4DK6A

Structure of editosome protein
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
127
structure length
127
Chain Sequence
QVQLQESGGGLVQAGGSLRLSCAASGRTSSLYSMGWFRQAPGKEREFVAAISRNGANTYYTDSVKGRFTISRDNAKNTVELQMNSLKPEDTAVYYCAADRFPTMEVVTIMTNEYDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the C-terminal domain of the largest editosome interaction protein and its role in promoting RNA binding by RNA-editing ligase L2.
pubmed doi rcsb
source organism Lama glama
molecule tags Rna binding protein/immune system
molecule keywords single domain antibody VHH
total genus 36
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dk6A00
2PW1A 3ZDXF 4HGMA 5KW9L 1BHGA 1EHNA 4QRTA 1AKJD 2OL3B 3D69A 1A3LH 4PJGB 4ZUTA 1T22A 5BJTB 4HK3N 5CEZE 1MCBA 3I6GB 2FECI 4QTHB 2FO4A 2DQCH 3TWCL 4DEPB 2NW3A 1WC7A 2PN5A 3EYSH 1MCIA 2L0DA 4TQEH 3ZKMD 4LVOC 4OLZL 1U8PB 3IFNL 3NPSB 4DN4H 4EDXA 3GI8H 2BNQE 1K5NB 4M6OH 4H25A 4FQHB 4J6RH 3MNVB 3MRMA 2DQEL 3P0VH 2C5DC 3DX8B 4XBEL 1K2DA 4JZNA 1KJVA 4WTZG 5DD0L 1QBLL 4XNXH 1U3HA 1CZ8L 2Z0BA 3MJ7A 3R8QA 1CICC 3LCYA 4MNHA 1FJ1B 4P99A 3R06A 5E70A 1B2WH 4S1SL 2AJZB 3P4LA 4Y4HA 5D1XC 4C57C 3VXRA 2DTMH 4I4WB 4LLUA 1SJEA 2P5WA 1ZHKA 2FSEA 2B1HH 2CK0L 5I1CL 2IPUK 3GSQA 3VRJA 4GJTB 3QI9D 3LRHA 1L0XA 4S2SB 1WEJH 4WY7L 5D7LD 2QADC 1BJ1J 1ZA6B 3OR7B 3KAAA 3MFFB 5IT2H 1FNSH 5E8DL 1EEQA 2LAAA 3RKDD 3DXAB 4QRUB 3UYPA 1OAQH 4Y1AA 3MODH 4Y7MA 1FFQA 1MHHA 1NGZB 3C8KB 4JREC 1PAMA 4JM2F 1T1YB 5DEFA 2IPKB 4QXTA 2HAZA 5IROA 3T0EA 4ZS7H 3ARFA 3PWNB 4KDTC 1AQDA 1OAZH 5KSUA 5T3XL 4XP6L 2YRPA 1LO4L 4JFDE 1CFTA 5F7DA 1R3IH 5T1MA 4YHZL 2H2PC 1CFNA 4P4RA 4PJ5D 1V3JA 2BY0A 3U4BH 4UDUB 1A7NH 1T20B 4RGMB 3C9NA 2DQFB 4EXPX 3PP4L 5IKCB 2QTEA 2R69L 4XPFH 2VXVL 5DHYA 3G5ZB 2A1WL 3QDGD 5CP3H 3DPBA 3ARTA 3K80A 3ZHKA 3L3HA 3SQOL 4RAUB 3KPSA 1JGEA 3UTQA 3PGCB 1QVOA 4RRPG 3K8MA 1SJHA 2CPCA 1F3JA 1WUNT 4Z78B 4ZG1A 2GK2A 1P5UA 4YDIH 3PWPD 1U8KB 4NN5C 4M62L 3RL2B 2WIIA 2EE9A 2FGWH 5FKPA 3NCFB 2FEDD 2XA8L 1YY8B 5A16B 1MJJA 2YC1B 4ODBD 1IQDB 1BP3B 3O2WH 2YR3A 1W72L 5EIQA 1GGCL 3O4LD 2VC2L 5F44A 4RX4D 4E0RB 1HZHH 1MRCH 4RZCA 3IT8D 3S36X 3IVKA 3WNNA 2PXYC 3JV4A 1UQSA 4FQXC 4I2XE 4ZD3L 5A40E 1QA9A 1S7VB 4R2GD 1H3PL 3TPKA 3H9HA 4LLQA 1RUPH 1FG2B 3GBMH 3QA3A 1MAML 2AK1L 3QDGB 4RIRB 1IZKA 5AZEH 3H7BB 2RIKA 3MLYL 3ROOB 4PY7B 4PJBB 4PGEA 3QB7C 3T8XA 2MHAA 2VLME 5L8JB 2Y25A 4DAGL 1INEL 4MWFA 5GRWA 5C07D 4WHTA 1CGSH 3WIHA 4NZRL 3EDKA 3P2TA 1ZVSB 3H3PL 1WWWX 1BBJB 3BPOC 1R3JA 3IDJB 2LTQC 3RVVD 3QEQE 5A3IC 3DECA 1DVFB 4HX1A 4C83B 1F3RB 5I74C 1EA9C 2Y5TB 2EDJA 1NDMB 3O0RH 3QUXC 5IFJB 4Y16C 4WFHE 2MCPL 1XIWD 4O02H 3W11D 4QGTA 3S34L 4KJWD 1LK3H 5SX5H 4O51A 2C1PA 1CTOA 3QWOB 3VDAA 5C86A 3TH3T 2C3HA 4IRJA 1S9XA 5DC0A 4P2QE 5EO1B 2QSCH 1HKLH 2XZAL 2DQGL 1OB1B 35C8L 3ARRA 5B38A 5IM7B 1FVDB 5DZLA 1OW0C 5ICYA 2DQJH 4P2RE 1FP5A 2BK8A 3O8XC 1NMAH 1NMBH 1ZT7B 2ZUQC 4N0UA 5F8QC 1U91B 4NP4L 4KRPB 4AL8H 4G8GB 3CVHL 1J8HD 3QCUH 4QRRB 3IF1B 4GG6F 4YZFE 1DVFD 4PJXA 3LKOB 4P23B 4QF1A 3JWOC 4YGVB 3CCHB 3HC0B 1CICA 3GJEA 1ZLSH 2FJGB 5KJRL 3T2NL 3AY4C 4NIKB 2FX7H 1D9KA 3T3ME 1FV1A 3KPOA 2EDYA 3VXMA 4Q6YA 5DHYB 1HYSC 3V5HB 3HG1A 2QQNL 3KXFE 5E24E 4LSVH 4OZIE 2EYTA 4O2EB 5C0AD 4WFGE 3SE8L 1FYTD 4RQQA 4G8EA 1IM9D 3SE9L 2VDRL 2Y07H 2Z31B 4CNIB 4PJ5A 1CBVL 2Y6SD 4QGYA 1DQDH 4FQQB 3SN6N 3WFHA 3MBXL 3MRJA 3TA3C 4U1NB 5FOBB 1KEGL 2W1NA 3QUMH 2DQGH 4K7PX 5I9QC 3L1OL 2VDLL 5ENWA 4M00A 1F90H 3ARUA 4HKZB 3ULUC 3N50A 1C12A 1MCRA 2HWZL 3MRRA 4X5XA 1XGPA 3HUJE 3QI9B 1J86A 3BIAX 3NZHL 2P8LB 4NQCB 3BYTA 1D6EA 5I16A 2BVPA 4LP5A 2W60A 3ECBB 4S1DC 2G75A 1I9IL 4P2QB 2CLVB 3HCVA 43C9B 1B4JL 2FZ3A 1P5VA 4PBXA 3ROLB 4J6RL 4KDVA 2BSED 5DS8B 2AEIT 5C0BD 1S5IL 3ME0A 5GZNC 1KN4H 3BDXA 2DMKA 3L9RA 3IFNH 2IALB 4KKBC 1ITBB 1UM5H 3DO3A 3IRPX 4CVXA 4JQIL 2WUBL 3U9PL 1Q8MA 4QNPF 4P5MA 1I1AB 3HMXA 4HIJA 4IRSB 4EI5D 3DO7B 2L7JA 4PJHB 4R97B 4YHYB 5AYUL 3D39A 3ARGB 3HUJA 1TTGA 1CU4L 2I9LB 2OI9B 3KPOB 2XKSA 2OL3H 2E6JA 3ZDXE 4JO3L 1DBAH 3MJ7B 3R06B 3C2AH 3TM6A 3MREB 2HP4A 4U1GB 1GGCH 4U6VL 1VKXB 3BH8A 4HKBB 3U82B 4XNZB 1I4FB 3GO1L 3LZFH 5EBMA 1J1OL 4MD5A 5FYKD 1QBBA 5HDLA 2BOCB 1N4XL 3C6LD 1MLCA 1JPFA 2ZJSL 4FZ8L 3MGAA 3G08B 5F88B 5SX4I 4LF3B 1CLYL 4JLRB 1QRKA 4FMFA 5E6IC 4NM4L 3W9DA 1T4KA 1I7UB 1Q9OB 3OB0K 1WBXA 4MCYA 2FR4B 4JZJC 1FZOA 1J0IA 1AC0A 3RWEA 1NSNL 1YY9C 2X4QB 1U42A 2DLHA 4HKZA 2WQRA 5CEYA 1KEMH 1DN0B 1IC4H 4X8JA 4LASL 4UQ2A 3WO3B 2WWMC 3LIZH 1E4XI 4LSUH 4P3CH 4WEBH 5IFAL 4H25B 4FG6C 1T66D 4EUPG 4JCMA 4QXUH 1UGNA 3W11C 4PTTA 5E03A 1WQVT 3KPMB 5D71L 5JORA 3O6FB 3T4YB 5IIEA 4NOFA 2BSRA 3T0WA 5TDOB 5EWIH 1P6AB 2CKNA 2DDQH 2HG5B 4LLMB 4ODXB 1CICD 4A6YL 1J0YA 2EH8H 3PWJB 1DDHB 2GFBA 3OKNB 3WIFA 5KS9E 4FXKB 4MDIA 5JW5B 2VR5A 3ZZ1A 5L6YL 1P84J 2CDEB 3C09C 1VPOL 2DICA 3K2MC 4GH7B 1JIBA 3HG1D 1T0NB 1KTRL 4JO2H 1XR8A 4Y19D 4GKSB 1A5FH 2P4AB 4GAJH 1PVHA 1EV2E 2VL4A 4XAKE 4Q9BA 3QFJE 2XZQL 1MCPL 4FFWC 2ADJA 2IQ9H 3TESA 3B8SA 2W0FB 3PDOB 5ECJE 2CGRH 1ZS8A 4NRXB 4GBXD 2O26U 3GRWA 1BVLB 1RUQH 4CN6A 1TZIA 2C3GA 5BW7C 4BZ2L 3FZUD 4NN6C 1FNFA 