3BGFC

X-ray crystal structure of the sars coronavirus spike receptor binding domain in complex with f26g19 fab
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
211
structure length
210
Chain Sequence
DILMTQSPSSLSASLGERVSLTCRASQEISGYLSWLQEKPDGTIKRLIYAASTLDSGVPKRFSGSRSGSDYSLTISSLESEDFADYYCLQYVSYPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYEHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords Spike protein S1
publication title Structural insights into immune recognition of the severe acute respiratory syndrome coronavirus S protein receptor binding domain.
pubmed doi rcsb
source organism Sars coronavirus
total genus 52
structure length 210
sequence length 211
chains with identical sequence L
ec nomenclature
pdb deposition date 2007-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07654 C1-set Immunoglobulin C1-set domain
C PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bgfC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bgfC01
1MAJA 4G7VL 1QFWH 3MRRB 4ODUB 3CFJB 4JPIB 1N8ZA 2FIKB 4U6XB 1U91A 3HNSL 1NC2B 3UPRA 1R5IA 3GSVB 4RAVB 2NNAB 3LZFL 2FYYB 2AEPH 3OKOA 3S35X 3UJTL 3WXVH 4Y2OA 3TJEL 1S3KL 3EFDL 4YXHH 5HHMB 5I8OH 1NJ9A 1A02N 3OR7A 1AGDB 4WWKB 1IAMA 2Q3AA 1MUJB 3OB0H 4XTRC 4S2SA 5D7KE 5INCA 5DS8B 1LILA 1A47A 4ERSL 5HHOE 1ZLSL 4RQQA 1HQ4A 4ZPTA 3VXSD 1JP5A 2G2RB 1TQBC 4U3HA 5MEPB 1WCBB 4JFHD 2CDEA 3DURA 3I3EA 1KLGB 2DD8H 2KH2B 3KR3H 1QKZH 1FLRL 3FQTB 3GMLA 3DVFA 5CSZA 3FT3A 3SGJC 2A6JB 3O6KL 4UUJB 5C2UB 3G6JA 1AGEB 3C60C 4Z7WF 4YXLH 2DWEB 1VADA 5F9OH 4NZDA 5D2NA 5GGQL 5C0GB 3MV11 5D93B 4BFGA 5C9JA 4N5UA 1AQKH 5IMMB 3H7BB 3GJFB 3BEWB 1F4YH 3WLBB 3QIBB 4RA0C 3HLAB 1EDQA 2AV1B 5I1DA 1JZ2A 5IK3B 1SJEA 2VAAB 3T2PA 1NBYB 3BGMA 1FO0B 3LPWA 1J8HE 3LRSA 3KLAB 1H5BB 3FRUA 3MJ7A 3DO7B 3LKNB 2P47B 2J6EA 3BO8B 1G9EA 2AQ1A 1JNLH 5GRWA 4R90L 1RZJH 4G7YH 3DECA 5HYFA 1F3DJ 2D2OA 4TQEL 1P5VA 4JVUA 4DQOL 4LCUA 5KSBA 2HT3C 3EOYG 4XZUB 4G9DA 5KVFL 3GUTA 2B2XH 3SDDD 1FFOA 5IVXB 1MI5A 1BD2B 5C08D 5E7BA 4X7SL 3MNVA 4LHUB 4MDJA 1RHHA 3LKSB 3S88H 4WI9A 2XWJA 4PB0H 3WS6A 2GJ6E 4IRZH 1F3JA 1IAIL 4GBXB 5LJYH 1QTYT 1KC5L 5AZEH 4XHJD 4XMKL 4F2MB 2N7AA 3L6FB 4C56D 1LDPL 1JJUA 3VFVA 3KYKL 4X6EA 4C83B 3TP4A 3H0TA 1SHMA 4P2RD 2L7UA 1TNMA 2EE9A 2IPKA 3VFSB 4N9GA 3OTTA 5CD5C 4JE4B 2APTA 1K4CB 1N64L 5GSVA 2BMKA 3QG6A 4WO4D 3HFMH 1JPGB 1T80A 1BF2A 4U0RC 2HFEA 4HUXA 5DK2A 2ZCLL 4PTUA 3BOVA 3VFOB 2YWZA 3O0RH 5TFSL 1NC4D 4QTHB 3UTQA 1HHJA 1OSZB 3T0VA 4F7EA 3RIAK 1YYML 2BY3A 3NGBC 3UTSA 1IGFL 5CEYA 1ZOXA 4ZD3H 4P9MH 4CMMA 3QXTA 3OX8A 5B3JF 2NX5A 5A2IH 1A6WL 5FHBL 1K5NA 3H3BC 3X12A 2XN9E 4YDLC 5I75B 3AU1B 5TE6L 2KBGA 3H8NA 1ZK9A 2VLLB 3U0TB 3C6SB 5KSVB 4XPAH 4GRMA 4FNLH 4PLKD 1K8IB 1KJ3H 4RFEA 1A7PL 4NQSB 4TULL 4PRNA 1INQA 1KLFA 3WIIH 3EKCA 4P2QA 2VITB 4FABL 4PJXB 1M05A 4JO1H 3V8CA 3AB0C 3VA6A 3CFEB 3BZ4A 3UROR 2AEWA 4OD2A 1CD8A 5C0BE 4P46C 3W9DA 1G7LB 3KPRB 4YGVA 3T0EC 2CLRA 2NYYC 1WISA 1UXWA 3TYFB 1FVEA 1MCOH 1RURL 2VC2L 2X1PA 3TN0A 4M1DH 2W0LA 4KKCD 4KMTH 3WNOA 2OI9C 5GJTL 5IFJB 1HH9A 4N1CA 2FO4A 1KNOA 2LFGA 4ZPVB 1S7WA 3PHQA 2DMKA 3GMOA 5D72L 1C16B 4DGYH 1MEXL 5D7KD 5IWLC 2Q3ZA 3BKJH 4G43A 4AM0A 1G0XA 1UM5L 3V0WL 5EU3A 4CVXB 2JIXA 2JB6A 1W0YT 1NAMA 3TJHD 1T0PB 4GO6B 4EQ2A 4YHNA 5D1XD 2VLJB 2F8XC 1S7QA 5T3ZH 3QIWD 5H37H 5EIIB 4K7PL 3I02B 3STBA 3ULUD 2IAMC 1UC6A 3RVWC 4TUOA 1Y6KR 4G6AD 2R1WA 3L7EA 3VRLE 3JWDC 3E6HB 1O7VA 1KPVB 3GMNA 5CSGA 1RJYA 4NWUH 5DDHB 2E6QA 3PE9A 3DI2B 4F37K 3QDJB 2X4UA 1QRKA 2CSPA 3CH1A 2F58H 1S7VB 1FBIL 1XCQA 5DT1L 3L3HB 3C09C 2KQNA 5L0QB 5KANG 3TA3B 3QI9D 2CIIB 4PJAE 1M7IB 3WEXA 1ZMYA 4MJ5B 3WV0A 2GCYA 1RMFH 2EXWC 1J8HD 4ODSL 5GRZA 1T5XA 5IHUL 3OPZL 1FIEA 4N8VA 1OGAE 4L3AA 2Z92B 1NFIA 5DFVD 4PP2A 3ROOB 3RWFB 3WFHA 3HS0B 1OTTD 5DMIH 1TMCB 1XGQA 4YHIB 4HG4K 3VWKD 1JNHA 4GRLB 4K9EC 1KELL 3MV9A 3HI5H 3R06A 5M95B 3GMPB 3ULSB 1F5WA 2CGRH 2FJHB 5CBAA 1WZ1H 3SDXF 2CDGA 4OLXL 1MFNA 4MD4B 4G9FB 4NO0B 1E4XI 4JQIH 3RWDA 5IFAH 5EO0A 1N6QL 4HJJH 4K7PY 3B5GA 3D25B 2GJ6D 4X5LA 1N0XL 5E0QA 1ETZB 3FN3A 4R26L 1D5IL 1JGLH 5M7QA 2NR6C 4S1DC 1FSKC 5GRUL 4P5TD 1DN0A 4MD0A 5E9DE 5ABDE 4W68A 4OFDA 2D7TL 5EU6A 4FN0A 4TUJA 2DF3A 3JVGA 3PV7A 4PJ9B 1YEFL 3PWJA 3UYRL 1MWAH 2A0LD 3ARDA 1I8KB 4G6JH 4LIQH 3R1GH 1Q0YL 5F7NC 4NPYA 2W65A 4NT6A 5EU5A 1RU9L 1CCZA 3D3VD 1YZZA 5TDNB 5FKPA 3C2SA 35C8L 2AW2A 2CLVA 1ORSB 1ZLVK 4P4KA 5I1IH 1OOAA 3AMLA 3GSNH 3PWLB 5J6HB 4OM0H 3MLXL 1CE6B 1WTLA 4XC1H 2UWEF 4XP9L 4ZFOA 3BQUB 1DQDL 4A6YH 3WDJA 1S9YA 4U1SA 1H3WM 3PHSA 4RA3A 3V0VA 5L9DL 1CICA 5IGXH 4X8JB 2C9AA 1ZGLB 3RA7L 1WIOA 3MYJB 3V4PH 1YN6A 1KG0A 1KXVC 4FZEL 3BSZH 3B9AA 4Y8DC 1RK0B 2XWBA 3U7WH 4DVBA 4LLVA 1DFBH 4M3KB 4LGRB 2GEEA 4LOUC 5HHVH 3BD3A 1KBGH 1LO5A 3QO1A 4NRYB 3RGVA 3V6FA 4LARL 1JIBA 1DBBL 2PW2B 3GRWA 3QIBC 4M7LT 3ILQC 2OQJB 5E5MB 1MJJB 4ZMAT 1PZ5B 1T83C 4LEXH 4Z7VE 1I75A 1U58B 3OR6A 4LU5H 1KUMA 1AXIB 1HSBA 1MFDL 3QRGL 4BK4A 4RDQG 3C6LC 2R0LL 5DI8B 1J0YA 5HDQH 5C0BD 2ADJA 5JPNB 1H5BC 2HKHL 2FBOJ 4JGUA 3MOAL 4NBZB 4JQXC 4BK5A 2KPNA 3B5HA 4XB8A 1JF6A 1NCDL 4K3DL 2PXYC 4OZGB 6FABL 5FO7B 5MP6H 