4AMKH

Fab fragment of antiporphrin antibody 13g10
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
215
structure length
215
Chain Sequence
QLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWVKQTPGQGLEWIGVIYPGNGDTSYSQKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYYCSRGGAGIMAYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB13G10, HEAVY CHAIN
publication title Crystal Structure of Two Anti-Porphyrin Antibodies with Peroxidase Activity.
pubmed doi rcsb
molecule tags Immune system
total genus 41
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2012-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4amkH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4amkH02
4PD4K 4QRQA 1H5BC 3VWJC 2EDHA 5EU7E 3ULSB 3C6SA 4P3CL 2BY2A 1QFWL 3HAEA 4PJDB 4OCRL 4JFDE 1FNAA 1T21B 4JM2C 5DJCA 3PGDB 4RA0C 5JQ6L 4CVXB 4KTEL 4Y5VA 2OXGA 2MKLC 4KK6D 2CUMA 1P84J 5I1EH 1R5VB 1SQ2N 4TSBL 4U31A 1WWCA 3P0GB 5FIEA 2PYEB 3VXUA 5IEHA 4MNQA 3NCBB 4QTIL 3KPRB 4FP8L 2H45A 4WI3A 3S34H 1K8DB 4XWOD 1EEZB 2HG5A 3EYQC 3PDOB 2WWMD 3BOVA 5L6YH 1EHLL 4GRMB 4I77H 2DMCA 4V2CB 3T4AB 3HMXH 2CLZA 4PJHA 5H2BA 2CMRL 3IGAA 1RQ5A 1BZQK 1U8HA 1QSEA 1KYOK 3AXLB 2YK1L 2IH3A 1HOCA 1FIEA 3HZYB 3RY6A 1SYSB 2ZKHL 2ZPKL 5FK9B 1LK2B 3STLB 2W0PA 1BOGB 3X17A 2NY0D 5DS8A 1VSCA 2CGRH 2UWEF 3SO3B 1MCCA 3OL2A 1CD0A 3V79C 4OTXL 3WFDL 1SY6L 2HTLD 1NAKL 3DYOA 4DKEH 3TH2T 4OCYH 4PJAE 3Q5OA 2NY7L 5CEZE 5HYSA 2W9EH 2HJKA 1BHGA 4IOFC 1P2CB 4XPTL 3MACL 1U92B 1U9KA 5I76A 4M8QA 3PXJA 4V1DE 5EUOB 1Q9WA 1G7PB 2FH8A 2R0LH 2IBBA 1M7DB 5C0RL 4HS8H 3SKJH 3BRDA 3PWPB 3JWOL 3QXTA 2H26A 3MJ9H 1CLCA 1N5AA 2B2XH 4UTAL 1Z0NA 1YNKL 2CKBA 3U83A 4LKXB 3CMOL 3S4SA 3GBNH 3OKKA 4HFWA 4K07A 4P5KB 4DGVH 1IFHL 3VW3L 1KOAA 5IM7A 1UWGL 3RVTC 4KPHH 4FG6D 1H5BA 3VWJA 1CFQA 1VFAA 2DWEA 5E6IC 4N5EC 4Q6IA 4EUPG 3S9DB 2X89A 3MNZA 3NFNA 2QV2A 3M8OH 2DQHL 3UCRA 2BNQE 3K8MA 4AENB 4YHMH 3TO2A 1MNUH 1JPST 2VZ3A 1AD0B 5KZCD 3RTQB 5B38B 4M1DL 1PKQE 1RJLB 4MD0B 3JWDL 4R7NB 2OTUB 4X5LA 2W9LA 4CU8A 1HHHB 3MROA 2R0KL 2C9AA 1OP5K 1UA6L 1NUDA 4AEFA 3HAEH 2NY2D 3MRRA 5FKPB 5BRZD 1FNHA 2BFVL 4OQ1A 2IBZY 4NO3B 4MA3B 3M17A 4DKAA 1C7TA 5MEND 5EO9A 4NO5B 2AKRB 2VXVH 2B0SH 1F45A 1KULA 5D71L 4LLWB 4TTDC 3QQ3A 4NDMA 4YDVA 1FZJA 2O93L 3ZDXF 5BVPL 4HF5H 2JK5B 5CHNB 3RGVA 4EQ3A 4Q0XL 4NYLA 3BHBB 1OP3H 5HI4C 1H15B 8CGTA 3DXAE 4PP2A 3T1FB 5EUKB 2XN9B 4UU9A 3PWNA 1D3CA 1A7QH 4O5LL 2XKNA 4M7KL 3UX9B 2NX5E 3ULUF 2A1WL 2GK0A 1SMAA 4O2CB 3VFWB 2O61B 1NCWL 2BNRA 