3BGFC

X-ray crystal structure of the sars coronavirus spike receptor binding domain in complex with f26g19 fab
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
211
structure length
210
Chain Sequence
DILMTQSPSSLSASLGERVSLTCRASQEISGYLSWLQEKPDGTIKRLIYAASTLDSGVPKRFSGSRSGSDYSLTISSLESEDFADYYCLQYVSYPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYEHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spike protein S1
publication title Structural insights into immune recognition of the severe acute respiratory syndrome coronavirus S protein receptor binding domain.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Viral protein/immune system
total genus 52
structure length 210
sequence length 211
chains with identical sequence L
ec nomenclature
pdb deposition date 2007-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07654 C1-set Immunoglobulin C1-set domain
C PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bgfC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bgfC01
4HC1A 5DFVD 5EUOE 2VE6B 5GSVA 4NQDB 4Y1AB 3ZKMC 3RY6C 5ANMB 5F89B 2DMCA 2ADGA 2BRRH 4RWYL 3SGEH 1JHLH 3OKEB 1UT9A 3HR5B 4NQXA 3TYFA 4QRRD 3DRQB 4ZXBC 5A2KH 4NN6B 1CXLA 1IGCL 1A3LL 2DM3A 4AEHL 4G6FD 2PYEE 5IB5B 1W72B 1MCFA 4ONHA 4FQCH 4OLVL 1JFQH 4X5XB 1NDMB 4JFQB 2P8MA 2OXGA 5TE6H 1G7LA 5EOCL 1KB5L 1ZLVK 4RGOH 2AJZA 3HUJE 1ZSDB 3HG1E 4R97C 3SE4A 4WCYH 5KSAD 4NFBA 5FKAA 1S9KC 4ZFZB 3L3JB 3FRPA 4CUCA 5EU6A 1ZLUH 1PZ5A 1QQDB 2Q20A 2NXZC 5E7FA 3WXWL 1ETZA 3VGHA 1T20A 1GHFH 5D93B 3NOIA 4HFWA 2GJZB 3GMQB 1UM6L 3BT2L 4HKXB 1A6VH 1Z9MA 2DLFH 4KTYA 4J4PD 4PD4J 3UP1A 2I24N 1IAIL 5MEOB 4V2BA 4LPXA 3MLWH 3P30H 1AFVL 1RZ7H 4TUKH 5JUEL 3Q5YA 2EE2A 1MAKA 3WO4B 1NFDF 2MCPL 5HDBE 2A83B 2DWDA 3TFKD 2NTFB 5C0BE 3P4OA 4OBSA 1G9NC 3OB0K 4NSKA 3RGHA 4QRPE 2GW5A 3FO0L 3MV8B 4H8WC 1MCJA 2D03L 4AEFA 1DVFB 2CK2A 2APTA 2OLDA 3BZFB 4W6YB 2R8SL 1GIGL 3ULUE 4P2RA 2VWEE 4D3CL 3UTZB 3ARFA 5CEYA 2AI0H 5I8EB 2OZ4H 4BELD 4ZAKD 5JORB 5IW6A 2W07A 3GMMA 1J0YA 1IL1A 4CVZA 1FDLH 1NMAH 3KPTA 2Q8AL 3MLTA 3R4DA 3KPRD 2CQVA 5EIIB 1N6UA 3ILPA 5T1KA 1ZLVH 5T1LD 5HGHB 4OUOA 3QDMB 1DE4B 2MQCA 4X7SH 2X4SA 4J1UA 3T2NL 2PXYB 4MB3A 3MXWH 2GQHA 1NDGA 2C7UB 4CMHC 1EIBA 1VGEH 4OFIA 1VB9A 4MXVF 4DOHB 3SGKA 4CMMA 3MLRL 1OHQA 2Y4SA 2IQ9H 4KDTA 5H35B 3DHMA 4NZTH 4Z5RB 2F58L 5FV1L 3DMMB 3WL9B 3PWNA 1BZ9B 3A67L 1CDCA 1HHIA 1LEKB 1N0XL 2OJZL 1BFVL 1NKRA 5TPWL 3S4SG 5HI4D 5DZOA 4KQ4H 2PXYD 5I74B 1PEWA 1KCRH 4Z7NE 1A9EA 4H0IA 1FVEA 3PP4L 4XMPL 3WEXA 1MH5B 4ELKB 1C1EH 2R0ZH 3QJFB 3KR3H 3LN9A 4F7MB 3L1OH 4JDZB 2UYLB 4X98A 5GGVY 1KB5A 2X41A 3AREA 2D9QB 2IPTH 1HH6A 4U1LB 2A0LD 1X5HA 3CMOH 1EGJH 4WUUD 3F7PC 1OAUH 1QR4A 4MZ3A 5D1ZC 5E8PB 5E9DD 5I0DA 1DLHA 3HC4H 3QXDB 4Y5YB 2YD6A 1JTPA 1ORQA 5GGUA 4NNYA 3OGCB 2BHYA 3M1BA 5EA0H 1ZLSH 2AXGA 4WV1A 3ORJA 1F3JA 1BGXH 2FX8L 1I9RL 1NL0L 3IXAA 2JF1A 3VG9C 2WNGA 4K71C 4YHYB 4QHLB 3MA7B 4R2GC 5HYFA 4WY7L 2GTZB 5DRXB 2EDRA 4GXUN 1UEYA 4LARL 3D39A 8FABA 1B0RB 2G60L 3UTTB 5DQJB 5DRZB 1FNEA 1EO8H 4Y5XA 3MROB 4TVSa 5BS0E 3MOAL 5DQDH 5HJ3A 4WU5B 5D6DC 5C3TA 2FJFB 4IM8A 1JYXA 4YNYA 2ERJB 1RHHB 5FECB 2R2CA 4OM1L 2P45B 1RZJH 1NGYB 2Y7QB 4JREB 3T4YA 3WN5C 1RZ8B 3L3OB 3HC3L 3REVA 1R0AH 4Y4HA 3QIWB 3TIDA 1CK0H 1D6VH 5HHVL 1NEUA 1OPGL 5CBEA 4JHAH 2DQHL 1WC7A 3WHE0 3EHBC 1ZK9A 3QQ3B 1WEJH 5DJZA 1J0KA 1CFBA 1YEGH 5HGBB 3VXSB 5JW4N 3RZCC 1IAIM 1HILB 2OI9C 1JNNL 1RJZA 1FPTL 4RIRB 3PE9A 4DN3L 2IALB 5E00A 2EDKA 3FONA 5I1GH 1YDPB 2VLJD 3VGDA 4Y16D 3OB8A 3BKJL 3OR6B 1G0DA 3JVGA 1DQDL 3FCTA 3ZLQC 1HOCB 5FEBA 3H9ZA 3BD4A 1NBQA 5SWSE 1YPZA 1ZANH 1CN4A 1NSNH 1P9MC 3TVMD 2IC2A 1G7IB 2IBZX 1JN6A 1KTLB 4NZUL 4TQEL 3W2DL 1U3HA 4YXLL 1I8IA 3IDYC 1J1XL 1H3WM 4S1QL 2XN9D 1F02I 1T22A 3MYJA 4JRXE 4J2XA 1A2YB 3DX9B 1LO4H 4TVPL 3PL6A 3JSSA 3HLAB 5C0GB 4FXLA 5DQ9A 2A74A 4QHNB 3UTSA 4YWGL 3HKFA 2BOCA 1ES0B 4NKDA 5T3ZD 3VI4F 3LPGA 4PJAA 4ZD3H 2MNUA 5SWQA 4GLRI 4BSJA 4UT7L 3KYMB 1WFUA 2OJEB 4LCWA 5DK2B 2W9LA 2FEEL 3LEVL 4F9PC 3H9SE 3NCMA 5SX5K 1LQSR 2VXUL 5ALCL 5J1SC 3P0VL 2R1XB 1T21A 1G7HB 4PRIB 4NQVB 4WW2A 1S8DA 4HAGA 3BHBA 4O02H 3MLVH 4BM7A 1D9KC 1MCBA 1C5DA 3BIKB 4UINL 2BNQB 4O51B 4OFYA 4GW4A 4AM0B 2UUDH 4JGUA 4YHKH 1BAFL 5BJTB 4JFOA 3ABZA 4ZUVB 3QPXH 5SWZB 1EVUA 5L2JA 1KLUA 4PJFB 4DFIA 1DQJA 1FGVL 1IT9H 4NJ9L 5HHME 1U92A 1S7SB 3CLEL 2VXVH 2R0LH 1Z9SA 1VEMA 3PGDA 3RVXD 1R24A 1MOEA 3H9YA 1ZAGA 3MC0A 3O9WC 1CD8A 5JZ7D 4PP1C 4R3SA 2OTWB 3RWFA 2LU4A 1X5AA 1NQBA 3D9AH 3DXAB 3C5SB 1FIGH 3EOAB 4G9DA 4N0RA 1M6OB 2X9YA 1KGCE 3TN0C 4HG4J 5KS9A 3TZVC 1BD2A 4HK0A 3ELAT 1SY6H 4WU7B 4ETQA 2L7JA 4QOKE 4ZUUB 4Y4KA 1PKOA 5DR5H 3DUSA 5IBLD 2V5SA 1XCQA 4N0UA 5D1XC 4JFDA 4ZQKB 1JRHI 2AEPL 5GIRA 4ODHL 5KW9L 2X4UB 4WWKC 4O5LH 1KCUH 2IH3A 1R3JA 1KEML 1UKSA 2FIKA 3FFDA 3SDCD 1VCAA 3SDDA 4NPYA 2BHUA 4U1NA 5JW4Q 2YRZA 3CVIL 1YNLL 32C2A 2OSLA 5TFSH 4JRWA 3RWDA 3LKSB 3WUWG 4XAKE 1BP3B 4RGNC 3GJEA 1I9JH 4PJBB 3BUYB 3WS3B 1A4JB 2ITDB 1F6AA 1L0XA 1UXSB 3OPZL 4I0PB 3RDTB 1CLZL 1CTNA 4OZFG 5MERA 4GG8A 1J7VR 5SX4H 4LLMB 4PY7B 4X7EC 4XCYB 1AGCB 3ES6A 3A6OA 1T83A 4NRXA 4RISH 4D9LH 3X3FL 4H1LB 