4DK6A

Structure of editosome protein
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
127
structure length
127
Chain Sequence
QVQLQESGGGLVQAGGSLRLSCAASGRTSSLYSMGWFRQAPGKEREFVAAISRNGANTYYTDSVKGRFTISRDNAKNTVELQMNSLKPEDTAVYYCAADRFPTMEVVTIMTNEYDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/immune system
molecule keywords single domain antibody VHH
publication title The structure of the C-terminal domain of the largest editosome interaction protein and its role in promoting RNA binding by RNA-editing ligase L2.
pubmed doi rcsb
source organism Lama glama
total genus 36
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dk6A00
4K3EL 4O5LH 1BQHA 1XF2B 1GCFA 4HS6B 4EXKA 4ZUTB 1WBXB 4MJ4A 3U9UB 4OLWL 4U0QB 3OAYH 4XMPL 4WCYL 1QKZH 1CLOL 5EG6C 3I02A 2EDKA 3BPCB 3KPRE 5IFAH 4Z7VB 5EUOE 2G9HA 5DZNA 3RVUC 4R7NA 2ZUYA 1NMBH 1OTUD 5AYQA 4U1MA 1QSEB 4APQC 4RFNB 3V0VA 3IGAB 3PUCA 3PWVB 2J4WH 2HH0L 5GS1C 3C2AL 4R26H 1D5BB 1U8QA 3DIFA 4XH2A 3ARBC 1EAJA 1CFQA 3ZSTA 4JRYE 3CU7A 4JAMA 4MA3A 1B6DA 5DA4A 3V6OE 3HG1D 3WNMA 4LMQE 2OJEB 3B8SA 5MHSE 3UPAA 4AL8H 1V7NH 2ZZUT 4NQCA 5ICXB 4RDQF 2O5ZH 4K3EH 4S0SD 1N59A 3EFDL 4ZQKB 3FQRB 1BJMA 3LHPL 4X6DB 1TZHB 3PHQB 1GHFL 4OLWH 3C5SB 4Q9CA 3CFEB 5HSFA 4XMPH 3B9VA 3MBED 3NPSB 1CLOH 1VFAA 5IBLC 2IH1B 2V5SA 1A9BB 3BFOA 4U6HA 5TDOA 1SYSA 2XYCA 2QR0B 1RULL 1JCKA 1ACYL 3THML 2HH0H 5HHNA 4K3GA 1NFDA 3C60A 3VFWB 4MXVF 3P4LA 4PJ5D 1CLCA 2OI9B 3C2AH 3T2QA 3WN5A 3NPZB 1FO0A 2VLKA 3ZE0F 4P49A 1HDMB 1HE7A 3OX8B 1FVCA 1YY9D 2IFFL 2P24A 5DZLA 1A6TB 2ARWA 5B21A 4GKSB 4Z18A 1GOFA 4QTIL 1U8LA 3IFPB 2C4FU 4RMUA 4HV8B 4MB4A 3EFDH 5B3JE 1RHFA 3LHPH 3AB0B 2GJ6E 3QZWG 5DURD 3EYQC 4JKLA 3QCVL 4RDQG 3VDCA 1E27A 5DR5L 4HH9B 2NTFA 4I5BA 4ODHL 3OF6A 4P2OA 4MQ7B 4HUMB 3N9GL 4K7FA 5CD3A 4HJGA 1P9MA 3EOYG 1RULH 2FX8L 4R0LC 2W60B 1PZUB 1ACYH 3LD8B 5IBTL 1CK0L 4LNVA 2J2ZA 2DIJA 1PYWB 2PTUA 2X4PB 1R5VB 3CC5A 2FGWL 5D6DC 4FG6C 3IT8D 3VWJD 3QXVA 4WUUA 3DYOA 2GJZA 4JQXA 4BJLA 5JO5A 2IFFH 1NGXB 1MFCL 2XZAL 3BXNA 5ETUA 2ICCA 2VLRD 4X7SL 1KELH 4U0RB 4QNPE 5SX4I 3MV9E 3E8UL 3FB6B 5DT1L 1T0MA 4QTIH 4XPGL 5H37G 3GMQA 4BA8A 4I18C 5DJYA 2X4UB 3HAEA 3I75B 5LKNA 4JFED 4PJGF 5TFSL 4JJHA 2BMKA 3RTQB 3BO8A 3QCVH 5D1ZB 3TA3C 5DR5H 2EDQA 2R15A 4HC1L 4N68A 4ODHH 4CW1A 1BOGA 5T1LB 2JIXB 2X10A 3S8WA 4Z9KB 1A21A 4NN5B 5FOJA 1XGTB 5ABDE 3SGDH 2Y07L 3BJLA 4XB8A 1RUAL 4G9FE 2FEDD 3MOAL 4M93B 3CK0L 1RJYA 3HG1A 1ZTXL 2FGWH 1Y0LB 3WLBA 2BNQB 1PLGL 4CVXA 4UDUB 1JZ6A 3IFNL 5D2LB 2IQ9L 2XZAH 3JV4B 4HKZB 2HTKC 1QFUH 2R1XB 5BVJB 3RWFA 5JQHC 4UOW0 4KK8C 3E8UH 5DT1H 1KJ2B 4XPGH 2UZYB 4Z7QF 3MBEA 3T1WA 1U93B 1CTNA 4G3YL 6CGTA 1ZLUK 2ZSVB 5HHOE 3PGFL 5IIEB 1U91B 5TFSH 2MFNA 4EDXB 1HXMB 2OL3A 2JCCE 1OGAD 4HC1H 4LLWB 3DYPA 4JY5H 2BDNL 2F53B 4H5SA 4S0TD 5E99H 5IB3A 3T0EC 4PJ5A 3PNWB 5ID0A 1LO4L 2EZ0C 4OUOA 1H3VA 1IAMA 4PREA 2H1PL 2O61B 1YJDL 3MOAH 5DSCB 1W72B 3BQUC 4HUUA 1CXKA 1O7SA 2D7TL 4P4RA 3UDWA 4X6CF 5HD8C 4OLUH 4GG6F 1ZTXH 2IALA 1PLGH 1RJZB 4U6XB 2R56H 3QEQE 3IFNH 1AGFB 2IQ9H 4ODXA 2XKSA 4NQVB 4NZUH 5GRYA 3G6AA 2DLFH 1H0DB 4N0CD 3DTXB 5C0CD 4JM2C 3U4EA 2G60L 3NAAL 4K3JL 5EBWB 4G3YH 2ICEA 4ETYA 3PGFH 3ZHLA 1GGCL 2ESVD 5FYKE 1XR9A 1MFEL 3ZHKA 4JN2A 3S6CA 1JJUA 4HW6A 3O8XD 1AGCB 1IEAB 2BDNH 3KPPA 5BZDA 1UQSA 3RKPA 4JFQA 1CGUA 4FTVD 1KGCD 5JOFB 1LO4H 3P0YL 1YJDH 5GIRB 4CNIA 5F7HA 3VWJA 4KI1A 1CE6B 4K8RD 4EUPB 1OAKL 4BH8B 1MCCA 1JGUL 2VLRA 1KTLB 5ERWA 5TDNB 1MHPL 3VMPA 1WC7A 3SCMD 2C7UA 4D8PB 4IRSD 3CVIH 3WXVL 1K9TA 2PXYD 1NEZG 1CGXA 5KN5B 3ZDZF 4AY0A 3O6ML 3S5LB 4KAQL 1U58B 4JFEA 5DRNA 1NJ9A 2G60H 2HG5A 5I8KH 1SM3L 2P8MA 3H9SD 5MI0B 2FYYA 1TCRB 2Z92A 3B4NA 4ZFFB 3DECA 2Y7QB 1GGCH 1BGXL 5GJTL 4E41E 3BEVB 4GRLD 5AYUH 1MFEH 4P3WA 3QI9D 5FB8B 4JDZA 1H3XA 4MSWB 3S35L 4U1IB 1I1CA 3MRJA 4DVBB 1ZA6A 3NN8A 3VXSD 3MR9B 3VXNA 5FECA 4TSBL 2BJML 3K2UL 1PG7W 3SGJA 1JGLH 4LU5L 4X6EB 3P0YH 1V3MA 2DTML 4H25B 1CIUA 2MPAL 1OAKH 4PJ8D 4ONGL 1FL5A 5DJ6A 4L4VD 2EIBA 1KIPB 3QISA 3MRLB 4Y89A 4PY7A 3ARED 3IFLL 3WXVH 3R0NA 4FFVD 1RFDL 3JTSA 1S7SA 3O6MH 4JR9L 4KAQH 3BOVA 5I8CA 2XTJE 4XNQA 1FZKB 2APVA 3A6BL 3CSGA 2BCKB 4MZ2A 3RX7A 3OR6A 2WP3T 4NCC2 4PLKC 4ZTPL 1BQSA 1OGAA 4C54A 4AH2A 1BGXH 1UCBH 3H9HB 1Y18B 3L3HA 4K71B 5I1AB 3OKEA 5HDQL 1QLFB 3ET9F 3SDAC 4M7ZC 4M48L 2AXGA 4AEIL 5DQDH 5D7LD 1X5IA 4TSBH 2BJMH 3FCTB 3K2UH 5HGHA 3BH9A 1JHTA 4PJDE 4P5TB 4W4NA 2DTMH 1KBGH 4L3AA 2MPAH 3GBLA 1CFBA 5FYJD 3QFJD 3LB6D 3TNMA 1CDUA 3V4VL 5D8JL 3O4OC 3BMWA 4KZEL 3MUGA 4PJ9B 4DVRL 1JGDB 3W39B 5EPMA 5C0CA 2PW2A 1ZMYA 3IFLH 4X6FA 3QIWD 4N1EA 1A7OL 3QUXD 2YMXL 1XF5B 3IRPX 2BFVH 4JR9H 4DFHA 1UZ6F 3W82A 4N9OB 2V2TB 5TE4L 5F7KC 4GRMB 1FVDA 1B9ZA 2ESVA 3A6BH 1KYOK 3F7RA 5T1MA 4GAGL 4LMQI 1KCRL 5CIPA 4F7MB 4ZTPH 2HAZA 3LDBC 4PJBE 4NBXB 5CSZA 2ATKA 5ANMA 3MLZH 3O2VL 3O8XA 2EE3A 1G6RB 1T22A 4NNXB 2XTJC 3VXMB 1C08B 5L6YH 3FQWB 4FTVA 5HDQH 8FABB 3GBML 2AJXL 4HBCH 3D25B 1NLBL 4Y2DC 4QRUB 3FT3A 3IFOA 3MRIB 2GITA 4HCRL 3OJDB 5IEHA 43CAB 1RZIA 1MI5E 2AW2A 3MJ6A 3SCMA 2D0FA 4K07A 4IRSA 1DSFH 4NJ9L 2PXYA 5F72S 4TNVK 5EOTB 3V4VH 5D8JH 