4DK6A

Structure of editosome protein
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
127
structure length
127
Chain Sequence
QVQLQESGGGLVQAGGSLRLSCAASGRTSSLYSMGWFRQAPGKEREFVAAISRNGANTYYTDSVKGRFTISRDNAKNTVELQMNSLKPEDTAVYYCAADRFPTMEVVTIMTNEYDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords single domain antibody VHH
publication title The structure of the C-terminal domain of the largest editosome interaction protein and its role in promoting RNA binding by RNA-editing ligase L2.
pubmed doi rcsb
source organism Lama glama
molecule tags Rna binding protein/immune system
total genus 36
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dk6A00
4ELKA 5LGJA 1ZGLA 1BWWA 1U8OB 3Q5OA 2YD4A 2Z8WC 3BWUC 3IXTB 1WEJL 3O8XB 3T2PA 4YHKH 4KAQL 3SKMA 5L88L 3ZDXF 4ZFFB 4UQ3A 3VFVA 1BQHA 2VDPL 4H1LH 4OFYA 4Y19E 1BBJB 4BSJA 5K9QI 4NPYA 1QKZH 1I1YA 2HN7A 3CDCA 5E2TH 4EI6B 1HYSD 3QCUH 4AEEA 3EOBA 1K8DA 4RCAA 5J13C 5IMLA 1NDMA 1ZVSB 1HHIA 3VDCA 4MXQC 3WIIL 3VXOB 1XCQB 2QKIB 4OF6A 5I73B 2KDGA 5HYQB 2CDGA 2J6EA 1IFHH 5D96C 3RKDD 5K33A 2PYEA 1XZ0B 4HZLA 3Q2CA 3M1BB 4XI5D 2VAAB 1OARL 2F5AH 5DA0B 4RNRB 5D6CB 1EGJA 2ZUQC 3P30L 3C60A 3EDFA 4LU5H 1WJ3A 3MFFA 4AH2A 3IDIB 1LK2A 1IC5H 4OZGE 1QVOA 4AYFA 4W4OA 4PJXB 2DQHH 1FPTH 5ICZA 4DKFL 2LAGB 4Y2DB 1YYMH 2VR4A 4PRIB 4AMKL 4WRLA 3D6GA 3P9MA 4Y5YC 1ORSB 4G3YH 4IOFD 1II4E 3MMEA 2UVFA 4XPHH 3MRIB 1CICC 1PLGH 4B7LA 1D5ZA 1CK0H 2V17H 2D0FA 2VL5A 4YHIB 4E41B 3ULUE 4XCYA 4RDQG 1U2HA 3C09B 1J11A 2O5XH 3EDJA 1QFPA 5M95B 4FFWD 1JZ5A 2FX9L 4QRUB 2DYPD 1UXWA 2I25N 3DARA 4YHLH 4TTDD 3QI9D 1CFQB 1J8HB 4DEPB 2IQAA 5ALBL 5GJTL 1PFCA 3QUYD 4RFOL 4M6OL 1YPZF 1ZLSL 5DJ0A 1FE8H 2YD6A 2XIDA 4JVWA 4G6KH 1HSAA 3ZHLA 4XHQA 3N85L 2QQLL 5ETUA 5C71A 1LEIB 1OM3L 4LSUL 3QAZB 4UOW1 1Z5LB 1P7KA 4OJFL 4HK3N 1L0YA 2DQTH 3VFTB 3IDNA 2EO1A 4JO1H 2R1XA 4DOHB 4WEUD 4KK9D 4IRZL 4AJ0A 4I3RL 5FA4A 1RJYA 4WDIB 2HT2C 5GISH 5D5MF 2D7TH 3H8NA 3MLWH 1YY8A 5ITFA 1U58B 5IFJA 2JB5H 5BVJA 2YXFA 3QCVH 3FB5B 3ARDB 3M45A 4KV5F 4IS6A 3BVNB 4PG2C 3LIZL 5F1NA 3SOBH 4ZO7A 2ZJSL 1GVIA 1KELH 3H0TB 3ULUD 5D9SA 3RTQC 4ZOCA 3UTSE 1MFNA 4RISL 1EBPA 3MRRB 2ZZUT 4RIRB 1KXVC 5E8NB 4LAJH 4AY0A 4EDXA 2CRMA 1ZA6A 3VFPA 3G04A 5E5MA 1G9MH 2BSRA 5EBGA 2RCSH 4K94C 1RZKL 1FNGB 4KDTC 4XX1E 1IM9B 1A7OH 4E5XB 4QRQA 4RGOH 1A9BB 3QUZA 1HI6B 4HWBA 4QXGL 4X0KA 3QQ9C 3U4EA 2C7UA 2OI9C 1DLFL 2DL2A 3FFDA 5JA9A 5KVEH 5JR1L 3V6ZA 5F93C 4NZTL 5AWNH 4Y5XA 2E6JA 4M8VA 4ZXBC 1XR8A 4IM8A 1F8TL 3WEXA 5KJRL 2EO9A 3B6SA 4NRXA 4FQXA 3EJJX 2FEDD 3U82B 4LF3B 1UZ6F 5IV2A 3SKOA 4XVTL 3BRGC 1DEEB 3GMQA 3MNVB 4JZOA 4PJ9A 3ZKMC 3GM0A 3T0EC 4EIGB 1I8IB 2VDQL 5E9DA 2E7LC 1I8MB 3AY4A 4ZNCD 4LRNH 3S36L 1KCSH 3CJJA 4OKVB 3UTSD 3UYOD 1EUTA 5GZND 2FX8H 3E0GA 4GUPB 3NACL 3WUWG 5IQ9A 4BZ2H 3GJEB 1JI2A 4D0BA 4LDLB 5D71L 1TTGA 1EXUA 5DS8B 4U6HB 1Q8MA 4K8RD 4PJGF 5J9PB 4HS3A 2H8PB 1AGEB 2XTJC 3DSFL 2HLFC 1JGLL 2LU7A 1FAKT 5L0QC 3TIDB 3MBXH 2H2PD 1A6UL 2X1WL 3F7QA 3QEUA 2NNAA 5DEGB 2Q86A 4Y5VB 5E7BA 1UGNA 1CXFA 3IXTA 1DQDL 3MRBB 3O8XA 4M61A 2JE8A 4DKEL 1Q0XH 4A6YA 4DN3L 1X6NA 2I5YH 1AKJB 2UUDK 4ZFFA 5F7EH 1A7RH 5JW3L 1U3HB 1NSNH 4OTXL 4OZ4B 4IJ3B 4OGXL 2APWA 3CIQA 2F9BT 4M7KH 3OKDB 3K8KA 5HDQL 5K9JL 1AC0A 4X6CB 3OJVC 4DTGH 3V6BR 5GQBA 2PR4H 5CD3B 4YXLH 1PEZA 4PTUA 3X11B 4Z7WF 1ZVSA 3HE7D 3ZSTA 3GKWL 1L9NA 1RY7B 4HG4J 2QKIA 4OGZA 5BMFH 1NCCL 3QWOB 4GW1A 1RULL 2VSCA 5HYQA 4EJ1C 4KK8D 4ODVH 1P7QD 1MI5E 1NBYB 4OV5B 1XZ0A 4TRPH 3TESA 1IC4H 1JFQH 1F3RB 4JLRB 4XPFL 2A0LD 3NA4A 5IB1B 2A83A 5CBAA 4K23H 2WBJC 3CFEB 3RWCB 1AP2A 5DT1L 1L7TH 1FZKA 5I1GH 4MZ2A 3VG0H 3NGBB 5BV7C 3UYRL 4PJXA 2D7QA 3JWDH 2X4RA 5MEPB 5DTFB 2EE2A 3MCLL 1Z2KA 5A2IH 5JUEH 3BZEA 4M93B 4PJHA 1EFQA 4POZC 2W0LA 3MRIA 5EUKB 3GUTB 1FVEB 2IBZX 2O5YL 3U46B 4YHIA 4E41A 1XIWD 5I1AA 1IZJA 5F9WC 1X5XA 1C16A 1QBLH 5T1KD 4QY8B 4JDVA 2Q8AH 1OSZB 3SDDC 1ZWIA 1IC7L 4EI5D 4QRUA 2YZ1A 3WUWB 2PTTB 1G84A 3BN3B 2GCYB 4OCWL 1J8HA 4S1RH 3RZCA 3ZSSA 4P3CH 3AAZB 5DVOA 1U8KB 4D9LH 5CSGA 3MOQA 3V6OE 4ALAH 2R69H 3TZVB 2FR4A 2W60B 3OBAA 1MI5D 3BP7B 3UTZB 4YHOH 4WUKH 5AYQA 4F2MA 3MLRL 3MOAL 4OSUL 3VXPA 2AEPH 5FM8A 2ICEA 4HUUA 4HKBA 7FABL 4YWGH 3V7MA 1Z5LA 4FQLH 4NKQB 4FQCL 2WSKA 3DX9B 3VFNB 3QXWA 2WZPD 2MCPL 5HGGS 3ZT6A 4PY8J 2VXUH 3VFTA 4FQJH 4LCCC 2BVQA 3WIFA 3QZWB 1CD8A 5J6HB 1S7TA 1FNSL 4YPGB 3AXLA 3SCMB 3P0VH 2XZAL 3IFPA 7CGTA 3DURB 3H9SE 1PJ9A 1TZHB 2C9AA 3FB5A 3MNWB 3T1WA 3ARDA 4PRPE 3L5XL 3TCLA 4QXWA 1DQLL 1X5IA 4OB5H 2ADIA 5FO9B 1S78C 2GTWB 3LKOB 1NEZA 1RVFL 5C9JB 3KPMA 1R24B 1SBSH 3SE3C 2JLLA 2XQYG 1BAFH 3F65A 1X5GA 5FK9A 2BSSA 4Z7UA 1KG0B 5FUZL 1KCVH 3KAAA 4HG4K 2APTA 3MRRA 4RRPG 4TUKH 2EH7L 3DVFA 1AD9B 5E8NA 3Q0HA 1L6ZA 1OTUD 1XGYH 4FOMA 5C0AB 4XVSH 1CFVH 1I3UA 4LCUA 1A02N 1RIVH 1P1ZB 3AC0A 5DLML 4M3JA 4OCRH 2AQ3A 3NCYP 1E28B 4MS8D 4KRPD 2GIYA 5IBLD 4E5XA 2BVYA 2E8YA 4XPGL 3GIVB 4MXWL 1A9BA 1DJSA 3FOMB 2OL3B 2EH8L 5CZXC 4FQIH 5E2WL 5L8JB 5ESQB 1T2QL 1JYWA 2MWCA 2VAJA 2VDLH 1CDHA 4LHUG 1NC2A 5D2LB 3G6JE 4UT7H 4F7CB 4JQVA 1CL7I 1U8HB 5T33L 1OAQH 4IRJC 1MWAL 5FF6B 4XC3H 2AEQL 4P0DA 