3KAAA

Structure of tim-3 in complex with phosphatidylserine
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
107
structure length
107
Chain Sequence
GYKVEVGKNAYLPCSYTLPTSGTLVPMCWGKGFCPWSQCTNELLRTDERNVTYQKSSRYQLKGDLNKGDVSLIIKNVTLDDHGTYCCRIQFPGLMNDKKLELKLDIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Hepatitis A virus cellular receptor 2
publication title T cell/transmembrane, Ig, and mucin-3 allelic variants differentially recognize phosphatidylserine and mediate phagocytosis of apoptotic cells.
pubmed doi rcsb
source organism Mus musculus
total genus 16
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3kaaA00
1F8TL 3O2DA 3MA7B 1QYGL 3D48R 4KUZL 4PS4L 3VWJA 1LO5A 5CAYB 5L2KA 1I1FA 4PRAA 2ED8A 5MEOB 4YDJA 1NAKH 1CTOA 4J1UB 4LPWA 4XTRC 25C8H 1QZ1A 4RA0C 3SDXB 2OMNA 4X6FA 1LP9F 3ARDA 1QBMH 1ZHLB 4Y5XB 4PD4K 5DF0A 3FFCE 4HZAA 4HD9A 3RKDD 3RVTC 4CMHC 1TVHB 3HAEA 3OKLB 5D2LF 2X7LB 1BZ9A 1SVCP 3B8YA 3NCYP 4DKFH 3BHBB 1U2HA 1XGPA 4JRYD 1JPGA 4PRDB 4IM8A 4UNTA 1NAMB 3D39D 2OR8A 1JRHI 2CJUL 1Z6JT 2EIZA 2W9EH 4HUUB 3O4LE 4TSCL 2V7HB 4NN7C 4NKQB 1A9EB 1F02I 1KLUB 4RNRB 4JRYB 1T0MB 2JIXD 3HE7D 4N0RA 5ACMA 3SDCC 4WWKC 3MV8A 2GK0A 1WZ1L 2CLRA 3GMQA 3HRPA 3WUWA 5GS1C 5FXCH 5DT1L 1X5ZA 1G7LB 3K1KC 2DBJA 5C6PB 3HE7B 1ZVSB 5JDSB 5IVXB 1YNTA 1DSFH 4RZCA 3U0TB 1CLZL 3W9DA 4P46B 4K07A 3OJVC 5AG8A 2PCPA 4GBXC 1LEKA 1ZT7B 3GSNL 3NZ8B 4FQJL 3HPJA 1T7ZA 1XIWD 3MRLA 3H9SE 2NNAB 2FEDD 2ERJB 1N4XL 3WKML 1INDL 3UTPE 5I1HH 3QR2A 3OAYK 1YECL 1OAUL 4Q6IC 1FL5B 1XIWB 2ITDB 4Y4HD 3BIAX 4H26B 1DVFA 4JFQA 1QRNA 3DXAA 3WJLA 4HGWB 2BFVL 4XC1L 1CDIA 2CIIB 3HC4H 3Q6GL 4KJYB 3T04D 3DVGB 4NKOB 2QJDA 3UZQA 2VERN 5HYQA 3SE8L 4I3RL 2FHBA 3EYUH 5E4EC 5DGRA 3LRHA 2EKSB 4QWWC 1OCWL 2E3VA 5H94A 5SWQB 2F15A 1F11A 3TM6A 1DQLL 4ORGA 5C0CD 4X6DA 1A47A 5E8DH 1IRAY 3W0WA 5E6YA 2HN7B 3O3DA 4KVCL 4S1SL 3KYMA 4P57B 5GISH 1K4CA 4PJAA 5DK2B 4LSDA 3G5XB 1P7QD 1A7QH 3BZ4A 4N8CL 2OBGA 3WFHA 1F3JA 3SCMD 3ZT7A 1MCOL 1P4IL 2MMXA 1KB9K 4KJQD 4NQDD 5BRZE 1N7MH 5CKGA 5ALBL 2C4FT 1C08A 3SCMB 1I1AA 1JGUL 2J88L 4QXTB 4WNQB 1NCCL 1YN6B 4NQDB 4XNMA 3MRNB 5B39A 1WFTA 1Z5LA 2PO6D 4OD1L 1I8MB 4JE4B 1UKQA 2HG5B 2J8UB 4UQ2A 1PFCA 1AFVL 3WIFB 5ITFB 1ZHKA 3AS0A 3GSUB 4Y2OA 3MX0A 4HS6B 4L3EE 3J7HA 5CGYC 1CYGA 2A83B 3KPSD 4RMQA 2PO6B 4B7LA 2X4PA 4FFVC 4ISVB 4AT6B 3MRMA 4M6MH 1KCSL 4JG0L 1HSAA 3KYOA 1FBIH 1MJ8L 2NZ9D 2Z4QB 5KG9B 5T5NF 2HT3D 3KPSB 1WZLA 3O4OB 1JRHH 3MRHB 1OGAA 3N1PC 1UWEL 4DKAA 5GXBB 3RVWC 5GS2H 4I0PD 2LV4A 2Y06H 4HWBH 5DUPH 3OR7B 1T89C 3V5KB 1JYNA 4XPHH 1RUPH 3QDGE 5C0DB 2HMID 1MLBA 3U36A 1W0WA 3QQ4A 3DGCR 4OCNC 1NAKL 3TEUA 1FSKB 5CIPA 7FABH 1FZMB 2HTLD 5K93A 1TQCC 1DDHB 4JQIH 2AV1B 4XNQA 4G80A 2NY5C 4NKIH 4FXLA 4KI5D 1FPTH 1WFOA 1NEZG 5DUML 5GGQL 2AK4B 1KLFA 1T22A 5FUZL 2BHYA 3K8MA 3I02A 4F37K 3SKOA 2R2EB 4PGZA 5INDA 2MPAH 1M7DA 1X5GA 2PYEA 4X4ME 3O3EA 4HJ0C 1HDMA 3GUTA 3VRLF 1AXTL 5KSVB 2H9GB 1FGVL 2C7UA 1EJ6A 4LLYB 3CDYA 4HBQA 5ESAA 3U7YL 1AGCA 1VERA 2Z8SA 3S35L 1CDGA 1MHCB 3U83A 4PGEB 1RJYA 4NFCA 4Z7WF 1X5IA 4FZEL 3IDJB 1S9XB 2BSRB 1J8HB 2VABB 3RP1A 2FSEB 4LF3A 2HRPL 4APQD 2X1OA 1QQDB 3OB0K 2FX7L 5IFJB 2NY6C 3I6GB 3Q3GB 3MO1A 2V2XA 4OV5B 1S7RB 2PN5A 2UWEE 2GSIB 3VXOA 1ZOXA 3TVMA 4NPYA 1OTUC 1CGXA 1P2CB 3MLVH 1PD6A 4YHLL 1AKJD 5KN5A 4WEBH 2C3VB 4YHYB 4RWHA 3CLFH 3C08H 4ZFOL 3L9RB 4FTVA 4FXKB 3C60B 4O2FB 3DUUB 4WHTB 3VJ6B 4M43L 2O5XL 3RTQD 4XAWH 3EJZD 5JHDE 4MXQD 2GJ6D 4LOUD 3WNOA 5E2TH 1QEWB 4WI2A 2IAND 2EDQA 3ALXA 4QRQA 4Q9CA 3QWOB 5BZDA 4OCXL 2XFXA 5E95B 3X3GL 1FC1A 1VFAB 4OCRH 2YPKB 5K59E 1DANU 3PV6A 1KJ2A 1OAZH 5EO1A 1YEKH 1KJMA 3FQUB 3MRPA 4IDLA 2FB4H 4NJ9L 4GW4A 5D9SB 5HSFA 4OJFH 5FF6A 5HYSA 4JQVA 3C09B 1GL4B 5F9JB 1Q0YH 4LVNB 4J6RL 5IFHL 5DEGA 5FO8B 3CDGB 3WSQH 4BH7A 5DD5H 3RNKB 3W2DL 2BRQA 3KDMA 3P4LA 3KJ6H 3ZKXC 3C5ZC 4PRIE 5D7JD 3WIIL 5J7CC 3MGAA 3DURB 2W1NA 2OZ4L 3OHXA 5I16A 2P42B 5ANMB 1BQSA 2VLLB 4XZUB 2E8YA 5IEHB 3EO9H 5IHZA 2OL3L 5GGRB 3U0PB 4XCEB 32C2A 5D7JB 4JZJC 2ZSWB 4P2OA 3KLAA 2MQ0A 4XHJD 4FRWA 5D1XB 4ZQKA 5EUKB 3U46A 2YD9A 3LSOA 3AS1A 5IKCA 4LHUA 1FRGL 3JUYA 2VZOA 4OUUA 4U0RC 5FAAA 1UVQA 1N0XH 4JG1L 2L7UA 5CJQL 4KJPD 2GTWA 4GKNA 1FBIL 3VRJA 1CF8L 3GBLA 3TH2T 1EHXA 1HCVA 2XG5A 1N2RB 2VZTA 3O2WH 1JRHL 1LEIA 3P2TA 3P40A 4LSVL 4JPWL 4XP5L 3BQUC 4F33A 3WKNA 3QEGL 4XNYH 3QQ3B 5SWZE 3VG0H 3SGJC 5E08L 5IOPA 5HY9A 3T8XB 3G5VB 1T83A 1BM3L 5HTSA 3VXRE 4U1HB 3VFMB 4XP1L 5FYLE 4U33A 4CW1A 3BP7A 7FABL 2NCMA 2G75B 3QH3A 2OR9H 5F1IB 3EJYD 1VGKB 4K3DH 5HHXL 1A2YB 2ESVA 4JFFD 1PEWA 1OLLA 1FPTL 5DEFA 5DMJB 1CIDA 3ZYJA 4R7NA 4MNHB 3U4BH 3BH9A 3QXUA 4WCYL 4Y4FD 4QTHB 3NABH 2BCKA 2UYLB 3RWIA 3M1BB 4AL8H 2ILLA 4JFDA 1A6ZA 2DQDH 3MNZB 4CMMA 3MBXL 4KRPC 1MQKL 1S7SB 4L4VD 4Y4FB 1CICA 1A7PL 1T1ZB 1X9QA 5CZVL 5HI3D 1WISA 4P59L 2NY4D 1M1SA 1JJUA 3ULVH 1WGOA 4YFLI 4P2CG 5HYJA 2MHAB 3G6JB 4L4VB 1T5XB 1BEYL 2V5TA 5FKPB 3KLHD 2LU4A 2YUWA 1NBYA 3PG2A 4PJHB 2VDMH 1K8DB 4RMWA 1FJ1A 1MJ7H 5C3LD 1K5NB 4DK6A 5F1NA 3T1WA 3QUXA 1G9NC 4OF7A 5GJTH 3MODH 4W4OC 3CK0L 3O6KH 4K3GA 1T0PB 3DRTA 5JPMA 5AD0B 