3TGXA 5CSGA 4KZEH 4MWFB 5T1DL 5D5MA 3FOLB 4IOFC 1G7PB 4LCCB 1A7OH 3DX7A 3H9SA 1VACA 4PD4J 4MJ6B 4PG2A 2NY5C 4L29A 1NCNA 1F42A 5F71A 3WFZA 4P23C 3MRGA 1AO7A 3BP6B 4GAGH 3HKFA 2IC2A 4GRLA 1KCRH 3BUYA 4QTHA 3MRQB 3PWUB 3QI9A 1B0GB 3FRPA 1KJ2H 4M7LT 1U8JA 4X6CB 4GG6B 3VXSA 4O4YH 4YDKL 3MC0A 2NY3B 5JW3L 4LL9A 3ZDXF 4C56D 1KIUA 5T5NG 2AJXH 3X3FL 1NLBH 3EYFA 4R97C 1MWAA 4YGVA 1IFHL 5F96L 1U3HD 4PJ8A 4CMHC 4HCRH 2AJSL 4KMQA 4L4VA 1ZGLM 1MCWM 1YEKL 5LJYH 2H2PC 3M17A 3EBAA 5KSAD 1WQVT 2P49B 4PJFA 3G6DH 3PHOB 2GEEA 4RCAA 4PJCA 5GS0C 5A2LH 3V4UL 3HB3D 4R9HA 5FA4B 4YHZL 4NPYA 1LMKA 3CD4A 2HN7B 1YEJH 4NZTL 1EBAA 4KK6D 1X5GA 1J8HD 4ODTL 3DXAB 2QSCL 4KMLB 2B5IB 3MCG1 5SWZE 2SEBA 1CDJA 1FL3A 5GISL 3EYVB 4YDKH 4QOKE 4M6ML 3ZTNL 4O2CB 5D7LA 5CZVH 4M9OA 5JIHA 2YA2A 5JW3H 1QO3B 4PY8J 4NUJB 5SX5K 3UJIH 4EI5B 2F74A 5DC0A 3VFGL 1OY3B 3BPNC 5DFVC 3IDXL 4WHTA 5F96H 4Q74A 3QFJA 1T3FA 3CZJA 5BCAA 2AJSH 5E4EB 2DM3A 3QDMD 4E5XA 1A3LL 1YEKH 1HILB 3LKSA 3LQMA 2BY0A 3KLDA 1OD7A 4JPWH 1JV5A 4IEFB 4X4ZA 3QIWA 1KV3A 3QUXA 3GSNA 2X1PA 4EUPH 1Q72L 3V4UH 4YFEA 3ULUD 3VH8A 3MLUL 2DQDL 1AGDB 4NZTH 5MERA 2DD8H 1J11A 1TENA 5EOCL 1TVBA 4P4KB 3AS0A 4ODTH 4BFIA 4OLVL 2QSCH 3IXTB 2VXUH 4PGCB 5AAWA 5MEPA 5J1TC 3LQAH 1EGJL 5GISH 1EFQA 1JYVA 1NFDF 4M6MH 3GSXB 3TIEA 2YPKA 3LH2H 4LVOC 4ELKB 3S37X 1T66D 1G1CA 3VFGH 2VISA 3IDXH 3RVUD 4X7TB 1SEQL 2RAMA 4OCYH 43C9A 3MLTB 3MV8B 1EEUA 4APQD 5C86A 4WU5B 5IHBA 5H37H 5L0QC 2PKDA 3P4OA 1QRKA 5CBAA 1QNZL 3FFCE 4FQXB 1V5JA 3WS6C 3ARBD 4JFDB 2BXYA 4GMTL 4XP6H 1KC5L 4NGHL 1Q72H 4LVNB 3T09A 3W11C 5C3LD 3TJHC 4L5FL 1RZJC 1JGVH 2DQDH 1I1AB 4LEOA 3NCJL 2J7LA 5I19L 5T5FH 4XCYA 1BQLL 2HLAB 5EOCH 2Q86A 5E8OA 1GZQB 2B1AL 7FABL 4XCEA 4OLVH 4NHUB 1AH1A 3C9NA 4C56A 1CCZA 1LNUB 1EGJH 5HHPA 3ROOB 2QBWA 3P9WB 4MX7A 1U3HA 4XWGL 5AZEH 5KSAA 1TLKA 5JQ6L 4OF6A 4MXQC 1SEQH 4QRSA 1H5BB 1V3JA 1LP9B 5T33L 2ZCLL 3ZE1E 4NQSB 4F3FB 5I17B 3KPRD 3C6LC 1MJ8L 2XWBA 1QNZH 3B9KB 3U46A 2DQGL 1CFSB 4ZO9A 4GMTH 2BC4B 5F6IB 1U36A 5GGUB 1GPOL 1UKTA 4LAJH 1J8HA 2DKSA 4BSWB 4TNWF 4U1NB 1EEYA 3VGEA 1BQLH 2J88L 2NLJA 4JRYD 3KGRA 4DKDC 5MEQA 7FABH 3PDOA 3T08A 1F00I 2EXYC 4XNMB 5IUSA 5F1IB 5MHSD 1LE5A 3EYQD 1QSFE 3D39B 4PGEB 4Z0XB 4XWGH 4AK1A 3QDMA 3PQYB 1J05A 2C3GA 2I60L 4KWUA 4DAGL 4XCCL 1FNAA 5JQ6H 1T04A 2XA3A 5I16B 2H2SC 4OCMC 3VFUA 4Z78A 2ZSWA 3WIFA 5BXFA 3TYFB 4CDGC 2ZCLH 3FMGL 5HHQB 5GRVK 1MJ8H 2V5MA 2P43B 4WO4C 3VE0B 5J9PB 1YN7B 4G43B 2DQGH 2A73A 2YUXA 4MD5B 2WQRA 1GGBL 1NCUA 3VXPB 2VIRB 1H3TA 4XP9L 3LQZA 2DLGA 5FHAL 3BIKA 3ROLA 2BHYA 2VSDA 1JGEB 1G9MC 3QUYB 2X44D 1FDLL 5K9QI 1FFPB 2BY1A 3QUKA 5I18L 2DF3A 5D2NC 3GMOA 1H8SA 4YHLL 1YMHB 1IILE 3TV3H 1TTUA 4U6YB 1QBLL 3QIUB 2J3SA 3TA3D 5KOVC 5AAMA 1BQHB 1SJEA 4OCRL 2G75B 4APQA 5T1KD 2I60H 4L1DA 1QTYT 1C5DB 1DE4B 5I6XC 5GS1A 4XCCH 2GJ6D 3Q6FA 3UTZB 5BV7B 2XWJB 4WW1A 4U05A 3ARBA 4HZLA 4PJIE 4MNQE 5ESQA 1N5AA 2G9HB 3B5HA 4KC3B 4G9DB 3GJFB 4GXUM 4OLZL 4BQCA 3V0VB 4LSRL 1G0DA 2VXSL 1T1XB 2VDRL 4M7KL 4XP9H 2MJWA 5FHAH 1U8QB 1MPAL 3R06A 1B90A 1DVFD 2HTKD 1A6AA 3IXAA 4KK8D 3VGAB 4Z7WA 4Q6YA 5I18H 1U8HB 4Z7UA 4P2RE 4Y5XC 1NGQL 5DEZA 1AJ7L 1K3ZA 3KLAA 4OV6F 3B5GA 5D7SL 2CH8A 3LSOA 3MV9D 2AEQL 4NQCB 4LAQL 3VU2A 4QRRE 1F4YH 5EU5A 4X5WA 3C5JA 1NCTA 3MREA 2JJUA 3KPRA 3UZQA 1VFAB 5EUOA 5DJ0A 4X98B 2EZ0D 3BKYL 4EKXA 1D5ZA 4U6HB 5C08B 3BQUD 1SYSB 4MDIB 4OLZH 5HD8D 4LSPL 4ZD3L 1EIBA 3SO3B 3Q5TA 4LSRH 5A2KH 1ZVSA 5HHNB 3C60B 5F7UA 2VDRH 4G9FD 4M7KH 4WFEE 2DQEL 2B4CL 3OKYA 4XZUA 3NGBC 4QHLB 3P4NA 2KQMA 2VDOL 1EAPA 1MHEB 3V6OA 1FO0B 4WHYG 1BD2B 4QXGL 5EFIA 4KVCL 1FVCB 2A74A 2FX9H 4PGDA 1XCQA 4TSAH 5D96C 5CEZH 1NGQH 1AJ7H 2ZUQC 4JQVC 2XKNA 3O9WA 4ZODA 3S3SA 4ZSOB 4M8VA 5D7SH 1U8LB 2AEQH 4N0FB 4JN1L 4LAQH 4OM0L 2JE8A 4OFYD 4KDTC 3GSVA 4R0LA 3FB5A 1SYVA 4AYFA 5TQ2L 4D9RE 2DQTL 5HHOD 5ITBL 3VRJA 3BRGC 5GRZA 4LRNL 1OD9A 3L3GB 3QDJE 4HIJA 4XI5C 5IB4B 2IF7A 4ZAKC 2NTFB 5D6DA 3L3KB 5ISZE 3BKYH 5JOEA 4P2OB 1ZK9A 4K7FB 3IKKA 5F7WC 5TJWK 4ZD3H 4KKBC 3D18A 5BOPA 5JPNB 3UBXB 3QA3A 2PETA 3QNYA 3R4DA 5HYIA 2DQEH 2B4CH 2W1NA 2A0LC 4WIQA 2VDOH 1YEHL 1ZHBB 1BFVH 4I18A 4WUUB 4KVCH 3CCHA 4GQ9L 1S3KL 4WI6A 4NKIL 3TM6A 3QEQD 1YNTA 5MP6L 3FFDA 2CUMA 4KDVA 3TA3A 4LDOB 3ZTJG 5T1KA 5J13B 1T0MB 4FQIL 1LK2A 4JN1H 5I71B 2GJ6A 4OM0H 5DGRA 3C08L 5C0GA 5DJYB 3HAEB 1BZ7B 5K9KA 5E1AB 2BMKB 5ITBH 3BO8B 3BD5A 1CDGA 1YUHB 5FYKD 3EUUA 2EYTA 1BOGB 4MCYA 4WEUD 2DQHL 2OM5A 3NCMA 5C6WH 1NMAH 1UEMA 1I8KB 3L7EA 4IBLT 1J1XH 4ZFZA 5B38B 1DVFA 5M95B 5GRJL 4EN3D 5A16A 1BAFL 1RJYB 4LGRB 3VFVA 1QBBA 3WLBB 4GUPB 4NFBA 4CVXB 4DW2H 1A6PA 3GI8L 3V5KA 4GQ9H 1S3KH 5JUEL 5I75B 2BVOA 4OFPA 2HKFL 4JGMA 3MV9A 4WTWA 5MP6H 1BQUA 3MRNA 2EDFA 1D3CA 4PLKD 2JKXA 1J87A 4F9LC 5HI4C 5HI5D 4FQIH 3V7AG 2QV2A 1NMCB 2WWMC 4HIIA 3C08H 3JWOC 2Q20A 4N0UE 3SDAD 4LHUD 3O3UN 3CJJA 4RGMC 3BQUA 3IJSA 2OL3B 5D5MF 1WZKA 4E41D 3RWIA 2DQHH 5AWNL 4F7EB 4KTDH 5IB3B 4C4KT 4LGPB 4ZS6C 3S36L 4G9FA 1D6EA 3GJEA 3WHXA 1BEYL 3P0VL 5EBMA 1EMTH 3MYJA 4PREB 1ES0A 1IAKA 1NGYA 5AEAA 3TWCL 5J8OA 1ED3B 2EEAA 5GRJH 1BAFH 5J6HA 1DCLA 4U3XA 5FGBC 3GI8H 5INDA 5BJTB 