLVH 2JKXA 3WD5L 5C9JB 1RZ8B 4B50A 3A6OA 3UYRL 2P46B 5K59E 1A8JH 1WCBB 2FJFB 5EU6D 3DMMC 3ZKNC 4NFBA 1KCKA 1ORSA 3AY4A 3MRDA 4LLQB 5FYLE 2BVOB 4X6CF 3PHQA 5A1AA 3WDJA 2R56H 3SGKA 3ZE2F 4UOW1 3W9EB 4OZGE 3AM8A 3LKSA 4AJ0A 3HE6C 3R06A 4PFEA 1U6AL 4LSUL 1ERNA 3H0TB 1F4XH 3BDBA 4U7MA 3HMWL 3K4AA 4OGZA 3SGKC 3IS1X 3MROB 2HVJA 4HKXA 5FUZH 3O3EA 5L8LB 1T04A 4AENA 3DRTA 2X42A 5EORH 5F7FA 3S37X 3DETC 4ZS7H 2NCMA 4AM0B 1U8IA 3MLTB 5CHNB 3U79A 4DUVA 2RCSL 1UG9A 3L3JB 4OCYL 4DEPB 3UDWC 1TQCB 3AUVA 4W70A 5HD8C 2AV7A 3SDDC 1FZKA 4UBDC 3QXTA 3EYUH 5K59F 4GUPB 3MMEA 2F5AL 1IC4H 1XGRA 5DSCA 4WIQA 4UT7L 3BQUD 1VFBB 2AV7B 4LPWA 4OUUA 1S7QB 5DQDL 4IEFB 5GRXG 1E4XL 1XF4B 3TBTA 4LSSH 4UDUA 3MOBH 2Z35A 1KLGB 2ZOKB 4GH7B 3U4EA 4Q6IB 1NH6A 4GXVH 1T7VA 1XR8A 3QH3B 1OGAD 3NACL 4HKXB 4OF6A 4Y2OA 2DOCA 4LLMA 3P77B 3KPPA 3MBXH 3VWKD 5A2KH 1BQLL 3B9EA 1CD1A 4HJGB 2F74A 1DBBH 3ZYZA 1U3HD 3ZDYF 1MCHA 2JB6B 4U6HA 3DO7B 5JQ6L 5C2UB 2PXYC 1ETZA 1NMCB 3V6ZB 3VXSD 2GY7B 2BNUA 5SX5H 3SDAA 3EDKA 4RGNC 1GIGH 3G6AA 5DDHB 3QIUD 4Y4KC 3MACL 1NANH 2IGFL 1JPGA 3L3OA 2HG5B 2CK0H 4FQLH 3ULVE 15C8L 5L7XL 4PRHE 1S7SB 1PG7H 2BVTA 3QQ9D 4WTWA 3OF6A 3CMOH 4NJ9L 4PJCA 3EYQC 3UTQA 1TITA 1FH5L 5FXCH 1I7UB 1S3KL 4QHMA 5I1IH 4S1SL 2BOBA 3RZCD 4M6OL 3ARDC 1KCUH 3DRQA 3KYMB 3OL2A 1RZJL 4DFIA 1MFCH 2F54D 1KELH 2NY2B 1HXMA 3U7WH 4ZUWB 4M6ML 4XRCA 4ZO7A 5J12C 2RCSH 2MNUA 2XFXA 5BW7A 3EUUA 3HAEB 2ZOLB 1FGVL 3ZDXF 1I3RA 3D85A 1C08A 1A0QL 2P49B 4P9ML 4MA7H 2R4SH 4QRRB 1QEWA 5EBMA 1E28A 4HJ0C 5HGDB 1I1YB 1MFEL 2CRIA 2DQFA 5FKAB 4YDJB 3HE7B 3LQAL 4YNYA 3D3VB 5HGHA 2AQ2A 4Z7QE 1L7IL 3EYOB 4BSVA 3K80A 2CGRH 1KTKE 1EFQA 3RUGF 4QXUL 5I30H 1RPQA 1UJ3C 3MGTA 2C4XA 1BF8A 3CVHB 5TF1L 4BFEA 1QRNE 2ICEA 3QRGH 4JO3L 5DUPL 4EN3B 1IM9A 4LCIH 5J7CC 5ALBH 3D0LA 4Q0XH 4X8XA 1K3IA 5HYJD 1EX0A 5DJ2A 3SPVB 3WNPA 4CDGC 8CGTA 4JM4H 4IOFC 5KVGH 4MAYC 1GYAA 3PV6A 1A7RL 3EO0A 2W38A 2VXSH 3PGDA 5JOEA 4NN7C 4E0RA 1Q9OA 3ZDXE 3BSZH 4R7NB 1SBSH 2GJ6D 4AEIH 4XWOD 2UV3A 5CGYD 2W9EH 1E28B 4NBZB 1JF5A 4GAJH 4F37F 2QQKL 3LPWA 4OGAC 2B39A 4NKOB 1WFNA 4U1KA 1KTLA 1D9KC 4KC3B 2ICWI 4P3DA 1DQLL 4X83A 1S78D 2HH0H 2A2QT 1MCJA 3G6DL 3G6AB 5L2KD 4JLRB 4I18B 4GLRH 1MLCB 1FVDB 2HKFL 3DV4B 3JWOL 3HZMB 1CICD 4AQ1B 3WFCL 4Y2DA 4YDLC 1HIMH 1KCSL 4PS4H 4TN9A 2PKDA 4WGVB 1AJ7H 3WE6A 1JPST 4AEHL 3OHXA 1MY5A 2P24B 5D7JA 4MWFB 1P7KA 3Q6GL 3D25B 4O02H 3DTXA 4YXKL 1M1SA 2VZ3A 1J88A 2Q3AA 3MRBA 1T03H 2CPCA 3F7QA 3IXTA 5D1ZB 4FFYH 4WI7A 2AXFB 2R29L 4AYFA 4R4NC 5KAQG 1I9IL 1MWAH 4X4ME 1D5XB 4U1MB 2FH6A 3MUGA 4NT6A 3FL7A 3IFOB 3TBVB 3TLRA 5C0FA 2G75B 2PW2B 2XZQH 3V52L 1ITCA 3MRQA 4JPWH 2IF7A 1J8HA 3OBAA 4JR9H 1BGXL 2NTFB 3QQ3B 5EN2A 4JQXA 1TJHH 2QKIB 4G8GB 2F19L 5FFLA 4K9EH 1NCNA 4K7FB 3V6BR 2J4WH 1B0GA 1U8MA 5C9KA 4KTDH 4HXBL 3G9AB 1T1XA 3LVEA 5F7EL 3O3EB 1QVOA 3O9WD 3SO3C 3S9DB 2AQ3A 4N5EC 3KPSA 4BSWB 1R0AL 5F1KC 1IGJA 4O4YH 4PB9H 2V9TA 1A22B 3WO4C 3WKML 2YZ8A 4QT5A 3NPSC 4LCUA 1NFDE 3W9EA 4BM7A 4QTIL 2UWEB 2CDGA 3FT3B 2ZCKL 1S7VA 4YHIB 1JWSA 2J88H 3O0RL 3TBVA 3F7VB 3MUJA 5I8EA 5C0BE 3RY4A 4OQTL 1PSKL 1A1MB 4F9LA 4X9IA 4HUXB 1DSFL 4I3SL 4JY5H 4OLZL 4I2XE 1T04B 4HEPG 3FN9A 2HFFA 2D0GA 1H0DA 1MNUH 1FO0B 4M5YL 3MJ9L 1A9BA 5FYKD 3H0TA 1J0YA 3QR2A 3VH8B 1FVCB 1KBGL 4N90D 3C5JB 4PJBE 1JYWA 2KKQA 3RHWK 2X1WL 1LK2B 3HMXL 4F7CB 5JW4Q 4JPVH 2YPVH 4U1HB 2BNQD 1MCPL 4LVNB 1IE5A 3BH8B 2C3GA 3ZE0E 1ORSB 4MXQD 1I7TA 2DLFL 1FORH 3HRZA 5ICYB 5CZVH 4MA3A 2FJFA 1IZJA 2IC2A 3GB7A 2PYED 4RMTA 2CIKA 5FM8A 4AH2A 1SJVA 2YWZA 4O51B 2DICA 1DUZA 3A6BL 4D3CH 1KJ2L 3QDJA 2IWGA 1RULL 3V6OA 3GB7B 1RUMH 5EU6E 5LXGL 1QEWB 5I1CL 1KIPB 4OV6F 4GG6F 1PZ5A 3J8F7 4FQPA 4P2CG 5E70A 1A4KB 3QDHA 5D72H 5BS0D 4D0BB 4HIHA 4F8QA 3P4MA 1LP9B 3S37L 5ABDE 3NA4A 2YHGA 4N0YH 1UZ8B 4P4KC 5GGTH 4L3CA 3GSVB 5E9DA 1QKZL 3K2MC 3AXLB 3UTTA 1ND0A 2ENYA 1HILA 3HE7A 5D1ZD 4XXDB 2X70B 5ID1A 3ZE0F 3OJDB 4PJAB 4DZ8A 4XAWH 3GSRA 1RUPH 3HRZB 4JFDE 4DVRL 4J1UA 1V7ML 3BT2L 1MJUH 1KJ2H 4U49A 2AJZA 1FE8H 2CSPA 4P2OB 4NRYA 3BRGC 1IGML 4YPGA 1CXHA 2FCBA 3LD8B 3BPNC 2I24N 5TF1H 1WTLA 2GJZA 5DI8B 3BWAB 1NSNH 2KQMA 3T8XB 4CU6A 4N8CH 1JBJA 1NCWH 3ZZ1A 2ZCLL 4XMKH 3DRQB 4I8DA 4NDMA 1FL3A 4E41E 1WBXB 3S36H 3TCLA 3TN0C 1NKOA 4L8BA 1CE1H 1LHZA 1QFPA 5DRXA 2DQGH 3T2OA 4OAWB 5E5MA 1HQ4A 2A38A 3P30H 4ZSOE 5DK0A 4BKLA 1T5WB 3UJTH 5F1IA 1G6RB 3U30B 4OD1L 4ONHA 3QCVL 5KVMC 1GGIH 2PTTA 1DBJH 3LPFA 4IRJC 4OUOA 3VGBA 3WFCH 5F7HA 5IHBA 2Z31D 3NPZB 5D7SH 2NXYB 1JMXA 1RUQH 4M02A 1G9MC 1T22A 3GSQA 3VMPA 5HGGS 4KQ3L 1KSRA 4ZFOB 3BFOA 3FO0L 4DUXA 1BM3H 4JQIL 1FYTE 3L3KB 5ITBL 4U31A 4HK3N 1JYXA 5K9KA 5H35A 4NSKA 