1EZVY 2QHRL 4YBQD 4NUJA 1VFAA 2GHWB 3G5YB 4NQVB 3FO0L 3C9NA 1A9EB 5F97E 1NEZB 4C56B 3V4VH 5BV7C 3ALPA 2VUOA 3KPSA 2X1QA 4N0UA 3S4SG 2G60L 2JE8A 5D6CB 1Q9KA 2SEBB 1QSFA 4GBXC 5E4IA 5D7JA 1BBJB 3ZHLA 1BFVH 4ORGA 4IDJL 1WBYA 3VXOB 3PABA 2WM0A 4WO4B 3T08A 1RZFH 4KJQD 2ICEB 5DVLA 2YC1A 2ZUTA 5L8LB 3V4UL 1CGVA 1WEJH 3K80A 1G7JB 1L9NA 3GMMB 4HC1H 4NCC1 3OKMB 5KN5A 1P53A 4RMQA 1ORQB 1UB6A 5JHLL 1G7IA 4JQVA 1TQCB 1NC4B 1B2WH 1UJ3B 2X9YA 4KJYA 4KWUA 5GGSB 5D5MB 4LFHG 1INDH 4NNPH 5J1AB 4ZSOB 2DKMA 3LKQA 2DTML 4M1GH 3MRQA 3B8YA 4OF6A 4J4PA 2ZG2A 1BEYL 1B0RB 4PJFE 1RI8A 4L4VE 5FUZL 4ONFH 2IALA 4PJ8B 5ID0B 1F45A 2DOCA 3RDTD 4N0YH 4X80L 4ZS7H 3HZMA 1FVCB 5ENWA 1ZVSA 2UY7A 2YD5A 1OGAD 3GEWB 2VDKL 1Q9WA 2CKBH 2EEDA 2ITDB 4E41E 1T20A 1LO0L 2E27H 1SBSL 4WUUE 4GKSA 4XNZC 3SOBL 1LP9B 1PSKH 2NY6D 3BH9B 3GBML 5E8PB 3U7YL 3IGAB 3V52H 4AIZB 2IMNA 2P5EE 4JFYA 4MWFA 2O5ZH 3O3AB 3TCXA 1UH3A 1HXMA 5C09A 2WBJC 3GIZH 5I15H 4PTTB 1FL6B 4UT6H 3O9WB 4PV8A 3NFNB 2D9CA 3QQ3A 5ESQB 4QHNA 3ZE0F 3K4ZA 2APFA 4V1DE 1ED3A 4CBPA 3PQYA 4PUBL 4LSTL 4MXVF 4POYA 5HYEA 2EEBA 5TQ2H 3FMGH 1E27A 3MRHB 3GNMH 3H3KA 5EU4A 2HTLD 4OFYD 5E7FA 2DTSA 3MACH 3QIWB 2LU3A 2WUCH 1HI6A 5IT2L 2GT9A 2IANB 4DWHA 4QHKJ 1YEHL 1ACYL 1O0VA 3WHXA 3GSXA 1WFOA 4H88L 1JPTH 4P2OC 5GJSH 3N1FC 1G6RB 2JTDA 4U2YA 2P5WE 1KPUA 4P59H 1KFAH 4PJEF 4HCRH 4LAJH 5I1GL 1J10A 5DO2C 1JWUB 3EYFB 4J12A 3S96B 1NSNL 1K8DA 3B2UD 2VQUA 3QHFL 4JG0L 4O2EA 4LLQB 3P4NA 3ZDZE 4X83A 4U1NA 1MNUL 1Z9MA 4YHLH 4ZS6C 4UOW1 5BRZB 5B4MC 1INEH 4D9LL 5FYKL 3G04A 4MQXC 5B38G 1AFVH 3OKEB 4G80B 1NANI 3V6OA 2HRLA 3WFCH 4O4YL 2HT4C 4G6KH 4KI5C 3TM6A 3TA3C 1HKFA 1J05A 1XIWD 3O4LE 1IQWL 4X6CB 5C0AA 4DKDC 5FO8B 4P23B 1I7ZA 3U83A 5FOJA 1R3HA 3WL9B 1G0YR 2DQCL 3VGBA 3NFSH 2VQTA 5HVFB 3K2UH 3RWCA 1LEKB 3N85L 3T65A 3UBXI 2VN4A 3BZDA 4EDWH 5FFLA 3PWNB 5E94B 5I0ZA 4HBCH 1A7RL 5MEOB 1MFEH 2PYEA 2OTWB 1AY1L 1I85C 4UU9A 2JJWA 3HC0B 1F4XL 3FONA 4IRJD 1KCUH 2BOCA 4H0GA 5DC9B 3WMSA 1EEZB 5TE4L 2ID5A 4QXTB 3D3VB 5F1IB 1U8KA 2OSLB 1IL1B 2R15A 1B6UA 4BFIB 5IV2A 3LEXA 5GRYA 4JR9L 2I9TB 2Y36L 2R29L 3JWDH 4WHTB 2WWMD 1P1ZA 1J88A 2Z91B 1CK0H 3A6CL 2AK1L 3STLA 5AD0A 3QUMB 4RMVA 4K94L 4UB0H 1MH5A 5I9QB 1U8PA 1WC7B 4IIQA 3ZYIA 3ZYJA 5FOBA 3OKKA 1MOEA 5DVOA 3MCKB 5EORH 3EOBA 3PWUB 4K3EL 3LN4A 4LPXA 3IFNL 1R3LB 3QWQB 2CMRH 4YNYA 4LPVA 4KUCF 2D31B 4HHAB 3ULVL 3C2AH 5L2JA 4D0DA 4WW1B 2VDPH 4YAQB 4GG6F 5DHVB 5KVMC 1YEEL 5I1AA 4Z7WA 3VGAB 4S1QH 3KVQA 1G7HB 3RX8A 4GAGH 3QIUB 4KY1H 3BD5A 3W9EA 2EYSB 2W0PA 1EEYA 2XZCH 4FQIH 3VXTA 4E41D 4OZHF 3IU4L 1T7ZA 5ADOH 5DEGA 3WFZA 3MRBB 1QBLL 2DI8A 4WUUD 3C08H 4N8CH 1VDGA 3U4EB 2RR3A 1JMXA 1A4KB 3DI3B 2FWOB 1CU4H 1DQML 2VXUL 3BKML 5ACZA 3NZ8B 5IMKA 3MJ9L 1XF2B 4XCEB 4L1DA 4Y4HA 1JZ5A 1BQLL 5JTWA 3ZTNH 5EO9A 1QBAA 1UKTA 2D7PA 3BKYH 5T1MA 3NCJH 5FK9B 4MJIA 1E6OL 4U6HA 4I3SH 2VLRA 5I74B 3F6IA 4ZTOH 1IBGH 1LWRA 3SDDC 5F9JA 3TBSB 5TF1L 3QCTL 3UBXB 4O02L 2V2XB 3RVVC 2Z8SA 3T4AB 4LLWA 3ZE1E 5MEQB 5JZ7D 1ND0B 3TBTA 4EKXA 5HGDB 3V5HB 4XHJC 1LK2B 3JUZA 3IDXH 4JDZA 3RWJB 3VCLB 3CVHA 1FNGB 2HWZL 1I1AD 2A6KA 3RKPA 4MNGE 4W70A 3MV7E 5F7WC 5I8CA 2V7NA 1CDCA 3PP4L 2LAGB 4OJFL 1P4IL 3L3OA 4QRPE 1CS6A 3NCFB 1EXUA 1TVBB 1OSPH 3O2VH 3UAJD 3V5DA 3OB8A 3EJYC 3VH8A 4CN1A 1UZ8B 3NBNA 4EN3D 1JN6B 1XR8B 4U3CA 1BLNA 3X3FL 1X7QB 5ERWA 1OAZH 4U1HA 2EKSB 1CLCA 4NO3B 3RDTB 3HMXA 1I3UA 4WFGE 1RAMA 1SJXA 2AABH 4DOHB 3BVNA 2G9HA 1FNSL 3BH8B 4YDJA 2WSKA 2IJ0C 4KGJA 1HINL 1NBVH 3K4DA 3O4LD 4MJ4A 3DMMA 1OP3K 2NY6B 1UACH 3RAJH 4POZD 4PLKC 3JV4A 1GOFA 5IQ9B 4LPYA 2UUDK 3TH3T 4O51B 5ANME 4F9LC 1Q38A 1MQKH 2VQ1A 4HDIA 5EBMB 3WO4B 4YHZH 5K59F 5F9WB 4HUUB 4GKZB 4WU5A 1GPOH 4N9OB 2FLBT 4R96A 4K55A 1UWXH 3N0PB 1DLHA 2Q7YA 5BV7H 1IT9H 1I1YB 1RZ8B 2BCKB 4ZNEE 5D2LF 4ZUWA 3QJHB 1BVLA 2HKFL 4KKCC 2ATKB 2BVQB 3EFFA 4O5LH 4QOKD 1HOCA 3NCEB 4MDIA 4ODVL 2I5YH 2DRUA 4M6MH 3OJDB 3B6SB 4HF5H 1CT8A 4P9HL 1A14L 1D6EB 3PV6B 1HNFA 2FH6A 1X5JA 1XF3B 4BZ2L 1ZHNA 2XQYG 4LLYB 1KIQB 2CKNA 2H6PB 4V2BA 4Z7QF 3TJHC 5T5NG 3E8UH 1A1NB 1HKLH 3DRQA 5D1XC 5EC2B 3QIWC 3HZKB 3QEHB 4MJ6A 4MQ7A 3FT2B 3VXRB 5F96L 4F8TA 4KZEH 1EGJA 4EI5A 5CMAB 2GSIA 3DLQR 1MCWW 4B7IA 3IVKA 1H9VA 1U3HA 1IZKA 4G6AC 4JM2B 4HUMB 2DS4A 3NTCL 1NLBL 1UWGH 4GAYA 1JGDA 1VA9A 9CGTA 1MCSA 1RUAH 3UO1L 1AQDB 3CFKA 3DUHA 3BP7A 3WIHA 1UT9A 1QEWB 5SWQB 2CRIA 1PKQE 3BT2L 5TH2A 3C5ZB 1S9XA 3QI9C 3SCMB 1XIWB 2XYCA 4FFYH 3IKCA 3HC4H 1AJ7L 1A3RH 1JZ3A 4WDIA 1B4JH 1X5GA 4XP4H 4X6DB 3VFMA 4WEBL 4RISH 5HHPB 2NXYD 1IGML 4PJ5B 1A3LL 1R5IB 1S7SA 4IHOB 5KJRH 2QQQA 3EOTH 4FQ2L 4GS7B 1MCLA 1PZUB 4OGXL 1OTTC 1MFCH 2DLIA 3VWKC 3VW3H 3BYTA 3MXVL 4OIAA 1CXHA 1JGUL 1MCBA 4WHCA 3TC9A 3LIZL 2OL3A 4J6RL 3BAEH 5INCB 5J1SC 4FZ8L 4BYHA 5AYUH 3F7QA 3RGHA 4O2FA 2ZKHL 4AG4H 1YMHA 3SDXA 2E7CA 1CGWA 1HH6B 4HLJA 3L5IA 3DURB 4M62L 3BKCL 3D87B 2R1YB 4P5TC 4F58H 3GMLB 3CPLA 2X2YA 3GB7A 5CSZB 3TESA 3QFDA 1CL7I 3G6JB 4XAKE 5FHAH 3GMQA 2A0LC 3MV7D 3I6LD 3S5LB 2EYRB 1VADB 1VEOA 3VD3A 2QQNL 4PY7A 4Y5VA 4NKDB 1F6AB 4EJ1C 3B3IB 3TZVC 3RUGA 5C9JB 2ORBL 3I50H 5HGAB 1PG7H 4H0IA 4YJZL 5FGCB 5CJBA 5JW4Q 4OCXL 5C6WH 5I1DB 4Z8FL 5JDSA 