3HZMB 3QDAA 1DQLH 2NYYC 3BP7A 2YOCA 3FTGA 2DQEH 3P0VL 1PQZB 3FT2A 3N0PB 2BHYA 4HKXA 3ULUH 2BXYA 1TJGH 3TIDB 3B5TA 4GW1A 5DMKB 4GKNB 4WUUB 4WU7A 4G6KH 4PGEB 2ZSVB 2X4SB 5B39G 4DW2L 1TNNA 5C09D 4TOYH 3QPQD 5ISZB 1FIGL 1L4IA 1M6OB 5BVPL 2EDXA 3DBXA 1BECA 2DBLL 4YHNB 3HZVA 3MRBB 5GRYA 5IEHB 4QHLB 4A2LA 4MD0A 4D3CL 4WUKL 4U7SA 3L3OA 4XNMA 4UQ2B 3WS3B 4LEXL 2EO9A 3RX7A 2EZ0D 3BGFC 1A6UH 4ZTPL 2Q8AH 4LSVL 4Q7DA 2E7LC 2ICEA 1BX2A 5JDSB 3IU4H 4UTBL 2C26A 4RRPA 3UZEA 2ZZUT 3MLTA 4KAQH 4E9LA 4KTEH 2FBJH 5F89B 4QTIH 4PG9B 1KGCD 4TSBL 1NCDH 3GSRA 3CUPA 3NCJL 3F5WB 3PQYD 3L5XH 3ULUD 3TFKC 3BIBX 5D5MB 1RURH 1YMMB 3TZVA 1CL7L 3VRLF 5HHME 3CIQA 4FFZH 3SGEI 4TUOA 4ERSH 1PG7H 3NIGE 1JV5A 1GGBH 4P5TB 5LBSH 3OX8A 4XXCA 1P7KA 5JIHA 2VLJE 2X1WL 5E1AA 5JPMB 5MEOB 2DI7A 4BFEA 3T0ED 1G1YA 1NH6A 1KFAL 3MRKA 1J1PL 2DN7A 1IQWH 4EKXA 3P0YL 3Q2CA 1N8ZA 1RUKL 3CFEA 2MPAL 3O45B 4JGUA 4FXGA 3CSPA 3WUWB 1WSST 4N0UE 1IAKB 3L5WB 3C5SB 4OFPA 5BRZB 1F4XH 3PWVA 3QFJD 5ANMA 4NN7B 3DVGB 2NX5E 5HXMA 2BSRB 1VFOA 4ENEC 2X4NA 3QFDB 4JRXD 3ZT5A 1UFUA 4MX7B 1IM3B 2AEWA 2D7NA 1F00I 3REWB 2H1PL 4QT5A 3HZYB 5HPMB 1OY3B 3OKLB 1HH9A 3QIBC 1S9XB 4AL8L 3U0PA 4JQVA 5IJVB 4I13B 4LNRB 5KBNC 2H32A 1ADQH 4Z7VE 1LP9E 1EMTH 1JHLL 1ZSDB 3V0WL 4NM8L 3TPUA 5IMOA 3PL6D 5EFIB 1YEKH 1HSAB 3SQBA 3N1PC 2VRAA 3ARBB 4JFFE 1E4WH 2NY7H 1K8DB 5C0EB 3MRNA 4NO0D 5INCA 3G9VA 3RUGE 1OWRM 3FT3A 4IOIB 2X5PA 1JPSL 5B3NA 1UCBH 4Y5VC 5D1ZC 4QHNA 2APBA 7FABL 1PD6A 3V7AE 1CDYA 2A77H 1OAUH 4PJ8C 4P9HC 3UEZA 4LLDB 1I7ZB 4FQCH 4AM0A 4D94A 1QR1A 3ARDB 5JW4Q 4OLVL 4U1KB 4ZYKA 5IBUG 5JUEH 5DI8A 3DTXB 1BBDL 1XF5B 2OZ4H 5MEPA 5HYJA 1EAPA 3D2UB 1INDL 4R96A 3ZE0E 1RIUL 1MCLA 1U3HB 1ZKAA 1VGKA 4OFKA 4BELD 5J06A 1FFPB 1KTLA 5EU5A 2M1KA 3V4UL 2GTWB 2CIIB 4HIJB 4IRSA 3DO7A 1LO2H 2BY2A 1QBMH 4ZSOA 4L4VB 3O9WD 1XR9B 2XPGB 3WSQL 2V2TA 1I1YB 3WXWH 2LE9A 5ANMB 4CN4A 5EN2A 4NO0B 1KPUA 1I3GL 1QNZH 4L4JA 1G7LA 1PZ5A 4DWHA 4OLXH 3KPPA 1RJYB 5D6DA 2R4RL 1CIDA 1CLCA 5EDXA 5FUCE 2Q7YA 4GRLB 5I9QB 4OBSA 2BNRB 3WJJC 2CKBA 2NY1C 1DE4A 4RA3A 4F57H 1IEBB 1MPAH 4QOKB 5FM4A 4X4ZA 1ZANH 3MRGB 2YN5A 1M71B 3DETC 2IMMA 1MI5E 2BOBB 5JUEL 1NDGA 4U1LB 2R8SL 4F37F 3OR6A 5BQ7B 5HDBF 4F7EB 5LJYH 3E6HB 1DBBL 1BWMA 1RIVL 3VFWA 5HDQH 4U2ZA 1MQ8A 5CJXA 2A6KA 5F7YC 3ARPA 4KWUA 2YD6A 1XGQA 3C6LA 1MREH 4JO4H 2IANE 5F6HI 4MJ6A 5E8NA 2DI8A 1MIML 3BVNB 3EO1A 1FVCA 2E9JA 3N85L 4KMQA 1NFDA 5I8OH 4W68A 5DJ6A 4D2NA 3WKML 4LSDA 2VXVH 5DJCA 2D9QB 4BFIB 3CFJA 3K0WA 4UINH 2KZWA 1KFAH 1NGYA 4ZUVB 1A9EB 2Z8WC 2SEBA 5IOPB 3WN5A 5DMIL 3SGEH 4ZPVB 3OJ2C 5GGSB 5AD0A 5FA4A 2WV3A 3QCTL 3BQUA 5HJ3A 1U8MB 4OSUH 4DGIH 3TZVC 3BPNB 3ZT6A 1JP5A 4UAOB 3G6JA 1CL7H 3PGDB 4WI7A 1N5YH 1ADQL 1KJMB 3GMMA 3EOBA 3IU3A 1RZGB 5E8DH 4ZAKC 1EX0A 2MOVA 5I8KL 1AXSB 4EN3B 1AP2A 1YPZE 4HFUH 2VWEC 1WIUA 5C0AE 5IVNA 2MCG1 1J0JA 5KSVB 1G0YR 4JDVB 5I1CH 3L3JA 3O4OB 5KS9A 4XVTH 1FNEA 2HRPH 5CEYB 4MJID 3IJHA 1C08B 3TA3A 4F7TA 5FIEA 1N0XH 2FDBP 3HAEB 1P7HL 2HVJA 3P0YH 4YR6B 5IB2B 4X9IA 3EJZC 4PJBA 2FD6H 3SGKC 1DE4B 1JGEB 1FGVL 3UTQB 4WRLA 5EOCJ 1T0PB 1D9KC 4V1DB 4LPYA 4XBEH 1XH3A 4OCXH 3TBTB 2DQDL 4M1CC 3MUZ1 4YC2C 3M07A 3CSGA 1MLBB 1IGIL 2G5BA 4ZOCA 4CVZB 4MNGE 1MJJB 2IQAB 5E4IA 3UCRA 2IGFH 3KYNB 2R9HD 3WIFB 1BEYH 1OTSC 3EFFA 3T09A 5HI3D 4DTGH 2YPLE 1Q9KB 5D7LB 1A6TB 4I0PD 3GSNH 3QNXB 5EOCH 1MCEA 3TT3H 4H26A 3BUYA 2I5YH 4NN5B 4O9HH 4UIMB 1GHFL 1T3FB 4OZIB 5EN2B 3CFBA 4KAQL 2BSSA 5I19L 5E7BA 4GBXC 4LBEA 3MUJA 3KPPB 5ID1B 3M1BA 5E94A 4HIIB 4I3SH 1INQA 3BP4B 4A6YB 1OQOA 1FRGL 4C59B 1ZT4A 3KJ4C 1WAAA 2VXSH 4WW2B 4XP1H 3FHAA 4CJ0A 1VPOH 1MJ7H 1QG3A 3U79A 2W65A 4HUWA 3RP1A 5F9WB 2M26A 5SWZB 4HIEB 2XTJE 1FIGH 4G6JH 5GHWL 3WHE0 3E6HA 1K3ZA 4U1IB 5HYEA 3NFSH 4G9DB 4WTWA 4XHJD 4JFQA 3RDTA 1Z3GL 1KGCE 4FQHA 2AABL 1F4WL 3EOAB 4YHNA 1NL0L 3P73A 3QUXA 3U7WH 4EN3D 4RFOH 3KYMA 5DDHB 3WFZA 3W0WB 2FRGP 4UINL 2EKSA 4JKLA 2LQRA 1CR9H 4HBCH 2WAHA 1N8ZB 5DC4B 3RJDA 4IOSD 1YYML 3I2CH 3MROA 4M93B 5HHNA 5CCKH 1ONQA 5HGHA 1IAKA 2IBZY 4BH7B 5ESVA 2Z31D 1T5WB 1IC7H 3QEQB 1MRDL 4W4OC 1RZ7H 4I5BA 3HC3H 4YO0B 4FTVB 4KQ4H 4JHAH 3RTQA 3HMXL 3VW3L 3LDBB 2B4CL 3A6OA 5SWSD 1HEZA 4FABL 5GHWH 3PABB 3RGVA 2J8UE 5FHBL 1FFOA 3SO3B 1AIFB 4DCQA 2YRLA 2BSTA 3VXPA 1C12B 4O2CB 4NC1C 4RA0C 5DK0B 4YPGA 2RB8A 3FB5A 2RAMA 3MCLL 1CICB 3GJEB 2DYPD 3VD9A 5ACMA 2F53E 4K7PY 1JFQH 1OD9A 3FO2A 2DQUL 5GS2H 1OAYH 4PJ5E 4HT1H 3HAEA 4HC1H 1X6LA 2QKIA 3RNKA 5SX5K 5HHVL 5ESAB 5IB2A 3S36L 4P23D 3GFUA 2WWKO 2EDOA 2H3NB 2Y6SC 5C0IA 4C56B 5MENB 4XAKD 4U4BA 1WTLA 3C60B 5JMRA 1MNUL 1QRNA 1BLNA 1T83A 1KIRA 3ZTJH 4OLEA 4ONGL 2OI9C 4JQXA 4U6HA 4FQJH 4YXLL 4XMPL 4UUJB 2OZ4L 5E8EA 5C07A 5L2KE 1VDGA 4WJ5A 3MMEA 2FIKB 1NUFA 4HIXL 5D2NA 5F8RC 5ALBL 4XP5H 2Q8BH 3UJJH 1ZTXH 1FE8H 4FQ2L 2CLRB 1LO5A 1MCQA 3QHZL 5TF1H 3R1GH 3QWRD 2HMIC 5E6ZA 3OAUH 5HI5C 3MUGA 3DX7B 3GEWB 4JFPA 1PX4A 3BD4A 4MDJA 3LN9A 1AXTH 5J6GA 1KCVL 2UWEA 2XQBL 4CU6A 4KVNL 3QIBB 1MCWW 2X4OA 3CH8A 2F8OA 2HWZH 5HYJD 4AEFA 3HR5A 3MSPA 3PUCA 4P5KA 2BOCA 3BZEA 1QA9B 3DETD 3BP6A 4P46B 3C09B 3DMMD 4LPCA 5C0EA 1IKFL 1WIPA 1KEGH 2ZCKH 