2AXHA 2OTUB 2BNRB 4Z8FL 2HVKB 1IKNC 1QLEH 4K23H 4NT6B 3TWCH 2HJLA 4NYLA 1JIBA 3NA9H 4ONOA 4RISL 4HIJA 4S11A 1L0YA 1FO0H 5D6CA 3DO7B 3ARXA 2PXYA 1QACA 1S7TB 4X7SH 1CLYH 2A74A 1I85A 2BRRL 4CADB 1P4LB 2VSDA 4NC1E 4OD2A 5EZOH 2I24N 1WWBX 2BNQE 2I07B 4DZ8B 5D93C 5DK0B 1JN6B 4PJ8B 1YUHA 1WFUA 4Z7NF 5ESVB 3BXNB 3EZ8A 4LIQH 2C1OB 1NMCC 4HUXB 3RX8A 4RMRA 3KJ4B 5I8EA 3FFCD 2BMKA 1YNKL 3P9WB 4U3XA 3VE0A 4PJFA 2VDRH 2X9XA 3WSQL 3WDHA 2H8PA 1F97A 5C0AA 4HUVB 3EDKA 5CEYA 2VDNL 1EHNA 4G7VL 4WY7H 4EZMA 3FFCB 4JHBA 1QLRB 3H3BC 3EOYG 2RFXB 3FB5B 3MRFA 3O4LD 4JM2D 3S4SG 3H42H 1WVZA 5IBUG 2DL2A 3SY0B 3PE9A 3HR5A 1U8IA 3S3SA 1GOGA 1WCQA 5ABDE 4OGXL 1FE8L 4QHKJ 4XMPL 1ZLUK 1UXSA 4IHOB 3WLBA 3D69A 1ONQA 3MXWH 2Z8VC 3TBSB 1XH3A 4MNGE 3DTXB 4KKLC 4NZTL 2Y5EA 1LDPL 4ZNEA 2G60H 1ORQB 4GOSA 3OAZK 4H0GA 3U1SL 3VFUA 5EZJA 2X9WA 1U3HC 4G8FB 1BFVL 4LVHC 5TQ0H 2HT2C 5I71C 1MFAL 1D7FA 1EGJH 1QSEA 2PYFA 1MCRA 3BKML 4JFXA 4H88L 2R1WB 2AJSH 1HHHA 1QSFA 2R2HA 2NY3B 2G5BB 4PJGB 2NYYC 3QIBD 3H9SD 3SGKA 3VG0L 3FT2B 1NCWH 4HT1H 4LASH 3UTPD 4D8PB 3RA7H 5IMMB 3RPKA 3VXQA 3BE1H 5J11B 3F8UB 4N90E 3WFCH 4P4RB 5CSZA 5IW3A 3MLYH 3OAYH 4U1IB 3S36L 3H9SB 1NGZB 1NUDA 2J6EA 3K8LA 1SJEB 1LHZA 5FO9B 3F5WA 4S1QL 1NC4D 4M48H 2RAMA 4YDIH 1NCAL 2E6JA 2G9HA 4CGTA 3L7FA 5EUOA 4MD5A 3K3QA 4WI5A 1S9YB 3JSSA 1KLGA 1KULA 1DFBH 1FZKA 3U4BL 1K2DB 1MPAH 3WD5L 5DD0L 1ZTXL 4TNVF 4WW1A 1NC4B 5IF0B 4LSSH 2F5BH 3ARBD 4LHQB 4N0YL 2APWA 1AP2B 3MBEA 3C2AL 2YR3A 2X5PA 3VH8G 1A9BA 2NXYB 3QG6A 5E99H 1L6ZA 3SKMA 2UZIL 3L5JA 2EYRB 5BRZD 5DLMH 3V95A 2JTDA 5IBTL 5TFSL 3ARBB 2AI0H 2R29H 1A3QA 2Z35A 4PJ9D 1P7KB 1LE9B 1G7IA 2ICWA 2AJZB 5CBAA 2NX5E 3K4ZA 3IDNA 3ULVL 4OCSH 1D6EB 2YEZB 3O9WC 1FQ9C 4GG6F 4R97B 4M7JL 1DBBH 1TCRA 1DBML 2YD6A 4PJ9B 4Z7QE 2VDML 4OD3L 4OLUL 5T3ZE 3G5YB 4Q9RL 1S7XB 4OI8A 4L3ED 5GJTL 4QXGL 1I4FA 1F13A 5HGBB 1GGYA 4ZXBA 1EUTA 1JV5A 1BWMA 1R3IL 3VFGL 3ZTNL 4RA3A 3ARRA 4OZFB 5I74C 4MJIE 4EDXA 4YDVA 4K23L 4L3EB 5IWLC 4RAVB 1LK2A 3HUJE 4ZO6A 1BBDL 2ZCLL 2Y5TA 1Q9OA 2BY0A 1KJ2L 4F57H 4R90H 5EG6C 3QDGD 3FQTA 1KACB 3JUZA 1OPGH 1U95A 3WE6A 3MZTA 5GGSB 3EYFA 1I75A 4PG9A 5SWSE 1HH6A 2CLZB 2VXSL 1ZLVK 3T0VA 1V3LA 1FVCB 4R2GD 1TFHA 3OKMB 1B4JH 3OXRB 3BX7C 3UAJC 3KGRA 5KANG 4HXAL 4IIQA 2WSKA 4X4XB 3FRUB 4KGJA 3BYYA 1C7SA 4UUJA 5D5ME 1DANT 4ODSL 2VR5A 2V5YA 3MMEB 5D1ZA 3C6SA 5GGTH 4WO4C 5C71A 3LV3B 1RSFA 4GQ9H 1KCLA 2VITB 3KPQB 3VMNA 2X4TB 3GJFK 2X1WL 3CH1B 1JWSB 3UC0L 3FFDA 5JW5A 1NGWA 4EN3C 2DQUH 5EO9A 3OKNB 4JM2F 4JLRB 1SJXA 3RU8L 1GGUA 4RGNC 5J0BA 4BQ6A 1MFEL 3DMMD 1ADQA 5IJVB 5JNYA 2ICES 3OB0H 3MRCB 3ZT5A 4EI5D 4WUKH 2Q6WB 4TN9A 4G6JH 5IMLB 1EGJL 1RUMH 2A2QT 1C12A 3Q6FA 5T1LD 3RGVD 2AJSL 3SOBH 5I30H 2DKSA 1EV2E 2PKDA 1EZVX 1I3UA 4PBVC 4L8BA 9CGTA 1NCWL 2C4XA 4EI5B 4LASL 4LCWB 5SX4I 1DLHA 1F3RB 2EH8H 2P8LB 1Z9MA 4FZ8L 5C9JB 1HHKB 3TNMB 4AK1A 4MD0A 1XGYH 3MLYL 5DJCA 5JHDD 1HIMH 2DQIH 1AIFA 2Z93A 1MI5D 4PBWD 3CXDL 1GGCH 4JY6A 4F3FB 1BOGA 1H8OA 5DJZA 4XGZB 5FYJE 4M48L 5L88H 2OI9B 2DYPD 1DL7H 3QNXB 5JHDB 1DFBL 4Q6YA 1MI5B 4PR5B 1RZKL 3TA3C 3O3BA 4LSSL 2F5BL 3H3PL 4M62H 2DYPB 3KPNB 3GSRB 1FV1B 1JBJA 4UIMA 5E99L 3IDMA 5T3XE 3CC5B 3ZZ1A 1WFNA 1ZLWK 3GMNB 1MFBL 1NKOA 5EC1B 3W81A 3Q5YA 3PWPE 3H0TB 3HHRB 3GMOB 5BV7L 1MCWW 4PRID 3TFKD 1TZGH 3UBXG 5GPRA 3QG7L 3S88H 3OTTA 3Q2CA 3IFOB 1J1OH 3V0VA 1S5IH 3N1FC 2FJGA 3STZA 3NOIA 2GY7B 3MCLL 4MSWA 2B1AL 2OYPA 1WBXA 4WUUE 2D3VA 3UJJH 2CMRH 3VFTB 1I3RA 1BBJB 2VKWA 1JNNH 5DRZB 1R5WA 3U4EA 5DSCB 3PL6A 5IB4A 2RCSL 3LKPA 3QIWC 3LRSA 4OZIE 3LAFA 5HDQH 3WBDA 2PTVA 5FIEA 3DGGA 3FOMA 4Z5RB 5A40E 2VDOH 2WMPA 4MNQB 5I8OL 1CWVA 4XCCL 5KSBE 4NM4H 1A7BA 4Y2DA 5DMIL 4ZUVB 5SWZD 3PWJA 2DMCA 5IB3B 1IEAA 1NJ9A 5TE7H 1M6OA 3TN0B 3UCRA 2EDXA 3VXRD 3VFPA 5BZWB 2DBLL 5FYLD 1I9IL 5E5MB 3B2VL 1N64L 1R5VB 3DSFH 3ZKSD 2W9DL 3F7VB 5IMKB 1TPXB 5DJDA 4KQ4H 3KXFE 3TJHC 4CU6A 2QLVB 5AZEH 5LGKA 4MA1B 1FNSL 2GJZB 4GRLC 5CEZL 3TZVA 4Z7UF 2R4RL 2G2RA 2WANA 1QA9A 2AJUL 2A1WL 1J87A 5C09A 5GGTL 5DMKB 5SX4H 2VZSA 4N5UA 2AERT 1A5FH 1N6QH 2I60H 4PRBB 2F19H 1QVOB 5I1JL 5CSGA 1JWUB 2CUIA 3SDAC 1FDLL 4NN5C 5SX5K 2VE6B 4DGIL 2X4UA 1NLBL 4PTTB 3WV0A 2DQUL 4RFNB 4F7MA 2XYCA 5FO7A 1U8JB 4QF1A 2O93L 4UILL 3OJMB 2FWOB 1IAII 2YPLE 3ZE1E 1ITCA 4P5MB 1H9VA 5JXEC 1NGXB 3TBYA 3CX5J 5DVKA 4DTGH 3LEXA 3QEUB 1IM3B 1T1XB 2UWEF 3VA6A 3B5GA 2J6EL 2FR4A 2QV2A 2K7QA 3F12B 4XP9H 1H5BA 1XGUB 2XQBH 3AMLA 3NIDE 1MCWM 3EFDH 3R0MA 1S9WA 5IP4A 2Y07H 3BO8B 4OLZL 3QNZA 5B4MC 2DQJL 2V17H 5FECB 3MZGB 2O5ZL 4HC1H 3AGVA 1PSKH 2DQIL 2BNQD 2ZP0T 2VLRA 1UACH 1WF5A 3BIBX 4XPAL 4RFOH 3B3IB 4NQCA 1RVFL 1DL7L 1N6UA 3SE4C 4RQQA 4I5BA 1MCJA 1L4IA 1NUNB 4P5KB 1JPFB 5F7DB 2BNQB 2DL9A 3E6HA 3U7WL 4LL9A 5E9DB 3CZFB 5T5FH 5L8JB 4Y5XC 3TBTA 2I26N 3MOBL 2W9LA 5EOCJ 1KTDB 2VLKE 1UKSA 1JUFB 5K59F 3JV6A 3F7RA 3RZCD 4LPCA 5HI5D 1Z3GH 2VXVH 1JNLL 1RPQA 4U6YA 2ARJB 3GO1H 1B2WL 1YEDA 3I6KA 3IAPA 4MDIA 4WFEE 1P9MA 1FAIH 3UTSB 1T66C 3MJ9A 4L29A 2QSVA 1IAOA 3KPRB 3RZCB 4EIGB 4PREA 1U93A 2NY1B 3F58L 1MOEA 3NFNB 1U9KA 4H5SA 1H8SA 4TYUA 3FB8A 1IVLA 2IAMA 5FYJU 3UJJL 2CMRL 2YSSB 