3L7FB 1ZWIB 1QKZL 3T0VA 3O3UN 3C5JA 4JRYD 3C08H 5IBTH 3KDMA 2R39A 1QLFA 3V6ZA 4R7NB 1VFAB 3GSWA 1X4XA 4PJIF 4L8SB 3RVTD 5IVXF 4O2FB 3A6CL 5I1DB 3WFDL 3MGTB 3RDTD 4M02A 4HJJL 5D7SH 3DUUB 4HIIA 5L6YH 5HDQH 4UILH 1XF5A 3QWRA 3OAZH 4LCCC 2FWOB 4X6EB 1QSEE 1KCVL 1Q9OB 3OJDB 1QSFB 1YY9C 5KTEH 1S7UB 3MMEB 4M1CC 3VJ6A 1ZS8B 3D0VB 2IAMB 3HB3D 2KH2B 2V9RA 3OKLB 4Y2DC 3QNYB 4XC3L 4I3SH 4FQQA 2AV7A 5EU7C 3SKMB 3FO9A 1NGPL 5B3JE 3U9UB 2ZCKL 1R5WB 3O41A 2YN5A 1I8KA 1W72L 1A1MB 1I1CA 5C0JA 5EU5A 4GKZB 1RZKH 3ZDZF 4D9QE 2B7DT 5E6YA 1NCTA 1HXYA 3VFOB 1QSFD 2DQTL 1CDHA 4OZGB 1T03L 3DTXA 4P2OB 1CT8B 2FO4B 4L4TE 2IAMD 4X8JA 4JGJA 1P84J 3VFMB 5TQ2L 2X5PA 3C5ZC 1IAOB 3QI9A 5D2LE 4HV8B 5EZOH 3QXWA 1CGYA 5CJXA 1L6ZA 1QFUH 4HGMA 2C3VA 4M7JL 1J1PH 5D7JA 3KYOB 2P4AB 3J7HA 1FH5H 2NQCA 2OCFD 4LOUD 2O5XH 2VISA 4S1RL 2ZPKH 3U0WH 3I02B 4J6RH 1ZT7A 4V2CB 5D1QB 2IANB 3HE6B 3RVWC 1MIEL 1T0MA 2W65A 2G5RA 4ELMF 3FFCB 4AQOA 1GAFH 3MRFB 4MAYB 3OHXB 1KIQB 3F62A 3BP5A 3L95B 2ESVA 3VCLB 4NC0B 1CL7L 2VZVA 1E27A 4MVBC 3BQUC 4RAHA 3LEXA 4FQXC 1OGAB 4Z7VA 1G6RH 3QEQB 4UTBL 2Q86A 2ZKHL 5T3XD 3T0ED 2XTJD 4YLQT 1SEQH 1XZ0B 2BK8A 4EUPG 5MI0C 1G7JA 5FFLA 1RHFA 3MNZA 1DBBH 4U1IB 1JGUH 5D1QD 3NFSH 3GSRA 5E8DH 4YDLB 5CAYB 3FFCD 12E8L 2WIMA 3GIZH 4GAJH 4NC2B 4WHDA 3QDJB 4ZUTA 1RZFL 3LSOB 2EYTB 1AE6H 2FEDC 5CP3A 2NZ9C 1OTSC 4KDWA 4OKVA 5EO1B 4GG6F 4WEBH 1YN7A 5D7IA 3UROR 1A6UL 4ODUA 4U1KB 1OOAA 1MFBL 4KJQC 5I9QC 1ED3B 5CIPB 1KELH 2VE6A 2XYCA 4NQDA 1YNKH 2KQNA 3MRCB 4Y1AA 1EFXB 4K8RC 4HHAB 5ANMA 5F89A 4Z8FH 1FG9C 1RIHL 4MZ2A 1KSRA 4M43L 1IZJA 2BVQB 4PRPE 5F7YC 3OKEA 1MNUH 3QDJD 5HGGS 4WW2F 3HR5A 3MJ9H 5BZDB 4MMXC 5DWUL 5AWNL 4XCEA 1RIVH 3S8WA 4XTRC 2PF6A 3QFJE 4PD4K 2XTLA 3PWPE 4OCWL 2NR6D 5E56A 4M7KH 3DYOA 5HYSB 3ZDYE 5IB5A 3RI5K 1W72A 4M93C 5EO0B 5IB1B 1G7QB 1X5KA 2NY3D 1T1ZB 3IU3B 1NDMA 4X5XA 4ZTOL 4JFQA 3RWIB 3BPLB 1ND0B 1KYOJ 5C0ND 3OSKA 1ZSDA 1JJUA 4X7FC 4ZFZA 1FAIL 3C6SB 4KMQA 5JDSB 3L3JA 3UJTL 1UQSA 3KPOB 2R29H 1P5UA 2CUIA 4BH8B 1VACB 1QQDA 4HXAH 2HFGH 4PJXB 5DVOA 1TJIL 5T1DH 2X44D 2CR3A 5LBSL 1ZT1B 4K3DH 2FBJL 1DP0A 4MD5B 3MRJB 3EJZC 3GMQA 5FYJD 4MA7L 4HKXA 3GKWH 5MEOA 3BXNB 4QHKI 5HDLA 4P5TB 2FCBA 1GRWA 1EHAA 2A83A 2NTFA 1B4RA 3B2UC 1H8SA 2FB4L 3S3SA 1YMME 3MV8A 3RIFK 1DVFA 3BZFA 1HYRC 4CJ1A 1U8MB 5ICXA 1GC1C 4KRMB 3UTZA 2IBBA 1R3IH 1N3NB 2LU3A 5I8EA 2O26U 3MBEC 4L8BB 1TETH 3LQAH 5JORA 1KCSH 4M5YH 1S78C 1DANU 5EBGA 5HD8D 3HCVB 4P5TD 3P0YH 2GTWA 4N8VB 4P23B 3MQIA 4V1DD 1ZTXL 5F7MC 3BPNC 3C6LB 5EIIA 5HGHA 1NUNB 3QDMA 1MJ8L 2C7UA 1QLEH 3U0PB 5J8OA 3CDGA 2YA0A 1DUYB 2CKBH 4EQ2A 1DEEB 2VUYA 2WQ8A 5H35A 4Z7QF 2EKSB 3I50L 4NJAL 4Z5RA 5CD5D 5GRJL 5F9DC 3NTCH 1QOKA 4HMDA 2GCYB 3DVGB 5EOTB 3DMMA 3WL9A 4G3YL 1BZ9A 3LN5B 1UA6H 4LSQL 1LEKA 4P23D 3V4PH 3QG6B 4KTEL 1IQDB 3VD4A 3NIFF 5F7EH 5IW1B 2NY6C 1DBKL 3BGFC 5DD5H 3PDOB 5DUBB 3QIUD 3X11B 3L3GB 1DBJL 3VFPB 1MY7A 1MH5A 3GK8L 5HI5D 1J0HA 2P5ED 4ELKA 3O81A 4UIMB 3QJFA 1CG9B 3QP3A 4OLYL 4XPTL 4F7MA 4JDZA 2UYLA 2J5LB 3FO2B 4GRLD 3ZE2F 4HLZH 1SHMA 4GXVL 3L3DB 1IGJB 2F5AL 3QT2A 5IROA 1KOAA 3NAAH 2WP3O 4I4WB 4U1LA 4KV5F 1QG3A 5I16B 1JZ4A 1OWRM 2WINB 4LIQL 5AYQA 3B9KC 5F3BB 5E8PA 4XCFH 3NFPB 3BRDA 3QXDA 4Y5YA 2EYSB 1JV5B 5GZOC 3OGCA 5CZXD 1MRFL 3IKCB 4RCAA 5TGBB 1WFOA 4U1SB 3DBXB 3LOWA 1TMCB 6CGTA 4I3RL 4JO1H 4U31A 3V9FA 4ZOCA 4G8IA 5IHUH 3HNTL 4QHLA 3MA7A 1OTTD 2GTZA 4NM8H 3RTQD 5DRXA 4G8FB 2P43B 4NP4L 1B0RA 3UTTA 5DQJA 2AP2A 4Y8DC 3EOTH 4Y4FB 5DRZA 4I2XB 4MA8H 1DQMH 3R8QA 3MROA 4WU5A 3LPFA 5GGQH 1OLZA 1KNOB 5IOPB 2XQBL 4P5KB 4OBRA 3LKRB 2NY2C 1RHHA 3V0WH 2RBLA 4UBDC 5FECA 1M05B 1KN4L 4OGXH 5CEZE 5E8NB 1NGYA 4HW6A 5CSBA 2Y7QA 1RZ8A 3L3OA 1TPXC 5IV2B 1X3DA 3QIWA 5GGTL 2H32B 2WWMD 2NW2B 3BRFA 5DMIL 5AYUL 4GAGH 1ZE3C 3INUL 1KB9J 3MRKB 4LLYB 3ARPA 3QQ3A 3U30B 1RIUH 5HGBA 3VXSA 5FYKU 1HILA 2QSCH 4PYHA 4OCMC 1G0YR 4NN7C 2YXFA 2RQ8A 2IALA 2O5ZL 3SDXF 4LDLB 1LMKA 1YDPA 4LSTL 4YEEA 3X13B 1LILA 2Y6SC 3VGAC 1P7QB 1OAZH 1S7QB 1KACB 3OR6A 1A8JH 2SEBB 4XB7A 2YBRB 1HOCA 2XY1A 4CNIB 4CN6A 1B9ZA 1A21A 3F7VB 4XBEH 4TTGA 4P0DA 4EN3C 3D2UD 1T1XB 3ARGB 1AO7B 4TNWK 4NQUA 4NYLA 3RI5F 3IDXL 4QKXB 1KTLA 4ZNEA 5CUSL 4QF1B 4WGWB 5DJAB 5FHAH 4YHLH 4YBLC 4NWUH 4OCNC 1F8TH 1BIHA 3PG2A 3MA9L 2J8UE 2JIXB 1F97A 3DX9A 2MKLC 2VDRL 3HLAA 5C0GA 4MJ6B 2PYED 4KKAC 1KTKE 4QHNA 1EJOH 1ES0A 4D94A 3WIHH 3GSNB 4KPHL 4NO5B 4OD3H 1G84A 4LQFL 3HNSH 4WI8A 3WNOA 3KYMA 3V52L 4APQC 2AQ2A 2OJEA 4LVNB 3UC0L 3DX7B 3T3MF 4JQIH 3HG1D 5DK2A 2E6QA 2W0FB 4GKSB 4P46C 4PJ8B 2Y07L 3QCTL 3W11C 1MCRA 4JQXC 2HJLB 3HE7D 4JG1L 1MLCB 2R1XA 3RIFF 1G7HA 4PRIA 4HG4K 1CGSH 5HYQB 3H0TB 1IILE 1UKTA 3FN0L 5KOVC 1WZKA 5E6ID 4QNPF 4U05A 3QEGL 3BIKA 2HG5B 2BNQA 4ODSH 4R4ND 4O51A 4X4ZA 1UVQB 2OR9L 4AM0A 3HA0A 1GOGA 4HMCA 5BJTA 4I8DA 5ADPH 4XP6H 5GGTA 5T3ZH 4F7EB 1L6XA 5SWZA 1FP5A 2DKSA 5C0BD 2GY7B 3F8UB 4JANB 4QRPD 1QA9B 3U4AA 3EDDA 1S7SA 4HS6B 4TTDC 3EO9H 1UM4L 4N0YL 3RU8H 3ULUD 3KYKH 3CSYB 2NY5H 3GHBL 1YEJL 4QXUL 2L4OA 4AIOA 2OTWA 3BKMH 2NTSP 1RV6X 3DXAA 3C5SA 4LMQE 3EOAA 1DDHB 8CGTA 1U8KB 3TH3T 1M6OA 1TZHB 2R56H 1NMBL 5H8DA 3PXJA 1RZJC 2YMXH 4WU7A 1SBSH 5ALBH 3DX8B 