1CL7H 2WAHA 5JUEH 4ODXB 4UB0L 3KS0H 1LK3H 4EOWH 1DBML 4WV1C 3UTOA 1A7PL 2Z31B 1A1NA 4OFYA 4NKOB 2VR9A 1NAMA 4N1HB 5DURB 5HHOA 1ZVYA 2XTJD 3SPVA 5D9SA 2ICEB 2E7CA 3HN3A 4PJFF 4DN4L 2YS4A 1YMME 1OP5H 1LWRA 2JCCA 4X0KB 4LCWE 4Y2DD 4PJCF 4ZO6A 1FH5L 5IVXE 2PNDA 2HMIC 5DK0A 4P3CL 3P73A 3DUUA 5AWNH 3KPPB 5BZDB 1V7ML 3S36H 4JFQB 4MXWL 1BEYH 5BV7H 1IGIH 3P0VH 2HFFA 1A4KA 5E0QA 4AQOA 1A1MA 1A2YA 3VWJB 1AXSA 3G9VA 1SVZA 4XX1E 2DM4A 1MCLA 1F11A 3Q0HA 4IOFD 2X7LB 3EOAA 3QEQA 3WUWA 3ZDYE 5CFHA 5L8KB 5T3XL 2VLRB 5ERWB 1XEDA 1VCAA 3PWPE 1HH6B 4LF3A 2CSPA 3SDDB 4UB0H 1HHHA 2W0LA 2C3XA 4P23D 3C09C 3KPNA 3EFFB 2XRAH 4FHBD 1DBMH 5F44A 1A7PH 2YZ1A 4ONOA 4YFLI 4I0CC 3GSOA 4JFEB 4LPUA 2CRZA 5DRNB 1I1FA 3VXTA 5I9QC 3C8HA 1UWGL 4WUKH 2FYYB 3WJJA 4Y1AE 1ZT1A 3DVNB 5HYSA 5C0DA 3P9MB 2H8PA 1HI6A 3LKRB 4DKEL 2GTWA 5DUPL 5DWUH 4JRWA 3GUTA 1IKNC 2AJ3B 1GC1H 2P4AB 3QHTC 4IHOB 1ZA6B 1V7MH 4EN3A 2H2PD 3QQ3A 1N64L 2K1MA 2R1YA 3VXNB 3U36A 4UT7L 3MLVL 5HVFB 4HLJA 3QDGE 5BS0E 2NW3A 1J0HA 2EDDA 1MI5D 2MCG1 5GS0D 5E2WL 1P2CB 4G8IA 4U33A 5T3XH 3FZUC 1IC5H 3QCUL 3BZFA 4FQ2H 3G5YA 3OB0K 1CGTA 4TVPD 1N8ZA 1FO0H 1I7TA 1P1ZA 4L4JA 1YN6B 1MJJA 5I8CB 3MPCA 3PXJA 4XNQB 3SDAA 4LHUA 3IYLW 3BX7C 6FABL 4RIRA 1OGAB 4O2FA 4E41A 4MD4A 3DV6A 4DKEH 3CSBA 5DFVD 3OKEB 1TVHB 2AABL 5DUPH 2VLME 3MRFA 3VD4A 1O7VA 1S7VA 2AXGB 1MUJA 1YQVH 2HA1A 3LN5A 1N64H 4KXZI 5I1CL 5GSRA 5HGHB 1TFHA 4UT7H 3VH8G 1TZGH 3MLVH 1F6FB 1I9RL 5AUMA 5IOPA 5FGCB 4OF3A 3AU1A 4CN4A 5E2WH 3DRQA 3QUMB 2V7NA 3K8MA 4ZTOL 3QCUH 3MUGB 3NACL 2V17L 5J57B 1FAIL 5EPMB 3ELAT 1BFOB 2VE6A 4XBGA 4X6FB 1UXSA 4RMQA 2P8PA 1ZLSL 4K94L 4Y0GA 4L3CB 2Q6WA 1P69B 3EJYC 1SJVA 3WUZA 3O6KH 2ESVB 5T1MB 4BFBD 4KK9C 5GGSY 1ZANL 4OZIB 4Y2DA 2RQ8A 3OR7A 3AGVA 2YD5A 5CIPB 6FABH 4ZO8A 5KSBE 2UV3A 4YDJA 4S1QH 5C0AB 5CSZB 5ANMB 4ORZC 3O8XB 2X1XR 4B7LA 1T22B 5SWZD 3HAEH 1DQDH 4FTVB 2HTLC 3MV01 4QOKD 3P0GB 2GK0A 1JI1A 2OQJA 3GSRA 1SEBA 4PJDA 4U1SA 3FT3B 4S11A 1MCIA 5I1CH 3IFOB 3IAQA 1CDIA 5FGSA 4IRZL 1I9RH 3CH1A 3H9ZA 3Q5YA 4MGXA 4QT5B 3DX8B 5EOQH 1F58L 4IRSB 3CZFA 4H0HB 4WI2A 3W11D 4CL7A 1Y6NR 4P23A 4PV9B 5I1EH 5GQBA 4ZTOH 3NACH 1FAIH 2VN4A 2DAVA 3TLRA 3T4YA 2Y36L 3QH3A 3O6FB 1ZLSH 3DX7B 5DDHA 4K94H 2ADIA 4L29B 4RSVA 4AMKH 2EIZA 3GIVB 1AD9A 4WW2C 1KTRL 3CPLB 2DTSA 1KLFA 1ZANH 4PJBA 1KPUA 1FNEA 1NBZA 4QTHB 2PR4L 3BUYB 2Y5EA 4QXUH 2EYRA 1FL6A 3V52L 3ULUF 1Q9OA 1WWAX 3WDHA 4XPFH 2NCMA 5FUZL 4MA7L 3BSZL 3IDNA 1CGSH 4I8DA 1ZHNB 3QWOB 4P48A 5FYLE 5KVMC 4MXQD 2IPKB 3RBSA 5FKPB 3CUPA 3QXDA 1S7XA 2OL3H 1MWAB 4YGVB 4LDLB 1QQDB 1MI5A 3C6LD 4M1GL 5EO9A 4IRZH 4PJ8B 3RWDB 4ZOEA 5I73C 3NOIA 2X4NB 4JKKA 1LHZA 2HVKB 4HGKC 3M17B 2XPGA 1AD0A 4JZJC 1F58H 3DGGB 1Q9KA 3AREB 1PQZA 4PJFB 1J1PL 3KJ4C 3WIIL 3WIHA 1DBJL 2VQ1A 3FFCD 2W9DL 3MOQA 4PJCB 1VDGA 5TGBA 2Y36H 4OZ4B 4YR6B 4DK6A 4TOYL 4NFCA 1ZEAL 4JDVA 4NPYB 3D0LB 2EXYD 4AEEA 3L6FA 3W5MA 1U41A 5DMGD 3V52H 5IMMB 4AJ0A 3ZYIA 3GZKA 3ARYA 2VC2L 4MA7H 3LS4H 4WHYH 4KJYA 1IGTB 4TN9A 2H2SD 4HWBA 3KPQA 1KPVA 3JXAA 4UU9A 4WHTB 4M1GH 1AP2A 4Z7WF 4JZNB 4E5XB 2R0KL 4Z7UF 3LKSB 4ZS7L 5J56B 4LCUA 1BJ1J 4TNVF 3NCCB 2X4OB 3TCLA 3WIIH 2X4TA 1DBJH 1FYTE 3GSNB 4OTXH 2W9DH 4RNRB 5IMKA 5FO8A 4WVRA 5EORL 2CIIA 3T0DA 5ILTL 3LN4A 1JIBA 4H8WL 3VH8B 4TOYH 4R7DB 4PTUA 4UV4H 4YPGA 1OHQA 4O9HL 3IVKA 3D9AL 5EUOF 2AV1B 5MERB 4KVNL 3JUZA 5B39A 4G6ML 4Q0XL 4CDHA 1TVBB 1EVTC 5DYOA 5SWZA 4BFIB 4PRAA 4QOKA 1WJ3A 2VC2H 4DGIL 1YDPB 1REIA 4RAUA 4P57A 1AI1H 1KJMA 3WS6A 5F7NC 1QSFD 2G2RA 3OXSB 3AS1A 1OL0A 5GRUL 2BNQE 3ZTJH 1K4CA 3DV4A 5B22A 43C9B 3HMWL 3LD8C 5CGTA 5D2LE 5EIVA 2R0KH 4N90E 5JXEC 3MFFA 3P4OB 3PIQA 1EO8L 5FYJU 1UM5H 5LWYL 4F7TA 1YYLH 3BIBX 1KFAL 2GJJA 5EORH 3L3DB 5C0IA 5ILTH 2AQ1A 2NTSP 4H8WH 4V1DB 4YIQB 3ULSA 4O9HH 4GSDL 3OKKB 4M43L 3D9AH 4TVSa 3EOTL 3I50L 3QRGL 4G6MH 3K1KC 4AZ8A 5JW4M 5E8OB 2ZUXA 1IEBA 4XCEB 1I75A 1LD9A 4OGXL 5JIIA 1BPVA 3FT4A 3C9NB 4C56B 3AY4A 4DGIH 5C8JA 3L7FA 2DMBA 4LCYA 1EJOL 1NGPL 2FL5B 3ZKNC 1UH2A 1X5HA 1U3HB 3C6LA 3CXHK 2Q1EA 1MVFA 1ZXQA 5GRUH 3RP1A 1ZS8B 5KSAB 3MA7A 4QRSB 1PJ9A 3HZMA 5LAXA 1IL1A 3U7WL 1HQ4A 3FFCA 4Z76A 3F7VA 3D0VA 2AXFA 1EO8H 4MNQD 2UVEA 5EZIL 1MFAL 3OZ9L 2JB5L 1RIHL 2GTZB 1TDQA 4DZBA 1KFAH 4Y16B 4HKXA 1MRCL 2DMCA 5E2UL 1J8HB 4KKCC 1P4IL 3HI1A 3RZCC 3UPCA 4OJFH 3HCVB 4GSDH 3DO3A 4M43H 4R96A 4URTB 3EOTH 2Q3ZA 4JHAH 2NLJB 3DJ9A 4PR5A 2FJGA 3AM8A 4XCNA 5H2BA 5TPWH 2GAZA 4LP5A 3GHBH 1RZKC 4P2RD 3DYMA 5DK2B 3T0WA 3ORJA 1EJOH 1NGPH 3AAZA 4UIKL 1A14L 1LE5B 1KB9J 1DLFL 1FNGB 4XI5D 4P9ML 4ZAKD 1A6ZA 2WLZA 1J05B 2XOTA 1QHOA 3QQ9C 4QRRD 4HWEL 4GXVL 4QNPF 4ZXBD 3I2CL 1QYGL 3RWJB 1X6LA 4KKBD 4KY1L 3RNQB 3WIFB 5BXFB 1E4JA 2I9LB 3KPMB 4K8RH 3K8LA 4G6KL 4NO5B 3FRUB 4GW1B 1G7HB 3OZ9H 3GGWA 1RIHH 3DVFA 3VI4F 2A0LD 3GEWB 3RWHA 4OFDA 1II4E 1XGQA 1BX2B 3KJ6L 5F9WC 1MRCH 4QHNA 5FK9B 1IQDB 5LXGL 1P4IH 4WFED 5M7QA 2W0FB 3MGTB 2NZ9C 2ZCKL 2FZ3A 2CKBB 3NZ8A 3HFML 1Q9WA 2CUIA 1JPFB 3GMOB 1ZLVK 4NKDB 3TIDA 5E7FA 4Y5VC 1QSFA 4Q2ZA 4UIKH 1A14H 1YEIL 2DM2A 1DLFH 2X1WL 1OF2B 5ACMA 3DUSA 4APQB 4LLQA 1JN6B 1RV6X 3V8OA 1KOAA 4EDWL 4J6RL 4G8FA 5GS1B 4MJ5B 