4O00A 1CG9B 1UZ8A 4UNUA 1HILA 1D5XB 3O41B 1CR9L 2R0KH 3HE7C 4TTDD 3QZWA 2BSED 3GIZH 1JF1A 3SKNB 5F3BB 4L4JA 3VFWA 3MV7E 3V5HA 4P46C 4I0KA 2R1XB 3LN5A 3QHZL 1PY4A 4DW2L 2R0WH 1AXSA 2VDOL 3X17A 3P0VL 3GMRA 5FM8A 4OM0L 1IGFH 5IVZB 1CCZA 2ERJC 3FQWA 4K3HA 4XC3L 3QCTH 1FN4B 5TE7L 3D39A 1F3DJ 4LLWA 4N90D 5BVJB 4Z7WA 1MCQA 4YHOH 3M17B 1PQZB 3BISA 4GAJH 5DXWA 1QLFA 4HG4J 3VFSA 1EBPA 3NZHL 2HKFL 2F54E 5KS9B 4M3JA 2B39A 5LGHH 3O11B 4P2RE 5IB1A 4KQ4L 5IG7A 5F71A 2YBRB 3U82B 3VI3E 2I27N 1JF5A 1YDPA 4TUJB 3FCTA 1G9EA 5DVMA 1R5IA 4KKAD 4B53A 4ZUUB 4MWFB 1NC2A 1X3DA 3QUZC 1KN2H 5I73B 5EOTB 4X7FC 3BPNC 1UA6H 4XI5D 1N5YL 4GS7B 1J5OH 2JLLA 1N6QL 2E7MA 4U3HA 3I3BA 4WTWA 4Z77A 4Z7VF 1ADQL 3MJ8B 3GDBA 4N68A 2CGRL 3MRDB 4MA8H 3C8KA 2UVEA 1HWHB 2WNGA 5EU5A 1V05A 1HQ4B 4LLVA 1EHLH 1NGQH 1RFDL 3O6ML 3QA3B 3CFDB 2NX5D 2P49B 4Y4HA 4H0IA 3KYKH 1J1PL 1KFAH 4LRIC 5F9AC 1BVKA 5E8PA 5BXFB 3ZKMD 1WEJL 4FABL 4K9EC 4FQXA 4JRWA 2NX5B 3FO2B 3ULSB 1L7TH 4XVTL 3QCUL 5C0CA 5D4QA 1WC7A 2PO6C 1W72B 1RZIA 4LSRH 1I7RA 1CLCA 1IARB 2X4SA 4RX4A 3D9AH 3ARFA 4YO0B 2ZUQB 5CD5D 5KJRL 1P7QA 3L3IA 2D0GA 2YC1A 4MJID 1X5JA 1QNZH 2BJML 3RKPA 1FLRL 2W92A 1AE6L 3HE6D 2FO4A 1XEDA 4S2SA 3O4OC 4U05A 5GRJL 3RWDB 5IHBA 4K8RL 4EBQH 2CLVA 3HMXH 4L3CA 2FBOJ 4X7EC 5CUSL 5E5RB 3EYQC 2Y07L 5D7KE 3QCVH 3WLWD 4HW6A 1LMKA 4MJIB 1NL0H 4ELKA 3CIQA 5EBWA 4LDEB 1VSCA 4LKCB 4M7ZB 2DQTH 1NMBL 3SEPA 1Q0XH 5JTWA 4NQSA 2EDJA 1EEZA 4C56B 5EORH 1BAFL 5SWSD 4OF0A 1FSKC 2P44B 4BZYA 5T5FL 1Q8MA 5D7SL 1NFDB 3I3DA 3GSXA 4FNLH 3CUPB 3ZDYE 5HD8C 3T1FB 1X4XA 2O61B 1CQYA 5F7HA 3CLEH 1OM3L 5SWSB 5C0EA 2J5LB 2APBA 4DOHE 2HKHL 3GO1L 1JF6A 4ZAKD 1NFIB 1CTNA 2YXFA 4KI5C 1JWMB 2YD3A 2HFEB 5ICYB 4RFEA 3K2MC 1GAFL 5ISZE 3KG5A 5DJXB 2JKXA 4M6OH 4NM8H 4U7KA 4ZAKB 3QDJB 5DHVA 3X14B 4I0PA 4YHKL 1UQSA 4YIQA 1BD2B 3GJFH 3IFLH 4GAYA 1KIRB 3QXTA 4BQBA 1BFOA 3BEWB 3CXHK 1CD1B 3RAJL 1DEDA 3HC0A 3VI4E 1SY6A 3BOVA 2YN5A 1Y6MR 4HS3A 3AM8C 4BA8A 5HBBA 5CCKL 2PF6A 1UEYA 3PIQB 4QHUA 1G1YA 1YMME 3OR6A 4YWGH 2AABL 1I9JH 1HQRB 1ZANL 2VL4A 4YPJA 1UXWA 5H37H 4YHYC 4LLDB 1IGFL 5DURD 1OB1A 3EYOB 4L1HA 1V7NL 4X6CB 4A6YB 3BP5A 4J7RA 2V2TA 3UTOA 3C60C 3HLAB 5DC0A 1A1MB 2BC4B 1VCAA 5D8JH 3C8DA 1MCFA 1CFNB 3QXAA 2X70B 5DURB 1OAKH 1I8KA 2WV3A 1I1YA 4YK4B 3V7AE 1IAIL 1MRDL 3IJYA 3ESUF 4L5FL 2Z91B 1RIHL 5FYJD 3UEZA 3ZTJG 6FABL 1J12A 2FYYB 4HPOH 4ZPTA 4APQA 1U8OA 1IL1B 5EN2B 1SBSH 4QOKA 1RJZB 4N0FB 35C8L 3O2DH 4S0SD 4JZNB 2JB6A 3C09C 2H32B 4U1JB 4LVNC 3VXMB 1GJIA 3MNVA 5T3XD 1AKJA 4DGYH 3KPMB 5EBLB 1VB9A 2GKIA 1BQHB 3PWPD 3STLA 1RUKH 5IR1A 2QQLL 3GHBH 1ZLWH 1I8IA 1NGQL 3JV4A 1LO2H 5DRWA 2X4OB 4AG4H 4AM0B 1YEHL 3PGFH 5E2UH 3E3QE 5L2KE 1MCDA 2HFGH 3UDWA 4X8XA 1EPFA 3ARWA 4M6NH 5HYFA 4J8RA 3BRFA 4Z7OE 2VYRE 4MZ2A 4WUUD 4M5ZH 3NCYS 4M9OA 5D1XC 3VRIA 4K2UH 4NO3A 5BJTB 4FQIH 1OAXH 1UT9A 1NEZA 5CD3B 3GSVB 2FJHB 2A6KA 5TH2A 5FK9B 3C2SA 4PP2A 1N8ZA 3PGCA 4PFEA 4XHJC 1OD7A 4YUEH 3BKCL 4BSWA 4X6BB 2AXJA 2CRYA 4IRZH 1FFOB 3LKSB 4OZIB 4KJPC 3HUJF 1ZA3A 3MV8E 3T0WA 4DFHA 2DQTL 1T04A 3VG9B 3QFJB 5EORL 4NDMB 1YJDC 1FAKT 2W65A 5GS0C 3TC9A 3IDGB 4JKLA 3MFGB 1XCTB 3KXFD 1G7MB 4FFWD 4YDLC 4LNVA 3MJ9L 3CSGA 5HJ3B 4KZDL 1FL6B 5DR5L 2ZOLB 1D5IL 1X5LA 5EPMA 1CGVA 3T65A 4ELME 3IGAB 3LQZB 1V5JA 2VXUH 2YA1A 4UAOB 1HSBA 4OQ1A 2NTFB 5LCVH 2IPUG 1CXIA 1I7UB 4GMSH 4M6OL 2H26B 1MWAB 2VSCA 4MHHI 5D5MF 4JM4H 4WW2F 2HWZL 5HGHB 3IFLL 4I3SH 2Y36L 5F7KC 2D7OA 5DD3L 1ACZA 1JZ7A 3GMMB 2W59A 4Q7DA 4X6DE 4U6HA 3K2UH 3W0WE 2HFFA 4F7TA 3EGSB 2CIKA 3SDYL 4Y19B 4LDOB 5HI3C 2YPLD 2NY0D 4YHPB 4PJAE 4PJXA 1DEEA 4TSBH 3MUGB 4BFIA 4HKJA 4YWGL 2DLFL 3NIFF 1P1ZB 4P9HH 2MOVA 4JFFA 2R4SL 4JY5L 4H25A 5MEQB 3TNNB 3VD5A 3FO0H 1KIUA 3IFPA 1FNGB 3IDXH 4IOIB 5FM5O 4HJGA 1ZGLB 1F4AA 4LP5A 3LCYA 1J0YA 4E0RA 3S97C 1YYMH 1X7QB 4CKVX 3FN0L 5JQ6L 4LFHD 4EDWL 1Q9KA 2XZAH 4GG6A 2AEPH 5TF1H 2AJVL 4YC2C 2XQYG 1MCHA 4WIQA 3DX6A 5F7EH 1S5HB 1R24B 4PJ8C 3HZMB 4IS6B 5D2NB 1A7NH 3IXTA 4H8WH 1A64A 3KJ4C 2ICEB 2Z92A 3C5ZA 3FTGB 3M8OH 4G3YL 4LEXL 4M61B 2VLKD 3U7AA 4NKMB 2NW3A 1D5ZA 1LO4H 2K9UA 3RBGA 3QDME 4DGYL 4TUOA 1OGAE 4G8IA 4JB9L 3MCKA 1BGXH 3I75A 2UZYB 1G7JA 2ADIB 3OX8A 5D96C 1RUKL 4KV5E 2WQ8A 5FFLA 1YEEL 4WFED 1N3NA 4JZJA 5IW6B 2VLKB 2QHRH 1XR8B 1T2XA 3OAUL 2X4RB 4UQ3A 2XWBA 2CDEB 3P77B 1Q9LA 3L95A 1LO3H 4Y5YC 4R26L 1FIGH 1VPOH 1N59A 2ADJA 5D71H 1J0JA 3MRIA 5IB2A 2JELH 1HHGB 3HRZB 3DX9A 1OW0C 2F9BT 4PJ5B 1JPST 4IOFC 3U9UB 2QADD 3A6OA 5FDWB 3BKYL 3GSQB 3P4NB 3HZKB 3MV7D 2IJ0C 4MJ2A 3OJDA 5JMRA 4W4NA 3TPUA 5DHYB 3SGJA 4F9LC 5F7UA 3CSYB 2P24A 4D3CH 2PYEE 3IU3B 1CZ8H 5CGTA 3O2VH 2QADB 1W0VB 2ZOKB 4IRZL 4KK6D 2NY3C 5EBGA 5D72H 1UM5L 2QQNH 4YLQT 5A16A 3QJHB 2KH2B 1H3WM 5IHUH 3MCG1 4HCRA 2I5YL 5DJ2A 3U2SA 1JGDA 5J11C 5L6YL 5DQJA 1V3JA 4HX1B 2APXA 4HUWB 1C8PA 5T1KA 5KSBF 5DYOB 4HXBL 4M1DL 3PNWB 5KZCD 2F54D 3IKKA 4P2RD 3BZEA 2Y7QA 4Y5VB 5BVPH 2AEQL 4UT9H 4NHUB 3ULVE 4KDVA 3FB7A 3GRWA 1JGLH 1FG2A 2YWZA 5KZCB 2H3NB 2KKQA 1WT5C 4PGBB 1FC2D 1QOKA 3HNVH 1BQLH 3OKEB 4FTVE 3MV9A 4B50A 1K6QH 2NXYC 4IMLA 3SDDD 1OD9A 1YPZE 3TIDA 5FCUH 2VN4A 3ARBC 3ARGD 