3BGFC

X-ray crystal structure of the sars coronavirus spike receptor binding domain in complex with f26g19 fab
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
211
structure length
210
Chain Sequence
DILMTQSPSSLSASLGERVSLTCRASQEISGYLSWLQEKPDGTIKRLIYAASTLDSGVPKRFSGSRSGSDYSLTISSLESEDFADYYCLQYVSYPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYEHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spike protein S1
publication title Structural insights into immune recognition of the severe acute respiratory syndrome coronavirus S protein receptor binding domain.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Viral protein/immune system
total genus 52
structure length 210
sequence length 211
chains with identical sequence L
ec nomenclature
pdb deposition date 2007-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07654 C1-set Immunoglobulin C1-set domain
C PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bgfC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bgfC01
1NBZA 4Y4KD 3T0WA 1UJ3B 2OR8A 3QH3A 4QTHA 1SJHB 3C8KB 2GFBA 2J2ZA 1F4XH 1FL5B 5GISL 3DRTB 5IIEA 4JQVC 3QA3B 5LCVH 3IXTB 4OJFH 3SDCB 1Q94B 1XFPA 4XCYB 3BKML 1SJXA 1UH3A 2BCKA 2D2OA 5E08H 3Q1SL 4MD4A 4PJHF 3SHSA 4PRPD 2OJZL 4F80A 3BYYA 3U9PH 1I8IA 4UIMB 4E41B 1JYWA 1T1YA 3UJIL 4XNZC 4GKSB 3ARDC 4PJEB 4WFED 3QZWG 4J3TA 3HCVA 5IVXE 3GHBL 3IJYB 2VDOL 4HK3N 3T0ED 4GXVH 5FO7A 1KTDB 2PF6A 4B0MM 3LS5L 4F37F 5JZ7D 4PJ7F 2EH7H 4KI5C 2EH8L 5IG7A 3C9NA 3PL6C 4ZAKD 2HTLC 3IDNB 5E5RB 2A1WL 4G5ZH 4TSCH 1LO5A 1I4FB 4HJJL 4QHLA 3EJZD 1CYGA 5D6DC 1JZ5A 5IF0B 3T1FB 1GGIH 3TH2T 4ODWA 4GRMA 4JN1L 1NUDA 5BOPA 4LU5H 3IAPA 1K85A 5DC4B 5JIHA 1CD9B 2WBJA 3GKWL 4G6AD 1QNZL 3CDGB 1N64H 3HI1B 3GUTB 4QRQB 3CSBA 1FO0A 1FZKA 2EE6A 4IRSA 1RHFA 4F57H 3ARFD 1JMZA 1KLFA 2WANA 4HKZA 4U1SA 4L1DA 5FAAA 1TVDA 2VZ1A 3CH1B 1XCTB 2CRIA 5KSUA 2ATPB 4J4PD 1FGNH 2IPTH 3KLHC 1R5VB 2VXUH 5I73B 2ADJA 4KJWC 4PJXB 3LPWA 1LK2B 1ODAA 4JRYE 4OM0H 3RY4A 4KZDL 4XVJL 5BS0B 4WFGD 5GGTA 3AS3A 4RGOH 1I9JH 4YO0B 5BRZB 2I27N 1NDMA 2LU4A 2RJMA 3LV3B 3GMPB 4PLJC 3MXWL 1C5CL 3O8XC 5IVZA 3RX5A 4UTAL 2VB5A 3P0YL 4JO4H 4QCIA 2VUOA 3RWCB 2Q7YA 4YK4C 2DN7A 1MY5A 3G5ZB 3DROB 1OVZA 3Q2CA 4HUVB 2NLJB 1DDHA 2NY0B 3TCXA 1FFRA 4YHMH 4PJFE 2I9TA 4MQ7B 5EOQH 4ZNEE 1IBGL 5JXEC 1S7UB 4OUUA 4HLJA 2MTPA 4A6YL 1H9VA 3MREA 1MCNA 3QDMD 1OARH 2VLRD 1X44A 1HIML 2E27L 3NVQA 3V6OE 4XNMA 3BKYH 2ED9A 2CLRA 2FJGA 3QG7L 5E9DD 1UGNA 3KJ4C 4LCIL 1NLDL 1RULL 3N9GH 2DMBA 4ODTH 5FYJH 2IG2L 5D70L 5EU6E 3X3FH 4J3OC 4PJCE 4L8DB 2AJUH 4DAGL 1G9NH 2WK2A 8FABA 5ISZB 3DMMD 2A6IA 1PKQE 3RU8L 1A14H 4LHUB 1U2CA 5FYKE 2W60B 5INDA 1RUAL 4N9GB 4MA3A 4N5ED 4F58H 4P2QA 1PX4A 2Z93B 1EEUA 2J88H 4O58H 4K94H 4NPYA 4PTTA 4Y88A 2NX5A 4LKXB 5E2VL 2CIKA 3D2UD 4ODXA 2XA8H 1L9NA 4ZS7H 3V7AG 4HDIA 4Y2DC 2X1OA 2I5YL 4YQXL 1KPRA 4R90H 2B2XL 5C09B 1MCQA 3X3GL 2W92A 2IF7A 5E8EA 4GKNA 4TSAL 1S7TB 3MYZA 1R5IA 1ZA6A 2QADB 1KB5B 4QHKJ 5IB1A 5I8EB 5FUOL 4JY4A 3KDMA 1P4BL 4LPWA 3KYNB 4AL8L 4HUNB 4R8WH 5EN2B 2DRUA 1TZGH 5CGYC 2MMXA 3MV7D 4YHIB 5FM5M 3HE6B 4JFFB 3EZ8A 4PRBA 3OKEB 5B3NA 4UT6H 2C1PB 4IRZH 3MV8E 2LU7A 3RI5K 2X42A 1Q9LB 1XF3A 4P23C 4P59L 1WWCA 2VLJE 2W65B 1QR1A 5E8PA 2H1PL 3SGDH 3UBXI 1JN6B 4YDLB 5TF0A 1U8HA 2FX7H 5IWLA 4OZ4B 4X7SL 3EOBA 1HHJA 3EGSA 3TV3L 3FO0H 2JJTC 1PY4A 5HPOA 1DANU 3ZTNL 1OAXH 2CXKA 4TVPD 2A0LC 2CKBH 3L3KB 3UBXB 1YN7A 1MVFA 5DJXA 1NJ9A 2X05A 2C3HA 3LQMA 4N8VA 3V5DB 2V17L 3BH9B 4DKEL 1LEKA 4C56B 3PJSB 3FHAA 3MUZ1 1RIVL 1UZ8B 3MV9E 4G8GE 5TE6H 1M7DA 3J8F7 2IBGA 2V7NB 4D9RD 3WJJC 4ZXBD 4LRNH 4UNVA 2XFXA 1ONQB 1UADC 4OLUL 2GJ6B 3GSNL 1T83C 4Y19B 1G7QA 3QEGL 5C71A 1KPVA 2YPVH 3KXFA 3S6CA 3BXNA 1CCZA 3O2DL 4H26B 5ALBL 1I7UB 5F1IA 3CFEB 1NH6A 1TPXC 5MERB 1QTYT 4NQTA 3WBDA 4ZFFA 3FT4B 2J5LB 3B8SA 5JHDE 3T77A 1QRKA 2BHZA 2FZ3A 3ILPB 3DSFH 3EO0B 4L1HA 4X7EC 4NO3B 3G04A 3PWLB 5HYSG 4Y89A 4TNWF 4U33A 1WIUA 2WBKA 1TTUA 3GJFB 1KCLA 5D2LE 3L3OA 3PWPD 4ZDHA 3MUGA 5HPMA 5GJSH 3P9LB 5KS9E 1LK3H 4LCWB 1A0QH 4HFWA 4R0LB 3RPIB 2ZUSA 3RWHB 2DI7A 1NEZG 4XAKE 1CBVL 1N8ZB 1CFNA 2Q7NA 5HHVH 2R2HB 2VDNH 3K8KA 1OLLA 1XGQB 3K4ZA 2OL3H 2R0ZH 4UBDD 4CU6A 5I1IH 1IGMH 1NMCC 5CKGA 4AMKH 4DGYL 5C08A 3VGEA 3BQUD 4HIJB 1Z5LB 4MX7A 1BD2D 2CO6B 2FIKB 1T03H 5D7LD 3MRIA 4YXHH 4O02L 5LG1A 2FX8H 3GMLA 4P9ML 3NZ8B 1HQRB 2BY1A 3MOBH 3MA9L 1QFPA 4ENEC 1X4XA 4OLXL 3MLSH 4P2OB 3DX7B 4XP5L 3OHXA 4YDVB 3CMGA 4ODUB 5I1JH 1EDQA 1H0DA 1AXIB 4MZ2A 5DJ0B 2CIIB 2X09A 5C0BD 4XX1G 5FUCC 4KI5D 1A5FH 4IS6A 4MXQC 1MCFA 4Y4FB 5KJRL 2IPKB 4DN3H 2MHAA 4NQVA 5LWYL 3M8OL 3DHMA 3DXAB 1SEQH 3VXTA 1JZ8A 2XRAL 3V5HA 2OR9H 2BNRE 3PP4H 1GH7A 2NY2B 2VH5H 3O2WH 2FB4H 4LP4A 3ZKXC 4NQCB 4PS4L 1C12B 4U1GC 4OCYH 2HH0H 4UNUA 1ZAGA 5DF0A 3QRFM 1YPZE 1A9EB 3T65A 2IADA 3LKRB 3SE3C 4WJ5A 3RTQD 3QIBB 4MAUH 1K4DB 3QDJB 5TQ2L 4EQ2A 5B38A 1QYGL 3LQZB 3VXOA 4PJ5A 2ZCHH 4Z7UA 1CWVA 4JFDD 1OAZH 4M5YH 4OCRH 3UTPE 3OXSB 3WHE0 4N8VG 2JB5H 5EZLA 5MENE 3IDMB 3GMMB 5K9QI 1UWGL 5IMKB 4GBXB 4BFIA 4OD3H 1KLGB 4YHNB 2PW2A 2FJFA 1FNLA 4KUCD 4OTXL 2VISA 3T2NL 4PLJD 2F54E 4QWWC 2YC1A 1DP0A 1EFXA 