2CR6A 5L2KB 3MV8B 4GAJH 2PO6C 2ZUVA 4Q58C 2YA1A 3H9SD 4LF3A 4ZMAT 5ALCH 1DEEA 2WUCH 3MNVA 4N1EA 1NUNB 5HHOB 4BZYA 1EBAA 3L6FA 1G7HA 4XP5H 1NCUA 4G9DA 4O51B 1I8MA 1CLCA 1UB6B 4D8PB 4OLYH 3C5SB 4ZFGL 4FQPA 4NN5B 3QO0B 3BO8B 3D1MC 4YK4B 1ZHLB 4GUPA 5HGHB 3MODH 3DHMA 2R0ZH 1MCHA 2EECA 1QKZL 4RQQA 3U36B 4N0UB 5DS8A 5ECJE 3T4YB 3DLQR 2VWEE 3QDMB 5E2TL 3QCUL 3MUGB 1JZ8A 1SMAA 3VA2C 2H8PA 5D7SH 5J6GB 1DDHB 1D9KB 3TIDA 1NCNA 2LTQB 2IAMC 1PKQE 1BVZA 2ZOKB 1MCWM 2W9DH 4Y5VA 2V5YA 5JLZA 5EOCH 1TVDA 1IFHL 5HI3C 3MRBA 4GG8B 4N68A 1V05A 5D1QB 2VSDA 3LS4H 5KSAC 2BERA 2APFA 3FAWA 1AKJA 4FXKB 2F5AL 1NCBH 4H5SB 3HRZB 4OZ4A 4GRWB 3MPCA 3CFDB 3KYNA 4APQD 5HHME 4E42A 1IC5L 2NZ9D 4I0PD 2ADJB 2DQHL 1FPTL 1G7IA 5CD3A 4UOW0 2CH8A 4G3YL 1I9RH 5D7JB 3G5ZA 3GJFB 1T3FA 5F9JB 1PLGL 2B5IB 3QWOA 3TBTB 1X5KA 3WO4C 1CK0L 3FQWB 4DZ8B 2P1YA 3KDMB 1H0DB 1NBYA 2ARJB 4OV5A 4JREC 1BF8A 1W72B 4JCLA 3S5LG 2O5XL 2FLRT 1O7VA 5SWZB 4Q74A 1LMKA 1P9MC 4JLRA 1HWGB 3MRLB 4YHLL 3VXQB 5E70A 2W38A 4Y4FC 3RWCA 1KEGL 1UEMA 4NN7C 3PIQB 5DGRA 4LHUB 2AK4E 4IOIB 3W39A 5GXBB 4ZPVB 1TCRA 1FE8L 4GBXC 4G6KL 2VLJE 2JK5B 5MEPA 5DTFA 3FQTB 3S4SG 4JKPH 1NMCC 4LVHB 3KVQA 3CSBA 4JHZA 1ORQA 2R0LL 1IMHC 3VMNA 3K1DA 4ZO8A 1BZ9B 5EUKA 4YFLF 3SDCB 3VXUE 2DQTL 3GUTA 2MJWA 5A3IC 2XN9E 1ZVHA 4JO1L 3U46A 5EB9A 4CN6A 4HBQA 5EN2A 5HHMD 4WU7B 3ULUH 3RVXC 2VZTA 1YEDB 1YMHB 5HYIA 4QY8A 5GISL 1OSZA 4LMQE 1EEYA 2FNBA 2GSGB 2D7TL 3WUWA 3MLWL 1D6VH 1EO7A 2JB5L 1SY6A 3QCVL 2GCYA 4KGLA 3AAZA 1U8KA 3QUKB 1WZ1H 1IEHA 1FG2B 4R7DB 5DRXA 3SOBL 3TZVA 1QFWI 2W60A 4EQ2A 1KELL 3BP7A 3UTZA 3WFBH 5C09E 4TULH 2XXMB 1JWSA 1MIEH 3DX9A 3VFNA 1UH2A 2FZ3A 3WDHA 4U1HA 2X4NB 2WNGA 3PABA 2AK4D 4PJIB 1G9ML 4TYUA 1XT5A 3EZJB 2RCSL 5DQ9B 1DTUA 3WHXA 4FA8A 4KKLC 4MXQD 2VLJD 3OKOB 4YPGA 1V3LA 4UNUA 1A7OL 3WJJA 4HDIB 4KJQC 1Q9LB 3DURA 3O4LE 1OAXH 1PVHA 4MAYA 2PXYC 4NZUH 2V2XB 1BVLB 4UNTA 4RGOL 1D5BA 1PZUB 4YC2B 3WNPA 5FO9A 3VXUD 5CFHA 1JYVA 1HHHB 4PP2A 2GTWA 4IMKA 3LKOA 2XN9D 5KVEL 1I3GH 5AWNL 1JP5A 4MJ6A 5E8EB 3VGGA 1QEWA 1TPXC 2F5BH 2MNUA 1RFDH 5FYJL 1FV1B 5KVFH 3BP4B 3J7HA 1NFIB 3GSNH 2BY2A 1S7SA 2QQNH 3B9VA 1AD9A 2XYCA 3PWJB 1VA9A 5C0AA 1FL5A 1G7PA 4JRXE 3V6FA 1EA9C 4RX4D 1ZHKB 3MV9A 3O45B 5HHQA 5DEZA 4HT1H 2JJSA 4K8RH 1E28A 1UYWH 4LRNL 3OB0K 5EU4A 4ELME 2P44B 1KCSL 1A1NB 3SDXA 5C09D 3DV4B 3GIVA 4XBEH 4OZFG 4PRBB 4LARH 3RUGB 2FX8L 3NIFF 1BX2A 2A73A 2UZYB 3FOMA 3PQYE 1Q72H 3L5WA 4BZ2L 4LSVH 4ZUTA 3S4SB 5JOFA 4L9DA 5I6XB 2DQFB 5ESQA 3GK8H 3LKNB 3EDEA 5TDOB 4POYA 1ONQA 4C59B 2J88H 3VGAB 1U8HA 1MF2H 1YQ2A 1FO0B 2ESVB 3CDGA 3G6AA 3I50H 3MV8A 4ODBD 1OGAA 5D2NB 3O4LD 3MBXL 1TITA 5JHDE 2COQA 1B9ZA 1M7XA 5DQJB 1F45A 2ATPB 2EDLA 3CXDH 3OHXA 1E27B 1VGKB 5BZDA 4X7CC 4GMTH 4JFHE 2NW2B 4O51A 4MWFB 1UB6A 1ZLUH 2BNUA 3F7VA 5BQ7A 4IIQB 4TVPH 3C5SA 1N64H 1Q0XL 3QO0A 4W4NA 2I5YL 1OAKH 5LXGH 1SVCP 5F7EL 5CJ5A 1A7RL 4Y19B 3KLAB 4CW1A 1NSNL 5I0ZA 2PW1B 1G7JB 5JXEA 1T0PB 1R6VA 4LFHG 2HT2D 1HCFX 3U36A 4M7KL 4N0UA 5IT2H 3LOWA 4JRXD 3E8UH 5DD5H 5AUMA 1MEXH 1I1FB 1JNLH 3HE6C 2B1HH 3CVHB 2DYPB 2PR4L 3HR5B 4YXLL 3QI9B 4HWEH 5J6GA 1D9KA 5I66A 4ISVB 2AJUH 3QUYB 4P4RB 2YRZA 3FB8A 3S37H 5I8OH 5BMFL 1OW0C 3GRWA 3EYFB 5MI0C 1YQVL 2ZOKA 3RTQD 3I75A 3PQYD 2IMMA 3UTQB 4JDZB 2D7PA 3WNKA 3GMNA 3MLVH 4ODVL 3KYKH 1FAIH 1T1ZA 4MYWB 4XCNB 4GG8A 1YMME 3BP6B 4LSRH 4TRPL 4A2MA 4PGDA 1IC4L 3C6LA 1CDIA 4J1UB 3CX5K 2B39A 3BPCB 3ZL4L 3OPZH 4KVCH 3LV3A 2X4OB 4K23L 3O11B 5JHDD 1L7TL 4OCLC 2XTJE 4OZGB 2NX5A 4X7DC 1M71B 4F15B 5I1GL 3RBGA 5EBWA 1N2RB 2XPGB 2HVJB 1WWBX 2ADJA 5ABDE 3JWDL 4JFHD 1KTKE 4RRPA 1KULA 2Q7NA 3MJ6A 2HRPH 1IGFH 1VFOA 5JUEL 3QQ9D 5D7JA 1CDJA 3GJFA 5FOJA 3EJZC 3QJHA 2AEIT 3N0PB 2NXZD 2X70B 4PJ8C 5C9KA 1DVFB 3FQWA 5HI5C 3KDMA 1H0DA 2ARJA 1WC7A 1KIRB 1YPZE 2MQ3A 1QBLL 3VRLF 2BSED 1UWGH 2Q8AL 1KPRA 3FAXA 1AGFB 4I9WE 1IARB 5C07B 2IC2A 4DFHA 3VXQA 4J3SA 3AS3A 2DF3A 4S1RL 3FOLB 3PIQA 4LHUA 5EFIB 9CGTA 4P3CL 4D9LL 4IOIA 4ZPVA 4KZDH 2R69L 1FFNB 5M7QA 2CIIA 2W0FA 1QZ1A 4I3SL 4YHOL 4WUKL 1YMMD 3IFNH 4GQ9H 5E8OB 3K81A 1Q94B 2AEPL 3DMMA 1CF8H 4YWGL 4PJAE 2RIKA 4FQLL 1JHKH 4X9IA 1CFBA 4ZO9A 3CH8A 3MGOB 4FQJL 1U8IB 1KTLA 1I85C 2XTJD 1I8KA 2VZ3A 4LNVA 3S36X 2HLFD 1UXSB 1HQRB 1YEDA 4YDJA 2F15A 4B7IA 1TENA 2NY7H 5LCVH 4PJ5A 4WWKB 3WE6B 2X1OA 3P0VL 4LPCA 4OLWH 1QHPA 2A6IB 1J1XH 1MCOH 5C0CE 3FQUB 5BXFA 4ZS6D 4PJCE 4AIOA 4N9GA 2CXGA 4U1JB 3QUKA 1C7TA 4OB5L 1FG2A 4R7DA 2IMNA 2KBGA 3QIWC 2LV4A 2V7NB 1SBSL 4JHAH 4LPTA 1BAFL 5DI8B 4I9WD 4TUKL 1IE5A 5MEQB 4Q9QH 2X09A 3V52H 1X5AA 4F7TB 3U0PA 5J4MA 1XGYL 2HFGH 2X4NA 5GRUH 4CNIB 3M8OL 4NGHH 1CFVL 4XVSL 1RIVL 1U8QA 1A7QH 2L0DA 4A2LA 4OCRL 4M5ZH 3QQ4A 3TA3A 3FN0L 4G8GE 1MFDH 3SQBA 1PEWA 2V2XA 1BVLA 4NBZB 2R8SH 1JWMB 2DB8A 3O41B 2VABA 1S9YA 3KPNB 1AJ7H 1HHHA 5D7IF 4FQIL 4ZYKB 3G6DH 4G80A 1M7DB 1MCWW 4XWOC 4UT7L 5DK3A 3MBEC 5E8EA 1OAQL 2WBJD 5E4IA 2HKFH 4XC3L 3HG1E 2O26U 1JGDB 2HJLA 4Z76B 1FV1A 3BP4A 4GAJL 1NFIA 3HAEH 1BIIB 5GRJH 5MERB 1YNKH 5C0CD 1RJCA 3SEPA 5LKNA 3PWJA 3RL1B 5ALCL 2A6KB 3S5LA 2WUCL 1H3GA 1ZHKA 2R29H 4YE4H 1CFTB 3O45A 5CWSA 1WBZA 4POZD 2Y9RT 4XP5L 