3P4OA 2AKRB 4NQVB 5I1AA 4LU5L 4NZDA 3DIFB 4TTGA 4XWGL 3A67H 4W4OA 3SDDB 4I18A 4FXGB 4MLIA 3MREB 4DZBA 3O0RH 5LGJA 3F6LA 5DVOA 3RQ3A 2YZ8A 3RPIA 3ARGB 4GRWE 5DD6A 4PJ9C 1CD0A 4H20L 4WJ5A 2GT9B 4JFOA 2ATPB 1PEZA 4DCQB 4I2XA 1MF2L 4TULL 1RULH 2EZ0D 4WHDA 1XGTA 3ZDXE 1DQQA 3AY4A 4LEOB 3ZE1F 3GEWB 2BSTA 1QBLH 4XMLH 1BJMA 3WXVH 1EO8L 4LGSB 3V52H 2WBJD 2EIBA 4BZ1H 1AGBA 5TDOA 3DYOA 3HI1A 3C6LB 5INCB 4ONFH 3SQBA 1P4BH 4JFZL 4KROB 1KB5H 3SJVA 4L8CA 4NHCL 4WI4A 2ZNWA 5EU7E 4L8SA 4U2YA 5BRZA 3S4SA 5A3ID 3O8XD 5IW1B 4K7FA 2OXGA 2R56H 2IPKB 2WUBH 5I19H 1EEYA 1MUJA 1I1RA 3NIDF 4XMKH 1NCBH 3LPWA 5F7EL 1A4JB 3OKKA 4OZ4B 4S1DD 3GM8A 1IGJB 3T3PF 2C1PA 2FGZA 1WLHA 3C5JA 4MA3B 5EO0A 5KSAB 5AG9A 2WLZA 1FNEB 1NPUA 1LNUA 1VESA 3ZHKA 2W0FA 4GAFB 1BECA 4GKZA 3B2UC 1IC5L 1YY8A 1IC4H 1LO4L 1V3KA 1H3PH 3D25A 3GMLB 1AJ7L 1RU9L 4NWTL 1L0QA 3MRBB 5F7NC 4FQHB 4E41D 5MP6L 4HMEA 2RJMA 3SGEI 1CDBA 3AXLA 4RIRB 4X98B 4QRPB 2FL5B 2AV7B 5ISZD 1NCDH 3JTTA 4KK9D 1LO3L 4EI6A 4X6EA 3KYNA 3GKWH 4AEIL 2EIDA 5D71L 2DLGA 4E41B 3TYGH 2V9RA 3HNSH 1A7RH 3EO1A 1U8QB 4G6FB 2VWEC 3QDGA 5ISZB 1XF2A 5BQ7B 1CFSA 5EA0L 4JRXB 4JDVB 4HWEH 4JJ5A 2WWMC 5E2JA 2FJFB 3LN9A 5IGXH 1ES0A 1KPRB 5C07A 1IGIL 4JREB 3QO1A 4Z7UA 4M1CD 5DS8A 4D3CL 2JF1A 1I9EA 4KAQL 3O2VL 1LD9A 1M05B 4P3WA 3CGTA 2NY5L 3EDJA 4JFDE 1WBZB 3T77A 3VH8A 3L3DB 3RWEA 5GSRA 1XGQA 2VXTL 2NY7H 4LBEB 4OT1H 5D72L 2LU3A 3X13A 1B90A 3EOTH 5LXGH 3KWWA 5ETUB 4X4MA 2GSGB 4QY8B 4BH8A 1EAPA 2FLRT 1IAKB 2DJUA 3NCJL 3EDFA 4MAYD 3G6DL 2ZSVB 5FYKL 1SEQH 2FBJH 5HHPB 1NDGA 4HV8B 5B38B 3WN5C 4NCDA 4UBDC 4U1MA 4N5ED 4YXLH 4UTBH 4EEEA 1U8LB 1NFKA 3DMMA 3LHPL 1TETH 1YQ2A 2ZG3A 3IF1B 3K4AA 4ZOEA 1KXTB 4WVRA 2Z31D 3PWLB 3VI3F 3DVIA 3PHOA 4P3CH 1AQDB 2EXWD 1MCCA 3RGVA 5BS0A 1UJ3C 4OKVB 1C16A 2F8VA 2OL3B 1K4DA 4P4KD 2ENYA 1UCBH 4L8DA 3DUSA 3QO0B 2EICA 3F7PC 3S96A 1T2QL 5IJKA 2XOTA 4I48A 1H0DB 1BLNB 2V5MA 4DGVH 1B88A 1JFQH 3VWJD 2OXHA 2GHWB 5L2KD 4P4KB 3BVNA 5ICZA 3UTTA 3NAAL 4RGOH 2CK2A 4MVBC 4OZHF 3ARDD 3NACL 3S98A 4I4WA 1WZMA 3D2UA 3GSWA 3LS4L 4J3OC 2MCPL 3V6BR 3VWJB 1LO5B 5CJBA 5L2KB 1I1FB 4PRAB 1CE6A 5DUBA 4YDJB 1CDCA 1FH5L 4ZSOA 1ZHNA 2DLIA 1EX0A 4Y8DC 5C0AE 2DQCH 4I77H 4X6FB 3ARDB 4ESKA 1N26A 4RMUA 5L2JA 5I18H 2F58L 1YC8A 3QRGH 4ZTOL 1X6NA 4W68A 2KQMA 4TVPL 2V7NA 1F00I 3LQAH 3HAEB 3SGEH 3V4VH 1A6WL 1DBJH 4L4TA 5J6GA 1BZ9B 4LCUA 5CEZE 3I2CH 3MA9H 4LGPB 2OJZL 5DFWH 1XGPB 2DDQL 4TSAL 1B0WA 1AGDA 1FCCA 3TN0C 3MV8D 4ODXA 5HDBE 1CVRA 2EIZB 5E24E 4ZNEE 2CO6B 3MLUH 5F97E 3I9GL 4O58H 3OZ9H 3E2HB 5ID1A 5I8KL 4X8JA 2GK0B 1TPXC 4ERSL 2CLRB 4LMQE 3GMQB 2GTZA 4GAGL 2LFGA 3UYRH 2DQHH 1QSEE 1RUQL 4LLAA 1QSFE 2XN9A 2F8OA 2AJYL 2D2OA 5JW3H 3BW9B 4LSTH 4RZCB 3VXPA 3UO1L 4EN3A 3RI5K 2PCPB 1LEKB 3OB8A 1CLOL 4JO3H 5JIPA 4Y8AA 3MRLB 1DVFD 3IETA 3DXAD 2XA8H 5HHME 5KBNC 2BDNL 1R6VA 2J4WL 4Q0XL 4RFNC 1YN7A 4FG6D 4YE4H 5GZND 5AEAA 3K4DA 2BSSA 2E27H 5AAMA 1YMHB 5EUOE 3RUGB 1DVFB 4JFQB 1QRNB 3DXAB 2WW8A 3W0WD 3CFJA 5IB5A 4F7EA 5IQ7H 5F88A 1X5HA 4NRZA 5HYQB 2KPNA 3HC3L 1Z0NA 2Q1EA 3VI4F 5H94B 1D3CA 1F11B 2GJJA 4YXKH 4ORGB 2A0LC 4PB0H 2CR6A 4UT6L 3W0WB 3O3DB 5DQ9A 2IQAA 1K4CB 4PJAB 2E7CA 4HH9A 3BZ4B 4Z7VA 5ID0A 3WFHB 1F3JB 3FN9A 3AU1A 4QYOA 3WHE1 3BP4B 2DQFA 1I1AD 4HPYL 3TT1H 4JKKA 4JN2A 1E6OL 1RZGB 3UBXA 3ECBA 3GRWL 4PLKD 1MVUA 5MENA 1KEGH 1C08B 1KENL 4M93B 1QSVA 2QQQA 1I1AB 2NY2D 1MREH 1RZ8B 3B6SA 2XRAH 4XNMB 1S7WB 5B39B 2FX9L 5GGVH 4MS8D 1Z5LB 3HG1A 1G7PA 1RIUL 4FFYH 1ZHKB 3KLSA 3EJJX 4TOYL 3AB0B 3IFNH 5CZXC 2YD2A 1ZVHA 3WFEH 1G9NL 2X4PB 1OGAD 4LP4A 2MQ3A 3MRMB 1TZIA 4XNZC 1JK8A 1HSAB 3K1DA 1YQVH 4XH2A 3KYOB 1E4KC 5C9KA 1L6XA 3TJEL 2H1PH 4AEHH 4OF6A 4PLJC 4KDTA 3RZCC 1JFQL 3DV4B 1OGAB 2NY1C 1XGRA 2IH3A 3CMOH 2C5DC 3RBSA 3W9EA 3BSZH 4RGOL 4XB8A 3QIWA 2KQNA 1MLBB 1VADA 1PLGH 4E42A 1W0WB 3ULUD 5F9WB 4LKXA 1BZQK 5ALCL 3I50H 4MQXC 3SHSA 4Z7OF 5CIPB 4NO0A 3TT3H 3KNBB 2ZJSL 4ODHH 3J8F7 1W8NA 3QNYA 5I18L 4KMTH 2PYED 4XNQB 2CK0L 4G80B 2Q7NA 3BWUC 2YD4A 1GYAA 3MSPA 4TTDC 4LRNL 3EOAA 1T22B 3I2CL 3EDDA 4R7DA 3I02B 3MA9L 3SKOB 4AIZA 5FOBA 5INDB 4M7KL 1M7DB 2PYEB 3LKQB 4LAQH 1CGSH 3O3EB 4WHYH 3QFDA 1HDMB 3GUTB 2XWTA 4Z78A 5ADPH 2PR4L 2WP3T 3GGWA 3T3MF 2C7UB 5HVFB 4GRLA 5IMOA 2ENSA 1IFHH 1E0OB 1S3KH 5EU4B 1AGCB 2IFGA 3VXTA 1I8LC 3TVMD 1KV3A 1L0XA 4N8VA 4LF3B 3UYRL 2HJKA 5CJOL 4JPVL 3WS3B 4XPGH 3MO1B 4XCFL 1NCNA 4R3SA 1JP5A 3VXOB 3TVMB 4PGDA 4NPYB 4OCYL 1SYVA 3OG4B 4G43A 4FTVD 2NXZD 4G42A 2FECL 5E4IA 5CBEA 2YPVL 3BH8B 3MLSH 2WINA 3NCCB 4GS7C 5F9OL 1EMTH 4LNRA 5KN5B 1U8NA 2ZG1A 5AZ2L 2H2SC 5J4MA 3RX7A 4ELMF 1T3FA 4LQFH 2DIJA 5K9KA 5C0RL 2NXZB 1W8OA 4MJ4A 5JXEA 4FQQA 4XI5C 4Y1AB 3HCVA 2E27L 3P0YL 1OQXA 1BJ8A 1MFCL 4PRPA 4QRQB 3EUUA 3FONA 3OKOA 4B7IA 2XFXB 4YXKL 4R8WL 4X6DF 1LQSR 1JTPA 3MLXL 3PV6B 1KJ2B 3BGMB 2ZUQC 5I75C 4Y16C 5EO1B 1KJMB 2YRZA 1DQML 4LLQA 3N85L 4GW4B 3H7BA 5FF6B 5HYSB 1U42A 1GHFH 2AJ3A 2IPTH 1JNJA 2C9AA 1VEOA 1CFTA 5DEGB 4BH7B 2YN3A 3SDXA 3ZSTA 4PYHA 1BHGA 3KDMB 2ZUTA 4X83A 1ZHLA 1J9CT 3N9GH 5HHVH 4G7YL 2V9TA 4P2OD 3OHXB 1Q1JL 2Q7YA 1IGTB 3OKLA 1HYSC 2X7LA 4UMGA 3RIAF 4WU5A 4LHUD 