4F37K 3WEXB 2WIMA 2NXZB 4Z9KB 1Y18B 2X44D 3GMQA 4JFZH 3JV6B 4R2GC 5MEPB 2R56L 1W8NA 5LBSL 2CJUH 3T09A 4AIZA 5IP4A 1QSEE 1MRDL 1WFOA 4ELMB 5GS2D 3F7VA 4TVPH 3SE9H 5JXED 1BPVA 3SCMA 3RVVC 3SKUD 5T5NF 5GRXG 1HI6B 3G5YB 4OLWH 1LQSR 1ZLSH 3Q0HA 2P46B 1D9KC 4HPOL 3LKSB 4BZ1L 1RK1A 4FQXC 4I4WA 2X4PB 3IF1A 3LIZL 4CVWA 4HWZA 3ARPA 1UJ3C 5FYLD 1UC6A 3MUY1 1NSNL 4LIQE 3SJVB 3EYOB 4Z7NF 2BVOB 2V9RA 1OAUH 2DQUH 4UDTA 4YBHA 4NQSA 3SDCC 2NW3B 1WFTA 5EPMB 2FHCA 4XAWL 2CR3A 2ZOLA 2EZ0C 1UZ6E 3UPRB 3ARSA 3E6FB 3O45A 1FN4A 4YHOH 1HWHB 4HC1A 5CIPH 5ALCL 3VFSA 4FQJH 4OF0A 3O3AA 3U4EB 3DV4A 2EIBA 5FHBH 3OAUL 4PB9L 2PYEE 3OL2A 1WEJH 3BPOC 2PW1B 1ORQA 3CSYA 3MNWA 1EHXA 3FT3A 1JP5A 3PQYD 3WS3B 3CC5B 4RCAA 3KPSB 3QI9B 1VKXA 1A9BB 3ARYA 3UTZA 1AR1C 5DQ9A 5GZND 5CGYD 3RA7H 3AVEA 3S37X 1FYTE 2E6PA 3KHOA 2YPLB 1VB9A 2CR6A 1T3FB 5CJXA 2IQ9H 3QXTA 1YEGL 1XCQA 5J4MA 4HIIB 4IDLA 3TVMA 3EYFB 5HBBA 5EOTA 4P23D 1MLBA 3B9DA 3CFJA 4H1LB 4DUXA 5J57B 4URTB 5IVXA 4J1UB 3QHZL 3HUJB 5AAWA 1J0JA 3SGEI 2EE3A 3L95B 3MRKA 3ULUC 4QXTA 5DRNA 1CFQA 4L4TA 1VADB 4FFYH 5I73C 4GMSL 3VWJA 3H0TB 5DD5L 3T4YA 1RJZB 5GJTL 5GQBA 3U82B 2BHYA 1NCAL 4UQ2A 1MCOL 1K2DA 4PREA 3BZ4A 1AC6A 1IVLA 2VR9A 3FTGA 4WTXA 4NRXB 1V8HA 2DIBA 3WN5A 1WVZA 4KXZH 1N6QH 2R15A 2W1NA 4L3EB 3EYQC 5EORL 1CXHA 5GIRB 2IALA 3BP4B 1KCUH 3D5OF 1LILA 2XPGA 3L3IB 1D6EA 2X4OA 4K3DL 2CQVA 5BV7B 1ZMYA 3FB6B 2D0FA 3H9SA 3SGKC 4HG4J 1IM9A 1I8KB 2NY0C 4CVXB 1ZGLP 5HGAA 5JTWA 3SKNA 3P9MA 2PYFA 4UINH 1R3JA 2P5WD 1MUJB 2E8YA 4JRYA 3B2VL 1YEFL 5IQ7H 4BFBD 2X89A 4TPRL 1FIEA 1IEBA 1WISA 3ELAT 4OGZA 5F1NA 32C2B 4UB0H 2JCCE 1S7RB 4IHOB 3P0VL 5EZIH 3V52L 1B0RB 2AJXH 2ICCA 3N1GC 2X5PA 3I6KA 4JO3L 1T7XA 1OAYL 4GRWF 3BIKB 5IB2B 4YHKH 3ZHDA 3IDJA 1J1XH 5SWSD 4JAMB 4D2NA 3GM0A 5GS2H 4PJFA 3WNKA 4ZNEA 3BH8B 2AV1B 3QULA 1IAII 5GS1C 1OWRM 2CSPA 1B4RA 3GRWL 1CZ8H 3OR7B 5BW7C 3PIQB 4X7TB 3VA6A 3WE6B 1FIGH 1KCKA 3V6OA 1AGBB 4ENED 3IKCB 4HGWA 2BHUA 5CZXC 5LAXB 4PLNC 2HT2C 4NKDA 1UB5B 4LGSB 5I16B 4JFED 5KN5B 4TTGA 3PG2A 1NPUA 4JM2F 5FYLH 5EU6A 3MJ9A 4PJCA 5EB9A 3NN8B 4MXQD 1N2RA 4Y5YA 4Q9CA 4TSBL 2QADC 1PKQA 4XHJD 2YMXL 2DQIH 2WWKT 4KHTH 1KEGH 2CMRL 4ZO6A 1NAMH 4M48L 4OFVA 3HE6C 1D5BA 3VXUD 4WFHD 2HFGH 3WIHA 3F65A 3QIWA 4XXDA 2NY5L 1KJVB 2VKXA 1ITBB 4O2CA 5C0FA 4N0FB 4Y5XB 1NDGB 4Z7WE 4M9OA 1CG9B 2FR4A 5IHUH 3NA4A 5A43C 1MHEB 5B4MD 3MLTA 4NJ9H 5C6TH 2EDRA 4YDLC 3MRBB 5D71L 5F44A 2PR4H 3A6CH 3IJHA 2OTUB 3NCBB 1WWAX 3ZKMD 2I25N 4KK5C 2R8SL 3TO4A 4LCUB 1RZGA 3ULSB 2EDQA 4RFEB 3RDTA 2GCYB 4OZFH 5JPMB 2D4FA 1GC1L 1BBDH 4XCCL 2VITB 1AXTL 5IVOA 5K9JL 1FPTH 5HHOB 1A7OH 3O11A 5F1OB 4P9HC 4FMKA 5C0NC 5T1KA 4TYUA 5HHQA 3P4MA 5F21B 4U6XA 4NNXB 4K2UL 4KDWA 3I6LE 4OAWA 1E4JA 4G9FB 3MV8A 4QWWD 2XZCH 1CDCA 2HTKC 4IMKC 1HHIB 2EDFA 2BERA 3GSXA 3TJHC 4NKIH 2VLJA 2HP4A 1P2CB 1KIRB 3HZKA 1BZQK 1DBBH 2EC8A 2L7UA 4R2GD 2FHBA 3RQ3A 3GBMH 1S3KL 4LSSL 3TZVB 3MLUL 3IVKB 3TM6A 2J5LC 1HDMB 5JW3L 1A6WH 5C8JA 1AGFA 3JBG7 3MLXH 5DQJA 3RVVD 4QEGA 1S7WA 1J8HE 4HWUA 2GUOA 5DFWH 5C1MB 4JRXD 1MJJB 1CFVL 2X1XR 3IFOA 5IKCB 1D9KD 2KUTA 4WWKA 2V2WB 5I8OH 3RIFF 3U2SA 4S1RH 3B5HA 3MV9A 4FZEL 4G8GA 4MQTB 4FQXD 5HI5D 5HI4C 2UZIH 1V7NH 1MRCL 3QDGE 5CLWA 4R0LC 3CDCA 1BLNA 3QR2A 1MJ7L 1Q9OA 4OSUH 4EOWL 3K4AA 4D8PA 3AGVA 2VDMH 3U0PA 2YKLL 2R1YA 3W2DL 1J0IA 4LSTL 1BHGA 5I1GH 2VDLL 3TN0B 5IT2L 4O9HL 3CD4A 2JB6B 1SM3L 5DD6A 3Q6GL 4F33B 1U9KA 5AEAA 5JHDA 3CMOL 1RZFH 1CF8H 2EZ0D 1ZLVH 3D18A 1VGEH 1ZLWK 2R29L 3L3GB 1MFAH 2ORBL 3MLYH 3GI9H 1FZJA 4E41D 5CGMA 4K07A 2X4QA 3ULVL 4P2YA 2BC4A 2HJFB 5FCSH 1S9XB 3HR5B 4Z0XA 5ID0B 5I30H 4HSQA 5KS9A 3U7YH 3PGDA 1MPAH 4JPIA 1NCBL 4IIQB 3QO1A 2UV3A 3HC0A 1ZHBB 2FL5B 1FBIH 4PJGF 3FCTB 5C0RH 3INUL 5BZDB 3QEQA 4PGCB 5KTEL 1P84J 3S3JA 1T1ZB 7FABH 1UKSA 43C9B 5DXWA 1MQKL 3G6DH 4Y4FC 2APWA 3EIFA 1AR1D 5HVHB 3VD7A 1X7QB 1LO3L 2F5AL 2GT9B 2WUCL 4EN3A 4MMZC 2VXVH 1XGPA 5HHXH 4JFHD 3HNSL 2NY2C 4S11A 3REVA 4Z5RA 3O3EB 4PTUB 2HRLA 1TETH 2QTEA 3CVIL 4HX1B 3KPRB 2OL3A 3GSUA 1Z9SA 2K9UA 2H41A 2FSEA 1FGVL 4WGVB 2VXQH 2IPUG 4OB5L 2R1WA 3S96B 2C3WA 4OV5A 5EU7E 4RIRB 3KNBB 3RY6A 3QIBC 3O41A 3U36B 1MIEL 3IAQA 4IMLA 1S7SA 2V9QA 2XKNB 2WWMC 4DFIA 5GSVA 3S88L 2XZQL 3EYVA 5BRZD 4GBXC 4G6ML 3OAZK 3BSZH 2BNRA 1C1EH 2FO1A 2BOCA 1IT9H 3X13A 3ZE2E 2NXZC 2ZPKH 5F3BA 3UTSB 4FMFA 3TC9A 5TDNA 1VFMA 4U1KA 4LPTA 3RGVD 4PB0H 4XPAH 1KCSH 1J05B 5L2JA 4N0UB 4KROB 1S7QB 2NQCA 1LO2H 4U1NA 2BNQE 5I76A 3M17A 3LB6C 1KJ2B 3G6JE 5T1LB 2ICEA 1KIQA 1RZ8A 4U31A 1A1NA 1AXSA 5GSRB 3QEUA 5MENA 1WZMA 4Z95H 3ZYZA 3QCTH 2AI0L 3IDGB 4RA3A 4W81A 3WDHA 4KVCL 1CD1A 4YIQA 2Q8AL 3GMNB 5C07D 5J3HC 3WFDL 4HXBL 4PJDF 4HPYH 1FL3A 3I02A 3HZVB 4XMKL 3VXRD 5E99L 1B9ZA 1PKOA 2MPAH 2G75A 5I1AA 5KSAA 2ZWLT 5EU4A 1QSEA 3FO2A 1F58L 3SDAA 2ZCLH 2FH8A 4EBQH 4DWHA 3TYFB 4K7PY 4LOUD 1B0WA 5I66B 3ZE0F 1E6OH 1OTUC 1ZGLB 4NO0D 1F90H 4G6KL 5EBGA 3TLRA 3LEVH 4LLMA 4HAFA 2X4UA 1FV1B 1MEXL 1JRHL 1MFCH 4PRNA 5CZXD 2HT2D 5I2IA 4HWBA 5GRJH 1A3RH 4P2CG 4N1EA 2F53E 1KPUA 3HNTH 4KHXH 4DQOH 4ZD3H 2QADD 3QI9C 5EBMA 3PABB 1CICB 2GK0A 3DRQB 5B3JF 3FFCE 2QR0A 1FSKB 1BX2B 1SJVA 3BP7A 1IGIH 1PG7L 4JFFD 4OKVB 