2YUZA 4NQTA 3I3DA 3S96B 1P7QD 3I75B 3CFKA 2OP4L 3B43A 4X6CE 1EMTL 1FLTX 3RVWD 4CVUA 2WM0A 1I3UA 1EPFA 5DLMH 5DFVC 2IGFL 1M7IB 1NC4B 2BSTB 1IGFL 4KDWA 2R9HC 3VXUB 3UAJD 5GGTH 4NZUH 5DJYA 4KJWC 1NKRA 2HKFL 4MXQD 1YEFL 2ZCHL 5I15L 1SYSB 1EAPB 4YH6A 1ADQA 5C08B 4AEHL 1R3KB 9CGTA 3LMJL 2C7UB 1T2QL 1DLHA 4I9WD 4ORZC 4YXKH 3WD5H 3WKMH 3K81A 1MFBL 5HHXH 4Y4HD 2R29H 3DVNA 4JJ5B 4HKBA 3NA4A 1NPUA 3GNML 4PJ8D 1MFCL 1NANH 1YMME 5J3HC 3TNMA 1J7VR 5FUZL 4OV5B 1KIPA 5DUBB 3VD7A 3TH4T 3MA9L 1Q1JH 3QUKB 5E8EB 5C07B 4NQXB 4O58L 5BS0E 4QRSA 1PJ9A 2YRZA 2AXHA 3H9YA 3IFLH 4GBXA 4YO0A 1OLLA 1FNHA 1WFUA 5L2JB 5CEZL 1T4KB 5CKGA 4TVPL 1TVBB 4HS8H 5F3BB 5B3JE 2A74B 1EEUA 3TJEL 2GQHA 1JWMA 1FFOB 4UT6L 1G7MB 3F8UB 4GXVL 3GM8A 1UA6H 1W8OA 4NDMA 4GOSA 5JQ6H 4MHHG 4UTAH 3SKOB 3Q6GL 4JRYA 5BZWB 3MLSH 4RDQG 4CGTA 2XKNA 1T04B 2ITDA 3EOYG 4R4BA 4BH8A 2QQNH 2E7LA 3GMRA 4Y16A 5MERA 3RZCC 5F97E 2E7MA 1YJDH 3TIEB 4MJ6B 5E8NB 1AXIB 1JGVH 3JTTB 4H0IA 1R24A 4JFOB 3T4YA 4YAQA 4OD3L 5JIKA 5I0DA 4XVJH 1ES0A 4G6ML 1RI8A 4YHYC 3GBNH 3MJ9A 1TLKA 1QFOA 4LCWB 1MIEH 4JPIB 2Z93A 1J11A 5FO9A 2BVOB 4HAGA 2MMXA 4JO4L 1LP9B 1OSZA 1TVHB 5CMAA 4TTDC 5FFLA 2O5ZH 1CIUA 1CI5A 4NP4H 4F7PB 3UMTA 4HWBL 3O6FD 1A6WH 1P6FA 5EBWA 1DQML 1XGRA 4K3DL 3V6FB 5I66A 2KH2B 3U6RA 4FFVD 3OXSA 3WFDH 2A6JB 3D3VE 2VNCA 5H94B 4XWOD 3MRJB 1E28B 3P4OB 4YHIA 4WFGD 1F6LL 4HV8A 3U48A 3V8OA 4U1NA 1NGWB 2VQ1B 1MPAL 4R3SA 43CAB 2IAMD 3QZWG 3S5LB 4X6EA 5JW3L 5FB8A 4XMKL 1J88A 1S7UB 1NCBL 3KYOB 2HVKB 2VC2H 1MQKH 4XNYH 3DLQR 4FQXA 1SJEB 2P5WB 3GBLA 2VLRA 3DROA 2V7NA 2AK4E 1X5ZA 4ETQA 3AXLB 3RY4A 1VEOA 5BS0B 3FN3A 43C9A 1QBML 5CEXA 5T1DH 1QP1A 4JKWA 4CN1A 3TYGL 3QFJA 3BEVB 1G0DA 3H2WA 4M7JL 2FEDC 3IDMA 2ITCA 2AQ2A 4DZ8B 4DAGH 3EHBD 4L1DA 1XZ0B 2ICWB 1GPOH 4JG1H 4FQQA 1A2YA 4HLZH 5ID0A 1Z9MA 3MNVA 3LRSA 3MRMB 3WLWD 3WFHB 5AZEL 4J7RA 2VXTH 3QNYA 1R3HB 3HI1B 3D85D 4LLAA 4NQSA 4AEEA 4XCCL 3F6LA 1JN6B 1WT5C 3EYQD 3EFFB 4X80L 1JK8A 2K7QA 4XVUC 3LQAH 4LQFH 1GAFH 4Z77B 3ZKMC 5EZJA 1WC7B 3SCMD 2NXZB 3RDTD 3VXME 4PJAA 4LIQE 1ZLUH 1KLUB 1OSPH 1N59B 2J8HA 4WW2C 2XACC 4H1LB 4U7KA 7CGTA 2R1YA 1MWAB 2EE3A 2NY2B 3GRWL 4UILH 4L3ED 4DKEL 3MLVL 4JFDA 1X44A 3IXTB 3FQUA 2WQ8A 1TVBA 4RGNB 3BI9X 2IPTH 3OG6B 5I18L 5CGTA 1WZLA 1I7UA 1SEBA 3QUYC 4MMXC 5D4QA 4PIRF 2E9IA 3MA7A 2Q1EA 3H6JA 5JHLH 2ZPKH 2YD4A 4LSPH 1EGJH 1NAMB 5DRNB 4ZFFB 4F8TA 3Q6FA 1T04A 4R4BB 3VGBA 2BNUB 5DGRA 3HE6D 1U3YA 3C5SA 2V9RA 2R2HA 1B0WA 3EFDH 1N6QH 3Q3GB 5E4EC 2XKUA 1KPRB 1GRWA 3AU1B 1Y18A 2DM4A 4YX2L 2VB5A 2DL9A 4PS4H 3SDXB 1Y6MR 1YMHA 3ULVH 1MHPL 1IAIM 3GI8L 1FFRA 4P0DA 1G7QB 1UACL 2BX5A 1U8IA 1XGUB 1I7TA 4ODUB 1GC1H 2NY0C 3EGSB 3QULB 2H2SC 4UOJA 1HHKA 2R0KH 2BRQA 4QNPE 4FXKA 4JDZA 3DURB 1Q0YH 2X09A 2CDEA 1F4AA 1OD7A 1DVFA 1E6JL 4M7ZB 5B4MC 2JCCE 3ULVL 2DQCL 1RZJC 2DLFH 5KZCB 2WBJD 2GK0B 1FZOB 4QWWC 1S7QB 4JZOA 3RZCB 2W38A 3CXHK 5D7IA 1HSBA 4P9ML 2CRMA 4PRNA 4ALAH 1F58H 3QIBA 4ZNCD 1ERNA 2CR3A 3HKFA 1HXYA 1U92A 5FCUH 4BZYA 3TBSA 3R1GL 1D5IL 2VDLH 5EPMA 1ZTXL 2BOBA 3S4SA 1EEZA 4XRCB 5FGSA 2JJTA 3ALXA 2QQLH 5D2LE 4ZDHA 5IW6A 3VFWB 5FKPB 5MEPB 4WW1A 3TBYB 2B1AL 1KCRL 1LEKA 1YY8A 5D7LE 3HC4L 3GRWH 4OAWB 2HFEA 4TQEL 1IAIL 1ZVSA 3V9FA 4DW2H 2L7UA 5JTWA 5K59F 3BAEH 3MBEC 1S9WA 2ZG3A 1XGTB 5DJ6B 2PO6B 3MGOB 4LLYB 4OBRA 4YDVA 5GRUL 1UH2A 3L5HA 1L9MA 3S35H 1NCNA 3JWOL 5E9DE 5HYSB 3QH3A 2JCCF 3FQNA 2IC2A 4HC1L 4YDJB 3QXAA 2DQTL 5SWZD 4RWYL 4M7LL 4M1GH 1FH5H 5D6CA 1ZHLB 2IAMA 2J8UF 5B39A 3QA3B 1G0XA 3GSOA 4PYHA 4K8RH 1IMHC 3BKCL 1CGYA 5IQ7L 4CW1B 5HVWA 4XPTL 2OXGA 3U4EB 4PJAB 5C0BA 4PJHF 3VGAC 2Q6WA 1MRFL 5C0ND 4PJXE 4JFXB 1JUFA 3IU3B 2D9CA 3BXNB 4LOUD 4BSVA 1V05A 1RK1B 2XXMB 5T3XE 3L3IA 5F96H 2HFGH 2NZ9D 1DBJL 3VI4F 2ZSWB 5GS0L 5GIRB 2W9LA 3NCYS 2LABA 3RGVD 3TV3L 4Y4FD 1IGTA 3QQ3B 5ITBH 4QRUA 3MCG1 4N9OB 1MRFH 5AUMA 3GO1H 3LZFL 1FCGA 3EO0A 1U6AL 4QRPB 3HE7A 1GAFL 4FFYL 1ZVHA 4NKMB 4QEGA 4XMKH 4U1MB 4LNVA 4HUUB 1DBAL 3FFCD 5IB4A 4UDUA 4QRQA 3LQZB 2YK1H 4XCCH 4NYLA 3IRZA 5LAXB 1U9KA 1AO7B 1F02I 1RVFL 5T5NF 5SV3A 3BWAB 1DQMH 4DEPC 3JXAA 2CDGB 2Y72A 4YFEA 4QRSB 1PW3A 3IJYB 4FRWA 4LHUG 4XP1L 3MJ6A 5DURB 3STBA 1QSFB 3EOTL 2HLFD 2HFGL 1LWRA 3BUYB 4XVJL 1R0AH 2NXZC 5E2VH 4HV8B 1ROWA 3MV01 1HSAA 4NZTH 4Z7QF 1A6VH 3U30B 3OGOE 5MENE 1GHFH 3MRRB 2R0ZH 3B9VA 1C08A 4MA3A 3I6KA 3MREA 4U6VH 4JY5L 3X17A 3QO0A 1P9MA 5CGYC 3D3VA 1E4KC 3OAZK 2R23A 2PYEB 3IVKB 3VXNB 3RA7L 4XBGB 1CFNB 5JQ6L 3PG2A 4BSVB 2R15A 1DBMH 1YYLL 2DQTH 4AEIL 1OF2A 1E4XH 4GXVH 3I6LE 4IOFC 1MLBA 1CXKA 5BS0A 4XRCA 4MHHI 2XY2A 4PJIE 3QJFB 3NIGF 2JK5B 1IGIH 1H5BB 5T5FL 3BZFA 4N68A 4OFDA 4UV7L 2FEEL 4HCRH 4MNQD 1U8KA 1ORQB 3MGOA 4P2OD 1RSFA 1BBJA 1QBAA 4G3YL 4F7CB 4HEME 1HHGA 3KG5A 3WFBL 1FZJB 4LPWA 4OT1L 2D0HA 4PREB 4LDLB 3BDYH 1VACB 1NC2B 1D7FA 2G75B 2ADFL 5JORB 1HHHB 3OWEA 3QHFH 4QOKD 5DFWH 4X6CB 3SY0B 3RVTD 4ISVA 4GAFB 1UB5A 5I15H 4R8WL 2WK2A 1AGFA 3FFDB 4OD2A 2MWCA 3BQUD 5FK9B 4D0BB 5L88H 1BGXL 2PTUA 3TT1H 4LLWA 3NPZB 4K8RD 4H5SA 1SM3H 3PHOB 5F1KC 2AEPH 5EBGA 1FC2D 4Z7VF 3D0VA 4MJIB 3EYVA 2Y7QA 1YEGH 2Q76A 1GGIL 3QUZC 4R7NB 4OSUL 4OI7A 3X12B 