3C9NA 3EO1B 3H7BA 2KH2B 1QLRB 4H8WH 5FB8B 2BY0A 4X98A 4QHUA 3VCLA 1KN4H 4G6AD 3S35X 3IFPA 5IHUL 4NRXB 4NPYA 3SCMC 1N2RA 1MI5A 1RJLB 4UIKL 4NQSB 2YD2A 3VG9B 1T0MA 3I6GB 5KSBB 4JJ5B 3UJTL 4MAUH 1IILE 2WUCL 5AUMB 1J8HB 4CJ0A 3RX8A 5F9JB 4OZHF 3HZMA 1OAQL 2OK0H 3OR7A 4K8RC 2GITB 2BFVH 1UFUA 2A83B 2OP4H 4HIIB 3ZKXB 4Z77A 3JXAA 4JAMA 1CTNA 4U1KB 1TJIL 2ZCHL 1YPZF 5CGMA 4M7LH 4HWEL 3T77B 4Y19D 2X70A 5J12B 3C5SB 3FQXB 4Z7NF 1AD9B 4JVWA 1G9NL 3L5XH 3MNZA 1LDSA 3TV3H 5CD5C 2QR0A 3QCUH 4GRLA 4DTGL 3ZKMC 4ZG1A 3R06B 5HYEA 1F58H 4KHXH 4LLYA 3P4MB 1LK3H 1RZKC 5DYOA 4OI8A 4M1DH 2ADGA 5DWUL 4NWUL 2RFXA 1WC7B 1CIUA 1EEYA 5EDXA 4OZFB 3QJFA 2VMFA 3MODL 3TT3L 1OF2B 3O3AB 3V5DB 1G1YA 1RJCA 4MA8H 4ISVB 4QRTA 1WZ1L 4M93B 3HZYA 2CKBA 3QNZA 2DYPA 2YKLL 4WFHD 2R56L 1GAFL 4LVOC 4DN4H 3IXAA 4XCCL 4AEIL 3BAEH 2VNCA 5J89A 1IC5H 5I1JL 4Z7NE 5GGTA 4QOKE 1ED3B 3MRCB 1S7XB 2GAZA 1Q1JH 1IM9B 3C5JA 2V7HA 1XF2A 1A6TA 4F2MA 2HLFD 1DN0A 1J0JA 1UB6A 2HAZA 1IKNC 4QHLB 5BO1H 5JR1L 2VDQL 1K2DB 1ZLUK 4DK3A 1G6RH 3SY0A 4PS4L 4L4TD 4PJXF 1D5MA 1M4KA 1I7ZB 1U8JA 1JTOA 2C3HA 5IWLC 2O5YH 5CP3A 4R2GB 2MKLC 3EZ8A 3AS1A 1IC4L 3TA3D 4ELKB 2BMKA 2A0LC 1I85A 35C8H 1I9RL 3F7VA 3JWOC 4H1LB 3V5HA 2QQKH 3D1MC 1RULH 1TVHA 3EYVB 1YEGL 3DUSA 4OGYL 4PYGA 4RWYL 3GMNA 12E8H 3KPOA 1DJSA 1NGPL 2BC4A 2D7OA 3CFBA 4ONGL 4R4FL 5J1SC 3BN3B 1A3LL 1HDMB 2DKMA 3BJ91 5GIRB 3P0GB 4L5FL 5IB5A 3SJVB 5E2UH 4WWKC 5SWQB 4YDIH 3NGBC 5JORB 4ZQKB 5FYJE 3TNNA 3T08A 4N1EA 5ADPL 2EDXA 4HLZH 1YEHL 3S35H 4NO0B 4YPJA 4FXKA 1KELL 4IRJD 1VSCA 2X4SA 4KRMB 4XNYL 1NGQH 5IFHL 4XXCA 3QHTC 2OXGA 5KG9A 1CFSB 4JO4L 1T7ZA 5E0QA 5MEQB 4O00A 5IV2B 4JGJA 1BF2A 3LV3A 4HBQA 1TZHA 5EOQL 5DMKA 4K7PY 2JB6A 2ITCB 3Q1SL 5GGSB 2VZUA 4X6DF 4OCXH 2BNRB 2DRUA 4KY1H 4J3SA 5C0AE 5T1MB 4QXGH 5A43C 5GGVL 4X7FC 4IRJA 3TNNB 2DWDB 4ETYA 4ZFGH 4G8GA 3SO3B 1UYWH 2V2XA 1KB9K 3D5OF 5IB5B 4MS8C 4L4JA 2DQCH 3BPNB 4WJ5B 2NY4C 4XNXH 1ZLWH 4PJ5A 3OSKA 5LCVH 1KOAA 4LARH 4XC1L 1RHHB 5LGHL 1FQ9C 3D3VE 5C2BH 2NY6B 1KGCD 25C8L 3L3DB 4LLUA 4M3JA 4Y4KA 1Z6JT 2C5DC 4HPYL 3TN0D 3U7YH 4YXHH 3MLRL 3DJ9A 1N0XL 3EDJA 5T3XD 2K3TA 4Q9QL 3KWWA 5TE6H 3WUWG 3SBWC 3OXRB 3NFNA 5EU7E 4YJZL 1OY3B 2GTZA 1F3JB 3I3DA 1NL0L 1R3HA 2V2TA 3O2WL 5DRXB 4HIXL 4LHUD 4KFZC 4YHNB 1U3HC 1E27A 5IW1A 4I3RL 3RNQA 3ARDA 2EXWD 2XQBL 3BWAA 5IQ9A 4M43H 2Q3ZA 3RDTA 4UT6L 1OLLA 4WWKB 3NACH 3HFMH 3MJ6A 4Y2DB 1NLBL 1PAMA 5HGAA 2LU4A 3QEGL 1MY7A 3GKWL 1U3YA 2AERT 1F6LL 4YXKH 3S3SA 2VLLA 5DJZB 4DJMA 2SEBA 2PTVA 5FGSA 5D93C 3WNOA 4EQ2A 5IBLC 2N7BA 4E42B 4HUVA 1QSFD 2CH8A 1OAQH 4X7CC 1J1XL 2BSED 25C8H 2Y72A 2ORBL 1QHPA 1T21A 5JTWA 5L6YL 3J7HA 2EDWA 4ODWB 1FNFA 1MWAL 2F53E 1INQB 3FCTA 5DVLA 3FQNB 5DD3L 5C09D 3V79C 2EXYD 4X7SL 4Q9CA 5K9JL 1B4RA 3TBYA 2VLKE 3BRDA 3HPLB 4ZTOH 1LEIA 2J7LA 4UZGA 1MFBH 1BIIB 1XF2B 2AW2A 3GK8L 3Q2CA 1WEJL 4POZD 4PGDA 1JNNL 3DUHA 3EFDH 1JL8A 1KPRA 2DBLH 3V7AE 4EQ3A 4YAQA 2AVGA 3DVIA 1EAJA 4YK4C 5GS0H 1WK0A 2IBZY 5FYJL 3HNTL 2XOTA 3JZ7A 3BN9D 1R5IA 3AB0B 2V9RA 4PGBA 3T0BA 5JZ7C 1YQVH 2OJZL 4R96A 5C09B 4I5BA 5EC1B 4OI7A 1A2YB 4XGZB 2BCKA 3QUML 2IPTH 3V5DA 3KPLB 2DMBA 1HCVA 5BW7C 2IQ9L 1EHXA 1NCAL 4YEEA 3PWLB 4M8QA 4QYOB 4ZPTA 5GSRB 2G5BA 4U7SA 2D9CA 1NAMA 3IKCA 5DQJA 3RP1A 3W9DB 1IRAY 3F7YA 4HWZB 3G5ZA 5TF0A 3IVKA 5CJBA 2X4QA 4UIMB 2CRMA 3P0VH 5EZLB 4KKLD 4PJ8A 3WIIL 2EDNA 2EYRB 1J7VR 2UWEA 3IDXH 4I0PA 3IRZA 1AR2A 5D93B 3VFTA 3TN0B 3ROLB 1IC5L 1WWBX 5BRZE 4Y5XC 5D2LF 3MLYL 3MNZB 4G8GD 4HJGA 2IEPA 4MNGE 2OS7A 5KVGL 3AS3A 2FR4A 4LSTL 4PJ5D 4EUPB 1RD6A 2AJSL 4GKZB 4RAUB 1R3HB 1QA9B 4PD4K 1ZVHA 3MJ9H 4P99A 4O2EB 1NFDA 5IF0A 5EO9A 2QSVA 1U92B 4NNXB 2AK1L 4AEFA 2IFFL 3ARFC 1AGEA 3VGEA 1JPGB 1G7PB 4Y5VA 1J1PL 1RJYB 1P1ZA 3OKNA 2E8YA 1YEEH 2I5YL 3ARUA 4V2CB 5FF6B 1SMAA 3SHSA 5JMOC 3FJTA 4MA7L 2ZUQB 5DSCB 5KTEL 1TCMA 2VO5A 3UPCA 2C1PA 3TNMB 4GRWB 4JQXC 2UY6A 1J8HD 4MB4A 4OKDA 4OFIA 1NQBA 4JREB 1XGQA 4M7KH 5JXED 2XTJE 4P59H 1PD6A 3F6LA 5IFAL 3FQWA 2ZUVA 5ELIA 5GRUL 3RBGA 4CGTA 4JZJA 4KI5C 3RDTD 2F54E 5IQ7L 3MXVL 5GSVB 4LFHG 4Y16D 4OZHA 2AEIT 5GS1A 1NUGA 1JV5B 2A9NL 2VZTA 1WTGT 4QHUB 3DSFL 3CLEH 5F88A 3V4PL 3L95B 3OF6D 5T1KB 5D7KD 3V0VA 1FJ1B 2VERN 4D9RD 2UWEF 3LKSB 1U41A 2AXGB 1UH4A 2X1XR 4HC1H 3GMNB 2ZCHH 4I18A 1G7LA 3LB6C 3QULA 1G7PA 4Y5VB 3RL1B 5DLMH 5F7YC 4QWWC 2WP3T 4GKSA 3T3PF 2XYCA 4NHUB 1AXTH 3DXAB 1FBIL 5HVHB 1ZK9A 2NY6D 1INDL 2X4UA 5DHVA 3T0EB 2CLVA 4OZ4B 1UVQB 1BBDL 5I1EH 3HHRB 3IDNB 2DM2A 4S1DD 2VLJD 1YY9C 2V9QA 2DQJL 3BGAA 3SQBA 4Q9QH 1FCGA 1KPRB 2HMID 3VXOA 3D0LB 4LQ1A 3TZVD 4ZXBD 4PG9A 4MQXD 4TSBL 2J3SA 4MDJB 4S1DC 5KTEH 1IM9D 4R0LA 4QTIH 3RVTC 