2LABA 5MP6H 5T5NF 2OJZH 3ULUE 4NZRL 4L8SC 5EBLB 3HZMB 1F42A 5DJ0A 3RVVD 4HIIA 4XCEB 2M26A 4JHWL 2FCBA 4F15B 1F58L 3G6DL 2ADGB 3DHMA 1JHKL 5TFSL 4XNYH 3M07A 2IWGA 1Q38A 5CILL 2BDNL 4PLKD 2BSED 1J0JA 4ZG1A 2D7TL 1QR1B 4W68A 5HHQB 4OLYH 2Y9RT 2V2TA 3IDYC 4NZDA 4XPBH 5C0AB 1O0VA 2BVQA 5C08E 3R06B 4HXAH 1QLEL 1C16A 1DQLH 1HE7A 4PJEF 1NGPH 5DSCA 1I1FB 4ZSOB 5INCB 5TE6H 5K9KA 1DBML 2B5IB 2DS4A 3VMNA 1A4JA 1CBVH 2P5EE 3P11H 5D8JH 2PW2B 1CICB 1EEYA 1L0YA 4C57C 2A6KA 2VAJA 5E6IA 4U6HA 5FUCC 3IDIB 3MLYL 3T0ED 4XTRD 1ZVSB 4RMTA 1LO0L 3MRHA 1D5ZA 4S1SH 1XF4A 3BFOA 1FH5L 1VGKB 4OGAD 3OJMB 4IOIB 3U0WH 4EXKA 3MFFB 2EXWC 1KENH 3ZSSA 1DN2A 1BD2D 1UM6H 2C3XA 4HIXL 2WLZA 4I48B 3LB6D 3DX6A 3QXDA 1VESA 1ZHNA 5KVEH 1GH7A 2JIXD 3VXMB 4UNUA 5TDPB 4L4VD 4HUVA 2WIIB 1P9MC 4P57B 1OQXA 5I1JH 4K3JH 5KOVC 3BWUC 4S1DD 5CEZL 5KSVA 2EDNA 3ESUF 2A77L 3U30B 2WBWB 2FDBP 3BQUB 1FIGH 4FFVD 5CJOH 4M1CD 4P2RA 5ACZB 2H1PH 4CADB 4HWNA 2IMMA 2WM0A 2CDEB 5LAXB 2FBJH 1BJ1J 2I5YH 4OV5B 4UIKL 2ITDA 4ODVH 2OSLB 4HIJB 3I50H 1ERNA 5GGRA 1Q9LA 1R5IB 4KRPD 1LE9A 1YPZB 4LSVL 3CVIH 1K4CB 3H6JA 3I75A 4XMKL 5ESVA 3O3AA 4HCRA 2VN7A 4G7VH 5ENWB 4L8SA 4IHOB 4GAGH 1MVUB 3DI2B 4HJJL 4LHUB 5L0QC 1C5BH 1BECA 5I1HH 4KZDL 4S1RL 1UJ3B 5FGBC 1IL1B 3QEQD 3G6JF 2ENYA 1FPTH 4ZDHB 3G6JE 3O9WD 4WDIA 1FGNL 1GZQB 1KNOB 1MCOH 1W0YT 2C1OB 4JR9L 3AAZB 3UP1A 3UPAA 1SJEA 4K3EL 3T77A 4R7DA 4LKCA 1J5OH 3TYFA 3GSUB 1VPOH 2KPNA 2DWDA 3TBWB 3ZKMC 5FDWB 4N5UA 3TZVA 2FX9L 4OAWA 4EJ1C 1I7TA 4JFQB 3ZO0A 3DSFL 4OFPA 3QNXB 5T1MB 3NTCH 1JHTB 3OB0H 4FFWD 3VWKC 2AJZA 1JI1A 3MRDB 4HS3A 3WIHA 1Z3GL 2BSSB 2VISB 4JY5L 4MX7A 3CVHH 2DM2A 4U1GB 5EC1A 2R2EA 4D0DA 3B83A 3UPRA 4NRYB 4Z76A 3VXOB 1PW3A 2ZUXA 1WEJL 4I0PD 2NTSP 3W0WE 5GS0D 7FABL 4I3GA 1SEQL 4MCZA 3UC0H 1X6LA 4KU1A 4PJCE 4EVNB 3O3UN 3MRNA 5B38G 3S5LA 3K2UH 3QEUA 1W72L 5KAQG 4TNVK 5J12C 1U3HD 3S37X 3E0GA 1Z9OA 5JQHC 3WHXB 3TCLB 4XPHH 1BJ1H 2GFBB 2FHFA 1P9MA 4WEMB 1EX0A 2V9RA 2XT1B 2YD8A 3ULUL 4NC1C 2VWEE 1MJ7L 4IM8A 1MFDH 5F88A 1R3IH 4MJ6A 3VFPA 2ZOLB 4QXWA 2HJLB 1HHIB 5J13B 4JKPH 4LK4A 3G04B 4M5YL 1WUNT 1YA5A 4LLVA 5CP3A 4HWZA 4PBWD 3X14B 4ZUVA 4GJTB 2XOTA 4G6FD 5DD6B 1TDQA 4NHCL 2X4RA 2FIKB 4I5BA 2YC1B 1UQSB 3THMH 1OTUC 1MI5B 4BZ2L 1NKRA 3QIWC 1MEXL 2HVJA 2QSCH 4LU5L 5BOZG 5GGUA 3GJEB 4OM1L 3AB0C 3P0YL 4ZFFB 1MQ8A 3F7VA 1GXEA 2W0FA 4RQQA 4TVPE 5HYFA 4MD4B 1J9CT 2BVPA 3WN5C 5FGBA 1YMHB 2I9TB 4M62L 1U93A 5BS0B 3CDYA 3LN5A 4U7KA 1JHLL 1PSKL 4X6CE 5EBWA 1XGQB 1CXEA 3AS0A 2J7LA 4RA3A 5F7DA 4Y2DC 5H35A 