3MBXH 1N4XH 1UCBL 1HHKA 1UVQB 2Y9RT 5CCKH 2PXYA 2HLFC 1G7LA 3O3BA 2BDNH 2DQDH 3GSOA 5EUKB 4ZFOB 5BXFA 3TT3H 5ANMA 2GJZB 4WIQA 3TBWB 2YZ1A 1GGUA 2PYEA 4S2SB 3SBWC 3LRHA 1JFQH 1A6ZB 4RWYH 3TWCH 4G3YL 2VR5A 1PAMA 1T04A 4OCXL 4I9WE 3BN3B 1NQBA 1D6VL 3CCHB 1JV5A 4F7MA 4LEOA 5H8DA 1CD0A 1FYTA 4KQ3H 5J9PA 3L7EB 3QFDB 5DT1L 1PSKL 1KNOB 4QOKE 4WUKL 4Z0BH 5TE4L 5F9JB 2VDKL 3FQTB 4FFWC 2X10A 5AUMB 5EOCJ 1WIPA 4Y19D 3AROA 3TJHD 2P8LA 3VMNA 2D7TH 3GMOA 3PDDA 3K2UL 2XKUA 4RDQF 2UYLA 3ESVF 1ZEAH 1DBKH 3MJ7A 5BV7C 3HAEH 2G5BB 4PGDB 1LHZA 2DLHA 1ETZA 1YMMB 5T1MB 5T1DH 5DEFA 1OGTB 1NGZB 2R1XA 2DYPA 4FFZL 4XNQA 5E5MB 3KYKH 3FN9A 1T0NB 2C3VA 2EDOA 4J8RB 3FRUA 2OLDA 3IYLW 5F7WC 2Y06H 3R1GL 3L5XH 5IMOB 1F2QA 2ATKB 4J7RA 3I3BA 3WV0A 1V3KA 1T5XB 2JKXA 5FUZL 1EO8H 1D7FA 5HI4D 5LQBH 4KY1L 4WNQA 1Q9KB 1T89A 3Q48A 1M05B 5FKPA 3S4SB 3FT2A 2MQ3A 4PJXE 1JTPA 3IETA 1QLEH 3FOLA 2EYRB 5H35B 5D6DA 5BS0E 4LCYA 5IJKA 1RK0A 5DLMH 5TF1H 2HT3D 4JFOB 1R3LA 4L3CA 4DJMA 1T6WA 4PRDB 1Y0LA 4HIEB 4JQIH 2I9LB 4M6MH 1U3HD 1EHLH 1T20B 1FO0L 4FNLL 1FH5L 1JE6A 2B1AL 2Y7QA 2NY1B 3BZEA 1U58A 4LSUH 4EXKA 4MNQD 2J8UF 3B5TA 4M1DL 5I9QB 3SY0A 4Q0XH 1BEYH 3T0BA 4MA8L 5D6CB 3BJ91 4P48A 4D0CA 2ZCKH 2CDGB 4AT6B 1I1AA 3IU3B 3TPKA 5E0QA 1JWUB 2W0KA 3BJLA 2XICA 3UTTB 4HUWA 4YAQA 1ZHLA 5GGTL 3T0DA 1KEML 1SBBA 1LNUA 5F3HB 3MROB 3CFDA 5ESAA 1JPFB 3WIFB 1R0AL 2HVJA 3QO0B 3RIFK 1MFBL 1PEZA 1IGJA 3MV11 1MWAB 1G7HA 5ECJE 1INDL 4XPBL 1D5MA 3X17A 3ZL4L 2NY2D 5DHVB 2NY7H 2P5EE 4GRLB 5ISZE 3EHBC 3G6AB 5DO2D 3PHOA 4NQCD 3VFMB 4LQFL 3HS0A 2VDPL 3BUYB 1MFNA 1VPOH 2X2YA 4WW1A 5D7JB 3ES6B 2ICES 2CDEA 2IH3B 2ZNWA 1A1OB 1SJEA 2YN5A 4Z6AT 3SQOH 1IM3A 5M7QA 4GAYA 1KC5H 1KB5H 3WFCH 4YUEH 1PFCA 2V7HB 3RZCD 4H8WL 1P9MA 3LPGA 3S3PA 3C60D 4RAUA 5C09E 1CVSC 1YEJH 3WFHB 2WIIB 2IC2A 3QCUL 1ORSA 3QG6A 4HZLB 4PJ9D 3MXVH 3JV0A 4Z7WA 5IFAL 1KBGL 3EO9H 4U6YA 3EFFA 4X4YB 4LPCA 3CVHB 1RJCA 1MHCB 2JIXA 1CT8B 5BVJA 4HFUL 3TZVC 1FVDB 4H88L 5CEZL 4LSVL 3KS0J 1BAFH 1YY9D 3FHQA 1AGCB 5BZWB 3LB6D 3OBAA 4KGLA 1CR9L 1F3RB 1UA6H 3SO5A 2BVUA 1Q1JL 2L7JA 1C5BL 4Y2DA 4P9HH 5CD3B 2M8XA 4WTWA 4FQHA 2DAVA 4JZJB 5C0CE 4MB3A 4BZ2L 5DD3H 2AGJL 3EDKA 1EUUA 4C56E 3BT2L 3DYPA 2VYRE 5HHMB 5FF6A 2OP4L 3LN9A 4NQXA 4M61B 1W72H 4LCCA 1CL7L 3TN0C 4NDMA 1KOAA 3UDWC 3BKJH 1XGTA 2AXFA 4JDTH 4R3SB 1J8HA 1QZ1A 3NGBB 4GG6E 1OTUD 4K3EL 3ARBD 2YWZA 4JPVH 1KCRH 3GJFH 5ETUB 3DGGA 3VXMB 2JJTA 5SX5K 3SPVB 2WP3O 3WLWD 3WFBL 2BRRL 4OCWH 3STLA 3LKNA 4RNRA 3SKOA 4IIQC 3EJYC 3UC0L 4OFKA 2DB8A 5D2NB 2NY3D 1A6AB 4OLZL 4GW4A 4XNYH 3VI4F 1DQLH 3CNKA 4ZMAT 1P7KA 4O51B 1AE6H 3MRFB 3LMJH 3PE9A 1T83A 1AO7B 5F72S 4UAOB 5FYJE 3R0MA 2AK1H 1OT2A 3WUWA 4Y4HB 1J5OL 3ECBA 2YD5A 3KPQB 1U3YA 2HLFD 4LGRB 4NQDD 4PRIB 4EI6A 6CGTA 2R9HC 2QEJA 4QRTA 1XZ0B 4MXWL 3UXFA 3MRLB 1F8TL 3STZB 2EKSB 3QWOB 5GISH 1ZTXL 1U8NA 3K81A 5JLZA 3F8UB 1E6JH 3CLFL 4NNYA 5D4QA 5C6PB 3BKMH 1WSST 1LWRA 2MQ0A 5FOBB 1FORL 3Q1SH 2OJZH 4QXWA 2FECL 1KGCD 4M5ZL 3D48R 4FQLL 4XB7A 2A74B 1ZT1A 4MSWA 3O6ML 4M7KL 4DZBA 1T2QL 5ICXB 1Q0XL 4R4BA 3DBXA 5FK9B 1I3RA 4TN9A 3VW3L 1H8SA 1U91B 3GHBH 1X5ZA 2VDOH 2YUXA 5ITFB 3HG1D 2C4XA 1DQDL 2QQLL 3DXAE 3T1WA 4RBPK 1MAMH 3LS5H 3CDYA 3LCYA 1V05A 5L8JB 4CRPA 2EH8H 1FL6A 4PUBL 3OKDB 4MNHB 4BH8A 4PJAB 2X4NB 2A1WH 1JNHA 2QQKH 4KROC 4HJJH 3VFPA 1NBZB 3HMXA 2FO4A 1HYSC 2Q87A 2R39A 3HE7A 4EZMA 4X9GA 2AXHA 2KL6A 2GFBB 2GY5A 3DUSA 4WFEE 2RFXA 1QNZH 4N1CA 3QDJE 4I0CC 2HFTA 3VFVB 2KBGA 2IANA 4FXGA 3HN3A 1ZANL 3AREC 3JVGC 4G8FA 4JLRA 1QSZA 5I19L 2IPUK 3BW9B 2AEIT 4D0BA 5A2IH 1T1YB 1X5GA 5C0AE 1GGCL 2CK0L 4KI5F 4Q2ZA 2DQCL 4WCYL 3HCVB 4RMTA 5GHWL 5IV2A 1NMBL 1QFWI 4FOMA 2BNQA 5D7IE 5FO7B 4WRLA 3ZE1E 3F7YA 2OJEB 4LVNB 4BSWA 1I3VA 4ZPTB 5IG7B 4LVHB 3N0PB 4ZTOH 1ED3A 5EZJB 3JSSA 3S5LA 3SE3A 4ELME 1PG7W 3WL9A 1O7SA 4AENB 4JGUA 4QRRD 3WLBB 3DX9A 1HHHA 4UTAH 5ICYB 1UM5L 4ZSOE 5C9JA 2ZUWA 4NNPL 4F8QA 3N50A 3NCJL 3JUZA 9CGTA 2DWDA 4ODWB 4GRMB 5AYUL 4B41A 2WBJB 4RQQB 5F8RC 5A2JH 2FNBA 1XH3B 2NYYC 1IBGH 4JY5L 4OBSA 4LPXA 4WHCA 4CNIB 1FSKC 1FVEA 4HMEA 5JA9A 1KB9K 3LN5B 5F6IB 4U1SB 1HIMH 3SJVE 1BFVL 5KSUB 4GG8A 1S9WA 2R4RL 3EHBD 4ZUTA 5K59F 1U8OA 1VEMA 4LP5A 4NJAH 4OCLC 4NZJA 3WUWG 1NLDH 1U8JB 1B90A 4M8QA 1NLBL 1RJLA 1CFTB 4MJID 5D70H 1J9CT 1EUTA 3TCLA 5FV1L 3O6LL 1NDMB 2F53A 3RU8H 1IMHC 2VIRA 1FC1A 5D1QC 1JNLL 4EEEA 1RUAH 4U6VL 1J18A 2WUBL 2ARJA 3FFCA 5HHOD 4E42A 2Q7YB 2BMKB 2NY5C 1UJ3A 3OAYH 5HTSA 1YEIL 2G2RA 5HVGB 1LE5B 3C8KA 4QNPF 1FL5A 2I9TB 2RCSH 4XMPL 3KPSE 3QA3A 3DO3A 3IXTA 5I0DA 1OAQL 4WW2B 2VZVA 3SDCA 1Q94A 2YUVA 4JN2B 4H1LH 3WXVL 2B2XH 2I26N 4XCYA 3X3GH 1VGKB 4NN7B 1PBYA 4TSAH 1IKFL 1F11A 4D3CL 4MAYB 2Z0BA 1X3DA 3C8HA 4QF1B 2CLRB 1P4BH 2FJGB 1NGQL 4UIMA 4AL8H 4HC1L 5CUSH 2O26U 4GKSA 3SGEH 2ITDB 3QWRD 2XN9E 3IJYA 4UOW1 4AEEA 1R6VA 8FABB 4MGXA 1KTDA 4OKDA 4QOKA 2IBZX 4P59H 3IDNA 2H1PH 1UCTA 4MA3B 4P2QB 5JPNA 5IF0A 3ZTNH 1DN2A 2NX5B 5BV7H 1U3ZA 3BD3A 1B3JA 3TN0D 1F4XL 3VDAA 5GS0C 1NC4B 4JFYA 4ODXB 2IEPA 2V17H 4OJFL 3CDGA 4DKEH 3HI1A 3GUTA 2Q86B 4YDJA 1KPRB 5MHSE 1OWWA 4M93C 15C8L 5E8EB 1RIVH 4G43A 3S37H 1ZA6B 3D85A 5I9QC 3ARZA 4X6CB 5F89A 4MA1B 