1VPOH 5DJCA 1RUMH 1KBGH 4GKNB 1U2CA 1VFBA 2F53A 5EUOE 4OLYL 4WU5B 1X9QA 4OLUH 4JAMB 3DV4A 2DQUH 1T0MB 4PJGE 3W9DB 4PRBA 4PBWD 2X4PB 1UWEH 2E9JA 4JFFE 1MAJA 3RVUC 1P7QB 3MODL 3VD5A 2R0ZL 3BH9B 3LVEA 1EHAA 4OIAA 3S4SA 5IB2A 2DQFA 3SDDD 1VESA 1Y0LA 5CEZE 2E9IA 5H94B 3GI8L 3ZE0E 2FECI 1WFOA 2ESVA 2ZP0T 1PW3A 3DX7A 3ABZA 1A4KB 2P24A 3BMVA 4FXGA 4QRRA 3FQXB 3L1OH 3NABH 3FRUA 4G8GD 3A0OA 4K7FB 3JBG7 1INQA 1WGOA 1SJHB 3L3OB 1A9EB 5DQJA 3BKJH 2ATPA 3JSSA 1E27A 1B0GA 1VGKA 2W9DL 1RZIA 5EOCL 2MHAA 2XZQH 2BX5A 3CK0H 3KPPB 3BIKB 2NW2A 4Q9RH 3U0WH 3LS4L 5T1LD 1G6VK 3P4NB 3HG1D 2JB6B 3NN8B 5F7NC 5IMMA 1NCBL 4Y19A 3KLAA 2LAAA 4LHJB 2PW1A 1G7JA 5DZNA 4Z7WE 1XIWB 2DWEB 4PLJC 5DMIH 4M1GL 5J1AA 5HSFA 1FYTD 3BN9C 1I1FA 5A2JH 4EI5B 3TN0B 5DJYB 2DYPA 3HR5A 2P42B 2I26N 3P0GB 3QEQA 1I9RL 4OCYH 1M7IB 2IBBA 1S78D 4O5LL 3MV7B 4KHTH 1G0XA 1CT8A 3E2HB 5B38G 3QIBA 4JFFD 2FH6A 2PF6A 4H8WC 3MGTB 3CXHJ 3VXTA 1K9TA 2BOBB 4XCNA 1NLBH 5CEZD 3BP6A 3CX2A 3HC0A 1T0NB 2PCPA 4Z0BH 3MROA 4J1UA 3WNMA 4WWID 5HBBA 1FDLL 1CFSB 1OPGH 4JZJB 3CZJA 3WFCL 2XI9A 3OX8B 4PR5A 3O11A 5DJ8B 1TTUA 5I75B 2HA1A 2E6QA 3STLB 3VI3E 3CPLB 4FG6C 1M71A 2FBJH 4OGYH 1C12A 1N2RA 1HE7A 2XPGA 4NCC1 4WHYG 1X4YA 3BPNC 3L7FB 1F90L 2ZUUA 3F7RA 4JKPL 5DSCB 4Y4KA 4JY6A 1FHGA 5E5UB 2GTZB 1R5WA 1U0QA 4U7KA 1B4JH 1R3HB 3FT2B 5L2JB 2X70A 4S2SB 1DVFA 4IRJD 4X6FA 3C60C 3BGFB 4U3XA 5C0ND 4FQ2H 3ULUL 1XFPA 1D6EB 4OZFA 4W4OC 2C5DC 1QFOA 5KSUA 4RWHA 1D6VL 4TVSa 4S1QH 1ZLWH 5C07A 3MLPA 4OQTH 3BKMH 1U36A 3EOAB 3O6MH 4P46A 3FOLA 3EGSA 1FLTX 1JK8B 2MSPA 4HWUA 1FFNA 2AJZA 4LEOB 2ZUSA 3KXFE 3VFGH 5E8OA 5CZVH 3TM6A 1BOGB 3WFBL 5DRNA 4E0RB 1Q94A 4YHYB 1CGSH 4TULL 1MIEL 4JKLA 3FZUD 5DURB 2H32B 4LCYB 2OTUA 3MGOA 4KU1A 2IG2H 4P4KD 5HYFA 3BT2H 1GGYA 1OB1B 1TJGH 1DLHB 5J1TC 1BD2D 1UJTA 2VC2H 1GZQB 2R0WH 1BVKA 2YPVH 4P2RE 1UKTA 4WWKA 2QV2A 1BZQK 3H9SB 4HGMA 2A6IA 1I3RA 2VDRH 1OAXL 4OLZH 4PRPB 4NZUL 4H0IA 3ME0A 4MJ2A 4U1JA 2UZXB 1IGMH 2EKSB 1MELA 5KSAD 4QHKI 1UEYA 2QJDA 3MXWH 1YDPB 2V7NA 1I3GL 3PDDA 3MRQB 4LLVA 1IL1B 5B38B 1RFDL 5DI8A 4EXPX 1JMXA 1N3NB 3GSNL 4ZPTB 3BRFA 1RZGB 4UBDC 2QQNL 5J89A 4L8CB 2IPUK 4CNIA 5TDPA 3CXHK 4DGVH 4OFKA 2EC9U 5DFTA 4KROB 4HJ0C 4G7YH 4K8RL 1UYWL 5I1KH 3RWDB 4HJGA 5JDJA 1IM3B 3N50A 4LVNC 4XBEL 2P8MA 4LARL 2DWDA 1JWMA 5EC1B 3R8QA 1Q72L 4JGUA 4LSVL 5HYSG 4HMCA 3G6JB 3GK8L 4R8WH 3QFJE 2J88L 1R3JB 1MF2L 3LMJH 4Y4FD 1UT9A 4P2RD 4Z76A 3FT4B 1W0VA 1BIIA 1H5BA 3OKNA 4UIMB 4GBXD 3GO1H 3BFOA 1QD0A 4WHCA 4APQB 2VQ1B 3RL1A 2HWZL 2A6KA 5EOQL 3CSYB 4I0PB 3FCTB 3QUZC 1E6OH 3CXDL 3INUH 3DX6A 1CFTA 15C8H 5EZIH 2GY5A 3RDTA 4LSDA 4GMTL 1YA5A 2AK1H 3VD7A 5AD0B 3B2UC 4BFIA 4WU5A 4Y5XC 3S8WA 4P5KA 4PG9B 4TVPL 1QP1A 5A3ID 1N64L 3W9DA 1T0MA 4MQSB 1OAKL 5LXGL 4XZUB 5SX5H 2Q3AA 5SX4I 5DHVB 2UWEF 3RVXD 3NMEA 4FHBD 4JVUA 4UDTB 3MLXL 1FFOA 4XMKH 5IT2L 2HTKC 5C1MB 5H94A 5DD5L 4PJ9C 4GXUN 1MEXL 5INDB 1JNLL 1I4FB 5MENA 2B1HL 2VLME 3DYMA 3FQXA 5J12C 3AY4C 4HWEL 5CKGA 4K7FA 2AJUL 2DI9A 1PKQB 3S37L 5I8OL 1SJHA 1YN6A 4C57C 3HZVB 1EAPB 2AJXH 5D7LE 3DX8A 3E1F1 3IKCB 3MLVL 3KPPA 2DQDH 3KYKL 1FAIL 1NGXA 2E3VA 4K7PH 3EO0B 3IT8D 3QFJD 5J11C 4I48A 3P4NA 3D0LB 4OCMC 3NN8A 3U7AA 3MR9B 3ARFB 2A9ML 4Z95H 3OPZL 4KVCL 1INEL 3LHPH 5TPWH 1N0XH 2FEEI 4B53A 4OF3A 2DWEA 2A9NH 4KKLD 4XXDB 4K3HA 5HHMB 4I2XA 4HSQA 4KJQD 1FRGH 2YPLB 3WXVL 3TN0A 5F3BB 2PXYD 3WNLA 3LZFH 4ZUWB 1DE4B 1IGFL 2HRPL 3W11C 3O8XC 1KFAH 4U6XB 5FO7B 1M7IA 2DOCA 4Q2ZB 4G9FB 1RIHH 1MRCH 3MV7A 1S7UB 4U7MA 1KIPB 2E7CA 2Y7QA 1WFTA 4ODTH 3CMOH 2BOBA 1VSCA 3O9WA 5GSVB 1MUJB 4D3CH 5GJSH 1F6AB 1UWGL 5IF0B 1FN4B 4YDKL 4HX1B 5HYSB 4YAQB 3DV6B 3HPLB 2BRQA 3ES6B 3TNMB 3STLA 2AK4B 4BQCA 2V7HA 3SGDH 3U0TA 5J13B 3AU1B 3CPLA 5I73C 4KZDL 5D7LD 2VLJB 4JO2H 5KANG 3DO7B 3MTRA 3L7FA 3C6SB 4PBVC 4X5XB 5C6WH 3O4OB 5DSCA 3MUJA 3DIFB 4CN4A 2ZWLT 3IFNL 4GQ9L 2GTZA 3MLZH 4P23B 1CF8L 4GOSA 3N1PC 1JHKL 3T0VA 2Q76A 3FT2A 3V5KB 3VFUA 1T83A 2GSIA 4U7SA 1JNHB 2XN9B 3L3HB 3UPCA 3DBXB 5C86A 5HXMA 1WCBB 4NQEE 3VI4E 2NY7L 4OF0A 3T3PF 1U8MB 3EYSH 3T2NH 4NJAH 4OLWL 2JJUA 4XP4H 1DN0B 1J1XL 4K71C 3PL6B 4X4XB 4HHAB 4QOKA 4S1SH 4F7PA 5EO9B 3ULSA 1JK8A 4F37K 4H0GA 1XGPA 3I02A 3TYFA 2IH1A 3STBA 1P4BH 4ZFOL 2Z93A 4JHAL 5H37G 5C09B 5JQHC 1BOGA 1LE5B 2HFEB 3RWIB 3WLBB 3VFOB 4AIZB 3NZHH 5DYOA 3E6FB 4UMGA 3MUY1 4LCYA 4Q9QL 2GUOA 5C08A 3V52L 3HE6D 1OB1A 2OZ4H 2HFGL 3HNSL 4J3TA 5GRUL 1FNLA 1V8HA 3RZCC 1LP9A 3AS2A 3HC3L 4Z7NF 1GPOH 3ULVC 1A7QL 3SE4A 2MQCA 3EOTH 4M5ZL 1NCTA 4QTIH 5GRVK 3O4LB 4CVZB 2G5RA 3CSGA 1MFDL 3QDGB 4YNYB 1CDBA 4PRPA 3D39E 4NQUA 3VXSB 2VMFA 5TE4H 3NCYS 5BV7H 1JN6A 1TZIA 4Y8DC 2R8SL 5I8CB 2Y1VA 2CKBB 3U4BH 1AJ7L 3H2WA 3V9FA 1HOCB 5FFLA 1Q1JH 1UKSA 3G6DL 1YDPA 1B90A 2QSCH 4NQED 1UJ3B 1NCWL 1CGTA 4O2CB 1XEDA 5D1XA 5IK3B 4AEIH 2HKFL 3T65A 1PYWB 2E8ZA 2DBLH 5B38A 3TPUB 3IF1B 4JDTH 4ZPTA 5GRJL 4NO2B 1YNKL 4JG1L 4ZODA 1WITA 4JRXB 3ARDC 4L8CA 3P9LB 2OR9H 2FYYB 4ORGB 1G7MB 2YXMA 5A16B 2R29L 4YE4L 4PV8A 1CD9B 5C0IA 5C92A 1QRNE 5HYJA 4ELMB 3EJZD 4HWNA 1VPOL 3IFOA 1RUML 4U1NB 1AHWA 5FV1L 5ID1A 1PAMA 3MREB 4PJ8D 5DZLA 3CMGA 4OLUL 4P3WA 5I17A 