3FB7A 2R1WA 5SWZB 3MLRH 4OCNC 5D7JD 3MLUL 2X4QB 3C08L 4PRIB 1NGWA 4JHAH 4ODUA 4Y4HB 3A6CH 4ZYKA 5D7IA 2VR9A 1K6QL 4KQ3H 3NCYS 4GAYA 2HFEB 1U42A 5DJ2B 5DHVA 3T2OA 2L7JA 5B3JF 4M1GH 3A6BL 4XP4L 3TVMB 3TF7C 5IMKB 5FM4A 5B3JE 1VADB 2Q7NA 3MLWH 4N90E 4WY7H 4P4RB 3B9KB 2ADFL 2F53A 1IAII 3VFMB 1MCHA 4PRAB 3LRGA 2C4XA 2XKSA 1JN6A 5CCKL 5CLTA 3AY4C 2NY4C 4NFBA 4JDZA 5J9PA 1HSBB 2Y7QA 5DXWA 3BKYH 2GTWB 5HYIA 2ICES 4HUXB 4KRLB 1KPUB 2Q8AH 3IDMB 5T5FL 5EU5A 1OB1A 3DUUB 4UINH 3QDJE 4HIHB 3R4DA 1GGUA 4KTDH 3QXAA 1NFDA 4YDJA 1WBYA 2ICCA 4U0RC 3U4BH 3MLPA 2C4FU 2R1XB 4PREB 4DN3H 4H5SB 4KK9D 4LVOC 1QSFA 4JFYB 4PJ8C 4J6RH 4LLMB 2I27N 5DD1L 3CDGB 1IAIH 4LSQH 5FO8A 1I7ZB 3FKUS 2V7HB 3BZ4B 2GK2A 1LILA 2ENSA 4QRTB 3WE6B 3OR7A 1XR9B 4NQDE 2GYSA 2P46B 2FSEB 3KLAA 3QULB 8FABA 1EEUA 3LOWA 5JMOC 2IG2H 4U33A 3QIWA 4HHAA 3OKMA 2YUXA 2DQTH 3GRWH 5HPMB 1OTSD 3ZDZE 3RI5K 1WZKA 4HWBH 3T0VA 3WN5A 1FZKA 1KJ2B 1D5IH 3D25A 4URTB 2DICA 4PP1C 3MRKA 4LHUG 3IAGC 1FAIL 1IGIH 1ZXQA 1C5CL 4Z7UB 4EOWH 4KH2A 4Y2DA 1JK8A 2UY6A 3CSYA 4CAGA 1F4YL 3FQUB 3RZCB 1MAKA 3IFOB 2AW2A 2IAMC 1BQLL 3C8DA 3C2AL 5JOPD 1GL4B 5I16B 4UQ3A 5FB8A 1CIUA 3CH1B 1K5NA 1RIHL 1TITA 5AUMA 5CZXD 1N6UA 3UTTD 3PP4L 2YD9A 4X4YA 1YN7A 4KK8D 3C6LD 1UH4A 4C4KT 3QH3A 4RGMB 2RHEA 4Y4FC 5DD3H 4S1QH 4HUUB 2CDGA 4MAUH 5EO0A 4ZXBC 1CE6B 3HCVB 3DO3A 5KVFH 1FV1A 3PE9A 4E41A 3TT1H 4HDIA 2E9WA 4D9QD 4U1KB 5JUEL 2FEDC 3TBYA 1TLKA 2E7BA 5AAWA 4J12A 2J5LB 4Z77A 2DLFL 5DHVH 4EKXA 1A3RL 5CMAA 3SJVB 3BIKB 2EIDA 1BIIA 1KELH 4ZO9A 5LWYH 2ZSWB 3EYSH 3O3EA 3L6FA 5FYKD 4JZJB 5CWSB 1R5WA 1T0NB 3SGEI 5BRZE 4D2NA 4DKDC 3ARGB 1KSRA 4QYOA 4KKNA 4CVZA 1T1ZB 2ED9A 2RBLA 5EPMB 1KCVL 2MCPL 1FLRH 5C0GA 3HLAA 3KPQA 4X6FB 5MENE 4M7JH 4GSDH 3ZTNH 4PJ8A 4F57H 1CDHA 4K8RC 3VFTB 4LCWD 5D2NC 3L3JA 4TVPL 4F33B 1RK0A 1UWEL 4WHYG 3I6GA 3WFBL 1ND0A 3EZ8A 3PP3K 5BO1L 1OAUH 4JB9L 3IFLH 5BJTB 3IF1B 5DEFA 1U8IA 4R6UA 5ANMB 4OF6A 3FMGH 1UEYA 1NDGA 5DF0A 1YY9C 4X7TA 4CN6A 1JP5A 1CCZA 5JORB 3RY4A 3M1BB 4NQVA 1RHFA 5HHNB 1T2QH 1D5BB 3QUXB 4AIZA 3LRHA 3CFCL 3ILQD 4G43B 3BMWA 3ULVH 4KY1H 5L7XL 3VH8A 3U9PL 2AEPL 4C58B 1QR4A 3FJTA 4FQXC 5GS1C 4JG1L 3WDHA 1FP5A 2I9LB 3SE3C 3JUYA 4HLZH 1DSFL 1P5VA 5FYLH 4WFFE 1J1PL 1YMMD 3QUZD 3F7YB 2IPKB 3QDGA 1FFRA 4M43L 3C09B 4JG0H 2VUOA 2B8OT 3DX9A 3GM8A 4MXWH 4R2GB 1L4IA 4RAVA 4GKSA 1M05B 3U7WL 3OKEA 4D3CH 3DIFB 5KTEL 3KNBA 2IAMA 3DVNB 4B50A 2AEQL 4O58H 3FONA 3HUJB 5DO2D 2MPAH 5D1XC 4L3EB 2VNCA 5CD3B 4PJXB 2VL5A 4CW1A 3MXVL 4HG4K 1U8QB 1VGEH 4Y4FA 