4OLUH 4ZOEA 5J12C 1XCTA 3QEGH 2ATPA 5ID1B 3DIFB 4KJPC 1R5VA 3LKQA 3D3VE 4KUZL 1R3HA 2QQQA 3EJYD 4KKAC 4PJXA 5ALBH 3BISA 3CH8A 3F58H 5BS0A 1NC2A 3NOIA 1AKJD 1NEUA 4JHBA 4JG1H 3WDIA 4M6OH 4YO0A 1XF3B 5DZNA 3K4DA 3LV3A 5EOCH 2YA2A 4TSCL 1U8HB 3FZUC 1LEIB 3EGSB 5E56A 3SKMA 2C7UB 2FEDD 5FYKU 3STBA 4F8TA 3VD9A 4GRLC 3DROA 3MCKA 4R6UA 2CPCA 5HYJD 2R9HD 4HUVA 1I7ZB 1IAIH 1N64L 1ZXQA 2DKSA 1S7UA 3OKLB 3MRNB 5D7JC 3U0TB 1ES0B 1CBVH 3UX9B 4BUHA 4F57L 4KK8C 1M7DB 3OX8A 3EDEA 5KSBF 4NUGL 1CFBA 1DSFL 4OFIA 3PWPE 1FNSL 3KXFB 3BXNB 4Y5VB 4PG9B 2JLLA 2BZDA 4O02H 4P9MH 4L8DA 4RGOL 5ISZA 1QEWB 2P5EA 3MA9H 4LK4A 3ALXA 2OYPA 3ZT7A 4X0KB 5JQHC 3G04B 1GOGA 1SY6H 5I1DA 3ZDXE 4JO4L 5HPMB 5KJRH 2IBZY 2PKDA 4RGNB 5D7LE 1Z0MA 3T0AA 4LKXA 4YHML 3M8OH 1HYSD 4HT1H 2NZ9C 4I3RL 3BHBA 2XRAH 5C09A 4JZJC 1DFBL 5ENWB 3MJ9L 4RFNC 3TGXA 8CGTA 4PS4H 3LY6A 5C0BE 1KB5A 1BFOA 4C4KO 3W5MA 2EC9U 3ARED 3KYNA 5DC0A 3SOBL 4MX7B 5FYKL 5EN2A 1MJ8L 4ODTL 4JKMA 4YHIA 3HE6A 1H8NA 5TQ2H 5HGBB 1G9NL 3S9DB 3OKEA 4F15B 3SDYH 1QSVA 4NCC2 1QYGH 4YFLF 1HINL 3BPNB 1Q9LA 4HS6A 2XIDA 3RL1B 2W65A 3QCVH 1EJ6A 1JN6A 1AJ7H 4GSDL 1FLTX 4OZ4A 3NA9H 3SGJC 3UYPA 5KG9B 5C0CA 4M03A 1F5WA 4RFOL 4HHAB 3L3KA 2VMFA 2XA8L 4QLRA 3V5DA 4ZS7L 3IRZA 1BECA 3HPLA 2FD6H 4C56A 1DLFL 3T2OA 2R56H 4R90L 5LBSH 3PJSA 1MRDH 1UZ8A 1INQB 3L5HA 3BVNB 4D9LL 35C8L 1JHLH 2P8PB 2V7NA 1BIHA 1KT2B 1T80A 3QFJD 5HI3C 1ONQA 4IMKA 2W9DH 2GJ6A 3L5WA 4UAOC 2DBLH 3BO8B 5EWIH 4WJ5B 4H26A 4HPOH 2OCFD 4GG6A 4AQ1B 4Y4HC 2EDXA 2BSRB 3J7HA 5B38B 4BZ1H 3CFEA 5MERA 3IRPX 5ESQA 1XGYL 3KS0H 2IQAB 3VXOB 4Z7UB 2GW5A 3ILPA 1HXYB 1UH4A 5EZLB 3B83A 3ZKSD 4NO3A 4BFIB 2FX7L 4OI9A 1BZ9B 4U05A 3GJFA 3NAAL 1WAAF 1O0VA 4JANB 5D1QD 1EFXB 4F9LC 3P9LA 4XVUD 5C0EB 4LCWA 1QBAA 1DUYB 1S8DA 2J6EA 3NCYS 5IFHL 3RPIA 3RWHA 5CBEB 1YUHB 4PJIB 1JHTB 4PJBE 1V3LA 1N8ZA 3LHPL 4ZG1A 5LGKA 1TZIB 2DF3A 5TE6L 3BPLB 1LO0H 1XGQA 1S7VB 2WSKA 4M1GH 3OAUH 4PB9H 4QYOA 3WO3B 1QPPA 5DJ8A 2HG5B 4NFCA 2YPVL 4LHUG 4HIJA 2FIKA 5FM4A 3MACL 5E00A 4XP4L 5F88A 1IEAA 2FBJL 3IF1B 4UIKH 1PYWB 3NZ8A 1HQRA 4HWZB 5CAYB 5FGCE 3BE1H 5L6YL 2IJ0C 3DX7A 4P2OA 2Y5EA 4NT6A 3VGAB 1RUKL 4ODUA 1YEGH 4KTDL 2BSSB 5MP6H 4V2BA 5D96B 5DJ0A 1MHPL 3V4PL 3GIZH 4NQSB 2XQYG 5GJSL 1EAPA 1L0YA 4Y4FA 2ZOLB 2AXGB 2IPKA 1EGJH 4PJEF 4DOHE 3PWUA 3QHZH 4NZUL 3QJFB 3DXAA 4C59B 1UEYA 1TJGL 5AWNH 3M07A 2VAJA 5TE7H 1KXVC 4GMSH 2VDNL 5GJTH 3MBED 3VWKB 5MEQA 2KZWA 1NCAH 2OL3L 3NTCL 5DEGB 1ORQB 1IGML 4AMKL 3F6IA 3WDJA 5DVMA 1A9EA 3A0OA 3LKRA 2F58H 2UZYB 4YXHL 5KVEH 3UTZB 3QIBA 2B4CL 3QDJA 2ADFL 2AW2A 3MOBL 1ZVYA 1OGAD 1RUPH 1MOEA 3LQZA 4H0IA 3MLSL 3UBXG 3UTTD 4K3DH 1T5WA 1WQVT 3OXSA 4HK3J 1XCQB 2WBJC 3IDMA 5TDPB 3RBGA 3TVMB 4HK0B 5E94B 1MLBB 5C0AA 1A5FL 1XF2A 1KLGA 3LD8B 2ZUXA 2FEEL 1DQMH 5MEOA 3FZUD 4CDGC 3ULVD 1WFUA 3WEXA 4MNGE 5D7IA 4MD0B 1YEFH 3KGRA 4QXTB 4PJ8A 4GRLD 2OR9L 3CXDH 4M1CC 2YWYA 3U30B 3O2WL 3ARFA 5KSBE 4ELMA 3VWJB 3T4YB 4HH9B 4Z8FH 1YYML 3V52H 5EFIB 1U8MA 5DDHB 3I50L 4PREB 5D7JD 5GGSY 4OCSL 3QXAA 1HI6A 2JE8A 4KK8D 3G5YA 4U7SA 4JHZA 4P3DB 4OF7A 4OZGF 4Y1AD 3PF2A 4WI7A 2IALB 4HIXH 1D6EB 2X4OB 2X4PA 1MELA 4Y16B 2ZCHL 4OZHF 2D7NA 1OAZL 4G9DB 4OCRL 2JB5L 3SJVA 3EYOA 4QGTA 3P9MB 2PYFB 4ODBD 4ZTPH 5GGVH 1NBYB 2NW3A 5EPMA 1J0HA 1X6LA 4NN7C 4PLOB 3MRPB 1K9TA 1ZVHA 4P57B 3X11A 3I3EA 1N7ML 4MAYC 1Q9WB 3I84A 1A7RH 3E6FA 2CJUL 2O5YH 5F1NB 3CPLB 2CMRH 4U0RC 2NZ9D 1NBQA 3LAFA 3OKOB 1RSFA 2XQBH 4IBLT 4LAQH 3T3ME 4HWBL 3NFSL 1NUFA 1AHWB 3U4EA 2NY5H 2PW1A 4LIQL 4NFDA 4XI5D 5DUPH 1FVCA 4PJFB 2WWKO 4KDVA 3KPSA 3QI9A 4KKBC 5D71H 1DUZB 5IMLA 4MCZB 5HHMD 3SEPA 2ARWA 1P7QD 2YPLA 2R8SH 1T3FA 3C5ZB 1JYVA 5EUOB 1OAUL 2Z92A 4XCCH 1AXTH 3EYFA 5K9JH 3EW3B 1H3PL 4AG4L 3CUPB 3GI8L 3QDHA 1A8JH 2XN9A 4PJCB 1WBZB 2RAMA 4LLVB 4HUUA 1N2RB 4K2UH 3IFPB 3HUJA 1UWEH 2C5DC 2V5RA 2JF1A 4HLZG 1YMME 2HLAA 4KMTH 3L95A 3LZFH 4MA1C 5L8LB 4YHOL 4RMQA 2APXA 5KVFH 1XR9B 1D5BB 3H0TA 3N85H 1RJZA 1VDGA 3DETC 3QIWB 4KTEH 1ITCA 5DURD 3ET9F 4XXDB 1S3KH 2LU3A 3MLUH 1WEJL 4O2CB 3VXNB 1KJ3L 1SBSH 4NZRH 3O9WB 3MUJA 5FDWB 5BCAA 3MLTB 2APBA 5DA0B 5GXBB 5T5FH 4MB5A 4U1HB 3W9DB 2R23B 1INEH 4X6DE 3BRFA 5F1SA 4L3EA 3IJHB 5GIRA 2LE9A 3BP4A 3K1KC 5DI8B 3L3IA 2HMID 3ETBF 1EHNA 2XV6B 4YDIL 1N5YH 4Y4HD 4FZEH 5IW6B 5K9QG 2E7HA 3IXAB 5F7UA 3IJSB 2BFVH 2XG4A 1I8KA 1WAAE 3S36L 5CGTA 4EOWH 1MJ7H 1YEHH 1JF5A 5T1KB 3HMWH 3D3VA 5H94B 3W2DH 3HI5L 1MUJA 4LSRL 4LSTH 2VDLH 1X4ZA 4JGJA 1NKRA 2P45B 5I8KH 3C87A 4X6EA 4Z7QE 3GSXB 2I07A 4NOFA 4XC1L 2VLJB 3MLWH 3MRMB 2M1KA 4Y5VC 3ZTJG 32C2A 1EBAA 2ORBH 2UWEE 1S7RA 4IHOA 3ULVH 3QIUA 1B0RA 1DTUA 4KH2A 4P2RD 3SKJL 5DHVH 4LGPB 5IB2A 3BIKA 4GXUM 3RIAF 1NCBH 3JWOC 4NHCL 1LP9F 1N6QL 3IFOB 3BH8A 3CZFB 1KCUL 4K9EL 1MQKH 3U2SB 3LVEA 4X7TA 3MNVB 3DWTA 1T2JA 2AABL 2D7OA 1FNEB 1FNAA 2F5AH 4MHHI 2QSCL 2WUCH 1AGBA 1CGTA 2QQNL 3IKCA 4D8PB 5LAXA 4K3HA 1UB5A 4QXGH 3C2SA 5FCUL 3WNPA 5I16A 4GAJL 1A6VL 5KN5A 3HNSH 4N9OB 2Z9TA 4YPJA 1HYRC 1QKZH 5AG8A 4AH2A 5IQ7L 4MDIB 3NN8A 1IAKB 3DX6B 3KPOB 4OUOA 5FFLA 3VFOA 4FQCL 4D94A 1FGVH 4R26L 4OB5H 4UB0L 3CVHH 3HRPA 5EA0L 1FZJB 3F62A 1JNNL 5D2LB 3MA7B 3AS1A 2AVGA 5DGRA 3WNMA 4GXUN 