1IM3A 2WWMC 5HI5D 2DQUL 1MIMH 3PQYB 3VU2A 4QNPE 1YECH 4FS0A 1UWEL 5EC1A 1CE1L 1KLUB 1G7LB 2NR6C 1BECA 3ALPA 3G6JA 3VDAA 2ERJB 4KFZC 5GGSB 5HPMB 1EFXA 1N8ZB 4X9BA 5F70A 5D7KE 5EU6D 3ETBF 3L1OL 5TJWK 5KS9E 3FT4A 4K07A 1T7WA 1TFHA 1RURH 2VZVA 3NABL 1KJ2B 3NAAL 5JHDB 4PLNC 4R0LA 3D39D 4JJHA 2W65B 3SPVA 1QFHA 3FCTA 5FKAB 1H8SA 1ZHBB 2XZQL 3CK0L 5ICYA 3F58H 32C2B 2EDJA 4JQVC 2EDYA 2OI9B 5KTEH 3WFZA 4M4RA 1D5MA 2NXZB 1L7IH 1RUAL 3WFDH 3RU8H 3SKJH 3T8XB 4UDTA 2NLJB 5DMIL 1A4JA 5MP6H 1I1AA 5GGVH 5K9OB 5CSZB 1FLRH 5INDA 1I4FA 2D4FA 4HS6B 1VACA 2VXTH 1QRND 1LNUA 1ZXQA 3GSRA 3TH3T 5E94A 3CFKB 4TUJA 2VO5A 4GXUM 5ADPH 4OCYL 1PKQA 5JOPE 3ZE2E 1XF3B 3QIWD 3HZVA 2VLKE 4KHTL 1EAPA 5LBSH 5FECB 1HHGB 3IKCA 1YMMB 1NLBL 4K3EH 3EO0A 4O58H 1BF2A 1HKLH 4WO4B 4Z0BL 1U93A 2PNDA 2Y23A 3A67H 3HB3C 5D7KD 4N0FB 3ARFA 2DLGA 4WUUA 1OPGL 4ZSOE 2FHFA 5FDWB 2ZG3A 2DL9A 2XTJB 4PB0H 4L3AA 2G75A 3L3JB 1B4RA 2FBJL 4OGYL 3IS1X 2ENSA 2B0SH 2YPLA 1YUHB 4Y5VC 2Y36H 5F3BA 3VFRB 4KMTH 2VR9A 4LPXA 3L3IA 4RGNE 3U2SB 4HFUH 4U6XA 3OR6B 4OCNC 3I3EA 3L3DA 4G9FA 5CJXA 2WQRA 2L4OA 4UT6H 1B4JL 5T1DH 1S7UA 2WW8A 2APVA 3TVMD 3NCCB 4XWOD 1PY9A 3MBED 4Z5RB 1KIPA 4IJ3C 3SN6N 4NRZB 1BIHA 4Y89A 3SGJA 4V1DB 5A40E 2C3HA 1YPZB 1MUJA 2AXGB 4O2EA 1F6AA 3KPQB 4FQ2L 5E2UL 4YLQT 4X7EC 2IPTH 2EEBA 2Q7YB 4S1QL 5HYSA 4OQTL 3B8YA 3BKML 3DV6A 4NKOB 2M2DA 3ES6A 3O6ML 4UZGA 2AK4A 5JOPD 5I18L 2RBLA 3AU1A 2VLKD 5IWLC 3FTGA 3AM8A 1K4DB 2Y07H 1M4KA 1A8JH 2VLJA 2FWOB 1Z0MA 5GSRB 1K4CB 1UQSB 3VFGL 3ESVF 3DIFA 5CZVL 3RVUD 4PJAB 5AG9A 4P23A 1UWXH 4EQ3A 3O2VH 2CD0A 5D5MB 1QACA 2BSTB 3V5KA 3L3HA 2IG2L 3BAEH 3BT2L 4MQXC 3CGTA 3DBXA 1TJGL 4HH9B 1WCBA 5LAXA 2VC2L 2FRGP 5EG6C 2R0WL 1NAMH 4PRHB 2YPVL 4MA3B 4RGND 5C0CB 4IHOB 4DUWA 3I6LE 1DN0A 4LKCA 5DGQA 3PL6A 4OLZL 4M93C 4PJCB 4HHAA 3LN9A 4U05A 2PYEE 5EO9A 1IGML 4G43B 3T08A 4LLQA 2NTSP 4LRIA 4RZCB 1QBMH 3MXWL 3KWWB 3LKQB 4QHKJ 3LDBB 1LO0H 43C9A 4X6DF 4X5LA 1LE5A 4LLUA 4JFXB 5H2BB 3WLBA 3RWIA 3RX5A 1NAKH 4PLJD 3VFOA 4AIZA 4PLKC 1A22B 3E6FA 4MXVF 1LEKB 3QXVA 5SV4A 3Q6FB 4UDUB 3B3IA 3OJ2C 3TZVC 4DGVL 1XGRB 4EKXA 4DK6A 5DHYB 4G7YL 4L29B 3S35H 5I1KL 2OCFD 3QDGA 4OFYD 5F89A 3R06A 3RQ3A 3VXSA 4FXLA 1ZMYA 4JM2F 3LRGA 3R1GL 4ZNEA 3F6IA 5I8CA 3VXNB 2CKBA 1FZOB 4AEHH 4RMSA 4QTHB 3OF6D 1DN2A 3HZMB 4U31A 1UJ3A 4O2CA 3HG1B 3LMJL 2Y6SC 2F74A 1PYWA 4U3CA 5DD3H 5HHVH 3TPUA 1JIBA 3WJJC 4FG6D 3D9AH 3TIEB 3I6LD 5F72S 4NO2A 5HDBF 1CG9A 4MAYC 3GO1L 3LN5B 2ARWA 3T3MF 3P9LA 5IROA 2FYYA 1G7MA 2PYED 5A16A 1E6OL 3INUL 3DRTA 4LPUA 3BDBA 1ES0B 3QPQC 5EZIL 3ILPA 3G5VA 4IMKC 1BJ1J 5EUOB 1T6VN 2QL1A 3L5JA 3KPSB 3MREA 1QSZA 1LEGA 4PJGB 3C60D 4CRPA 4JFFB 3RNKB 4HEPG 1GJIA 2E27H 3WO3B 4MCZB 1G7LA 2EDQA 4XCFH 5GGUB 3BJLA 4XMKL 3MRNB 4WY7H 5GGSA 5HPMA 1N8ZA 4MHHI 3KJ6H 5K9QG 3BD4A 3WV0A 1GRWA 2JJSC 1DUYB 3PWPA 3VRIB 5CHNB 1RUQH 2B1AH 1KJ2A 1TQCC 4WCYH 5IG7B 5FKAA 2AJXL 2YC1A 2P4AB 25C8L 2AV7B 1DBAH 1ZHBA 4J3UA 3L5HA 2DQDL 3D0VA 4K7PL 1I1CA 1NGPL 4I77H 1FFPB 2C1OB 3I84A 5F3HB 1ZT1B 1M6OB 1KNOB 3MZTA 2R9HC 1DCLA 4OI7A 1CU4H 3KYOA 4IRJB 1WBXA 3T8XA 4EIZC 4Z7WB 1JF5A 3LHPL 5C2UB 1HEZB 5TPWL 1N0XL 1K8IB 2A9NL 1MLBB 5EOTB 3FO2B 4DJMA 4KH2A 4PRAB 2WBWB 1XGTA 3P4OB 5F6HI 3DVGB 3LZFL 1DBKH 3CSPA 1JZ7A 1KFAL 5ERWB 3CFKA 5E00A 1U42A 1DQMH 5JMRA 1XF3A 1RIHL 4NN5C 1MRCL 1R5IB 2N1KA 5JXEC 1GGUA 4KUCF 1JVKA 3WFEH 4ODTL 5ESAB 2XWBB 2YD3A 4D3CL 5GJSL 5CLWA 4WO4A 3PNWA 4N90E 3TV3H 4UBDD 2I9TB 1EH9A 1ETZB 2WBKA 4P4KB 1D9KC 2WLZA 1A6TB 4WI8A 3QNYA 4HJ0D 4UB0H 1SYVB 4JO2L 1A14H 4BQ8A 3JV0A 3DGCR 3VFRA 3BGAA 1KB9K 3HI1B 1RQ5A 2BP3A 3FB6B 5ID0A 3FQRB 2M26A 2EEDA 2ZOLB 3MLZL 3P3YA 4XXCA 5DUBB 4N8VG 5FXCH 3C6LC 2GT9B 4MB5A 1MCFA 3EBAA 4PIRF 5KSAB 1JGEB 1BZ7B 2CUMA 3FFCA 3MRJB 5CEXB 4BQ9A 3RGVB 1NANI 4NRZA 4V1DA 2VLLB 2G5BB 1YPZA 3KPQA 1NFDF 2BY0A 5IM7B 5IVNA 1AGCB 2OMNA 3D2UB 3EYSL 5F88B 4LL9A 4NJAL 5C0EB 1FC1A 3QUZD 4XP4L 3BDYH 4NFDA 4L3CA 5D7JC 2P5WA 5KN5B 1CXIA 1EEQA 2XOTA 1AXSA 3KNBA 4S1SL 2B5IC 2XY1A 2GFBB 2H3NA 3KXFB 2FWOA 3OQ3B 5GSRA 1REIA 4TOYH 4ETQA 4WNQB 3TBYB 1WICA 5DJ2B 3WIHA 4FQXD 4N90D 2WP3T 3QUMB 4JREB 5D5MA 1WAAF 4PBXA 1ED3A 4N5UA 5A2LH 1A64A 2HTKD 4PJ9D 4M6MH 1JF1B 2OZ4L 4M3KB 4X4MA 4DVBB 5E9DD 1GPOL 4Y4FB 3EFDH 4P2RB 2VISA 1GYAA 4PRHA 2BMKA 3OKLA 3O6LH 3AREB 2X44D 1CLOH 4WTZA 2J3SA 4IHOA 4N0RA 2VXSH 4CAGA 3DMMC 3BZFA 5TE4L 3QRGL 5BV7L 1J5OH 5ISZA 1R3KB 5GZOC 4G43A 2YUWA 1TNNA 3SE8H 4Y88A 4RZCA 3U4BL 1WWAX 1K85A 1Q1JL 1J0ZA 4PRDB 3KWWA 3LKQA 1X5LA 2QSCL 4P57B 2FJGA 4AEIL 4JFXA 1WISA 3S37X 3RVVC 2DBLL 2DIJA 2V9TA 1NBQA 4JDTL 4GKOA 2V2TA 3LRSA 3IDGB 3OAUH 3X13A 2MPAH 3Q6FA 5E6YA 5IMOB 2OR9L 5C0FA 3W11D 2EIZA 3O8XD 2PYFA 3JV6A 3RVWC 5DJZB 2WP3O 1GH7A 3L5IA 4PJHE 5JTWA 2KQMA 3IGAB 5DHYA 1B0RB 5C8JA 2ZSWA 1NGWA 1FP5A 3VXMB 3P77A 4E41E 1MIML 5GGRA 3T0DA 1YECL 5J06A 4HBCH 4MNHB 1T7VA 4U1GB 4YHMH 4XMLH 5L8LB 1ZSDB 3NCJH 1QLRA 1FZJB 3TA3C 1ZA3B 1UH4A 1RURL 4EOWH 3ULVE 3QYCA 5FYKE 1JHTB 5JW4N 2JELH 2VZ1A 4NCDA 4YC2C 2PXYB 1ES0A 1OF2B 4TTGA 2IH3B 3NCBB 5EU7C 4UV7H 1Q9KB 3F58L 3ARXA 4X80L 5FV2A 1ZT4B 4R7NB 3VRJA 3KPSA 2EDKA 4B0MM 4OZHF 