2HN7A 3LKPA 3ZYJA 1H3XA 1JTPA 1IEAB 3BDYL 1AJ7L 4WGWB 3ZHDA 2J3SA 1WCQA 3RKPA 3NCJL 4M6MH 1JZ4A 3B5GA 1J1XL 4KFZC 5D1QB 4X0KA 1ETZA 3ZKXC 3EOTL 5C09D 3GMNB 1S7VA 1U0QA 4FTVD 4P9ML 2A38A 2R2BA 3MBXH 3WL9B 2N7BA 3L3HB 3EO0B 4NM8L 1KTKE 3QQ9C 4GQ9H 5D70L 4KHXL 5JLZA 1BREA 5C07D 2V2WB 1D5MB 4R4FH 2VTFA 1BD2E 3QDMB 4PYGA 4TYUA 2NTFA 4MB5A 4JFXB 4O2EA 4GKNA 5SX4I 1GC1H 4PG2C 5TDNB 2BVUA 2A74B 4NZTL 4MJ5B 5IB4A 2APVA 4ONGH 4U6VL 2AXJA 4HS6A 4F9LC 3NACH 5LXGL 2IQ9H 4P2CG 5FO9B 5GXBB 1QNZH 1G6VK 3PJSB 4TSCH 2LTQC 4E5XB 1XF3B 4M4PA 5DMKA 5AZ2H 3DOSA 3V5DA 5MEPB 5EU6D 1AGBB 2AJVL 2F5BH 3ZKQD 3IT8D 3O2DL 3C8KB 2Y5TA 1S9YB 4JQIH 1UENA 3ZL4H 4ZQKB 4LQFH 5IB1A 1IM9A 1BBJA 3PWVB 4UDTA 4BQ8A 3MGTA 5HDLA 1CT8B 4TUOA 2IBGA 4S0TD 1JGDB 4O51A 2WUBL 4FQXA 5GS1A 5SX4H 2JCCB 1NAMB 1WAAF 4UILH 3H9ZA 4PJBA 3CDFA 1F4WH 1BFOA 4MHHI 1GOFA 1X5KA 1WAAE 2SEBA 3QEQE 4Z95H 2Z35B 2MFNA 1IC5L 3FO0L 4LLUB 4PS4H 2ZG3A 1PLGH 4J3XA 1S9XB 1URLA 1LDPH 3EGSB 3RWEA 4JM4H 5IQ9B 4K7PH 4BZ1H 5JXEA 5E2VL 3OKLB 3VGAB 5CJQH 4CVUA 3PGCA 5DJDA 1GHFL 1N26A 3FFCB 5C2UB 4IMKC 4QHKJ 3TBVA 5HDOA 5D1XA 4XPFL 5HYJB 5IMLB 1ZT4A 3E6FB 3DYMA 3U0TB 3CSBA 2ITCA 1G9MC 1I3GH 1FL6B 2F9BT 3MJ7A 5D7LB 2F54A 1IM3B 4GRWB 3G5XB 3K80A 4LVNC 1B6DA 5IG7B 4HQQH 4YXLL 5TF1L 5CZVL 1RUQL 4D8PA 2VH5H 1P7QD 3NH7L 3FO9B 5KS9E 1Q0XL 4CRPA 3MODH 2AEIT 3WEXA 3MV9B 1OW0C 3FT3B 1KC5L 1ORQB 3EYVA 2W0KA 4LPTA 5C92A 1CDYA 1E0OB 5HGBA 1IE5A 3IU3B 2VUYA 4NPYA 4H20L 5E8DH 3LKNB 2HVKB 4YAQA 1T22A 3VFVA 1PFCA 4N9GA 1AGEA 3B43A 3I9GH 5E56A 3R8QA 4YHKH 1P53A 4NUGH 5IGXH 1TJIL 5EWIH 1Z6JT 2Y07H 5EA0H 1Y18B 3TN0D 3EBAA 4HFUH 2ZSVA 2PW1A 2Z8SA 4QHKI 4X6DF 5FM5M 4F9LA 5B4MD 4AEIL 5BV7L 2DQDH 3SDDB 5MEOA 4YBQD 3I02A 4X6DE 4AK1A 2FL5A 5ILTL 1KXVC 3IJSB 3L5WA 4NBZB 2QHRL 4MHHG 4OCXL 4CBPA 3DHJA 4K7PY 1GVIA 3HI6L 5SX5H 3MA7B 3TBTA 1XIWC 1CGSH 2VDLL 1T6VN 3L3OA 4G8EA 1IT9H 3L3IA 3L7FB 4M7LL 5D9SA 4KAQL 4G8GA 4G9FD 1JNNH 1F6AB 4UT7L 5DJXB 2LU7A 3MRJB 3DV6A 3OKNA 2YN5A 1FYTA 3SHSA 3LAFA 1RZ8A 3RWJB 1EZVY 2DB8A 2WMPA 2Y23A 4P46B 3VFRA 3HRZB 3OGOE 1FL5A 3C60D 4MSWB 3ILPA 5GZOC 4OLUL 4CDGC 5K9QI 1J05B 4NQEA 2OX5A 1KJVB 2ESVD 3ZHLA 4PB0H 1B0RB 4RIRA 4O9HH 2EEAA 4R4NC 2DJ4A 3VXPA 3JWNC 3OMZA 1NJ9B 4KRNA 4OJFH 5GSVA 1MWAA 3SDXF 3MV8B 1HDMA 4J3VA 4P23B 1ZWIB 4DVBB 5T1LD 2H8PB 4YGAB 1JNLL 3GI8L 5DC9B 4Q74A 5KSAC 4HKXB 3WLWD 4YZFF 4A2MA 3UXFA 1CR9L 2VDNL 5HY9B 4G8FA 1GGIL 1B88A 1Z5LB 3FQXB 1QPXA 3U46B 3WNNA 3U7YL 1UG9A 4OD2B 2PTVA 4NJAL 3SKOA 1I8KA 3TT3L 4U3XA 2VIRA 3LEVH 