4F15C 3S7GA 3PGDB 4N0FA 4Y5XA 1NDGA 3BPNC 4JFHE 2Z8SA 3F7PC 3QO1B 2DTML 5AZEL 4KDTA 3S88H 1SY6A 3MRBA 3VFGL 4K23H 4H1LG 4G6MH 1QFUH 1H3UA 4QRPB 3NIFF 2H2PC 2OTUA 4KWUA 1EEYA 2P8MB 1RHHB 1E4WL 1U92B 2F9BT 1A4KB 2P44B 4EIGB 4LCUA 3ULSA 4H20L 4RFEA 5JPMA 4TTDD 2WNGA 2VITA 2E6JA 1I7RB 1ZA3A 1XGPB 5E95B 3QUZB 5FYLL 3S35X 1U8PB 5DRZA 1QD0A 4NNXA 5F9WB 1ZS8B 4PJ7B 5DJYB 3C6LB 2EDBA 4G9FA 4IRSD 3AS2A 4NCDA 5SX4H 3MRDB 1QLFB 4M7LH 1KIRA 1R3KB 4OV5B 4ZUVA 2AI0H 3AB0C 4M1CD 2Q8AH 2VN7A 3TZVA 2OBGA 4IMLB 3VI3F 3IVKA 3WFDH 1A3LL 1S7SB 3H3PL 2Z8VC 2V6HA 1HDMA 4UUJA 3K2MC 4XMKH 5E99H 4S1QL 2V5SA 4NJ9L 5C0GB 5C6TL 4FG6C 3BDXA 3EYVB 5FHAL 1JYXA 2BNRB 1JK8A 3THML 2PR4L 3A6CL 3BMWA 1GZQB 2BOCB 1F58H 4WHTB 3DI3B 3SQBA 4CMHB 5FB8B 5F6HI 3QQ9D 4N8PA 5J56B 1NCTA 1BBDL 1YPZB 5TDNB 4U1KB 5C07E 4X7DC 4G6KH 3NFPB 5D2NE 2PCPB 1H15A 3QQ4B 4WO4B 1MEXH 4DFHA 1JRHH 1ZT7A 3MPCA 1E4XI 1URLA 3BPLC 3M17B 5CP3A 5T3XD 4QXUH 4NM4L 2APTA 4F33A 1AO7E 4NKIL 1RZ8B 5EU5B 1K8DA 3QEUB 5MENB 1DBBL 3L3GA 5FGSA 4YEFA 1CD1B 4PRIE 2F54B 2HJFA 4TUKL 3HR5A 3I02B 1BVLA 1A6WL 1RU9L 1PG7H 3OF6A 3UJTH 4IIQA 4U1JA 1BJ1J 4Y8DC 4D9QE 3VGAC 4DKFH 2FL5A 2X1QA 4XBGB 1CTOA 2LVCA 3FCTA 5I1AB 1RD6A 4PGCA 5EU4B 1QSEB 4PJBA 1CDJA 1T1ZA 2ADIB 3FO2B 43C9A 1JTTA 4S1RL 4LLUB 4KKBD 4U0QB 4P2QD 1V7NL 1X7QA 2GT9A 5I1CH 5CEZD 4OSUL 3ILQD 4LLMB 5L7XL 4EJ1C 2NX5D 1MCPH 2X4UB 4YGAB 5I75B 1KV3A 4GW1A 4OCXH 4PRNB 1D6VH 3SDDB 4WEUD 3O3EA 4PTUA 3NZHL 3HZYA 1CF8L 2XWTB 5DT1H 1M71B 3QRGL 5E2JA 5TE4H 1VGEL 4ODHL 3UAJC 1MFAL 3S96A 3ARTA 3GI9L 5EBMB 1V3MA 5JW4Q 4HJGA 4RIRA 2GK0B 5IB4B 4O5LL 4KV5F 3U36A 2ZSVB 4ERSL 1KF9B 1GOFA 3DETD 2XKNA 1RURL 3QUMB 5CJXC 3WMSA 1FBIL 2AJYL 1YYLH 3TVMC 7FABL 3TBYB 3O3BB 2Y5TB 3GSOB 3LD8C 5K33A 1RJYA 2X9WA 5F9OL 2DQFB 3R1GH 4GQ9L 4GUPA 1KN2H 1PGRB 2FGWL 5HSFA 4G42B 4XPHL 4HG4K 2VERN 4MDJB 4DKDC 4BKLB 3CGTA 3CX2A 4LDOB 1SVZA 3UTSA 2VXVL 5E2WL 5FUZH 2P49B 5IMMA 3IDXL 5JW4R 1J05A 2BJML 4DKAA 1QFWH 2XQYK 1JV5B 3VWJC 4XWGL 3U46A 1S7QA 3HMXL 4LEOB 5J9PB 1KJ2A 2ILLA 1YNLL 1TNNA 2ESVE 3EZJB 3MTRA 4X5LA 2LVEA 3FMGL 5GSRA 2VLMD 2DBJA 2VZ3A 2BSTB 1O5DT 3IDGA 3WN5C 1H3TA 5D93B 4OF5A 1FO0H 3VRJB 1WZ1L 3JVGA 4CN4A 2E9WA 1PQZB 1CXFA 2DM3A 3P4NA 4HWNA 3P2TA 3NPZB 1ETZB 5D7SH 1NFIB 4MA8H 1XIWA 4XNQB 1C1EL 2C3VB 1G6RB 4GAFB 4U2ZA 3UTOA 4RMVA 3U48A 5FECB 3OJVC 5GGTH 3TYFA 5I66A 25C8H 1IQDB 3BDYL 4PB0L 3I85A 3LDBC 4IOIA 5FKPB 1NFDF 1LO2L 3IETB 1JI2A 1INDH 4XPBH 3ZL4H 2WW8A 4LCYB 3RUGF 3TYGL 1Y6KR 2R4SL 4MS8C 2EYTB 1AHWC 4YHLH 1TTGA 2HAZA 1CDUA 1VSCA 1NCNA 1XT5A 3U7AA 3V9FA 2VDPH 5HYEA 5C08D 3BKCH 5SV4A 3PABA 1CICA 5T3XH 3DRQA 1HQ4A 4ESKA 2Y7QB 4KZEL 1PY9A 1U58B 1BX2A 4U6HB 4HPYL 2XTJE 4OKVA 5JUEL 3V6OC 2OMNA 5F8QC 2UUDK 4RMWA 1UVQA 4H8WH 2DQJL 3GJFK 2J7LA 3O6FB 4O00A 3RX8A 2JCCB 3UTQA 5EUKA 4ZFOA 5L2KB 3RWIB 4FP8H 4TUJB 1Q8MA 2GJZA 2BOBA 4HQQL 3RIAK 4W68A 2OM5A 3Q6FA 4Y5YC 3TBWA 1E6OL 2H2PD 4S2SA 3RKPA 5GGRB 1U42A 4PR5A 3BMVA 1EJOH 1KBGH 1MH5B 4WU5A 2HVJB 1EXUB 3FQRB 3FL7A 4X9FA 1MFCL 1G7HB 2QSTA 3CCHA 4Q6YA 4V2CB 3QIWC 4JHWL 5GRJL 4QTIH 1BWMA 4H88H 3IDYB 5CEZH 1UQSA 3L7EA 4LSVH 3PUCA 4KHXL 1KB9J 2F8XC 1IILE 1KNOA 2F5BH 1DCLA 4ZD3L 3P0GB 4JFPA 5F9JA 2BVEA 5FGBA 5CKAA 3O9WC 3FQTA 3V95A 5AUMA 3HS0B 1Q1JH 2MOVA 4OFPA 5DUML 1AQDB 1F02I 2YHGA 3OR6A 5I71B 2CDEB 1ND0A 2DICA 1SJEB 4CKVX 1IGIL 2WINB 4DGIH 1IM3B 1N4XL 4F7CA 4GAYB 1KSRA 4PGDA 5SWZE 1YMMA 4PJ5D 5C7XL 1OGTA 5E5MA 2BDNL 3BT2H 3OZ9L 5DK3A 4J8RA 1BJ8A 2OP4H 3QG6B 2R2EA 5GGRY 3NCYP 1NAKL 5IMOA 1WBYB 5DS8B 2GSIA 4QHMB 2ATKA 1FNHA 4Z7WB 1YY8B 2DQEL 2VN4A 4U6YB 1EFXD 3EFFB 3TWCL 1FJ1B 5IFJB 1Q9KA 5H2BA 2JIXB 3AMLA 4K3EH 1M05A 4HEME 1OP5H 1KTRL 4X6DA 3T2PA 2EC9T 3W0WB 4KQ3L 4FN0A 3LRSA 4EDXA 4JFOA 3SCMD 4PRDA 4BFGA 2XKSA 3MCG1 3MRJB 4HIEA 1F97A 2I9LA 3UC0H 4N0CD 2D7TL 1T20A 4FQHB 3DO7B 4OLZH 3ABZA 1JPST 4F7PB 4HS3A 1DBKL 1XR8B 1IRAY 1GZPA 4GT7A 3ULUL 4LRIC 4AT6A 3IU3A 1P4LB 4NC2B 1JWUA 3E2HB 2Y06L 2UWEA 4H25B 4LCCB 1J5OH 4XPTL 4JPKL 3ISWA 3IDIA 4UU9A 3ROOA 5F3HA 1JPFA 3WIFA 1J8HB 1F8TH 2DJUA 4DCQB 3QO0A 4UNTA 4JG0L 4EI5A 1MWAA 4AY0A 4J23A 4APQB 1VENA 4Q9RL 4XZUA 5DLML 2HRPL 4RNRB 4NOBA 1I8MB 2NY4B 4YEEA 3QDGB 3VFMA 3ARGA 5ITBL 4M5ZH 3LH2L 4YXKL 1BQUA 3R0NA 3VG9B 4HKBB 3BUYA 3ES6A 1JZ2A 4GW4B 2Q1EA 4JFXB 2IH3A 1PZ5B 1OLZA 2VRAA 3EUUA 2X4SA 3VW3H 5JXAL 1BEYL 4RGNE 1IKNA 1DQDH 2ZCKL 2QQLH 4EN3C 5E2UL 1I85A 1EPFA 3I6GB 5E24E 4PUBH 4L5FL 3QUZC 2Y6SD 3QUXA 4GQPH 3WFHA 3ECBB 4DK6A 3ZDZE 2Y07L 3RNQB 2E7LC 3C6LC 4OIBA 3H42H 2DJSA 3SDXF 4OGXL 1U8NB 3BYTA 4NNYB 1FAIL 1CT8A 3HG1E 4NGHL 4L4TD 4ISVA 1FVDA 4QRSA 3VWJD 1JJUA 1T7VA 3NACL 4P99A 5E6IB 4TULH 3VRIA 1AGCA 5BZWA 4WU7B 3RI5F 4PFEA 4B53A 4MSWB 1OW0A 1YQVL 3H7BA 4ZQKA 1GGCH 2CK0H 1MQ8A 5CD3A 5DSCB 4R4BB 3QQ3B 1G1YA 2CLZB 1I3RB 2DQCH 3OAYK 1GSMA 4WCYH 4CMHC 1KB5L 1LO4L 1HHGB 5HDQL 4EUPB 5DZLA 4ORZC 3H9SD 4J3WA 3LN4A 4KJQC 1MFEL 4BH8B 3S4SG 1YEJL 1IM9D 2IMNA 5KOMC 1OCWH 3MXVL 5FYJU 1UM5H 1ZHKA 3HE7B 3MO1B 2LQRA 2EXWD 3NCJH 4JRYD 3EO9L 4KTYA 3EYSL 4GS7B 4BZYA 4R3SA 2CUHA 2X89D 1EEZA 3NCFB 4JY5H 5C0DB 5ETUA 3VXMA 5D5ME 1BAFL 2VWEE 4IM8A 1B2WL 1RZJC 2W0PA 2AK4B 4XCEB 