4HS3B 5KJRL 5LGHL 4D9RD 1F90H 2GW5A 4H26A 3V9FA 3BT2H 4WW1B 1QYGH 4HDIB 5DUML 3QDJD 3ARBB 3WHE1 4B7IA 4YJZL 1XGYL 4OIBA 5JW4N 4G6KH 5ISZD 1VFMA 4NM4L 2Y25A 3IAPA 3DO7A 5E24E 3MNZA 4Y5XA 1T5WA 3DVIA 1KTDA 5K33A 2AJUL 2JCCF 1OSZB 3R06B 5CEYA 4Y2OA 4KRMB 2A9NL 1A6AB 2ZCKH 2J6EA 2N7BA 4WGVB 2UZXB 4OGAC 1DTUA 5HI4D 4MHHI 1KXVC 1TVDA 1KENL 4Z7UB 3QHZH 1X5JA 1H8OA 2WWMD 4RRPA 3TYGL 1MF2L 3KLAB 4OBRA 1OP3H 4HK0B 1S5HA 1YEIH 3LSOB 4ZPVA 2CKNA 2BP3A 1VEMA 1Y6MR 1UB5A 2H41A 5I0DA 5E9DB 5DJ8B 5EU5B 1A8JH 4J6RH 4PJHE 1IC7L 3EO1A 5KJRH 4PJIA 4ZS6D 5LGHH 4MNQA 4HIHB 1KTKE 2A83A 1XGYH 1D5ZB 2GUOB 3SHSA 2BZDA 5I8EA 5FYJH 2YSSA 4NM4H 5KS9E 2FJFA 2W91A 2VLLA 4JFHE 4JQVA 3HHRB 1KT2A 4JRYB 4UILL 1YEGL 2AJUH 5CP3A 4XZUB 5FO9A 1EAPB 1NLDH 2I25N 4I9WE 4NRYA 2J5LC 2Q7NA 4CMMA 1K2DB 3BEWA 3VXME 4KDTA 5SX4H 5EFIB 1S8DA 3JTTB 3L3JB 1GIGL 1JNLH 4PGDB 5IW6A 1KENH 4UQ3B 3TYGH 1MF2H 1QEWA 1QFOA 4ZAKA 2XKNB 5F9DC 2LABA 1TCMA 4QRRA 3WFDL 2YA0A 2A6KB 3U0PA 1U6AH 2E8YA 1CR9H 4MAYC 2WUBL 4ZXBA 1KNOA 2AJYL 2BNUB 4J8RA 3OKDA 2HMID 4LP4A 1SYVB 2V2WA 3N1FC 1IC7H 4RGNE 3VRJB 1M6OA 1JL8A 2VZSA 4P5TC 3WUWG 3VGGA 4S1SL 4KRNA 4M03A 2LU7A 1NBYB 3CXDL 1GYAA 1WGOA 1FZOA 4ZUSA 2Z91B 3MO1A 3D18B 3QG6A 5E8NA 3VFSA 1JZ5A 1F97A 3QNYB 3EDEA 4FXKA 4JG1L 3H6JA 4UILH 1YEGH 3WNPA 4BZYA 1CGYA 1K5NA 3WBDA 4DTGH 3S88H 1SMAA 4H20L 2FO1A 4XPHL 4M62L 5EO1B 3VFRA 1GIGH 2EO1A 5HYSG 4NO3B 3B9DA 3TT1L 1QA9B 1E28A 3TA3B 2H32A 4WDIA 1PGRB 1D6VL 5T1KB 1XT5A 4JFYA 3C5ZC 3WFHA 2F54B 4DUWA 1TJGH 4TRPL 2D3VA 1FFNA 1N26A 3QDJA 3L5JA 4PTTA 1SY6A 3A6OA 2QQLL 1YMMD 5ISZA 3KWWA 4LCWD 5A40E 4MCYB 4S1SH 4CU8A 3CXDH 5ESAB 3L7EB 2AERT 4RGNC 1I9IH 3G08B 3FZUD 3U7YL 3JWNC 4YNYA 2OTPA 2P5WB 2AAVA 1KJVA 3VGHA 3DXAE 4JG1H 3FTGB 4N9GB 3VRLE 4LHUG 4F9LA 2M1KA 1GGIL 4H20H 4XPHH 2AJZA 3V5KB 2R4SL 3PWPD 3R1GL 3MV9B 3TT1H 1Z6JT 4PJDF 2KUTA 4MVBC 1U92A 1BBDL 2VDQH 2DB8A 2MKWA 1D6VH 4JFFB 1P7HL 4OT1L 2NY3C 1B4JL 4YWGL 4HUVB 3T0EB 4TRPH 4FRWA 4GW5A 1DUZA 3BAEL 1DN0A 4Y1AD 4J3SA 3BQUB 3T2OA 1VESA 4K9EC 3F12A 4XXCC 3NH7L 4HS8L 5CKGA 5HJ3B 3MV7E 4FFZL 5K9QG 5FGBA 4G9FB 3GJEB 1ONQB 5IB1A 3DGCR 5CLTA 5EZJA 2I07B 4PJBF 5EBMB 2EDNA 1ES0B 1IAKB 3HC0A 3U7YH 4WV1A 1BM3L 2P44B 5B8CC 3ULUH 1WICA 1N6UA 4JM2B 1QPPA 1YNLL 3NFNB 3VXUE 8CGTA 2LTQC 3QDGD 5BS0D 5INDB 3ZKQD 1U8PA 4HK3J 3EJYD 4YLQT 3R1GH 2VDLH 4KK9D 5AZ2L 3T1FA 3SDXE 1NAMB 3UTQA 4OT1H 3KNBA 3EO0A 1MCDA 5HHOB 4N0UA 3MUHL 4YWGH 2E7LC 1NAKL 2HTLD 3BAEH 5DJZB 1B0RA 1NH6A 4OD1L 4QRPE 4JFDE 2X05A 4XVSL 2F58L 3S4SB 1RSFA 1DFBL 4FFZH 3VGBA 1U0QA 3DUUB 4K2UH 2VLMD 4JFOB 2Z35A 2YRZA 1Y6KR 4ACPA 1UVQB 1CXEA 1G7JA 1Z5LB 2HFFB 1F3JA 4K3HA 5T3ZE 5DRWA 5IHUL 1AXSB 2FATL 4XGZA 2A77L 2OXGA 2P5EE 3QEQB 2PO6C 3NTCL 3HA0A 4TUJA 2EC9T 4J3XA 4CU7A 1FZMA 1IGJA 2E8ZA 5HHME 1J8KA 5IR1B 3DLQR 3B3IA 5AZ2H 4RFEB 3Q3GA 1ADQA 3KXFE 1JVKA 3GSOB 3BD4A 3L5XL 3VXTB 1IKNA 2BOBA 1YMMA 4HIEA 1M71A 1ZT1B 5IVXA 3X17A 5C0DB 4GJTB 3U0TB 4D9LL 4OD1H 4JQIH 4G6AC 2F58H 2GTWB 1DFBH 2K3TA 2DJSA 3UJTH 2IANE 2Z93A 4ODWB 4FQXC 2R1YB 3U36B 4HAGA 2YC1A 4ONHB 5KSUA 2Q7YA 3SKUD 3T2NH 1FFOA 1X9QA 5IHUH 2FATH 1S7WA 1XFPA 3O41A 2HJLA 2A77H 3QR2A 4N0YH 2XQYK 3D3VE 2LE9A 3PWPA 3QYCA 3NTCH 4G8IB 3BUTA 3BZFB 4FXGA 3OGCA 5KVEH 4OD2A 4RA3A 4ZUVB 2Y06L 3IDGA 3T0XA 4NZRL 5FF6B 1I7TB 5IM7B 2BNRE 2P7TB 4RISL 5EWIL 3SDAB 4LHUB 3BI9X 4M7ZB 4Y1AA 4DCQA 2D2OA 3HMXA 4O2FB 4E41B 4M7LH 2EKSA 4M5YL 5DEGA 5C0BE 4MD4B 3F65A 3KYNB 4NQXA 5BRZE 3CFJB 3HR5A 3DV6B 2A6JA 4W81A 1KLGA 5FYKU 2ZOKA 3UZVB 5L2JA 3MRFB 1MJ7L 2OTWB 5FYLD 3MLPA 1MUJB 1U3YA 2C1OA 3LN5B 4MA8L 4D0CA 3B9KC 2HP4A 3ESVF 1UACH 1TJHL 2IAMA 3QDGA 5BS0A 4FFWC 4PB9L 1ITBB 3ARTA 5IOPB 5F6IC 1H3WM 4LKCA 3ZZ1A 5B39G 4UUJA 2VZVA 1EXUA 3LDBB 4CVZB 1UXSB 2Y06H 1S9YA 4RISH 1W0VA 2Q6WB 3VFNB 2ZUUA 4NRZA 1AIFA 1RK0B 3OR7B 5DD3L 1UADC 2NR6C 1WCQA 4YFDB 5IBUG 4HJJL 4M5YH 3MJ7B 3BPOC 4HWNA 3VJ6B 5E00A 4KQ4L 1MJ7H 3OKOB 4GRWE 5JXED 3GSRB 1SEBB 4PJDB 4U1SB 4X7FC 1KULA 1BVLA 2EEBA 1NGWB 1C1EL 2VITA 5FA3A 1JZ3A 1UZ8B 1YY8B 4MB5A 1CD1A 1EFXD 5DQ9A 1TJHH 3TJEL 4ZFGL 4GOSA 4KJQC 3DUHA 2E9BA 1BOYA 4WW2A 3RI5K 1FE8L 5JNYB 4P23B 1XF2A 1CYGA 2WK2A 2NXZB 2UWEE 3GMPA 4OZHB 4KZDL 1XR8A 2YPVH 1FYTD 5L9DL 3U9UA 4BZ1L 1T1ZB 3KR3H 1JRHI 2ADIB 2EDBA 3ZE1F 2EIZB 3RIFF 1AD9B 2FO4A 5KSBA 1R3JB 3ZKND 5D1ZD 1KPUB 1FNEB 4R97B 2YR3A 1DZBA 3CX2A 4TYUA 2EYRB 1FL6B 5FIEA 5EZOL 4HJJH 5C08E 3PWVA 1IT9H 1OW0C 1PAMA 3D1MC 3TC9A 1KUMA 2R23A 3FL7A 4YFLF 4KQ4H 5D4QA 3CUPB 3QXDB 1R5IB 2VDMH 1C1EH 3RNKB 2ITCB 1BD2E 1L7IL 2WW8A 3TJEH 2BNQD 2LAGB 3D87B 4HMDA 3WSQL 1MIEH 4XC1L 4N90D 1E4WH 4HFWB 2WANA 4HT1L 1CQYA 1FE8H 4KKCD 2VQ1B 4ZSOE 3RZCD 5I1GL 1A6VL 3FQRA 2R8SH 4LIQL 4RAVA 5L9DH 5TGBB 4LPTA 3C5SA 3CFEA 3NA9H 3HZKB 3U6RA 4N8CL 2HT2C 2IH1A 2OMBA 4NQUA 1A9BA 1SHMA 1ZLWH 2CDFB 3NIDE 3QO1A 3BPNB 2QR0A 3KHQA 1NAMH 3QG7L 1MRFL 2VXVL 5IV2A 3QQ9D 3VFWA 1CBVH 5FYKL 3BWUC 2DQUL 3F58L 1PX3A 3KPQB 4YDVB 3KDMA 1B88A 1KPVB 1PKQB 2ZKHH 4AIXA 3CMGA 1HCVA 3KYMA 3BPLC 3STLB 4MS8C 4HPYH 4GKSA 3CDGA 2B1HL 4XC1H 4BKLA 3S96A 3MRHB 4HT1H 3TCLB 2X4TB 4HV8A 5I1GH 1A6VH 2E6JA 5FO8B 