4ZUUA 5GZND 4JO4L 4OZIE 5DUPH 2XZQL 5EU7E 5L88H 2P8LB 4OV5B 3K8KA 4UOJA 2NY1C 1EV2E 4ZQKA 1QR1B 2X1WL 4NBXB 4Z7WE 1Y6NR 2X4UA 2AERT 4X80L 4DW2L 4OLZL 1A6ZB 1K85A 3H8NA 1JGLH 5DDHB 3V4VL 1FZJB 1MJ7H 4N1CA 3HAEG 4I77L 3CDFA 3KPMB 4YC2C 3RPIB 5LXGH 1GGBL 3L3IB 4M6OL 3P9WB 3TT1L 3LKSA 2B1HH 2R0KH 5F44A 5B8CC 4PJBA 3BUYA 3WS3A 1A4JA 1QTYT 3OAYK 1AC6A 2ITDA 1UXSA 1MVFA 4I0PA 3RDTA 4EDXA 5C0AB 4XPBL 2I25N 4DVRH 3TF7C 3E0GA 4LLMA 4PY7A 4H25B 4XCYA 1AGCA 1R3KB 4WFGE 2VL5B 4H1LA 3N1PC 4YZFE 3L7FA 2NY7L 4HULB 1ZWIA 4LLAA 4MMZC 4GOSA 1CU4L 3W9DB 5KSVB 4A6YH 4FQIH 3FT4B 4R4FH 4R7NA 4PRBB 5KOMC 5HDOA 4L8SA 1OWWA 2HKFH 4O2FA 2VDPH 5I1DA 3VGGA 3MGTA 1KJ3H 4WWID 2NXYB 5E6ZA 1Y0LB 1CF8H 3MJGX 3DUUA 2PTTB 1BMGA 3D69B 3B9EA 1P84K 4Q6YA 5HVHC 4LP5A 5GHWL 1ZHLB 1DJSA 2FWOA 4X6EA 3WS6A 4EBQH 5BS0B 1Q9OA 3OJDA 1B4JL 1BOYA 1VFBA 4QHMB 3VRJB 3O8XD 1S7UA 3MMEA 3VD7A 2CDEA 1AXTL 1ZS8A 2DQFB 3D0VA 4YQXH 5IFAL 3W82A 2IAMA 2E7LA 1YJDH 5B39G 1A14H 2V17H 2YKLH 3OKLA 3VW3H 1X4YA 3FB8B 3QNYA 4JB9H 4AEIL 1FSKC 1KXVC 1N5YL 5J3HD 4UT6H 3SKMA 5CD3B 2DJUA 3U9UA 4M48L 3VXNB 3TBYB 1R5WA 2ZUYA 4HZAA 2I27N 3Q1SL 1A1MA 3G6JB 2ILLA 4X6CB 4GKZA 4KU1A 1MIML 3VFOA 1PY4A 4OZGA 2PW2B 1II4E 3LRSA 4Z7OE 3P11L 3MNWB 5DC9B 3V4UL 4P2OA 3QUXB 1CT8A 1F13A 2HRPL 2FO4A 3NIGE 3VFMA 2VDOL 4N90E 1IAOA 1LWRA 2JCCE 4MCZB 4U3CA 4P3CL 3DARA 3EYOB 4X6BB 3KYOA 5EU3B 2GJ6E 4L29B 2VZ3A 2YD2A 4PJCB 3JV4B 4JM2D 3RIAK 5LVEA 3I02A 3B3IB 1U8LB 4UB0L 1Z6JT 4AY0A 4LGRB 2CK0H 5D1QA 2IANA 3BVNB 3HE6A 3VI3F 1QFWH 3QUXD 1CICC 3U7WH 1JK8B 3FFCA 1HCVA 1Q72L 1VFOA 3BYTA 3MRFA 3VXQB 4MAYA 3OHXA 1KIQA 4TNWF 5KG9B 1YEIH 2FH8A 3L95A 3VCLA 2LQRA 3MBXH 3TO4C 2FJGB 3SE9H 1KT2B 3M45A 1T66C 3OG4B 1OGAA 4N9GB 5FF6B 3QEQA 4I18B 3FQNB 2WAHA 5GGRY 1XZ0A 4FMFA 5IKCB 1T0NB 1CFSB 4U1IA 1FL6B 1H0DB 4IS6B 5SWSD 3QDJA 3RKDC 1GPOH 5F7NC 3LSOA 2EYTA 4XWGL 3QXAB 5CJ5A 1FFRA 5DT1H 5EO1A 1RMFH 4U1KA 4MAUL 4YK4C 2Q6WB 1WT5C 1ED3A 1KYOK 5CIPA 4GRWF 4LGSB 1KFAL 3H9SB 3LQMA 1EEQA 3MRCA 1M7DB 1EFXA 1WJ3A 4HHAA 4U6VL 4HWBL 4JRXD 2CGRH 2WUBH 4YDKL 1RJLB 2EXYC 1E4XI 4OZHB 2EICA 2EH7H 4C4KT 2BVQA 2F8XC 1FL5B 5T3XH 4G8GB 3PF2A 5BZDA 5TDPB 4WO4C 4OB5L 4ZG1A 3QO1B 1S7XB 5F1IB 3VRIB 3P9LB 2QQNL 5HYSA 4WGVB 2E8ZA 3H9SD 5EH1A 5EO0A 5IB1A 1G7QA 4G6AD 2J88L 1HEZB 4Q9QH 1T1ZA 3IU3A 3TCLB 3RWIA 3LEYL 1TVHA 1ND0A 4PJFF 2X4TB 1ACYH 1WBYB 2P8PB 4X83A 4TUJB 4QTIL 1VADB 2C3GA 3C6SA 4EIGB 2MMXA 3PHQB 4XVJH 5JDSA 2CJUH 3KPOA 5TF1H 3D0LB 4BH8A 1VACA 1BM3L 4PB9L 4PJXA 4UT9L 3QHFH 4GFTB 1FGNL 1H8NA 1ZT1A 3VFSB 2AK1H 5KVDL 1MCEA 5DVMA 1DBAL 3MRJA 2B0SH 5HHMD 1JF6A 5FB8B 3AC0A 2H1PH 3BXNA 4ODVL 1A7PL 3O4LB 1C5BL 1CGVA 3HMWH 1LNUB 3MOBH 2BVOB 3MUJA 4KTDH 4ODXB 1W8NA 1AD9B 1KGCD 4YX2H 1U8MA 1P69B 1TLKA 1TNNA 4YDJB 4MNQA 5F9OL 2WUCH 4QOKD 1FYHB 1IRAY 1N3NA 1XF2B 4BYHA 4L8BA 2HT2D 1P4LB 1HHGB 4ZSOE 1U91B 4PJBF 3T0AA 4ENED 3E3QC 3HCVA 4N8VA 2X89D 5EG6C 4R96B 4PLNC 1MF2H 3C60B 3JWDL 3C6LA 5BRZB 5FYJH 4JPVL 3U0PA 4DAGL 3RKPA 4QRTB 4XAKD 3D3VE 1DUYA 3VWKC 1F4YH 2EE9A 4PJEE 5L2KB 3CX5J 4HWBA 2EKSA 2VERN 1QBLL 4P2YA 1JYVA 5GS0D 2GCYA 3DVGA 3KS0J 1L7IL 3CU7A 3LN5A 3FJTA 2AJ3B 5B3NA 2BSRB 4MJ2A 4NO2B 1QVOB 3QG6A 3JWOL 4XVUD 1IQDA 1WQVT 3TPKA 4B0MM 4NOBA 5EUKB 5IW1A 3PDOA 5DUBA 3X11A 3L3GA 3VFPA 4UIMA 2ZSVB 4WHTB 1CG9A 3WFCL 1QFOA 1N64L 4QWWC 4HS3B 3S37H 3L3DA 1IGJA 4I4WA 1UM6H 1JNLL 4BQBA 1F3DJ 1R3LB 1G9ML 5I16A 1QSED 4F37K 3KYAA 1QUNA 1U8JB 2WINA 3B5HA 4J3OC 2MCPH 5F3BA 1U9KA 4ZMAT 3NFPA 3U6RB 4HEPG 1UZ6F 4FFVC 2EYSA 1JV5A 4L4TB 4ZXBB 1YQVH 2EDTA 3LZFL 1P6AB 2W59A 3LB6D 3ZL4L 4MX7B 3IKCA 1CVRA 5TGBA 4D3CH 4U1SA 1U3JA 3DBXA 1DLFL 4R90H 2A38A 1KLFA 3ARXA 2BY0A 1INDH 2F8OA 4D9QD 5D70L 2JJSC 4DVBB 2BNRE 3RIAF 2EC8A 3GSNL 4R97B 4G8FA 2Q8AH 3MV9E 1Y18A 3QYCA 4U0QB 2VKXA 4L4TD 4MNGB 4ZXBD 2EO9A 4JDTL 1T7VA 2H3NA 3HI6L 4Y4FA 3BH9B 4I2XA 4OSUH 2NXZB 1YNTB 2Y5EA 4K94H 1DFBL 1KNOA 5IR1B 4P5KA 4NRYB 1HI6B 4KMTL 2UZIH 3LKRA 1MCPH 2AXFB 3A67H 2DTMH 2I26N 1M05A 1N0XH 3S34H 4B7LA 4LRNH 4IRZL 1MFEL 4XX1G 5IV2A 2CKNA 1QYGL 2M2DA 4UV7L 4E41B 4EOWH 2H32A 3P9MA 2NW2A 3TWCL 5KSAC 1QZ1A 1R5IB 1BJMA 2Y5TB 3MRKA 4LLYA 3LQAC 4JFFE 3TT3L 3JBG7 1J1OH 4WW1B 4M7ZB 1S9WB 1PG7H 2P46B 3PP3K 3HC0B 4NDMB 1WFTA 1S9XB 4J4PC 4LLQB 1P7QA 5AZEH 5IEKB 1BVZA 1S7QA 4LHUA 1WFNA 4CMHB 1KTDB 5BMFH 2SEBA 4XMLH 4TPRL 1B3JA 2YBRA 3ZE0F 4CNIA 3TFKC 3QFJB 2HKHL 3F7VA 2XA8L 1I9IL 3NFNB 4LEXL 1T1XA 3ARGA 3IFOB 4C56E 1AO7A 4FP8L 3F6IA 4OCSL 4YFLI 4KI5C 3VGEA 1V7NH 4HEME 2LFGA 1A7RL 4QF1A 2BVUA 4ZAKC 4FG6C 4PRPD 1A3QA 5DJAA 1Z3GL 1JRHL 1OAKH 1YECL 3NCCB 2G60H 3V8OA 1GOFA 4PJGE 3QIBB 4KVCH 4LFHG 4JN2B 5A3IC 2JIXA 4EI5C 1CFNB 1BBDL 3PWPD 3ZTJH 3MOAH 1ADQL 3DURA 3F7YB 2UWEF 3LIZL 5DD0H 4AJ0A 5HHQB 4GBXA 3GSNA 3TYGL 4XNQB 4B5EA 4NO5A 3SKJH 5CP7B 5D5MA 4DKEL 5EWIH 3GSVB 2YWYA 4JFEB 3DX7A 1NANI 2DQJL 1WWBX 2W0FA 1OP9A 1A7QL 4GKSA 4PJ8A 1S5IL 1B0WA 3HC3H 5D1ZB 3D18B 4KUZL 2DOCA 4F2MB 4L3AA 3U1SH 5D4QA 1MLCA 1MFAH 3WSQL 5HYQA 3H0TA 3ZDXF 5CCKL 1KUMA 2F53B 5IT2L 1JE6A 1DANT 4LU5L 1KEGH 1DN0B 3MLZH 3VG9B 4O2EB 1L9NA 1MCOH 1FPTH 1UVQA 4K71B 3ZKNC 5KAQG 4R2GB 1S3KH 5KBNC 3W5NA 4F7EA 