1JNNL 1XCQA 3DWTA 3LPFA 4U1SB 5IBLC 4LRIC 1P1ZB 4M03A 3TT1L 1TTFA 4K9EH 2HFFB 4RGOH 2FHFA 5JHDB 1R5IA 1NAMA 1DSFL 1ZS8B 4NRXA 4FQ1L 4PRID 1EEYB 2JE8A 5IGXH 3PE9A 3R4DA 3NFNB 5MEND 5DJ2A 1N6QL 2BNRD 5I8CA 3HFML 2D03H 2PR4H 4TUJB 4HZLB 4WDIA 1AGBB 4KU1A 4Y2DD 5IK3B 2IFFH 1OARH 3IDIB 2JJVA 4GW1B 1Y18B 4JM2B 4XP9L 5EIIA 1GPOL 1RJYA 2HKFH 2X4SA 2CDFA 3AAZB 3KPRB 4JG1L 4EVNB 5EZJB 4B41A 2NMSA 4HW6A 4GRLA 1EHLL 1JGDB 3KVQA 5JW5A 1T83C 3UPRA 2CQVA 3F12B 2DWDB 4ELMF 5AWNL 4KXZH 1QSEA 1NLBH 1FVDA 4MAYC 3MLYH 2V5SA 4F33B 1BQHG 2OR9L 4NPYB 1WISA 4JB9H 2OM5A 5JLZB 4JFEE 3MLVH 4JPVL 5SWSB 4JKMA 3ZT7A 2RCSL 5K9KA 3ARFC 3SKMA 1OL0A 2ZP0T 1TQBB 2W0FA 3KPMA 1JFQL 2B2XH 3TBWA 1OP3K 1MRCL 3LQAL 1VADA 1LO2L 1WGOA 5D2NE 1UKSA 3CVHB 1D6EB 1ZHNA 4XWGL 3ULVD 3OMZA 2QEJA 4OIAA 2FYYA 3B83A 2IAND 1FPTL 3MO1B 3QHZH 4M8VA 4OZFG 3EUUA 5B22A 4NC0B 3GB7B 1XIWA 4XCYA 3QIWD 1I9JH 4HWEH 5AD0B 5DJZA 4PJ8A 3D9AH 4WU7B 3CXHJ 1FL3B 3SCMA 3WLBA 4ZFGL 2V2WB 3ES6A 2AXGA 1HHJA 2C3XA 5CJ8A 5IB3B 4XI5D 4WU5B 3KPLB 5IJKA 3DX6B 12E8H 2GJZA 2ZUQB 4PTUA 3JUZA 2ESVB 4DQOL 5J8OA 1MI5B 4JFFA 2GCYA 3BGAA 3C6SB 1XFPA 4Y4HB 1I85C 1S7RA 1JGLH 3MJ9L 3VFRB 4LHUA 5FHAH 3VXRB 1T0MB 1TPXC 2YK1L 2M2DA 2NY5H 1FYTA 4X7SL 3A6CL 5HYFA 5BJTA 2YSSB 5E9DD 1JTOA 5KVEH 3SDYH 3U0WH 4YJZL 2NTSP 2UZIH 4WO4B 3LQAC 4WWKC 3REWA 5EU3B 2ADGB 2V9TA 4KK5C 3NFSL 1OCWL 3V5DB 1JPST 1UKQA 2VH5H 5DK2A 1MF2H 2KUTA 1F11B 4F37K 4EUPA 5HYSG 5FHBH 3CX5K 4U1GC 5J1TC 4G5ZL 3TV3H 1TZGL 1KNOB 2I07A 3UTZB 4BKLB 5GGQL 4LQ1A 3O4LB 3ARDD 2RGSA 1K5NA 5DJAA 4GXUN 4IEFB 1I1AC 5EUOA 4ODTL 3SE4A 4NQDE 4Y16B 5E1AB 5JPMA 2JB6B 2X05A 1EFQA 1GH7A 1JF6A 1M1SA 3PWPA 4YEEA 5I0ZA 1HWHB 3B8YA 1UEYA 4S1SH 1NFIA 4L3CA 5IBTL 2GTZA 3QEUB 2Z93B 5KANI 1KCLA 2AJSH 5DFTA 3BD5A 3QXUA 2AGJH 3HPLB 4PJCF 4X6DF 4BH7A 4RGNE 3MRPA 2ZNXA 1NAMH 3T4AB 1JYNA 2IH1A 5A2JH 2NY3C 2P8PB 1P4LA 4Z95L 3Q6GH 1JF1B 5C08E 5FF6A 3FCTB 2AXFA 3QEHB 3PWJA 2AQ1A 2F5BH 3DX9B 3H3KA 1BD2A 4R3SB 5ICZB 2ZUXA 1DCLA 1T03L 1BF8A 1QSEB 1Q9WA 3FAXA 5BZDB 3SKOA 2VXSL 4LLVA 1NEZB 4Y2OA 5D1QD 4OCYH 1NGQL 4PJIA 4YNYA 3W0WD 2GYSA 2IFGA 2X4PB 2OTUA 1FVEB 2EE6A 2H6PB 4OZIF 3PDDA 2ZUVA 1HNGA 3T2OA 5C9KA 4L8CA 4GSDL 2ICWJ 15C8H 3CMGA 2P1YA 4ONHA 1GZPA 4PJ9D 5DQDL 2PUQT 4YPJA 1U8LA 5FV1L 3OAUL 1LEGB 4PRPA 3BKJL 4WI8A 1HILB 3F62A 2RHEA 2H32H 3T0EE 4JDTL 4Y1AE 4P2RA 3NFPA 4N8VG 4LVHC 5GJTH 3FT2B 4HKXB 4MZ2A 3V7AG 2VN4A 5ALBH 2P7TA 3TIDA 2QHRL 4DGIL 3ES6B 2WBWB 3KPSD 1V3MA 1H3TA 4XMPH 4KZEH 4HBQA 3RUGA 2XIDA 1XGQB 3C6LB 4LCCA 3LVEA 3EO1B 5JO5B 3K8KA 5ESQA 1EZVX 5HHQA 4KHTL 3VXMD 4TRPL 4BZ1L 3PQYE 1WIOA 4HWUA 3P11L 4ZSOB 3TO2B 4FQLH 4PGBA 3KR3H 4XP4L 1WBYA 5EORH 4UAOC 3CDGA 4AT6A 5H37H 3FQRA 5EBLA 2VXUL 3KXFB 1YN6B 5TH2B 2NY6B 3HE7D 1SVCP 3PWLB 4QHKI 3P9LA 3ULVF 5CD3A 2AXFB 1GZQA 2AKRB 3N9GH 5INDA 5TFSH 5ABDE 5KG9A 5FDYA 4DUXA 4JPKL 1AGCA 3P40A 3MV8A 3CH1A 5ANME 1G7HB 4K3GA 4X4XB 2B4CH 5I18H 2VITA 1U41A 5DK3A 2VLKA 3RJQB 1A4JA 1NJ9A 5F6HJ 4XH2B 2PF6A 5CFHA 1J05B 3SDAA 1FV1B 1G7JA 1WWAX 4Z7NF 5FO8B 1QKZH 4CKVX 1JWSA 4UBDD 4XCEB 5E2TL 1KPRA 3INUL 4I48B 3GJFH 4J3VA 5J7CC 3BN3B 4I0KA 4XTRD 1CR9L 4MNHB 3V6BR 5H35A 5JR1L 1BFVH 1SHMA 2ATKA 4B7LA 1BQHA 3BUTA 3WLWC 4KY1H 4U6TA 1KLUA 4GRLC 3UBXA 1AY1L 4MYWB 5BO1H 3NZ8B 1KEML 4OV5A 4P5KB 1X9QA 2J6EH 3TLRA 1GYAA 3FCTA 1C5DA 1MFDH 1IM3A 4WTZA 1JWUB 2FJHA 4POYA 3V5KA 1KLGB 4DVRH 5CLTA 2NXYD 4G5ZH 4QYOA 4BSWB 5IQ9A 3DXAA 3VE0B 32C2B 3VG0H 3GSNB 3VWJC 1FVCB 4H1LH 4PJEA 3QAZC 1NLDH 1EXUA 1LEIB 1GVIA 2P8LA 3VXQB 1W72A 1FBIH 3BH9B 1EO5A 5T1KB 4FQPA 5D93C 4GFTB 1AQDB 2YKLL 3A67H 3U0WL 1CLZH 1VENA 5J1AA 2I5YL 3MRDA 2JELH 4Z7NE 4HLJA 3DGCR 4IHOA 4F2MB 5FYJU 1ZT4B 3C2SA 4WW2A 1T7YA 4BZ1H 4RFOL 4K7FA 1I1RA 4MD4B 4KTDL 3FO1A 4JQIH 3LKPB 4NWTL 2AI0H 4XAWL 3R0NA 5KOVC 3C5ZB 4KI5F 3WIIH 5C6TL 1JNHB 5GGUA 1KB5L 5F1NA 1ZA6A 2NXYB 4NC2B 4M93C 5IB5B 1E28A 4TUKL 5DJ8A 3P73B 5ENWB 3LD8C 3OL2A 3HFMH 3RBGA 3G9AB 5E2WL 1MIEL 1C5CL 5IR1A 1MFAL 2WWKT 2XWJA 4FP8H 3U4EA 3UPCA 3NZHH 3W5NA 2EIDA 3QDJA 3ZE2E 5IEKB 4Y5XA 4NQEE 1L7TH 1HXYB 1T5WA 4NCDA 2V7NB 1XAUA 4HDIB 2J4WL 1P84K 1TZHA 1INQB 3JTTA 5I1EL 4QCIB 5C2BH 3RWFA 5E5UB 3VFTA 3JV6B 4ZXBB 5AWNH 5EZOH 3CH1B 4J4PD 5D6DC 5DD6B 1H8OA 1AR2A 3IFPB 4U1IA 4B53A 5BXFB 5CINL 1BGXH 1VFAB 1OTUC 4N1EA 4TVPH 1NEZG 4LU5L 4ETYA 5DJZB 1T5XB 3MRIB 1S7TA 3FO0L 1SMAA 2EC8A 3U6RB 1Z2KA 4DKFH 3VH8B 4L4TB 4PV8A 1EIBA 3QIUD 3BSZH 2Q86A 2IADB 1G7IB 3SDXF 4PBWD 1BIIA 3DIFA 5HGBA 3CPLA 3FFCB 3P4MA 4KRMB 2HH0L 5IFJA 4XCEA 1T1XB 1KJ3L 2HTLC 2NY2D 5E94B 1RZ8B 2FCBA 5C6WH 1ITCA 1RUKH 4ODSH 4D0DA 1NKOA 1A3RL 4YFDB 3WD5L 4FQ1H 1X7QA 4F7MB 4G9FE 4QHUA 4MQ7B 1S5HA 3QCUL 3ARBD 1XCTB 4NRZA 3OKNA 3T1FB 4AEHH 5DT1L 2DBLH 4ODWB 5EOTA 2DB8A 2X2YA 4KK9D 1YEFH 4G42A 1C5DB 1QPPA 2ZSWA 4QRRD 1V5JA 2PTTA 2WP3T 3VXSA 1JPTH 2EICA 4J2XA 4Z7UB 3VCLB 1FN4A 5D5MF 35C8H 4K23L 5EUKA 5FKAA 3TN0D 2MKLC 3ABZA 3T3MF 4X6FA 1M4KA 1SEBB 1E4XL 4JJHA 3BGFB 1QR4A 2X1PA 3LQMA 1HK6A 3DMMC 5DK0A 3MA7B 1RK0A 3MRQA 4PFEA 3HNVH 3N1QC 1NAKL 1AP2B 1PGRB 2VAJA 2LAGB 3HAEH 2R23B 5DA0B 1RZIA 4D9LL 1FLRH 4NT6A 4KTEL 1KENH 