1I4FA 3MLYL 4BH8A 1Z5LA 1K2DB 2GFBA 1C5BH 4PRBA 3FHAA 4BSJA 2NTFA 3ES6A 5CP7A 3G08B 3MRCB 2MJWA 5IB4B 4JO3L 3RWEA 2RHEA 5BQ7A 2QJDA 1U2HA 3RVTD 4OLWL 3I3DA 2A9MH 2V7HA 4LCUB 1A6PA 4JREB 4L4TD 3P0VH 2DM2A 4NSKA 2XG5A 4G9DB 2YUVA 2NZ9D 1QOKA 1FFOB 4R7DB 2YPLA 4MDJB 1RHHB 2RFXA 1G9ML 2APWA 2Z4QB 3D0LB 2XWJB 4B50A 1DVFA 4DFHA 1F3JB 1MPAH 3CDCA 1XT5A 1MHCA 2CDFB 4HUKB 1JGVL 4QYOA 1CR9H 1ZEAH 1AP2B 4X6EB 4XMLL 1A4JB 4OCWL 5F3HB 1E4KC 3P9MA 4CMHB 4Z0BH 2EDHA 4EVNB 5EZIH 4AT6A 2FX8L 2VSDA 4KZDL 4YX2H 4C55A 5D7IA 3VDAA 2VDLH 2BMKB 2M2DA 3MLRH 5CZXD 1U8MA 1TTGA 1JYVA 3V2AR 4OCSL 2MPAH 3MGTB 3PP3H 4XXCC 3T0DA 2FR4A 1QLFA 1T66C 1KB5H 4HUXB 1U2CA 3LPGA 2NY5C 3V5KA 5JW3L 1E4XL 1P9MC 3RZWA 3S36H 2EDXA 5I18H 1UEYA 5EO1A 2YPVH 3CFDA 1LO2L 3UTQB 3CMOL 2MKWA 4PJ7A 4Y4FC 2LQRA 4UQ3B 3SDYL 4OFPA 2WUBL 3O3UN 3I9GL 2BSTB 4F57L 2GJJA 4KJQC 1JL8A 2O5XH 3OX8B 4Z7UE 4X7DC 2NX5B 1FORL 2H45A 3KYMA 3X12B 1QFHA 3IAPA 4HD9A 3BDYH 3DRTA 3DARA 4AH2A 3GHBL 3QUXD 5DJAA 5DRNA 4XPGL 4KTDH 2Y5TA 1F42A 2KDGA 5DFWH 4PBVC 3PWPE 4RFEB 5ESAB 1JFQL 4LRNL 3VD5A 3Q1SH 1RUPL 1Z6JT 2IGFH 2V2TA 5KVGL 5ITFA 1X3DA 4W81A 2HVJA 4OAWA 1MAMH 1N2RA 1MHHB 3WNLA 1GOHA 5I1CL 3HPJA 4JDTH 1HSAA 3ZKSD 3MGOA 1I3VA 5CCKH 3BZ4B 1P7HL 2FX9L 3G5XA 3DWTA 2XG4A 4NFBA 1JYXA 4G5ZL 1JPSH 2MHAA 4NNYA 3W5NA 5SWSA 4YGAB 3W9DB 3WSQL 3O3EA 4W6YB 2CQVA 4P57A 3OL2A 1LNUA 4MA1C 4TSCL 4AIOA 1XGRA 1HH9B 3FJTA 4GW5A 5ACMA 4OCLC 3HB3D 4YHYB 1BJ8A 2FO4B 1KNOB 3O8XA 1R3JB 4N5ED 1GZPA 2PO6B 1S7WB 4JRXA 2NY6C 4RGOL 3AM8A 4NCC2 3QYCA 1KIPB 1T04A 1R5VA 4RGND 4URTB 4U1LA 4OLYL 4AM0B 3DXAE 1KTLB 5CGMA 3WO4C 2W38A 1A5FL 2JB6B 1QUNA 3BP6A 2ZJSL 3MBED 1IRAY 2LTQB 4QOKB 3W81A 1JZ6A 1FGVH 5EBGA 4QT5A 1ZWIA 3L9RA 4QCIB 2EDEA 4PRIE 3HN3A 1JHKH 4GKOA 1W0WA 4XAKD 2R8SH 3JZ7A 2R1WB 4WNQA 2EDBA 2AXHA 3GMNB 1J1PL 2A6IB 2HTLC 4P5KA 1OGTA 2V5YA 5E1HB 5GGSY 3KXFD 4NYLB 4XPBH 3WD5L 3CH1B 3GKWL 3DSNA 3QBTB 5DSCB 1XCQB 5EU7E 2NXZD 2WLYA 2ATPB 3P4LA 3KPLA 3HRPA 4MNHA 4PR5A 3ULUL 3LKRB 2Q8BH 1D5XA 4ZFFB 3UJTH 1S3KH 3TO4A 5ELIA 5HHNA 4TNWK 4PJHE 1G6RL 3R8QA 1QFUL 4J8RA 3ZT6A 4N8VB 4FG6D 4XNMA 5HGGS 4XNYH 3B2UC 1UJTA 3AS2A 1I8IA 2DJSA 1CDGA 2PYFA 3OQ3B 4R4FL 4WRLA 1ZLSH 4ERSH 3MLVL 3MV9B 4LPUA 3GGWA 4I2XA 4JFDA 4KRMB 3SDAD 4KHTL 1YEKL 4XH2A 2ILLA 5CBEA 1HNGA 3BEVA 3F7YA 4LNVA 5ISZD 1FLRH 5D1QA 2NXYB 1A64A 2FATL 2R1XB 2PTUA 3L3IA 4OSUH 2IBGA 2Q7NA 3Q5YA 2YRPA 5FIEA 5DD6A 4NO5A 2UV3A 5TQ0H 4A2LA 1XIWC 1R24B 1XZ0A 1P4BL 4XCFL 5IB3B 2IFGA 1T1XA 2D7QA 1G9NL 2CJUH 1DN0B 1P84J 5DEZA 2WP3T 4BH7A 1LDSA 3KPPB 4UNTA 3CXHJ 3ARDB 2ZUQC 4GS7C 4Y5XA 1EA9C 4MLIA 5DC4B 4Q9QH 3HI1B 4NPYB 5HYJA 3SE9L 1JRHL 5EU5B 5GS0D 4NP4H 1I7UA 5FKPB 3QEQE 2CLVB 4ZAKA 2A73B 5L2KB 4P4KB 4KK5D 4BQCA 3LV3A 5FM5M 3VD9A 1GGBH 5FYLL 3SKNA 2E3VA 1OP5H 3GIVA 4IRJC 3ULVF 1WITA 4XRCA 5EOTA 1L7TL 4AIXA 4EUPA 5C0FB 4R90H 4RFOH 4TQEH 1G6VK 1A9BA 4DQOH 3REWA 3QWRD 3E0GA 4MX7B 1ZANL 3O6FA 3WNKA 3MNWB 3ZHKA 3ARED 5KVFH 4O2CA 3RWIA 1JE6A 2E9JA 3VD4A 3LMJL 1RIHL 3HR6A 2WWMC 4I1NB 4X7SH 4BFBD 1U8QB 2V5RA 5IF0B 3BHBA 4LPCA 4LLVB 4UIMB 4Z18A 4QHKI 1LO5B 1RUMH 3PWPD 1KJ2A 3QUML 3S4SA 4NO2A 3FB7A 1KC5H 4XGZA 4XMKH 1I9JH 1XF1A 4KKBD 1JUFB 1LDPH 3KYKH 4JN1L 4KQ3L 1GGTA 5JW4M 3OR6B 4UV4L 2IH1B 4XNXH 3T09A 2BNQD 4L4TB 4JFEA 4PJIB 1BIIB 1N64H 3X3GH 1TTUA 4MGXA 5IVXF 1IEBA 3U0PA 3D39D 3FOMB 4HS8H 2JJSC 2R4SL 1M7DA 2CUMA 4KRPC 1IFHL 4OLVH 4NUJB 3MOQA 5GZND 1MLBA 1VFAB 1P7QD 1PKOA 1IGFH 3VI4F 4GQ9L 2VO5A 3QPXH 4HQQH 5BZWB 3MRLA 4KUZH 3KPSB 4N0UB 1Z0NA 4PYHA 1ACZA 2VIRB 1Q9KB 3VWJD 4QRRA 1QSFB 1I7TA 5DRXA 2IQ9H 4XXDB 3SGKC 2X70B 4ORGB 3N1GC 4PRID 1J87A 4KROB 3L5WA 1A7PH 3DX8A 1H15B 1TVDA 4L8DA 2XPGA 3ROLA 5KN5B 1X5KA 4X6FB 5JZ7C 1TJIL 2VNCA 1AO7D 1T03H 3M1BA 4KJYB 4M8VA 1FRGL 1NGQH 4U1IA 4Q6IB 1EMTH 1ZT1B 1I1AC 43CAB 2O5YH 5E2TL 2VXSL 1RURH 2VC2H 4JGMA 3WNNA 1QZ1A 4YZFF 2FGWH 1KSRA 3UX9B 4X98A 3KPMB 3O2DA 3QUXB 2FLRT 3N50A 2J4WH 3UAJC 4JZJA 2JJTA 2UZXB 3QDGA 5IQ7L 4KAQH 3HZMB 4L3EA 4M9PA 3RWHB 4QF1A 3QDME 2OXHA 1MEXH 3HUJA 1MAKA 1I9RL 3L95A 2HFFA 3IDJA 3NAAL 3V95A 4EN3C 5DVMA 1UM5H 2FZ3B 2WLZA 3KAAA 4FQPA 4PJXF 4ZXBD 1RSFA 2D03L 3EHBD 4RGMB 3CFBA 4XC3H 2G75A 4ZO8A 3OKNA 5KSAA 5K9JL 4OUUB 3EDJA 3TWCH 4NHUA 1H3GA 4FQXA 4Y1AA 3EYUH 5T1LD 3OGOE 4HJ0C 1RZGA 3DHMA 1YC7A 1T2JA 4GAFB 2ZSVA 5DJ8A 2EH8L 3MRNA 3HE6D 5FB8A 5MI0C 4PV8B 3TBYA 4LCIL 3QQ3B 1NANH 1YEJL 3DSFH 4POZC 1ED3B 2RBLA 4XNQA 4RGNB 3CDFA 4IOFD 2P48B 5KVDL 2GW5A 3RNKA 1FBIH 5DT1H 4L29A 5DJ0B 5BS0A 4LPWA 2G5RA 5B38A 4JFZH 1EHLL 1B4RA 4XBEH 4XB7A 5DURD 2J5LB 3B9KD 4HLZH 3IFLH 2NY5H 4XMPH 5CKAA 2HA1A 4ODSH 4R3SB 5IHUH 3OPZH 1IGIL 4HIEA 1NUNB 3RX7A 3VFRA 3HAEB 2LTQC 1UXSA 3LQAC 5D2LA 4DKFL 5JDJA 1AXTL 2DQEL 3X13A 2AEIT 1GIGH 1W8NA 3PXJA 1KELH 1KT2A 3IS0X 2CD0A 2DM4A 3ZSSA 1I1CA 3KXFB 1CBVL 3JBG7 5DHYB 4A6YA 3C8KA 1UFUA 4QRUA 5T1KA 5TJWK 5I1JL 4M7ZC 5ITBH 2NXZB 4WI2A 1CLYL 2W9EL 2WP3O 4UV7H 5FA4B 4U1NB 3WS3B 1N0XH 3W82A 4R26H 1FNEA 4PJGA 4S10A 3MJ6A 1QRNA 5GRUH 1FL3A 2HRPL 4WW2C 4B5EA 3GMRA 2EC8A 2D7TH 2B5IC 1UH4A 1YEFH 1OAYH 3BMVA 1J05B 3UYRH 4G8IA 1Q0YH 2B0SL 4NC2B 1JGEA 4YFLI 3NOIA 4K8RL 3IXAA 