4KQ4H 1GRWA 2NW3B 4WFFD 1MQ8A 5DHYA 4FG6D 4ZFOL 2QHRL 5F7NC 4RA3A 2RQ8A 3AROA 2AJUL 4RQQB 4KK6D 3GJEA 3LKRA 3P2TA 1CD8A 4IRSD 5HI5D 3GSNA 5A16B 5K9OA 3QDMA 5CSZA 1KFAH 1Q72L 3OKEA 1NSNL 3B2UC 3SDXB 5IMLA 5CBEB 3RRQA 2FGZA 5E8OA 1FVCA 4KH2A 3ARSA 1KEGL 1KJ2B 4FQQB 2Y23A 3KPTA 4JFQB 3CH1B 4UB0H 4WU5A 2MOVA 2XT1B 1CLYH 1UM4L 5JXAL 1RZGB 1AHWC 2NY5L 3FQXA 2FECL 3JUYA 1DN2A 1JMZA 4MHHG 1BWMA 2EEAA 1T21B 2VL5A 5D7JD 1DQDL 5IHZB 1H3PL 1FNGB 5F8QC 4MZ3A 1DLFH 1J5OL 4G43A 3C60B 3CD4A 1MVUA 1I3RB 4B53A 5LWYL 1QFWL 3L1OL 3V0WL 1M6OB 3NAAH 1FFOA 2ZUTA 3VU2A 4X6CB 3HB3C 4WW2A 4P46A 1L0XA 4H0GA 5IM7A 1G7QA 5GRVL 1OGAE 1U8HA 3N9GH 2DQJH 5CP7B 5CKGA 2LFGA 2P45B 3DOSA 1UA6H 1N6UA 1XZ0A 2NW2B 1W0WA 4KMTL 5C6TL 5JO5A 2E3VA 4K71C 2DDQH 4F37K 1EO7A 4BSWA 1H0DB 1FFPA 1F45A 3FN0L 3LKOB 4X4XA 4ZUUB 2MTPA 4ZSOB 1A7RH 4XI5D 1G9NH 3CX5K 5JPMA 5I1HH 2OBGA 1N4XL 5GQBA 1JPSH 2DQDH 5D1XD 3V4VH 2Z35B 1F8TL 1HHKA 1UC6A 3LH2H 2Y6SC 1FV1A 4U1GC 1SVZA 3KJ6H 3P4OB 5D6DC 5D5MB 1TTFA 1IQWH 4X5XA 4JFZH 3N50A 3SDYL 3QAZB 4ALAL 4ZFFA 1CVSC 3HLAA 2ATKB 3O6LH 1OP9A 1H8SA 4JFXB 3PP4L 4YEFA 3U0PA 3C87A 4NO2B 3ULVC 4PRHA 3VWJC 3EBAA 5C7XL 1Z5LB 1BVLA 4EJ1C 3IFNH 2H41A 3GMQA 1JGVH 3LN4B 1S9WA 1P4BH 1PLGH 5DC4B 4W6XB 5AZ2H 4C54A 2HVKA 3EOAA 1G7HA 3NVQA 4I0CC 2ADFH 1NL0H 4P2OC 4S0TD 4LHUA 4AK1A 4P5MA 1NC4A 4ACPA 3TCXA 4MJ6B 5JPNA 1I8LA 3HUJE 5FF6A 3UC0L 5ECJE 5CFHA 3NOIA 1YEEL 4ZUVA 1ZS8A 3D48R 4YUEH 3PHOB 3FQRB 3FTGB 3DVFA 4M5ZL 1JNJA 2YS4A 1UWXK 3BD5A 1TTUA 2FLBT 1R0AH 4L1DA 4BKLB 3SGJA 2OCFD 1U8JB 4G6FD 4NQXB 2UYLB 5I71C 3UO1H 5HPMA 1LNUA 3QUMA 1CFVH 1FZJA 3RI5F 2APBA 3GSUA 5DI8A 5C0ND 1HHGB 1MRDH 5KSUA 5ANME 5TJWK 4Z78B 1ZT7A 1U8QB 4F58L 4YHOL 4CBPA 2A0LD 4OIBA 5BV7L 3D2UA 4XMLH 1EJOH 1OAUH 1FLRL 2FJHB 1QNZH 2Q7YA 5B39G 4EN3A 3BP5A 3DARA 5T3ZH 3CVHA 4BELD 2NY1D 2E9IA 1ODAA 5JDSA 4GMTL 3QQ9C 4N90E 3QXUA 5FGRA 2W92A 4LVNC 4P2RA 4X4YB 4NQED 1NMCC 1JF1A 1ZWIB 4OLYL 1YQVL 2OJZH 3SKMA 1N64H 4R97B 3I6KA 5H37H 1TCRA 3MLZH 1B0RA 3B2UD 3BYYA 1VGKA 4PJDB 4R4FH 5E4IA 1G7MB 2Y5TA 2G60L 2PYEE 3HUJB 4PJXA 1CF8H 3SGDH 4OLUL 2HT3C 3UXFA 4NUJA 4EN3D 4XNUH 4AG4L 2B0SH 3QDMB 4LRNL 4H1LH 3BZEB 2PW1A 2C3WA 3W81A 1R3JB 3HI6L 3QNXA 5HYFA 2ARJQ 3ILPB 1R3LA 5D1XA 4Z6AT 5LG1A 1S8DB 3WUZA 4LSUH 4OSUL 5D7IA 5DC9B 4GRMA 1CDHA 3HNTH 2NW3A 3MLYH 4R90H 5AZEH 5CCKL 1BFVH 1A7PL 2GJJA 1RK0B 4LLUB 5L9DH 1GOFA 1S7VB 3MRGB 4YHIA 4P4RB 1N64L 5E9DD 1CU4L 2C4FT 1GXEA 1OOAA 4MJ6A 1ZHNB 1D5ZA 2GK0A 3CZFA 5ALCH 5JUEH 1GGCH 4H88L 5I18L 3O41A 1YYLH 3L95A 3IAPA 5A2LH 3FOMA 4OJFL 4FQXD 3UTTD 4UTBH 1S7RA 2NX5E 4X4ZA 5I71B 4Q9RL 5DJ0B 2R0WH 1JUFB 4PJFB 2X5PA 1UA6L 5C6TH 3DXAE 1V05A 3RVWD 5J13C 2FX7L 3IJYA 3MRFA 3GSWB 4K7FA 4JKMA 1JK8A 4HWBA 3BXNA 4JDVA 1EMTH 3EJZC 3HG1A 2FYYA 4FQJH 2YD7A 1P5VA 4JY4A 4XVSH 5TPWH 3BIKA 4PY7A 1QLEL 3S3PA 2YUZA 3C08H 1FN4A 3BYTA 1YDPA 2FD6L 3Q6FB 3UTOA 3VXPA 3WFEH 4GUPA 2PO6A 1F6AA 3F62A 4JY4B 2FSEA 2YC1A 1P1ZB 1ONQA 4OF5A 4X6BB 4L8SA 4FP8H 2VQTA 4EOWH 1YC7A 4YHML 1NAML 3L9RA 4PP2B 1YN7B 4WO4C 3LZFL 4Y5YA 2WK2A 1AFVH 1X5XA 2W0FA 3U7WL 3HN3A 4JG0L 4HKJB 4N0FB 4ENEC 4PREB 1JI2A 5JHLH 3HG1D 4U1IA 1AKJD 1KCRH 4WENB 4HS3B 1CDBA 3T2QA 3RWJB 1A1OA 3SCMA 3VFTB 1D9KB 2XRAH 5EZIL 4NP4L 3LY6A 1OB1B 5FYJH 4FMKA 1P9MC 4ELMF 4P46B 4MD5A 1KNOA 1RK1B 5HDBF 3GFUA 1XGPA 1P5UA 5KSAB 1IGIH 4P2RD 1D6EB 3FMGH 4JRYE 1X4YA 3GRWL 4A2LA 1I85C 3QWRA 4MDIA 4G6ML 1ACYH 2DL2A 1S7UA 3QHZL 5KAQF 1JJUA 4W81A 2HTKD 1UH2A 5IF0B 3L5XL 5DK0B 3FZUC 4PD4J 3EOTH 4PTUA 1X6LA 2X4NB 1CTOA 4OCXL 4TSBH 4U1LB 3MXWL 2GK2A 1ZHKB 2HFEB 5IMMB 5IHUH 3JUZA 2J88L 2CKNA 4JVUA 1KJ2A 5F9AC 4XP5L 4G6JH 3WIFA 3NCFB 1JHLH 1B9ZA 1EO8L 1EAPA 3OXSB 4HIEB 1ZA3A 5CZVL 4Z95H 5D1QC 1MCKA 4XNMA 1IEAB 2BVOA 3ALWA 5EOTB 4XC1H 2WBJA 3ZKMD 1Q0YH 3GI8L 4DW2H 1Y6NR 4RMUA 3I3EA 5CEZE 3S7GA 4HPOH 3VD3A 4Q97A 3U0TA 3UPRA 1HSAA 3L6FA 3I6LE 3QB7C 4R2GC 4Z8FH 4WI5A 1EA9C 5CEYA 5ILTH 2VZSA 1R5IB 1BZ9B 3IYLW 4C55A 5F70A 4ODBD 3BZEA 3ZO0A 1OAUL 1S9YA 2VKWA 3STZB 3DETD 5FA3B 3CSPA 3RVTD 5I16B 5J6GB 2R69L 1FVEB 2R2BB 3Q1SH 1P69B 1UM6L 1L7TH 3ARTA 3D18A 4H25B 5DD6A 3U1SL 3B8SA 3D85D 4PJ9B 1QFWM 5CSZB 1D6VH 3BKCH 3WHXA 5C2BL 5IR1B 3K46A 4HUUB 3TGXA 4HZAA 1EIBA 4HHAA 3D3VD 3HAEH 1J1OL 1NCDL 5IBUG 1DUZB 1YJDH 3RTQC 1IGYA 3BT2H 5I75B 4PB9L 2X40A 4KGLA 3MRLB 1QKZH 2AXJA 4CADB 1G7JA 1MFEH 4RMRA 4HUNB 2PXYB 1DEDA 2YA0A 4LEXL 3RY5A 3QULB 4BFGA 2Q1EA 5FOBA 3RZCB 4PJ9D 2I60L 2QSCL 4AIOA 5GGTL 5I19H 4UILH 3ZTNH 3CX2A 5C92A 3I2CH 3ESVF 2YUVA 2VC2H 3STBA 7FABH 5IVXF 3LDBC 1IGMH 3NZ8A 4MQSB 2VABB 2R1WB 3ALXA 4PJ9C 4FQCL 4OZ4A 4M4PA 2DKSA 1KLFA 1M7XA 5DURD 4L4VD 