3UDWC 5IV2B 1JRHH 4X0KA 2V9QA 4L8CB 1CLZL 5I1LA 3BP7B 3FTGB 4D9RE 3VFOB 2H41A 1KOAA 1U95A 3O8XB 1EERB 5FUCC 3E6FB 4XC3H 1NFKA 4JM4H 1E6OL 4Z7UE 4IRSD 4LHJB 4R26L 4EI5B 4OF0A 3L5JA 4IM8A 4DKAA 4ZXBA 1BM3L 5HHOD 4M3JA 4WHCA 4ZUVA 3SDDB 3GMQA 3IAPA 4RAVA 5ISZD 1YEHH 5SWSE 5DQJB 1IL1B 3QHTC 1CE1H 1N3NA 1BFTA 1S3KH 1AE6L 4PGDA 3R8BB 3GSUA 2E6PA 1W0VB 4OI9A 4YXLH 1FPTH 4KDTA 4PRHB 4Q97A 5ACZA 3MOAL 1ZLVK 2VDKL 3I9GH 3HI6L 3BT2H 3GMPA 4ONOA 2XN9A 4NGHL 4BZ2H 4U0RB 4N90D 1QSFD 1AGFB 3FOLA 4PR5A 3NCCB 1N2RA 2H3NA 2X4PA 3FQTB 1AI1H 5C09A 3LN4A 4NRZB 5KVFL 1BIHA 4HWBA 4AH2A 4FQXD 4PP1D 4K8RC 1OWWA 4G8IA 5MEQB 1KIRB 1BMGA 5EOTB 4WFHD 4P4KB 1F5WA 1MJ8L 4MVBD 1J0ZA 1IC5L 3GSWB 1TETL 4GAJL 4HF5H 3GZKA 1LO0L 5K9QG 1I7RA 3VG0L 1HILA 1TQBC 4HK3J 1ZWIB 1UYWL 1CFSB 4ZUSA 4Z7VB 3KPNA 4NQEA 2Z4QA 3HMXH 2XTJB 3MRFB 4KJQD 3K7UA 2AJZA 5SV4A 3BDBA 4OFYA 2HJKA 4M61B 5T1MB 3ZMRA 1TCRA 3O41B 4XNQB 1IAII 1MRDH 2R69H 4XPFL 2ZOKA 5JNYB 1N6VA 3FL7A 5TDNA 5C3LD 2OL3A 3D69B 1R6VA 3QQ4B 4OI8A 2AS5M 4KVCL 3FQWB 2C3VB 1FJ1A 4P46A 4JY6A 1W0WB 2VR9A 3W0WA 3AB0C 3DVNB 4K55A 1JJUA 3AS0A 4JM2D 4S10A 5HHNB 4MJ5B 1ZHKB 5E8PA 3IXAA 5ESVB 4GKOA 4LSTL 3VRJB 1I1FB 3BXNA 4JRXB 1BQLH 2Q76B 1FNSL 1V3KA 5K33A 2JJTC 4IMLA 1QYGH 3VGDA 5HSFA 3SDDD 5CZXC 3MRCB 2G60H 2XTJC 3QWQB 4R6UA 1VA9A 2E3VA 3TBYA 3JUYA 5I6XC 3ARBA 5CSGA 4OUUA 1MJ7L 3FOMA 3VWJD 1C5BL 5TFSL 2HVKA 5DQDH 5EO9B 4X4YA 5KSUB 4XVSL 3BP5A 3C2AL 4MJIE 4J3TA 2VXUH 4WI5A 1EHXA 4PB9L 4KZDH 4Y88A 3SDAB 1GXEA 3PHSA 3QUZB 5H2BA 4GMTL 3VXOB 4Y0GA 1E0OB 1BVKB 1WFTA 5IG7B 5AYUH 3V0VA 4IHOB 4WHYH 4ZTPH 4F2MA 5GSRA 4LHUD 3SCMB 4OCWH 3GSNL 1S9KC 1GOFA 4HUVB 3EYOB 2QADB 4HUMB 5D7JC 2ICES 4TRPH 1U36A 1I4FA 5EBMB 4TSAH 2ICWI 3R0MA 5K59E 4NCC1 4G7VH 1JE6A 1MCOL 2R2CA 3P9WB 1AHWA 1GC1L 5C8JB 4I2XA 5EC2A 1UM4L 4J4PC 3MMEB 3UPAA 5F7FA 3TWCH 1ETZB 4MAUH 4PS4L 4P2CG 4QRRE 3SKMB 4M6NH 2DQDH 2K9UA 4OGYL 2X9XA 3RA7H 5AUMB 1KCSL 2UWEF 1X5IA 3IFOB 4QRPA 4ALAL 5DHVB 4JPIA 1DUZB 2D7OA 15C8L 3HR5B 4TNWF 2AJXL 4NKIH 1MCPH 2Q3ZA 3HRZA 3OKEA 4XBPB 1G84A 4CU8A 2IBGA 1RJZA 3FONB 5I66B 4GW5A 4PRAA 5A2LH 4C4KT 4ZODA 4PLJC 4ZXBD 2AJYL 3GSXA 1PYWB 2XN9E 2GY5A 3SGDI 2AAVA 1RAMA 2X10A 3JV0A 3ET9F 5EZIH 4H88H 3H0TB 5GGVL 3DARA 1L0QA 1P2CB 2VLKD 4HIHB 4PJXB 4APQB 4CRPA 4FZEL 5LCVH 4JO1L 3C6SA 3P0GB 4LSSL 4E41A 2FEEI 4L29B 4JPWH 4O5LL 1A14H 5FM8A 3X13A 1R5VB 3TVMD 5BVJB 2C4FT 4JQVC 3MBEA 4HKJA 2FX7L 4LFHG 3ALWA 5BV7B 3RY6A 3WCYA 4G7YL 4NQED 3LIZL 4LSUL 4RNRB 4XVSH 3MZTA 2ARJA 4YDLC 2CGRL 3K4ZA 1FAKT 3H7BA 1FL6B 2F53B 3LKSA 3MNWA 3FRUA 4G8EB 3AROA 5L9DH 1UXWA 2CLZA 5GGRY 3QJHA 3JWNC 1UYWH 4NJ9L 4JFED 4H5SB 4OTXH 4HWZB 4M7JH 4XNUL 5B38B 3D0VB 4MJIA 5HDQL 5I1KL 3MPCA 2FLRT 2I26N 1RQ5A 4UT7L 2V2XA 4HFWB 5F96L 1TZGH 2ENSA 1FVEA 5I74B 2XICA 4OJFL 25C8H 4HG4K 3WL9A 4P5TA 4KK6D 1BAFL 3DBXB 5JW4M 2ZCLH 2D7QA 5L2KB 4OZGF 2DIJA 3LRGA 1RHHB 5IVXA 3B9KB 3DMMA 3FB8A 1U93B 4JN2A 4PV8B 1YEDA 4NGHH 1QLFB 4NHUB 3OJVC 3O2VH 1UZ8A 4KVCH 3WN5B 4R9HA 3D2UD 2MCPH 3T2QA 3GK8H 1RJZB 3FONA 3AREB 4LRNL 2Z91B 3NACL 1P4LB 2D7MA 2FL5A 2OR9H 1IAMA 4X7DC 3FQUB 1TPXB 2NW3B 1S5HB 3ILPA 4X99B 3UJIL 3V0AC 1KPVB 5IWLA 1QVOB 3O3DA 3H0TA 5D2LA 2ADIB 4N0CC 4F7PA 4YHPB 4APQA 1IEHA 5DSCA 5L7XH 1CD1B 1F6AA 1HINH 1P7QB 4JG0H 4MNGA 5TQ2L 1F45A 5CLWA 1QHOA 1HOCB 3DUSA 1R3LA 2PTTB 3SGJA 4J3XA 3GSUB 1ZSDA 5F9JA 5A16A 2UYLB 4JHWL 5D8JH 3N1FC 2OQJA 1BOYA 4PRBB 3UYRH 3KPQB 3SDAC 43CAA 4W6YB 5CZXD 5BV7L 2EH7L 3D0LA 1R3IL 2E7BA 4L5FL 4HIIA 3T0DA 2IPKA 4QXTB 4Y4KD 2V5RA 2I60H 2CUHA 2E8ZA 4PJ9B 4MLIA 2YD2A 2XKNB 4GS7B 1DUZA 3KPRD 4RBPH 4K9EL 4JZJB 3GUTA 4MA1C 5FOJA 5KOMC 1FC1A 3L7EA 3W81A 3SGDH 2VDKH 1WLHA 5J1SC 1NEUA 4GQ9H 4OZHA 3LHPH 3OKKB 2VR4A 3O81A 4K23H 3SDCD 5C0AA 4JKPH 1OHQA 4PJ8B 4GRWE 3MJGX 1OM3L 1CE1L 3PGCA 3ULUE 3D39B 4LGRB 5JOPE 3MYJB 1MY5A 4U05A 3ARXA 4YUEH 2NY3B 3CDCA 2E7CA 5D1ZB 2B7DT 4R26H 5D7KE 3VFPA 4Z8FL 5JIIA 4YX2H 2CRYA 2B5IC 1OARL 3WFCL 2VTFA 4ODHL 4UIMA 2VXQH 5IVOA 1FFNB 3LMJH 3P9MB 5A43C 2NY0B 1SJVA 5C0FB 1RY7B 2NLJB 4OCRH 2CLVA 4G43A 1FO0B 4IRZL 1CXLA 4PB0H 5FGRA 3RAJL 4Z8FH 1DL7L 4YHML 1LO3H 3E8UH 2EDEA 4LSPL 2YPKA 1A21A 4GG6B 2YPLA 1OAQL 2DWEB 4OAWA 5D1QC 3L3IB 2APVA 1GGBL 3AXLA 4N0YL 3E3QE 1H8SA 5JQHC 4PJEB 5CEXB 3GGWA 1GGUA 3EW3B 1KJ2L 1JHKL 2D4DA 5T1KA 4LHQB 4PJAE 5BCAA 2J1KA 3O3AA 4O58H 3DRQA 2YPVL 3B2VH 4P4KC 1WCQA 1QUNA 2VDRH 1GGYA 1OSPL 4JFEA 1UM6L 2JIXA 2P5EE 3VMPA 1KG0A 3S37X 2VZUA 3BZ4A 4KVNH 1LK3L 2GCYB 4M43L 5CJOL 5CBEA 3RWJA 1IEAB 5GGRA 2FATH 2DTSA 3PGFH 3SKJH 3ZLQC 1NGYB 4P2OC 2ADFH 5FYJE 4PRPD 2YWYA 4ODHH 2X6MA 4U6YA 2VXTL 3EKCA 5IMMB 4PLJD 3VD5A 4F15C 1X5JA 3ZL4H 2P8MB 2X89D 4M6OL 4I0PB 4X99A 1NCCL 3KLAB 4DN4L 5GGTL 3RIAK 1UVQB 1V7NH 1A47A 4NO2A 3VI3F 4M8QA 3RWHB 1MWAA 2XXCB 3MJ8B 3MLZH 1U2HA 1AHWB 4K2UL 4U1LA 5T3XD 1B90A 3VFVA 4Z5RB 3UTPD 3ZKND 2GW5A 2XWBA 3M17A 1FNGA 1PFCA 2OTUB 3GMLB 1DQLL 1AGEA 1A4KB 3OGCB 4NUJA 1WK0A 1WCBA 2NX5A 3A67L 4LSRL 3GIZL 1IVLA 5B8CC 1EUTA 3FB6B 4Z0BH 1N5AB 5I75B 1A8JH 2R0ZL 4LPXA 4P2QA 2P47B 1A7QL 1DFBH 1U8QB 2D31B 2ENYA 3C5ZD 4OKVA 4JREB 3RVTC 2EXYD 4CMHB 