2NZ9D 5IMKB 4LIQH 2IBZX 3IKCB 3O45B 1I7RA 1TTFA 2BVEA 2WINB 3MLSH 4PJIF 4YPGB 3IVKB 4HH9A 2P42B 1Q9LB 4MQ7A 3N1QC 3L3OB 3ARZA 2B39A 4Z7NE 2EDYA 3RUGE 5SWZB 2IMNA 5HY9B 3F7YA 3QG7H 1R5WA 4QOKB 4HMEA 4X8JA 2VXVH 5JXEA 1DDHA 5E2TL 5L0QB 5FYKH 4P57B 1CE1H 2RHEA 4QGTA 1EFXA 3F58H 4I2XE 3GIZL 1MSPA 1IKFL 1K4CB 1NGXA 3DV4B 3W0WB 2KL6A 1FBIH 3NIGE 1BF2A 1JWUA 5MENB 1UYWH 2B1HH 3FB6A 1FYTA 1VGEH 4YQXL 3GSQA 4U2YA 2D31B 2AEWA 1P53A 3RJDA 2X4UA 4RRPG 3ZYOA 1NKRA 3U30C 5C0IB 2D4DA 1DP0A 3HZVA 1MCSA 4IM8A 4OB5H 5D1ZA 4ALAL 3ULSB 1WTGT 4QEGA 4U6VL 1K6QL 3QXAB 4RWHA 4V2BA 1IEBB 1FLRL 1XGTA 1LD9B 3RY4A 2PCPB 3L7FB 3WFBL 4LCYB 5GPRA 5E2TH 2MKLC 5L8LB 4MLIA 1Y0LA 2BNQA 2LVCA 3GIZH 4P2QE 5IK3A 1IKFH 5D2LA 1WWBX 3MA7B 3I9GL 3LZFH 3HZMB 4OQTA 4HKZA 1IL1B 5BVJA 3RZCA 2H26A 4J3VA 4Z76B 3F7VB 2AXFB 2JB6A 1AY1H 1CDCA 1J86A 3LEYL 2EH7L 3KYOB 2ZSVA 4DZBB 2AQ2A 1U91A 4HKXB 3U79A 1MAJA 5CHNA 4OBSA 4ALAH 3OPZL 5E2VL 3HI1B 1HXMA 3CAFA 4GKOA 1VB9A 4R96B 2P46B 4U6VH 1K6QH 4LLWA 4PR5B 3OV6A 2FJGB 1D5IH 2EDHA 2L4OA 3U4AA 1FLRH 4IRJB 4MAYD 5H2BB 3PNWA 2GAZB 5F89B 3WFBH 3S98A 4JM4L 1BLNA 1MY5A 3AAZB 4WEMB 2AXJA 1BF8A 4WO4B 4E42A 2VAAA 4P5TD 5D1QB 1T1YB 1IGYA 4U1HA 5IW1B 3T8XA 2ZP0T 3MUZ1 5CMAB 5ENWB 2HVJA 5I15L 1H0DA 5E5UB 4DWHA 3MLYL 4YAQA 3FHQA 3GGWB 1U42A 5GRWA 3UYRH 4EVNA 5D2NB 3RWHB 1XGQB 2APBA 4TVPL 4Y5VA 2FX7H 1WVZA 1C5CH 4UT9L 4JFHD 4UNVA 3BYTA 1GGTA 3WIHL 3OPZH 4NCDA 1MFDL 2Z31C 2NY6C 4HEME 3B8YA 2FZ3B 4I9WD 4OZFG 1AGCA 1AGBB 1IEAA 1Q9WB 4EI6A 3VXMD 1HHJB 3SKJL 4HXAL 2Y4SA 1EEQA 4WI7A 3C5ZD 5JOFA 3KYAA 3TIDB 2EH8L 1A7RL 2BSTB 3MLXL 4HIXL 4X80L 5GIRA 3BP4A 4JM4H 4RMRA 3IDMA 4D2NA 5K9JL 4PLOB 1MCKA 4YDLC 4LLQB 5TDNA 1KTLA 3VXOB 1HHKB 2AK1L 5I1IL 4D8PA 2B20A 3K4ZA 1UJTA 1QFWI 1URLA 2C26A 4RGND 4HWBL 2I5YH 3V5DA 5C0EB 4J3WA 3V8CA 5KN5A 1CL7I 3S5LA 5GS0H 3MLYH 3HS0B 4OCXL 3ULVL 3UP1A 2DQIH 1EUTA 5GGQL 1TCRA 3QEHA 4Y5XB 3ARGC 1BIIA 4TVPH 3SDDC 1L0YA 2EDWA 2IPTL 1X5ZA 3WIHH 3BEVA 1MFDH 4MVBD 1PVHA 4U1IA 5ICYB 2XXMB 3WD5L 4HXAH 3OHXA 2NY3D 3EYUH 4UOJA 1MLCB 4HIXH 3MLXH 2X70B 1UM6L 3O3DA 4X6EA 4X80H 4H25A 1DEDA 1FGVH 4ZPVB 5M94B 2VDKL 5K9JH 5C07B 3CLFH 5HYJE 5FGCE 3BZEB 3RWGA 4QF1B 2AK1H 5DXWA 5I1IH 2VXQL 2DI9A 4KU1A 2WIIA 3AMLA 4HWBH 1CXHA 3LVEA 3NGBB 2VLJE 2A83B 4XCFL 4KKAC 1H3PL 4ENED 4OCXH 2FLRT 3TPKA 1KB5B 3TF7C 3K74B 1FZKA 2YSSB 4IMLB 4R6UA 2MQ0A 2XZQL 3ZKXB 1MJUL 1RZJL 3IDUA 4JVUA 2NY4B 2AEPL 3R8BB 4OZIE 2ZUQB 2KDGA 3IS0X 5IVXF 2IPTH 4LRIC 1Y18A 5FO9B 5C0AE 3DXAD 4MAYA 4P2RB 5EA0L 4HFUL 3C87A 3MXVL 2IBGA 3WD5H 1ORQA 3FCTA 3X12A 4P5TA 2GK2A 5J89A 4F33A 3ZDYF 1HSBB 4HX1A 1QRNE 4PJHA 1KNOB 4J8RB 5LGJB 1KCKA 4G8GE 1CICC 2V2WB 1CWVA 1KCSL 2VXQH 1JGDA 3W39A 1M6OB 3EJZC 4J2XA 5HVHB 4I48B 5IQ7L 4IOIB 1OCWH 3CVHA 1H3PH 1XF5A 3T4AA 3MV7D 1FZOB 3BVNB 1MJUH 1RZJH 1PX4A 2PO6D 3QG6B 5E8NB 4F7MA 3X3GL 5DJDB 2HKHL 5CSBA 2AEPH 4OGYL 5F7EL 3GJFK 4FXKB 4YH6A 5HGBA 5I1DB 1G6RA 1K5NB 3K3QA 3VXMA 4JGUA 4OCWL 1C08A 2BOCB 3FQWA 3FN3A 3C5ZA 2OTUB 1EERB 5EA0H 3VXUD 4Q9RL 1KB9K 1JWMA 5IESL 3D25A 5D7IB 4QRUA 4GQPH 3WXWL 3MXVH 2XY1A 4RFOL 1ZV5A 4YE4L 5IF0A 43CAA 5IG7B 4JFYB 4WI4A 1RVFL 3IF1A 1CVRA 3WFHB 1FCCA 4G6AD 1R6VA 3OJMB 1FFNB 3ARSA 1P84J 5EOTA 2DLHA 3QDJB 5A2FA 5I0ZA 5ISZB 3RGHA 4FQXD 5IQ7H 4L8SC 4QRPD 4JFDD 3UTPE 4MJ6A 3SKOA 4AEFA 1OT2A 1R3HA 4Z7OE 2NW2A 4QY8B 2BRRL 3NFSL 3IDJA 3ZYJA 3K0WA 2HKHH 3E2HC 1G9ML 3ZL4L 4YNYB 5F7EH 1DQJB 3SQBA 3FN0H 5T3ZD 4A2LA 2ADFL 3O6FC 4AIZA 1X5KA 3CGTA 2P5ED 5DD5H 1T20B 3GKZA 3S37L 2AJZB 5J1SC 4Q9RH 5BMFH 1TQCC 1G84A 5JORA 5DMJB 4RGMB 5HHMD 4MQXC 3CMOL 4R3SA 1U92B 3RPIA 4XXCA 1YA5A 2BHZA 5E94A 1GH7A 1YEEH 2XN9E 4TUOB 5DD1L 3KXFD 1RVFH 4KRPB 5K93A 4JFXA 4WW2F 1DBKL 4GW5B 4JB9L 2AEIT 2R29L 1GAFH 1HKFA 1DN0B 1KACB 5A1AA 4YHNB 3OB0H 3L3IA 4DN3L 5B8CA 1D5MA 2XFXA 3B9KD 1W0WB 4XNYL 4RZCB 3A0OA 4FFWD 3MROB 4G8EB 1U8IA 4PP1C 5IB1B 5EZJB 2IAND 2BRRH 4KGLA 1V3KA 3DXAA 1PG7L 3HC0B 4NBZB 3ZL4H 1G9MH 4WV1B 5ADOH 2ADFH 1BP3B 5JIKA 4W6YB 1P6FA 1S7QB 3D3VD 1DN2A 3OKMB 1QO3A 3JUYA 4M8QA 1U8PB 4NUJA 2D03L 4LHQB 3T1FB 2J6EL 2NR6D 5DVOA 4BSVA 1EZVY 2DL2A 3WNLA 3KLHD 2BNRD 1HILA 1JNJA 2R2CA 3KNBB 3EO0B 4HQQL 4A6YA 4JG0L 4N0UB 5FKAB 1HHGA 4LQ1A 1RMFL 2F15A 1DBKH 4JB9H 2HJFA 2R29H 2CJUH 5F7YC 5C0BD 4DN3H 3MV7A 3UTSE 3DPBA 1ZGLP 5BRZD 5HTSA 4XNYH 2BSRA 2PO6A 4F2MA 1AGDA 4Z6AT 2Z35B 4KJQD 4P99A 4XB7A 1ND0A 1G7JB 3WMSA 3VFTB 4DGVL 1F3JB 2IFGA 12E8L 1PG7H 1T2QL 3C09B 4YHYC 3PF2A 4PGCA 4X7EC 4XGZB 3RGVB 3VXUA 3BGMB 4Q9QL 5J11B 3N1MC 4NC0B 2V7HB 1A6UL 1E4KC 5I9QB 3GSXA 2WNGA 4TUJB 4ELKA 3MRPB 1FZMB 2K9UA 3SDXA 2D03H 4YBLB 1EUUA 4F9PA 5IROC 4MMXC 2DKMA 2J6EH 4X7TA 5BZWB 5GGRA 2VH5L 4WU5A 1FPTL 2X9YA 3KVQA 4HQQH 2BOBB 4JG0H 1MLBA 3VA6A 1YMMB 4WTZA 1I3VA 1RMFH 1DLHA 2QADB 4FQXA 5JA8B 1FNFA 1P4BL 3FB7A 1WFUA 1N5YH 4LCWB 3SDCC 4QRPA 1OM3L 4JFDA 5IVXB 5F93C 1UWEL 1X44A 3O3AB 1CTOA 1VPOL 5GZOC 2Z93B 3FQNA 2HLAA 2ZG1A 2XZCL 1NL0H 12E8H 1T2QH 4KI5E 2P5EA 5DGQA 1YQ2A 1FFOB 4PUBL 3O41B 1DL7L 4Q9QH 2HJLB 5JHDB 1A6UH 1T89C 3ROOA 3PWPB 1Q8MA 3MRDA 3TH2T 2X41A 4FXGB 2HT2D 4U4BA 5CJOL 1M7XA 5CP3H 1KN4H 