3QXUA 3SDYL 2A0LC 4JANA 2HH0H 1YMMD 1QA9A 1X5JA 3AVEA 4YHMH 1A7NH 4HS6A 3BKJH 4Q6IC 3IYLW 3CSYA 5E4IA 1U8QB 3I85A 2Y1VA 2OP4L 3OZ9H 4HF5L 4E42B 4WHYG 1DDHA 2H26B 1U8KA 1TZHA 1V3LA 1OP3H 3WUWB 4HCRH 3H3BC 5GGSY 4R2GD 2R4RH 5JHDB 4LCIL 1DZBA 5KVFH 3DX8A 1BF2A 1T89C 5D2NC 1NCDL 3WN5B 3ZSSA 4XT1C 2P8LA 1TNMA 3L5XH 3HN3A 2ZCLH 1CZ8L 1FV1B 2P24B 5T5FL 1QR1A 4JKPH 2R0WH 2CH8A 4IRSD 4NN5C 5J13C 5IMOB 1J0IA 1BVKA 1A6ZA 5DJ8B 2EDLA 5IWLA 5DDHA 1M71B 3NIDF 4GW1A 1FZJA 2VLKE 4BSVB 3O6LL 3KPMA 5CZVL 3RZCB 3RPIA 3L3IA 1HE7A 1ZVYA 2ICWJ 4AENB 4P2QE 4JFHE 3ZT6A 3LRHA 2EZ0D 2AJUL 3GRWH 3QZWB 1MPAH 4F37F 2C4XA 4HKZB 5ISZD 3O3BB 3NH7L 3MODL 4OGYH 3CK0L 3ARUA 5C0AA 1NFIB 1ADQA 4MLIA 3V8CA 4QXTB 2VXUH 4JVWA 2YXMA 4H25A 3O6KH 1R3KA 3BESR 2LVEA 2VL5A 5C07E 4O00A 4URTB 3GO1H 3EHBD 3AM8A 4DK3A 2C3XA 3O6FC 3G6AB 3QISA 1MCDA 3W9DA 5KSVA 2O61B 4IJ3C 3FT4A 1SEBB 4PRBA 3F58H 4KQ3H 5FUOH 5E94B 4XPGL 6FABL 2VLLB 3IDYB 3DIFA 3WIIH 2VLRE 4NFDA 4Z7UE 3G5VB 1Y0LA 3OJVC 5KSBE 1OW0A 2NY4B 1I1AD 2PTTA 3NABL 5C08B 4M1DL 4J3SA 2OXHA 2PCPB 3D69A 4M1GH 4G8EB 3V7AE 3SO3C 1ZHLA 5BS0A 4Y16C 4IMLB 3CXHJ 4K3EL 3BSZH 2CRZA 4QHMA 3VRJA 2VNCA 3EOBB 2DQFA 3GFUA 2LVCA 1I7UB 2VDLH 5GRZA 2WANA 1A0QL 1BJ1J 1EUTA 4OZ4B 4M7LT 3FB8A 4LSRL 1OQOA 1RVFH 1CBVL 3RX8A 1URLA 5CD3A 2AK4B 3TBYA 3WFBH 3G6JA 4X6CA 2E7BA 1WZ1H 2PW2A 1JUFB 4MD4B 1D9KB 4K3JH 3MNWA 4P5MB 4FA8A 4JFPB 5IVZB 1UACL 4HLZG 1YNLH 1NH6A 3BDYH 5EUOF 4WTZA 3JV6B 5CEZD 5F70A 1K8IB 1FNLA 4JPIB 4K2UL 4MCZA 3S35L 5F7WC 5GISH 1ZA3A 3K1DA 3EYOA 5EU3A 3WNLA 3GNML 3HNVL 3L7EB 4L29A 1GZPB 4EUPB 4K23L 4PJCA 5ACZA 3JV4A 2XV6B 4FZ8L 5DD1L 1U8LA 1BWWA 1E0OB 2NY5C 4ZO9A 3QSKB 3BVNA 1QLRB 3O9WB 4MJIB 4RMQA 3VXME 1JK8A 2VKWA 2DYPD 1X6NA 4TSCH 5FO8B 3VXQA 1IKNC 4N0FB 5KG9A 5C7XH 4FFYH 1X5GA 1OM3L 1MHCB 5HHXH 2IGFL 2FJGA 4G6KH 1I9EA 1KT2A 1FRGL 4N9GA 3A6CH 2F15A 4JHBA 5FF6A 4I18A 4FHBD 3W0WB 2F19L 3FQNA 5IP4A 4FQ2L 5D1XB 3HUJF 4YAQB 4Z18A 5LGJB 1IAII 4K7PL 4KFZC 4AZ8A 5IKCA 1T0NA 1TITA 5TE4L 3T04D 5HHOB 2J8UB 3O9WD 5I8KH 1CGWA 3T1FB 4PP1D 1FL6A 2FX7L 1H0DA 3H3KA 4IS6A 1FL3B 3QXAA 3TN0D 3RVXC 3TZVD 4F9LA 1BLNB 1LK3L 1IFHL 4PJ7B 4WRLA 4RGNB 1BQLL 2KZ1B 2Q6WA 1G0XA 4AEEA 4ZFFB 1EFQA 4O9HL 2YPKB 2DF3A 4TSAH 5ENWB 3VD9A 5IQ9B 3T77B 1M7DA 3E3QE 2ZCKH 1RJLA 4LLVB 3BE1H 4WWKD 5HDBF 4XVSL 4OZHA 1XMWA 2V2TB 1YC7A 2M26A 1FL5A 2WBWB 4Y0GA 4MDJB 4G8GA 2VDMH 3DVIA 3CH8A 4RZCB 4ZNCD 1T03H 1MCCA 5DK3A 4D8PB 1LGVA 3ULUF 5E5RB 5TDPA 1OGTB 4U49A 5EOQL 2D2OA 1IC7L 1S7XA 5F1IA 4HGKC 2ARJB 3VRIA 3P9LA 5TQ0L 3TBSB 2I5YH 5EFIB 3RUGE 2X1OA 4KHTL 5JIHA 4L1DA 3GSOB 3F5WB 1IAMA 1MEXH 1HEZA 2PO6C 2BSSB 4X6FB 3VFRB 5J12C 4R9HA 5D8JL 3TCLA 3REWB 1R5VB 4LCCB 3DWTA 4S1RH 1QPPA 2X4TA 1RFDH 4WI2A 1WBYA 2P8PA 4TUJA 3VFNB 1VADA 5I1HL 1MIEH 4DN4L 3VXRB 5JXEC 3PHQA 1Q0XH 5E2WL 3QH3B 1LD9B 1YJDC 3KPSE 2EECA 1YYLH 4Y2DB 1A9BB 3VFSA 2Q3ZA 2I9TB 3S98A 4ETYA 4PJ9A 1FZMB 4P48A 5FB8A 1J88A 1OSZB 3SJVB 3RVTC 3L5WB 3O4LA 4KAQH 4KRPC 5EN2B 4Z7WB 1J05B 4Z7NF 1LNUA 2BVOA 1XR9B 5B21A 4M1CD 2Z8SA 3Q3GB 4G9FE 3FQTB 2FHFA 3CX5K 4I0CC 2EE3A 1N5AB 1U3ZA 3EGSB 4ODXA 4ZO8A 1AD9A 2X40A 1V3JA 4Y2DD 4C55A 4NM4H 4F8QA 1A6UH 3UPCA 3MACL 4Z0BL 1XF2A 2VUOA 4WI9A 1P4LA 1HHGA 1U91A 4TYUA 1TCRB 1PW3A 2IPKB 3TBTB 3C09B 4Q7DA 3N1MC 3L3KB 3F65A 5MP6L 3ULVE 4KJYB 4IOIB 4R96A 3C60A 2DTSA 3VDCA 5BRZA 3GMNB 4FQLH 2DD8H 3C5ZD 1RUAL 1G9NL 3G04B 2ICEB 4H8WL 5F3HB 2WWKT 2EYRB 1Q8MA 1N0LA 5L2KA 5GRVK 3BQUB 4FQXB 1OAQH 1NLDH 4CVUA 4XC1L 4DKAA 2K7QA 4FXKB 5MI0B 5ID1B 1EHLL 3HI1B 2AJ3A 1NGQH 2BSRA 4NO2A 1QVOA 1M7IB 4OLWL 4WFGD 1MRCH 2XACC 3RVWD 1OCWL 4XP5H 5EUKA 5F7KC 3DVNB 1OD9A 3U83A 1LO5B 3PNWB 3SOBH 5HBBA 4EKXA 4WHTA 5I9QB 4MVBD 3BQUD 4WDIB 3SE3A 3BIAX 2VN7A 2FBJH 3QULB 1FORH 2HLAB 5FGSA 4HS3A 3U46B 2RB8A 3G9AB 3OKNB 3QFDB 5KVGL 1R3LA 4KC3B 2FDBP 3DETD 4ALAL 3BEVB 5GS0H 1YA5A 1U8JA 1PYWB 3S97C 3O2VL 2BVPA 2ICES 2EIBA 2WBJB 2X4PB 3U6RA 3KAAA 2FEDD 5LG1A 4WNQB 2NZ9D 1OTSD 4ZXBA 4KJQD 4MX7A 2JCCB 3ALPA 2ADJB 1EVTC 4JGMA 4LVEA 1AKJB 1NBVL 2VXTH 1J8HE 4M93B 2AJYL 1C16B 4KI5E 4M6NL 3PWLB 4DVBA 1EEZB 2FH6A 1CE1L 1ZTXH 4P9HL 1NFDB 4J8RB 4MNGA 3WJLA 1KIUA 1DSFL 3KPRE 5I2IB 3QG7H 3BH9A 5INDB 4N90D 3U82B 5I19L 1CI5A 1YNTA 5BZWB 4BZ2H 3KGRA 2APBA 3I50H 4NRYA 1HI6A 4BQ9A 2GJ6D 2AXFA 3D48R 1ZEAL 4G3YH 4Y19A 3HZKB 3Q6FB 4LSQH 2GT9B 4UAOC 3AXLB 5IVNA 4KTEH 2FEEI 2NY3C 1AHWC 3ULSB 5L7XL 3U48A 3CCHB 4UI2A 1HZHH 1BVLB 1LP9E 4E41A 1L0QA 1WICA 1UM5L 5DMYA 4JZOB 5C0NC 1BFSA 5J6GB 3UX9B 1R5IA 1AXSB 1NC2D 3GK8H 3NZHL 2O5YL 4N8CH 4NQEA 3CZFB 1VEOA 2Y5TA 4J12A 4ZS7L 2UY6A 3EJZD 3SGKC 1U93B 4KWUA 4KDTC 1PX4A 1LEGB 5CGYC 2HAZA 4WW1A 2Z92B 4K3HA 3Q6GL 4F58H 1S9WA 3ARBB 5BCAA 5BOPA 2HVKB 3HC0A 4NDMA 3B2UD 4LIQH 4NQCE 2B39A 1S9XA 1DN2A 2X1PA 1F4WL 4LLQA 5DHVB 5IEKA 1HNGA 1CFVH 3DI3B 1WAAE 3CAFA 1KTDA 2H2SC 4LSPL 4MHHG 1I8LC 3FMGL 2BC4A 2DI7A 3QFJA 2GYSA 3MBED 3GBNL 25C8H 1INEL 4I3RH 1OSPL 4O4YL 5IBUG 3E6FB 1S78D 3BI9X 2Q76B 4XPHH 4YUEL 1Q94B 2F54E 1KTRL 2A6JB 5CKAA 3C2AL 2VDQL 4M62H 1TIUA 3TA3D 5D2NE 2VJXA 5FM4A 1Z5LB 4JCMA 4Y88A 1MAJA 1FAKT 3PQYE 3BGFB 2W9EL 4XNXH 4EZMA 2FD6L 4JEGB 3BZ4B 3O2WH 3QIBA 