4LPVA 3LD8C 5DJZA 3DURA 1RUAH 1DANU 5EO1B 3UTSB 4X99A 1BQUA 3KHQA 5I1CL 4GW1B 5D7SH 1MLBA 3HB3C 2J4WL 2VLKA 1OW0A 1QBMH 3PF2A 4OQTL 2WP3O 2BHUA 3HE6D 1CLYH 4U6XA 1E4XI 1MRDH 3ARBD 1OSPL 4NO0B 1VEPA 5FUZL 2GCYA 3HG1B 1MJJB 4M48H 3PIQA 1XCTA 2Z92B 1MFNA 3NZHL 3UTQB 4HKJB 4KKCC 3OR6A 4DW2H 4ODSH 2WANA 2YPLA 5E9DB 1R3KA 1TMCB 2EDRA 5CKAA 1GGCH 5JW4Q 1MREL 3H0TA 2D9CA 3MRBA 1ONQB 1UYWH 1W0VA 1PG7X 3DV4A 1EMTL 3IXAA 4EI5B 3IETA 2PNDA 4QEGA 1JNJA 3GMPB 5IJVB 3RZWA 2Q86A 1FNEB 4XC3H 1E4WH 3GBMH 2F19L 1NGQH 2X4PA 2IANE 1D7FA 2CLRB 1NMBH 3UYPA 4MNQD 1BPVA 1E4XH 1CVSC 1AGFA 1XIWA 3KPMA 3QUML 4IRJB 3GI9H 1ES0B 3OAUL 4LEXH 1Q1JL 5E8OB 2XWBB 4UT6H 2DKMA 1T1YA 3HTLX 4HPYL 2VDKH 1I4FA 2P24A 3QIUA 5DLMH 5FF6A 3BO8B 3Q6FB 5I1AA 1QSED 4UOW1 2B39A 4UV7H 4BFIA 1QFWI 1S7QA 2VXTH 4M8VA 5CEXB 1EO8L 5CJBA 1ADQL 4L29B 1CFVL 4YDKH 3HS0B 3SO3C 4JVPA 3DROB 2NY1B 1KLFA 1MJUH 2DIAA 3QXUA 3S37L 1CE1L 2E5EA 3LDBC 3QYCA 2CK0H 4KKAD 4E0RB 1DFBH 2FRGP 1TENA 1S5HA 2W60A 5KSAA 1MHHB 4G6JL 3GGWB 4I2XA 5JOPE 3VFSA 4F7EA 1PYWA 2FGWH 3H3BC 4KJYA 4XWGH 3UTTE 1C8PA 3U1SL 4CNIB 5CGMA 4DZBB 3SE9L 1KTLB 5I1KL 4NNXB 3H9SE 5C0EB 4G80B 4JGJA 1T03H 3CU7A 4P3CH 2IFGA 4BKLA 2NY3B 5GISL 3MLTB 4YNYA 4OCRH 1PY4A 2H6PB 2NY5H 3IDUA 4OZGF 5I74B 3NN8B 4JFDB 1EAPB 1OGAA 3F6LA 5JQ6H 1QHPA 4OZGE 3S36H 5I1DA 5HPOA 4KQ4L 5KVMC 4XZUA 5JW4N 5A2FA 4X5WB 1QLFB 2D03L 5JO5A 1M4KA 2OZ4A 1P4LA 4TSBH 3TYGH 2R69H 1MCIA 3D18B 3ULSA 3STZA 1AKJA 4JO2H 1FRGH 4NNPH 2X89D 4JE4B 3HI5L 1T21A 3RTQC 5C0DB 1TCMA 4Y89A 1EHLH 3V8CA 1RIUL 4WWKB 5IFAL 3OX8B 5DZOA 3QUYB 3JV5A 2X42A 5ID0B 5I73B 2CMRH 3WIFA 1LNUB 5BMFH 2OL3L 1HNGA 2PYEA 2YK1H 4LCWE 4Z78A 1A22B 3KPRA 5E8EB 4MLIA 4JFZL 4H88L 2ZPKH 3IDGA 4EXPX 5F6HJ 3D2UB 5HVGB 1F97A 1ACYH 1MCPL 1YEHH 3BP4B 3LQZA 4GRMA 1D5XB 1A7PL 4YXHH 4OTXH 2YD5A 5D93B 3T4AA 1NAKH 3HR6A 2EDYA 2JELL 3DGGA 4PJAB 2HTKD 3AXLA 3RGVD 5F3BA 3MACH 1P84K 4NHUB 2L4OA 3GMMB 4GAJL 4MQ7B 4XP1H 3STLA 1BOGA 2VR4A 4BQ9A 1JFQL 1MHCB 3MLVL 3GMLA 4XP9L 4V1DB 4QHMB 3ARYA 3D0LB 2QQNL 2YWZA 4ZAKA 5C0RH 4KVNH 2CD0A 3V52L 2BNRD 4QKXB 3VI3E 3GSRA 3OXRB 3JV4B 2A83B 1JTTA 3FQWB 1YNKH 5TGBB 1V7ML 4IOFD 5FYJD 2XICA 1QLRB 3CMOH 3VI4F 1B2WL 2EO9A 4AM0B 4WI8A 2YEZB 2DLHA 5CKGA 1U8MA 3GJFB 5EUOA 3P77A 3VI4E 5KW9H 5GJTL 1IFHH 2C7UA 5F6HI 3OAYH 1T2JA 4GMSH 1M7DA 4OGYL 3PWPA 3C5ZB 5JIIA 2CO6B 5CINL 1UH3A 4FQLH 1DUZA 1IQWL 2FR4A 2DQHH 1JUFB 3B9VA 2DL9A 2D7OA 1I9EA 3O4OB 4RGOL 3AMLA 4XP6L 2BNQB 1F11B 3OPZH 3GMRA 3PQYA 1JV5B 1IQDB 3QI9A 2X4NB 1CFSB 