4MS8D 3V2AR 3EDDA 2HYMA 5MI0C 4RMSA 1Q0YH 5C07A 2R4RH 1RZ7L 2EIZB 4P9HL 5D2NA 2H2SC 1G9MC 4MQXC 3SDAC 4S0SD 1BVKA 3IFNH 4E9LA 1QVOA 3G6JB 4O51A 3F7YB 3O6LH 1AO7A 4BSWB 3TBVA 3BP6B 3QUYA 4N90E 4PJIE 2YD2A 4FQ2H 3S5LB 1U8KB 5FA3B 2VSCA 4GRWB 3DX9B 3MQIA 3SDDC 3KPQA 4XBEH 3AY4A 4PRIA 1SHMA 2WUBH 4HUXB 1D5XB 2DWDB 2DTSA 5EU6D 1YEIH 3SO3B 1XZ0A 4JDTL 4XTRC 5FDYA 1TQBB 3CXHK 3OKNB 3V6FB 2FATH 2EKSA 4XMPH 4JPVL 3RX7A 1VACB 1GGYA 5FYKD 1KIPB 4OCWL 4F3FB 5FOBA 1IKFH 3QIWD 4D3CH 3HC3H 2J6EL 4TOYH 3P4OB 4GG8B 4JM2B 1NGQH 3OKYA 5CEXB 2A74A 1CFSA 3F7RA 4UQ3B 4LEXH 4XNYL 1F6FB 4M8QB 1RJLB 2JJSC 2DWEB 4Z7OF 2P7TA 4OT1L 4P4RB 1U91A 1AE6L 5ITFA 5A3IC 3LMJL 2D4DA 2F53B 3TO4D 3RZWA 5EO1B 2E7BA 2AK1L 2J12B 3RDTD 3ZSTA 3OKDA 4RISL 2X4NA 1WWWX 2Z35B 5KBNC 2ARJB 2H3NB 3BGFB 4E42B 2EEAA 5FO8B 4HJ0D 1AD9A 1BJ1H 2G2RB 2XWJA 3MUHL 3Q5YA 3MV8D 1E6JL 5D93C 2VLJD 3VFVA 15C8H 1DBJH 3QWQB 1F11B 1T7WA 2PO6B 4NSKB 1NCDL 4PYGA 5JOPD 1HZHH 4S1SH 3BW9A 4CU7A 4UV7H 3D39B 1ZVSB 2D03L 3GSVA 4FTVD 4X98B 3R8QA 3WD5L 3PV6B 1RPQA 4KUZH 3E8UL 3WIIH 5SX5H 4WWKD 4WFFE 3VRLF 4XVTH 1MAML 3MV9D 4G8GD 2ESVA 4QOKB 2F8OA 2OJEA 1KTLB 4ZPTA 3B9KB 1BWWA 5FEBA 5DRXB 1T89C 3OB8A 5EZJA 2QQKL 1I1FB 3IDUA 4AENA 1YNTB 5JPNB 5JO5B 3WLBA 4DN4H 5ICYA 4LLAA 3MNZA 2GEEA 5B8CA 5IJKC 3D87B 4WEBL 2C1OB 4EKXA 3RVUC 5DMYA 5DD1L 1NFKA 2VL5A 4JFYB 4RQQA 2NW2A 5JHDD 1LVEA 1XH3A 1JF6A 2K7QA 3MODH 1B6DA 4YDJB 5HYFA 4JY6A 3O0RL 4G43B 4K9EC 2C3GA 4CNIA 4W4NA 3D85B 4ZS6C 5I6XB 3LN5A 5J7CC 5F89B 3OGCB 1U36A 1NCUA 4NUGH 2RGSA 1DSFH 4JZOB 2ZKHL 5TGBB 1I1AC 5JR1L 1FNSH 4QKXB 3CFBA 3LKQB 1R3HB 1B4JH 3O6FC 5TPWH 1IE5A 1U8JA 3BIBX 3KG5A 5HYJE 3QEQD 1CFTA 4WHDA 4NYLA 3MGAA 3ULVF 4XAKD 1NC2B 1KCVL 2VABB 4K8RC 3WSQL 5JMOC 3GSRA 4QO1A 4O2FB 4ZTOL 4OZIE 2R2CA 5ICZB 3RJQB 5JNYB 4EN3D 4NWTL 3SKMB 2YZ8A 5IROA 3VFWA 1CK0H 4M02A 2BMKA 3IDYC 4L8SA 4U7KA 3MCKB 1I1YB 1LE5A 4Q74A 4I18B 4RBPH 4I3RH 4I77H 4W4OC 5IR1B 4WW2A 5IVNA 1W0VA 4Y2OA 4JN2A 4LFHG 3S34L 1R5WB 1VGKA 4KKNA 1DFBH 3OX8B 3MJ9H 4NKOB 4OBRA 3FO9B 1U95B 4U1LA 3BN9D 1I1CA 1MCSA 5EUOE 4MAYA 1FE8L 5BO1H 4QF1A 3QAZB 3SOBH 4NJAL 3AMKA 1P9MC 4XP1L 5FYKH 1OSPL 5GGQL 1MJ8H 1UXSB 1GJIA 3WIHH 2ITDA 5DUBB 3SE8H 4YXLL 1JZ7A 2EIDA 2P5EB 4KRPD 1HINH 1MCIA 4WWID 4ZOBA 4JPWL 5HDBE 2R69L 1GYAA 4M4RA 2NTSP 4XPGL 4JVUA 4NQEB 5I1DB 3MRQA 3FQWA 4GSDH 4MXVF 4RFOH 4I0KA 1MI5B 5SWZA 1NC4A 2RCSL 1J10A 2PUQT 3BHBB 3UTPD 1DLFH 2Q86A 4CGTA 2BVYA 2G9HB 3MGOB 3ZKND 5MEND 5ADPL 2EDEA 4Y0GA 3D0VA 4Z7VF 3RWJB 1J1OH 4D9LH 3UYRL 35C8H 4X6CA 1BFOB 3VFUB 1CDGA 4OI8A 3I75B 5CUSL 4PY8I 3TBSB 3DIFA 3VJ6B 5ID1A 1HILB 3E2HC 4LCCC 3T04D 5KSAD 3BESR 1QSED 4UI2A 1P6AB 1XGYH 3SDAD 4UOJA 1JWSB 3L3DA 1K6QL 3QNZB 4HS6B 4OF6A 4P3WA 2E9BA 4A6YA 3QFJE 4PJDB 1LEIA 1QSFB 4APQC 3NAAH 2C7UA 5C0CB 5CD5C 1MREH 5BV7L 4BM7A 4ZFGH 2XACC 3W11C 1I7ZA 4Q97A 1YECL 2NR6C 3VFTB 3HPLB 4RMRA 5IFHH 1GGTA 3VG9C 4F7TA 3OKLA 3MRNA 5I1KH 1JVKA 1ES0A 3U0TA 1J86A 1EBPA 3LHPH 3S37L 4X6FA 3WNLA 1JPSH 1A2YB 1Y6NR 3L5WB 3T08A 2NXYC 1X5KA 4GG6B 4Y5VA 1L7IH 3MACH 1AP2B 1OTSC 4PG9A 4XP4H 2PXYD 3F58L 3PXHA 2FBJH 5ESQB 1QUNA 4JG1L 4M6OL 1QEWA 4R7NA 3G9AB 2ZSWB 5L6YH 5EOCL 4R4NC 5A3ID 2PYED 4X0KA 4H5SB 1RUKH 4KTDH 2ICWI 4I0PA 1MHPH 3V4PH 3QPXL 2P1YA 3C5SA 3N06B 1TNMA 4P5TB 1S8DB 3K0WA 5HY9B 1IAIL 5DMIH 4N8CL 1FYTD 4NZUH 4HEPG 1DVFA 4N0YH 1HKFA 3U0WH 1TJGH 1WGOA 1X5YA 3QNXB 1A21A 4PJHE 3QXWA 1GRWA 4QRPE 3O81A 5ENWA 4PJAF 5HVFB 5C2BH 1CVRA 1KENL 1W0YT 2DD8L 2L4OA 4QYOB 3NTCH 5DJ8B 1KFAL 4X5XB 5CHNB 3WKMH 4XWOC 5INCA 5I18H 2XWBB 3C09C 2KZ1B 4M7ZB 4U3XA 5EU7C 5E00B 5AAMA 2YN3A 5F88B 1IEAB 2DYPD 3DVGB 2B4CH 4XGZB 4YZFF 2ADFH 3MR9B 2OS7A 3OKMA 1DQQB 5HGBA 4PJ7E 3ARDD 3HE7C 2VSDA 5EDXA 1ADQA 4NT6B 2HKFH 1K3IA 4GS7C 5GRZA 1MJUL 3RL1A 1S9YA 4O4YL 1SY6L 3JWNC 1HXMB 1QO3A 3W39B 5FA4B 3FONB 3PL6D 2HTLD 1EAPB 4K71C 5KG9A 3VXQB 4C4KT 4HHAA 1PDKA 3PWUB 3OWEA 4KI1A 3VG0L 4HT1L 2ZZUT 6FABH 3RVUD 3O2DA 4TUOB 3SGDI 4PRPB 3L1OL 4UTBL 5LVEA 5K9OB 1IZJA 1INQA 3T3PF 1YYMH 4AQOA 1REIA 3BVNA 5MEQB 2P8PA 4J2XA 3I50H 2QKIA 4LLQA 3TNMA 1KT2A 4OCSH 1OAKL 4WUUE 1CN4A 2OSLA 5T3ZE 3ALPA 3BO8A 3ULVE 1E4XH 3T0EB 5J11B 4M6AA 1I1AD 2BSRA 3KLHD 4GKZA 3SDYL 1ZKAA 3MLVH 4WENB 2CKBB 4KJWD 5D5MA 3C5JB 4BH7A 2IQAA 2MFNA 1RZJH 2A77L 2VOTA 4ZAKB 2DM7A 1T5WB 1BF8A 1HXYA 1TQBC 3QCVL 4K8RD 1AJ7L 1G7MB 5C0AB 1XF2B 1BZ9A 3NA9L 3FB8B 2J8UB 4B5EA 4JANA 1RZKC 3DX8B 1FNGA 5MEOB 3JWDL 3O8XD 3Q5OA 5D7IB 5C0EA 1DUYA 4FQ1H 1N7MH 3OG6B 1JNJA 3T2QA 4PJ8B 4LSDA 2FD6L 4PBWD 5CBEA 1YUHA 1H5BA 2DQHL 4PJIA 4ETYA 1JHTA 3ARFB 1MY7A 4Z77A 1TZIA 1JHLL 4ZSOB 1U8MB 4LPUA 3TO2B 4HWBH 1RQ5A 4QRUB 3NFSH 3P77A 3DYOA 1S7VA 3K74B 1JTOA 2W9DL 3QXAB 5DRWB 3TJEH 5C0JA 5KZCD 5HD8C 2HG5A 4LIQH 2DBLL 4LNRB 5EWIL 2OK0L 1S78C 3QPQC 4EQ3A 1PYWA 4JRWA 2E5EA 4C83B 4JHAH 3JTTB 4CADB 5TDOB 3KYAA 1Q72H 5HDLA 1F6LL 4OLYL 4E5XA 3W9EB 2BSSA 1H3PH 5E8DL 4FXKA 4AG4H 1MCRA 2JIXD 3GI8H 2AXGA 3X11B 4M7JH 4HS8H 3HLAB 1A3QA 1X5FA 1WCBA 3H9YA 3QJFA 4WI8A 4LBEB 1K4CB 1IGYB 4Y8AA 3K46A 3QDMB 2BXZA 2HN7A 2VLRB 5IOPB 1ZWIB 4Y2DD 1LO0L 2EYSA 5ERWB 4ONHA 2BRQA 4MJ6B 2CRZA 3PGCB 3VWKA 4M1GL 4GFTB 5DEGA 