3GJFB 4YHOH 2MSPA 4JN2A 4OM0L 4HUUB 2ZNWA 1BFOB 1CFNA 1SM3H 4X8XA 1CLOH 3F7YA 1A6WL 1Q38A 5HHQA 2DQDL 4WV1C 4QXGH 4XNQA 1C08B 2YA1A 5CP7A 4WFEE 2DIAA 3GSVA 5CD5C 1JPGB 3FQWB 4JFEA 3RGVB 4YXHH 1ZVHA 1NCBL 2NY6D 1NCAL 3KPQB 3LQZB 3B9KB 2E3VA 5D1ZA 3D18A 3KHOA 4LRIA 3MFGB 3ZTNL 2XWBB 2J1KA 1N2RB 3BP6B 5GGTH 4F2MA 2IWGA 1BIIB 2EDOA 2ATKB 4HBCL 5GGVH 5AYUH 2F53A 1XGPB 1A5FH 4NZDA 3WFEL 1DN0A 5HI5C 4D9RE 3KXFE 4O2EA 4ZSOB 2V2XB 1TVBB 4LASH 4QGTA 1HK6A 5DEFB 4GRLC 3B9KD 4CU7A 3FQXB 3EYUH 2W9DL 5HYEA 5J06A 5GZOD 2D3VA 5E2VH 2XFXB 1FJ1B 3GI9H 1U95B 1U8QA 1AIFB 2Z31A 4K94C 2BDNH 1FHGA 4LNVA 1D7FA 4E42A 1CDBA 5JHLH 3ZT7A 2NY2B 3V6OC 3QDHA 2IBGA 3WUWA 5J6HB 3C9NA 1UFUA 1D6EB 4NKIL 4XP4L 5JHDA 1MQKL 3MLYL 5C2UB 1ZHBB 3VRLE 4KXZI 5CUSH 1MCSA 2DDQL 3LS4H 2D0FA 1I1RA 1AC0A 1FV1A 2P24A 4FQJH 4XNZC 2I9LB 1NCUA 3D3VD 5F8RC 5IMOA 5DJ8A 3EFFB 3JUYA 1M71A 3JVGC 4AMKL 4BSVA 1OTUD 5IF0B 4ZTPH 3RZCA 1MREH 1S7RB 2XZZA 4NFCA 4HPOL 4KPHH 4H1LH 2Y72A 3FKUS 4NN7B 5I1CH 1NGZB 3IDJB 4AENA 3ZYZA 5B3JF 3QZWA 1UGNA 1HIML 2KPNA 2K3TA 3CXHK 4HKZA 4OUUB 3STBA 3O3BA 4TOYL 4Q9CA 1ERNA 4OAWB 1NFIA 4PJDE 3UPRB 3NCJH 4BFIB 5K9JH 4QXTA 1KXQE 2FX9L 4JG1H 2ADFH 4M6AA 1JTTA 2WWMC 5F96H 4EN3B 3G6AA 4DKFL 5D2LF 5E2JA 2NY0C 3PL6C 1EAPB 1MI5B 3AAZB 3QEGH 4ZO6A 2P5WE 3SGDI 4Y5VC 3VA6A 5B39B 2O61A 3CMGA 4ZFGH 1V8HA 4L4VE 4Z77B 1CL7I 3UJIH 2G75B 3HPJB 5E94A 4JHWH 3P4LA 3G5VA 4PPTA 5DRNB 4B50A 3IJSB 5C08A 4S0SD 4XAWH 2PCPA 4G8EA 5C0IB 1NAKL 1UM4H 4N0YH 2VXSH 4IMLA 2X6MA 2YD8A 1CE6B 5ESAB 4M8VA 3EOBA 3OKDB 1I7ZB 4OZ4A 2BNRD 4U1HB 1FE8L 4P46B 3MV9D 1H3PL 4F9PA 4JO4H 2VH5H 2VZOA 1PBYA 2AK4A 3MCKB 2QV2A 4ZO7A 2XOTA 3WBDA 3HZYB 1F58H 2DQIL 2KL6A 1ZVSB 5F71A 4DW2H 1JUFA 3K80A 4MD4A 1D9KA 1JGEB 4P5MA 4PS4H 5EU4B 4JFPA 5IVZA 4JFFB 4I77H 1FZOB 3TP4A 3GSUB 3TT1H 4APQD 3JV6A 1O0VA 1K8IA 5I15L 4JPIA 5CJBA 3LAFA 4LSSL 1NC4B 3DO7B 2E7HA 3H6JA 4YXKH 3W11D 3L7EA 1GZPA 4EUPA 4XPBH 5IJVB 3LY6A 1JCKA 1X5YA 5E4EB 3LHPH 1QLRA 4JM4H 5C1MB 2F5BL 4MJIA 2NY7H 4BZ1L 5FO8A 3UYRL 3SDDC 4N0FA 5KJRH 1OP5K 3TJEL 4Z78B 1CU4H 3VA2C 3ZDYF 1MHCA 2PNDA 1CD9B 5B4MD 4HUKB 4ACPA 2E6JA 3N06B 4HPYH 5GRUH 2IG2H 4R26H 5E5UB 4ORGA 1N7ML 3IT8D 1LO0H 3W0WA 3O45B 5FYJU 1IGIL 3IFLL 5D1XA 4KUCD 4YAQA 4TTDD 5LGJA 1DQLL 3V2AR 1NUDA 5CILH 5HHOA 4YHNB 3T1FA 4D0CA 1LE9B 1U0QA 3L5HA 3T09A 2R2HB 4C56D 4OCYL 2CRYA 4IIQC 1AXTH 1FL3A 2V7NB 4M7LL 4YC2B 3K4AA 5IFAH 1BLNA 4PJ7A 1UKQA 5B8CB 1HHHB 4PJIB 4OGZA 4ZFFA 2ZUWA 2YK1L 2YPKA 2D4DA 5JPMB 5ENWA 2NY1D 5IQ9A 3T77A 3SY0B 4EVNB 4M48H 5FYKL 4LLVA 2HFFB 2J6EL 4X0KB 5EDXA 5F72S 1FYTB 3HPLA 2V2TA 4JY6B 1MIMH 4MA3B 4MDJA 4RZCA 4P4KD 4HX1B 3P11H 5AZ2L 4YEFA 1NAML 1N6QH 4JN1H 4D8PA 2HRPH 5IESL 1OGTA 5I1JL 1E6JH 4LVOC 3OG6B 1H8OA 1GGUA 2GSGB 2JLLA 2ARJA 2DI8A 4HKBB 3TBSA 2E9BA 5IQ7L 4MGXA 5EFIA 4KY1H 4JO3L 1MJUL 1ZA6B 3GSOA 1KV3A 4X6FA 2BSSA 2C26A 3VFRA 2D7NA 3WHXB 3T65B 3REWA 1R5VA 5C71A 4LCCA 3D87B 1ORSB 4K8RL 1SJEB 2VYRE 1MFCH 4R8WL 4NZRH 3VFNA 3H3PL 2HN7B 2A9NH 4JCLA 2AJSH 3VXRA 2HMIC 2HWZL 3VE0B 1MHEB 3IFPB 3QH3A 1LD9A 5FDYA 4PGEB 3TNNB 5I30L 4OTXL 3AROA 5T33L 4Y2DA 3THMH 1UB6B 1A9BA 5IHBA 4B53A 3V0AC 2I9TA 1H3UA 5CJXC 1CIDA 3ZZ1A 3ESVF 3EDEA 5D7JC 1OSZA 3SJVA 5GQBA 1PLGH 3L5WA 5DC0A 5EN2A 3ARDD 1J05A 3ZTJG 4DQOL 1XR9A 4IMKA 3Q3GA 4X4ME 3FQTA 4G7VH 5J9PB 4KZDL 4ELMB 1N5AA 3EGSA 4YDIL 1DUZB 4RMVA 1J87A 1T04B 2APVA 3IU4H 4YDVB 3IETB 3O8XC 1MCWW 4QRUA 1UCBH 4LSUL 2AABH 1PSKH 4ONFH 2BCKB 3DSFH 3S88L 3KPPB 1KFAH 1AGBB 1TCRA 2OX5A 1DR9A 2IPKA 3TBTA 3KLAA 3WKMH 1A6PA 3L3KA 4YDKH 1TTFA 3UO1L 3V6FB 1E6OL 4ZPTB 4L3EB 3DECA 4KJYA 4IOIA 1I3UA 4U7KA 2WLZA 5LCVH 1UWEH 2CXKA 2VLKD 1P4IL 3GMNA 1CICB 3Q48A 3S3JA 4J3WA 1Q1JL 4GKNB 4LF3B 5FA3B 1L0YA 3G04A 4GG6B 1V7MH 2ICEA 2K9UA 2ZG2A 3IFNH 3ALXA 4JFHD 4P2QD 5F3HA 3TO4B 1HQ4B 1OARL 2EYRA 4Y89A 5D71L 3BQUA 3RPKA 4FQXA 2J6EA 1RUKH 4FXKA 5ID1A 2VN4A 3HI1A 2Y23A 1IC4H 4JPKL 5F1OB 1M7IA 1NAMA 3X3GL 4MS8C 5C07D 3P3YA 3QDAA 3PDGA 1N6VA 4JM2C 1JPSH 3DVNA 1LO5A 3PNWA 4MXWL 15C8L 3LN4B 3NCYS 5MHSE 3R1GL 1AQKL 4JJHA 4PB9H 4UV4H 1T66D 4WDIA 4YK4B 1FGNH 3A6BH 3S5LB 2HLAA 2VLRD 3O0RH 1DBML 1JHKH 1Q9KB 4DTGH 3OKNA 2JJWA 3QFDA 2APWA 4RFOL 2YD1A 3BEVA 3WXVL 1FBIL 3GSQB 5FYJE 1RD6A 2B1AH 1T2QL 1PYWA 5C92A 3RKDD 5FYLH 2WBJA 4PUBH 2EIZA 2X4PA 2KUTA 4WNQA 3F7QA 4YIQB 3EW3B 1D5IL 1N4XL 1AJ7L 1IQWL 2ADJA 1CQYA 5FGBA 3HI5L 4HJ0D 2OL3H 1AKJA 2N56A 2R1WB 3FOLB 1C16A 5JPNB 4NUGH 3B6SB 3PWLA 4BQCA 5BO1L 4DZBB 1EEZA 1A7BA 5IM7B 2BRRL 3QEUB 1NFDA 3I9GL 1EEUA 5IHZB 4J8RA 1N59B 1IM9D 4K9EH 4WO4D 1LDSA 3WO4C 5I2IA 4DAGH 4HDIB 5INDA 2V5MA 1XIWA 5GSRB 5SV4A 2H32H 1TFHA 5BZWA 4LPTA 4DFHA 3CLFH 4OLXH 4KK5C 3F12B 5H37G 3HZKA 1T2XA 3Q6FA 1CS6A 2GT9A 4XVTL 2JJVA 3VD5A 3AXLA 1JFQL 3JWOH 4H5SB 5DHYB 2ENYA 2EDDA 1IBGH 5TE6L 3ULSA 3VXMD 1BVLA 2J8UF 3I6GB 4BUGA 4OV6F 3D39E 2OR7A 4JZOA 5TJWK 5J6GA 4M5ZH 3N1GC 1AXSA 4R0LB 2GIYA 1I8MB 3CZFA 4UOW1 5LQBH 1F2QA 1U93A 3L6FB 1NMCC 2P5EE 4JQVC 2F9BT 2GI7A 2DLEA 3FHAA 1GHFL 2Z92A 3DMMC 4LNRB 1A6VL 3ARBA 1XF4B 1CDUA 3MLWL 3P30L 1K6QH 4TUKL 5DHVA 4WTXA 4P4RB 4PRAB 4AQ1B 2R1YB 3BAEL 1RUQH 3LZFH 5I74C 3VWKB 3ZL4H 4H0GA 