3KYOB 1PKQB 4P5KA 5C8JB 2UWEA 1CFTA 1CICC 3LKSB 1FZMB 5C09E 3BUYA 4PR5B 1I8MB 4LFHG 2FO4B 3GHBL 4FTVE 4XNZB 5GGSB 4BA8A 3BKML 2V9TA 2AABL 5E6ID 5C07E 3AREB 4N5ED 4EN3C 4N68A 5F7MC 4QRPE 4H8WC 4ZFZA 2QQKH 3FB6B 5D71H 2OXHA 4DN4L 3RTQA 1T7VA 4WFHD 5B38A 2Z93B 3CDCA 2KQMA 2PYFB 5DFVC 4IRSB 4RCAA 3KPNA 1EFXB 4R7NA 2YSSB 1HHHA 5GS2H 2VLME 1KB5H 4Y2OA 4Q0XH 5DHYA 1XF1A 2QQQA 1E6OL 4XCYB 3DXAB 4NO3A 4OUUB 1BZ9B 4PJ5E 4PJIE 1V05A 1FFNA 4JVUA 1XH3A 2WUCH 5IROC 1NBVL 2Z91A 1XT5A 4O5LH 1W72B 4B7LA 4FMFA 4M7KH 5EU6E 2NX5B 3QQ4B 3T8XB 1NFKA 2JJTA 4O4YL 4TTDD 2P4AB 2XFXA 4KGJA 5CHNA 1KV3A 3BQUC 3CFDA 3BHBA 1RUML 1KEGH 1H15A 1S78C 4Z9KB 5HI4D 3ES6A 4P2RD 2EIBA 1H0DB 5EUKA 3T1FA 5LJYH 4JHWH 4P9HC 4WI7A 2EDQA 5AZEH 2ATKA 4O2CA 1OHQA 5I30L 3T3MF 1KCKA 4WJ5B 5CILH 1KN4L 5JR1L 5J6GA 1H8SA 3SGDI 2D7TH 3T3ME 1I1AC 3P73A 4L9LB 4F58H 4LLDB 5FAAA 1E27A 3ALPA 4BSVB 1UJ3C 2AK4E 3F6IA 4GRLD 5C08B 1J0YA 4MAYB 4U1LA 5FKAB 4LLQB 1NGYA 1U8JB 4PJGA 2NQCA 1SYVB 5IR1A 5ACMA 5E03A 2X7LB 3BE1H 4ZUUB 1U3ZA 2P5EB 4KKBD 5ITBL 1G9NL 2OI9B 2EDEA 2FBOJ 1DBKL 4WTZG 5E1HB 1T7YA 2PR4H 2GJJA 1ZHKB 5HHQA 3NMEA 4LHQB 1X5YA 4GFTB 3OAZK 3R06A 5FGSA 2VE6B 3O3BA 4BQBA 4Z0BL 4X6EB 4DK6A 3GSNA 1I1FA 4ZSOA 5INCA 3B9AA 2P7TB 1PGRB 2DLGA 3CCHA 1TZHB 3TZVD 3CC5A 4N8VA 2Z8VC 3SGDH 3P9WB 2LFGA 1CICA 3DTXB 3PHOB 1WFTA 4J3UA 4HIXH 1JPTL 1U8PA 3MQIA 4FFZL 2DQJL 1AQKL 5ITFA 4U1GC 5ICYA 4EN3A 1ZVSA 1A9BB 3GDBA 4Y4KB 2O5YH 4Y8AA 1CDIA 3UEZA 1II4E 1OQOA 3MNVA 1VGKA 1TETL 3P30H 4IOIA 3VRJB 4YPGB 4NQUA 1N64L 3MOBL 2XZCL 4RSVA 4I48A 3LPFA 4WUKL 1CTNA 2X40A 4APQC 3TJHC 5IROA 1FG2B 2R1YB 4UIKH 2WIIA 1JZ7A 3BIAX 1G7HA 2X4TB 4JN2B 5CFHA 2EYSB 1I7UA 2Z8WC 4OF3A 1EBAA 2NYYC 2KH2B 5D6CB 3BQUA 4A6YL 3RX5A 5J13C 1YC8A 4RZCB 4XAWL 4KZDH 4S1RH 4CADA 3LS5H 1I3RB 4NNYB 3ROLA 2B4CH 5LAXA 3WLBB 3JUZA 12E8L 4OV5A 1CTOA 2UVEA 2YUZA 5EN2A 4EBQH 4HIJA 2ESVE 5KSBF 1ZE3C 3MRCB 1R5IA 3G6JB 2X4UA 2KUTA 4NWTH 4IMLB 5DT1L 2Q8BL 4D0BA 5KSBE 4LMQE 1XGYH 3TFKC 2X9YA 4IHOA 1MVUA 2FJFA 1I1AA 2Z31B 1QKZL 4K3EH 4HJGB 1KBGH 1DVFA 3LCYA 2DMBA 1IL1A 1PQZB 3MCLL 2X4SB 5IB5A 4QO1A 2FX9H 2P8MB 3KDMB 4I4WB 4R96B 4ZDHA 1I8IA 2A6IA 2J8UF 1GZQA 1FBIL 1K3ZA 1IGML 3HZKA 2C1OA 3DMMA 4OZHF 2J8UE 4K2UH 4K55A 5EZOH 3AAZA 3RWFB 1QBBA 4JY5H 1Q9OB 5SV4A 3LRSB 4Y4HC 2OS7A 3ARFA 3GSUA 2GJ6A 3OZ9L 2H9GA 3WFEH 3ZHKA 4M6NL 1HH6B 4JFQA 1INEL 5TQ2L 3ZKMD 3QZWA 4BQCA 5T1MA 3QNXA 3EO1A 1KPVB 4JQXC 3W0WB 7FABH 3GMOB 1MUJB 1A3LL 1SEQH 4PRDB 3PXHA 1NFIA 3NFSL 4PJCB 4UV4H 3IDJB 2BSSA 1FNSL 