5IHZB 4FFYL 3UROR 2R69H 1QKZH 1GZQA 1Y6NR 1EBAA 4P2OB 2VLJE 5F89A 3KLAB 3RVUC 4HUUA 3U46B 4NZRH 5DZLA 3LS5H 3LSOB 4QHKI 4TUKL 5IKCB 1IKFH 4LHUB 4P2QA 3W82A 4JAMA 4OUUB 1UVQB 4WI6A 2GTWB 3H9HA 4GKNB 5DD1L 4LPYA 3VRJB 5EB9A 3KLDA 3HE6A 1MY5A 2AEWA 1LEIB 1SM3L 3CVIL 4XNUH 5TE6L 2EC8A 4ZAKC 1AGFA 3QI9D 5IFAH 4KV5F 3L7EA 3ZL4L 5FEBA 1A1OA 1TDQA 3DRQA 3ILQD 1S8DA 4P46A 1FZJA 1MRFH 2X2YA 4P3DB 1PLGL 3TCLB 2IPUK 2X42A 1T21A 3NZ8A 2X4NA 3BP7B 1TQBB 1PG7X 3QH3B 1RZ7H 4ODHL 4AENA 2NQCA 3CPLB 4D0BB 4KMTL 4U7MA 2ESVB 2R0ZL 5C09E 5EIQA 5J6HA 5DEFB 5F8RC 1KNOA 3NFPA 4JFDD 4Q9BA 4FMFA 2UUDH 3FT3A 4XPFH 4ZFZA 2CIIA 5EZIL 3BH9B 4NZUH 4Q9QH 4NKOA 5KVDL 3T0EC 3O6FA 4DKDC 4YFEA 4DEPB 4X9IA 2Q86A 2BCKB 4X80L 4JN1H 4WW2A 3RWIB 3KR3L 1Q72H 5ILTL 4JFDB 1ZGLP 1A6ZB 5ADPL 1MFDL 4YR6A 2P5EE 4CMMB 2Q3AA 3Q1SL 1WTGT 4P48A 1BJ1H 2Y4SA 4EQ2A 1CICB 5DK2A 3G5XA 4YK4C 4RDQG 2CUMA 3QUZA 3L3GA 1OSPH 2R15A 1JZ2A 3ABZA 3QRFM 1F2XK 5J9PB 2WWKT 5I1LB 3L5WA 5HYJB 3WNLA 4NJAL 1A02N 4O5LH 5I2IA 1MCEA 4L9LA 3AFLA 5I1CH 3T08A 5A2KH 3EKCA 8CGTA 4KKCD 1MY7A 1NBYB 4KK8D 4EUPA 3CFKB 3UYPA 1FJ1B 3E1F1 3ULVF 3QUXB 2APFA 5AYUL 1J0KA 4WNQA 3RY6A 3AUVA 3DRTB 5C0ND 1EFQA 4RCAA 3ZYZA 4U1GC 5CILL 1FVEA 2PXYD 5JPMB 1QFWH 4LRIA 5MI0B 2HG5A 2J8UA 3NIGF 2DWEA 4NQXA 5DJ6A 1KC5L 1YNLL 2VLRE 2XICA 2HJLB 4NYLB 3U0WH 1GSMA 5E1HB 4HIJB 4HS6A 3QIUA 1KPVA 1YPZF 2A83A 1RV6X 1ZK9A 1MRCH 1V7MH 5EOQL 3SO3B 1VFMA 4OD2B 4LCIL 1A0QH 2CXGA 3CZJA 4QHMA 4WGWB 1TJGL 4ZTPL 5E56A 4UV7H 3TO4B 4JDTH 5ACZB 2B0SH 1YUHB 4NBYB 4S0TD 5HGAA 1JL8A 1CBVH 3MRHA 1GGIL 4GRWF 4WRLA 5C2BH 1MCBA 5C0AD 1KJVA 5JLZB 4O2CA 4KRNA 4OCWH 1NLDL 4XBEH 4PV9A 3VE0B 3NCEB 3RVVD 4PJFB 5J06A 5CEZD 2H8PB 5C0AB 1FG9C 1EVUA 5CEYB 3I6LE 5LWYH 3PWPA 1D6VH 1MLCA 2XXMB 2AV1A 4N0CD 4JFYA 5BW7C 3MRFB 5KTEH 5EU3A 3VXUE 2IQ9H 3MRGB 4FQLL 1GRWA 5FOJA 4XNXL 1PZ5A 2R2EA 3P11H 1UXSB 4HG4K 1CXFA 1ZLSH 1MJUL 4UV4H 3D69B 3IU4H 1ONQB 3MQIA 4X7CC 1DUYB 1PJ9A 1XH3B 2EH7H 3EFFA 5C08E 1MCPH 4NZRL 1QSED 4XP4L 5ELIA 3VRLE 1IKFL 3G08A 4Z6AT 1AY1L 3VFVB 1QSFD 3QJFA 3VFUB 1KXVC 3TIEA 4KFZC 3UP1A 4MAUL 3W39A 1Y18A 3TV3L 1JI2A 3SQOL 4PGEA 4UAOC 3IDJA 1G6RA 1QSEB 2PYFB 4PJ7F 1YY9C 2FSEA 4JFXB 1DZBA 3FMGH 1AO7A 1HHHB 2DQGH 2WP3O 2R2HB 3I6GA 5HHMD 1T20A 2GSIA 3WFZA 1PAMA 1JVKA 4U6TA 1OARH 1SJHA 2ZWLT 2PUQT 3WO3B 3IXAA 3VXQB 4PG2A 5JUEH 1PW3A 5HHMB 5HHOA 3B9EA 5LG1A 3N1MC 1YEFL 3GK8L 2IC2A 3F5WB 4JVPA 3L9RA 3B9KC 3MOAL 3C60A 4JVWA 4DN3L 2EXYC 3KXFA 1H3TA 3L7FB 1QR1B 5EUOB 4MD5B 3R1GL 4HGMA 4OTXH 4YFLF 4BM7A 1D5MB 1HOCA 7CGTA 1FZKB 4NP4H 3VDCA 4WW1B 1OTTD 5I0DA 4D0CB 3LEVH 3QWOA 3MBEB 2CKBL 1Q72L 5KSUA 2BVQA 4DFIA 3QG6B 1VFAA 3SKMB 5E8NA 2OP4H 2GI7A 2W91A 2B2XH 3RDTD 2AQ3A 1BMGA 4WHCA 2D4DA 2Z35B 3HFML 1CGYA 2D03H 1AHWA 1G7IB 2VAAA 1F58H 1FGNH 2ICWB 4U1KA 5F9JA 3WFDH 4ZUSA 3IDNB 1AD0B 4OUOA 1H3UA 5FO8A 4JO1H 3T4YA 4O5LL 1RURL 2EDFA 4OIIH 1AD9A 1HHJA 5I1CL 1PKQA 5D2NC 4ZXBD 2YPLA 3TF7C 3VMOA 1DBKH 4M7LL 3KS0J 4F15B 3DX8B 4P9ML 4HWNA 4LSPH 1LEGA 1QTYT 3X11A 4PJCE 3G5ZA 1I4FB 5TPWH 3BFOA 2VNCA 1YEIH 4N8PA 4ZXBB 1JV5B 5J1SC 4XZUA 4NN6B 4MJ6A 2XG4A 4YDVB 1HINH 4NZJA 2ZSWA 1LK2B 2DWDA 3JWDH 3T2OA 1QBAA 4JHAL 3RWHB 3INUL 2E5EA 1V7ML 1YYLL 1MHPH 4OSUH 1A0QL 2VDKH 3QUMA 1ZGLM 4M1GH 4UV7L 1CFVL 1U95B 3WE6B 3EYFB 5FB8B 4PG9B 3U4AA 5K9QI 2XKNA 4U6VL 2DM4A 2VQ1B 1ZT1A 3VD7A 4UIKH 4XBEL 5D1ZD 1B0GB 2DM7A 1SY6H 4JDZA 5JZ7C 3MLPA 4KJWC 3MXVH 4X7DC 5TGBA 4IIQB 1R0AH 1U58A 4M4PA 3RL2B 1CK0H 3HNTH 4UUJB 1A6VH 2Z9TA 4HK3J 1D6VL 1IC7H 2OLDA 5D1ZB 3C6SB 4FQ1H 5JXAL 3DBXA 3VGAB 3GB7A 1NAML 3HI5H 1QFOA 4MA7H 3FHQA 5L7XH 4OLWH 2YRPA 3RWGA 2HP4A 3N06B 4F37F 3FFDB 4RDQF 1NGWB 3CMGA 5HDBF 1R3JB 5JW5B 5K9OA 5EO9B 5DJ0A 3DWTA 5I1DA 5T1MA 3M1BA 2EH7L 4CJ0A 1MNUH 5C2UB 2XXCB 5HVHB 1INQB 1ACYH 1KBGL 2R23A 3N1GC 1UADC 4WTXA 4JPKL 1AI1L 1NQBA 4X7TB 3NPSB 5JNYB 4CVXA 1NCUA 5FDYA 3MV7A 5I9QB 4BQCA 15C8L 4EVNA 1DQDL 3REVB 1NDMA 3LMJH 2QQKH 1S78C 4G6ML 3VWKC 1UZ6E 1A3LH 3Q6FB 2JCCA 2MHAA 2DQGL 1FORL 1IJ9A 2VR4A 4L8BB 4UT7H 3C8HA 2H6PA 3ROLA 1G9ML 3RIFK 1DLHB 3IJHA 1A14H 3ETBF 5GRWA 3P30L 2WWKO 4K8RD 4MD0B 2EEDA 3B5TA 3S37L 4HZLA 5AD0A 2EDTA 3ARGC 1XF5A 2VXQL 2PW2A 2Z93B 1M7IA 2OTUA 1JYXA 4QOKE 2XT1B 2E7LA 4JY6B 4KMQA 1BOGB 4YBHA 5DJZB 4ENED 5EUOF 4LHJB 4OTXL 4POZC 5M95B 3O6LL 2H45A 4PJEB 4KY1H 1KIPA 3GZKA 4MB4A 3DO7A 4HIIA 1S7TA 5F93C 4B5EA 1MCLA 3GI8L 4ETQB 2JK5A 1RY7B 1YC7A 3O3BB 3C6LC 2XACC 2EZ0C 3P73A 4GKSA 5CP7A 3LEVL 2LTQB 4KROC 2DIBA 3LZFL 5DK0A 2R8SH 4UIMB 3CFIC 1K9TA 3IDMB 4PJ8A 3FN3A 1IEBA 1RK0A 2A9NH 3EAKA 4HUXA 1ZHBA 2D03L 4OZHA 2B7DT 4U1LB 3LEYL 2IBGA 4CU8A 5A3IC 4RWYH 5FV1L 1FCGA 3M45A 4OIIL 4OCMC 2FJGB 3STZB 5KSAC 4EKXA 4MSWB 3PL6D 2IBZX 1F4WH 1WBXB 2BNUA 1LP9B 2VLJD 4K9EL 1NANI 3FB5A 4KK5C 3DVNA 5CINL 3NBNA 4Y5YA 1R5WB 3U4EB 3SY0A 5D2LB 1DLFH 3PL6B 4K3JL 3S5LG 1YEJH 3LKPB 4Y2DD 3HMWH 4HKZA 3LRSB 4QRUB 3ORJA 1OW0A 1H3GA 1JGVL 1Y0LA 4HKXA 1XAUA 3FOMB 4OI9A 5JR1H 4YHNB 5FA3B 1PZUB 4XPBL 2OTWB 1MEXL 2DMKA 4PD4J 4BQ9A 5CSBA 1KG0A 3AVEA 4Y2DB 3HZVA 5JIIA 4PP1C 1IEAB 1NJ9B 2VDKL 4F9LA 1M6OB 2C3GA 4M1GL 5GZOD 