2VZUA 5KANI 2VABB 3MLPA 2QKIB 1J5OH 1G6RB 2D0HA 3V6OE 5GXBB 3QUYB 3E6FA 3MCG1 1U8IA 4FQHB 2AI0L 2Q76A 4OFKA 4FTVB 1Q94A 2OZ4L 2A6JA 1NLBL 4Y2OA 5D70H 1FDLL 1NMAL 2ITCB 2HT2C 5IROC 3RP1A 2DIJA 1Z5LA 3FO1B 4CADB 3K74B 2VDKH 2ZUQC 3KHQA 1F00I 3BZ4A 2J8HA 3GJFA 4F57H 4X7SL 3SCMD 3VWKD 3MXWL 3GJFK 4HUUA 1BFOA 1VGEL 3P77B 4BQ8A 1MHPH 1TJGH 3MRQB 4HIJB 1YPZE 3G6DL 4OZIF 3QDGA 1JPGA 3FQWA 5GS0C 3RGVA 2DM4A 4IRZH 3KPQA 3LQZA 1MCWM 3B9KA 4KKCC 3VXOB 4Z7WF 1QYGH 3ME0A 2XWBA 4NKQB 2YWZA 3KPSD 1N2RA 2HP4A 3BP6A 4KQ4L 5MENB 1KCRL 1JNHB 1BIIA 2ATKA 5CZKA 2X4QB 3RWJB 1XGPA 3MREB 1C1EL 2R0ZL 4QWWD 4WTZG 5DFTA 1Z9LA 3KR3L 4BQ6A 5LAXB 4ZSOA 2XT1B 1AXIB 3L1OL 2V2XA 4W70A 4XCCH 5CBAB 1G9EA 3UTSE 1TVBA 3DJ9A 4PJAE 1FNFA 2IPTL 5DEFA 4MD0B 3RBSA 1W8OA 1UH3A 3W9EB 3P4NB 4G9FD 4LCWE 1EGJL 4G43B 4FFVD 4WFHE 7CGTA 3QUMH 2DM2A 2XZAH 1S7WB 1EA9C 1OLLA 4OF6A 2P7TB 2XFXA 3QUKB 1FJ1A 3VXPB 4TPRH 4YZFF 3HC4L 3B9AA 1ZLUK 2LAGB 3QIWC 3LS5H 1AIFA 2HKHH 3F6LA 4QRRB 5J7CC 2ZUUA 4LEXH 5IB3B 1WSST 5EA0L 1ZLSL 5C8JB 5FUCC 2A77H 4KKBD 5J6HA 2FATL 1BGXL 4G6FB 4XXCC 1D6EA 4LPWA 2ZJSL 3ULVD 1ZHBA 3IAQA 3SDXB 4OI8A 1JRHH 1YECH 4D2NA 5IEHB 4HWZB 1YYML 2I9LA 3BEWA 5KSAB 3FQUB 1EO8L 1ADQH 2H9GA 4EXKA 2OZ4A 5DQDL 5IF0A 5ESQA 5AEAA 1S7RA 3IS0X 3ZSTA 5TE7H 4LDEB 1NGZA 3IDJA 4DKEH 3O2DL 5KS9E 5GJSH 1BD2E 1RZJL 4OUUA 3D5OF 1O7SA 5C6TH 4OAWA 4FRWA 2DQGH 3UPRA 4BFIA 1D5XB 1GGTA 5L0QB 4Z7OF 1R0AL 4N0UE 4JFDE 2CKBB 3NIGF 1D6VL 1WCBB 4PTTA 4EN3A 4JHAL 5KN5B 4ERSL 2JCCF 1EAPA 1MI5A 3FT2B 1WEJL 4ONGH 4DCQB 5B39A 2CSPA 1YEGL 3QEHB 1YEFL 4Z77A 2CPCA 1M7XA 4XH2B 1ACZA 3HHRB 3QHZL 4ZAKB 2G75A 3HPJA 2CIKB 1GGIH 2EDWA 3O3EB 5DRNA 1FN4B 3QPQC 5I1GL 5F88B 1KJ2H 4OF0A 2CLRB 5A2FA 4PJHE 3KPRB 5C0IA 5T1LB 4AG4H 5F7UA 5H94B 5BV7H 1CE6A 1T4KB 5ESAA 5F6IC 1J8HD 3OKDA 2OP4H 4HF5H 4KI5D 1I7ZA 1P53A 3CD4A 4YHPB 3RJQB 1ZANL 4F15B 1NSNL 1EGJA 4FG6D 5I1AB 4U1HA 3LMJH 4P46A 1NCDH 3M07A 4W81A 3DI2B 4JQXA 3MCKA 1CZ8H 4EI6A 5A3ID 4EI5D 4DK6A 3HZYA 1W0YT 1ZVSA 1I7TB 1U6AH 3SPVB 5DD3L 3JXAA 1JGEA 1F90L 3MV7D 5EU4A 2XKNB 1LO4L 3IDGB 4JFFA 4MXQD 2OQJB 2AS5M 1FZOA 1V5JA 1RUPH 3GSUA 3PV6B 4JZJC 4JKKA 4ZD3L 2H6PA 3BMVA 3B5GA 1NC4A 3OXRB 3DO7A 2ZOKB 1QSVA 3PGFH 4U6YB 3NACH 3CK0H 4WUUB 5IJVA 3ZHKA 1JPTL 1IARB 4Q6IB 1S9VB 5E9DB 1S7TB 3B2VH 3IDNB 3MCLL 1I85C 3O2DA 3MLVL 3ZKND 4Z78A 3CJJA 3KWWB 4P49A 1JMXA 5DEGB 2VC2L 1QD0A 5D2NB 5GPRA 3VFVB 4NQCD 4YHKL 3O45A 2Y06H 1EHNA 3PQYB 3VDBA 3I3BA 3P0GB 3QPXL 3TM6A 4J23A 5DZLA 3OBAA 4NN5B 5J13B 4YHNA 1IT9L 4I0PC 4M3JA 5DK0B 1LE9A 3WE6B 2R0LL 2DAVA 2A1WH 1IGFH 2R2HA 3D85B 1FVDB 2V7NA 4OF8A 1TQBC 2F54D 1QBML 4FABH 4HWEH 3D9AL 1FIGL 1A0QH 5B8CA 1HHHA 4PJIA 4UIKH 2ZSWB 1FC1A 5IVXA 3G08B 3RNQB 5JPMA 1SY6L 3PQYD 5CJQH 3PUCA 3SY0A 3I6KB 4EVNA 4U1MB 5AUMB 4Z7VE 5DR5L 4GKOA 4HLJA 4X0KA 1O5DT 1FYTA 4U33A 3BKCH 5EZJB 4JY6A 1Q0YH 2VL4A 4MA3A 4NHUB 3GM8A 3D85D 4O5LL 1KCUL 3MLSH 3WS6C 4IRSC 2W60B 4YR6B 4DGIL 4IJ3B 4WFED 2GSGA 5TFSL 2AEQL 4HKBA 4CN1A 3IB4A 1EO5A 3S35H 4KK8C 2E7LC 1T5WB 5D7IE 3W81A 1ZA6A 3WLBB 4S0TD 5HHPB 3HNVH 1UB5B 1BZQK 1YEEL 1A02N 3WHXA 3T65A 3D1MC 2EZ0C 4NQDE 2VLJB 4Y1AE 2W91A 2COQA 2YZ1A 4O2CB 3SO3B 5DD1H 5ESVB 5ANME 1CLYH 4Y16B 1SJEA 3O6FD 2PTUA 1NCCH 2HN7A 4X99B 4JVUA 3I3EA 1MHEA 3VE0A 2EDBA 3IFPA 4RISL 3WD5L 4D9LL 1UWGL 1VA9A 4D9RD 3KXFD 4AT6B 4NNXA 3BPCB 1J12A 3TNNA 4PGEA 4PJEF 3BN3B 4P2OC 2XA3A 4U2YA 5DF0A 3SDAD 3C08L 1UB6A 3TVMB 3SO5A 3S6CA 4OD2B 3LH2H 4X6DE 4UTAL 4K55A 5D7SL 4K7PH 2QHLA 5L6YL 2YHGA 5HDQL 2RHEA 4MWFB 4UILL 2XN9B 2WIIB 4ZPVB 3CFEB 1I1AC 1IEBB 2GEEA 4TULL 5J9PA 3K2UH 5FCUL 1EBPA 4ELMA 1QRNA 3RL2B 1DUZA 1T04A 3CPLB 4N5ED 4YDVA 5CS7A 5KTEL 3IETA 4P59L 1GCFA 5INCB 1ROWA 2UUDK 1F11B 4CL7A 1GJIA 3KPPA 3RA7L 3J8F7 4LAQH 3X12B 2ZCHH 1SYSB 4I3SL 1AGBA 3ARTA 3V6FA 2CIIA 4L3EA 1F3RB 1MJJB 5JDJA 1Z0NA 2F8VA 3JTTB 1RZKL 1CICA 4ISVB 5ELIA 4GKNA 4LF3A 4YDLC 5FA3A 4BSWB 5C0FB 2P5WB 1SJHB 2DQCH 5EOQH 1XFPA 3MV8E 4GG6A 4XGZB 1SY6A 3TO4A 4JVPA 1HQ4A 2YA2A 3U7AA 4M3KB 4GQPH 5TQ0H 5EZOL 1IKFH 3ZKQD 1QFUL 1WGOA 4GRWB 4LPCA 4POUB 1HH9B 2H2PC 2BY3A 4N9OB 2H45A 1J1PL 2DBLH 1LHZA 1FH5L 5A2IH 4IRJD 5ITBH 3O6MH 3CSBA 2AEIT 1MAMH 2O5XL 3SE8H 2J7LA 2ZPKL 1RUMH 3HMXH 4GQ9L 4D0DB 5ICYB 4DN4H 3T0WA 4XP1H 5E2WH 5HVFB 2P5WD 3QDME 3LN4A 1GAFL 4L4VD 1N8ZB 3EUUA 3VG0L 1FFPB 1MFDH 1WT5A 4DOHE 4KJPC 2BJMH 1KN2H 3EZJB 2D7PA 4PP2B 1W0WB 4ODTL 1Q9KA 4QYOB 4NWTH 3AS2A 3MV11 4MDIB 1G6RL 3GI8H 4ZUWB 3HFMH 4WI7A 4KHXH 2R69H 3GSQA 3VGBA 1DBBL 3CC5A 1JGUL 3BD3A 4R7DB 3NFSL 5E8DL 1FCGA 2UZXB 3GIZL 4N68A 4NUJB 3SDCB 4GAJL 4A6YB 4YIQA 1KPUB 4WIQA 5F9WB 1AE6L 1P4BH 4WEBL 2R1WA 3FOLA 5JPNA 3B6SA 4A2MA 2GITB 3V5DB 3MLUL 5J12B 1KELL 4KZEH 2BMKB 3NA9L 4DZBA 1YNKL 1PEZA 2B8OT 3N9GH 5IM7A 3OAZK 4KUCF 4U4BA 2GK0B 3BZDA 3QEUA 4Z8FL 4HH9B 1A1OB 2QQLH 5IHZA 1N59A 2VQ1B 1MNUL 1AI1L 3ZKXC 1NCWL 4HDIA 1SMOA 1MWAH 3MJ9L 5DA0B 1RY7B 5GSRA 5IIEB 3W5MA 2FO1A 4JRYB 2E6PA 1KULA 2PO6D 4XC1H 3E8UH 1PGRB 3H7LA 3F12A 3PWUB 1RK0B 1EHLH 4NKOB 4CVXB 2D0GA 1HCFX 1U8PB 4H5SA 5DHYA 5ADOH 4PJGF 5JXED 4KI1A 3I6GA 1JF5A 3C6LC 3UTTE 3MRNB 4XMKH 5E99H 1PKQB 4R0LA 2OMNA 2R29L 4G7YH 4I48B 