3KXFA 3P4MA 3K2MC 4GBXC 4ORGB 5BOZG 4K55A 4Y4FC 1H5BA 1QD0A 1FPTH 4AG4L 2LU3A 4MLSA 1I3RA 4Y1AB 1DR9A 3FQUA 3FQTB 3B9KA 1UG9A 3VGDA 1P4BH 2EKSB 1OM3H 1CFSA 1UWEH 3RWCA 1ROWA 3OXRA 2E9JA 5C08D 2BC4A 2A6JB 3I84A 1KLGB 2ZOKB 1VPOH 2IANA 5F1KC 4NC1E 5L2JB 1SY6L 4ZOCA 4MS8D 4U1NA 2C1OB 3BYYA 1F3DJ 1X4ZA 3QDGB 5JOPE 4ZOAA 3D3VA 4Y16C 1BD2D 4WHCA 1DL7H 3RY6C 4GAJL 1QPXA 4U3HA 4XNMA 5F1IA 1UH4A 1DANU 3KPOA 4Z0XA 3CX5K 4KI5C 5CJOH 5CWSB 1EXUB 3BHBB 1S9XB 2BNRA 4F37K 4JO4L 2ITDA 5D2LF 3ARPA 5I16A 4LCIL 2XA8L 3FONB 2BX5A 3MNWB 1MVUB 3NFPB 4NRZB 5HHQA 5C0BA 1AIFB 2GY5A 2H32H 3VE0A 5JW4Q 5J9PA 4P5KB 3U2SA 5ITFA 3OG6B 5BRZA 2XWTA 4QHKI 4Y19E 3SKMA 2Q8BH 3VXPA 2VIRA 1OT1A 5L7XH 4R26L 5E00B 1F3RB 4Y5YB 2DIAA 1SY6H 1I3GH 4LLUA 4PB0H 4DGYH 4HWZA 5FA3B 5JIPA 1FFPA 1BHGA 1CD1B 1NDGA 1YMHA 3LEXB 3BP7A 4NC1C 4P46C 4IIQB 2NXYC 4GAJH 1V7NL 4LQFH 1NCDL 4WW2B 5FM8A 3QIUA 3IU4L 3VG9C 5GGTA 2O5ZL 2JTDA 3ARVA 3GMPB 2G75A 1XR8B 1C5DA 1DE4A 3HE7C 5E9DE 1OW0A 1CGWA 4JO4H 3UTZA 3F7PC 3JWOH 1CLZH 1A0QL 1A9EB 2XWJA 4LCIH 2KH2B 5IFJA 2XA8H 1MREL 2FO4B 4UBDD 5KSBB 1F8TH 5C0JB 4G9DA 3GJFA 1F4WL 2DM7A 3NBNA 5H35A 1O5DT 5I73B 4PBWD 2ED8A 1T1XA 1O0VA 4MA1C 1FV1A 2R23B 4JZJB 3AFLA 1C5BL 3BP5B 1NEUA 3KJ4B 5EN2B 1LILA 3JZ7A 5JW5A 4BQ9A 1LEGA 1VEOA 2R2BA 3EDKA 4TQEH 1U8HA 4OF0A 3MNVB 5DQJA 3IJHA 1LEKA 1NCDH 2UWEA 1CFVL 1J1OL 3IU4H 3RA7L 3RIAF 3IDYB 3TBYB 4GFTB 3MLWL 4NBYB 4RAVB 5DHXB 4P5MA 5EH1A 4D0BA 1ETZB 4P59L 3U6RB 1A0QH 2YUVA 4X98A 1MREH 3HE6C 15C8H 4NNPH 3QO1B 1HNGA 2GCYA 5C08A 1F4WH 4YBQC 4K7PL 4MDIA 4TSCL 2JJTA 5HYQB 1I4FB 1P7QB 2IH3B 1HQRA 5IV2B 4QHLA 1C5BH 1RD6A 1MHEA 4BFEA 2IBZY 3KDMB 4L1HA 1ORSA 1BD2A 4QRTA 4P2QD 5GHWL 3KYMB 3WS3A 1KELL 1T80A 3HUJE 3CDGB 4BKLB 4X5LA 2VZ1A 4ZSOA 3S96B 3DMMC 1CFVH 1J1OH 4N0FA 3RA7H 4FNLH 3S34L 2FHFA 5CGMA 4PRDA 3MLWH 2Z31D 2NY6D 1I8MA 2F54E 3E6HB 3KYKH 1LVEA 2N56A 1I7RB 3L3GA 1J10A 4P59H 5IB4A 4EUPG 4KKNA 1J0ZA 1J9CT 3L3KA 3SKNB 2OJZL 5IVNA 1ADQH 4XWOC 2C1PB 4K7PH 4TSCH 5JPNA 3F7YB 4NN7C 1R5WB 3UBXA 4X8JB 2OBGA 3UTTE 1DDHB 3HMXL 3S5LG 4I3RL 2Q76A 1JHKL 1EFXB 2P5WE 1JYWA 1ZHBA 4ODBD 4NN6C 1C7TA 3RKDD 5GHWH 5EUKA 1QFUL 2AXHA 3QCTH 1JWUB 3UCRA 1A64A 5HBBA 5IT2L 3ARGD 4LPYA 2X6MA 1NFIB 3SDDD 1FYTB 3UX9B 3DSNA 3LIZH 3S34H 2YOCA 3GSQB 1L6ZA 4JFFE 1K8DB 2FD6L 4PJHF 4FXLA 1BZ7A 3T0EE 5E1AA 3HZVB 5KW9L 1YUHA 3JWDL 4PRIE 3TFKC 3RUGA 3NCFB 3JV6A 2OJZH 4JY5L 5E99L 2QLVB 3L9RA 1I8KA 4W6WB 1QACA 1RU9L 1ZAGA 2E6QA 5B38A 3O3BA 5IKCA 4I2XA 4NQEB 3HMXH 4I3RH 5J1AB 4OLUL 3DSFH 4GO6B 1JHKH 4GUPA 4WTXA 35C8L 4PRNB 4KKAD 5IK3B 1G0YR 2R56L 2B4CC 3HNTH 1P5VA 1IC4L 4ODUA 2WSKA 4NZUL 1JWSB 3RZCB 2DLFL 2H26B 3E6FB 5IT2H 3FO2B 2JB6B 5F3BA 4NQTA 4LSTL 5GSVB 2FD6H 3V5HB 3ARFB 1RUMH 5CHNB 4PJXE 5KW9H 4YXHL 3JWDH 2W0PA 3OL2A 5GJSL 4F15B 1KN2H 4F7EA 3V79C 4FQCH 2HFEB 1EHNA 1RU9H 1JK8B 1BLNB 1CICD 1ED3A 4NWTL 5FUOH 4P2QA 5E8PA 3EJZD 2XNAA 2QQKH 3NCBB 4E42B 2VAAB 3ZDXE 35C8H 5HYJD 1Z9MA 1IGYB 4U1HB 5BJTA 5D70L 3T8XB 1IC4H 3ZKSD 3CVIL 5F9WB 1HH9A 4C58B 2CUHA 4C83B 1Z2KA 2HVJB 3TZVC 2YXFA 1WK0A 2Z31A 3W5NA 2VLJD 1BFTA 4NKOA 1P7KB 2QHLA 4YAQB 5E95B 3REVA 4LSTH 4CVWA 5C6TL 5I8KL 1KPRB 1QR4A 3G5XA 4EVNB 4Y5VB 4X0KA 4EIGB 5AYUL 4YXHH 2CR3A 4RAHA 5HVGB 2EC9U 5GJSH 3WLWC 3H7LA 5C0AD 4YHOH 4EI6B 5E2JA 4ZFOB 1RIVH 4LKXA 1CGVA 1JGLL 3BP4B 3VRLF 4NWTH 3IDMB 2ENYA 2NY0B 2OZ4L 2EDRA 2X7LA 1KCVL 1I7ZB 1JPST 1PEZA 2RJMA 1NQBA 1QRND 4WWKC 1T6VN 1HH6A 4LPXA 4G8GD 5D70H 3ARGA 3SDDA 1YEFL 1FIGH 2FHCA 1FORL 2I27N 3V5DB 3FO9A 3EFFA 3C8KB 3RL2B 2AP2A 2HWZH 3H9YA 4LSVL 3EO9H 3O6FD 5C6TH 4PPTA 2ARJQ 2XICA 3QEHB 3DVNA 1BIIB 1UCBL 3P9MA 1N3NB 3LKRA 1I1YA 4MQXD 3NCYS 2R2EA 2AJ3A 4IHOA 3DWTA 3T0VA 1FN4B 5EU6E 3OHXB 5DQDL 1FFRA 2FBJL 3O3DB 2BVUA 3BH8B 4OKDA 1ZGLA 1KBGL 1J0KA 1CVSC 1EHLL 4U2ZA 5T3XE 2OZ4H 4G6JL 3IU3A 1KCVH 1P2CA 4LVHC 3RWGB 3GMNB 5EO0A 5FYLH 5D72H 1Q0XL 4HXBL 4HPOL 3HNVH 3UXFA 1YEFH 1FORH 3MCKA 4PP1D 3SDXF 2WIIB 4LRIA 5DA0B 1EV2E 4BFGA 1NCWH 2J5LB 1YN6A 2R39A 2BFVL 1RJLA 3UTPD 4LSVH 3QEGL 1FZJA 3MLZL 4J4PC 4MDJB 5CD5C 1DBAL 4AENB 3W9DB 3TPUA 5L6YL 2R69H 4MAYB 1TVHA 3MACL 4X9IA 3EJJX 3H42L 4HBCL 1CICA 3BDYL 2VWEE 1ORQB 4XNUH 2FBJH 3X12B 5GS3A 2NY7L 1INDL 1IM9B 5HYJA 1VFOA 1EHLH 4F33B 1NUNB 2XN9D 4HX1B 4G6JH 4KUZH 1DSFL 4PJHB 4JPKH 3QUMA 4MCZB 4JO2H 1B2WH 1T6WA 5CJQH 3QAZC 1Q0XH 1OAUL 4HPOH 4HXBH 2VLJA 2FRGP 1BFOA 1R0AH 4OZHE 3CVHB 4OAWA 5KS9B 4L3CA 1FNSL 5DJXB 3T4AB 1YC8A 1L9MA 1LP9F 4OQTL 1JYNA 1AQKH 4OZIA 1G7LB 4X9GA 3BN9C 4PRBB 5D6CA 2YD4A 4PJEB 4ZPTB 4XC3L 4IJ3C 3UPRA 3QEGH 5C0AA 1KJ2L 4CUCA 2Z8WC 5HGBB 2YN3A 1DBAH 1LO5A 4O4YL 5TQ0L 4WTZG 3C5ZB 3MACH 4OIIH 1FNLA 1JWMB 3H42H 3SQOL 3GK8H 2FB4L 4OUUB 4FQ1L 3BDYH 5A3ID 4NM8H 1IRAY 2Z8RA 2V6HA 3RZWA 3B9AA 5IF0B 2NY7H 4L8SA 1INDH 1QRNA 4HGWA 3SDCD 3X11A 4OFIA 5SV3A 3CXHJ 4G8GA 1IBGL 3IF1B 4N5EC 3DX8A 4QT5A 2CPCA 4HUNB 1RK1B 2VWEC 4RGNB 4PV9A 3G6DL 1W72L 3RQ3A 2VQTA 4N8VA 3LRSA 1OAUH 3K1DA 3N85H 2WBWB 3TO4C 3O6FA 4LLYB 5TE6L 3UTSD 3ILPB 5FUCE 2DJUA 3SKOB 1FNSH 1YEJL 1R3HB 3GIVA 1CFNA 1YPZE 3DI2B 5IEKA 5ALCL 4PP2A 2NW2B 3CPLA 4OQTH 4V1DD 