1J0YA 1KJ3H 5CSGA 2FHFA 1QLRA 4XB8A 1FVCB 3I6LD 1GIGL 1U3JA 3DVFA 4WTZA 4R96B 3DMMB 5DVKA 5IMLB 4UIKL 4MLSA 4AIXA 3I9GL 1P6FA 1OL0A 3BE1L 4YDIH 3E6HB 3QEHA 5IM7A 3B6SA 2CRMA 1LD9A 2N56A 2Z92B 1WZKA 1VCAA 5MP6L 3A6BL 5TDPA 1CLZL 3GIZL 3S36H 2A83A 4HK0A 4Q9BA 5E94A 1VERA 1NMAL 1EA9C 1G6RH 5JW5B 1EGJL 3HI5H 1EEQA 2XN9B 1J11A 4LSRH 4HUUB 3D2UB 4MD0A 5GPRA 5CD5D 2HLAB 1ZE3C 1VEPA 2A0LD 5AWNL 3B2UC 5IBUB 1AGDA 4XC1H 1JGUH 3K7UA 5TE7L 2NR6D 4HH9A 5B38G 2FIRT 2DLGA 5EFIA 1KJ2L 5DDHA 3SKJH 4ACPA 5B39B 4AJ0A 3B43A 1CGWA 1K5NA 2GTWB 2F58L 1IC5L 4P3DA 3F7QA 1NCWH 2XT1B 5KVEL 2I24N 1WLHA 4NHCH 2NXYD 3LSOB 1CGVA 4HWEL 4K9EH 1RUPL 4Y16A 1QG3A 1SVCP 4G9DA 2YA0A 2C3XA 5EO9B 2AABH 4YBLB 1HKLH 2QSCH 2QQNH 4KVNL 1A7BA 1MLCB 1MCBA 1NBVH 5DFVC 3D3VB 4R4ND 5IEKA 5FCUH 1X6NA 1NBYA 1DQML 1EVTC 3IU4H 1A6VH 1H3VA 4GAJH 2ZOKA 1V7MH 3MRPA 1RZIB 3WJLA 1N3NB 1Z0NA 4K8RH 2JJVA 4P57A 1IC4L 4X6EB 1Q9WA 4DVBB 2I07B 5I8CB 2VQ1A 3QAZC 4FQCH 1YMHA 3CXDL 1QR4A 4UZGA 4YNYB 4OZIA 4R26H 3CPLA 3OKKB 4Z8FL 4GLRH 3NMEA 5EA0H 4ZXBB 3QIUB 5L2KE 1NGXB 3OKOA 5LXGL 1JNNH 2YEZB 1JPGB 1AHWA 5ELIA 3CU7A 5A1AA 4MA7H 2PTTB 1D5ZB 3WXWH 5HHPA 5DZOA 5IB5A 2DTMH 5FKAB 5AZEH 4YPGB 1OF2A 5GRVK 4NHUB 5FM5O 3VFGH 1DUZA 4HIXL 1RIUL 4MCZA 4X4ME 5EC1B 2GSGB 3BX7C 2WQRA 1E4WH 3C5ZA 5E70A 4JCLA 5EUOA 4H20H 2QL1A 3PWPB 3V7AE 4ZTPL 5GGVL 1YDPB 1HN1A 1YN6B 3DHJA 3MRCB 4JM4L 4ONFH 4ZFOL 3BP5B 1C7SA 1OB1A 3CUPA 4AH2B 2YXMA 3U1SH 1WBZA 4LLVA 5ILTL 3MRGB 3IFPA 1Z9LA 3UYOD 2IAND 2Z31A 3VFOB 1A7RL 4JDVA 2O5YL 4GH7B 3VXSD 4JKLA 4K3GA 1CDBA 5M95B 1U41A 4WTZG 4O2EB 1XR9A 2XQBL 1IGTB 3HTLX 4LAQL 4PRHE 3V4UL 5F96H 4G8IA 4X9IA 3BQUB 3VXNA 1A7PH 5C2UB 1A3LH 3H3PH 3GK8L 1UACL 2RHEA 5D7LB 5DUPL 2BNQD 1I9IL 3O9WA 4S1QH 5FDWA 4F2MB 4XNZB 3W9DA 2A9MH 4U1HA 5FHAH 2R23A 2Y4SA 3THMH 3W0WE 1DLHB 5DI8A 1EEYB 4ZOCA 4OQTA 5TFSL 5IW6A 5C0BB 1RV6X 1C7TA 3IXAA 3S97C 3OGOE 3IJSA 3MJ8A 1ZA3B 4HF5L 3D0LA 3L3HA 5DRZB 1LEGB 1RMFL 5H94A 5KOVC 2H32A 2P4AB 1UWEL 4OLVL 3VGFA 4KMTL 4NM4H 1X5HA 3LZFL 3NH7H 4Z7UF 2NMSA 2GQHA 2X6MA 3NIDF 3MZGB 5E8NA 5F7LB 1KXQE 5KVFL 3D6GA 4ZUVB 3K80A 3MRMA 3N85L 3LEXB 1CXEA 4KTEL 3QFJA 3ARQA 3GRWA 5IBLC 3ROLA 3TIEA 3MMEB 1FFNB 1SBSL 2XNAA 4TUKH 4UUJB 5D72L 3ZYJA 1RU9H 4NZRL 3RTQB 2DIJA 3KLSA 3V6ZB 4CN1A 5L9DH 5GS0L 5JQ6L 3U6RB 1XEDA 3EYUL 5T5FL 2BSED 1INEL 4JDZB 1TQCB 1MCLA 2F53D 1QA9B 1JK8B 3E3QE 2XYCA 1NUGA 3CZFA 5K93A 3RAJH 3TA3A 2UY6A 1HK6A 1S78D 1N5YL 1JI1A 3QPQD 1S5IL 4L8CB 1MCEA 4Z7NE 3MNVA 3FFCD 1FNEA 2BFVL 1UKTA 4LRIA 3T4AA 2BVQB 1YEHL 3KR3H 5L7XH 3P73B 3HMWL 1H15B 1ZT7B 3OJMB 1GAFL 3SDCD 3NZHH 4MDIA 1IAKA 4NRZB 1BQHB 5I8KL 1PLGH 3DX6A 3KPOA 1UB6A 1T22B 4YX2H 3TIDB 3DUUB 3QRGH 1K8DB 1WBXB 3MLWL 2ADGB 4ODHH 4IRJA 4YBQC 2IFGA 3HI6H 1WC7B 1A6TA 1MWAL 4D0DB 3BWUC 5D2LA 4O5LH 1NCCH 3MA7A 4KRLB 3RVWC 4I9WD 4ERSH 1BVLB 4U1JB 4P2OC 1RURH 4K7PX 2R2BB 3FAXA 4FS0A 2YK1H 3UPCA 2AJYH 2B1HH 4QOKD 4LKCB 4PGEB 4PJBB 1CLOL 1M7IA 4PJHA 1IL1B 4QRPA 5F9OH 2G60L 3K3QA 2P8MA 1RHHA 1U92A 4GQ9H 1A4KA 2FGWH 1MCHA 4XPHH 1KTKE 1DBML 1UG9A 5E2WH 1I7RA 1NAMB 4QXGL 3BFOA 3WYRA 4GW1B 3F12A 3RKDC 3QUZA 3E0GA 3IDXH 5E7BA 2BJMH 1QKZL 1U8PA 4XWGH 2MCPH 4POYA 3HMXH 1ZS8A 2RQ8A 4PJ7A 5DJYA 3O3DB 3C6LA 3HZYB 2E7LA 5FGCB 4YWGH 1YNLH 4KKCC 5HHNB 1MSPA 2HVKB 2FJHA 4DW2L 3MRDA 1JGEB 3DARA 1QLFA 3CVHL 3FMGH 1R3KA 3ULUD 3HNVH 4HJGB 5CMAB 4P5KB 5DQDL 5J11C 4OV6F 1MF2H 4RZCB 2O61A 1YEKH 3PQYB 4DOHB 4LLDB 1WZ1H 4OZFB 4BJLA 1BOYA 4ZAKC 5IVXF 3N1PC 5BS0D 1NC2D 1ZT4A 5C0GA 1GHFL 2H8PB 3TBTA 3ALWA 4K23L 3GO1H 5KW9L 1QFUL 4IJ3B 4U1IB 1RJYB 1GZQA 4V1DE 5FV2A 4GUPB 4WHTA 2PNDA 4EVNA 3EYQD 2AERT 2VLME 4G6AC 5FB8A 2CDFA 2AK4E 3FAWA 4LLWA 4HD9A 2C4FU 4WUUA 1YPZA 2V9TA 4PJ8C 5DJZB 4CAGA 3BDYH 1T4KB 2B7DT 3NFPA 5IMMB 2PCPA 3ARFC 2NY0D 1JWMB 1FLRH 3QQ4A 4HKJB 3EBAA 4WO4A 3U46B 5ACZA 4I5BB 5CINL 2VLKE 2YD8A 3TYGH 2R4SH 1HOCB 5F9AC 3UZEA 1FP5A 4QHKI 5EU5A 4NUJB 4M7LL 1IGCH 3DV6A 3H3BC 4GRWE 4I1NB 3FOMB 4PP1C 1RZKH 4KZEH 2F54A 1HH6B 5JIPA 4MNGB 1L9MA 3P4NB 5JUEH 4NZTH 2D9QB 3L6FB 1XIWB 5ISZD 2P5ED 5J1AA 4XBGA 2YUZA 4WI3A 1OP5K 3LQAL 1R3IH 2DQJH 4PRAA 5KSBB 2ADIA 4LHUD 3P3YA 2E9JA 1HWGB 4MHHG 1E28A 4LLUA 3PXJA 4HXAH 4HQQH 1MVUB 5FXCH 3QXUA 3HFML 5DWUL 3AAZA 5I17A 2P5WB 4QY8B 4UILL 5E1AA 1BBJA 4IOIB 3WFEL 1IZKA 4PJFF 5GRVL 2DI8A 3SDDA 2BY0A 3BEVB 1FDLL 2VXSH 4QXUL 4JHWH 5DD0H 5C09D 4N1HB 2XWTA 2BX5A 3CFKA 1M71A 2X70A 4PLKC 2R0KL 1L6ZA 5IB4A 1HQ4B 3DMMC 5DUMH 2ZSVA 3PGFH 3GSQA 3HE6D 4ZODA 4HW6A 1G7IB 4ZUWA 3UJTL 2FX9H 3KYMA 3QUMA 4PJCF 4DKFL 1SYVB 4X4XB 3HR6A 5C7XH 3TBYA 4J6RL 2Y5TA 3UTQB 3O4OB 3OZ9H 2JJSA 4HUKB 2BOBB 2DQFA 3Q6FB 4G42A 3MRHB 1NAKH 3NABL 4YFLI 5C0CD 5I1CL 4MDJA 1GVIA 2AJ3B 4JFEB 3O4LE 1JHKL 4KK5D 4PR5B 2DQEH 4BKLA 3I3DA 4WU5B 1MCPL 3D9AL 3D39E 2VL4A 3CXHJ 1KUMA 4CU8A 4C56D 1PD6A 5C0ND 3NIDE 1UQSB 3ESUF 1N5AA 1N0XL 1RI8A 4JFPB 3VXUB 2OTWB 2DLTA 1BQSA 2HTKD 2BSTA 2GJ6D 1FFOB 2H6PA 1FZOB 3OR6B 3DTXB 1ND0B 2V5TA 1U6AL 3VRJA 1DE4A 4F7CB 1PQZA 4JKPL 2AQ1A 5IBLD 1JMXA 1NFIA 4YBLC 3ULUH 1YYLL 3DOSA 5IHLB 3BAEL 4Z76B 1G6RA 5DGQA 4G7YL 3NCCB 1KN2L 2R2EB 5FECA 4XPTH 1JCKA 1Y6MR 4JPKH 2GSIB 3BD4A 5EBLA 