5KTEL 3GBNH 3BDXA 1XMWA 1L7IL 2AABH 3RU8L 5I19H 3SKJL 1TPXB 2J8UF 3P4MB 1LK3H 2BY1A 5J56B 4MDJB 4MCZA 3PUCA 3HS0A 5CMAA 1HYSC 5GGVL 4U1IB 3VDBA 1H8NA 1R0AH 1FLRL 1FL3B 2VXTL 3DXAB 3DJ9A 1S7RB 1OLLA 2NYYD 1IGYA 4JFOA 3VRIA 5CHNA 2A6JA 2GQHA 2NCMA 3G08A 4PGEA 5ADPL 5IG7A 3VH8G 4XAKE 4U1LB 4E41D 5D7LB 1A6AB 5LBSL 3MCG1 1D5XB 4Z7UE 3U6RA 4ONHB 4Q6IA 3DSNA 1FFPA 4O58L 3IAQA 1HKLL 3VGAC 4R6UA 1M6OA 5DO2C 1KNOA 3A67L 4MDIB 3BE1H 3RZCD 1YJDH 4Z7WA 4XH2A 4U1MB 3ULVD 3N1QC 1HEZA 2D0GA 3N9GH 4NKMA 4PB0L 1MLBA 5EOTA 3FO2A 2B0SL 1QR1A 1TVBB 3P4OA 2Y36L 4KMTL 1U9KA 2A1WH 4HFUL 5ERWA 2AQ2A 2XG5A 5F7UA 3PP3H 5DEFB 4D2NA 4YGVA 3K8MA 3C8HA 1C5BH 1J87A 4UT6L 1R5IA 5T1DL 3LB6C 4HGKC 4JFPA 4LDEB 4I18B 3LPGA 4OFPA 4HKJB 4TUOA 3AB0C 4UQ2B 5ESAA 4HLZG 3V8OA 1KTRL 4FFWC 4QGTA 3DGGB 2I9TA 2IPTL 3PJSB 3ARDD 3MUZ1 3OKMB 3W5MA 1ETZA 1FFRA 4TTDC 4X4YA 2BXZA 3HE6B 3QT2A 4HUXB 4PJFF 1MHHB 2C3VB 4XAKD 2Y07L 3EDDA 5T3ZE 3QIBC 3LH2H 4YQXH 1PQZB 2WWMD 2EDEA 5MI0B 1KB5B 4DUVA 1U8NB 3FQRA 2GK2A 3TFKC 2ZOLA 1LO2H 5DUBA 2WIMA 3O2VL 2AI0L 3D85B 2NR6D 4G6FB 5CJ8A 1CD0A 1BZ7A 3MRJA 5EZOH 3RGVA 3E3QE 5CEYB 3JUZA 4D0DB 4KK9C 4QO1A 2VLLA 2FO4B 4NQEB 3FO0H 2FCBA 3CFBB 2X7LB 4PREA 1NAML 3RWGA 4LCIL 1AGCA 1J88A 3D2UA 4M4PA 2YWYA 3BXNA 3QXUA 5DR5H 3WHE1 5C0EA 4Y4KC 4XNXH 1DP0A 3F8UB 1ITCA 5IKCA 5HGAB 4JZNA 4WW2A 4HH8A 1A7NH 4J4PA 1JWUB 5LWYH 1NC2D 3KXFA 4MZ3A 1DVFC 5JPNB 3CUPB 3S97C 4WNQA 5SWSB 4PJ8B 5DJ2A 5IB4B 3REVA 3IXAB 3VH8B 5GIRB 3DRQB 1NAKL 4H8WH 4HPYH 1U95B 3UJJL 1A0QH 3MJ8B 1X7QA 4RFEB 2ZG1A 1M05B 1URLA 5T1MB 1GGIH 2RGSA 4P46C 4DVBA 1AO7B 3KYMB 5T3ZD 2HRLA 3P0YH 3VGDA 2D7MA 4PB9H 3AREA 5HHPA 1AQDA 3VXRB 3H9HA 3HHRB 4S0TD 3S35L 3KPRB 1GAFL 3C08L 2VN4A 5B8CB 3QO1B 3UMTA 4HV8B 5DMGC 4RAVB 3S96A 1J0IA 4N9OB 5FO8A 2VKWA 1Q9WB 1JHLH 4AEHL 1BEYH 3HB3D 2CKNA 5CIPB 4HUKB 4FRWA 5HTSA 1SJEB 1EJ6A 1EGJH 4KY1H 5DD3L 1T5WB 5FUCC 5HHVL 4WWKC 3BUYA 3D9AL 3OMZA 1LO5A 2R23B 3SGEH 1FG9C 2YMXH 1J10A 5DJZA 4LQFH 1KCLA 4W70A 5IW1A 3IGAA 1JPGA 1AKJD 2Q3ZA 1RIUH 1MH5A 3VXMA 2ITCA 1C5DB 5E2VH 3VJ6B 1CVRA 1B2WH 5MEOA 4KTDH 3WDIA 2E27L 4XCFL 1IKFH 4WY7L 2CRYA 4N8VA 1OGTA 3K7UA 5KANI 3NFPB 1ZSDA 3KJ6L 4ZD3H 1FZJA 2I60H 5KS9B 2F8OA 3RFZC 1NBZB 1ZLSH 1YN7B 2X4QA 2X89A 1RUQL 2B1AL 1WQVT 4UOJA 2HJKB 2QQLH 2YUVA 4JCMA 4CVXB 1FIEA 2DS4A 1MRFH 2VOTA 1OF2A 1G9NC 2WINA 4LK4A 2C3GA 5JW4M 1Q9KA 3HN3A 5D93C 4I77L 4R96A 1M1SA 4MQXD 5GS3A 3TVMB 2FHBA 4MB3A 2OXHA 4I3RH 2IADB 3DI3B 5IB5B 1MVFA 2OYPA 2VERN 1KPVB 3C5JA 5FCSH 3JZ7A 4U1IA 2Q6WB 3MZGB 4L1DA 4R2GC 2Y5TB 1FL3A 5TFSH 4PGCB 2CUIA 4EDWH 3DXAA 4KZEH 1VENA 1V7MH 2CGRH 3HLAA 1DBKL 5F6HJ 4JQXA 3QFDB 4DW2H 3BI9X 3S88H 1DQML 2VLKB 1HH9B 1A6AA 1FSKB 2XNAA 4L4VB 3O6FA 4EN3B 5E1HB 4MD0A 4XPTH 5F6IB 2OR8A 4PLKD 5HY9B 1OWWA 3EYOB 2IPUG 4O9HH 2AS5M 4CADA 3TV3L 4H25B 3ARGB 2EDOA 5D1ZA 3ZE1E 4ZSOB 1RK1B 3B5GA 3O6KL 3MV9E 2W9LA 4QEGA 3TZVD 4X8XA 2OM5A 4M7LH 3CNKA 3PGFL 4UB0L 1OHQA 1TVBA 1A14L 4L8DB 5BRZA 1VADA 2E5EA 4RGNB 1UM4H 4K3GA 3F7YB 3SDXE 4FP8H 1XGUB 4QXGH 3U83A 4F33B 3P11H 1DLFH 4ZUUB 1R3LA 1DQJA 3RKPA 3AGVA 2VR5A 4PJEA 2YUXA 5KOMC 1XF2B 1NUFA 2R1YB 4LVEA 1JCKA 3SJVE 4Z7OE 4EUPH 2Y6SD 4I18A 2EIDA 4UQ2A 4FNLH 3MV8E 1OGAE 1S7VB 4MAYD 3PJSA 3TN0C 4ELKB 2EDDA 5LGJB 2XZCH 1ZGLB 4X7TB 3BDYL 4HUXA 1AXTL 1RPQA 2ENYA 2VDQH 3QPQD 1MHHA 2H9GA 2C3VA 2LU4A 4JM4H 5ADOH 3JV4A 4AEFA 4PJ7F 4TOYL 3ZYOA 4LLMA 1BQHB 4PJDF 3GBMH 1IQWL 4NPYB 1YNTA 1I1YB 2HVKA 5D8JH 4F7MB 1ROWA 1HXMA 3D85A 5CD5C 4N0UE 5C0AD 4S11A 4ZG1A 2W0KA 2Z91A 1GCFA 4RMVA 3MV9D 4OFVA 4LGRB 5FGSA 5E24E 5TF0A 4M6ML 2D4DA 1TETH 5CEYA 2DBJA 5I75C 5IMLB 1CXKA 4PY7A 4YDIL 3EFDL 3QHTC 1VKXB 1HILB 3HMWH 3O6LL 1CLOL 1JPFA 4KI5F 1J9CT 3A6BH 3C8KA 3BPNB 4AZ8A 1IKNA 1F13A 4TPRH 2VXSL 1QYGL 2PYEB 5HGAA 1VB9A 1J5OL 4HZLB 1JWUA 2YR3A 2FB4L 3SE8L 3SJVD 1T83C 3HCVA 3GGWA 2R9HD 5SWSA 1BQLH 3CU1A 4F57H 3MV8D 5IR1B 1OGAD 3VH8A 4CUCA 2NY5H 1WZMA 3MFFB 5GIRA 4AH2B 3DRQA 1NEUA 3BKCH 4RMTA 2NX5E 3MJ8A 1QVOB 2FJFB 2WQ8A 4KJWC 3BP5B 5J3HC 1M05A 2GK0A 1EMTL 1H15B 3OAUL 5T1MA 2MPAL 5IMKB 1S9WA 4K7PX 1QTYT 1AO7A 5CJOH 3GSOB 1QQDB 3MMEB 2X4TA 1NCCH 5I1LB 3VXRA 4UILH 1D5ZB 4R97C 3KPRA 4J3WA 2VL5B 5JXED 2ZKHL 2D9QB 4YHYC 5B8CA 5GGTA 1GZPA 2OS7A 2UYLA 5I76B 5F7DA 3B9AA 3NCEB 5A1AA 4HBCL 1GC1C 3BQUA 2X1PA 2YN5A 4X6CF 5CIPA 1HINH 1CIUA 1GGCH 2NY3B 4YHML 1S9KC 3B9DA 4XMLL 3NCJL 4P2OB 1T5WA 2NZIA 3LEVH 1TIUA 3CVIH 5DJ0B 4EOWL 1HSAB 2DQEH 4NRYB 1RZFH 2R23A 2CLZA 2R2EB 2JELL 4PGJA 5IGXH 1EV2E 3HAEA 1F3DJ 4GAYA 1A2YB 2XA8L 4UV7L 2FX7H 3C6LD 2H26A 2VH5L 1YEFL 3SDAB 5D1XC 2NY4C 3GBNL 5EZJB 2AP2A 2AABL 3OGCB 2NX5D 1W0WA 3QBTB 5I19L 1RJYB 1CGWA 1W8OA 3ARTA 5IJKA 1LK3L 2J5LB 1TJIH 1YY8B 4PJ5E 5AG8A 5IFJB 2NTFB 4NT6B 2V2WA 2ZUTA 3KR3H 1R0AL 3NFPA 1CLZL 5D7JD 3S34H 4IS6B 1NBZA 4KROC 1EPFA 4PYGA 5FA3B 1IQDB 1DBJH 3ULVH 5HGBB 3U7YH 5T3XE 3TYGH 5T5FH 1QR4A 3MLRH 4TSBL 4QYOB 3GM8A 3UJTH 4Z0XA 2QQKH 4FTVA 4OF8A 4Y1AB 2WK2A 4HCRA 3ARWA 4OBRA 1K5NB 1ZA6B 4EDXB 1T7ZA 3T09A 3TVMA 3G04B 3BE1L 5E5MB 3QP3A 4LHUD 8FABB 4HXBL 2BSRB 2IADA 1YJDL 3N9GL 4R0LC 4G8FA 4KKCC 2XZAH 1F3JB 2Q6WA 