2DI9A 1QSED 2G60L 1JCKA 2JK5A 1YDPA 2VABB 3GJFA 3ALPA 1YMHB 1KB5H 5KTEL 3PXHA 5L7XL 4OGAC 4OIIH 4K94L 4ZFOA 3DIFB 2XZZA 1NGXA 2BVQA 3MYZA 1RIHH 3ZTNL 3LH2H 3VXUD 1N64L 2HKHH 1I8IA 1T1ZA 5EC2B 2IH3A 4Y19A 3B2UC 5KANG 1JGVL 1J9CT 3KNBA 1RUPL 2CUIA 3KLSA 4PG2C 3PWVB 4HK0A 3V4PH 1NBYB 4M7LH 3UC0L 4WUUE 1CLOH 3K46A 2AJVL 4KXZI 3HB3D 4TULH 3KXFA 1SY6H 4LGPB 4WEBL 4LAJH 4JO1H 1CVRA 4K3JL 5I8EB 5EU6B 1VKXA 1U8LB 4KKAC 1BZ9B 2ZCLL 2R1WB 4H88L 3EYVB 3OX8B 4FTVE 4QHLA 4AG4L 4RCAA 4LF3A 2QQLL 4HH8A 4GW5B 3VRIA 5HHOA 5HVFB 3PWNA 4L4TD 3BEWB 5E00B 1RZ7L 2GIYA 3WS6C 2J6EL 2B1HL 4P4RB 5HTSA 1RJCA 4KK8D 2X4QA 2AJXH 3E2HC 3QDMD 4AYFA 1YEJL 3CK0L 1KB5A 2EYRB 1KG0B 4NNXB 2PETA 4N0CD 5E8OA 1F58L 3LN5B 4IMKA 2KQNA 4Z7WA 4P9MH 1IEAA 4RAUA 5GGRB 1QO3B 3P11H 4ZO9A 4GW4A 4MQ7A 4WWKB 3QG6B 1GOGA 1A7NL 1Z6JT 3G6AB 3MBED 2G2RA 1X5FA 4O5LH 1CG9B 4L9LC 5EBWB 1RUMH 2NQCA 3QXVA 3KLHD 2BHZA 3LOWA 4N5ED 5DVOA 3HE6B 5LCVL 4FTVA 1IC1A 1Q0YL 1YECL 3QR2A 3TN0B 1R5WB 1KPVA 4OLZH 4M48L 2R0KL 4JFXA 5DD5L 3GI9H 4TSAL 2R4SH 2Q20A 4X8XA 4ORGA 3T0EB 2UY6A 4WY7H 4S1DD 3WUWG 4EJ1C 3FT3B 3WNPA 3OAZH 3RGVC 5GS1B 4JFZH 2NY4D 4HK0B 4L8SC 2A73A 1CFVL 1BF2A 1G7LB 4E5XA 4P4KA 4UOW1 3VFOA 5GGTA 1KENL 3D0LB 1IZJA 3MLWL 1NANI 1FIEA 3GHEH 1YQVL 1NGQH 2BVOA 3LKNB 4ZAKA 1ORSA 3TF7C 4M1DL 4XGZB 3NZ8A 3D2UA 4YHLL 3ULSA 4PJGE 5IB1A 3QUML 5CIPB 5GRVK 4P2RD 1N5YL 5CILL 2VABA 1YECH 4UUJA 1FNAA 2Z91A 3RIFK 5T3ZE 5FYLD 1AR1C 3G5XB 1JWUA 2FJHB 3TPUB 2UV3A 1MHEB 1M6OA 3NA9L 3RWIB 2F54E 4FNLH 1IGCH 4P2QD 5MI0C 1Q9LA 2JTDA 1FDLL 1KULA 1U8OA 2ESVA 5D72H 4R0LB 1QFUL 1HHIA 2BJML 3CFJB 4Q74A 2VZSA 4TNVF 3VXTB 3K3QA 4PLKC 5F1OB 1FZKA 3MO1A 1KCKA 1YA5A 3TJHC 5KVDL 3PDOA 4OD2B 2Z8RA 1DEDA 3ZKXC 4NC1E 4U33A 1A7RL 5C07E 1J5OH 3V6OC 1RZGA 3RIFF 2NY1D 2DWEA 2VLMD 1DQTA 2VDQH 1AXSA 1NGPL 1ZEAH 3STZB 2GJZB 5M95B 2IPTL 2VN7A 3U2SA 1BJ1H 3RL1A 4GKNA 4WUUA 4PJFA 4GKSA 4F80A 1HQRB 4PJCB 4X6DB 1G6VK 4KI1A 2VJXA 3I6LD 2QSCL 2R1XB 2MQ0A 4YBQC 4NO0A 4F7TB 4Q2ZB 4HGWA 1TJIL 1ORQA 3HG1B 4I18B 3LSOB 4J1UB 1AQKL 4NWUL 5CP3A 4EDWH 2AV7A 1F97A 3O4LE 4X7CC 1KT2B 3RPIA 4Y4FB 1C5CH 1JL8A 4CADA 1BX2B 1PEWA 4EUPH 4QRTB 4NQDB 3VI4E 5DZOA 1IFHH 3VFMA 4JE4B 4HULB 3LH2L 4Z7QE 4TUKH 2ARWA 3LKQA 5F9AC 5DJXB 4BQ9A 3QIWC 2VDML 3OB0H 3S96A 3CLEL 1DANT 5DYOB 3SGKA 3PWPE 4ZUWA 4G6JL 3KLAA 4PJ7B 3GMMB 5F7WC 2BVEA 2GK0A 2EDQA 5ESQB 5K9QI 1LHZA 2IG2H 3GSVA 4WFFD 4QO1A 4PJIB 4YNYB 4ZFFA 5BS0D 1IGML 4X5WA 4AK1A 3UJTH 2XWBB 2EDBA 1G9NL 1H3XA 5JDSA 3PIQB 4KKLD 4S0TD 1K8DA 3QQNA 5L0QB 5FO7A 3S4SB 1YEKL 1GZPB 3WFEL 5E56A 3MJ9H 2GEEA 3MLSL 2P5WE 1X5XA 2R2BB 3EJYC 4KGLA 3P4NA 1PYWA 1KIQA 1YPZB 4MJ2A 3V2AR 3MOAH 3D85B 4NJAH 3UTSE 3L3GA 3P77A 2D31A 2XA8H 1WT5A 5E2UH 1KJ2B 1WVZA 4RMQA 5BOPA 1I9EA 3IETA 4FQCL 3GJFK 1BREA 1OAKL 1DQJB 3DYPA 3HZYA 4MAYB 5HPMA 4WTXA 5E4EB 3TYFA 5DI8B 5I1IH 2HT2D 3G04B 5I71C 1NCWH 1Q9LB 2O5ZL 2P5WD 1S7QA 3RBSA 5GSVA 5C0JB 4HKJB 4Y1AB 3BE1L 1I1AD 2YD9A 5C0GA 5T1LA 3C8DA 4PJ9C 1WZ1H 4ZO6A 2CIIA 1ND0A 3O2DH 4HMEA 2P45B 4MD5B 5F9DC 3PV7A 1G9EA 1JVKA 3WUWA 4AQ1B 1JUFB 2I25N 4IRJD 3ZYJA 4ZO7A 1A1MA 4I5BB 3H9SA 5ICXB 4UU9A 5TPWH 4J8RA 2BNQD 3D39E 4JGMA 1A7OH 3VWKA 2F19H 3CNKA 4YHKH 4X98A 4FFZL 2V2XB 4YFLF 1HEZB 1IILE 1K8IB 3L95A 5EU6A 3HNVL 3KYKL 4P57B 4OF6A 1D5MA 1EJOL 3RGVB 2IALA 1SMOA 1NGPH 1IGFH 1ZEAL 4H20L 5SWZA 1I7RB 1C8PA 3QI9C 3GSNA 4NNYB 1H8NA 3U0PB 4LFHD 1UZ6F 4HS8L 5L2KD 1LEIA 1S7XB 4LNRA 4BKLA 3THML 5CEZH 3BGMB 2D7TL 4TSBH 4JAMB 3QISA 1QFWM 3DSFL 3DHJA 4H26B 4Y4HC 3I50H 2XQYG 3KS0J 4URTB 4PYGA 3Q1SH 2BFVL 2JIXD 2JF1A 1F4XL 2PR4L 1GJIA 1FAIL 3U7AA 4JY6B 2NY6C 3WJLA 1Z9SA 1CD9B 3K1DA 1MFAH 4NFCA 3X3GL 3H7LA 5CBAA 3W9EB 1BQHB 3EJJX 3UTTA 2UZYB 1A6UL 3QXDA 1N2RB 3A0OA 4MQXC 5AYQA 3BWAA 3WMSA 3KWWA 3RTQC 1QEWA 5TF1L 2MQCA 3Q1SL 4HUWB 5DD5H 1AD0A 4GRWB 4ETQB 4HIEA 4UB0H 4F9PA 5DSCB 1T7WA 2DKMA 5DFVD 2DKUA 1KC5H 1F2XK 3S7GA 1J18A 2K3TA 5IW1B 3F58L 4MCZB 1BZ9A 5CILH 1IBGH 5EZLB 1ZT7A 3VE0A 3H9ZA 3KPQA 2ZOLB 3DVFA 5CUSH 4XZUB 4P5TC 3BW9A 2O61A 3KDMB 4ONFL 4MQXD 3CLFL 1KACB 4QTIL 1B0GB 3BYYA 4Y5XB 1BVLA 2HTKC 3V52L 1IT9H 3L3JB 3RDTC 4R8WH 3O41A 2D3VA 4WI3A 2EH7H 4XNQA 3UBXB 2VLLB 1G6RL 3G5YB 3BZDA 4QRQB 5KS9B 2DLGA 3I84A 4XPBL 1L7TL 2UY7A 3FB7A 4PRHE 3EYQC 5KSBB 3T0VA 3L95B 2YA0A 2BRRH 5JIPA 3H9SE 3RI5F 1JTTA 5KZCD 5FECA 4DUWA 2AJUL 2BMKA 5FYLE 5T3ZD 2Z31A 1FL5B 4FQ2H 5GRVL 3SKNA 4HSQA 4M48H 2Q8BL 4XP5L 3VWJB 1OB1A 2VDMH 3D5OF 2Z35B 1HHGB 3W2DH 4ELKA 2H26B 4KMTL 4LRNH 5D71H 5F7KC 1XEDA 3QCVH 4C56E 1WICA 4LPUA 4MDJB 3F65A 1A6AB 3BRGC 1RZ8A 2WWMD 5D7LA 1DN2A 2MSPA 5IFAH 4LCCC 1YZZA 1YNTA 3UTSA 3M8OH 4ZSOE 4FN0A 4JDVA 4PJDB 5BOZG 2ICCA 4ZUTB 3SE4C 4Z6AT 2XG5A 3FQRB 4NQXA 1G9NH 2YMXL 4Y8AA 1PY4A 1CDHA 4KROC 2ESVD 4MNQA 5E2VL 2B0SL 4Q0XL 4Y4KB 2ERJB 3I75A 3ZE0F 1FBIL 4JFYB 1MAJA 2AV1B 4N5EC 4UT7H 1CYGA 4N9GA 3BQUB 2OR7A 2Z8SA 1CLYH 1LE5A 4ZO8A 1J1XL 2IG2L 5EH1A 2ZJSH 4FZ8H 5D70L 1QOKA 1SYSA 3S3SA 3KYAA 3NIFE 2DM2A 3LD8B 3MV9A 4KRPD 5F1SA 5EU7E 5EU4B 1OCWH 4NZJA 5IESH 3BZ4B 1QZ1A 1CF8H 2EEBA 2J88L 5DHXB 5EWIL 5LWYH 3DRTB 1CDIA 3CPLB 3BO8A 4OM0H 