4XVSH 3D0LA 3VFPB 1W0YT 2OK0L 3ZHDA 2WAHA 2R1WA 4K94H 5CKAA 3GSOA 3TZVD 2G5BA 4PJGA 1NMAH 1U91A 4FFZH 4JREC 5FYKE 1YJDH 2E8ZA 2NR6C 5C09D 3LPFA 5JW4N 1ULVA 4LPTA 3MXVL 1J05A 4Q58C 2AXFB 4EOWH 2G2RB 2V2WA 1QA9B 2D4FA 2DQEL 4V1DE 5GRVK 3FOLA 1IC7L 5C09B 3S8WA 2XTJB 4KTEH 4F80A 3VXNA 4M5YH 2ZKHH 4FP8H 2P5ED 2Q8BH 1S9YA 4E9LA 3QAZB 5GJSH 4WI8A 1OP3H 4ZFOA 4R4ND 5JOEA 3BEVA 3G04B 5DWUL 5F7MC 2X4UB 4PJXE 4F7MB 3FAWA 1KJ3H 5LQBH 3V8CA 5FO7B 3MUY1 4QF1B 1KCUL 3T2NH 4JKPL 1YMMA 1JPSL 5I1GH 4FOMA 1P7KA 3WS6C 5T33L 3VW3L 1IT9L 3LEXB 5K9JH 4GMTL 4AIXA 2DI9A 4GG6E 3LQMA 2FR4B 5EOCH 4M4RA 2VLRD 4TVPE 1S7XA 5E2VH 4IRJB 5H37G 5JDJA 3NFSH 2BY1A 2X4QA 4R0LA 1T2JA 1S9WB 3QNZB 1OAQH 4P49A 3WFBH 1KB9J 3GI9L 2HH0H 6CGTA 4RAVA 4JEGB 3VWJC 4NQCB 1LE5A 1NANH 2Q8AL 4I5BB 1IE5A 5CWSA 4MLSA 3QHFL 4UNVA 1OQOA 5E8EB 3TBTB 1CI5A 4PY7A 1REIA 5FUOL 4HMDA 2Y6SD 3JV6B 1GZPA 5GGSA 5E6ZA 1CT8A 4U6YB 1MFNA 1NCTA 3PDDA 4C57C 2XKSA 3BPLC 2CLZA 3QDAA 3I6LD 5AWNL 4MDIB 4NUGL 3LIZH 2IAMD 4L29B 5J12B 1CDYA 5IBLD 4F8QA 4QRRA 4PREB 3WNPA 1U93B 4Q74A 4OGYL 3VXUD 5D6DA 3FO1A 2GUOB 4X4XA 3FB8B 1GPOL 1DN0A 2VR9A 3QEHA 1F3DH 2W38A 1P69B 1UZ8B 2ZCKH 5C08D 4NNXB 4S1RH 1HILB 2VITA 4OCLC 2VKXA 2XNAB 4ODTL 3WNKA 4K71B 1JHLH 1OGTA 3VFWB 1I9RL 4QTIL 3V5HB 5ERWA 3U9PH 3LN5B 2DF3A 3SN6N 3WXWH 3OKNA 3JWOH 4JLRA 3QUML 4OGAD 1AXSB 2DTSA 2ITCA 1DCLA 2GEEA 5JR1L 2ADFH 3GMRB 4NGHH 5CGMA 3ES6A 3FQWB 4TPRH 3UPAA 4JQXC 1ZEAH 3MRCA 4FQ2H 3D39B 4ZFGH 5DA4A 4Z7WB 5DRNA 2IFFL 3JV5A 3WJLC 2B1HH 1QLFB 3VFSB 3V4PH 2JIXB 3UJIL 3U6RB 3EHBD 4FFZL 4KWUA 43C9A 3T0DA 1NC2D 1YJDL 5IB1B 5GS0L 4HQQH 5IG7B 3KPTA 5C9JA 5D1QA 5HI4D 3MV9E 3TLRA 3TNMA 1YDPB 2ATKA 5I15H 1R5IB 4O02L 1VEPA 1NC2B 5TE4H 4R4FH 3LD8B 5GHWL 4ELMA 1HEZA 5CHNA 3CCHA 3WN5A 3H7LA 2ORBH 2VB5A 1C1EH 1KPUA 2ZKHL 5E70A 4FP8L 2F8XC 3S6CA 4Z77B 4LLUA 3C8KB 1IBGH 1WWAX 5EU5B 3GMPA 4LLVB 1I1AC 4FQXD 4P9HC 4KDWA 1Q94A 4I2XE 3RHWK 3ALPA 1Q9WB 4PLKC 4Y4HB 4ALAL 3CC5A 1UJ3A 5DRXB 3V9FA 4RX4D 3ARFD 1BVKB 5E8PB 5FYKU 4ODBD 1D5BA 2IWGA 5I1GL 4FQXB 2D9QB 5DJAA 3UMTA 1ZVYA 3CFCH 5C0CB 1WC7B 1QP1A 1J0IA 4MS8C 1C5BH 3SJVE 1RZIB 4IRSC 1I7RB 1VACA 2X4SB 2ZCHL 4KQ3H 4OGZA 2EIEA 2L0DA 1P7QB 3L3IB 3WEXA 2YC1B 1UYWH 4J2XA 1E27A 4OZFH 3FRPA 4UOW1 5B39G 5E2VL 2FO4B 4ZS6C 4R9HA 1BBJA 4S2SB 3I85A 3REWA 4DVRH 3NFSL 2CLVB 4L3CB 1X5FA 1SBBA 4TRPH 4IDJL 2ICWJ 2VL5A 3D3VE 4CN4A 5DSCA 2LAAA 5JW4Q 1SYSA 4H8WC 3FAXA 5K33A 5EBWB 1A6UH 5JHLH 4Y4KA 1CL7L 5E00B 3L1OH 4CMHB 1ORSA 4Z5RA 3TGXA 4XCNA 4NQSB 4ZUTA 4PRNA 1EEZB 4FQCH 1CXHA 1YEGH 1GIGL 4G9FE 3GSXB 3WJJC 1HCFX 3EYVA 3ULUC 2A6DA 2H2PC 3EIFA 2X10A 4NN7B 4XP6H 1WIUA 3THML 1INEH 3C87A 3QDMA 5BZWA 3KAAA 2W0PA 1O7VA 2IMNA 1H15A 3NCMA 3LIZL 1U41A 1AQKH 1G6VK 2P48B 4RFEB 1RAMA 5GGUA 1KXQE 2BVYA 4LSQH 1N0LA 5DHVB 4I0PB 5C07E 4YIQB 25C8L 2HT4C 4GAYB 4Z7UE 1QBML 3IT8D 4QGYA 5J3HC 1BFOB 2VQTA 1KT2B 3GNMH 3HC0B 5DMKA 4HS3B 3UTQA 3K46A 3MV11 4PRBA 1QVOA 5JA9A 4QHUB 5DO2C 3U9PL 4DKFL 3OR6B 4Q97A 2DKMA 1UM6H 3MFFA 2W9EL 4W6WB 4X99A 2FWOA 3NGBB 5HPOA 1A6TA 3BP5B 3B5HA 5FA4B 2V2TB 4WV1A 3QUKA 4P5MA 4YPGB 1RJLA 3QXAB 1UWGH 4YBLC 3TO2A 1BIIA 4MHHG 4ZDHA 1I8KB 2CXKA 1I1YB 4QOKD 3IJYB 5HVWA 1JHKH 1DSFL 1U0QA 4HIXH 5C6TH 1CGTA 4ZS7H 1U8MA 3LH2H 4ZPTB 4APQB 5CJXA 1U8OB 5E7FA 5BS0E 3ARTA 1EERB 4JFPA 4QCIA 1EA9C 1H8NA 4HWZB 2CPCA 1JYWA 2DAVA 4X4ZA 4NCC1 5I1HL 5HHNB 4A2MA 3B3IA 3CFBA 3MNVB 1AKJB 3AROA 5CGYD 4UU9A 1YPZA 5IK3A 4FFVD 1X5XA 3UTTE 5C8JA 3STLB 3HC4L 1KEMH 5IR1B 2RIKA 3JZ7A 1I8IB 1NBVH 3EYUL 4MYWB 5DRWB 3RTQB 1JUFA 1FO0A 4Q2ZA 2P8PA 2GJ6B 3MLTB 2QSCH 5E8DL 4ZSOE 4U6XA 2ARJA 2AVGA 4J8RB 3RVWD 2YMXH 5DZOA 5GISL 2IANB 2A9MH 1KCVH 1A7QL 4C83A 4P2OC 1ODAA 1ERNA 4DQOH 1E4XI 5KVFH 4YBQC 3KPRA 4NO3B 3OV6A 1UB6B 1AR1C 1OVZA 4L4TE 1NEZB 5TH2B 4JHZA 1N7ML 3BDXA 4PP2B 3MYJA 3U79A 3PGCB 1MHEA 2SEBA 4PJCF 3PP4H 1CG9A 1G7QA 2VZUA 3ZDZF 4XPTH 4OZGE 5F3BA 1F6FB 1ZA3B 2KBGA 5BCAA 4XWOC 2BY2A 4N1EA 4AYFA 2F5AH 2M1KA 5JIHA 2XN9E 1TQBC 2ZUWA 5FYKD 4M6ML 3ILQC 2W65B 3PWUA 4WWID 5EULV 3BAEH 2MJWA 3RVXC 3SPVB 2M26A 4KVNH 1WBYB 4PJ7A 2HFTA 5FYLH 3WNMA 1VGEH 5EPMB 1RUAH 3T65B 4CVZA 2AGJH 2NY6D 4X4YA 1RHHA 4KHTH 3L5XH 4V1DD 4WFGE 2Y06L 1I8LA 4HWBL 5DUPL 2VISB 5C7XH 4XPHL 1OTUD 1RUPL 1EGJA 4YHIA 5GSVA 1NGPH 4LSQL 3UTZA 4HFUH 2NY6B 2JJTA 1CICC 3QI9A 5EOTA 4JQIL 3GNML 1W2KT 4NKIL 1UB5A 4NO5A 4U6HB 2HFFB 4F7TB 4PJDA 2CIKB 4KI1A 2ADGA 1MH5A 5D7IF 4OF8A 43CAB 4HULB 4Z7VE 4BFIB 4HKJB 2MPAL 4ZG1A 5F70A 2Y23A 1II4E 3QUXC 3QA3A 4JFFB 4H25B 5DA0B 3IFPB 2FGWH 1QSZA 5FHBH 4Z95H 1CU4H 5MENE 1IQDA 4JANA 5KOMC 4E0RB 2HVJB 2YXMA 4TVPD 1UZ6F 5IIEA 5C0NC 3VGFA 1UWGL 3MRKB 4M6AA 1I85C 1Q9KB 3SO3C 4GG6B 4Y16A 3HG1E 1M4KA 3W11C 3QT2A 1KTRL 3Q5TA 4XCYA 2NY4B 4QXUH 1E4WH 3DX6B 3TO4C 3C5ZD 2IADB 3MLVL 2OM5A 2VTFA 1E4XH 3WIHH 1QG3A 2A6IB 1KGCD 4WEBL 3IXTB 3CLFL 3C08L 4JO2H 3ZKXB 1QFUH 1BJ1J 2Z92B 1JHTA 3IDYB 1AR2A 2FATH 1PG7H 2CD0A 1FYHB 2NW3B 3FQRA 2OS7A 1RIVH 4TUOB 4BFBD 4G8IB 4XAWL 4C56A 4JY4B 4NFDA 3PWNB 3IB4A 1T7XA 3I75B 5E2TL 4HJJH 5T1DH 3R06A 1RMFH 1N3NB 3F65A 4JZJB 3V6OC 4QHLA 2Z8WC 1P5VA 4G6KH 