4I0PC 2CK2A 1HHJB 4QRQB 4PGCA 3DMMD 3QUZB 2A1WL 5GZOD 2AV1B 2C7UB 4NQSA 1I7ZB 3FFDB 3MO1A 3GMLB 3V6ZB 1HH9A 1C5BL 3PHSA 5E0QA 4L4VA 2EYRB 1HH6A 4EN3A 2OJEB 1XR8B 3WEXB 3B6SB 4NRXB 2VB5A 1I1AC 3IETA 4FQXB 4PJ5D 3WLWC 2I27N 3S3SA 5BW7A 4H25A 3ARGA 3GMQB 1IAMA 4JZOB 1MCKA 4NHCH 4BJLA 4PJ9B 2EDNA 3MV11 3EHBC 2QADC 3RVWD 4MD5B 5T3XD 4YZFF 4HFWA 3OAZH 2F53E 4L4JA 4ZO6A 5CS7A 4YQXL 4M48H 1MHCA 1XGUA 5AZEH 3NCMA 5I8EA 4Q9CA 4D0BB 5C0JA 1LO2L 4ZUUA 4HUWA 1MLCA 4BFEA 5DFVC 3ARFC 3RP1A 1XF2A 3QR2A 4HS3B 5EZOL 3CCHA 1KN4H 3OXRA 4L1HA 2YOCA 1TXKA 2Y5EA 4QRRE 5FHBH 1T1YB 2CR3A 3FO0L 3TA3D 2EDXA 2Z31A 1S7VA 1I7UA 4DUXA 2Q86B 4PS4H 4X7TA 5DR5L 4WEMB 4XNXL 2EC9T 4KMLB 1XF4B 2N56A 5FYKU 3ARBA 5CJXC 1QLFA 1NDGA 4M61B 5DC0A 1A7NL 2JCCF 3IJYA 1Z9MA 5LWYL 5IFHH 4ZFGH 3QHFH 4A6YB 5T3ZH 3SGJC 5D2LF 4EVNA 2OSLA 2DLEA 4IBLT 3L95B 5TQ2H 3NA9H 4NKIH 1GOHA 4DFIA 5FGRA 4F7MA 4L5FH 1OLZA 4H8WL 4HPYL 4NNPH 4RAUB 1A0QL 4PJBA 3OF6A 1J7VR 4BH7A 5JPMB 1GGIL 5B39G 1EVTC 5F9OL 1NEZG 3VCLA 4PTUB 3AM8C 4Y16B 2F53D 3QEQE 3P0YL 3RIAF 3HUJF 1VKXA 1OAUH 1HILA 4PB9L 2F8VA 1C8PA 4GW1B 3O4OC 3RY5A 1G0YR 3AMLA 1NGQH 3UCRA 4Z7QE 2W91A 3IVKA 4P23C 2P45B 3B9KB 5B21A 4OCSH 4HUVB 4NNXA 1S5HA 4LKXB 3RPIB 1X5HA 3TO2A 1JHLL 3ARYA 1BEYL 2ESVD 5DO2D 4QRRD 2P7TB 2A83B 5CBAB 3MNZA 5IR1A 1AP2B 3DVIA 1JGUH 3WXWH 1KGCE 1EGJL 1FZKB 1U8JB 4HAFA 4KY1L 4KMQA 2AXHA 2C3WA 5KVMC 1I7RB 2FJFA 3BP5A 2X4RB 1CICA 1WTLA 3PL6C 3TH2T 1H15A 5IMKA 4F8TA 2YMXL 1UG9A 1Z9OA 4K71B 2EYSB 1JZ2A 2JKXA 3BZEB 1EZVY 4PJHB 4LQFL 3GSOA 5TE7H 4CKVX 1QQDA 4LRIC 5D7IA 4DGIH 2P8LB 5I1LA 5IEKA 5ESVB 4J3XA 3LB6D 1MREH 1P4LB 4Y19D 1RIUL 4KJYB 1VFUA 4PV9B 5I1AB 5E2VL 4JRYB 5I76A 1C16B 4GG6F 1B2WL 3TBWB 4KTDL 4JDVB 1JBJA 1ZWIB 1QA9B 2VQTA 3KPOA 3ZDZF 1F58H 1B0WA 1IKFL 1H3UA 2XQBH 2YD5A 3OXSB 5C07E 2RB8A 1KEGH 3QEQD 4ZD3L 3RZCB 5K59F 2I60L 4P2OA 4NM4H 2NQCA 1J8KA 3D25B 2FR4B 3QIBD 5DD0H 2KZWA 4NRYA 1S9VA 1RSFA 2R2EA 1MRFL 4F2MB 4Q9BA 3VXPB 2ICEB 2UWEB 2R0LH 4HUUB 1A2YA 1ACYH 4HKBB 4WTWA 3TFKD 4GXVL 2J8UE 3R0MA 1TQBB 4KKNA 4V2CB 3TBSB 1UJ3C 4TSCH 3SDAA 5K9KB 2BVQB 3WIFB 4ONFH 4F80A 3NIGF 1KGCD 1FGVH 5EZJA 4UT9H 3QG7H 3OGCA 4QRPE 5BO1H 1S7TB 5FGBA 3AXLB 5FUCE 5IROC 3IFPB 3KLHC 2NTFA 4NT6A 4Y4KD 1QBAA 3SO3C 5TFSL 1VGEH 3TCLB 4EDWL 1SY6H 4LBEA 4KZEL 1V7ML 2F54B 2CGRL 1ZGLP 3JXAA 2ADIB 3GDBA 4X99A 5FA3A 4DW2L 4Z7VF 2FJHB 5B39B 3S88L 1IQDA 1DVFD 1NEZB 4XP1H 1MSPA 3KPMB 4U3HA 5HGBA 2ICWJ 1PSKH 3GFUA 5DHXB 2X42A 4QYOA 5FK9B 1YY9C 2BSSB 4Z7UB 5I1EH 4NBXB 4XPTL 2ZCLH 4Y1AA 2ERJC 4O9HL 2H6PA 4ORZC 5C07D 1K5NA 3EOYG 3SDYH 3BJ91 3BPLC 2EC8A 4LCUB 4P46D 1MPAL 8FABA 2VXVH 3GMMA 1ZS8A 3DTXA 5ANMB 2HKHL 4M7LL 1F3JA 4W68A 4XAWH 4LDOB 1HHJA 5BS0A 2PTUA 4OZIF 1UM4L 4RGMB 4FP8L 4FMFA 5AEAA 1X6LA 3SKNA 4XWGH 5I1CH 4YIQB 5DMGD 4AM0B 1QSFB 2AV1A 3P11L 1I7ZA 3CC5B 4IRSA 1QRKA 3MXVH 3GMLA 4OD2A 1T4KA 2NXZC 1NC2B 2WM0A 5C0DA 1ZLVH 2EYRA 1C08A 2OJEA 2VE6B 4E9LA 5FYJH 3UZEA 4PJIF 3HRPA 4FNLL 4WWKD 3VWKD 3S35X 4KRMB 1YC7A 3QRFM 4LFHD 4K9EC 1HXYB 3O2DA 2XZCL 3CLEH 1HDMA 2NY2C 3IRPX 3L6FB 5FCUH 1G7HB 4G9DB 4MD5A 1IGTB 2O93L 1T1WA 1OTSD 3MLYH 4JM4L 4MNQB 1I75A 3VFMB 5ADOL 4N8CH 4FABH 3N06B 3QH3A 4G5ZH 3VGBA 3ROLB 3GBML 1T22A 1Z6JT 1MQKH 4YFLI 4WO4C 3T1FB 2LVCA 4JB9H 4RQQB 2CLRB 3IFLH 4HK3J 5D8JL 3NPSB 2OL3H 3ELAT 2XFXA 4KK5C 5DC9B 2CK0H 5MENE 1JNNH 2EDRA 1TETL 1UCTA 1T1YA 3BWAA 3MQIA 3HR6A 1JUFA 4QCIA 3UTOA 3HMWL 5HYEA 4Y4HA 1F97A 3A6BL 4MAUH 5DRZA 4ZS6C 1X5YA 5JLZB 1XF4A 4TPRL 3RUGF 2OJZH 2R2CA 4N8PA 5F7WC 5TE6H 4OM1H 1F4YH 4M7ZB 4I4WB 4NO0A 1BQLL 2EDHA 2YS4A 4M8QB 3L95A 4F57L 5ENWA 1NQBA 3GMOA 3ROOA 5CP3A 2NY5L 3KYNB 3BKCL 4E42B 2N4IA 3LN4A 1JV5B 4R2GD 4I2XE 3NZ8A 3D18A 4KRLB 5JPMA 4ZTOH 1G7IB 4JR9L 3RDTD 1SJXA 5CJOL 4Y16A 3G5ZB 2RFXA 1T3FB 1DUZB 3ZKXB 5E8PA 1YQVH 4Z78B 4JFDA 3MV7E 3IDYB 4UILL 4MVBC 4C83B 4MGXA 1RU9L 3B9KA 1RHHB 5CCKL 1FZMA 4MA8H 4HUVA 4CU6A 4LKXA 4NQCA 4UIKH 3RPIA 3WYRA 2G9HB 3UAJC 5MEND 3QISA 3ZL4H 3ZTJG 2Z4QB 4O02H 1HINL 1BQUA 2P7TA 1LO3L 1GGCL 2GJ6B 4NO3A 1JF6A 3GSVA 5JIKA 3OGOE 1T7XA 3RWEB 1U8JA 3LEVL 3W39B 1TCRB 4GRWH 3CVIL 1I7RA 2CDEA 3MRMB 1OD9A 2DQEL 1RZFL 4NM8H 2Z0BA 1TLKA 5KBNC 4L4TA 5IGXL 2EYSA 4NC0B 1G6RB 1ORQB 3K46A 3DO3A 2P8LA 2FX7L 1OP5H 2BRRH 4KXZH 3LDBC 5ESVA 3GJFH 4ETYA 1P4LA 5F7MC 3TBVA 4TN9A 4KJYA 4PV9A 1IEBB 4LIQH 3FN9A 5EN2B 4JRYA 2VDNH 4RMQA 1LQSR 2DKUA 1N59B 3TBWA 4XNUH 5MHSE 3ZMRA 3AFLA 1EEYB 1QA9A 3TN0D 1W72H 1TJIL 2X41A 1CQKA 4PGBA 4WFGE 2A2QT 3OXSA 1CE6B 3KR3L 3I6GB 1V7NH 3N1FC 3S34L 3ZT5A 4UTBH 4QOKE 5C0BA 3PGDB 3D25A 3MV7D 3LCYA 2WAHA 5DRXB 5DRWA 1HSBA 2BNQA 1OL0A 1DBJL 3IAGC 2N7BA 3ULVL 4I3SH 2YD9A 3U7YL 3TYGL 1TTFA 2I9LB 5T5FL 3MYJB 3HA0A 3O9WD 3RX8A 3ULUF 4XC1H 2UWEA 1V3KA 3UJTL 2QQKL 1GIGH 2EDBA 1T21B 4WW2F 5D6DA 1UZ8B 1JWSB 3O3AB 4LPWA 1MCJA 5TQ0H 5CD5D 2EE3A 3TBSA 2FZ3B 2IPKA 1UKQA 5K9KA 1F4WH 2D03H 4U1HB 3THMH 3QEHB 5C08E 3KHOA 4GSDH 4NP4H 3PABB 1PZ5A 1LP9E 2PTVA 2ORBH 4AQOA 3V8CA 3WHXB 4ODXA 1NCDH 5EOCJ 4MAYB 3EAKA 1IAOB 1D5BB 2F54A 2VRAA 4AIXA 2ADFH 3FN3A 2FJHA 5B39A 4PP2B 4ZQKA 5IVZA 2E9WA 3W0WB 4MJ6B 3G9AB 5T3XH 