2W0FB 5SX4I 2GJ6A 5HVHC 5IFHH 2EDRA 1HZHL 4ODUB 2XG4A 5FCSH 5T1MA 1S7SA 1P4LA 5IG7B 2AP2A 1X5FA 1NUDA 4B7IA 3ULUL 2JCCF 4JZNA 4B5EA 3T3MF 3ARFA 5FDWA 2MQCA 4OCRH 3QEGH 2FSEB 2VISA 2YC1B 4UV7L 1U8LA 3FOLB 5IJKA 3ECBA 3LH2L 3RWDA 2ICWA 4UAOC 2G75A 1WIPA 2PW2A 2IBZX 3EKCA 4U1IB 4OTXH 1JPFA 1CCZA 5JOFA 1NDGA 4PR5B 4X7EC 4PRAA 3I75A 2XZAH 1XR8B 5D70L 5JIHA 1DE4B 1G9MH 5DXWA 3RKDC 2ZNWA 3MRRA 4OCSL 1T4KB 2GW5A 1TDQA 5GRVK 1FNEB 4JHAL 1MFAL 3T2NH 3P0YH 1BD2D 2Z31B 3EFDL 3HR5B 1ONQB 2W9EL 2W9DH 3HS0B 4X6BA 4KJWD 1MRCH 3RY6C 4EEEA 1U42A 4ZNEA 1KPVA 3KPOB 1XGRB 2FEDC 4DKEH 2VXSL 3DX7A 1P84K 3ARFB 1K8IA 3EOTL 5FDWB 4EBQL 2F53D 3S5LB 5E95B 4XBGA 4J1UB 3SKJH 1AO7E 3GSRB 4RGOH 4FNLH 1KEML 3SDDB 3FMGL 1DUYB 2PYFA 5IHZA 1JHKH 2LAGB 4NZJA 5DJCA 5I15L 4PJFA 5EULV 5BXFA 1FZMB 1TNNA 2XN9D 4TNWF 1RURL 3ZT5A 4X7TA 2DIAA 3GMRA 3BHBA 4QXWA 1DTUA 3QJHA 3QUYA 3CNKA 1ZGLA 4KTDL 3TT3H 4MJIE 1EJOL 3TN0A 4KTEL 4X9FA 1CLCA 1UEMA 2BC4B 4LBEA 4OCWH 4Q7DA 4XP4H 5IMKB 2AK1H 3HC0A 3K0WA 3QI9D 4HIJA 3WIHA 4ZYKA 1ZSDA 2EYTB 4YXLH 3LKQB 3A6CH 2IH1B 3C8HA 3LD8C 5E6ZA 4PGJA 1S9YB 2UWEE 1FIGL 1R5WB 4UOW0 5CWSB 2NR6C 1P6FA 4ELMB 1XGYL 3SDXF 5E8EA 3HC4L 4E41B 3GRWH 3EW3B 3IDJA 1UQSA 4NQCE 1Z9OA 3NMEA 5TE7L 3AXLA 2P5WE 1CG9B 2NY3B 3DMMB 1ZLWK 2Y9RT 4S1RH 4OZGF 3ZT6A 3ULUF 4ODHH 4LLWB 5K9QI 5CJOH 5D7LA 1FH5H 3N1MC 5DF0A 2K7QA 5M95B 2VTFA 1Z9MA 1QO3A 1RURH 4JO1H 3SE8H 3BP4B 3MLSH 4JQVC 3HE6A 2Q86B 5DYOB 2W9DL 1ZA3B 4YHYC 1JYVA 4LLYB 3RGVB 4XBPB 2B5IB 5IMKA 4AIZA 2VQ1B 2DLEA 3GSNB 4XAKE 5DRWA 2A6DA 1AGFA 2EDQA 1WWCA 4NN6C 2V5TA 3NA9H 4Z76A 1LNUB 3QUMB 4ISVA 2UVEA 5EOCL 5IW3A 5JUEL 1BZ7B 1YY8A 4KRPB 1CGVA 5C0RH 4YIQA 2ZCLH 4URTB 1VACA 2R0KL 4CN1A 1CR9L 4BSJA 4Z77B 3IU4L 2X41A 4OQ1A 2HG5A 4HC1L 4I0KA 1NCCH 1ZS8B 2A83A 4CW1B 1QQDA 5AZEL 2NX5B 1ZV5A 2FJGB 3B5GA 4RGNB 4UTBL 4C59B 5C0IB 35C8L 1KBGH 1N8ZB 2IALA 4JO4H 2ICWJ 3L3HA 2A9MH 1VFUA 4P9HH 1MCFA 3KHOA 1FZJB 4WGWB 4G8FA 1FZMA 1WFOA 3FO2A 5I18H 1YNTB 2FHCA 4HD9A 4HLZG 4HQQH 2FD6H 1OD9A 5JOFB 2D4FA 3V9FA 4D8PA 4WO4D 3HMXA 4CN6A 1H5BC 5D5ME 1DBAL 3MX0A 4QCIA 4PJ5E 4BJLA 5DD0L 2AKRB 4IIQA 4UUJB 3G6DH 1H3XA 2DM7A 4KROB 3T4YA 3BRFA 1MPAH 4C83B 2DI8A 2IAND 3DX9A 5L2KA 4WHYG 1IAOB 4FQIH 1RI8A 1WZ1H 3CX5J 3VXRB 2W1NA 3O6MH 1U3JA 2VC2L 4XCFH 5CD5D 4Y7MA 3IAGC 3IDUA 4PV8A 5F9WC 1NPUA 4NO0A 5LXGH 4K3GA 1NC2A 3VWJA 3MOAH 4C56E 5IB4A 1CLOH 5HGBB 3MLZL 3VXRA 1WWWX 2HP4A 2FIRT 2DL9A 3FQTB 3O4LD 2CO7B 1F11A 4P2QB 3CMOL 3REVB 2Z9TA 2ZJSH 4ONFH 1YC8A 1GL4B 5L7XH 2GTWA 3NCCB 3KYNB 3CDCA 3DNKA 1YMME 4D8PB 5HHXH 1DEEA 2OJEA 4XWGL 4M6MH 3O2WH 3DURB 1YPZB 4TVPH 3TO2B 4PJDE 2R2EA 3BUYA 3O6FA 3WFDL 1KCUL 4OIIL 4NZTL 3LQZB 4P4KB 4J3TA 1MCDA 1VCAA 3FO1B 2VYRE 4OLEA 4QOKD 1GSMA 3G04A 4JFQA 4DVBB 2QSQA 4Y4FD 1DN0B 3CZFB 5IGXH 2QQLL 5J57B 2FIKA 5T1LD 2NX5D 2W65B 1ZAGA 3EO9L 3FO9B 2A74A 2R2CA 3OZ9H 1B4JH 5EZJA 4FNLL 3OPZH 4CL7A 3CLFH 4KJQD 2HRPH 2WP3O 4LASL 4ELKA 2LTQB 2CRYA 1YZZA 3LCYA 1DDHB 3MPCA 2Q8BL 5D1XC 3MSPA 5J0BA 4GAYA 1A7OH 5IB1A 3SE3C 1JIBA 4JB9H 4ODVH 1YYMH 3GUTA 5D1QB 4M6AA 1JRHI 4RWYH 3CXDH 5DRWB 3S6CA 3GKWH 4ETQA 3FFDA 4HJ0D 4PGCB 4XBEL 5I1KH 1EJ6A 5AD0A 1U6AH 1EO5A 1V3KA 5ISZD 1CBVL 2F58L 2R0LL 2EYTA 1LK2A 3HMWH 3D2UB 1JZ6A 1JGUL 1U93B 5I16A 1E4KA 1CL7I 2VLMD 3OKEB 4L9DA 3QEUA 4K71B 5C0EA 1Q9KA 2EE2A 4LOUD 2H8PB 1BZQK 1FO0L 1SBSL 3P4NA 4LNRA 5D2NE 3HI5H 1WBZA 5EA0L 2XI9A 3MBEC 4M5ZH 5TE4L 5ACZB 5DJCB 5TQ0H 3Q6GH 1GGBH 3P0VL 4NC1E 1HYSD 4X6CE 5CAYB 4OFKA 3WEXB 4QHKI 3S37H 3VGDA 3QPQC 1C7TA 4L4VA 2ADGB 4MJ2A 3ARFD 1RIHL 2DJUA 1E4XH 2ESVB 2F53B 4W68A 5DMIH 5HD8D 4Z78A 4NM8L 3NCMA 4XRCB 4OBRA 5F1NB 4BYHA 2VDLL 1CXKA 4JN1H 1U8NB 4KROD 3NTCH 4ZO6A 3MJ9A 3E6FB 3RNQB 3HR5A 4JFYA 1UGNA 3GMRB 5CEZD 1LE5B 2MPAL 3CC5B 4P2QE 4XCEA 1FNEA 5KS9B 2PUQT 5J9PB 5BO1L 1IAIM 2IMNA 3RU8H 1FPTL 3RWIB 1B0GB 3T65A 2IADB 4IS6A 4LPVA 1YEDA 3L9RB 5EA0H 2CXGA 1U3HB 2NZ9C 1WAAE 5I8EB 5JA9A 3WUWA 3E6HA 1KIQB 3ROOA 3RTQD 3IB4A 4LAJH 3U36B 2VDOH 3QIWD 2CKBL 1A7BA 5C09E 5IVXA 2X44D 2MCPL 3RJQB 4X6DB 1PW3A 4JJ5A 5JZ7D 4ZODA 2DAVA 5MEQA 5E08L 5I1HL 2P8LB 3WDIA 5MENE 3LQAH 3ZL4H 5DD0H 5I1AA 3DUUB 2CGRL 4O2EA 5FV2A 4PRHB 4JZJC 5EO1B 1NFIA 4L5FH 4LIQH 3L7FA 3FO2B 1S9XA 1UB5A 3C6SA 3AU1A 3U7AA 3CC5A 5EU3B 5DD1H 3EHBC 2P5WB 4FXLA 3W39B 1FZOB 2ZCKH 3LSOA 3O4LA 3OHXB 5D7JB 5D4QA 4OZIA 3QAZC 2Q6WB 3O8XD 3QXAA 4P9MH 3AMKA 1XCQA 1ZHNA 3OKYA 4Z7VE 4I0PB 1A6WH 1I3UA 2R39A 4WW1B 5BV7B 1WAAF 1MFCL 2VISB 3O11A 3OJ2C 4HGWB 4JG1L 2EO1A 4MCYB 2HFGL 5DD3H 4M8QB 4ZPTB 4GG6E 4KI5D 3RDTC 4G9DB 1OTSC 1WZLA 4N8VG 4CMMB 1T3FA 1U8KB 4Q58C 5DJ0A 4GG8A 4GBXD 2Y7QA 3GBML 3UCRA 