1W72H 35C8H 1D5ZB 3J8F7 4HGKC 1E4WH 5ISZB 3OMZA 3DO3A 3VFUB 1C1EL 2UZIL 5DD5L 4W4NA 4YHML 3EYOA 2Q76A 5H35A 1XH3A 1DQDH 1G7MA 3D85D 4HXBH 3F58L 3BE1H 4JO4L 3IFPB 4D0BB 1QBML 2BRRL 2NXYC 1FZMA 1KIUA 4CW1A 3OB0K 4UDUA 4PGDB 4XHQA 5D2NE 3HG1A 2HTKD 2ICWA 4KPHH 4PV9A 3CSBA 4IM8A 1UA6L 2IEPA 2AKRA 3DIFA 3GSRB 4G8GA 3MZTA 4Z7NE 3MOBL 3HC3L 4PJBF 4KFZC 4ZG1A 2OTUA 1P1ZB 2X4NA 5BVJA 2BNUA 5I8EA 2AK4A 5BW7C 2GITA 1R5WB 4CJ1A 3L3JA 4M6NH 3SGJA 3NN8B 5T3XD 1P84K 4FQQB 3VGEA 3OKKB 3QRGH 5FOBB 1MFDH 4JFFA 2R0LH 5EUOA 3SO3C 1KCSH 3VRJA 4HC1A 2VABA 2CRZA 2QQLH 3LN4B 5KSBE 3T3MF 3HZVB 4YNYB 2C1OA 5F6IB 2W1NA 5EN2A 2PW1A 1YEDA 1CTOA 3RI5F 4NQUA 4PFEA 3TF7C 1MI5E 3STZA 3HZYA 3FO0H 3QDMD 4NC0B 2OLDA 3AS0A 1CFNB 1EEYB 4M7JL 1KENH 5FYJU 5LAXA 2A9NH 2WIMA 5DEGB 2VR5A 2H41A 2BNQB 2ARJB 2RIKA 4GRWE 2NY1D 3FB6B 4OI8A 1JWSB 2ERJC 2CKBA 5IMKB 3QAZB 3V6ZB 4KVCL 2IBZX 3S6CA 3G6AB 3D39B 3RVTC 1DUZB 3PHOA 4IOIA 1ITBB 4OZGF 2J6EL 5C6TL 2XTJD 3GJEA 5EO9B 1RUKL 5F7MC 4OCMC 5A16B 3AY4C 5F6HJ 2VDQL 4U6HB 3ARVA 2NZ9C 1WBXA 1U8NA 2OXGA 4WJ5B 5F8RC 3TBWA 5F9JB 1X5LA 3WBDA 4YHPA 2H8PA 4Z78A 2J8UA 4M93C 2DTMH 2MOVA 3DX9B 2PETA 2IFFH 3MJGX 1S5HB 3BGFB 2ZOKB 5L88L 3EJJX 1H0DA 1D5BB 4IS6A 3A6BL 1EERB 3UYOD 2KQMA 1GH7A 4NQCA 5ID1A 2EDKA 4QHLB 4UIKL 1IC4H 5CHNB 2ICCA 1C08B 2Q8AH 2VDKH 2V7NB 2J88H 4X0KA 1G84A 2Z0BA 3L3OB 1EXUB 5K9OA 2DQJH 4FTVE 3V5DB 1AO7B 4LSVL 3SOBH 4HMDA 4P2QE 1YY8A 1OL0A 3KNBA 3MMEB 1QQDB 3VH8B 1DL7H 5D5MF 3TVMD 1QACA 3GBMH 3U7YH 4HT1L 4ETYA 3WKMH 4ELMA 2P8PA 4XAWL 3WFBH 1ERNA 3ORJA 4HCRA 1AR1D 4AQ1B 4JANA 4LNRB 3D69A 4MNQE 4Q6IC 1P69B 1RUQL 4PUBH 2ADFH 2G9HB 1YYLL 1KCRH 2CRYA 2RGSA 1SBBA 3CD4A 3QUXC 4LP4A 4ZXBB 1ZSDA 1RK1B 1VACA 3PL6D 3DMMB 1LP9F 5HDBE 4LLAA 4HIJA 5D9SB 4JO2L 1NUDA 3JV4B 4DEPB 4TUKH 4LCCB 4LMQE 4AMKL 5IT2H 1CDHA 4HDIB 4HLZG 3UBXG 1RZKL 2YUWA 4LK4A 4OD3L 3PNWA 3FQRB 4KMQA 1EIBA 1YEHH 4P46A 1NCCL 1ACYH 4O9HL 3T0EA 2HLFC 3AXLB 4JZNB 4H88H 2YD7A 3HNVH 1ZGLM 2H3NA 2QLVB 2Q7YB 1IEHA 2DBLH 4PBWD 4XVSH 1AHWC 1NUGA 2DKUA 1BVLB 1KGCE 1RY7B 5I17B 1Q9OA 4PJCA 1MFBH 3DROB 5CJOH 2NW3A 3QHFH 4KTYA 4N5EC 3QB7C 3BYYA 2DYPA 3TIEB 1RZ7L 2DQIH 4UQ2B 1FC2D 5IWLA 1CT8B 2WANA 5C07E 1FNAA 3F7RA 4R4BB 1VENA 3B9KB 4RGNC 3TIDB 1ZHNB 2DMCA 2NZIA 3CDYA 2VERN 2K7PA 3ULUF 2YD2A 4J23A 4FQHA 3BZEA 1A6TB 4O4YH 3MBEC 5L6YL 2NTSP 5KTEL 4N90D 4Z77A 4XX1E 2W59A 2XY1A 1NAML 2IAMA 5JHDA 1HEZA 4LKXA 3CK0L 1CGSL 5C2BH 2IADA 1LEGA 1RULH 2YPKB 1CFTA 3OKYA 5IVNA 2XFXA 2CPCA 5EOQL 2EDDA 4GAYB 2PNDA 1DBKH 1JGDB 4MA7L 1A7RH 1CF8H 3TNNA 3W0WE 1KPRB 4GAJL 2MQ0A 4RX4D 2FBJL 5E99L 1EAPA 1F4XH 1FAIL 1V7ML 2NXZC 5TH2B 4TVPE 5F7EL 1S9XB 3T3PF 4X6CF 5TE4H 4GKNA 5DUPL 3O11A 2RCSL 4ACPA 3VFMB 5ILTL 2X10A 3E6FA 4HKBB 4TSBL 4OTXL 4FG6C 3HPLA 1EVUA 3THML 3Q0HA 3U36A 1WCQA 1MY5A 2R29H 2B1AL 4MZ3A 1DZBA 3A6CH 3LDBB 3D85B 2HJFA 3SDAC 1XR9B 3RVXD 4YR6B 2OL3B 1CFQA 2QR0B 7FABH 1CLZH 4S11A 3X11A 3GBNH 2AJSL 2XI9A 5CP3H 5GGUB 1F11B 1WBZA 2E7LC 1OB1B 3IFNH 1X9QA 4JHAL 1DQLL 3ECBB 4IJ3B 3CFJA 1V7NL 4ODUA 4JPIA 3BWAA 2BK8A 3TCLB 4TTDD 4U6XA 3EW3B 3GSVA 4RAVA 4XVJL 5FM8A 2FYYA 4NZRL 1JTTA 2VDML 3UC0H 4Y2DD 1DQJB 4OZIB 1A6UL 4OT1L 3GMQB 3LQAH 1AGDA 2KKQA 3RKDC 6CGTA 2Q86A 4LL9A 5DD1L 5DS8A 3CU1A 4FTVD 1QBLH 3RUGB 4P2QD 1HZHL 2YA1A 5BJTA 4KK5C 2JB5L 4QXGL 1RVFL 1WCBA 5D70L 3FZUD 1N5AA 2Y25A 3BKMH 3MV8A 3RIAF 2VXTH 1KLGA 4IRSD 2YMXL 4IMKC 5TF0A 1MCDA 4ZFOL 4UUJA 2WIIA 3E2HC 2NTFB 4X99B 4MNQD 4JB9L 3TN0D 5IVZA 3RFZC 5CILL 2DWEA 3AREC 1U36A 3VFGH 3QDMB 3RWEB 3NPSC 5IBLD 4RAHA 1MJ7L 5IMMA 3H7BA 3GJFA 1WAAF 5I1HL 3MCG1 3BEWA 4PRPB 1CGXA 3QIBA 5C71A 1OW0A 1U42A 2IMMA 1T83A 1QFWI 2NY1B 3QNYB 1CE1H 3QNXB 5IK3A 5KANI 3IDGA 4KKBC 5EZJA 2YSSB 2RFXB 1NBYA 2ED9A 1FO0A 3GRWL 3FHQA 3K46A 2R69H 3UDWC 5BZDB 3KLAA 1DVFB 2XTJB 1H5BA 3NPZB 2VDNL 3DO7A 3LKNA 1EJOL 3C5JB 3S34H 4JQXA 5HYSG 3UJIH 2KZ1B 4DGVL 4QYOB 4TTGA 1FZJB 1SMAA 2V2WA 2X1XR 5KAQF 4XZUA 3BD4A 4JY4B 1VERA 4CAGA 1C5DB 1VESA 5IVXA 2XXCB 1BD2A 5DFTA 4LHUA 5C07D 3LKSA 2Y6SC 3TYGL 3RJQB 5F1OB 3T77A 4GBXA 4MB5A 2FR4B 5GISH 3V5KB 4K7FB 1L7IL 5KW9H 4F2MA 4XP1L 5EO1B 3BGFC 5DMGD 3L6FA 4NHCH 3VWJC 1XF5A 2GJZB 4OLZH 3ZL4L 3A67H 2ZWLT 1I3GH 4CU7A 3VMNA 4L9LC 5FCUL 1FVDB 3D9AL 1K4CA 3IJHB 3O6ML 3DRTB 4OB5H 4E0RB 4F37F 4MAYD 5DRNB 3QXAB 1T2QH 3QEGH 5DD0L 1T1YA 4KJPD 4XNUH 4YUEH 2FB4H 3VFOA 3LH2L 1JF1B 5C09E 3W0WD 5JIHA 1HDMB 1PW3A 4FXGB 4OAWB 1LO3H 4ONGL 2DIBA 5DTFB 3VG9B 4LPTA 2W0KA 4TVPD 4MCYB 3PQYE 3G5XB 4MXWH 1QSEB 2F74B 4DJMA 3AU1A 3U0TA 2VLLA 4GXUM 3SDCD 4P57B 3C6SA 3V7AE 5KSVA 4PJDB 4BZ2H 2XWTA 2B4CL 3B4NA 3HR5B 1K8IA 4WCYL 4NQSA 4NRXA 4ZXBC 4CDGC 1IAOA 3EHBC 3IXTB 4M7LL 1GVIA 2IPUG 2N1KA 1T04B 4E42B 4H1LH 4LCCC 2WBJA 5EBLB 3QRFM 1CG9B 4F15B 3EGSB 5FYKU 5ICZB 2EDRA 3K7UA 1BBDH 2H1PH 2PTVA 3SQOL 1KEGL 1G7LA 3KPRA 3QP3A 1FYTD 3HE6C 4ELKA 3LD8B 2R2CA 4QT5B 5IFJA 3UO1H 4WUKH 1XGUA 4R9HA 5JW4R 4IOFC 2F54E 4BZYA 4ZPVA 3AFLA 2NY2D 1BFTA 3S36X 1C16A 1FJ1B 3BT2H 3UJJH 4YWGH 3BJ91 1OGTB 1MVUB 2A83B 4MLSA 1AJ7H 1FPTL 1ZAGA 3V6OE 5IR1A 3B9KC 4TYUA 3WNMA 2AJ3A 3NH7L 4P2OA 3VXMA 3SPVB 2VLJA 4I77L 1J1XL 4NN6C 3W2DL 1A3LH 5EIIA 