5H2BB 1I8MA 3S35X 2HFGL 2AQ3A 3RVUC 5T1DL 5IBUB 4PRNB 2Z93B 4K3DL 5IK3B 4YJZL 1SYVB 3G5ZB 4KRPD 4M00A 3QZWG 3CDCA 4LNRA 1SVCP 4P3DB 1XGYH 3GKWL 1XF4A 1ITCA 1C7SA 3BO8B 2ZG1A 4Q9RH 4NZJA 4L5FL 4P4RA 4CU6A 4PRAA 1BEYH 5E8OB 2R1YA 3CVHH 3VWKA 1T5XB 2WMPA 3IKKA 3DRTB 1HKFA 3OAUH 2QKIA 4OLEA 2DQEH 2DRUA 1G6RA 3QUYA 1BQUA 5FUCE 4FQHA 2BOBB 3V0VB 4FTVA 4DGVL 1TETL 3VXSE 1KCSL 4L1HA 1RULH 4YBHA 4ZODA 4K7PX 4LPUA 2C3HA 3OKMB 2ITCA 3HZVB 3P0YL 4CADA 3FO1A 5JQ6H 5F1KC 4KJWC 4C4KO 4Q97A 4P9HH 4C54A 3ARVA 4NO3B 2OK0H 3LKOB 4IDJH 2X7LB 1DSFH 1QEWB 1QLEL 4JG0L 1NBZB 3P77A 2X9XA 1IC5L 1S5HB 4UMGA 2CKBL 3MRQA 3UMTA 3BUTA 5BQ7B 1TJHH 3QRGH 4HIJA 3NTCL 3H42H 1FLRH 4HIHB 5GRWA 4LIQE 4F80A 3T0EB 3V4PL 2XTJB 1YY8B 3MJ9A 3VXOA 3VXUA 5L7XH 5ETUB 5I17B 1K9TA 5F7EL 3MR9B 35C8H 5MENA 3IF1B 1JNHA 3DV4A 2X4QA 5JR1H 3RWJA 3MREA 2RCSH 2ZWLT 2A73A 4RMUA 5JO5B 4U1GB 5LAXA 2B20A 1E4JA 1T1WA 2JK5B 1OAXL 1RURH 1JZ3A 5CBAA 4ZUSB 2JJSA 4PGDB 3Q6GH 4Q74A 4MD0A 3NAAL 3W9EA 3P4NA 2DBJA 2EIEA 4ZDHA 4HXBH 4PBVC 4K9EC 3BJLA 4G43A 3KLHC 5IFHH 5DTFB 1J10A 3DETC 1ZOXA 2P7TA 3QXTA 5EBMB 3QUKA 4XCFL 3ET9F 3DROB 3FMGH 5EU6D 4HUVB 2QBWA 4OZFH 5DYOB 4FFZH 4QRRA 4KVNH 3MGOB 3GBNH 1IEAB 3FL7A 1D5MB 1D5ZB 2B2XH 5IB3A 5C8JA 3W39B 2RIKA 4O4YH 3EYSH 3BX7C 2WZPD 5C2BL 4PBWD 4YUEH 4UAOB 2A6IB 2FIRT 2BNQE 3JWOC 4Z7UF 5IHUL 5KSBF 3FN3A 3SDXA 2NY3B 4Q0XH 1T0PB 1AHWB 3D6GA 3STLB 5IEHA 4NM8L 2EO1A 2W9EH 4HWZA 5AG9A 5SWZE 5T1KB 4HAFA 3LCYA 3IDIB 4NCDA 5KSAA 1CVSC 5FGRA 3WYRA 3EOTL 1HQRB 3FQUA 4MA8L 1DQML 3DRQA 3P40A 4P2RD 2DQUL 4G6ML 3ARFD 4JO2H 5GGQL 1VPOH 2Y36H 2DQDH 5K59E 1B2WH 3DXAE 2CRIA 4W6XB 3QQNA 3V0WL 4OGXL 1NCBH 1U8OB 4J4PA 4KROC 4GXUM 2GY5A 5T1KD 2JB5L 3ZTNH 3U2SB 5DJ2B 3ULVH 1D5XA 4GAFB 4M9PA 4MB4A 4YE4H 5KSUB 3RFZC 2FJHB 5MHSD 5HTSA 3S36L 3AUVA 1AQDB 1LVEA 1UJ3C 1WCBA 4GAGL 5KN5A 3MUGB 2UWEB 4XBGB 1MCKA 5EORH 5CGYD 5E2TH 3FT2A 4DCQA 1IGMH 5KVEH 1RIUL 1QHOA 3QEHA 4XH2A 2FSEB 3BH8B 2GJZA 4GBXC 4ZAKA 2CIKA 4IHOB 1GYAA 2M8XA 3O3EA 4LVNC 1FN4A 4KGLA 5F88A 2H2SD 5DS8B 4V1DB 3GDBA 2VRAA 4PJ8C 4AH2B 1RU9H 3KPRA 1M4KA 3EDKA 1P1ZB 1ZXQA 1OAZL 5T1LA 4XB8A 2FR4B 3KG5A 3KJ6H 4M6MH 5H94A 4HWUA 5GGUB 5IHLB 3OR7B 3TNMB 4UDTB 2BFVH 4XBEL 2Y25A 2UVEA 5JW4M 4JDVB 3ARED 5E1HB 5I1AA 2YR3A 3LKNB 2OTPA 1KJVB 4YPGB 2KQMA 4LSVH 4JHZA 5FHAL 4YHZH 3TA3C 4YHLL 2E27L 3CFCH 2BY2A 1F8TL 1DE4A 2IPUK 2PXYA 3LKPB 1I7TA 1A22B 3SPVA 3QIUB 2XXMB 4AMKH 1X9QA 3IDGA 4AIZB 5I6XB 1XR8B 4MCYB 4OD1L 4YGAB 2OQJA 2P5EB 4NHCH 4LLDB 3PV6A 3UDWA 1EJOL 1CLCA 5FXCH 3WIHL 3MO1B 3U7YL 4BFGA 4HWNA 4GRLB 4OD3L 3OXRA 1T7YA 2ZOKA 2D31B 4U6YA 4F7CB 5AAWA 4JQIL 2IQAB 3D39D 5DFWH 4WUUA 1F5WA 2JELH 2VZTA 4Q6IA 1S9VA 5ISZE 3DV6B 5E9DA 4OFVA 2L0DA 3IDNA 1BQHG 3IAPA 1B6DA 4OZGE 4J7RA 1TTGA 1DL7H 2HJFB 2YUZA 3RUGF 3KWWA 5DEGA 4ODSL 1T89A 2WBKA 5D2NA 4PREB 4HQQH 4YBQC 4N0CC 2XNAB 1U3YA 4XP6L 3PQYA 5KZCD 5T3ZL 4HS8L 2EDYA 3RTQB 1RQ5A 1NAKH 5DK0A 1GXEA 1CXIA 1KLGB 5M94B 3WE6A 1IM3B 2E5EA 3FCTB 3KYKL 4S10A 1FVDA 2IANE 1FG2B 3BKML 5CEXB 1YPZB 2AJXL 1KENH 1L4IA 3AB0C 2JJTA 1ZGLP 1E4WH 5K33A 2ZSWA 4PJ5E 3G08A 2PW1B 3RNQA 1CR9L 2YMXL 5C9KA 1SBSL 1E4XH 2C9AA 5ALBL 2J4WH 3I6KA 5I1LB 5FO7B 1OGAE 3ARQA 4U1MA 5F9AC 3QEQE 2EEDA 4PRDB 5L88L 5DMGD 2HTKC 3I75B 5EZJA 2DQIH 4X7DC 4NHUA 1HYSD 1U8HB 1OY3B 3QCVH 1HHKB 1QO3B 2NY0B 3AMKA 1JGLL 3PL6B 4Z95H 2UZYB 2W60A 2FJFA 4YR6A 2QJDA 4Y5VB 1K4CB 4Y8AA 5LXGL 1OTUC 1MRDH 1J9CT 3VFGH 2B1HL 1T5WA 3TIEB 2R0KL 1A3RH 3WLBA 2I07B 1U3HD 5HHPA 3ULVF 3R0MA 1UB5A 2P48B 2VLJA 4KKLC 4O2CA 2HLFC 5ESVA 4P57B 2XRAH 4Y16A 4DVRL 5BV7C 3ZE1E 3NGBB 4X99A 4NKMB 2NY0D 3PL6D 1MVUB 3NN8B 3WIHA 4EDWH 3UYRH 3BPCA 3CFKB 3UTSD 5LKNA 5JIPA 5EUOB 3D2UB 5JW5B 1F4XL 4A6YL 3TVMA 2XKSA 4FQIL 4E5XB 1WK0A 4R4FL 4GW5B 4RIRA 4AK1A 4OD2A 4LCWD 1N7MH 2FGWH 4WFHD 2HKFL 2VDPL 4JFOB 4JPWL 1KJ3L 1CF8L 5DLMH 2G9HB 2VAJA 4MWFA 2IBZY 2XN9A 4IEFB 2WIIA 4JFYB 4ZPVA 3CFEA 2PR4H 4H0HB 1IEBA 3CFDB 3RL2A 1WWAX 4OT1H 1BJ8A 4OF7A 2Q8BH 4BKLB 3L9RB 2ORBH 2PYEB 4YQXL 4OIIL 5INCA 4OFYD 1A14L 1F11A 1G7IA 1JWUB 4RFEB 4PJXE 2H8PB 3X12A 1SYSA 4JB9L 2GHWB 3HUJB 5FYKH 3HG1B 4RDQF 2YD3A 5F9JB 5EBLB 1A47A 5FHBL 1MJJA 5SV3A 2A9MH 4LLWB 1HNFA 3JTTA 4LCUB 4ISVA 1QNZH 1A2YA 3HE7B 1R3JB 1NAMH 3FFDB 3ILQC 4KDVA 4S1SL 4BSWA 3FB6B 5JXAH 4X9IA 1LDPH 1SJHA 4RRPG 4UDUB 4XGZA 5E6IB 3TJHC 4KI5F 5I8OH 1BD2D 4QLRA 4MNQE 1MJUH 3GHEH 1HH9A 4Y4KD 3ALWA 4GJTB 3EBAA 2VIRB 4PJHB 4JFDD 3EYFB 4QY8B 5C0BB 2R2EB 4QRSB 2AW2A 5MERB 2V5RA 4QRPB 4KH2A 2JTDA 4D0DA 5ICYA 4NQVA 4GS7C 4IIQB 2CK0L 3SDDD 2QADC 2K1MA 4NRXB 4DEPC 1QFWL 5A16B 4HKJB 1N8ZA 1CFTB 3OXSB 4XP9L 1FFPA 4NNPH 4TSBL 3WFHB 2ICWI 5D7LE 3T4AB 5C6WH 4PP2A 3MBXL 5E2UH 3VFWB 1W0WA 2YRLA 4QYOA 5HI3C 5B4MC 2EDXA 2BZDA 5J4MA 5ILTH 4MDIA 1EBAA 4ZUVA 4ZUWA 3SGJA 4TVPD 1LP9F 3QR2A 4PJFA 4U3HA 4R7DA 3NCFB 3SDCA 3TEUA 4NUJA 4A6YA 5GS2H 1KPUA 1U2HA 1GPOL 4LVOB 4OQTL 4AL8H 4BA8A 3T08A 3NIDE 3RWCB 3AGVA 1WBZB 5DT1L 1RMFL 1GOHA 2VDNL 3S88H 1JGVH 2GITA 3V5DA 2BMKA 4FNLL 5FKPB 4KRNA 3UO1H 2BHZA 4UNVA 4F3FB 1OT2A 4PJ9C 2UVFA 1WAAF 5FV2A 3QWRD 1JP5A 2GK0A 1PY9A 4HH9A 1ZLWH 1A1OA 2O93L 5JXEA 2EH7L 2VQ1A 4M4PA 5T3XL 