2HRLA 3MFGB 3PHQA 4GBXA 4JDVA 2MHAB 1ZLUH 2F53D 4IS6A 2NY6D 4NRYA 1NCCL 1JZ8A 3W82A 3ULUH 4JRYE 1T7ZA 4BFGA 1F3DJ 1YNTA 4LRNL 4TNWK 3VRIB 2FX8L 2D9QB 2Z4QB 1X5IA 1BLNB 1VEOA 3RWDB 1D6VL 1UKSA 4XBPB 5AWNH 1YEGH 4EVNA 1DN0B 3OGCA 1ZLSL 4UQ2B 2GSGA 4H0HB 2YRPA 4APQA 3HKFA 5ICZB 4NHCH 4ONHA 2MMXA 3TCLA 2GFBA 3ARDB 1RVFL 4MNQE 4MGXA 2ILLA 2JF1A 3UO1H 3K0WA 4R4BB 5JPNB 3LEXB 4Y19A 3LN9A 4LU5H 3NZ8B 5DJ6B 43CAB 2DQEL 3P0YH 1QSFD 3T09A 3NVQA 2HJLA 1MHPL 1N8ZA 4R90L 5DC4B 1D9KB 1I9IL 1F3JB 4PJHF 3ROOB 3BXNB 4IDJL 2FYYA 2ICWB 3ULVD 3FRUA 3X14A 5HHPB 4TQEL 5DD6A 5IJKA 4M62H 2VL4A 4HUWB 1QSEE 4KUZH 2YC1A 1JHLH 1PSKH 5T5NG 1CDBA 1RURH 4X6CB 5CBEB 3UJJL 3HMWL 4YQXL 2APXA 1OTUD 4K7FB 2WLYA 1MIML 3GJEA 4ZFFA 4J23A 3QIWD 2A9ML 5DA0B 3C08H 4MD4A 1J0IA 4ZPTB 1G0YR 2YN3A 5JIKA 1YMHA 1K6QH 5F8QC 2IMNA 1SBBA 2CUIA 1W0WB 2IADB 4K9EC 3A6BH 4DGIL 4P49A 4HC1A 4GKOA 3CGTA 1QOKA 3DSNA 5SWZA 2FIRT 2YD4A 4B53A 1S5IL 4Y2DD 3QPQC 3X12A 4D0CA 4NCC2 4NFCA 1JPGB 4NSKA 4Y4HA 5T3XD 1S7RA 3LVEA 3RIAF 5I1EL 4XCNB 4MJIA 2ZUUA 3UZQA 5ESAB 4NFDA 1X5FA 3O11A 1PZ5A 2UYLB 4B41A 1FORH 1K8IB 4F3FA 4RGMC 2R2HB 3S34L 4JQXA 5DJ8B 2BCKB 1AO7E 5IMKA 2PXYC 3N50A 4OT1H 2YXFA 5EIQA 3WS3B 2QR0A 1MCJA 4E41D 1VACA 4TSAL 1LO2H 1RHHA 2J5LC 2YA0A 3TM6A 3QDJB 1AR1C 5C0IB 3RNQB 1KIQB 1HQRB 1RZJC 2DQGH 2VKWA 5FHBL 3UDWC 3UBXB 4S2SA 4OZIA 3FAXA 1HSBA 3DPBA 4GW5B 4DCQB 1WTGT 1FG9C 3V0VA 3IDMA 4Y1AA 3U48A 3ZTJG 3QUKB 2CGRL 4JZJC 4G6AC 1QBLL 4PRNA 3TA3B 4HIHA 3TPKA 1BIHA 4XH2B 3RNKA 3ARGC 4NQDB 4DKEL 2EDKA 5BQ7B 1UB5A 2R1XA 4K23H 3T0AA 4H5SA 3H2WA 2GAZB 4KMQA 2NY0B 4JFYA 2AXGB 3PWUB 3BMVA 3CDGA 3L5HA 4PTTA 4PJ8D 2DBLH 4Q9RH 2VABB 3CU1A 3QCVH 1PG7W 2E9IA 2V7HA 1MFBL 3WMSA 3BZ4A 4QRTA 1CGXA 1J11A 4YHPA 1FC2D 3NFPA 4HS8L 4YC2C 3GSWA 2IPUG 4X5XB 3MJ9L 1FAIH 1FE8H 5I1LB 1QP1A 3O6LL 3I3DA 4GXUM 3LPWA 4G6KH 1FFPA 3GBNL 3C2AH 3CLEH 2BNRE 5FA4B 1ZKAA 1KJ2A 2Y36H 3BESR 1PG7L 4R0LB 4LSRL 4G5ZL 4KPHL 2A9NL 5C0ND 3EUUA 3RDTB 2BP3A 4PP1D 4F7PB 3QDGD 4NQCA 3OF6A 3MLXH 4Z7UA 3BZEB 4R2GC 1MNUL 5INDB 4Y0GA 3FQUA 3IFOA 2PCPB 2ICWI 1MSPA 5I16A 3PL6A 2IAMD 2Y25A 3VXTA 1E28A 1FN4B 1A3RH 4UTBH 4EDWL 4HC1H 1A7BA 4YUEH 4TUJA 4ODBD 5J1AB 4X7DC 4JFHD 2PXYA 4Y4FD 4WO4A 3CFJA 4KJWC 4L4TA 4U1KA 5TDOB 3RX8A 3T04D 1U8NB 3O4LA 3VRLF 4FQ2H 1XR8A 3GSXA 3G9AB 2NY2B 3MRMB 5BRZB 3VRLE 4J2XA 1WWBX 3CMGA 2CK2A 4NO2A 5F9OH 4WUUA 1A7RH 2YUVA 1EZVX 4M4RA 5MENB 4Z7WA 2QQLH 4WFHE 1UB6B 3JSSA 5CJ8A 1T1XB 2MOVA 5C0BA 1YY8B 3WFBH 4PJ9C 5C6TL 4JZJA 5CWSA 3IXTA 1ZTXL 