1GRWA 3IDJB 2NXZC 4XC3H 1YEDB 3BN3B 2R4RL 4M9PA 2CRMA 3V6FA 3ISWA 4GBXD 5DD0L 1ZHNA 3QWOA 1I1RA 5TQ0H 4AIZB 5CZVL 2P47B 4Y4FD 3VFOA 1RZKH 3RVVC 1VKXB 2IPKA 4L4TB 1L7TH 3SQOH 2FB4H 4R8WL 3UJIL 4FQ1H 5FKPA 5JORB 1QQDA 1FJ1A 3TH3T 4R3SB 3RPIB 3RWDA 5F88A 2X4NA 1PKQE 1KEML 1M05A 2YHGA 4HSQA 4Q6IC 5D1XC 5E94B 3RHWF 2HVKA 3QUZC 1NGZA 3H0TB 1IBGH 4PS4L 4KHXH 3D6GA 3DGGA 4JZOA 2FH8A 4JPWL 3AREA 4WJ5A 2MCPL 4JFXB 1W72H 3FQXB 3C6SA 2CLZB 4XVJL 4JJ5A 3L3IB 5B8CB 3Q1SL 1D5MB 2XFXB 4FZEL 4OZ4A 4YR6A 4ZNEE 5TE6H 3ZLQC 2LTQB 4Y16D 1U8IB 2DD8L 3D0LA 3OKNB 4WI8A 5ALCH 1B4RA 1IARB 2R2HB 2DYPB 1MCQA 5IMMA 3IAGC 2VXUL 1GOGA 3LQAL 2R4RH 4KI5D 5FUCC 2LVEA 3WJLC 2OLDA 2DDQL 2X4QA 2F5BL 5DD0H 1IGTA 5TE7L 5ECJE 3LH2L 1C7SA 2AI0L 4GRWF 4OFVA 1IAII 1QR1A 4M8QB 1BJ8A 4R8WH 3TBTA 1IZJA 2Q8AL 1FAKT 2XN9A 4I4WB 3DARA 1JTPA 4OCYL 4M7JL 4JZNA 1RUKH 2Y1VA 1KEMH 4BSVB 1Q38A 4A6YB 2ZG3A 3W0WE 4PS4H 1HHGB 5HPOA 2UYLA 5DEFB 2BVYA 2MCPH 4UQ2B 5MENE 2X4OA 1WISA 3QBTB 2UWEF 5TF0A 2HJFB 4RNRA 4XVJH 4XP6L 1XIWC 3CDCA 3MV7B 1NDMA 3Q1SH 4FZEH 4IMKC 3X13A 2DBLH 4R7DA 4NUGH 1E4KA 1R3IL 2BSRB 1JGVL 2PO6B 4F2MB 3W81A 4NWUH 1BQHG 3ESUF 5T5FL 3TBWA 2AV1A 1X3DA 4P46D 1ND0B 1Z9OA 1N0XL 4M61A 5BQ7B 2DQFB 3QT2A 4QWWC 3VXUB 1YDPA 5JOPD 2A6DB 2ERJC 2DDQH 1H15A 2F5BH 3HE7D 5TE7H 2AI0H 4HKBA 3RU8L 3WNNA 3SDCA 3SDXB 3OXSA 4L9LB 2Q8AH 5AZEL 2MNUA 5GGRB 4M7JH 3N1PC 3DHMA 1NUDA 25C8L 4U1GC 1MLBB 2CXKA 1DLHB 3HRZB 4N8PA 2EDOA 3FB7B 4QRPB 2ZOLB 3PL6C 3UTSA 3VW3H 1C12A 1M7DB 3V6ZA 3L3DA 1T7WA 2VR5A 3PE9A 3MYZA 4Y19D 1NBVL 4V1DA 4YIQA 1R3IH 4D9QE 1U9KA 3B6SB 3OKKA 5DHYB 4PRHE 3NIDF 3FQNB 4PLNC 3JV5A 3SE4C 4OKVA 2CQVA 1N0XH 2XXCB 4GBXA 2EDJA 2P5EB 4Y4KB 2YPLE 1PG7X 2F8OA 3PWLA 3HLAA 4Y4FA 3MRMA 4XRCA 4LBEA 4OZGE 2FL5A 2JELL 2FEEI 2OR8A 3MRDB 4LSQL 4FQQA 5HHMB 1WCBB 3RU8H 1JRHL 2BSED 5IBLD 5KVDH 5EU4B 2PF6A 4UTBL 1G6RL 3P4MB 3HE6D 3KXFB 3V7AE 1P84K 3R8QA 1ZHLB 1ZS8A 3WE6A 4HBQA 1T7XA 1NCCL 4YBQD 5E9DD 3MODL 2HJKA 1GVIA 5TDPA 25C8H 3HZYB 1I3RB 4B0MM 2VL5A 4MD0A 2AS5M 3FQUB 4RGOH 3JVGC 2GTZA 4MB3A 3RWCB 5DD6A 3OXRB 4Y16A 2F5AL 3RY6A 3ZHDA 5D2NE 1B3JA 2IANB 1NBVH 5HGDB 3TESA 3HCVA 4QRQB 1J0JA 4GS7C 4Z7NF 2EDLA 1U2HA 3DMMD 1FQ9C 4LHJB 2X09A 3D3VB 2VAJA 3TV3L 3EKCA 3F5WB 5DK2A 4NT6B 2JELH 2VTFA 5GZNC 2F19L 4LSQH 1XCTA 2QSQA 3KPOB 1FNGA 2VUYA 1JRHH 1KIRB 4UTBH 1G6RH 3UBXG 2BNRB 3BPOB 5JHLL 4JFPA 4IRJC 2ITDB 1HCFX 1NCCH 3G04B 3NIGF 4XWOD 4TUKL 3MODH 3RWJA 4KROC 4KQ3H 3RNQA 2I9LA 3KPMA 4JVPA 5C0BB 2OX5A 4NO5A 3FRUA 4GW1A 1G7HA 2G5RA 4XAKE 5ITFB 5BRZB 3QO0A 5D1QC 3U2SB 2XWTB 2HLFC 3PDGA 4FG6D 3SKMB 1BX2A 2N1KA 2QQNL 4P46A 3TO2B 2F5AH 5F1SA 4B5EA 4XAWL 5FK9A 1IQDA 1QUNA 3WFEL 2W0FA 3MGTA 3UYOD 3NABH 1MQ8A 2A1WL 4LLUB 3OAZK 4MNHB 2CKBA 3HAEG 4JGJA 4HWZB 3FO0H 2Y9RT 3HE7A 1NDGB 1JPFA 1T4KA 5HPMA 4NKDA 1AO7E 2AV7B 3BP7B 4YX2L 4U31A 3OJ2C 5CAYB 2F19H 1CU4L 1E6JH 1MCHA 5E6ZA 1UXWA 3QDAA 1OF2A 2JK5A 1F4YL 1JN6A 3TFKD 5B38G 2FSEB 5C07E 5JHLH 1NC4D 5DO2C 4MJ5A 4HS3A 2F54D 1JP5A 4TUKH 1QVOB 5IFJB 4HDIA 1UWXK 3EZJB 1EBPA 5GRXG 4K9EH 1J12A 4Y19A 5H35B 3S7GA 1I8IA 3QP3A 3FHAA 2QQNH 1FV1B 4ELMB 4XAWH 4GRWB 3UTTD 1OSZA 1QBAA 2PW1B 3WFEH 1I7UB 2A1WH 4JCMA 2WUCH 5KVFH 3T65A 2C3WA 2P5WD 3STBA 2PXYC 3T2PA 5JW5B 1LEGB 2FX9L 2R2BB 4TSAL 5DQJB 5CEZL 5H94B 4YX2H 1RURH 5C2UB 3IJHB 3LKNB 1LEKB 4FP8H 1NEZA 4HK0A 1BMGA 3HE6A 2UWEB 1CU4H 4GKNA 2IMMA 1D7FA 5E9DA 5DJ8A 2YD1A 4JFFD 1PDKA 1IE5A 4P5MB 5F7DB 3QI9C 4D0BB 3DX9A 3T0ED 5F6HJ 4HIHA 4S10A 3RDTC 5J4MA 4PRID 1UEYA 3QFJE 3M8OL 2GUOA 2GCYB 3PDDA 1TNMA 3ZKMC 4C55A 3CNKA 3KPTA 3V7MA 4TULH 4FQLH 1BWMA 4ZDHA 4A6YH 1HQRB 3PWNA 3BPLB 4IDJL 5IQ9A 4JRYA 4YK4C 3DMMA 3MSPA 3ZYZA 1ORSB 3TZVD 4FFYL 1K2DA 1BFVL 4QRTB 3JTTA 3L3JA 2YBRA 1N0LA 2EE2A 1ZWIB 4JM2D 3ZKXC 1QLRB 3WS3B 2H3NB 2NY4C 4UQ3A 3K4AA 5D7IE 5T3ZL 1V3LA 4J3UA 1ODAA 2A6KA 4MJIE 5C71A 4PRDB 2BNUA 3WLWD 1I8MB 2H9GB 1XAUA 4FOMA 4X6BA 3KHOA 1ZSDB 3RVTC 1OVZA 3M8OH 1S7UB 1NMAL 1J7VR 4NJAH 1NBYA 1FC2D 4OFKA 2Z91A 3S97C 1J1XL 2IPUG 2QSTA 2W07A 3CFBB 4IDJH 4WWKD 3RAJL 5CJBA 5HVHC 5IHZB 2FWOA 2Q76B 2IGFH 3F6IA 5I1LA 4OGZA 4FFYH 1IC1A 4DW2L 3DETC 4ONFH 5EO1A 3U30B 5CP7A 3HUJA 4NO3A 1TQBC 5EUKB 1FG2B 1QA9A 2CMRL 3QFDA 3W2DL 1EK3A 3U48A 5T3ZH 2ICES 4B41A 2GYSA 3HR6A 3GO1H 1QBML 2IADB 4GXUN 1NC4A 4HUWA 2YUZA 3L5HA 2F54A 3NIFE 3GBNL 3BIAX 1BJ1H 3BISA 3BKMH 1A7BA 1F5WA 1F2XK 2YZ8A 3LCYA 2J8UB 3VXQB 3VRIA 1WZ1L 3RUGB 2MHAA 3JV6B 3PP3K 3BMVA 1J5OL 5HVWA 4KTDL 4Y8AA 3WHE0 5ESAA 3L9RB 4OF8A 5F1NB 4K7PX 3F6LA 3UTTA 3G08A 4FS0A 4L3EE 4FN0A 4OZIF 4UAOB 1EMTL 1N7ML 3O3BB 5IKCB 1HSAB 2P5WA 4I2XB 3RAJH 3AS3A 1OTSC 3FTGA 1MY7A 4N9GA 5DMKA 3VDAA 1MQKL 1QFWL 3SN6N 5I66B 5DJAB 1CL7L 2JJWA 3MXWH 1FHGA 4ODUB 1LK3L 4EOWL 2CMRH 3W2DH 3ARQA 1R24B 1DBBH 4UDTB 4JFFA 5F3BB 1QBMH 2OR9H 4J4PD 5CD5D 4HUVA 3T0EA 5C92A 5HDOA 3GBNH 4WNQA 3L95A 3O2WL 4PRIA 3DX6A 5GGTL 1DUYA 1G7QB 4O58H 1WZ1H 3Q5OA 5HJ3A 1I9JL 1J5OH 4KRPC 2PTTB 3HNSL 1ONQA 4O00A 5BV7L 1IGIL 1E6OH 5D7KE 4U1LA 3HTLX 2I07A 5D71H 2BVPA 5EU6D 1N7MH 3OB8A 4CAGA 4G80A 2ZG2A 3TZVA 1WZMA 3NVQA 1OAQL 4P2QB 1MQKH 4JM2A 5E8PB 2XNAB 