2DRUA 1QEWB 5MHSD 3ZYJA 4JN2B 4LNRA 3B2VH 1S7SB 2OBGA 2ZSVA 4NZJA 4WFGD 4Z18A 4KJWD 3U48A 5J3HD 3M8OH 1FL5B 1G7PB 3CFJA 4QOKD 4NHCL 3V6FB 3MV9B 3PF2A 4I3GA 5HHQB 4JFEB 5ANMA 1WUNT 5E08L 4P5MA 5HYJE 3F7PC 5EU4B 3FN0H 3KLDA 1TQCB 3SDXB 4M48L 3MC0A 3FL7A 1BX2B 2A73B 5AZEL 4YIQA 4AM0A 1ODAA 2WUBH 3L5WB 4Q6IC 4X83A 5DURD 3AMKA 5JIIA 1QSFA 2CUHA 2MQ0A 4ZUTB 3CC5A 5JOFB 4MD4B 3VFWA 5C08D 1DQQA 4D94A 1ONQB 3SJVB 4X9HA 4HKXA 2QSQA 4UINH 3N1MC 1KN4L 1PX4A 2DM2A 3CDGB 4HWZA 3G6AB 2VE6A 1VCAA 4L8SB 4LPVA 1YEEH 1EHNA 5FHBL 5C0NC 3OAYH 1OGAB 4JPIA 1CGYA 4PRPD 1HXYA 2DDQL 4G6JH 1BGXL 5DQDH 3OHXB 4PS4L 5HVHB 4PJDE 5BZDB 3FRPG 3WFHA 4QKXB 1A47A 4WI2A 1IGTA 5JXAH 3IYLW 4MNQA 2BNUB 3F7VB 3VFMA 5BQ7B 2Z8VC 5IFHL 1N6VA 4HS8H 5IVOA 4X6EB 3QHFL 5D1XD 5T3ZL 4OQ1A 1KSRA 1BWMA 2B4CC 2NY4D 1AGDA 3ROLA 3ZHDA 4CW1B 3BEVA 5TQ2L 3NA9L 4NKIL 4U0RB 3T1FA 2CLRA 4M6NH 5GS2D 3KYAA 4L5FL 3FZUC 2KQNA 2XKNB 2VNCA 4NNPL 4HPOH 3GI8H 5AUMB 4P4KC 3BYYA 2IAMA 3X14A 1KLGA 4MJ5B 3HI5H 5DVNA 5HYJD 4KROD 1DBBH 5I66B 1FO0H 5I9QC 2C26A 5BOZG 3HPJA 3FB8B 4KTYA 1OAUL 1WWWX 3VD4A 3I75B 3TT3H 1JMZA 2QHRH 4GRLA 1WVZA 5DJXB 1NGQL 3GMNB 3LEYH 2HP4A 3WN5A 1T1ZB 1KACB 2AVGA 1MJ8H 1F4AA 5BVPH 5HI4C 2VTFA 4OCSL 3LRHA 3GHBH 4PGDB 1EFXD 3C6LB 4JGMA 2OP4H 3RGVC 2ED8A 1KCKA 1L0QA 4I4WA 1E4WH 1GL4B 4M8QA 3MRFA 3LV3B 4WUUE 3C8DA 1QSEB 1JGUL 3WXWL 3TWCH 2Z9TA 4IDJH 4M1GH 2NX5B 4KKCD 4EZMA 3GHEH 5EBWB 3WSQH 1JV5A 4R90H 3TPKA 2YPLE 1P53A 2A74B 5DD6B 4JM2B 5EU3B 4NC2B 4J4PC 5CUSH 3CVHH 3RL2B 5TE7L 1DUZA 4DGIL 3MSPA 4O5LH 1T80A 4G9FE 4Z78A 3QJHB 2L7JA 5F7FA 1MREL 1WIPA 5E4EC 4C83A 1P9MA 3P2TA 3LKSB 3TO4A 1RHHA 1WC7B 1I1AD 1I9JH 3QDJA 1CXEA 3RWJA 3WLWD 2G9HA 1FDLH 1KPRB 2Z4QA 4PJEF 3WFCH 2YSSB 3VW3L 1F58L 2XQBL 4O00A 2GJ6A 4HF5H 3EHBD 2QADD 4NIKB 3RWEA 4W81A 2FSEA 3O3UN 3AREC 3IU4H 4NM4L 5E56A 4MJIE 3V0VA 3FT3B 4HGWB 1AXIB 2CIIB 5DD0L 3MRMA 2W0FB 1Z9LA 1F90H 3Q5TA 2IEPA 4FMKA 3V0WH 1MVUA 1E0OB 1G6RA 2ITDA 4K3DH 3DMMB 4LLWB 1ACYL 4R26L 1ND0B 3MRCA 3DOSA 1IJ9A 2F8XC 5DFVD 3ARFD 1JZ4A 4WUUD 1P2CB 2Z92B 1MY7A 4TSCL 3HMXH 1KTLB 4ONFL 1IEBA 1I8KB 1FGVL 4UT9L 3QG7L 3IDXL 4YDJB 4NSKB 1N59A 4HIHA 5BO1L 3RY6A 3PHQA 2YPLD 4PJ5B 2Q87A 5K93A 2EXYC 5BXFB 1CE6A 4G6AD 2LE9A 3I6GA 4CJ1A 1CFNB 1VGEL 1MAKA 4N9GB 4JN1H 1SY6L 4G9FD 2KUTA 3QULB 4OUOA 3PGDA 4PLOB 3G5YB 2BZDA 4XP1L 4QRTB 4AT6A 1RK0B 2I9LA 3FO1A 3MYJA 4NQDA 4W6WB 1PSKL 3T0AA 4G8IA 4N1CA 1T21A 2IALA 5I1EL 1C7SA 1UZ8A 1JJUA 3O3AA 2ZCLL 4U1GC 4J2XA 3U0PB 3SDYL 2C1PB 3QEHA 1U8QB 2QSTA 3H6JA 2VXVL 3QSKB 3ARUA 1NMBH 3QQ4B 3KG5A 3TA3B 2DQIH 3O2WH 5KW9H 4XAWL 3ZLQC 1WIUA 3UYPA 3QDGE 1WLHA 3VXSE 4P23D 1IAOA 1E4XH 2YD7A 4XWGL 2PW2A 4ZNEE 5I1CL 2VABB 1A6PA 1PKOA 1KV3A 1S9YB 2BNRB 5JORB 2Q8BH 3MXVL 3MLTA 3W2DH 4G80B 4OUUB 3W0WA 5E6ZA 1CXLA 3K74B 4KRNA 3UZQA 4RWYL 5B3JE 5C70A 1UFUA 1RZJH 3PWNA 2DM7A 2HJLB 4JN2A 5IVXA 5GPRA 3GBLA 3PL6D 3DYPA 3TGXA 3S5LB 3QJFB 5FB8B 4YX2H 3CLEL 4JQXC 5CWSB 4JFEA 1WBZB 5FCUL 1OCWH 2BVUA 5DJCB 1AD0A 12E8H 1VFBB 1IAKB 2F53B 3MLYL 4N8CL 3RAJH 4FABL 5F71A 4G5ZL 3O6FC 4ZS7H 2G60H 1MQKL 1VERA 4HIJB 3CU7A 4P9HC 1NFDB 4JB9L 1WCQA 4MD4A 5IB2B 3IFLL 5D1ZC 3GMPA 4XCEA 1G9NH 1Y0LB 2OL3L 3SGDI 3FQNB 3SJVA 3ET9F 2NY1C 3DX7B 2CK0L 3OJMB 2P24B 4FXGB 4L8SA 4QRRB 1JNNL 4RAUA 1D5IH 4C4KT 3FRUB 4PUBH 4ZUVB 3L3KB 3PWPE 1INQB 2JCCE 3QDGD 2HWZH 3ZDXE 3MA9H 3VXSD 5EOQH 3E6HA 5CKAA 1B0GB 5JMOC 4MAUL 1RZIB 2MHAB 4CU8A 5E99H 2H1PH 2JIXA 3WD5H 2OJZL 4HIEA 2P5EA 3I6KA 1KIQB 4X6EA 5TE6L 4OM1L 1F4YL 4KKAC 1FORH 4I18C 5IMMB 1OP3K 1ZLUK 4YBQC 2D31B 3MLXH 1KC5H 3AB0B 5J1AB 2DLTA 1N7MH 1SQ2N 2XKNA 4R4NC 3KLHD 1U8PA 4I0KA 4JPKH 1SYSA 4M43H 1OW0A 4KHXH 4ZTOL 4MJ5A 3PWVB 5AYUH 4H20H 3QEQB 1NGZA 3ESUF 2DICA 2YD8A 5EIIA 1S7XA 1AQKH 1CT8B 3QIBB 4X6DA 3DUUA 5DJXA 1VEMA 3VXTB 1KJVB 1YY9D 4B50A 3EFFB 4C4KO 3HC0B 4MA8L 5EH1A 2PCPB 5E6ID 4WHTB 3MROB 4UIKL 1KF9B 4HK0A 2A9MH 3LKRA 4O02L 1JZ6A 1INEH 3PWPD 4PR5B 1FCCA 1QSEA 5CILH 1C12B 4DCQB 4LCWA 3CD4A 3RBSA 3WXVH 1IKNC 4NM8L 3WKMH 2A74A 5DD6A 5DJAA 4K55A 4JM2A 4Y4KB 4JY6B 5EU3A 2J8OA 1R5WB 4XBGA 3RL2A 4UV4H 3C5ZD 4JO4H 5GRWA 4GG6E 1Y6KR 2BRRL 3ZDZE 2GITB 4X6FB 3FFCE 4WGWB 3LKSA 4LIQL 4V1DE 4EUPG 2VDNL 2C4FU 4F9LA 4OZFB 5DA4A 5IW6B 1RJLA 4XNUL 5KSUB 3K2UH 1W72L 4YDKH 2YSSA 3QUXA 1RI8A 4POUB 3QQ3A 4FQ1L 2CRIA 1OQOA 5DVMA 2NY2D 4JVPA 2AJ3B 4P46B 1NL0H 1V7NL 2P5WE 2FL5B 3EGSB 4UTBL 2HMIC 1CWVA 1G1CA 3FT3A 2AJZB 2CRZA 4HGWA 4MHHG 4OZHB 2MOVA 3QNZA 3MRKB 1VFAA 5B8CC 3JVGA 4XC1L 5DRNB 2J8UB 4F3FA 2QTEA 4LLWA 4WO4D 3FHAA 4CVWA 3PWUB 1GIGL 3BQUC 1ND0A 1WT5A 5H8DA 1AI1H 2K7PA 4HKZA 5D5ME 5L9DH 3MCKB 5TQ0L 3FRPA 3VGFA 2OTUB 4NWTH 5I30H 1P2CA 1X3DA 4KK5D 2Z92A 1F4WL 2D03L 3THML 3IDMA 4GSDL 4NP4L 4KV5E 4QRPB 2B8OT 4X4ME 3X3GL 2ORBL 1BVKB 4NSKA 3HNTH 1T04A 1NCDL 4Z7VE 4PRHE 5TDNB 3VWKB 2X1QA 4PJBF 3LPFA 4ODUA 1EJOH 1I3RB 4D9QE 2ZCKH 1CFNA 3UP1A 3QULA 5ISZE 5I1IH 2IANA 2ADFL 3G5YA 1IGJA 3FFCD 3W5NA 4YXKH 1I7TB 2R2HA 4GLRH 4JANA 4QRTA 1RK0A 2IBZY 4V1DD 1G7QB 5T3XL 1CGVA 4LLVB 5IJKC 3GSQB 5GRXG 1FVDB 4AENB 1HNFA 3UTTA 1SEBB 3B2VL 3Q6GL 3HNSH 2C1PA 3MRHA 2H32H 2P5WD 3HC3H 