3FB7B 2FL5B 3RRQA 1X5XA 2MOVA 4P4KC 1EMTH 5IIEA 1OARH 1GZQB 4X5LA 4JRYA 3BFOA 4I9WE 3PWUA 3BPOC 1RK0A 1H3VA 3I84A 4NKOA 1FNSL 4CVXA 4HIXL 5I18H 1U8PA 4Q9QL 5FYLE 4HUMB 1TDQA 4FQ1H 5CSGA 2HMID 1A1NB 1ACYL 1WISA 3BJ91 3C60C 2EKJA 1RK1B 4NOFA 3CZJA 3MRNA 4DGYH 4XVJL 1PKQA 4MXWH 15C8H 2CJUL 4I48A 3O8XB 5H2BA 5TF1L 1AQKH 4I2XE 3WJJC 3JUZA 1X44A 3QI9D 4HFUH 1EHXA 1VFAA 4PRNA 2Z93A 3MOQA 5IK3A 5D7JD 1SYVA 2AK1L 3LEXB 2B0SL 4XNUH 4P3DA 2H1PL 5I1KL 1NEZB 1OF2B 5K9QG 3BO8A 2HT3C 5FUZH 3HMWL 3ARDC 5LWYH 3MOBL 5E8OA 1ZMYA 1QSFA 4K7PY 1TQCB 1EX0A 5ABDE 3MJ6A 3QWOB 4NO0B 2CDFB 1X5IA 1N4XH 1T5XA 5JMOC 3DRTA 4I5BB 5DJ6B 3HI5H 4OCRH 2ESVD 2BOBA 3SE3C 2B4CL 4XNYH 5BO1H 1U42A 3OKMA 2W92A 1A4KB 3HZVA 1GGCH 3OWEA 3EYQC 2AV1B 5I75C 1YC8A 3I9GH 3MUY1 4JM2B 1MF2L 4OQTA 4NO3A 3LKOA 3CIQA 5FYJL 2X7LA 2W0PA 4NO0D 1QEWA 1NBZA 1BWMA 4GUPB 1I3GH 1JNJA 4H20H 4XCEB 1EH9A 1IAKB 1S5HA 1F4YL 4HV8A 1OQXA 4ZFOB 1VERA 3BGMB 5BQ7A 3VRLF 2XXCB 4KGJA 1NANH 5BVPH 1AO7E 4X6DB 4NQDD 1T7WA 4MS8D 4XVTH 4Y1AD 4NGHH 5CINH 4HIHA 4HUWB 2BX5A 4OFDA 3T0EA 2JB6B 3CXDH 2VOTA 1YY8A 1QFWM 3ROLB 4X4MA 1EK3A 1I7RB 2UY7A 5ETUA 5I17A 2YD4A 5GJTH 2NMSA 3MR9A 1KPRB 1H15B 3U4BH 3IF1A 4RMSA 5E08H 5HYIA 3WJLC 2BVYA 5SWSB 1UQSB 5DHXB 2EE6A 5JO5A 2JK5A 1HKLH 3QNXB 3M8OH 4PG9B 1Y6KR 4H26B 2BXYA 4ZUSA 3HAEH 1X5LA 4PGDA 3S37L 2CDGB 5D5ME 4PJDF 4HC1H 4I3GA 4JRXB 3CFBB 2X4NB 5DTFA 4JY5L 2HA1A 5EBMA 1YZZA 3DROA 4Z9KB 1AR2A 3BAEH 5BW7C 3OF6D 4HUVA 1YQVL 5DYOA 2APXA 3MGOA 1IEAA 4Q58C 1D5MA 1D5ZA 5ICXB 3W39A 4R90L 2QEJA 3GIVB 4HJ0C 3RWGB 2A6IA 4MA1C 1NLBH 2EXWC 1INDL 2AKRB 3FAWA 3DX6B 1U2CA 1AHWA 2LU7A 2GTWB 3AMLA 1NJ9B 3STLA 4M7ZC 2BNUB 3I3DA 3IDIA 4MSWB 2BSTB 1PG7W 5HPMB 3MV8D 1DVFD 5FDWB 1HQRA 3CDGB 4OIAA 4OSUL 2MTPA 2WWKO 1CFQB 1UJTA 3QQ4B 4PB0L 2E7MA 1NMCB 4KK5D 1KXTB 1MCLA 3PV7A 2Z8WC 4K94L 4QRQB 3TESA 2UZIL 3KJ4C 1MCPL 3G6DH 5IMKB 2X4RB 4LMQI 1T6VN 3LD8C 2HJKB 2KZWA 4JFZL 3OGOE 2DTML 4X9GA 4XHJC 2AXHA 1V3MA 5HHMB 1GVIA 1U8OA 3S34L 4LRNL 1A7OL 2LTQC 2FBOJ 3WIFB 3U2SA 4GMTL 5DJ2A 3QDMD 1U8NB 5KSUA 1I8LA 2FJHA 2XZCH 4EOWL 1LO2L 2D7MA 4ODBD 5T5NF 1H5BC 1AQDA 3QIBC 1LEIB 1C12B 2IFFH 3M17B 2YPLE 3OB0H 3MUGA 2UWEA 4XBGA 3OX8B 4NCC2 5LJYH 4HGWB 2YUXA 4QOKB 3RVVD 3DMMD 5L9DL 4WUKH 2FSEA 3BH8A 4MD5A 1J1OL 3EO1B 3QQ9C 4QGYA 7FABH 4G6JH 5DGRA 2IMMA 4IHOA 4K7FB 4P9HC 1YUHB 2ZUQB 3AY4A 1PG7L 2KBGA 4P5TA 4XPFH 3PDDA 4XI5C 5DS8A 4V1DA 4AH2A 1NKOA 3NCBB 1P1ZA 5AZEL 5C0AE 2DN7A 4LRIC 5BMFL 2FR4A 2DWEB 3ZMRA 1JPFB 4LLUB 4XMLL 3JV0A 4YFLF 3B9VA 2WLYA 3OR7A 3TNMA 3FZUD 4UNUA 1ULVA 3FRUB 5DA4A 4UDTA 1YEHH 1MQ8A 2EDNA 1JMZA 2FATH 3K8LA 3PIQB 5E03A 3SQOL 3UAJD 4JDVA 2ZJSH 3VDAA 3LKNA 4G8IB 5EB9A 4YPGA 1KJVA 1V7NL 5IMMB 3H2WA 4P23A 4RWYH 1IGTB 4U0RB 3KPNB 1OAKL 4ESKA 1MCIA 1VKXB 3V5HB 1YYMH 3RY4A 2R2BB 3LKPA 5IFJB 4KVCL 3PJSB 5LGKA 3CNKA 3QIUA 2EH8L 1MCQA 4AIZA 1XR8A 4MCYA 1PDKA 3SCMC 2P5EA 1DEEA 1IGCH 2Z31C 1A3LH 4AEHH 4LLDA 5DD0L 1H3XA 5EOTA 3MO1A 3O2DH 4GRLA 4OLVH 3SKJL 4A2LA 4KKCD 5EWIL 3SBWC 2D31A 5I1EL 4F7CA 2HTLD 5EOCH 1KB5H 2IQAA 3DPBA 1QSEB 3UTTD 3I2CL 2DICA 2G2RB 3KLDA 2I60L 3WMSA 3DV6A 1O7VA 5D9SB 3QB7C 3U1SL 3G6JE 4S2SB 4X6CE 3SQBA 1MFAL 4ERSH 3V6OA 3MUHL 3H9HB 2VQUA 3WXWH 2HJFA 4PY8J 4WI4A 1KEGL 3FO2A 3MLZL 3DSNA 1CD0A 1YEFH 1BX2B 3QHZH 1MCOL 3G5XB 1E4KC 4PREA 3BT2H 1WBXB 1OB1B 5FOJA 3IAGC 1IAIH 1S3KL 2XNAA 3V7AG 1AFVH 5JUEH 3RTQA 1R6VA 2GUOB 5JNYB 1X4ZA 2HH0L 3QIWD 3NCYP 4PJCE 4G5ZL 1KLGA 4YHML 1A7NL 2DJ4A 2M1KA 3FO0H 5DMKB 2D03H 1JHTB 1IM3A 2R8SH 1GIGH 4LCYB 5D2LB 5GS1C 5F1SA 1FG2A 2HT4C 5CEXA 1CXFA 3OZ9L 3VXSD 3T3PE 3S5LG 5DURB 3X17A 4NYLB 5FM5O 4HCRL 3E1F1 2R4RL 2PW1A 4KKBC 5KVFL 4KMLB 2EEAA 5I1LA 5FO7A 3ULVC 4PRHE 2XQYK 2D7QA 4PRDA 3L5XL 3I75A 4MB5A 4U7MA 2ZCLL 5DI8B 1UENA 2NY4C 3T2NH 3QUZC 4JKPL 2R0WL 1U8HA 5DD3H 1HHKA 1F90H 1QO3A 4X5WB 3R0NA 4BFEA 3MLRH 4Y5VA 1K4CA 5DURD 5IOPA 4XWOC 3DOSA 2F58H 3IGAB 3ULUL 5HGDB 3TIEA 3UYPA 3WNNA 2I07A 2OJZH 5E8NA 1BFVH 1HHJB 2YD7A 3GRWL 1MPAL 4XNMB 5TPWH 4PGJA 1JPTH 4G80B 4OGYL 4P57A 4U6XB 4RAUB 4UQ2B 3PP4H 4XMPH 3O6KL 4OZHE 3OKYA 4NKMA 5F6IB 4UOW0 1I1YB 1MVUA 3GO1L 3NN8A 3MCLH 4ZYKB 4G8GE 2X05A 3CFKA 2MWCA 4IBLT 2FECL 5EUOA 5EBWB 3D2UA 2FHBA 2BRQA 3TBVB 5JW5A 4LGPB 4E5XA 2VC2H 4GW5A 3F58L 3QPQD 4KQ3L 4MQ7B 5C0CE 3CUPB 2QLVB 5FUOL 2VXQL 4CBPA 3WIIL 1JWSB 5JMRA 4PRPB 2YEZB 3X13A 4R6UA 2G9HA 2YPVL 3IRPX 4JFYA 4PRID 4M1GL 2N7BA 4IDLA 4EQ3A 3CFDA 1FFOB 3BSZL 3VD3A 3PWPB 4BKLA 1WTGT 3L9RA 1QBMH 4FMKA 4JZJB 2PYEA 2BNQD 2FX8H 1I9RH 2VDLL 5DJCB 1NL0H 1JWUA 3TC9A 1JL8A 1F45A 4RFEA 1QFHA 2H8PA 3OKOB 1BBJB 1RVFL 2DB8A 4U6TA 4YHIB 4WY7H 5SWZD 1TVDA 3HUJA 3HG1A 1F42A 5F9JA 4LARH 5EBLA 3RWHB 3BW9B 3WFBL 3RQ3A 4LLWA 4WEMB 3O4LE 4LCUA 5SX5H 4I1NB 3SGEI 3HE7A 1WZ1L 4UUJB 1UG9A 4OKDA 4PV8B 4K3JL 3FB6A 4HCRA 4MJ6A 4PG2A 3DXAD 5F6HJ 1OP3K 4DGIH 4UDUA 3L3HB 5JIKA 5E6IA 3BDYL 4MXQC 2AEQH 2CRMA 3P73B 5EC1B 2CLZB 4OM1H 5GISL 1YEEH 3BP7B 1PQZB 2VIRA 4PJHA 2VR4A 3EYFA 4EDXB 4QY8A 5C0BA 2R2EA 4QRSA 2HJLA 4QRPA 1YMMB 2E9JA 3MV01 4YH6A 4C57C 4IIQA 5HHVH 3OTTA 1OPGH 5BRZE 1TQBB 2DQHH 3WD5H 1UWGH 5A16A 1CYGA 5B38B 3IXTB 4HKJA 1KPVB 3DGCR </