1H3GA 3R06B 2ZUVA 1IQDA 4LCWD 2AKRB 1QFWL 5H2BB 4JG0H 4X6DB 4X6BB 4PP2B 3NIGF 3QIUC 3VDCA 1S9KC 3N1MC 4X83A 5I1LA 4Q9RH 2EYTA 4BK4A 2HRPH 3LRSB 3VH8B 1J12A 4EDXB 2BNUB 1WFNA 4R2GB 4TNVK 5KAQG 5ITBH 2QHRL 5ESVA 3KLAA 3LH2H 4YXKH 1W0WA 3WHXB 5CP7A 4U6HA 4HS3B 1B88A 2AP2A 3HPJB 1ZHNB 4JRXB 1GZPB 4PJGE 3X14B 5JXAH 2CK2A 5D7SL 1TLKA 2IWGA 5DEZA 3UPAA 3ZSSA 4P2OD 1DANT 5E2UH 3EOTL 2GAZB 1MCDA 2OXGA 3O6FA 2JCCA 4L5FH 2UWEB 5L2KA 3RWIA 3BUTA 4TUJA 3IDIB 5D2LF 4UU9B 2Y07H 3ZYIA 3ROOB 4Y4FD 2F74A 1X5IA 25C8L 1MCWM 5GGRA 5J1SC 5KS9F 4XC3H 1MH5A 1EXUA 3OJDB 3FQRA 1FRGL 2DJ4A 4EI5B 5LGJB 4OGXH 3DXAD 4KRMB 4OCNC 1FAIH 4UBDC 4NGHH 1SEBB 5EC2B 3RKDD 4XZUB 5TJWK 4YHLL 1R24A 4X4MA 3BQUC 4Y5XC 5GZOC 2Q20A 3NACH 5ABDE 1TJIL 3ARGB 4YHPA 4BQCA 2OZ4A 5HGHA 2UY7A 4KDTC 1WWBX 2V2TB 4KKCD 3BKCL 4W4OA 4NQEE 5T3XL 1YQVH 1AQDA 4NWUH 1RVFL 1EZVX 4XMLL 5F9DC 2WINA 2X4SB 1OSZA 3BPOB 3QDJD 3QIBD 2X41A 1MI5E 3LKOB 2W9EH 4CL7A 1LO4H 2X1PA 4L4TE 5DFTA 2JJUA 2WWMD 5HDQH 2CGRH 2AEPL 1F3JB 3QUXB 1MFEH 4FP8L 2YR3A 4PRHA 1Z3GL 4GBXD 5C0AD 3GIVA 2FYYB 4NIKB 1WBYA 5DS8A 5T33L 4QHMA 5BQ7B 1YY8A 1EJOL 3QBTB 3EYSH 5CEYB 2NXZD 1FJ1A 5IFJA 2VXTH 5FOJA 3OPZH 4PJ8D 2I60L 1DEEA 2NPLX 1TVHB 4ISVB 4QTIL 4I3SH 3W0WA 4QRSB 3H9SE 3HAEB 1B2WH 2F5BL 1VA9A 2J4WL 7CGTA 3VRIB 3RTQC 3LRGA 1QRNE 4K3JL 3MRJA 4R97B 2MWCA 4J3XA 1YPZF 4ZO8A 3WNOA 1TQCC 3H7BB 4ZQKB 1RZ7H 4PJDE 1QSFE 3DO7A 4DGIL 1A1MB 3PWVA 5D1ZA 4F7PA 3JWDC 1XR8A 3BGMB 4IOSD 4PP1D 5D1XA 5J3HD 4N5UA 4L4VE 3RL2A 4BSVA 1UT9A 3PWJB 4DZ8A 3GB7B 5CJ8A 3LN4B 1P4LA 3SJVD 2ED7A 4H25A 3ZE0E 3ZT6A 4P46A 1ZHKB 3RGVB 1JUFB 4OZGB 2Z91B 3OB0K 2WAHA 1JF1B 2VKWA 3RNKA 1TJHL 4DCQA 5HYSA 2UUDH 1EEZB 1G84A 5HXMA 5KAQF 4OZHB 3V8OA 3TEUA 4APQA 1ACYL 2OX5A 3HZMB 3QYCA 1DQJB 1A7QL 1A02N 4PIRF 1WV7T 1I8MA 2J6EH 3BGAA 3QDGA 5B3JE 5CJOH 5C07B 3SE4A 1NEZA 2OR7A 1F13A 4HKBA 3RVTC 4PLKD 2JELH 3VXRB 4JFXA 1P5VA 2IGFH 1WJ3A 3KPSD 1PZ5A 1BVKB 3QI9D 4FQPA 4M9PA 4OT1H 1QVOB 1BVZA 5HVHC 3MLPA 1EIBA 3A6OA 1XGRB 1LDPH 2YPLD 2NCMA 3TBVB 3QUYB 1EZVY 2HFFA 2LTQB 2AV7B 3I6GA 5GS1B 4P3CL 3ZHKA 4RISH 4NO0B 3RHWK 4XP6L 3RNQA 2W0FB 1TCRA 2XN9D 1UZ6F 1BM3L 5L88H 1WF5A 3JWOL 4YE4L 4PBVC 4HKXB 1OTTC 1QFOA 4GAGL 4JR9L 3B3IB 2A6DA 3GBNL 1XF1A 1X5XA 4LLYA 3CFCL 3U7WL 2B20A 1KN4H 5E6IA 4MQSB 5I1EH 1S7XB 1NCDH 2F15A 3OJ2C 5GZNC 5CILL 4WU7A 5IW1A 1CFSB 3X12B 1A6UH 2D03H 1OQXA 2HJKB 3KPMB 4FFWD 4IJ3C 5DSCA 3WD5H 3QQ3A 4WDIA 2CLZA 2P7TB 3E8UH 4MLIA 5MHSD 4L3ED 4M4PA 3WO4B 2EEBA 3IB4A 3VU2A 2W07A 4HLZH 1HHGA 5FO9B 2AJVL 4FA8A 4EUPA 4JQXC 1ZOXA 4PRPE 5JOPE 1UM4L 4ALAL 3C08H 3EOAB 3D3VD 5E8OB 1AD9B 4FTVE 3MO1A 1ADQL 3H42L 4WEBH 2XWJB 1VFBB 4PV9A 5DD1H 2X9XA 2Z8RA 3NIGE 4MMXC 5KSVB 1HSAB 1KULA 3T0EE 3EKCA 4HBCL 2OQJB 1AQKH 3O0RH 5C0DA 1ZSDB 2VQTA 4V1DA 4QHNB 4TULL 3QIUD 1PZUB 3QT2A 4HZAA 3PNWB 3WNNA 2AK4A 3P40A 1E4KA 1MCJA 1EHAA 5IQ9A 4XCEA 1XIWC 2ZKHH 3GSVB 5JR1H 2EIZA 3H9HB 1EK3A 1W72B 2J8UE 5T5NG 2D31B 2VZSA 1X5AA 2VLKA 3L3JA 3S8WA 3WCYA 3G6JA 4LVEA 1KCVH 4TQEL 5GGUA 2ESVB 3WSQH 2C9AA 3BP6A 4NBYB 1B0GB 1FZMB 1U8KA 3ZTJH 1OCWL 5FA3A 2A6JB 4ZUUA 5EG6C 2LV4A 4NWTH 3MNZB 4X99B 5B8CB 4OIIL 3V0VB 3DSNA 1D5XA 4HUXA 4XVSL 5D9SB 1LP9B 3RWFA 2VL5B 3OKNA 4YHZH 3V6FA 2NW2B 3QEQE 4LSQL 4WFGE 1VFOA 4I48B 1TMCB 4JY6B 1CICC 1VACA 1EO5A 2JCCF 1KIPA 5E03A 3S34H 4F3FA 2DOCA 1U3HB 4NO2A 4PGJA 1Q0YL 3P4OA 1FE8H 5GZOD 4JM2A 4P4KA 3CFBB 5CEXA 3H8NA 4XP1H 4MNQB 5I1HL 4UQ3A 3EFDL 1OSPH 2SEBA 5GGQH 3O4OC 5DR5L 2E8ZA 4NYLB 4X80H 2DWEA 3IFNL 4P4RA 4YXLH 3QUKB 1QOKA 2PN5A 3GSRB 2NZIA 5EO1A 3QHTC 4FQ2L 3QDME 2Q76B 4JPWH 2R69H 2VLRE 4XPGH 3V5KB 2Z35A 5SV3A 4XBEL 3FB5B 2XI9A 1DL7L 2H3NA 4XHJC 3VFWB 5FO8A 2Y1VA 2XTJB 4L8SB 4LMQE 5E9DE 3NPSB 1T7YA 1I3GL 2D7PA 5GRWA 5F71A 2FATL 3PHSA 5FGBC 4GW5A 5DTFA 4G9FD 5JOEA 1W0VB 5LGHL 5ADPH 3WFZA 4U1LB 2PO6A 2X7LB 2YD9A 3KJ6H 3HC3L 4NSKA 3UYRH 5B4MC 4Q6IB 3TZVD 4TOYL 5JOFA 3GM8A 4YHYB 2YRLA 1WUNT 3O4LA 3IGAB 4EUPG 2CD0A 4Z7WF 3D39A 1ZVSA 3ZKMC 4X98A 4LEXL 1L7TL 4UMGA 2F19H 3PV6A 4HCRA 4UT9L 3RZCB 4IDJL 3MZTA 3H3KA 1DEDA 1JGLL 3BZFB 3C60B 2Y36L 1K6QH 1KTLA 3B9KA 4PJ9B 4R7DA 5DJDB 5DRXA 2W91A 1I1FA 3MRQB 5JMRA 3FQWB 1YNTA 5JO5A 1A7NH 1YJDC 4CMMA 1YNKL 2MNUA 4GO6B 2C1OA 3MV7E 3MLRL 3HRZB 3Q5TA 4UT7L 1KACB 5SWZB 4KK6C 5E1HB 1YECH 4M3JA 3TH4T 1CTNA 3F5WA 1FAKT 4KFZC 3D0VB 1DBJL 4OGYL 2NY1C 1JGDB 2DLIA 1HZHL 3OGCA 4S1SL 5F7MC 3KYOB 2AEQH 4UV7L 4Z78A 4JZOA 3OF6D 3VI4E 5TGBA 4NC1E 1ZLUH 3S5LG 4JJ5B 1VFAA 4TVPE 4ETQA 2UZXB 5HI5C 3WIIL 3RVTD 2AQ2A 3MFFA 3W81A 4LAJH 3DPBA 4XVTL 2VABA 3L3DB 4DEPB 1CE1H 1UJTA 4NBZB 4O2FA 5DJ2B 3OMZA 5F7DB 3JV5A 3VMPA 5ICZA 3VFRB 1PW3A 3FB7B 4EI5C 4A6YB 4D9RE 5JDSB 5JNYA 4DN4L 3FQNA 1QBML 2ITCA 3QPXH 5IBTH 3LKPB 2P47B 3ARBB 1G1CA 4PJGA 5DVOA 3FN0L 2DL2A 1I1YA 4N8CH 3ARGC 3KPRD 4I18A 1QP1A 3MODL 3UO1L 4F7TB 4NO5A 4ONGL 4PD4K 5IR1A 5ANME 3KPPA 2NNAA 5TH2B 4RSVA 1OTTD 4X6FB 1R5WA 2ARJQ 5EO0B 2P24B 4NKOA 3FO9A 1U95A 1KENH 1IKNC 4JGMA 4FXLA 2DD8H 4K55A 4JO2H 2NY3B 1KFAH 3FQXB 1I85C 5C70A 1B4JL 5TPWL 3QUXC 4MCYA 3JUYA 1OY3B 1UXSA 1T2XA 5DUBA 1Z9MA 2A9NL 3H6JA 5J0BA 43CAA 1TTFA 4R7NB 3M45A 1MJUH 3C6SA 4NQDB </