2BP3A 4AEEA 1XGYH 4U1SB 4Y1AD 4Z5RA 2HT4D 1INDH 3C8DA 4G6KH 7CGTA 3DI3B 4JM4L 1P2CB 1U8HB 5F9OL 2OYPA 1NMAH 2CR3A 2R1YB 4K3EL 5DZOA 5HHVL 4L4TE 2GYSA 4ODSH 4GRWH 1IQDB 2OL3A 4JKKA 3KNBB 5IT2L 5TH2A 3LB6D 4NYLB 4MAUL 3MCLH 1DLHA 3O81A 4RGMC 1NAMB 1PY9A 2VJXA 4U6XA 1WQVT 3HE7C 1TZIA 2DN7A 1A02N 1PEZA 1XIWD 1VACB 2CUMA 2QV2A 1IL1B 4YZFF 3QPXH 4G7VH 1RHFA 3SKNA 2O61A 4JCLA 3X17A 5BMFH 3SE8L 4JFDD 2BNRD 4APQA 1IL1A 2G60H 3IKKA 2PXYD 2H8PA 4QRRD 3CFDA 3WHXB 5T5NF 4Y1AA 1F3DH 2VR5A 4OM0H 2HRPL 2APFA 3QEUB 1UXWB 1BGXH 4BFBD 1GZQB 4YE4H 2AEQL 5EBGA 4EDXB 3HAEA 4FFVD 3GNML 3X13A 1TIUA 2Z8SA 1EHLL 4P2OD 2W65A 2EZ0C 4NRZA 4UQ2A 4UNTA 2R1YA 2BNQA 3PDGA 4UQ3A 4NQDA 5C0AB 4CMHB 4QRQA 5E99L 1QSFA 3KPSD 4PLJC 1CGTA 1YEIL 3FONB 4KJYA 1INEH 1C5BL 3LDBB 2QHLA 1AO7D 3TBYB 3QNZB 4Q9BA 3PNWB 1E27B 5B8CA 4M48L 4GAYB 4GAGH 2A77L 4K3DH 3UDWA 4IMLB 1TJIH 4LRIC 2X4RB 5TGBB 1PG7L 1A3RL 5CUSL 5D72L 1TZIB 1I3GH 5FAAA 2YBRA 3QQ4B 4CU7A 5DK3A 4HFUL 2Y5EA 3BN9C 3TYGL 3MR9B 1AH1A 4I77L 3LKQA 1Q9LA 4JGUA 3SBWA 3AS2A 5TQ2H 1XGUB 2JTDA 4RX4D 1I9IH 5JXAH 4G42A 3WIFB 2VITB 3RVUD 2L7UA 5B38A 1HXMB 3VG0L 3IDIA 4NHCH 1YMHA 4POZC 5C08E 2EC9T 5EBLB 1F11B 1DBAH 1GGBL 2WUBL 2CLVB 2UZXB 3FQTA 1S9VA 1UACH 2FX9H 3I02B 2BRRH 3QIUB 2VXTH 5IKCA 3VDCA 5C3LD 4ZNEE 5FO9A 5LGJA 5HYSG 3NFNB 1ZT4B 4PRAB 3LQMA 4HIIA 2DQHL 5J56B 3SJVD 4JN1L 1AP2B 4A2MA 2YKLH 1JZ5A 3PL6C 2NXYC 4YGVB 4FQXA 4R3SB 4L8SC 3RTQA 1U36A 2DQTH 3L3KA 1PY4A 3Q6FA 2NY2D 5T1KA 3RVXD 5FECB 3MUHL 4LSPL 2IG2H 4F7EB 1HCFX 1OAYL 5F93C 3E6HB 3ROOB 3MJGX 4MJIB 5DMIL 3WXVH 5D8JL 3C6SB 1U8IB 3BOVA 3MLTA 4JGMA 1FLTX 3MV9A 4ZAKC 1JGLH 1HKLL 2Q8AL 4Y2DC 4DGYH 5EB9A 5DT1L 2WUBH 4JY6B 3IFPB 1MFBL 3UPAA 1OW0A 4G8FB 1MVFA 2R9HC 5DTFB 1UWEL 5T1DH 3ARWA 1ZLVH 1VHPA 5H35B 3SE4A 5FUOL 2ZZUT 4P57B 3LV3B 5A2FA 4N0UA 2VH5L 2OI9B 4W4NA 3OB8A 4ENED 5I66B 2DQUH 2VSCA 3PHQB 4NBYB 4PRDB 3RHWF 1AO7B 2IPUG 4JFEE 3ZE1F 4OGXL 3GSWA 7FABL 4J4PA 5C0RL 2BFVL 4R26L 4P46C 1KLUA 5J1AA 1LEGA 5JPMB 3WFBH 3QNYB 4JANA 2AK4B 2D03L 1MCOL 4XP6H 4WFEE 3LRHA 3QO0B 5KW9L 5EU6A 1A2YA 1LD9A 1ZHBB 5I74C 2N7AA 4WU5B 2M26A 4QHLA 1U8NA 3MLWL 4DKAA 4C58B 3CLFL 3TFKD 1MJJB 2VITA 1LO5B 3MA7A 4U2ZA 5DJ2B 3SPVA 3T0AA 5GGSY 4PRPD 1T1WB 4PJXE 2AJZB 4LNVA 4LLQA 1BQHG 1LEKB 4D9QD 3WEXA 4NFDA 4Y1AB 5F96H 1KT2B 3OX8A 1RZJC 1TNMA 2P5ED 1VA9A 4XT1C 4WI2A 3GHEH 3JWDH 4HPYH 2HT2C 2FO4B 4R7NA 5D71H 2CK0L 4RWHA 1JZ8A 1HSAB 2NY1B 1FNSL 3UBXI 3B9KC 2VLJB 2EXYC 1G9ML 1BQHA 3JWOH 1R3JA 4Z9KB 1OAXH 1JHKL 3MGAA 5I15H 3DECA 5C08B 1KXQE 4Y4HC 4WDIA 1YYML 3QXDA 2DQCL 5BJTB 3D0VB 1WFUA 3MRKB 3NIDE 5HHME 3WJLA 5FA3A 3MA7B 1RFDL 1HYSC 2P5EB 4OFDA 1JI1A 2ZKHH 1W0YT 5DHVH 4MYWB 2F58H 2V2WB 4K3EH 4OZGA 1HSBB 1S5HA 3OGCA 1CU4H 4JKLA 5IROA 1JGDB 4PP1D 3ULUC 2WINA 4P2RB 4U1LA 4F57H 2FL5B 1F8TH 1RIUL 5E8PA 1PSKH 4G9DA 1NLDL 3PE9A 1PQZA 1JPTL 2BJMH 5AG9A 4WW2C 4AMKH 3MA9H 3R0NA 3RVWC 3DX8A 1QFUH 2OSLB 3KWWB 3FQRA 5TFSH 2AJVL 2VDLH 4ZUVB 5EZJB 5I66A 3A0OA 4XNYH 5IOPB 3UJIH 3AM8C 4EBQH 3KPSE 4P49A 3HC0B 3MV9D 4OF7A 3CVHH 1RVFH 5DFTA 1RUQL 2YPKA 3VG9C 4Z7VB 2CO6B 3ZYJA 2IANB 3X3GH 5E8NB 3JV4B 4RBPH 3WFEL 1A5FL 5F7MC 1EEZB 1R3IL 2EDJA 5DJXB 2XV6B 3ULUH 3OR6A 4TUOA 2XTJC 3HZVB 2VR4A 3HC3L 4N8VA 1MQKL 2Y07H 2AABH 5DUMH 1IAOA 5HYSB 3VFRB 4LVOB 2MCPH 4X7SH 5K9JH 2CUHA 4QY8A 3VRLF 5HDLA 4FQHB 1U95A 2EH7L 4Q6YA 5HHNA 4G6FB 3TVMC 1RHHA 1A6VL 1TFHA 4LCIL 3I9GH 5C07A 3B3IB 4HBCH 2QLVB 5DGRA 5DTFA 5KZCD 3RX5A 2W91A 5I19L 4GW4B 3BQUB 4HW6A 1U8OA 3Q0HA 3U46B 1KEGH 4G80A 1OP5H 3VDAA 1C5DB 4MA1B 4EI6A 2GT9B 2CUIA 3V8CA 4XHJD 1V3JA 1TTGA 4HUWB 1AXIB 1LO2H 5CZKA 5INCA 4C83A 4L8CA 3M1BA 1ZLSH 1XZ0B 1HWHB 1X7QB 5EIQA 1XEDA 4HIXH 2BSSB 2EYSB 3QQ3A 4KAQH 5DS8B 3CFBB 2E27L 3HCVB 3KPRD 1Z0MA 3OKOA 4YGVA 2BY2A 3RAJL 5H2BA 4ZXBC 4MVBC 1Z9LA 3ARBB 4HWZA 1KV3A 1YMMB 3DWTA 3GIVA 4ZPVA 1GGUA 4NQVB 1JRHH 2YBRB 5IG7A 4XPBL 1A4JB 1FAIL 1RZ7H 3PG2A 1QYGL 4M7ZC 4ODUA 5J3HC 3LEXA 4KRNA 1YNTA 5GS0D 3VXSA 5DFVC 4LSDA 5LAXA 4HFWA 3PGCA 3HFML 2YPLD 5CP3H 1OWWA 1JCKA 3VXNA 2EZ0D 3O41B 1AKJB 3GGWB 3NGBB 3W11C 5EIIA 4G8EA 5JQHC 4NCDA 4OT1H 3VD7A 3KR3L 2MHAB 2C3VA 2UUDK 5DEFB 4OIAA 3GI8H 4HKZA 2BVPA 5IB2B 4NKMB 4RZCB 5I30L 2I07B 4S2SB 5GS2D 4PJBF 3WFBL 2WIIB 5CJ5A 1MAML 5E7FA 3C60A 5MEND 1EXUB 5MEPB 5HXMA 1BQHB 1TJHL 2R2HB 5C0BB 2DLHA 2DI9A 2YPLB 4UDTB 5GS0L 4XXDA 4RMQA 3BEWB 4YR6B 4RFNC 3QI9A 4R96B 1I1AB 4M61A 2QBWA 1ZANL 3VFSA 3BZFA 3D39D 4UIKH 4JRYB 3BP7B 4F7MB 1X3DA 5HVFB 3QWOA 3DSFH 2PR4H 4YO0B 3LRSA 2WV3A 4JCMA 5I1EL 4OZFH 3HB3D 4EDWH 3RL2B 4NCC1 3FO9A 3GI9H 2KZ1B 2C3VB 1OAZL 3QWOB 2VOTA 2J2ZA 5C0BD 3U82B 4GQ9H 