5C0AE 4P4RB 4OQTH 1NFDE 4UNUA 4JM2F 4MNHB 2ZSWB 4CADB 5LCVH 4HGWB 3TO4B 3CH8A 5LVEA 3WHE1 1AD0B 1GGIL 3IDIA 4UTBL 2MNUA 4U4BA 4HXAH 4J8RB 3SE8L 1LE9B 1JGUH 3C87A 4LMQI 3LIZH 2XQYK 4J6RH 1IC5L 5DDHA 3U9UB 4QNPE 1J1OH 2PYFB 4NIKB 2V9TA 3QDJA 1T4KA 3JWOL 1EVTC 2ZKHH 1MCRA 2PYEE 2DWDA 4X4ZA 4NUGL 4JFDB 4Y19B 4F7PB 2EDTA 5F1SA 5IB5A 3BKCH 3TA3A 2OR8A 4X6DF 2CIIA 3QCVH 1M7IA 2R0KL 5D1QB 2NCMA 5C0JB 4MJ5A 3PG2A 1Z3GH 3LB6D 2BY2A 5DD6B 1IGCL 4HWBH 4KK8D 4CJ0A 4G6FD 2PKDA 2QQNH 1T1XB 3IDNA 2VZOA 1TZGL 4J1UA 1PY9A 4GMSL 3ROOA 3RWFA 2ZCKH 2ORBH 3HS0A 3MCLL 4YHIA 2YOCA 3BESR 1NMCB 5SV3A 1FN4A 1N26A 4Y5XB 5E6ID 1VB9A 3ULSA 1BZQK 2VLKE 2FJHA 5E2WL 1A21A 2H32H 5H2BA 1I85A 4U1JB 3LDBC 5F9AC 1RJCA 1MJ8L 1I7UB 3FRPG 2X4PB 4LCWD 3D25A 3LV3B 3AC0A 3SKNB 5MENE 1ETZA 1SY6H 3ARYA 3G6JF 4HWZB 3QHZL 5HD8C 4XRCB 3NACL 4KQ4L 1KEMH 4Z7WE 4M48H 2C5DC 4MSWA 4PJ9A 3C60D 3O6FB 1I8KA 4XCNB 5BVPH 3RJDA 3K1DA 5ALCL 3VXSA 4O2CB 3RWIB 3FO1B 4IEFB 4NNXB 1DBAL 1HIMH 2R39A 4IRSB 1G9MH 2X41A 1BOGA 3PWLA 2BY1A 4HEME 5C0CE 2FX7H 2Z35A 1SVZA 3S4SB 4NO2B 3DETC 1EFXD 3H9HB 1DBML 3MYZA 4XGZB 4EBQL 1ZGLP 2W9DH 3T4YB 4NM8H 2LVCA 5T5FL 4NZUL 4I9WE 4XMLH 1CGUA 4NFDA 1AGFB 1LEIA 3INUL 2NY0D 4MJIE 5GXBB 4X8JA 1ZGLA 3KS0H 5DZNA 4JFEB 1XGYL 3MYJA 2HVKB 1C5CH 2DJ4A 2I60H 3U4BH 5IBTL 4AL8L 1TPXB 2CO7B 4MZ2A 1M7DB 3M8OL 3LY6A 2PW2A 1FZKB 4H20H 1RIUH 2W92A 1LO2H 1MJJA 3CMOH 4M02A 5IW6B 2DLEA 2ZCHH 1AC0A 1U58A 1EAJA 3I9GH 4F57H 1I1FA 3MRLB 2WV3A 5DQ9B 3VGFA 5JXEC 5DI8A 3CXDH 3HMWL 3RHWF 3ARZA 3AAZB 2V17H 4DAGL 2XTJC 5DRXB 3LEVH 4LEOB 3SDDA 1BM3L 1CFVL 1YN7B 5C08A 4DZ8B 5AG8A 3EYVB 3DX8B 5I1EL 4LRNH 2F54D 4L8DB 4UINL 1KV3A 3IU3B 3ROLB 2VRAA 4KHXH 2L7JA 5GZOD 3G5YA 4NQVA 1A9EA 3QFJE 1NEZA 4U1KA 4C56A 5I1CH 1EEQA 3ZKND 2FX9H 1AI1H 3DYOA 4G5ZH 2OCFD 2JCCA 3CDGB 3WSQH 5JXAL 1BBJA 4D9QE 4GMTL 3S37L 5B3JE 3CVHL 3VXOA 4R8WL 4WO4A 1U8OA 4TSCH 1D7FA 1FNHA 1Q0XL 1NKRA 2ICEA 1N5YH 3U30B 3IAGC 1G7JA 1ZHBB 3GMMA 1KN4H 3QDGB 5IB1B 3OKMA 1NMBL 4DN4H 3GJFK 1ORQA 5EPMB 4PREB 4L3EB 3BXNB 3TVMC 1VKXA 1NC4A 1KXQE 3L3GA 3IDJB 3H3PH 3MUHL 5D5MA 4DGIL 4DKEL 3B2VH 3CFBB 1AR1C 4ZSOA 5J1AA 4LLDA 4FQXB 2OTPA 4YEFA 1G7PA 1B0RA 4GSDL 3SDCB 3GSUB 5ID0A 3HMXL 4TOYH 1JK8B 3VG9C 1FG9C 2PN5A 1QPPA 5E2VL 1FVCA 2E8YA 4F9LA 4F9PC 3QR2A 3PL6C 3LAFA 3KLSA 2ITDA 4OGAD 3BPNC 1WFNA 4XNQB 4HK0B 1UWXK 1AGCB 3GKWH 1LP9A 2E8ZA 5E08H 2J12B 2DN7A 3RNKB 2C3HA 1D6VH 3BH9A 2VLKD 5BS0B 5E8PA 5I71B 3GM8A 3IGAA 1OD9A 3C8HA 5B38B 1FYTB 4AIZA 4JVPA 3O3AA 1BVKA 2FHCA 4JM4L 1WIPA 5E2UL 1X5YA 3TT1H 2OJZH 4CVZB 1MWAB 1FL6A 4PTTA 3ZDXF 4HIEB 5MEND 3MUJA 5ESQA 1K3IA 5F6HI 3S3PA 5D2NC 1UXSB 5B3NA 2I26N 4HFUL 3X13B 4P99A 4YK4B 3QUYD 4WV1C 3GSNB 1QA9A 5IIEA 4KHTH 3ARSA 1YEKH 5I19L 1CIDA 2B7DT 4A6YB 5D1XA 4WEUD 5T1KB 1ZHKA 4XCCH 3QIWA 4S1RL 1HHHB 3NIGF 4WI3A 3CFCL 4G6ML 3K3QA 3L5XL 4OI9A 5C0CD 1M6OB 4OLUL 1N4XL 4PJGB 3UPAA 1G9NH 1FL3B 4Y4HD 3GMRB 4R97B 3CLEL 5LWYH 4I9WD 5E8DH 3VA2C 2EXWD 2W0FB 1JWUA 3EYFA 3P40A 3QXVA 5J12B 3S96A 3SJVD 1JRHH 5KS9B 1GAFH 4H0HB 3MROB 4LLMB 3IXAB 4K7PX 3QI9A 4O58H 3SDXE 3KJ6H 4POUB 5FYLH 5BRZA 4LRIA 4C59B 2Q76B 1XH3B 5DJ6B 1J8HA 3RPIB 1G7MB 4LCYB 2VR9A 3OKEA 4G80A 2EDYA 4DW2L 2P8LB 1ZANH 3MLPA 1MHEB 4JAMB 1RZJC 1P2CA 1IKNA 3BRFA 5FO8A 4JFQA 5HDLA 3HAEG 4UDUB 3U1SH 1U93A 1KTDA 3T0WA 3QISA 3WL9A 3MO1B 3LMJH 1RIHH 3MODL 4FFZH 4PV9B 5GGTH 3DIFB 3MRPA 1LEKA 1I9IL 1MF2L 4LCWB 4XP6H 2J8HA 8FABB 1TQBB 2GJ6A 4HIIB 4KU1A 4OF5A 2ZNXA 3PWNA 4ZUUB 2OTUB 3I6GB 5MEOA 1QHOA 2OL3L 2DI7A 2BSRB 4KQ3H 2UWEE 4P5TA 2OTWA 2P8MB 2X7LB 3QFJD 1CWVA 2GITB 2JJUA 1IKFL 2AGJL 4F80A 4I48A 3C60B 4ZDHB 5FCSH 5A43C 2FD6L 1VEMA 5EUOB 3N9GH 4JEGB 1MRDH 4Y2DC 1EEZA 2EDQA 3Q5OA 2VABB 4QXTA 3D3VA 5F1IA 2C1OB 1YEGL 4BFIA 1U9KA 3OG6B 3V79C 1AKJD 4PGCA 2I9TA 2FCBA 3LKOA 4OCYL 3D2UD 3LHPH 2Y7QB 3BPLB 2KZWA 4WHTA 1YEIL 2YPLE 2LVEA 3KLDA 2Z91A 2K3TA 3STZB 3QXDA 3QUMA 3HZYB 4I13B 3G9VA 4NGHL 4GQ9H 3FZUC 4R0LB 4D0CA 1WC7A 3T1WA 3NA9L 1TXKA 1TJHL 2FEDD 2C4FU 5DLML 2R0WH 4IRSC 1JWMB 2QSCL 2NY0B 4XI5D 3ZO0A 3MCKA 3PWUA 2UVFA 4PJIF 4HV8A 5I16A 1R3LA 4H26B 1JNNL 1W2KT 3TN0C 2D31A 3WN5C 4WW1A 1OVZA 5IBLC 4YAQA 3C6LD 5DHVA 4LSSL 1G7HA 1MCPL 3QIUA 5TE7L 3RY6C 2EEAA 3DBXB 2ITCB 3BDXA 1M7XA 1TJIH 2DLFL 3A6OA 5FO9B 4NCDA 2PXYD 5CJQH 4CKVX 5GGVY 1FRGH 4HFWB 3MRBA 3KYNB 3BUTA 3LPFA 1SM3L 4Z78B 2J8UB 4JY6A 5E2JA 2VXSH 5DUML 1A4KA 4X9IA 5C0BA 4Z95L 3ZYOA 2FWOA 4IS6B 3NZ8A 4K2UH 1DTUA 4F3FB 1XF2A 1E4KA 1YMMB 5EWIL 2A77H 1U3HD 2BFVH 2ICES 1WQVT 2GQHA 2R56H 5JOFB 2F54B 4NQCB 1RQ5A 5F7LB 5BOPA 2CLZA 3PP3K 4D2NA 5FK9A 1NAKH 5BO1L 4X0KB 5EIQA 3TBSA 2D03H 4YDKL 3F62A 1DUYA 3UBXA 1A7BA 1A1MA 3T4AA 5DWUH 1BF8A 1ND0A 1OQOA 1CYGA 5D6DC 1TETH 3NGBB 3P0YH 3V5HA 2VLME 5DJDB 1NFDB 1LHZA 1LK2A 5DMGC 3RWJA 3TLRA 3VCLA 5BMFH 1FNGA 2EH8H 3FB8A 2ZUYA 4N0RA 1E4JA 2GSGB 4PRDA 4JANB 4PRHE 2CK0L 1TIUA 4LCIH 4FQLL 5D8JH 3QUZD 4NM4L 4LBEB 3U9PL 2F53D 3JTTB 2MQ3A 1TVBA 2CUHA 4JRXE 3L3DB 1ZSDB 2LV4A 4MAYC 1VACB 1CDBA 1EHLH 1XR8A 4KJPC 4JPVH 4QXUL 5F44A 2W9LA 5ALBH 4PJAA 2R9HD 5D7LE 1KF9B 5BXFB 5CZVL 4NO3A 3RDTA 1P4LA 3DX7A 4P46B 4U6VL 3T0EB 2XQBL 1GGCH 