5CGTA 1QFUH 5TDPB 3ALXA 4BSVA 4OZIE 2Y06H 1JPST 5A2KH 3Q1SH 1Y18B 2DJSA 4FQHB 4GMSH 4MVBD 4HJGB 2P8MB 2DWDB 2WUBL 1I9IH 1KJ3H 2BNRA 5JORA 1UZ6E 5D93B 3UAJD 3TVMC 4OUUA 1NCWH 4LASH 1BLNB 4PJFB 4UINL 1DR9A 1LD9B 4PRHD 4CMHC 1YEEL 1W0VB 4G6MH 4WI4A 1H5BB 3OKNB 4GW4A 4JG1H 5HD8C 5GS0C 4D9QD 3QJFA 4G6JL 5FB8A 2E7BA 4R2GB 5DQDL 4JKWA 3DX6B 2CIKB 5ISZD 3RDTB 2MMXA 3TEUA 3QIUD 3ARVA 4DZBB 1ZK9A 5JXAL 5A43C 2QSVA 1IAKA 3WUZA 4BFIB 4MCYA 3KPSE 1FSKC 3Q5YA 4P5KB 4MQ7B 3G9VA 1J0HA 4HS8L 4YPJA 4EN3C 3KPTA 1R3IH 4G42B 4ZAKA 3CFIC 4GW5A 5DVLA 4XNYH 5F6IC 5GS1A 1CE1H 4HIJA 4NDMA 1KJMA 4R9HA 2X5PA 4S10A 5TH2A 1NFDA 2FIKB 1R5VB 1FFOB 2NY6B 4M6NL 3ARGC 3HZYB 1IZKA 3F12A 4HPOL 3FQNA 4XTRC 5LJYH 1E4JA 5MENB 1OWRM 5IW3A 4BFBD 5JW5B 1CIDA 3HI5L 4J3OC 3UEZA 1DBBL 3NAAH 4LLYA 3L3KA 1FO0L 4OF5A 4ZUVA 4P5TA 4HJJH 4CU7A 1YN6B 4RGNC 3RGHA 2GJJA 3DX8B 3TT3L 5CAYB 2QHRL 3LEYL 3PDGA 3RNQA 1NGXB 1MJ8L 5BVPL 1KPUA 4WI6A 1WAAA 3OKEB 3HNVH 3SBWA 5F9DC 3GHBL 2NXYB 4I48B 1KIQA 2OP4L 3FHQA 1RUAH 2FLBT 4K3JH 5EO1B 1E4WL 3V4UH 5ITBH 2VITB 2D31A 2Z31C 4OT1H 3TWCL 1V3MA 2ZG2A 4FFVD 4IDJL 5DHVH 1UC6A 2D2OA 1FGNH 1A6WH 3GHEL 3WSQL 4LVOC 4I2XB 2BVEA 1NCAH 4R90L 5E5RB 3DROA 2P8PA 3Q48A 3PWVA 3ARBC 4LP4A 4KQ3H 5AZ2H 5CUSL 3CVHL 3KPSD 3PXHA 2OTWA 4QRSB 1BFTA 2H2SC 1F11A 2Y7QB 1KJVA 1VEPA 5DDHB 3BSZH 3EFFA 3O9WB 1OTTC 3U30B 5FYLE 1I9JL 2GAZB 4XMPH 4WHTA 5EZLB 4UTAH 2BFVH 2XZZA 4XNQB 4HF5L 3V79C 2HG5A 4HXAH 3HFMH 2HTLC 1JL8A 2V7HB 3U0TB 5FEBA 3IU4L 3V95A 4DCQA 3BGMB 4F58H 3DVNB 4H88H 3K4AA 1OT1A 4Y2OA 1WFUA 2ATKB 3F6LA 3V0WL 1T66C 3EYQD 4K3DL 3KPLB 1MCBA 4QHNA 1CD1A 4LLAA 2Q76B 3BD3A 3CZFA 1TNMA 3VFUB 2GSIB 1CI5A 2GITA 5JQ6L 3EO1B 5A2FA 3HMXL 1W2KT 1J1OH 5E2UH 4AL8H 4ACPA 5IW6A 2EXWC 1A5FH 1ZT7B 4XBPA 4FQQB 3BZDA 2UY6A 1IEAA 2AJ3A 4QOKB 4XVUC 5I18H 2FL5A 4JN1L 4F7PB 4NHUB 3ULSB 3BEWA 1ZLWK 5IBTH 3TCXA 4OZHA 1XGPB 4OI9A 2NPLX 3I02B 3MRKA 2YEZB 3SO5A 4HZAA 3TYFB 2IH1B 4NO5B 4R97B 4NOBA 2ILLA 2Z93B 5FYLD 3MJ7B 2J8UA 3GSWA 4KQ4H 4H1LG 3PWUA 5DYOB 4XPBH 3MCKA 2NY3C 2GUOB 5C08B 3HI6H 4YDVA 4NOFA 4Q6YA 1LP9B 4P2OC 4QRPA 3U9PH 2DLFH 3REWB 4NQVA 3OV6A 1B88A 4L3EA 4HUMB 5TDNA 1NMBL 3VWKA 3GSXB 2DQIL 3O2WL 5KW9L 2ED7A 2MKWA 3NFSH 3BPOC 1JN6B 5HI4D 1TZIB 3IJHB 1E4XL 4WIQA 4BZ1H 3DPBA 4PJAF 5JIHA 5HVFB 3SDAC 2Q8BL 3RGVD 1I7TA 3W2DL 2FBOJ 5CP7A 5KSBA 1IBGH 3ARQA 2AJSH 1G7QA 2GI7A 5D1XB 1CS6A 4BH8A 3T65B 1J0JA 2NY4B 4HMEA 3GSQA 1RZJL 2J5LC 5FGBC 1FVDA 4AENA 4JE4B 3QWRA 3T0WA 1IAIH 3D2UD 4FFYH 1BMGA 1SEBA 1AR1C 1QBBA 1MNUH 5EBLB 2DD8H 3L3GA 3DUSA 4YX2L 1KTDA 4PJCF 4J4PD 4PV8B 5HJ3A 5C0IB 4W6YB 3KXFD 5I1DA 2M1KA 4CVUA 5HYJB 1OCWL 3JTTB 3SHSA 3IFOB 5ID1B 1AHWB 1Y18A 12E8L 1RHFA 4FQHA 2UV3A 3RAJL 5I17B 3VD9A 4ZS7L 2VLRA 3R1GH 4JKKA 3VXME 3U4AA 2G60L 4DKAA 5BZWB 5ACZB 4I5BA 3AS1A 1G9NL 1IAIM 2XWTB 2CKBH 1EFXB 5LQBH 2R0KH 2RHEA 3TLRA 3PHOB 1BLNA 4PJFA 1LD9A 5INCA 1D5IL 3IJSB 3ARED 3OKKB 4PUBL 4R0LB 1MWAB 5I15H 4EUPA 1NC4B 4PJ7B 3MA9L 1SMOA 3SPVB 2NMSA 4XGZB 2XACC 4PJDB 4MA7H 3QNXA 2CIKA 3L7EB 4CMMB 2A6DB 4J12A 5E99L 2H1PL 5ICYB 4IRSC 3M17B 5EPMA 5L7XH 3VFSB 1E6JH 3WD5L 3NTCH 4DZBA 2DKMA 2A77H 5LGHH 4MQ7A 5HVWA 2HFTA 3VWJB 1D5MB 4G42A 1FORL 5I8KL 1EHXA 4FQXC 3RWHB 2OMBA 4X4ZA 2FIKA 4I0CC 1R5VA 1A4JB 1KC5L 4TVPE 1I1AB 2QR0A 3D87B 1N7ML 3HZYA 4WFHE 5SX5K 4JPKL 2EXYD 5DK2A 4H1LB 2ZPKH 4M43L 4KHXL 1VACB 5F1IB 5JW5A 1LNUB 3GSRB 3DXAE 5E94B 5AYUL 4H20L 4UUJB 1ZANL 2QADB 4TUJB 5B4MD 2K3TA 1JYNA 5EUOF 4K94H 3NFNB 1KJ2H 3VXMD 1AQKL 2HJFA 4M62H 4EEEA 25C8H 4U1KB 2CDFA 4UU9B 3H3KA 3V4PH 1MRDH 1FNFA 3DETC 5FUOL 4YR6A 1NGPH 4C56B 4LAQH 4P9MH 2J12B 4C54A 3OKEA 1U93B 3ZYZA 4M7JH 4J7RA 4JRWA 3T4AB 4F7EB 3ZE0F 4NFCA 3V2AR 1U8OA 4WUUB 5EO1A 5BCAA 2VITA 3LD8B 2UUDH 2X89D 5CILL 2G75B 3PV7A 4NZRH 3U9UB 3QZWG 4LEXL 4Y4HC 3LQMA 5EWIL 5IOPB 2CO7B 5H37H 5BRZE 5F97E 1QUNA 2V9RA 3L3IB 4MJ4A 3WKML 1A6VH 4K9EH 3NOIA 1J0YA 4BQ6A 1BBJA 2WV3A 4HIXH 3L3DB 4UV4L 1FL6B 4JO4L 1C5CH 4HC1H 4EI6A 4OGAC 4QRSA 3ZT7A 4PJEE 3BW9B 3FB7B 4ZUSB 2EYTB 2VN7A 5DDHA 4TVPD 3RY4A 3WJLA 4WFHD 5IHBA 4O2EB 2GAZA 1Y6NR 3VXOA 1XCQA 1PX3A 2VLMD 3K2UL 5EZLA 2OX5A 3DXAD 4DN4H 1WBYB 4XNQA 4Y16C 1NL0L 4MJIB 5DWUH 3FTGB 3U79A 1GGTA 3BGMA 5FYJU 3DVNA 1S3KH 1UVQB 2BJMH 3M1BA 2VAAA 1CXHA 5JA8B 3O6FD 4RNRA 5D6CA 2ATKA 1DFBH 3B9KC 4NN6C 3LQAC 2NW3B 2HLAB 3KPLA 3IDIA 5D1ZD 1AI1L 3QHZH 5L9DL 2WIIB 4NWTL 5I30L 2NY1D 3EO1A 5ELIA 3KJ4C 4Y2DA 4PRIA 5LAXB 1ORSA 1F42A 1FCGA 3VI3F 1S8DB 3HNTL 2DI7A 5DK0B 4RA0C 5BRZD 1ZT7A 4G8EB 4FQQA 4LKCB 1EJOL 3DYOA 4I1NB 3RWFB 1QPPA 2ZCKL 2NYYC 4WW1B 4NHUA 3OG4B 4X5WB 4LLQB 5I1IL 3H7LA 3NPZB 1BJ8A 2YEZA 4YXKL 2W07A 4KKAD 43C9B 4NO5A 4TNWF 1LDSA 5SWSE 4BKLB 3MJ7A 1CFQA 1CQYA 4LLUB 4YBQD 2D9CA 4KK6C 2R4SH 1HCVA 3WIHH 3A6CH 2P48B 4KPHH 5JO5B 4R4ND 3PGCB 3RJDA 1LEIA 1QFUL 3B3IB 1A3QA 1GC1L 2V5MA 2VZSA 1AO7E 3S98A 2Y06L 3REWA 3GSXA 1MCQA 3Q1SL 4KKBC 3VXRE 1DANU 1Y6MR 1CZ8H 4GMSL 3R06B 5F89B 2XKUA 3KPRE 3QRGH 1CDCA 1VHPA 4QGYA 5D6DC 1TQBC 3IJHA 3V7AG 3D85D 4QHMB 1A1OB 4WDIA 4G6FD 1BFSA 1I9IL 1KJ3L 5F96H 1U58A 2D7OA 2APBA 3EJYC 2LFGA 4LASL 2F74B 1ITBB 3BVNA