5EBWB 5D2NB 4IRSB 3MRIA 4S11A 4PJAE 4KKCC 5F3BA 4LOUC 4TVPE 1URLA 1PKQE 3T0XA 2CLRA 1FLRH 4RQQA 3B6SB 3BMVA 1A14H 5FYKH 4LDEB 1P4BL 1PLGL 4Z7WF 2VE6A 5DZLA 1F4XL 3ARGC 4GSDL 1H5BA 1G84A 4P5TD 1CQYA 2C1OB 4HF5L 4K23H 1FHGA 4LDLB 2VLLB 5DJZA 4LPTA 1OAKL 4M7JL 1ZVYA 1GH7A 4YFLF 4NKQB 4MD0A 3ZTJH 4Z7QF 5FM4A 2AAVA 4LK4A 3ZDZF 3DO3A 3NFSH 3QUXC 4ODXB 1OL0A 3GO1L 4HWUA 3N1PC 3DLQR 1X5AA 4HS3A 1ZHBA 1KN2L 1IGTB 5F7WC 5J6HA 2Y7QB 4E5XB 1RZIB 1I7RA 1JNHB 3KS0J 3E2HC 5EU5A 4Y5XA 3VXSB 5I76A 2NY2C 3RVXC 1QD0A 4O02L 3W5MA 2NR6D 4LARL 1S78C 1PKOA 4S0SD 5GGQH 2YEZA 5EUKB 4GW4A 2H2SC 2DKUA 2CMRH 2FHBA 3TH2T 1I8IB 1D5BB 5DZNA 3SKOB 4JRXA 1JTTA 4ZFFB 3LOWA 4FZEH 4I0PD 4GG6A 3EOBA 2YMXL 4OCYH 4KDWA 1A1OB 4FQXB 1U91A 2AJSH 1FZOA 5F7DB 3P30L 4X8JA 4MJ4A 3EJZD 5CEZL 5KSBE 3VA6A 3PIQA 1X6NA 5IMOB 4PJGA 1DANU 5GZOD 5I0DA 3L5WA 1KTDB 1T1ZB 3P11L 2NZIA 5J11B 4F7TB 1XMWA 1W72L 4RA0C 2MFNA 1KN2H 1ZXQA 5FYJU 5DMGC 3MV7A 5J6HB 3D39B 4YE4L 1XF4A 3TBTB 1CDJA 5GRYA 4V2BA 5K93A 4CNIB 3C60D 1JGUH 3HNVH 1JN6A 4HF5H 5A40E 1MWAB 3KPQA 5C0IA 1V7MH 4LLDA 1IFHH 3RGHA 5FHAL 1XF5B 2F53A 4NC0B 3QI9C 4MCZA 4FXGB 4ZOCA 4H1LA 4I3SH 4JY5L 3V5HB 4PY8I 5HHMB 4YWGH 3BXNB 1NLBH 3PWPD 3U30C 5FEBA 3WD5H 2NTSP 5BVJA 3FB7B 3K2UH 4HG4K 3WFHA 2M8XA 5LJYH 2X4RA 2HJLB 4RX4A 8FABB 2ADJA 1BFVL 5AEAA 5C0GA 3QA3A 1E6OL 1ND0B 2CDFA 3K8MA 4NQDE 5JIPA 4NQCA 1OT1A 3HNSL 4HUUA 2JB5H 4PRID 2BERA 4W6WB 5B38B 4LASH 3N06B 1FNHA 3RZCC 4RFOH 5AYUH 4M7LL 1RK0A 1MLBB 5C8JB 5J6GA 1LMKA 3OAUH 3ILQD 3QFJE 1K3ZA 4HT1L 2OSLA 2VUOA 3CFDB 2D31A 5FHBL 3VJ6A 5E1AB 1UM6H 3H9YA 1HQRB 4ODHL 4Y4FA 1WV7T 1XIWA 4BQ8A 3IRPX 3BP6A 3O3AA 3MUY1 2F8OA 3KLSA 3ZLQC 3IU3A 3E8UH 3MRMA 2O5ZL 1R3LB 1HQRA 4P9HC 5TDPB 2W0PA 43CAB 4BUGA 1KCVH 1QSFB 5EOCH 1QR4A 5KSVA 4O2FA 3BWUC 1N26A 1QG3A 3NIGE 4MXWL 5DD1L 1T5XA 3MRNA 1CI5A 3IAQA 3VWKC 1IQDA 2OL3B 2DLTA 3H3PH 3DXAD 4HIJB 4I9WD 1Z3GH 2C4FU 4O2FB 3U4BH 4WDIB 3C09B 2H9GA 1NKRA 1WIOA 3CFJB 2HJFA 2QR0B 1ZHKA 3IDXL 4Z95L 3Q5YA 4EUPG 1PKQB 3HZYB 5KSAD 5EU6B 5DWUH 3CXHK 4O51A 2DMKA 2O61B 5BS0A 3WSQH 4E41A 2RIKA 5JHLL 5HYJE 4OLVL 3RBSA 3GJFK 3EYUL 3OXRA 1OQOA 3GI9L 3QEQB 4D9LH 1EEYB 2DQTL 1DQQB 4MNQA 5EOTA 1PZUB 3S5LA 5I1GH 1MHCB 4KI5E 4FFYL 1HEZA 2EECA 4BH7B 3TV3L 5DK2A 5E5RB 5HI4C 2VN7A 3G08B 1OSZB 4M03A 3PWVA 4NBXB 4DOHB 3QIBB 1R3IH 3SCMB 1JHLL 1CFTA 3RVUC 3V0WH 2DWEA 3S3JA 3OKLA 1IAII 4PLKD 1MHHB 2VAAA 3MLUL 3ZMRA 1U58A 3QIWA 4YGAB 3WV0A 5F6HI 1FL6A 2KDGA 3ZDYE 4F7PA 3P0YL 2AK4A 4QRPD 4AEHH 5L2KE 3CFCH 5IBUB 2Y06H 4GRWF 2A6IB 1J1OH 3DX9B 3ARBA 4KUCD 1JFQL 4HGWA 5EC2A 1KYOJ 3QZWB 3QIBD 4OUUB 1AGDB 4KGJA 4OJFH 4G8IA 5E2UL 4JKPL 1KF9B 4M6NH 5CINL 5DD5H 2ZJSL 3AREC 4ONFL 2XA8H 1FPTH 1BVKA 2L7JA 4BZ1H 1B0WA 4LSRL 1P7QB 1R5VB 3BVNA 5EPMB 1N2RB 1OM3H 2X4SB 4RDQG 1A3LH 1GC1L 1T5WA 1W72B 4UV4H 1F02I 4JFOA 5ACLA 4Y88A 3BE1L 4U33A 3QP3A 3INUH 5I1AB 3QIUA 1BM3L 4XNQA 3OG6B 1IJ9A 3KHQA 3C5ZA 1VFAA 4W4OA 5DJ8B 2ITCA 3P4LA 4O2CB 2ICWB 4LKXA 1QLFB 2IFGA 2PO6B 1RAMA 2YPKB 1X4ZA 4GG6B 4Y16B 1YDPB 4HCRH 5LQBL 4F3FB 5IEHA 2NY0B 3C8KB 3GHEL 3H9SE 5GPRA 3MQIA 5CSBA 2X89D 1K6QL 5CHNA 5DQJB 3QDME 1NLDH 1CLZL 4N0CD 5H94A 3MNVB 5EU5B 1A7QH 5BS0B 3VFMB 3L3IA 3VXTB 2ADIB 1F58L 4HWBH 5JW5A 2R0WL 1RZGA 4GW5A 5SWZA 1WICA 2EE6A 2X7LB 2ZUXA 2PW1B 1Y18A 2ZG1A 3GHBL 4NUGH 5DRZA 4LL9A 4CRPA 3GSXA 3H3BC 3MBXL 4YBHA 3BPCB 4JLRA 3MV7D 1E6JH 3OKKB 1YN6B 3AS0A 1VGKB 5I1KL 1FSKC 2FLRT 1K4CB 3P40A 4PGCA 5BMFL 2KPNA 1N5AA 4ZXBA 5FGCE 5IB3A 4X0KA 4TVPD 4M7LT 4BA8A 2CR6A 1IGCL 2DBJA 4PJGF 4JFPB 4KVNL 4YNYB 5HGHB 3F58L 1F3DJ 4XGZA 1B2WL 3MV01 5CJQL 3KDMA 5JDSB 3TT1L 4DZBA 1OGAA 4Y8DC 3TWCL 1YPZE 1FC2D 1WWAX 2OTWA 4U3XA 4TSAL 4M1CD 1HSBA 4M1GH 3DPBA 4JFZL 2EH8L 3B5HA 3BH8A 3PV7A 2GQHA 4ZMAT 4LRNH 4N1HB 2GHWB 1LP9F 3OXSA 2HMIC 4L4VE 1DP0A 1MRCL 1OPGL 4G9FA 2ORBH 2VWEC 4MSWB 1GZQA 5ISZB 4K9EL 1GOHA 2IH3B 2ICCA 1V7NH 3C2AL 1QOKA 1EGJA 5TDPA 3UAJD 5ADOH 2JJTA 4PJAF 4PJHF 5GRZA 15C8H 1TXKA 2CK2A 4LVEA 2HJLA 8FABA 2G9HA 3HI5L 4YHPB 1LEGB 3T1WA 2R2HA 3PUCA 4P23A 2LTQC 4KVNH 3EYFA 4O9HH 2CDEA 1CE1L 2A6JA 4OM1H 4X6EA 4NYLA 4WI4A 2VH5H 4KI1A 4XX1G 5DUBA 4XB8A 2XN9B 4RZCA 2D0HA 5DDHA 3PWJA 2BNUB 4OCWL 1JNLH 4G7YL 2FX9L 1N7MH 4GRLB 5IMMA 1UKQA 3PDOB 1RY7B 1LO0H 4WY7L 4YDKL 1LP9E 4R90L 3L3IB 1QVOB 5T33H 1E4WL 2OZ4H 3HPJA 3IS0X 5F96L 1UWGL 4JFOB 1OTUD 1RU9H 3KPMB 1RJZB 3OJVC 4L3AA 5JXEA 4N0RA 1HE7A 2LU7A 1EFXD 1AQKH 2WWMC 1CGYA 3QUMH 3H9SB 4NM8H 4X99B 5F89B 1ZOXA 3L7EA 1H15B 3Q3GB 3ZYIA 3TBWB 2ATKA 4JFDB 1CDYA 1DBJL 2NTFA 4X5XB 3S4SB 4GMSL 5JHDD 3VD5A 1FJ1A 2WSKA 4NQEA 2PTUA 2X4PA 4WUUA 4DGIL 1JGLL 3W39A 1VFAB 4OZIF 