1OGAA 4JFOA 5CUSL 5F7FA 1W72A 4YDIL 3BH8A 1L0QA 3ZE0E 3HNTH 2DL9A 4AEIL 3SDCC 5FV1L 2HMID 4MXVE 1CBVH 3HTLX 4NDMB 5HGBA 1U3JA 2X40A 4BQ9A 4O51A 4NKQB 3UZVB 2XZAL 4EEEA 2EH7L 4HIXH 5EBMA 5JMRA 4HUUA 3GM0A 3MXWH 4GKZA 2XRAH 4HAGA 2R0ZH 2QSTA 3SKJH 1RZ8A 1I1YA 5EZOH 5I1KH 4Z77B 3QJHA 4A2MA 1U3YA 3MLUL 2IAMB 5JHDB 2EXYD 3QUYB 4NWTH 1HEZB 4PJEE 3WLWD 5I8OL 4YIQB 2ATKA 4HZLA 1ZVYA 4LKXB 4I0PD 5AUMB 4ZUSB 5T1DL 4OFYA 4EDXB 4OKDA 3OJDA 3B6SA 5HY9B 2NY2C 5F7DB 4LSUL 1D6EA 2XFXB 4I2XE 1C1EH 2UZIH 5DD5H 3PV6A 3VGDA 4YHMH 1UGNA 4PB9H 3RGVC 1UKQA 4LLYA 1KIQA 2YPLD 3MLWH 3F58H 2DD8L 3L5HA 4JO4H 1A1NA 4UTAH 4U6YB 5D1ZD 5EC2A 2BRRH 3ZYZA 2X4QB 3HZKA 3QEHA 3BDBA 4DUWA 2Y06L 3BN3B 3FT2A 4O00A 4YXLL 1A22B 5CMAA 1QFPA 5F9OL 3SJVB 1U6AH 1VSCA 5HBBA 4KI5D 4JM2A 1AQKL 4PBXA 2P45B 2BNRB 3HPLB 3OKLA 1F4YL 4R97C 5HYJE 1EHNA 3MOBH 2FDBP 2E7MA 3FN0L 1AQDA 2GY7B 1KTKE 5AG9A 4CU8A 4WU7B 4QHUB 2EDJA 1QEWA 1NBZA 5SWQA 4FXKA 4QLRA 4OI7A 3CC5B 4NQDD 1XIWA 3X11B 1RFDL 3FFCD 3LB6C 1FSKB 1WBZB 3DYPA 1JNLL 4G7YL 4PS4L 4X6DA 4JFXA 5HHPA 3BWAB 1T6VN 4KK8C 4PJ5A 1A6VL 4IHOA 2R23A 2FECL 2AI0L 1GHFL 1M1SA 5F70A 1KB9J 3K1KC 5E6IC 2QV2A 4M7JH 1OP5K 2YS4A 2Q86B 4NKIH 4HH9B 4IRZL 1I7RA 4EIZC 5J9PA 3LS5L 4Z76B 5AZEL 5BJTB 2JF1A 4R2GD 1WGOA 1HH6A 4J4PC 1N5AB 3MV8B 1PVHA 5HYSA 5CEXA 2R1YA 2CH8A 2VLMD 2WBKA 2AXFA 1UADC 5C6TH 3BGAA 2WIIB 1VFBB 1RUKH 4PRHD 2YEZB 4GG6E 5IVZB 3HFML 3S5LA 2EYRA 3PGFL 3OKDB 3VRIA 4NKDA 2NLJB 1F6AA 3O8XD 5JA9A 3B3IA 3V0AC 3QWOA 2FSEA 4FQJL 5HGAA 1DN2A 4OZHE 4MQTB 3MRMB 5L88H 1DBJL 3BPLC 3U6RB 2WW8A 2AXGB 4J3XA 1NKOA 4ZUVA 1K2DA 4OCRL 1MY7A 3GI9H 3IDGB 5EZJB 1MFAH 1KJ2L 4P9ML 3B43A 1TITA 4QRRE 4R0LC 5D7LD 4ZFGH 1CD1B 3C6LB 2HFGL 1OQXA 4UIKH 3OAZH 3Q6FB 3G08A 2NY0C 2Y72A 2R2EB 1P6FA 3MRCA 5IB4A 2XTLA 4GRWH 1S8DA 3WXWH 2CIKA 5HHQA 3QSKB 2J1KA 2ZOLB 4K23H 4FNLL 2AJYH 4E41A 4YFEA 2JJSA 5FYJE 2D3VA 2PXYB 1KJ3L 1DEDA 3MPCA 2X42A 1RPQA 2V2WB 2XA8H 4M4PA 2Y07L 4WUUA 1K85A 4DK6A 5I8KH 4HT1H 2XZZA 4JO1L 5BV7B 2GI7A 3AUVA 4OF0A 4R7DA 1J7VR 3RVVD 2Z4QA 1BECA 5A1AA 3D0LA 3KLHD 3T77B 4WHDA 4P3DB 5CJXA 3QEUB 3RBSA 2HLAB 1RUQH 1G1YA 4JN2B 1EEUA 4X7EC 2CDFA 4M1DL 3ARBD 4KMTL 4MJ2A 3UTTE 1AP2A 4LASH 1XF5B 1A4JA 3U0WH 5F3HA 5IESH 4EVNA 1FAKT 5FGRA 2A38A 5AWNH 1UZ6F 1GOGA 1S7UB 4DGYL 4AMKH 2R2BB 1Q72L 3MLZH 3Q6GH 4JPWH 3EJYD 2DDQH 5GZOC 4ISVA 1J0KA 3MGTA 5FYJL 1M4KA 2FJGB 1FYHB 5JW5A 1NCCH 4Y1AE 2F5AL 4NJ9H 4FMKA 1NGXA 1T1YB 3QQ4B 5T3ZL 4GXVL 3ZKNC 1Q1JH 3QPQD 3OF6A 3QUZB 5TDOA 4OV5B 5D71L 4ODWA 1Y18B 2F53B 3DJ9A 1OAXL 4UZGA 2MCPH 2J2ZA 4UQ3A 5H94A 1CQYA 3FB5A 2BSTA 4TNWF 1D5MB 4QY8A 4I8DA 1WJ3A 2VXVH 2XIDA 1DR9A 2F5BH 1IAKA 3LSOB 3REVB 3RTQD 4EN3A 3O2DL 4NWUL 1AXSA 3MLSH 3H7LA 4R7NB 4XNZB 2F58L 5HYJD 2XWTB 5JLZB 4JRYE 5HPMB 2NW2B 5ESAA 2XNAB 4NRXB 1IAOB 4OV6F 5FV2A 5K59E 3S97C 5EUKB 3G6DL 3O3BB 1NAMH 1F2XK 2Q87A 1MHHA 1RMFL 2WBJB 4JKPL 3O4LA 4WFEE 5D2LE 5HVGB 3BZFB 2ENSA 3CSPA 4ELKB 5A3ID 5EOQH 5DMIL 4KDTC 3P9LB 4MA7H 1HCFX 3HI5L 4OGAC 5EC1B 2Q6WA 1XGUB 4TPRL 1R3JA 2VN7A 1WZ1L 2PO6A 1KJVA 2MKLC 4JQIL 4XVTH 1KIPA 5IFAL 5E99H 4HWEL 4HJJL 4E9LA 2Q1EA 5B8CB 5F7EH 1VFMA 3V8OA 4Z7QE 3MA7A 1KTLA 3MR9B 5IR1B 5HHOD 1JGLL 4Y0GA 4XWGL 4BJLA 2AJ3B 2RCSH 4HWNA 4QOKA 3NIDF 4P2OB 3VXMB 1YJDC 3SE4A 2AVGA 1S9KC 1I8MB 3PGDB 2YKLH 5I6XC 1II4E 2AXJA 4Y5YB 4QCIA 3THMH 4G6JL 3N1PC 4MAUH 3R1GL 4KUCD 2WQRA 3QUYC 3IDIB 1BX2B 2WWKT 3PIQB 2YA2A 2OS7A 3RBGA 2A6IA 3WCYA 1NGYA 1KCKA 4OM0L 3QH3B 2APXA 3HRZB 4XC1L 2IPTH 4FFVD 4NYLA 1T4KB 4A6YL 5LQBH 2DWDB 4JHAH 1DQLH 4WW2A 5DSCA 2OJEA 1KOAA 2ATPA 5IB5B 3W39A 2VL5A 3CUPB 3SBWC 3LKRA 4Y4HC 4J3VA 5IGXL 4ZFFA 4TVPH 2VZVA 1A6UH 4OT1H 3V4PL 3BSZL 4G8GE 3U7WL 1T0MB 3UPCA 5HHVL 1X5XA 4X9HA 5IOPB 1EO5A 3IDNB 5DD1H 4J1UB 1KBGL 1QVOB 4Q9CA 3K8KA 4FFWD 4RNRA 4NQDB 1HZHH 2AK4E 5DJCB 1U92B 2JB5H 1FN4B 3HCVB 3FFCB 1X6NA 3FAWA 4LEXL 1GSMA 4NQEE 1ADQH 5DEFB 1PQZB 5H2BB 4JFFE 1QSZA 2YMXH 1BQUA 2R1XA 3ZKMD 1A7QH 2HH0L 5C0EB 4Q0XL 4Z0XB 4P48A 3IRZA 5HDQL 1M71B 3F8UB 4Q6YA 4OZIF 1R24A 5CILH 1LK3H 5IB3A 2B20A 3WYRA 2D7OA 3UTTD 1MJUL 3H9SE 1CLOH 3KPPA 4MSWB 2C3WA 3RUGF 1BFOB 1KB5B 3VXSB 3HI1A 4R2GB 3F5WB 4Z5RB 1QR1B 1KJMB 3TZVD 3LQZA 2GK0A 2X4TB 2A73A 5L2KA 4GLRI 3P4MA 4OM1H 4YHKH 1BOGB 1IARB 1MRCH 2VDNH 1WZMA 2Z35B 2N4IA 4WI5A 1EJOH 2ADGB 1BFVL 5C0FA 1TVHB 1KB9K 2AERT 5EOCL 4ZTPL 3OGCB 4JCLA 1WEJL 1GYAA 4MX7A 4YPGB 1LEIB 3MNWA 4HC1L 4D9RE 1WZLA 4L5FL 1BWWA 3BP4B 3MJ8B 4OZ4B 5E95B 4UILH 2XN9D 1U8QA 5C0IB 5IF0A 3DVGB 1HQRB 5HPOA 4UBDD 3ALWA 4UIMA 4NNPL 2VUYA 2P44B 4JRYD 4M1GL 2FEDC 2AEQL 4EQ3A 3NABH 5M94B 2ESVE 5TGBA 4XI5C 1JUFA 5IHZB 1ZT4A 4ZS7L 1ZLUH 2IH1A 1I1FB 4L4TA 4PJIA 2VZTA 4QEGA 1BIIA 3AY4A 2CKBL 5MHSE 3QCUH 3SDDB 5ETUA 2E27L 5D7IF 5C08B 1PSKL 3FOMA 5DD0H 1W8OA 5HGHB 2JKXA 1KACB 4QGTA 5D4QA 5GS3A 1ZV5A 4Q9RH 3V52L 2F19H 2O5ZL 1EH9A 1U0QA 3ARBB 4ONGH 4ZQKB 5TPWL 4ZOEA 2XXMB 4U1KB 5DGRA 5BZWA 3GIZL 5I15L 1T66D 4PJ7F 1SEQL 1IILE 4P2RB 4UT6L 4V2CB 2V9QA 3CVIL 1IGTB 4LKCA 2VIRA 4M5ZL 4NQXB 1U3HC 2JCCB 3K0WA 3WE6B 3MV01 4Y4FD 4XXDA 5TQ2L 5LGJA 1IE5A 2X70A 3FMGL 3JXAA 2DQGH 5JUEL 1MREH 1U8OB 3GNML 1HE7A 1H15A 1IAII 