1OLZA 2IBBA 2HT3D 2GITA 3V4VH 4BQBA 4TUJA 3SY0A 1ZA3A 2APWA 4P46D 3RPKA 4YBHA 2AK4B 3QDME 3S35L 5JXEC 4HBCL 4H8WC 4PGBB 5GRUH 2VLJA 4Y4FA 3KWWB 4L4TE 5C0DB 1ZLWH 1TFHA 3ARWA 1IRAY 5TDPB 4ZFOL 3NA9H 1RIHL 3ZTNH 5A2IH 4LVNB 4V1DA 4CL7A 4NBZB 1T89A 3LS5H 4X9HA 1PBYA 5BXFA 2Z35A 3HNSL 2FECL 4NN7C 2Y5EA 4NM4H 1P9MC 4P9HH 3HNTH 1SJXA 1VFBB 1TITA 2JB5H 4WWKD 4ZQKB 1DBJH 3HB3C 3HI5L 4MCYB 5LG1A 4M1DH 4YHLH 4C55A 3QYCA 5B8CA 4Y2DA 3WXVH 5DVNA 3OAYK 2CMRL 5F1IA 2F5AH 5ACLA 1N0XL 1WWCA 3IDGB 4WVRA 3G5YA 1FH5L 5I8CB 4GSDH 2APXA 3PHQB 4O4YH 3FB7B 5EO0B 4OQ1A 2FSEB 3G5ZA 4JFZL 4J1UA 3DV4A 4F58L 3B4NA 1C7TA 2HJLA 4CW1A 3NMEA 5MENA 1WV7T 4FS0A 3MROB 1MHCB 1NCTA 4MWFB 3T3PE 2NY0D 2OCFD 2EDRA 1MCOH 5DD3L 5FM5O 1NGWA 1UM5L 1G6RB 3DX6A 5EC1B 2EIZB 2Y07L 3AMKA 3ULVC 1JPFB 1A2YB 4P3DA 1DR9A 2QHRH 4ELKB 4MXVE 1RD6A 2Y23A 5J11B 1JNHA 2D0GA 1MI5D 5BZWA 4PG2A 2DQIH 1S7SA 3DGGA 3IKKA 2OXHA 3EJZD 4H0GA 4AJ0A 1F4YH 1FNGB 2ITDB 2VQ1A 4JFQB 5I30L 4G6AC 2ZUYA 3W39A 4J3WA 4QXGL 4YWGL 4A2MA 2A6DA 2YSSA 1JZ6A 4DCQB 3EAKA 4YXHL 3H9HB 4LLQB 1KTKE 3BIKA 4PGZA 3SKJL 1RUQL 3CMOL 1YMMD 5IMKA 4X8JB 2HN7B 1ZHNB 1A6PA 1XF2A 3WIHH 3TN0C 1XGYH 3FJTA 5C0CE 5IB4B 4NKOA 1T22B 5CWSB 3B2VL 5EOQL 5HI5D 2QKIB 3RNKB 5LAXA 4IMLB 4MB5A 2YXFA 2V7HA 4JKKA 1VSCA 3RKPA 5DJAB 3C8HA 4HFUL 3C5JA 3HLAA 4FA8A 5ID0B 3ARBC 3C60D 1BQSA 3L3DA 5E00A 3SJVD 4X6BA 2W07A 2BVTA 5B21A 2ITCB 3LHPL 4WU5A 1UWGL 1JZ7A 2EYRA 1OTSD 3PP3K 4X6EB 3EZJB 4WFEE 3LN5A 5FYJD 2OJEA 4JRWA 4JGJA 2F19L 1MHPH 4YHKL 1HNFA 5DJ0A 2I60L 5TPWL 1NAML 1OVZA 3S88L 1WZMA 5DO2C 5D8JL 3WSQH 2D7PA 3RVVC 2X7LA 3J8F7 2CSPA 4KROD 5EU3A 3L7FA 1H5BC 4OLYH 5E1HB 1K4DB 2FH8A 1PSKL 5FM5M 1JHTB 2ID5A 3GSRB 3RWDB 5E8PB 5F9WC 4G9FB 1O7SA 5LXGL 1OP5H 1G6RA 3EOBB 3BZEB 3UTPE 4DKDC 1XMWA 2J5LB 1H3GA 1CFSA 2ZKHL 4P3DB 4ORGB 1PQZA 3OKKA 1V7ML 1QACA 5ICYB 3LAFA 1CTNA 5EU6D 4O2FA 4PRIB 3MFFA 2K1MA 3VFGH 2Q7NA 3K1KC 4B5EA 4YK4C 2X9YA 4LCYA 4UILL 4KC3B 5TDNB 3MYJA 1YNKH 3FQWA 1NFDB 5KVFH 2VKXA 2GJ6D 4ZMAT 4JRXE 5B4MD 4MXWL 4Z0BL 1PEZA 3EO9H 1O0VA 4WWKA 4XGZA 4YQXL 5FEBA 1BZ7B 2G2RB 1IM9B 4ZNEE 5J9PB 3Q0HA 1VGEH 3O0RL 1EEZB 5FA4B 4QKXB 1JGLL 4OJFH 2FX8L 4U6YB 3DYOA 3UJTL 2F53D 4OM1L 1U0QA 4MX7A 4XCFH 5HGAA 4PG9A 1LDPH 3CFKB 4OQTA 4TTDD 5J6HB 3GMQB 4YDKL 2YD5A 4WI6A 1INEH 5HHMD 3H42H 4L3EA 4ZXBC 1G7PA 4R0LA 4G8GD 5LXGH 2FWOA 4GAYA 5HY9B 1CD8A 1UXSB 5CJBA 2A83A 4XC3L 1OAUL 2V5YA 4L29A 1UH3A 2PYFB 4E41E 3HC0A 4MSWA 4X9BA 3CGTA 4LP4A 5C9JA 2JLLA 5TQ0H 3S8WA 1YJDL 1B3JA 1X5GA 1JTPA 3Q3GA 4X5XB 2XZCL 3MRQB 1B0RA 2CRZA 4RZCB 1YNTB 1HZHL 1SVZA 1J1PH 1ZAGA 3UTSB 1RZIB 2ATPB 2B2XL 2VL5A 3GMNB 3CD4A 4MXWH 4ZAKB 5JW3H 3RWJB 3QJHB 1PY9A 2VKWA 4L9LA 1GL4B 2DAVA 3MODL 2YPVH 3GDBA 1FQ9C 3CAFA 3O11A 1H15B 5DWUH 1F3JB 1PG7L 3ZYZA 5D7KD 5GS1C 1N6UA 2V6HA 1FO0H 3U2SB 3QFDA 4Z7OE 1OP9A 1Q72L 2ORBL 5CKAA 2FLBT 2EYSA 1YEGL 5KAQG 5HHPA 1EAJA 4K3DH 3WKNA 4N0YH 2GSGA 2HFEB 5FECB 5FGBA 1HI6B 1LP9F 3QIUC 3RWIA 2AJ3A 4U0QB 1JGDA 4KMLB 5IF0B 4U3HA 3FAWA 2BMKB 1I3RA 3SGJC 2C1OB 1NGXB 2DMCA 1V7NL 5D1XD 2WIIB 3I3BA 1VGKB 2VDOL 3ILQC 4KGJA 3A6BL 5EU5B 1FSKB 2R29L 4X83A 1QQDA 2A9MH 1WBYB 2BDNL 3X13B 4YGAB 1BZ7A 4YHOH 1T21B 1RZKH 4M5YH 3RWGB 3T0EC 3KLDA 4KI5C 4KPHH 2X7LB 5C7XL 5K9JH 1A6AA 4WIQA 5CJOH 3BSZL 5FYKH 2WUCH 2QHLA 3BKMH 3MNWB 4MA8L 2DQIL 3FB6A 1ES0B 3OKYA 1UXWB 2JJUA 3S35X 3PJSA 2QLVB 4PY7A 4Q9CA 2YPLD 3L9RB 5IUSA 3CVHH 1BWWA 3NN8B 2ZNWA 1CS6A 2EXWC 3OJMB 1JNNH 1GIGL 3HE7C 3SDDC 2OSLA 2F74A 5JW4R 1KELL 3EO0B 3VG9C 4N1CA 4PLKD 3QUYA 2WBJA 4OCWL 4J3SA 3QPXH 4KFZC 1CK0H 5GRZA 3BEVA 4M7KL 2R0LL 4RFNB 5HYJB 1DBML 1YYLH 4KV5E 2R2EB 2DQHL 2HJFA 2ERJC 3FOMB 1A1NA 3Q5OA 5BV7C 1ZGLM 1MFCH 3ESVF 4PTUB 4V2CB 2R2BA 3UROR 3U36B 2DYPB 5GGVY 3QIBD 2GTWA 4KRPC 3CCHA 4JY5H 4JZJA 2GUOB 4WI9A 1HXMA 4OCRL 3G6DH 4GO6B 4G6FD 4K9EC 5E6IB 3QG6A 2IJ0C 2XZQH 3QEQA 2VLKE 3DROB 3UZVB 1MLCB 3VXOA 1SBSL 1FE8L 2OJZL 3IKCB 3CZJA 4M6NL 5CGMA 1ACYH 2Q8AL 1EFXB 1TDQA 5D1QB 1QSFA 1H5BA 5A1AA 1TJHH 1J12A 4PJFE 3AUVA 4RQQB 2CRIA 2DRUA 4PJ5B 3PXJA 4YDKH 4NHCL 5C0JA 3D18A 4NZDA 2KBGA 3O6KL 3DURA 3QO1B 4RDQF 2DDQL 3ZKXB 5C6PB 3VXQA 4HLZG 4ZNEA 5F9JB 3QDJB 2YD3A 2COQA 3AY4A 4LCUA 2OQJB 4BA8A 3MLTB 4XXCC 5FDWB 3ZSSA 3ARZA 4MA3B 1NBVL 3OG4B 4BFGA 2DQUH 2RR3A 3NIFF 4KV5F 4OQTL 3BPNC 3L3KA 2FX9L 3C08L 5E8OB 3D48R 2HVJB 4LKXB 5IVZA 1KTDB 1IC4L 3U4AA 4NN6B 1BVZA 1W72H 2BC4A 4XB8A 5I76B 2HA1A 3JV6A 4ZOBA 1C5BH 1BAFH 2ZPKL 4NZTL 1FORL 4HXAH 1A9EA 3KLHC 4DGYH 1MCNA 4C58B 5GGSA 1QFWL 2EYSB 5DUPH 1LO0H 3X12A 1JPGB 2DIBA 4ZDHB 2NCMA 3DNKA 3L5IA 1HDMA 3U0TA 1MHCA 4W70A 5E5RB 1YPZF 5I1HL 3VFUA 2BCKA 4LSTH 1KJMA 4ONGH 1DJSA 4XNMB 3ELAT 1P2CA 3JWDL 4D9QD 4K3EL 4OUOA 4R4ND 1QQDB 4EN3A 1T6WA 1VHPA 3LKRB 3NACH 1ZGLP 4DN3L 3QXDB 1CXEA 4K3HA 4Z76A 3LKOA 1F8TL 3IDNB 3FQXB 3W39B 4L8DB 5A2KH 3L7EB 4N8VA 3H9SB 1B9ZA 1U3JA 3WDIA 4H8WH 3JVGC 3D6GA 1YEIH 2XNAA 2YEZB 3CUPB 3BMVA 1AKJA 3FRUB 4QHKJ 2GSIB 4GXUM 5FKAB 5C2UB 2HKHL 3PHOA 3KJ4B 3NN8A 3RTQD 1UWGH 3UPRB 4R7DA 5D5MA 1AGCB 4N8CH 3HRZB 1AJ7L 5LQBL 5C3TA 3T0XA 3M45A 4YEFA 2CKBL 4L1HA 4XNZC 2VZOA 4JDZB 6FABL 