4QRUB 4KKBD 1VENA 4FZEL 3DIFA 5CIPB 1FRGL 1NBZA 5CGYC 4LQFL 3C6LD 1EFXB 3T65B 4A6YH 5J9PA 4G3YH 4PJGB 4CU8A 3SQOL 4ZO8A 1UCBL 2V17H 4XP9H 5MEOB 3EHBD 4FFZL 1NGXB 1HNGA 3MJ7B 4NC1C 3BX7C 2I25N 4EUPH 2Z91A 2H3NB 3VRIB 4FS0A 4MWFA 1JPTH 2BJML 2GSIA 5GS3A 2VZVA 5CS7A 3ROLA 1S5IH 2IAMB 2GK0B 4OLWH 3RWFB 3BGFB 3WIIH 2BNRE 3TJHD 4C4KT 4UIMA 5EZLA 3L7EB 1UXSA 3ZKXC 1A7OL 1CFNB 4Y4FC 3WS6A 5EO9B 1H8NA 2B4CH 3FRPG 3IJYB 1NC2D 3VWJD 4OD3L 1SYVA 1UT9A 4X6DE 2HVJB 4Z76B 2FZ3A 2AJVH 3I3BA 2ZSWA 1I9JH 1DVFB 5JNYB 3NZ8B 5GJTH 3IJSA 2A6DB 4KMQA 3ZYOA 3CFJA 2P5WD 2BY3A 1S5HB 3GMPB 4QO1A 2VDRH 5C0EB 3LMJH 3INUL 3WLBA 5I1IL 3EGSA 5HYQB 3GBMH 1N0XH 4BQCA 5B4MD 2A1WL 3DV4A 1CFBA 2GSGB 5DMGD 3MRCA 1LO4H 5TDOB 4TTGA 3VRJA 3QDMD 3G5ZB 4G7VL 1DCLA 3MCG1 3ARDD 3MGTB 3QFDB 3QEHB 1BBDH 2H26A 3PJSB 2R0ZH 1FFNA 1OGTA 3B4NA 1D5MB 4KKBC 1YECH 5IFAH 1MEXL 1ZE3C 4CVWA 1J1XH 3C6LC 3O9WA 2EDFA 3GNMH 5E1AA 3FONA 4KJYB 3GM8A 3MRIB 5J4MA 1BOGB 4RCAA 3SKUD 5IT2H 3QO1A 4HCRA 1B2WH 1F6FB 1U0QA 3W0WA 1FFQA 2ZPKL 3I50H 4NN7B 5ESVB 1ZSDB 3VFUB 3FB5A 5IB2A 1I3GL 1P7QD 1AI1H 2VLRE 5GS1C 1CGSL 4MXWH 3N85H 1BX2A 1MSPA 2X05A 3FAWA 2DYPB 1E6JL 1UVQA 2DQDL 2CDFB 3T1FA 1NGQL 5L88L 3U83A 1YEIH 1T3FB 4QRPA 4JFPA 1UJ3B 4DAGH 3T77A 4Q74A 4RGOL 4YHLH 1MHEB 4JDZA 4M93C 4NNPH 4PRNB 4QNPE 5ICYA 3F6IA 1S7TA 3UBXG 1EHLH 3EFFB 3KLAB 5JIIA 2VLJE 4BZ2L 4DGVL 4JE4B 4MCZB 3TT1H 4XNMB 3BUTA 5EORL 5I75C 5GJSL 2B1AH 1KIRA 4LCUB 2AI0H 2P1YA 3BDXA 4OV5A 4CN4A 3RWJA 5IQ9B 4TSCH 3MV7E 4L3ED 5DJ8A 3H42L 5HPOA 4L8CB 4H26A 4LCCC 5DR5H 1FYHB 2HFTA 1FIGH 1FC1A 4NOBA 3VGGA 1JWMA 2NY5H 4UILL 1BD2E 3ZTNL 4OZHE 1YNLL 3A6BH 5SX4H 4K94H 4Y5VC 4ODSL 3MBEA 4PB0H 3C5ZD 2Z92B 5IIEA 4N5UA 1QHOA 1WGOA 2DF3A 4J8RA 5EWIL 1OTTC 2C1PB 5K9QG 4IHOA 2DTSA 1JYNA 1BEYL 2VDNH 4LHUB 3SE3A 4FQHA 1KG0A 2OTUB 3H9SD 1BHGA 1HZHH 2FB4L 3AY4C 1IGJB 2Z91B 3Q3GA 4L3EA 4IOIA 3OAZK 4EI5D 4JKPH 4FRWA 2V17L 4XP9L 4LSPH 3ZDZE 4L8DA 3V4VL 5GS1B 4JFEA 3VA2C 1KB9J 2A9ML 2IBGA 1VDGA 1QRKA 1RZIA 5GZNC 4FG6C 3LEYL 4JFHE 3RX7A 4J7RA 3LKPB 3PP3H 4P0DA 3BKML 1ZA6B 4DKEL 3E6FA 5L0QC 2EIZA 4XC3H 1C5CH 3NCEB 2ED9A 4B7LA 2B0SL 4TPRL 1K6QH 1XIWC 1K4DA 5DA0B 2MCG1 1INEL 1C5BH 1EV2E 4JKWA 3SKOA 2I26N 1RJYA 3AVEA 3AC0A 1U8PA 3GSQB 4N5ED 4HCRL 4GMSH 4OFPA 3IJHA 1NCBL 2O26U 5TQ0L 5SV4A 4HS6A 4IS6B 4OFVA 4HBCL 5FK9A 5IK3A 2JIXA 2DIJA 4LF3A 4K2UH 5KVDH 4ZQKA 3X12A 5TE6L 4XPTL 2WLYA 4TQEH 3F7RA 4XNZC 2EE9A 1QBLL 5DVMA 1YMHB 1M7IA 3OGOE 2NQCA 1QRNA 3GIZH 4CKVX 1HI6A 4NO0D 1U2CA 3B83A 4I48A 2V7HB 4PRIA 1MCCA 4P4KD 3GMLB 5JR1H 3MRPB 4PJXB 4OIIH 1QO3B 4JO2L 5CJXC 2FWOA 3EYFB 1T1YA 3DBXB 3TYFA 4MNQE 4P23B 5HDQH 3O9WB 4PJEB 2FH8A 3SOBH 5ID1B 2CJUH 4DOHE 4D9LL 1DBKL 2P44B 3VFWB 3B6SA 4HLJA 1WBZB 1HH9A 2FNBA 1G7IA 4HXAH 4YXLL 1VGEH 1Q94B 3WHE1 2P8MB 1BVZA 2CIIA 4Q2ZA 2FJHA 1U93A 1IEAA 1T1WA 4HZLA 3VXOB 4AMKL 1NCTA 5ANMB 4EDXA 4BFIB 1ZLVK 1OARH 4YO0A 1PZ5B 4L4TB 1CK0L 1HI6B 5E4EB 3GSUB 3BHBB 4XWGH 3VXTA 4FA8A 5SWSD 4HFWB 1G0DA 5HYJB 3WS3B 1BFOA 1K5NB 1AR1D 4PJ7F 4UT9L 3PQYE 2V5RA 1RZKH 3EJYD 3BIBX 3DBXA 4OZFA 4X4MA 3C08L 4QRRA 3SOBL 3SDXE 1WC7A 3I85A 4HAGA 4GKNA 2E7HA 1VFOA 1TMCB 5C0AD 1T6VN 5IEHB 1FL5B 2Z93A 5E2WL 4LLAA 3W5NA 1QUNA 4X6FA 3KLHC 4LBEB 2PYEB 5KSUB 3QXAB 3NCJL 3QSKB 1Q38A 3NABH 1VEMA 4K55A 1X7QA 2ZPKH 3KS0H 1C1EL 3TESA 1GOGA 4CDHA 3NIGF 2L0DA 3GMOB 2Z8WC 1MF2H 5E8DL 4P5TA 1BAFH 2ADIA 5JW5B 4JG0H 5DEZA 5EO0A 3S97C 3X12B 4UU9A 2JIXB 2OR8A 1X5ZA 5HDOA 1KTDA 1T1ZA 1XGTA 2LQRA 3IT8D 4NM4H 2VXQL 1YEFH 4QTHA 3PHSA 2QKIA 1JWSB 3ULVL 4C4KO 5BOPA 3VI4E 4DGIH 4Y0GA 1QACA 3T2PA 4K94L 2AGJL 1F5WA 3QISA 3ARRA 4X7DC 1UKTA 4LU5H 3M17A 2NY4B 5BZWA 3B2VH 4L1HA 1N3NB 2GEEA 12E8L 1AGEB 1MCNA 3C5ZB 5ICXA 1MELA 2DWDA 4R7DA 2XNAB 2HWZH 3DI2B 5EO1A 1SYSA 1JP5A 3ISWA 5ENWA 3RWIA 3EAKA 4Y5YB 4J3VA 1Y0LB 4JRXD 5IMOA 3UX9B 1FL6B 4R7DB 4TUKL 3SGEH 4Q9RH 3VXSE 4KUZH 3PXJA 4X98B 3SJVA 3O6KH 4CVUA 4UDUB 3TA3B 4X80H 5INDB 2R4RL 3CK0H 4N68A 2DLIA 1XT5A 5F6HJ 9CGTA 4YDVA 3ECBB 3B9KB 3E0GA 5TDNB 3RWDB 3QZWG 2ESVD 5IVXB 2M1KA 2B2XL 2BX5A 2EYRA 5L9DL 1QQDB 5GHWH 5C1MB 1MVUB 2C26A 1NGPH 1WUNT 4NO5B 2W0LA 4XPTH 2YK1L 3T0WA 3WIHL 3OR6B 4TUOB 4M3KB 3B2VL 1BFOB 4F7PB 4DK6A 1HILB 2E9JA 1S7RB 1X5KA 3OQ3B 1NMBH 2DQIH 4F58H 5D1ZC 5DFWH 3MFFA 2Y06L 1L7TL 5FIEA 3TM6A 3U1SH 2J5LC 3P4NB 2HN7B 2DBLL 5FM5M 2V2WA 2H6PB 2YD5A 4JB9L 4ODVL 2Z8VC 3KYAA 1OQXA 3ABZA 2GUOB 3GJFA 2YD6A 3D18B 3V95A 2YD9A 4ZD3H 4OLXL 4I3GA 2ZNXA 4Q6IC 3X3GL 5ITFA 4DN3H 4YDLB 1XR9A 3G5VB 3UZEA 4L29A 4I18C 1B4JL 1TPXC 4FTVE 1HH9B 3HUJF 2VL5B 3HNSH 3LIZL 3OJDA 1JF1B 4PJAA 4DZ8B 2YA1A 1K5NA 4U6YB 3FQNA 1IGYB 