3HI6L 2PF6A 1NGZB 5FECA 3SKMB 3ZDYF 1UWEH 1U8JB 2WUCL 3BW9B 4X6FA 1VKXB 4MB3A 3I6KB 3L3GB 4OQTA 4BZ1L 4PGEA 4Q6IA 2ZPKL 4BSWA 1YUHB 1IM9D 1KEGH 1JPTL 1ZT1A 43CAA 1YPZB 3BP5A 4KDWA 4LLDB 4P59L 1KFAL 4HCRL 3QUZC 3AGVA 3KPMA 1G7PB 3QUXA 3QZWB 2Z8WC 3KYAA 3EO1A 4PJDF 4KMLB 2F8OA 1J9CT 2PR4H 2EYTB 5SWZE 1QO3B 3RWHA 3BUYB 4HWUA 3K8MA 4L8SC 1MHPH 4WI6A 3D6GA 2FZ3A 4AZ8A 5I1LB 1INEL 1ZE3C 1FPTH 4AEHL 2VSCA 2R9HC 4KC3B 1WFTA 3ARGD 4HWBA 4OUUA 1H3UA 3L7FB 2WWKO 3W2DH 5H37G 1AHWA 4MXQD 4NQED 4CN4A 4XX1G 1MLCB 1EHAA 1BVKB 4P49A 2P42B 1N7ML 1VFOA 1GGIH 4UTBH 1UQSA 4K3GA 2HMIC 3SE8H 5LGKA 4Z7OF 4U7KA 2H32A 3RHWK 5J89A 4HBQA 3LRGA 5E9DD 5L8JB 1J0JA 3H9SD 2IPUK 4X5WA 5FYKE 1RIVH 4HBCL 5DJYB 1E28B 1K4DB 1QA9B 1W0VB 5DJ0A 1U8HB 1FL5B 4C58B 5HHOB 3MBEA 5IIEB 1NMAL 1SY6A 2P46B 2B39A 5D1XB 1KXTB 1ZHKB 2E7BA 5FXCH 5B8CC 3VE0B 1HHIB 3IDYC 2Z31D 4R3SA 5I30H 3TPKA 2EXYC 4ORZC 3WLWC 3TV3L 3HAEA 3K4AA 4L8CB 3D18B 4GG6B 1TZGH 4M1CD 4I0PC 5J8OA 3R0NA 4Y5YC 5HVHC 1RZIB 4I3GA 4D9RD 3KXFA 2A1WH 3I75B 5DHYA 2DMBA 2F8VA 4UB0L 4ZOCA 4APQD 3QI9B 1S7XB 5FA4A 4PGZA 3HHRB 5D1ZC 4K3JH 3WS3A 4NRZA 5EORL 2VR4A 1FFNB 1J8HB 3N1MC 5C0ND 5I66B 1C7TA 1BREA 3OJ2C 2ESVD 4PGBA 1V8HA 3CSYB 4YE4L 4ZODA 1K9TA 3OV6A 4JPKH 1J5OH 4S1QL 4KRLB 3VWKB 1P2CB 1JHTB 4GAGL 4JFQB 4NC1C 1LE5A 1U93B 1KTDB 4FQIL 3SDAA 5MHSD 4K9EL 4LAQH 1DBAH 2DQUL 1D3CA 1D5ZA 4WGVB 1BQHB 5ISZA 5DUBB 3VFUA 3C08L 3MRPB 3VFWB 2OK0L 2O61B 4BKLA 2E7LA 3U7AA 1DBMH 2GJ6B 4EBQH 5JA8B 1CU4L 3U2SA 4RDQF 4P5TB 3ULVE 3FOLB 5LXGH 1E6JL 1PX3A 3FTGA 3IFPA 4D0BA 1F4WL 4LSQH 3ZTNL 3RZCD 4I48B 3NCJL 4GG8B 1YJDH 4PGDA 1CI5A 5J6GB 4I3SL 2R4RH 4U1GC 3KS0J 2NY7H 1IBGL 2YXFA 4AL8H 2Q20A 3TZVB 3GSRA 1QFWM 3O2WH 3GHEH 4PGCB 3M8OH 3LKOB 1FFPB 4KXZH 3BIAX 3QXDB 5J06A 4Y4KD 4R2GC 3IDXL 1FLTX 1R5WA 4D0CB 3TH2T 3NN8A 4FQQA 3QWRA 2QL1A 1NCAL 3FO9B 4H25B 3AREA 2NY3D 4DAGH 5E8OA 4HV8B 1BM3H 1OSPL 1VFUA 3O2VL 5I16B 4OF8A 3RIFK 4YHOH 3HZVA 4Y16D 2XN9B 1RJZB 4OIIL 3WDIA 2GK2A 3KYOB 3R0MA 4L4VD 2OP4L 3IJYB 3O8XC 1DQQB 2DYPD 5IVXE 4JRYB 3PWPA 1FE8H 3LEYL 3KJ4C 3H6JA 3EZJB 5SWZD 3ESVF 2OZ4A 4KH2A 1CFNA 4XPHH 4LDLB 1NL0H 5A2FA 4HH8A 3VI3F 3UDWA 4KRPD 1KN2L 1HYRC 3QT2A 1KCLA 3VI4E 2AABL 2BNQA 2ARJA 4PD4J 4JY6B 4GMTH 3RL1B 3FB6A 5C0BB 3CVHH 3VFPA 2PCPA 4KV5F 1JWSA 4R8WH 4M8QB 5K9KB 2P5ED 3V6ZA 1FO0L 4N0CD 4HW6A 5C7XH 3G6AA 3D39A 1DUZA 1UACL 3RAJL 3O45B 1A7NL 2D9QB 1NMBH 2AAVA 5CEZE 3KDMB 1MQKL 1L9MA 2CLZB 5A16A 1AR2A 1P7QA 3MFFB 4V1DD 5E70A 4YHZL 4M3JA 4WJ5A 4DGIH 1ZT7B 2VDOL 2UVEA 4AEEA 1DUYB 5FYKD 5E4EB 3DX9A 4PIRF 1A1MB 5BV7L 3KLHC 1S5HA 2ZOKA 4QRTA 4F7MB 3VWJA 1D5BA 1NGPH 3NIFF 4Y4FB 4LVNC 1H3PH 3DYMA 2DB8A 3HMXH 3ARBC 4PRIA 1Q94B 4YZFE 3FB8B 1MCKA 4BM7A 4O5LL 4PRDB 5E2VH 2I5YL 4ZUTB 4M6ML 4QHLA 5CHNA 1C08A 1J86A 2GUOB 2BVPB 3ET9F 2B1HL 4PG2C 5IVOA 4HS6B 3V7AG 2P5WD 2COQA 3HUJF 3UEZA 4IMLB 1HYSD 1K6QL 1AO7A 5IFHL 3MMEA 1QQDA 5CIPH 3AVEA 1QLRB 4PJXE 1IM9B 1HKLL 4NFCA 5CEZL 4NJAH 5GQBA 1PX4A 5H8DA 3QPQC 5ICXB 2FRGP 4PJAB 1ITCA 1EBPA 1TZIB 4M61B 2BVOA 1ZA3A 3KPRE 4LNRA 1P4LB 1NC2D 5JNYA 4PJHA 3MLTB 3DX7B 1L6XA 4HJ0D 1Y6MR 4JFOB 1OGAB 1UWGL 3SKOB 2W60B 4MA1B 1W72B 3RTQC 1RUAL 1FIGH 5IEHB 1U8IB 4WWKD 4ZXBA 1RK1A 5E6ZA 5HGBB 5E6YA 1Q8MA 2HYMA 1IC7L 4UT9H 5D9SA 3CGTA 4MB4A 4LCCA 1ZLWH 3WO3B 3EOAB 2X89D 4Y88A 2VKXA 5FF6B 3CFCH 5T1LA 1UM6H 3CX2A 2I9LB 5F8QC 3HC4L 1A3RL 2VLJE 3FQRA 1B4JL 3RVUD 4HPYL 1WF5A 3HE6A 1ZTXH 2BERA 3AXLA 4RISL 4JZNA 1T1ZB 2EIZA 1XGPA 2VXQH 5KJRL 3UXFA 3O41B 3ULVD 1EGJH 1IVLA 2RAMA 5E9DB 5A3IC 5GGTA 5I17A 1GCFA 1MFCL 3MBXH 4YC2C 5FKAB 2GIYA 2Z93B 5T33H 3DROA 3EO9L 4HZLB 4GQPH 5IW3A 2OR9L 1YC8A 3GO1H 5KOVC 3TIEA 1GXEA 3QDJE 3BAEL 4UQ2A 4GOSA 5DRWA 3MRDA 2P7TA 4R4BA 3B9KA 3OSKA 3TIDA 3WIHH 4AG4L 3S9DB 4WENB 2A2QT 5KVEL 4PJGF 2WBWB 1A6TA 4DW2H 1WSST 2LU7A 1KULA 1JYNA 5CGTA 3RQ3A 4D3CL 3JSSA 3PJSA 5FHAL 3KPTA 2I07A 1R3KB 1NDGB 2BX5A 2YPKA 5KS9F 3UTZA 1I9IH 5GS1B 1PG7L 2VZUA 3EUUA 3OKLB 5L7XH 3WJLA 4G9FE 3FQNB 4LHUD 4FFVC 2BVUA 3F6LA 1KPRA 4BUHA 1IKFH 1NBZB 25C8L 4FXKB 1AIFB 2AGJH 4NKOA 4EI6B 1SMOA 1NQBA 4Z7VB 5DYOB 1KIRB 1T5WB 3B5TA 5E5RB 3I3BA 1YEGH 4JFXB 4HKBA 2A9ML 1LQSR 4NQTA 2R23B 3P0VL 4OCYH 1OY3B 2ZUQB 4JFPB 4JFHE 1OAKL 4FFWC 4WI8A 4LQFH 4XPTH 3D85A 4NGHH 4I3RH 4PJBE 5E56A 1U95A 5GGRB 1VGEL 1XR9A 3MZGB 1TJHH 1UG9A 4LVOB 4YR6A 5I76B 2QR0A 2Z9TA 4I18B 1I7RB 1MPAL 1NCTA 5TDPB 4M7KH 3ZKMC 3RZCB 5HTSA 5J9PB 3W5MA 3IDMA 4IRJB 1TCMA 4PPTA 4RBPH 5GGUA 5I0DA 1F11A 1OB1A 3KG5A 5EUOF 3ECBA 4ZOAA 1KLUB 3TCLA 1GZQB 3UMTA 5HYSB 3GI8H 3IT8D 4HSQA 3QG7H 5CEXB 1T1WB 3NVQA 4Z0BL 3T3ME 5GHWL 4P3WA 2AXFB 1JTOA 3VXUE 5EZIL 1DQJA 3ZSTA 4ALAL 4OZIA 4NBXB 3NCBB 2LE9A 4P5MB 1JYWA 1MCPH 1KCVH 3ZT7A 3NFPB 2DLFH 4YXKL 4Y4KB 3VRIB 2MPAL 5C9KA 4QRPD 1HWGB 4OUOA 3T0AA 5B39B 1KB5L 3QWOB 2FSEB 1SM3H 1FNLA 5KSAC 2YPVL 4LLUA 1JBJA 1OARH 3ARFD 2GAZA 3X17A 5EWIH 4U49A 4ZUVB 4F7CB 5C1MB 2D7MA 4LSRL 4PJFB 1R0AL 2WNGA 2O5XL 4L4VB 4OGYL 5AAWA 2QADD 1F8TH 4X99A 2MCG1 3DVIA 4HK3N 4WFGD 1YNTB 1R6VA 5C86A 5BO1H 4OZGE 1S8DB 3QDMA 2CIKB 5HHQB 4X9GA 1FGNH 4E41B 4ZNCD 1YECL 3LN5B 4KRPB 3Q1SL 1NCBH 4PRPA 4UBDC 2IGFL 2IG2H 1UYWH 