1MH5A 4FOMA 5KTEH 4X7FC 4XVUD 4IBLT 4KQ4L 4I3GA 4KK9C 3GSXB 3WS6A 5D9SB 2UUDH 4I8DA 3WHXA 4KI5E 1F2QA 3W5MA 3FN9A 3B2UD 4XH2A 1FYTE 1JGUH 3EYUH 2C4FU 3PP3H 4LCCB 3PF2A 3T3PF 2CJUH 1LNUA 4NO5B 1DUYA 5HGGS 1T1XA 4O9HL 4B50A 1PZUB 3I2CL 1IT9L 5EORL 4NBXB 1T89C 2ZG1A 4FQLL 4BUGA 4K8RL 3QIUB 1HSBB 4XNXL 2GT9B 3QRFM 4QHNB 1BQUA 3L1OH 3UP1A 3F12A 2NY1B 1JPGA 1UM4H 1J8HE 1OTTD 4Q58C 3RFZC 4MCZA 4RMWA 4IRJC 3CDYA 5INDB 1LQSR 1Q0XL 3LB6C 1JBJA 5L8LB 4JVWA 5J6HA 3O3AB 4NCC2 3CSBA 3K4DA 4WW1B 4KKNA 4EZMA 3I3EA 3GSVB 3RVWC 4F3FA 1NCCH 2KZ1B 4ZOAA 3TFKD 1M7XA 3CXDL 2FD6L 3MLXL 3S37H 4OCLC 2PYFA 1S7VA 5C9JB 5FCUL 4NKIL 5I19H 4YHOL 3RNQA 3RIAF 2WINA 2Y9RT 4JANB 2F5AL 2CIKB 2XG4A 4OIBA 3D3VB 3VXSE 4JM2C 4Y89A 2D7TH 4AM0B 4KJPD 5DEGB 3BH8B 3NIDF 5HGHB 1KF9B 3LV3B 1D5XA 5I1GL 1AR1D 4DZ8A 3REVA 1DDHA 4CAGA 4I0CC 2F15A 1EH9A 4MAUL 1AO7A 3VRIB 2Q3AA 3LKQB 3LRSB 1KELH 5HHOE 3VFNA 3HNSH 4XCNB 1A7OL 3RTQB 5DYOA 1LVEA 2ZOKB 5JNYA 1IE5A 4V1DD 5KSBE 4LPTA 3PWUB 2DLIA 3QQ4A 5DT1H 1CVSC 1JK8B 3MLRH 4XPGH 2NYYD 1ZGLB 3OXRA 1CQYA 4HS3A 3BKML 4LARH 4WNQB 3S9DB 5B38G 2PW1B 1T0MA 5K9JL 1A6ZA 2BNRA 3G6AA 4N0RA 2BVYA 4IJ3C 1T2QH 3WEXB 1QRND 4MQTB 4OGZA 4KI5D 1I1FA 3T2NH 1NCWL 4O00A 5KJRH 5IM7A 1QLRB 2E9WA 2PW2B 1FL3A 5TDOA 2O5YH 4HQQH 3X11A 3CVIL 5GS0C 3THMH 2NW2A 1WITA 3PJSB 1Y6KR 2KDGA 3H42L 2HLFC 4EUPB 1PKQB 1GC1C 4L9LB 5FYLH 4L8BB 3IDMB 1KB9J 2Y06H 4M6MH 5C0RL 1ZANL 3ARED 3EDDA 1KSRA 4N5UA 4DUVA 1YEEH 3QWRA 3VXRE 5EZOL 5KSAB 5KSVA 5D7JD 1UENA 4JFFB 5HI3C 4U1JA 1S7TB 3MRIA 3WV0A 5IFHL 2GTZB 3QEUA 4DK3A 4G9FD 3WFEH 5IHUH 2EDKA 3HZVB 3PWPB 5I17B 4PJ7E 3G6JE 3QDGE 5HPOA 2D2OA 2YKLH 3HPJA 1I75A 1R5IB 2VSDA 5AAWA 1NCBH 3EYOA 4W6WB 2BNQB 4WGWB 5I8EA 5I8OL 3BT2L 3RRQA 3BE1H 1T2JA 3F5WA 4YIQA 3MV9E 3HZMA 3AGVA 1DANU 3SDCC 2EIZA 2IH1B 4NSKA 2EDHA 2AEQL 1RMFL 2W9DH 4Q6IC 2FO4B 1DBBH 3VWKB 5ADOH 1UH4A 1MFDL 3PV6B 2A77L 1R5WA 3QRGH 4HWBH 2YZ1A 3BEWA 4P57A 4LLWB 3ZDYF 1A7PL 3OQ3B 2BERA 1JV5B 4M8QB 2AERT 1G7MA 4RFNC 3UJIH 5DRZA 4AQOA 4QRRA 3EZ8A 3I02A 1E6OH 3QO1A 3NH7H 4HD9A 4R2GC 5DJYB 4ELME 5F1IB 4NPYA 4TUOB 1K4CB 2WBJB 3IDXL 3BWUC 1JYWA 4OLXL 4GW4B 1P69B 3INUH 5J12B 3HUJF 3MLPA 4K71C 1ZHBB 1P1ZA 3TBSB 3OZ9L 5E99H 5MERB 3WXWL 3J7HA 2EYTB 3IDXH 5JXAL 2AKRA 1BD2E 1FZMA 2JCCB 2DJUA 5BMFH 3B5GA 1C1EH 5F89A 1FGNL 4JCLA 1CFQA 1UG9A 1RU9L 4PGCB 3KYNA 1RIUH 2NPLX 8FABB 2CXKA 2G9HA 5GXBB 1EHLH 4W4OA 4RMSA 2O5YL 4HQQL 3V6FA 3VFNB 4NRYB 1NMCC 3VFSB 1ZXQA 3TO2A 3SO3C 5L2JA 4U6XB 5F3HA 2AEQH 5FOBA 5EIVA 3TEUA 1FN4B 5GZND 1J05A 2CK0H 2BY1A 4NO2B 4MS8C 1BD2D 2BCKB 4HGWB 1CDJA 2H32B 3EHBC 3V79C 5L9DL 5D7JB 3MLUL 3T77A 1DTUA 1HE7A 1CE6B 1CXFA 3RPIB 4PRNB 1UCBL 1MFBH 5HHXL 3UTOA 2A1WH 4N0FB 5SWSA 1OGTB 4OD3H 2ED8A 4NQDA 1UT9A 2VERN 3KNBB 1CZ8H 2O93L 5C09B 4KHTH 1A1OA 1JRHL 2D4FA 1JYXA 2NTFA 1IGJB 5DR5H 4BFBD 5DO2D 1L6ZA 3F7YA 5I1LB 5JHDD 1NBZB 5IHUL 4MNQB 4X4XA 3ULUF 1I9RL 3OKDB 3IDIA 4JFYA 4EBQH 1YUHB 4FZEH 5F21B 5I76A 3KPSB 5JXED 3DUUB 1YEEL 4U2YA 4AZ8A 2X70B 5HYQB 1EJOH 1NCAL 2HT2C 2H9GA 5E08H 2F58H 4HIHA 3TZVD 1A7RH 1DQQA 1EBAA 2CO6B 4IRSC 5J56B 1MCKA 4QY8B 5C0BE 5EULV 2X89A 3SJVB 4NKQB 1MFEL 4DOHB 5D9SA 3WHXB 3CDGB 3HI1A 2JB6A 2CR6A 4R2GB 2P24B 4P48A 4HPYL 3VI3E 1YC8A 1XT5A 3M1BB 4OV6F 2AV7B 5KW9H 3FN0H 2IH3B 4XHJC 1KBGH 4HJJH 5HGAB 3KYOA 1CFQB 1FHGA 4UT9L 4Z0XA 4WUKH 2YUXA 5DD0H 1Y6NR 2Q7YB 3FQXA 3AS3A 2H8PA 4P5TD 1IGYB 5D96B 4GG8B 3GI9L 5F9OL 5EUOF 2LTQB 4N8VB 1MUJA 1Q0XH 3VXPB 1C16A 3QZWA 4Y5VA 3TH2T 4PJEF 4ERSL 3W82A 4F7EA 5IB5A 1CDCA 4OCSH 1B6UA 2XWTB 3DTXA 4PRDA 3AB0B 5F9OH 4OUUB 3I6KB 1OTTC 3KPNB 4U49A 5IR1B 3ZSTA 1QRNE 3BH9A 3F7VA 5DRNA 4HUXB 2PYEA 2WZPD 1NUDA 4ZFZB 2H6PA 1PKOA 2NY2C 3NAAH 1S7RB 3WNLA 2EKJA 3B9DA 3U9UA 2J12B 1TZHB 4OZHB 3MV8E 1KB5B 3IU4L 4UTBH 3AVEA 3BD3A 4JEGB 2X4TA 3LS4L 5JA8B 2EEDA 5D96C 5J3HD 4AIOA 2ADGA 3KPSE 5DQ9B 2ED7A 3RHWF 3QDJE 2KQMA 5F6IB 2DS4A 1D5ZA 2X41A 2FIKA 4NRYA 4YPGB 1NDGB 1RVFH 3MACH 5DD1H 1X4YA 4ZPTB 3HC3L 2FBOJ 3DX8A 3OTTA 4XCNA 3S97C 4FQJL 4Y4FC 5DJ8B 3MRCA 2IQAA 4ACPA 4J3OC 4JQXC 4DFHA 1IKNC 2X1QA 1XF1A 1CLOL 4OZHE 1LD9A 2A6DB 1N26A 2NZ9C 5D1ZD 2WLYA 5ESAA 1MEXH 3E2HB 4OB5H 3VG9B 5I73B 1XF3B 1URLA 4X4MA 4K3EH 2VDPH 4F9PC 1B88A 3FO1B 3W0WE 4P46C 12E8L 1YEJH 4DZBA 3K74B 1JGUL 5TH2A 2NNAA 1KB9K 3OR7A 4AY0A 3HMWL 2YWZA 3UO1L 2E9BA 1U8HB 1M7IA 3VDCA 1OGAB 4DGYL 4NDMB 1BIIB 5HGBB 5MEOA 2H9GB 3TBTA 3REVB 4NOBA 5DEFB 5C92A 3FO9A 1ACZA 1J1OH 1UB6A 3UO1H 2XY1A 2EZ0C 1JYVA 2G5BB 5BMFL 2NR6C 3BPOB 5KVDH 5F70A 1IC5H 2KKQA 5L8KB 2B0SH 2IEPA 3GIZH 1IC7L 1FCCA 2QL1A 3EYFA 5CP7B 3QXAB 4JO3H 1R24B 4XHQA 4YAQB 3V4PL 2YD1A 3IKCA 2DD8L 1AI1L 1RULH 3QNXA 3ARDC 2IMNA 3IFOA 4AMKL 2EXWD 5IHZA 2NY4B 1FL6A 2F53A 3LKSB 3V4UH 1NLBL 2W60B 3T1WA 4OZIA 2J6EA 3B6SB 3RQ3A 1U92B 1A7BA 5EA0H 3FT4B 1C16B 1QD0A 1YN7A 4K94C 1AE6H 3TBVB 4Z18A 4KH2A 4CU7A 3RHWK 4XP9H 3EBAA 4PRHA 4HJGB 1I9JL 5CZVL 1B4JH 4U1HA 4NUGL 4Z7OF 5LGJB 1MELA 3FHQA 1KJVB 1N4XH 5C08D 4IIQB 1G7HA 4GRWF 1ZT1B 3UDWA 1BM3H 2P49B 5E2JA 3TBWB 4PJGF 2FATL 4IDJH 4JM4L 5CS7A 1S9YB 4XWGH 1XGTA 3MLWH 4X5WB 4RGND 4BH8B 1Z0NA 3V95A