3VXME 1ZTXL 2LE9A 5IB1B 3C2SA 5EOCJ 4XCCH 4U6VH 5ETUB 1OGTB 4XPAL 3ULVF 1CQKA 1TQCC 3L5JA 2PO6C 4XTRD 1CDCA 4WV1A 5F3BB 5C0CD 3WJLC 1N5AB 2E6PA 2AK4E 3EO0B 3ARZA 3ULUD 2FWOB 4PG9B 5F8RC 1NUNB 1LP9A 3ZTJG 4E41D 5TH2B 3C6LA 4GSDH 5B22A 1H3TA 4PYHA 5D7LD 4GBXA 1DANT 4FN0A 3BPCA 1JZ3A 4M43L 5DEFA 2NLJB 4JFFA 1A5FH 5IJVB 3VH8A 1D5IL 3H6JA 3I50L 5GRJL 3Q5TA 1FNAA 1G7IB 2HFEA 5F6IB 1BZ9A 1GIGL 2F8VA 1IM3A 5E94A 5ESQA 3TIEB 5D1QA 4MHHI 1RZKL 1LD9B 1V5JA 3KPRE 5EUOE 3W2DH 1ACYL 4YDJA 3O45A 3EYSH 1X4XA 5E00B 5I1GL 3HI6H 5H94B 4WTXA 4UV7H 4XZUA 1A6ZA 3DXAA 3KJ6L 4A6YB 2QJDA 2WBJB 1IAIL 2XN9E 3MLVL 5FO7A 1LEKA 2AK4D 4KJPC 2QQNH 3QQNA 4LCWB 4U1JA 5IP4A 3QCTL 3T0ED 4KV5F 3ULSA 2CDGB 5KSBF 3G6JE 4HKZB 1VGEL 4LKCA 4HULB 4Z7OE 2YPLE 1ADQL 5AUMA 1MJUL 2FIKB 4NN6B 1D9KA 2MMXA 2A73B 3V0VB 3CU7A 4GW1A 3RIAF 3QJHB 3QUYB 3K4DA 4MGXA 2CD0A 4K7PH 2F74B 3E3QE 4JQIH 4WNQB 4XMPH 1EBPA 5HSFA 3LKPA 3GSOA 4ZAKD 3GMQB 1GCFA 1RJLA 1XCTA 1Y0LA 5B3JF 4XP1L 1AIFB 2JJUA 5D96C 4FP8L 4EI5B 6FABH 4PBWD 3VXRE 3MLWH 3S36L 1F4AA 4OT1L 5GGRA 4IRZH 1AO7A 5CIPA 1YMMA 2PN5A 1MOEA 4FQ2L 5ICXB 4AQOA 3L3OB 4QRUA 2DD8L 4OKVB 1MIEH 5E2VL 4IJ3B 5DD5L 1G7LB 2AKRA 4UI2A 4NSKB 1F6AB 5T5FL 4RAVB 1IGFL 3O4OC 4HDIB 2F5BH 2BVQA 2BSSA 2EYSA 4OZIB 3LZFH 4QY8B 2FATL 5KG9B 4QHKJ 3GKZA 3KPSB 2O93L 5CLTA 3UO1L 2J8HA 4LLMB 4ZAKA 4ZUSB 1NC2B 1NEZG 3VWJB 1MREL 5LGJB 1A1NB 3IXTB 3JV5A 5T3ZD 2XZZA 1KB5A 5JMRA 4UU9B 2VDOL 1P7QA 3EZJB 4Q6IA 3K1KC 4H26B 3TCLB 4PUBH 3MROA 4ZUTB 4PY8J 5GGSA 5BZWB 2YN3A 3B3IA 3REWA 1NGWA 1CXLA 3D9AH 2YN5A 1F13A 3VXPB 5B4MC 5CEZH 4GQ9L 1GGTA 3BKMH 4LPCA 4JRXB 1MLCA 1M6OA 5IIEB 2ESVA 4JVPA 2PCPB 5JW4R 1PFCA 4MMZC 3VI3E 3M07A 1L0QA 1U92A 3WKNA 4HV8B 5FHAH 4JRYD 3MJ8B 1P4LB 1WCBA 3SCMD 1V8HA 3O6FC 3MA9L 4CVXB 1QSEB 1ZHLB 5C9JA 5F6IC 5T3ZL 5BQ7B 3BW9B 4MB3A 4PJ7A 4MB5A 3V4UH 2WINB 4XP5H 4AIXA 1UWGH 1RUAH 4JFFD 4F9LC 2MSPA 2BHYA 3RNKA 1X5YA 1VADA 5D2NA 4ODXA 4F2MB 4IRSC 5HI5C 3MXWH 3PABB 5E8OB 4KTYA 1AGBA 1G9EA 4K8RD 2R4SL 4D0BA 2XZCH 5I17A 1MIEL 1RSFA 3DUSB 1WSST 5FOBB 3HE6B 2YR3A 5FCUL 3KXFB 1G6VK 4KU1A 2BSTB 3B9VA 4QOKB 4DWHA 4DKFH 1NUFA 5HHMD 4JPKH 5DR5L 4NKOA 4Z7VF 1WITA 3ARXA 4NKDA 3WN5A 2O5ZH 4PRBB 3TZVB 1QNZL 2XQBH 1I1AC 3H8NA 2P48B 2JJSC 3SDCC 3H7LA 1O7VA 1YY8B 4QXUH 1S8DA 2W60B 5B8CB 3IDJB 4OM0L 2UZIL 4IOSD 5SWZD 3RWEA 3O8XB 4LQFH 4D9RE 4YQXH 4PRBA 3TZVA 5ESAB 5BS0E 2WQRA 1H9VA 3BH9A 3UEZA 3NZHH 3S36X 1EPFA 1HHJB 5E99H 3RIAK 4POYA 2ADFL 3UJJL 5A3ID 2GSGA 4ZS6C 4MD4B 5E03A 5MI0B 3W2DL 3ZSTA 1OCWL 4NN5B 5C3TA 2H1PH 4MLIA 4DVBA 1M7DB 3PWUB 1YNKL 1ZGLB 2ARWA 3VXNB 3HMXH 4WUKL 5KVEL 1JF6A 4GW5B 3A6CL 3QCVH 5SWZB 2HT3D 4DN3L 4TSAH 1DBMH 4WUUE 3JV6A 4LCCA 2ADJB 1I1YA 3QUXD 4I77H 3QJFB 4XVSL 3FFCA 5TPWL 3QFJB 4UINL 4D0CA 3BUYB 3OKMB 3QEQE 2JJTC 1S7UB 3HR6A 4KVCH 2OZ4A 1Z3GL 3DURA 2K9UA 5KW9H 1DLHB 2DMCA 4R4ND 4LEOA 2XWJA 4G9FD 2UY7A 4MD5B 5I8KH 2AXGA 4BK4A 1F90L 1O7SA 1PDKA 5E7BA 1Y6MR 5FKPB 1J9CT 3SO5A 3BISA 2E5EA 3BKJL 4F9PA 5MERA 4MNQD 2IPUK 1M05B 3RWCA 5CILH 2BY1A 3MV7B 5FYJD 2COQA 5I1DA 4V1DD 3BW9A 1C16A 1FG2B 2X1OA 1P7HL 4CVXA 5H37G 1J86A 3WJJA 4OB5L 3ALPA 4WI8A 3TH4T 32C2B 5KOMC 3BVNB 3P9LB 1QBAA 1FYTD 3QUYD 4RRPG 3UROR 1KLGA 3QEQD 5FB8A 4FXGA 4L9LC 3SDAC 4DGYL 4LPYA 2BVUA 4X6DA 4YBLB 3CSYA 3WN5C 1I8KA 4LSSL 1LDPL 1DLFL 1JFQH 1CVRA 5EZOH 5FUCC 2F19H 3S4SA 3CFEB 3F5WB 3UTZA 4KKAD 2X9YA 5D5MF 2HWZL 3MRQB 1I8IA 2WBWB 3QRFM 4RGNE 1KJMA 3P9MB 3P77A 3BE1H 4FTVB 1A6WL 4PV9A 2R15A 1Z2KA 4N8VB 1WT5A 4I4WA 1AIFA 4EI5A 4OTXL 3DYPA 3L5WB 4AENB 1KJVB 4YWGL 1C16B 1FG2A 4KZEL 3U2SB 4PJFE 1T66C 1FFPB 4OCLC 3M8OL 2Q8AH 4WTZA 1Q1JL 2IALB 4P3CL 5JW3H 1GHFL 3WXVL 4N9GA 3VI3F 3BO8A 4YPGB 2X2YA 1KXTB 5FM5O 4JPWL 3WL9B 1HN1A 5KS9F 5CBAB 1P9MA 3TJEH 1S3KH 3WNKA 1S7TB 3UYRH 3KPMA 1GAFH 1HQ4B 2OL3L 1F2QA 1XCTB 1L6XA 3FN0H 5DQ9B 2WWKT 1BP3B 2X1PA 3V5KB 2VLKA 4S1QH 4HJJL 1T0PB 2DWEB 2J5LB 2YUWA 4G5ZL 4HK0B 4TRPH 5F97E 4QWWD 1T0NA 2DS4A 5ICZA 4QRPE 4PLOB 1IMHC 1G7QB 1LVEA 3D39E 1FNLA 4PB0L 4X6CA 1S7XA 2GAZB 4BUHA 2J8UB 1MH5A 5C0CA 1EVUA 2DQEH 2XQYG 5C0DA 1CL7H 3GK8H 1DL7H 4MNQB 2IANE 4QGTA 3QUZC 3PWPA 3PWLA 4QYOA 4XZUB 4PRPE 5ESAA 4MJ5A 4APQB 5HVWA 1CG9A 3O9WC 1ZGLM 4X4YA 1I7ZA 3UYOD 3MV11 1HH6A 2P8PB 1F2XK 4U4BA 4YFEA 1M7DA 4MAYB 3PV6B 4F57L 2UZIH 1MAMH 1TZGH 4TOYL 4KKLC 1FSKB 3CPLB 3GEWB 4JJHA 3OKKA 2R0KH 4OFYD 1VPOH 4PTTB 4CUCA 5I17B 5I8OL 3MRPA 4Y5YC 4EN3C 1T5XB 3QXDB 1AGBB 1A4KA 1BIIA 4ZOBA 2EDTA 5ALBL 2FRGP 1D9KD 1T0NB 3IXAB 4Z5RB 3BQUC 2RBLA 4NQCB 4ZOEA 5CEYB 5JNYA 1CN4A 3CXDL 1ADQH 4YUEL 2YD1A 3QO0A 2W60A 3DHMA 5CGTA 1OF2A 2D3VA 2DQFB 1DBBL 1ZHLA 2VDKL 5MENA