2XWBB 1Q9LB 3L95B 1OF2A 2D7TH 3FT4A 4OCRL 2ADJB 1N59B 1HI6A 3MRIB 3BJLA 3QPQD 4ONHA 2DOCA 5GGSY 2GFBA 3BQUD 3DX9B 2YMXL 1OAZL 1WCBA 2OJEA 1YEKL 1LK3H 2A9ML 3G9VA 3CVHH 2FB4L 5J13B 4OJFL 3LQAC 3ZE2F 3RJQB 1EVTC 2HFEA 1Q0YL 2BERA 2K1MA 4X0KA 1PX3A 5DD5L 4OLYH 3UPRA 4GH7B 3KPPA 3OJDB 4GXUN 5TQ2H 3TPUB 2QSQA 1BD2A 2P24B 5BMFH 5B8CA 3KJ6L 1QPPA 4MB3A 1CD1A 4M03A 1E4JA 4XPTL 4K7PH 5T1KD 2BHUA 2DJ4A 3BIKA 1CIUA 4F8TA 5A16B 4X5XB 2AW2A 3EO9L 4YH6A 3L3HA 4D9LH 4PJIE 5GGTA 3O4LB 4JM2B 2GK2A 4H1LA 4JHWH 2OQJA 4JGUA 2LQRA 4OFPA 3T0EA 3D0VA 1M71B 1N0XL 4NSKA 2Y7QB 3HLAA 4MCYA 4P5TC 5CFHA 2N56A 1FL3A 1IGMH 2V6HA 4BZ2H 3MV9D 3ILPA 3FB7B 3KPOA 4OB5H 3JVGC 3IJSA 3ZLQC 3QQNA 3O2WL 5FYLL 1FG2B 3C5SA 1URLA 4KPHH 1NSNH 3MLRH 4XNYL 3BN9D 4HBCH 1F4YH 3MBEC 5EBMA 3F7YA 5EIIA 3MV9B 4BKLA 1NBZB 4IMLB 2X1QA 5GRVL 4DVBB 3FKUS 1JMXA 1HKFA 3QIBB 1HNGA 1RJZA 4N0FA 3P4OB 5I1AB 1WIOA 4PRPE 2OR9L 3FL7A 1MHHA 4K3DL 4U1JA 5A43C 4I18B 4DZBB 3VXMA 5LGJB 5ACLA 2DI8A 3AREA 4NUJB 2O5YH 4OIBA 2P5WA 4PB9H 3OKDA 4WJ5B 3CH8A 4PJXF 3A6CH 1HNFA 4JFOB 3EW3B 5ESQA 3NABL 2BVPA 4I2XB 3UJTH 1OTSC 1XGTB 4GKOA 4AL8L 3SJVD 2DQDL 1P84J 5FHBL 4ZXBC 5DFVC 1W72H 4CL7A 4Z95L 2BSTB 3VMPA 2MKLC 3ARUA 5IQ9A 3RGHA 4JR9H 2EE6A 2VC2H 1AGBB 5TDOB 3SDXE 3HI1B 5JMOC 5T3ZH 1OY3B 5M94B 2EKJA 4TQEH 4PGCA 3V6FA 5JA8B 4L8CB 5F6HJ 4F7CB 1A7OH 4L8SB 4OLVH 5BRZB 4P23A 3S4SB 3D3VD 3RDTA 4HIEA 3GSVA 5IBUB 1NMCB 3CD4A 1T7WA 3RY5A 1MUJB 5KVEH 4NCC2 4OKDA 1MJ7L 2YUVA 3OKKB 4UDUB 5D70H 2X9YA 3MODL 3O6KL 3MACH 2C1PB 2ZUUA 3HB3C 1GOFA 3TYFB 4P2QE 4LK4A 5EO0B 2ARJQ 1CGWA 4KKBD 3V4UH 4G9FD 5HYIA 4OQTH 2AK1H 1LNUB 2W0FB 1QLEL 1ZE3C 4GKZB 1J7VR 1PG7L 3TWCL 4J3VA 1YY8B 3E0GA 3NA9L 4NKDA 5DDHA 5BW7A 4Z76A 3D25B 4IIQC 4KKLD 1FO0L 4Z0BH 3QEQA 4X7SL 1CLYL 4U1NB 1D9KA 1CQKA 5IVXE 3MR9B 4KZEH 5EZOL 4HF5H 1U3HD 5D1ZC 3AXLB 4NNPH 2CR3A 2HT2D 2YZ1A 1EEQA 3JTTB 4EI6B 3KYNB 4OFKA 5I6XC 1TZHA 4P99A 3IDUA 2KZWA 4F58H 2ZOLA 4QRTA 5C07D 4LCCA 4LIQL 3EO1B 4XX1G 2NYYD 3WHXB 1GC1H 1MAJA 1U6AH 3QDGB 5KW9H 2P4AB 1XF2B 1CFSB 1IQWH 5C70A 2GAZA 4DK3A 1G7HA 4JJ5B 2AEIT 1ETZA 4HKBA 4PLNC 3NPSC 1ES0B 2VDRL 4LSUH 5I9QC 4Z7UB 3D85D 5DS8B 4R2GB 5HGHA 2Z0BA 4WY7L 5H2BB 4NRXB 4XVUC 1TJHH 2EO1A 3DETC 3GMMA 3T77B 4OI7A 1HE7A 5F1OB 3H42L 3RWEB 3RWCA 5GSRB 3EGSA 1XGQB 2EDOA 2J8OA 4Y19A 2VDLH 4EUPH 2J12B 3X13B 1OT2A 2P47B 2KUTA 1IMHC 4A6YH 3EOBA 3KWWB 3DJ9A 3B9KA 5C0IA 4BH8B 3ISWA 1N6VA 1EAPB 5MHSE 3MXWL 5MEQA 3NIFE 4BK5A 2UVFA 2G60L 1EEUA 5DQDH 3DNKA 3LY6A 2DTMH 5C0JA 4WHYG 4PJBF 1NDGB 4MJ5A 5TQ0L 4WI9A 3L3JA 2D0HA 4ZO8A 3DMMB 1M7XA 5BS0D 1UCTA 4PGJA 1KELH 2UWEB 3OGCA 2J8UE 4FS0A 1A6PA 2R9HC 4HT1L 5FYJH 1F4YL 2LTQC 3PHOB 3RA7L 4ZYKA 3QWRA 3OGOE 3GKZA 2H32H 3BE1L 3PV7A 5T1LB 3RGVB 1C16B 3VDAA 3WFCL 5GRUH 5JORA 4LARH 1I3GH 1K4DB 5D2NA 4HIHB 1MIMH 3UTTD 4L8DB 3DUSB 3MRRA 2R0LH 5KVGH 3S96B 4I48B 3D2UD 4YDIL 5T3XH 1IM9A 3BVNB 2O5YL 3DVFA 2F53A 5FUCC 3TH3T 2APTA 4HC1A 2CUHA 3SGDI 1MPAL 4I4WB 3D2UB 3GSWB 3VU2A 5IW6A 4W81A 3UJTL 3VFNB 3VFOB 4AH2A 3RNQA 1CE6B 5DUBB 4ODVH 1ZHNB 4L4TD 5C3TA 1W72L 2NPLX 1I7TA 1FFPA 5DLML 1SVZA 3HRZA 4KRLB 3W5MA 2AI0L 2R29L 1QFPA 3QXDA 2V7NB 4TQEL 4HLZH 4OLXH 3U48A 3ESVF 2N1KA 3D18A 2HJFA 4L4TB 5J6GB 4LCUB 4OCSL 2DLTA 5FDWA 2AK4E 3UAJD 3S34H 4Y2DC 2XZQH 1DBBL 5FGCE 1C5DA 1AGDB 4ODWA 4ODXB 4PRIB 4KI5E 2FHFA 1G6RH 2ZUSA 1FFNA 1FHGA 1LO0H 2ZOKA 5F7FA 1A3RH 1HH9A 3HZYA 1MCKA 3DUHA 1L7IH 2XN9D 3RL1B 2IGFH 4X8JB 5E2WH 5GZOC 2ZPKH 4WTZA 5EWIH 2VLJA 4EN3D 4YX2H 1NEUA 3K81A 1J8HE 3TBVA 4XVJH 1CE1H 1AO7E 4BUHA 3PHQA 2HLFC 5F96H 5HDOA 3MGTA 3PNWA 3VXPB 4F57L 3VD3A 4EN3B 1HHIA 1IGYB 4R90L 4WFGD 4JFEA 4HF5L 3T4AA 4J4PA 2XTJC 4DKEH 4NBXB 3EYSH 3P9LB 1OPGL 1U3ZA 5E6IC 3IETB 5HHOE 5SWZB 1MWAH 2R2BA 4ZD3H 1IEHA 1KIQB 3P9MA 4NIKB 1YN7B 3OKEA 4O9HH 5KW9L 1VFBB 4YHMH 2BSSB 2BVEA 3VXRB 3DYMA 3VWKA 3IVKB 1B4JL 2A77H 1S7VA 4R4NC 3NH7H 5F88B 3SKJH 4I13B 5I1IH 3X12A 4C58B 4UOW0 3LKOA 1U2CA 1OAYH 4FQPA 3BP6A 4FXGA 5DQ9B 2IQAB 3GHEH 4GQ9L 4YAQA 4HH9B 3MLZH 4QHNA 2VDLL 3MRJB 5MEND 4Z7VB 5ID0B 1F8TH 1IZKA 4QYOB 1QYGH 4KUZH 2EYTA 2DQFB 1EXUB 4PS4H 4IRJC 1EFXD 2XTLA 4JN2B 3OWEA 2P5EA 3UBXB 3DECA 4GUPA 4DWHA 1RK1A 5MENB 3HG1D 1PKQE 3JWNC 2AJXH 2IMMA 2AXGA 3SGDH 1CS6A 3B6SB 4WUKL 2QHLA 2X6MA 3OJ2C 4G6JL 1RUML 3HG1B 3GIVA 1G7PB 3SOBL 5I30L 5ENWA 3ARVA 4UDTA 3S5LA 2CJUH 4TSCH 1A4JA 2EH8L 1OT1A 3O81A 3QUYC 4MX7A 4IEFB 1XGYL 3BPCB 1JK8B 4M8VA 3T3PE 1HIML 5F7LB 4NQEA 4CN6A 1P9MC 2C3WA 1WZ1H 3QIWD 1GGCL 5J12C 4UB0H 5IVOA 5JOFA 1L9NA 5L88L 5DT1H 4EXPX 4KUCF 4X9GA 2IH3B 2V5RA 4GW1A 3W9EB 3L3KA 3MRBA 4MXVE 4NO0D 1CLZH 3QIWB 1DBAH 1VADB 1FFQA 4RIRA 4E42B 4M62L 2I9TA 2AV7A 3VGGA 5ICXA 3GSNH 4LKXB 4WI3A 4FQJH 4IMKC 8FABB 4K71C 1ND0B 1ZKAA 1TXKA 4NO0B 4C4KT 4MQSB 3QNYB 1XCQA 3WKMH 1INDH 1BZ7A 4WU7A 3RKDC 1YECH 1OAUH 2IH1A 1TZGL 3TJHD 4JRXA 3EOAB 2IALA 4LPUA 5C92A 2HLAA 3PDGA 2BFVH 4R7DB 4XC1H 3ZO0A 3S88L 4AIZB 4GRLD 1J0ZA 3Q6GH 2FJFA 3H6JA 3BGFB 5FOBB 2HTKD 1J1OL 2LABA 1S5IL 3SE8H 4I3RH 3CVHB 1QFWM 3QFDB 3BN3B 1OCWH 4XXDA 2XWTB 4Z78B 3QXVA 1FZOA 3GGWB 1DE4A 1WBZA 5IMOB 4KVCH 4S1SH 