4WUUB 5C6PB 1DEEB 2CK2A 4C56E 2QQKL 2N56A 2J8UF 1DDHB 1MAML 3QNYA 3QNXA 1F4AA 2P5EB 5CCKL 2YSSA 3MQIA 2HT2D 2IC2A 2DQDL 3QUKB 4QRQA 5BZDA 4FA8A 4FQLH 1NGWB 3VGHA 5DK0B 4NM4H 3C5JA 3M45A 2BXZA 3TNMB 1F90H 1SVCP 4V1DB 1FZJA 2DLGA 1TENA 2JK5A 3VFTB 1FH5H 3ARTA 4M5YH 4JY4A 1MIMH 1C5DA 4XCYB 2MWCA 4QXUH 1ZA6A 4PD4K 1A2YA 2JJVA 4ELMF 4UAOB 4ZSOE 4MMZC 1NFDF 4ISVB 5HYQA 2D7NA 5IB2A 3KPNA 5JW5B 1I1AB 1FGVL 1NGXB 2XQBH 4K7FA 5E4EC 1X4XA 4OQ1A 2BSSA 5CUSH 4YDIH 1JNJA 5TDOB 4X4MA 1BAFH 4IDLA 4ODWB 1JHKL 2P5WB 5DR5L 2GJZA 5H94B 3FB5B 3ZT5A 1SJHA 4QY8B 1XGTB 3P2TA 5B22A 1FVDA 1IAKB 5ADPH 3U82B 4EN3B 4GRLD 4R4NC 1AXSB 3IJHA 1LP9E 4XP5H 4CVUA 1QG3A 4E0RA 4OZFH 2VZ3A 3DTXA 5T5NF 4XPBL 3QXAA 3AROA 3OAUH 4G9FD 4NO0D 3MRFA 4OD1L 4RAUA 1JF1A 1S9VB 1TNNA 2Q8BL 5FDYA 1HDMA 4FXGA 1G7QB 3MLUH 5DTFA 3VJ6B 1WICA 1X44A 3O81A 3R8BB 3MRIA 4NN5C 5MI0B 2HLFD 3O4LB 4MCYA 4F9PA 1QSEA 4PJCF 3QNZB 5C0RH 1UENA 1OCWH 2APBA 3BPCB 3PL6A 4XNYL 5T1DH 3LS4H 2F74A 3MRKB 4PJ9D 4LSUH 4KGLA 4FQCL 4PJDA 3SE3C 1NBQA 5IKCB 2E5EA 3HR5A 2Q6WB 2BDNH 4FQ1H 2HJLA 5KG9A 2C3XA 1KJVB 3ARGC 1T6WA 3G5ZA 3IXTA 2IANE 5DD3L 4E42A 1OF2A 3ULUE 4OSUL 5EBLA 4MXQC 2Y06H 2X6MA 1CG9A 3BQUD 5ICYB 3EGSA 5TQ0L 3MA7B 2C7UB 2X4OA 4YDVA 5ICZA 3B9DA 2CJUL 3FO2B 3OWEA 1I8LC 4WV1A 3KGRA 3IKKA 3FN0H 1DLFL 3VXUD 4KJWD 4Q9QL 4RSVA 4MCZB 5LBSH 2HJKA 2P4AB 3K81A 3WUWG 4HMCA 4M7ZB 4NP4L 3PGCA 3FKUS 5BRZE 1AC6A 1FJ1A 1NGYB 1MVUA 2A83A 2X5PA 3ALXA 1GGBL 2PUQT 4GT7A 3R4DA 1RFDH 4G7VH 3O6LL 1FZOB 4RFOL 4PS4H 4WW2B 2Z31C 3SPVA 3P77B 3T3PE 5HI5C 1S78C 1CXFA 1A6VH 1EO8L 2B5IB 2OJEB 3HNSH 4X6CE 3WKNA 4P4RA 1ODAA 2VL5B 3B83A 5F89B 3W39B 3LZFH 2AJUL 1H8NA 2AI0H 2XZQL 2ZSWA 3P73B 4GLRH 4M1CC 1GHFH 4CADA 2YZ1A 3TJEH 4JDVA 3EFDH 4HGWA 3NCYP 3MRJB 1AD0A 5I73C 1LE9A 2VDRL 2RQ8A 4RWYL 4J3OC 4APQC 1X4ZA 4RX4A 3U9UA 2JELL 1RUML 3LS5H 4B7LA 4RNRB 5GS1C 5FYLE 1AGBA 4PG9B 1I9JL 3DUSB 5C0DB 4Y19A 4F7PA 1F4HA 5C0NC 4TRPL 5C0JA 4XNXL 4EXKA 1SQ2N 4LHJB 1SJVA 3O6KH 1ONQB 2XKSA 4EUPH 1P5UA 3X3GL 3D3VE 3F7PC 3PGFH 4U31A 5IUSA 1QNZL 1CIUA 5GGQH 3UZEA 4U6TA 2P1YA 4HS8L 4AENB 5EBWA 5I2IB 5IEKA 1VEPA 4FQJH 3ILPA 4OLVL 1MCQA 5DJ2A 1DBJH 5FGBC 3RKDD 4HULB 4U1JA 5DK3A 3QPXL 1ULVA 4OCRH 4HQQL 1KJ2H 4KUZL 3LQZB 3S3JA 3FQUA 2GK0B 2X4PA 3I84A 2FJFB 3P4MB 2HFGH 4LVOC 3SO3B 4I18C 4Y2DA 2HG5B 3NA4A 2IH3B 1BWMA 2IQ9L 3RZCC 5J57B 4HWZA 1URLA 5DC0A 4MNGB 4NZTL 3MV7B 4PJ8D 4ZO6A 1RV6X 3B8SA 3LKPA 4WI4A 2WK2A 4QRPB 2AJVL 2GTWB 3DPBA 4FTVA 4X4YB 3SHSA 2Y07H 4XCNA 4JKWA 5EULV 1HXYB 4ENED 3T04D 1WAAE 3FO1A 5DMKA 4Y89A 4CDHA 3S3SA 2XA3A 1T03L 4NNXA 3ARFB 1NGQL 4IRSA 4Y4KC 2DIJA 2LU4A 5J4MA 1EMTL 2V9RA 3T2OA 1IAIH 2QADB 2O5YL 4MNQA 4KK6D 3H9HA 4N0FB 2DQFB 2FGWL 4OF3A 5TGBB 2ERJB 1T89A 3T4YA 2H9GB 2NY3C 5K93A 3WN5A 4DTGL 1ZT4B 3RU8L 2EDWA 2J4WL 4LVHB 5KZCD 3O9WD 4Y16C 1AGFA 4KAQL 3RY6A 2HVKA 1Q72H 3F7VB 1HN1A 1T21A 5ANMB 4LGPB 5ETUB 3QQNA 4H1LB 5FYJH 5KSUB 1JPFA 4XC3L 2KL6A 1ZVHA 2OYPA 2F5AH 4M93B 3ZKQD 4YBLC 2ZCLH 4WWID 4GXVH 3TWCL 5FDWA 2EE2A 1FZKA 3EYUL 5F88A 5TFSH 3LOWA 5D71H 2IAND 4X7TB 1OAXH 1YYMH 2Y6SD 5IW6A 1MRFL 1QPXA 3CFIC 5DJZA 5EZLB 1IGJB 3BMWA 2FH8A 3DXAD 5DQ9A 2YD6A 4LSPL 4N0CC 4JY5L 4LKCB 5CD3B 1A6WH 3EO0B 5FHBH 3VD7A 3AAZA 2XKNB 3DSFL 3O2DH 5ESVA 5JQHC 5TE6H 5GRVK 4LEOA 5LGJB 1YN7A 2XOTA 4OZFG 4DZ8A 3DUUB 3NMEA 5C07A 4PY8J 3EYVA 4YPJA 4TULH 3SGDH 2CR3A 3IU3A 4JFZL 5D6DA 5FECB 4FABH 3G6DH 4P3CL 4XBEL 5BRZD 2J7LA 3IFLL 5IW1A 2NY5L 1QSVA 4XMPL 4JKPH 4F8QA 4UAOC 4DOHE 4PGEB 3ZE2F 4BSWB 3CDGA 2F15A 4I0KA 1RJLB 3BP5B 3DVNA 1CGYA 1GIGL 4P23D 3MUGA 5GJTH 4BA8A 3EO1B 4MAYA 3U48A 4TPRH 3CLFL 1OT1A 1A7OL 2VWEE 1HYSC 1ZHBA 2YD1A 5IB1A 4G8EA 5EPMA 4PREA 5ITBL 3BXNA 1LVEA 2BHYA 5D72H 4HWEH 1AD9B 4ZO7A 3VXQB 4UV7L 3W0WA 4UMGA 4CGTA 1DSFL 1PKQB 3V0WH 5FYLD 4XWGH 4QTIL 1CN4A 1T7YA 4OIBA 1FDLL 1AHWB 1MVFA 1OAYL 1JF5A 4K7PH 3SDCA 2HAZA 3GSUA 1TZHA 4KVNL 1JK8A 1I3RA 1CVSC 3FT4B 1UQSB 1W72L 4WWKC 1YQ2A 1E4WL 3HE7D 3WFDL 2EZ0D 2H32B 1ADQA 4PJBB 3VFNB 2QSQA 4HK0A 4K94C 1AGCA 5DGQA 1OTUD 4J2XA 3ZZ1A 4X5WB 4HXBL 15C8L 5E1AB 3MBEB 3BE1L 3RVUC 2YUXA 1JV5B 1FYTA 3EJZD 3VXRE 5DVNA 5IJKA 4MA8L 3QEQD 5CWSB 3OXRA 3ULVC 4LSDA 4CN6A 1B3JA 3VXUB 4CVZA 1MWAA 4KPHL 4M43L 5D93C 3QZWG 2APVA 1NCUA 2YK1L 1RHFA 1ES0B 3QIUD 1OW0C 3GSNA 1DP0A 3NCYS 5IROC 3P3YA 5FUOL 4OLXH 4M6NL 3PWVA 3VXPA 4RZCA 2HH0H 1HHHA 4KI5F 3BRDA 1N6QH 4Q0XH 5AEAA 4EUPG 1PFCA 1KCSL 4X6DE 2BY0A 1FNFA 4NRZB 2QQLL 4PJ5E 1M6OA 5HSFA 1D5IH 4PGBB 1QLEL 4RMSA 1MJUH 4HX1B 2W0FA 2AJXL 2RJMA 1CDYA 4RMWA 5KS9A 1BJ1H 1RU9H 4MYWB 1LE5B 3SDAB 3MROA 4LLMA 1KENL 2A9NL 32C2B 5JIKA 3IJSB 4N68A 1SYSA 3MLXH 1X5ZA 4U33A 4BKLB 4XP9H 3OZ9L 2YBRA 5DJ6A 3RPIA 1BPVA 2NPLX 4G42B 4LCYA 3T2NL 2M8XA 1LD9B 3U2SB 4WHYH 4UDTB 5EOCH 1FQ9C 4ZTPH 2P8LA 3G6JE 1EUUA 3F65A 3FTGB 3VU2A 5L9DH 1BFSA 4ODBD 1MHEA 4JAMA 1WVZA 4L5FH 5FA3B 2A6DA 3RA7H 1D9KD 4M6OL 5HD8D 5E6IA 4FZEH 4HUWB 3MO1A 1YNKL 2M26A 1PY4A 5CLTA 12E8L 1P7KA 1EK3A 5FGCE 4LCWA 4JG1L 4J3SA 2IFFL 2AEQH 8FABA 4LARH 4HIIA 1DBBH 3IFOB 2M1KA 2BXYA 4ZUUA 1XF4A 3I6GA 1L4IA 4MD5B 1Z2KA 1NCNA 2BSRA 2UZYB 2P8MA 2X7LA 2CO6B 3E2HB 2ZUSA 3C60A 4ZDHA