3REWB 3NFNA 5J3HC 1QFWH 2KZ1B 5T3XD 3R0MA 1K4DA 1G0XA 3OAUL 4UIMB 1HYRC 5F3HB 1A3RL 2ZUTA 1HH9B 4RMWA 5E6IB 5C0RH 4P9HC 3BN9D 2XRAL 1CT8A 1T2XA 5I2IA 2NY6B 1E4XL 4Z95L 4ZYKB 3JSSA 2EDXA 3REVB 4NQDB 3G5XB 4WUKL 2VDNL 5IP4A 2WWKO 4PJXA 3O2WH 4KHTL 2JF1A 3PABA 5DJZA 5GGTH 2XG5A 4M3JA 3AS2A 3S4SA 4KMTL 5DWUL 4HD9A 1I9JH 4Z7OF 4YDLB 1GC1L 4JLRB 4JY4A 4N8VG 3O11A 4JFOA 3GMLB 4WI5A 1Q0YL 4WWKA 3HNSH 4ZUWB 1UVQA 1Z5LA 4N5ED 3STZA 4LKXB 5JTWA 1MAKA 4F7PB 5BO1H 1XH3A 1KCUL 5CBEB 3GJFH 4RBPK 2W38A 1HEZB 5E6YA 1OAQH 4OIAA 4XNXL 3T0AA 4EJ1C 3TO4D 5JHDE 2ORBL 4XVTL 1IC5L 3OAUH 3FRPG 3A67L 1HOCB 4FQ2L 4GKZA 2KZWA 3ARGB 4GRWH 1A3RH 2XIDA 5IR1A 1ZA3B 1FO0L 2R0LL 3FO9B 4RFEA 5CJ8A 3SJVB 3RGVC 2NXZD 3OMZA 1E4XH 5J11C 4Z95H 1KJ3H 3KLSA 2VDNH 1CDHA 3MOBL 3HI5H 4KHTH 4YBLC 2FLBT 3RVVD 3U83A 4LEXL 3RY5A 3U0TA 1I1YB 5F70A 5JA9A 4KMTH 1T66C 4P3DA 2R2EB 4OI9A 1HN1A 2DKUA 5D1XD 4BUGA 4HG4K 1Q0YH 1YQVL 1CN4A 2AKRB 3QUZD 4ODWA 2QADC 3G9AB 4ONHA 5C09E 1TZGL 1KCUH 2BY2A 1ZGLB 2MTPA 4PYHA 5C0NC 3QXUA 4XNXH 1F6LL 1JPTH 3IU3B 5DRXB 1BZ9A 5JR1H 5EO0B 2ORBH 4XVTH 4OSUH 1JHLH 1SJXA 3ARDC 3VFPA 3A67H 3GB7B 4NKMB 3HRPA 3MCKB 4M6OH 4GAYA 5F9OL 4ZUVA 3SGEH 2R0LH 4J4PA 5FF6A 5IM7A 2P7TA 4PV8B 5B3NA 1RJLB 3BGFB 2QHRH 5HGAA 3O6KL 2DRUA 3UZEA 3MOBH 4S1QL 2HYMA 3TBSB 1FZJB 3KYNA 4LEXH 4WCYH 2H6PA 4I0PC 3CFJA 4KV5E 3VD9A 3TPUB 5GXBB 1DQDL 2JJSC 3QEUB 2ICWB 1WIUA 5EU6A 1Z0NA 2OTWA 3QXTA 5D7JC 4MMZC 1CICB 3EAKA 2CK0L 1RZGA 4JRXB 4JE4B 1NUGA 2FJHA 1DQML 2H45A 4JKPL 5HYJB 4H88L 5EOQL 1XIWD 3MV11 5I1EL 5EC2A 1ZT7A 2VLJB 4NSKB 5ADPL 3FKUS 5F9OH 4CVZA 4HMCA 5HHVL 7CGTA 2GSGB 1MNUL 4OAWB 1RUQL 4QGYA 4AMKL 3VFNA 4AT6B 4QWWD 3V6OC 1RK0A 1CXLA 5D6CB 3PGCB 4XNZB 4QXUL 4PIRF 3UPRB 5HYFA 1GHFH 2CR6A 4W4OC 4XPFL 2YD9A 3MJ7A 1CGSL 1LO5B 4M6AA 3VJ6A 1BVKA 5TH2B 3O9WC 4R4NC 1OAYL 3RL1A 5L2KE 3OKOA 4W68A 2RFXA 2OL3L 1NGWA 1ITCA 2CK0H 4KI5F 3ES6A 1UZ8A 1YY8A 2PN5A 4NO0B 3THMH 3TBVA 1QFWM 3TO4A 4WU7B 4L8SB 1QRNB 1DQMH 4HGWB 4JKPH 4YHPB 3X11B 3PL6D 4H88H 4G8GB 2RCSL 2Y5TB 4Y5YC 3W0WD 3TVMC 5JNYA 3TEUA 3TJHD 5IMOA 4N8VB 5MEND 3LRSB 5HHXL 2VL4A 4OZHA 3E2HB 5ADPH 5HHVH 3D2UB 3C8DA 1Q94B 1VENA 1MNUH 1T1ZA 1WFTA 4IIQC 5D93B 4O51B 1RUQH 2HRLA 2DN7A 4LPCA 4OLXL 3MLRL 1CFNB 5IEKB 4PP2B 1R3JA 1LO2L 1TQCB 5IB5A 1LDPL 4PBVC 3VI4E 3VXRE 1WT5C 5GGVL 3ARUA 4Q6IA 3V6FB 5D1XA 3LS4L 3QUZA 3D48R 3DROA 1OAYH 3VFOB 2D4FA 4XPTL 2EIDA 3O0RL 2UY7A 3N9GH 1UC6A 1CFTB 1R5IA 2FX8H 1FJ1B 3RNKA 2ITCA 5F88B 1OP3K 5IBTH 1CK0H 5EU3B 1M05B 2UUDK 3OQ3B 4BQ6A 1NGZB 2RCSH 3V0WL 4JZOB 4HFWA 5IWLC 4WJ5B 5IVOA 1MIML 1N6VA 4BUHA 3J7HA 3C6SB 1N2RB 2M26A 4OTXL 5HHXH 2VABB 4M02A 4JJ5B 4JO3L 2AK4E 4UNTA 1MFCH 1DVFC 4X7SH 3WJLA 1YPZA 3HZKA 2F9BT 4UV4L 4OLXH 1AFVL 3MMEA 3MLRH 1AQDB 4D9QD 1TNNA 2CDFA 4PRHD 1LO2H 3DOSA 3IDYC 5F21B 5GZND 1LDPH 3QJHB 5GGVH 2NX5E 2YPLD 2P8LB 2GFBB 3NMEA 3T0BA 2X4QB 1WTLA 4IRJD 4XPTH 1AI1L 1QR1B 3O0RH 4YDVA 5DRZB 4KROD 3TBTB 4AM0A 3VCLA 1PKQA 2XN9B 2Y07H 1XIWA 3FB8B 4WO4D 1IJ9A 1RUAH 4IMKA 2ZUVA 5DS8B 5D1QD 3STLA 2HLFD 3CK0H 5IVZA 4LLDB 1K85A 3V0WH 2UYLB 3MRHA 1UM5L 1MIMH 4LIQE 1MHHB 1SVCP 4BZ2L 1TPXC 1B0WA 4YHYB 1YYLL 4ZNEA 4JO3H 3QWQB 4L8CA 1NDMB 3IKCA 2VKWA 3X13B 3O45A 1S7RA 2WINA 3DI3B 1AFVH 3TBWB 1Q9LA 3WKML 3G6JE 3L3OA 2GT9A 4M61B 1U8MA 1XF1A 5HY9A 3M1BB 3BDXA 2I26N 1XMWA 4JPIB 1H15B 5DO2D 1U8NB 1ERNA 4HKBB 4NQEE 3MQIA 1D5XA 1X5YA 5FDYA 1MOEA 3SDCB 5C2BL 1JTTA 3PL6A 3CH8A 4POUB 3O4LE 5J12B 2ILLA 3LKOB 1X7QA 4NRXA 3W0WA 2H1PH 3OGOE 3QZWB 2QJDA 3KPLA 5MENA 1SJHB 2D7TH 2BERA 4X83A 5EZLB 1LEIA 3SE4A 1UKQA 4BZ2H 2D31A 2COQA 3I6KA 3UTSB 4XAKD 1C12B 3V6ZB 3I3DA 3QUML 3BD3A 2VN7A 4OJFL 1EEZA 1KCLA 5CCKL 4JHAL 5JPMA 3QXAA 3WKMH 3NAAH 4OKVB 1MHCB 4K3JH 1EPFA 4GBXB 5TPWL 3PWLB 3HLAB 4Y4FB 2PCPA 3GHBL 3FAXA 3MRMB 4XRCB 4LBEB 2V9RA 5TF1L 4DKFL 1AO7D 5CEXA 1A1OA 2OP4L 4WWID 2CXGA 4FQQB 4S2SB 3J8F7 3JVGA 2G5BB 4BSJA 3RDTD 2YD3A 5C2BH 2WZPD 1FSKC 5C1MB 4B50A 1C16A 3WJJC 3WE6B 5C07D 2B2XL 3ZKMD 3HUJF 5E56A 2EECA 2HJKB 3GSUA 5TDPB 1INEL 2WBJB 4F57L 4K8RL 2VL5B 4MD0B 4PY8I 4GLRH 1JGUH 5B3JF 1MHPH 3P2TA 1XF4A 4EN3C 3KYOA 5DD6B 4Z77A 2O93L 2ZPKL 5E08L 4PRHA 3QUMH 4N1CA 4R4BB 2NY4D 5CCKH 1JUFA 2OSLB 1WEJL 1FRGL 4CJ1A 2YPLA 3SY0A 3D69B 3NA4A 1SM3H 4E0RB 4IRJA 4OZGA 3ARFC 4R90L 5F89A 5DFWH 5HI5C 5LVEA 5TF1H 5GJTH 4DKFH 1Q1JL 2OP4H 5CIPH 3VMOA 1XCTB 3MJ8B 4GG8B 4KTEL 4WO4A 3S35H 4F15C 3IB4A 5D1QA 5HDBE 3WL9A 3SO5A 3RVTD 1T1YA 1RPQA 2DI7A 4JFPB 5IW1A 4PRPE 2B2XH 1F90L 4H0IA 4LU5H 3BT2L 4PG9A 5CMAA 5ENWA 3W9EB 1QSVA 1UCTA 3QJFB 5JMRA 1INEH 5IW3A 4F57H 1MWAL 3WO4C 1N4XL 4LOUC 1KEGL 4ONGH 2VRAA 4PJGB 3GRWA 1AR2A 3QO0B 1RZ7L 5D2NA 1G9NL 2ZPKH 4CVUA 5E08H 3DETD 4P46B 1WBZA 2NXYB 4YZFE 4OF7A 2VZOA 3MRKB 3VI3E 1RFDH 3VG9B 1WEJH 1FRGH 4MQTB 1AGBA 5DZOA 1HHJA 2F8XC 3HE7B 2BSSB 5AG9A 1T4KB 4R90H 3QHZL 5HPMB 5T5NF 4UMGA 2PYEE 2BSTA 1F6AB 2IBBA 1Q1JH 2W65A 1UXWB 3G5VB 4KTEH 1G7IB 4JM2F 2JK5B 4M48H 3VXOA 2YEZA 1XGPB 4MJID 4AEIH 1HHKA 2ADGA 4MA1B 5KZCB 4UTAL 5C0EA 3P77A 3IS1X 1C8PA 1MWAH 1CLYL 2NY0C 2VJXA 1N4XH 3HS0A 1KEGH 3V6BR 1YNKL 1OTSD 5FYJL 5JXAL 4Y19B