3VXUA 2MQCA 4OZGF 1A3RL 1JNNL 3L3DA 4N8CH 1T4KA 3BMVA 5I17A 3VXTB 4TNWK 3GJFA 4GO6B 4GW5B 1F45A 4QY8A 1CN4A 1H3XA 1MCOH 4QRSB 4N8VB 5HDQL 1P4IH 4YX2L 4MNGB 5C08A 4BSVB 3RWFB 1AGEA 4XBPA 2JCCE 4F7PB 4U1SA 5ALBH 4R3SB 4NN5B 3LD8C 4NM4L 4R4BA 1XF3B 4PGDB 4B0MM 1SYVB 4G43B 1JGUH 1K3ZA 5IROC 1ZWIA 5JXED 3ZKND 5CBEB 1TJIH 2FDBP 2WINB 5F6IB 1NCCH 4LNRB 3WL9A 1KOAA 1U8NB 1XIWC 4FN0A 4OD1H 1U8PA 1U8HA 1AFVH 1MWAL 2FEDC 2JB5H 3IF1A 3VGHA 3S3JA 2BNRE 3DSFL 4FQQB 4PRPD 4FA8A 4POYA 1BPVA 3UPCA 3WS6A 5MEPA 3HCVB 1MCIA 3SBWA 4Y4HC 3DX7A 5AZEL 4JGJA 5EIVA 4BELD 1BP3B 1IC1A 4JG0H 5B4MD 4PRPB 4FQXC 1MJJB 3OKOB 1MJ8H 4W70A 1UWEH 1A5FL 2I60L 4S10A 1A4KA 2F19L 2D7NA 4WEUD 4LLMA 1XR9A 4ZOCA 3H7BB 3SCMC 2AJ3B 3HR6A 3PHSA 4O51A 2N7BA 4OZHE 1CFTB 4KJQC 3MJGX 3E6FA 4PYGA 2P45B 2AJXL 1CFQA 2J8HA 5T3ZD 4DN4H 2JJUA 1FYTA 3OSKA 5GGQH 5DUMH 2Q7YB 1T66D 4UOJA 1R3KA 5D7LA 4DTGL 5FUZH 4WU5B 3VGEA 3L3OA 4P2QD 2EEBA 4QEGA 4YGVA 1GZQB 5F89B 1G0XA 1AXTH 3JWDC 4XP9L 4PJCA 5J1AA 1FGVH 2XQBL 1DQJA 4P2QB 3EFDL 4JAMB 3U7YH 3JV0A 2V17L 3N1QC 1LDSA 4HC1L 3S35H 1FP5A 1PSKL 2FRGP 3H9HB 5EC2A 2NZ9C 3HUJB 4FZEH 4P46D 3HE6B 1UACL 2HT3C 4UB0L 3AAZA 5E8OA 4RFOL 2HRPH 2FX7H 3IKCA 3MPCA 1AGFB 4I0PC 4RMVA 3L7EB 2W60A 4PJGE 1A1OB 3BW9A 4UTAH 3DRQB 3P3YA 1DBAL 3BDYH 1S8DB 1FZJB 2HMIC 1B0RA 3LN4A 1T21B 4YHLH 2X4NB 4F9PC 4M02A 2IEPA 1Z3GL 2VXVL 2HTLC 5L9DH 4AENB 3O6FD 1CD8A 3B9DA 3SDCA 4JQXA 3GBNH 4M43H 4WWKA 2EDBA 2O5XH 1FAIL 5J6HB 1KTLA 1KNOB 3NFPB 1YMHA 3RUGA 1T5WA 5GS1A 3FT3B 4ZFZB 3NGBC 4J3WA 2RB8A 3O6FB 2M2DA 5D5MB 2Q86B 1O5DT 3PXHA 3QUZD 4WW2B 4OCXH 3X3GH 4YR6B 5MHSD 4M7LT 4GBXA 4K3EH 4D2NA 2R0KL 3IDIA 2EDYA 1OHQA 3GIZL 3QUZB 3L3GB 4NJ9H 4ZOBA 4PJIF 4CNIA 5D7IA 4I1NB 2YD8A 3BP4A 3BPNB 3TBWA 1EUUA 2FZ3A 4J6RH 4OV6F 3L5WB 5IFHH 2IBZY 3BZFA 4APQC 1RZGA 3RRQA 2R0WL 5I2IB 4QXWA 4L9LB 4Q6IA 4N1CA 4WGVB 3HA0A 5SV3A 4EUPB 3W2DH 1UH2A 4PY8J 3OF6A 2GCYA 3WIIH 3LKRA 3QCTL 1XZ0A 1TJIL 1RZ8A 2OZ4H 4I8DA 3QIUD 1S7WA 2VIRA 3GJEB 4YHOL 1FVEB 5DK3A 5GIRA 5LAXA 4GAJL 2ZG2A 2DWEB 2OL3H 4HUNB 2JB5L 4NQXB 5DJ6B 2YKLH 4HEPG 1CXEA 3RY4A 2C3HA 5LGHL 2X1XR 3QIUB 1KPVB 2FO1A 3RTQC 2RR3A 1CD9B 3EJZC 3ROOB 4IRSA 4MXQC 3UDWC 1P53A 4LOUC 1FRGH 2PETA 1JNHA 3CSBA 2XWJA 3EYQD 3MJ7A 2EDWA 4JG1H 2CDGA 2MWCA 5CJQH 4QHMB 2A6JA 5HGDA 1KN2L 1CF8H 3C9NA 5HGAB 3DV4A 4LSVH 1UA6L 3D6GA 4JPWH 4XP5H 3LB6D 1J5OL 3OL2A 3QEGH 1KJVB 3KPLB 5F44A 1WAAF 5E08H 5AUMA 4O2CB 3DI2B 4MA8L 1RI8A 4WDIB 4PV9B 1EHLL 5HD8D 1BM3H 2WBKA 3FQXB 2HRLA 3HAEH 4QRRE 4XP1H 2AK4D 4OBSA 3R4DA 3KYKL 3SDXF 1KFAL 3PWPB 3KNBA 3JBG7 2VUYA 1MLCB 1Q38A 3WJJA 2OSLB 5D7JC 3TPKA 5HHXH 4JFYB 4DN4L 2VO5A 4GRMA 1L7TL 5EU3B 4RAUA 3MLWH 2F74A 3T2PA 5J56B 4LSRL 5FGCB 1PZ5B 3D9AL 4WCYH 4C4KO 3LKQA 4WUUB 4I9WE 1T89A 5EU6A 3EFFB 2VWEE 1QNZL 3L6FA 3N0PB 1J8HD 3MBXH 3K7UA 3G08B 1MQKH 5K9QG 1AO7D 4EBQL 3HMXL 3QJFB 4B41A 5EU4A 3T3ME 3TIEB 1A7PH 3W39B 5CZVH 4N9GB 3ZMRA 3QCVL 1Y18B 5TDPA 3DROA 1K8IA 1NL0L 4P59H 5CP3A 4MQTB 1G6RB 2NMSA 1AO7B 4K94C 1Q0XL 4N0UA 3WS3A 1XMWA 1BEYH 2YWYA 5KSBB 12E8H 3B9VA 3M07A 5IVXF 5HHOD 1T20B 1MELA 4G8EA 4UTAL 1SJHB 3BDYL 3IXAB 3C60D 1K3IA 4HK3N 4LCWE 4FNLL 1DP0A 3CK0H 3BH8A 3RI5F 3U30B 3CLEL 2B20A 5HHOB 4KGLA 4LCYA 5L9DL 3ARQA 3VD9A 4Z8FH 3EJYC 1GGBH 1VA9A 3GBNL 4Y1AA 3KXFB 4RISH 3T0BA 1HOCB 3MUJA 2EYSA 3HI6H 2R1YA 2BRRH 1RQ5A 3KS0H 1V8HA 4NM8L 4Y4FC 1MI5E 4V1DA 1T1WA 1AH1A 5KSUB 2BVQB 5MERA 3BYTA 5E8NB 4V2CB 5F7YC 4K3EL 4HK0A 3BGMA 1AC0A 3PDOA 1RZJC 4P0DA 4OFDA 2NY4C 3HS0B 1AHWB 2VAAB 4U1KB 4ZUSB 4D9QE 1I9JL 1YNKH 2K3TA 3T4YB 5I8CA 1AD9B 4MB5A 1HHJB 5SV4A 1PKQB 3KLHC 3DOSA 2YPLB 2NY0B 1QR4A 2VDNH 3LKNA 3L5HA 4G7VH 2OTPA 1ZA6A 3IDYC 1LEGB 3X11B 4MCZA 5B3JF 3G5ZB 2NW2A 1IGTA 5D8JL 1U8KB 5D1XD 4MD4B 1A22B 1F4XH 2J8UF 4AEEA 1OAKL 4OGXH 1FE8H 4XMPH 4MJ6B 2YKLL 1WSST 1TTFA 2FIKB 2DWDB 1S9KC 1KB5A 4LQ1A 4NZTH 3DSNA 1LDPH 4HPOL 2MNUA 4JFHE 4MNQE 3U1SH 4OAWA 5FV2A 4X5WB 1SBSL 1BFVH 3MRQB 3O2DL 1MFAH 1S7UB 5J13C 3QUMB 4NO2B 4O2EA 4YJZL 1NH6A 3BKMH 3BI9X 4H88H 3QPQC 3MGOA 2XKNB 5CIPH 1ZT1B 5C86A 1PDKA 1C5CH 5IUSA 5GS0D 2CQVA 4P3DA 3GHBL 4KC3B 2XKUA 4JDZB 2E9JA 2EO9A 3TCLA 3ULUH 1LO2L 2W0KA 2EDNA 3NPZB 5TGBB 1VKXA 1U58B 4AG4L 3S36H 3PGFL 5E2UL 4ZFFA 2HFGL 3HPLA 4L9DA 1TVBA 4M6NL 2CDFA 5FGRA 5DTFB 3CPLA 4S1QH 1S9VA 4BJLA 4D0BA 1UM4H 4IBLT 1NCAH 3DBXB 3GB7B 4M5ZL 4JM2C 4YDLB 4AY0A 3KYAA 3GSNB 3H9ZA 3MLWL 4D0DA 3RWGB 4HUKB 4K2UL 4FQIL 3BWAA 3WD5H 1OAXL 5DD0H 1ZTXH 3EDEA 4W6XB 3BQUA 5I1EH 1PY9A 5K9OB 2O26U 5DJ0B 4KI5F 4N0YH 5I1DB 5T1MB 3JWOC 2PTTA 3C2AH 5DJYA 2BOCA 3DO3A 2R23B 4YUEL 3ZE0E 2UZIH 2P43B 5C0BA 1S7QA 4CVXB 4EVNB 2X05A 3MV7B 1SQ2N 2EC9U 5DVLA 5IBTH 1FVDB 5TFSH 5HPMB 1F6AB 2AQ2A 3RFZC 1NDMB 3WUZA 3BUTA 1IGCH 2EE2A 4PV8A 5J9PA 5C0GB 5I1LA 3I3EA 2JCCB 4DJMA 3EO0B 5LVEA 4YNYA 4M7JH 1A1NA 4NNYA 12E8L 1ZSDA 3QIBC 5IEKA 1DBMH 3BN9C 2H6PB 3CFKA 4QT5A 3ROLB 4OD3H 2BNRD 4OLUH 4Q9RH 5I66B 4PJBA 3IJHB 1JGEA 4QXGH 2PW1A 4I18C 4HZLB 2FH6A 1DUZA 1R3IH 1XF5B 4YGAB 2PW2B 3VFGH 3ZTNH 1X5KA 4M8QB 1M7IB 1T80A 2F54B 3R8BB 1GGBL 4P2RB 3PABA 3FB6A 3NIGE 4HFWA 2VXUL 1BBDH 2ZCLH