5E6ZA 5MP6L 1OTTC 1T0NA 2OJZL 1WC7A 4S0SD 3ARGA 4TOYH 3ZE1F 1T1ZA 1Y6KR 3MOAH 1U8KA 2EDTA 5EPMA 5I71B 3AM8C 3CFCH 2OR8A 4PRPA 3F5WA 4NKDB 1U8OA 5L7XH 1A3QA 3RL1B 4OLEA 2ZUQB 4JKWA 5A2LH 2AEPH 5T1KA 3ZKNC 1KT2B 1AFVL 1MHEA 1RI8A 1C08B 5ANMA 5ABDE 4XNYL 1AY1H 4JDTH 4Y16A 1BQSA 1KGCD 5E94B 1J1PH 5IBLC 1YY9D 5HHNA 4M43H 4OLYL 1AH1A 4HJ0C 4XPBL 4ELME 3HPLB 3B9EA 4G43A 2W07A 1IM9D 5F21B 1NGPL 4IJ3B 3U7WH 2HYMA 5KTEH 2HMIC 4N0CC 5TE6L 4NQXA 2VZOA 2VQTA 5IHZA 1N0LA 1CBVL 2OQJB 2I9LA 4GQPH 2VERN 4QGYA 4FQXD 4N1EA 5D2LE 2CKBL 3EYFB 2N4IA 1CG9B 5K59F 4NN5B 1J0KA 3DIFA 5DZLA 1BQHG 2Q87A 2EC9T 3DVNA 3VGAC 3VE0B 3HUJA 2CRIA 1J1XH 4KKLD 3V5HA 2YD1A 3U0WL 3QG7H 5JXED 1KENL 4L3EA 1UM6L 4Q6YA 5CD3A 1TFHA 5EG6C 2EC9U 1UCTA 3H8NA 3PNWA 5KVEL 4RMSA 1JWSB 4JRWA 2N7AA 3K2MC 4MNGA 1UZ8B 4PRBA 4KHXH 1CXFA 1IEAA 3FT2B 3I6LD 5I1JL 4K3JL 4NT6A 1BD2B 43C9B 4I3SH 3AS2A 4MNHB 4NZTH 2UZXB 5ESQB 5CJOL 5F96L 5FUCE 3K7UA 3JVGA 5GZNC 2FBJL 3BDXA 3IYLW 4H1LH 4ODVL 4ETQB 3UBXG 2V2WA 4PJ9A 1D5MA 5GSRA 1NCTA 4ZFGH 3CVIL 1PZUB 2HWZH 4W6WB 4D9RD 3TP4A 1EXUB 4MWFB 4G7VL 3BYYA 2E9JA 4GAGL 1TCRA 5TDNA 1C5BL 2NNAB 2QADB 1JWUB 1P1ZA 5H94B 4RNRA 1V5JA 3SDYH 4QY8A 3SDDC 4X4ZA 3L3KA 1RZ7H 4KRPB 2WUBH 4E5XA 1FPTL 4YBLC 2GEEA 3WJJA 5MEPA 1G6RH 1MCOL 5L2JA 1AGBA 3MO1B 5FYJL 1A21A 3RI5F 4RFEA 4ORZC 1K4DB 4ZQKA 3JXAA 4PJ7E 1FFQA 3QEQB 5IKCA 1IC5H 1J5OL 1KIPA 3FO0H 3QUMB 4LPUA 3EYUH 4RISH 4OCSH 2DD8H 4G8GD 3O9WB 4FQQA 4P5TD 1YYLL 2AXFA 4P46C 3V6ZA 1OPGH 2M2DA 2R56H 1FYTD 3RL2B 4KJQD 2AV1B 1GHFH 2CDFA 3NTCL 1NAMA 1YZZA 1WBZB 4FNLH 3FQRA 1XZ0A 4NQED 5DVOA 2AJ3B 1ZANH 2Z35A 1HYSD 3CVHL 1I1YB 4FQCH 5LCVL 1JE6A 4P23C 2BZDA 1XGUB 4YXLH 1ZLWH 4BH8B 2AK1L 5KN5B 1ACZA 1IGTA 2X1PA 1OF2A 1WFNA 2XWTA 1Q0XH 3OKLA 5K9OB 5KS9B 2VDRH 1IAOB 3FFCA 5IQ7H 3LHPL 4HH8A 1JGEB 4BH7B 1KC5H 5HYJA 5IMLA 2IEPA 3E6FA 2VJXA 2AJXL 3KPLB 1UM4H 1DBJL 1WVZA 4JANB 4ONFH 3U0TA 3UC0L 4K94C 5D7IF 3X13B 3K2UL 1FL6A 3E1F1 1LEGA 5D7LA 1AXSB 3G5XA 4Y5YC 3LKRB 2PUQT 4XPHL 5CP7A 4F7TA 2CH8A 3QAZB 5C6PB 2ATPA 4I0PB 1S7WB 5JHLH 4ESKA 2E7LA 1T3FB 3FL7A 3JWOC 5J1SC 1TJIH 5HYQB 2D7MA 3BJ91 2AQ2A 1ORQA 3N1QC 4RRPA 2VLKD 4P2QD 4DFIA 1U3HB 1S8DB 3KYAA 5BV7H 3K1DA 1U41A 3IU3A 1OLLA 5IB3A 5L88L 3IKKA 5DMGC 2QL1A 4X6DB 4XCFL 1EBPA 1MCEA 2QHRH 3SE8L 5TH2B 4XHQA 4OCXH 3QWOA 3HI6H 2QSCL 1XCQA 2GHWB 1Y18A 2VDLH 1AHWC 3IRPX 3S36X 1NFDF 4G6FB 3V0AC 2YPLD 5HI5D 4EI5C 1DLFH 4YR6B 3TBSB 3SDDA 4WW2A 4RGNE 4P4KD 1ZT1B 4KDTC 3TIEB 1FSKB 3JWDC 1LMKA 2AAVA 4JFFE 3IJSA 1T1WB 1Z2KA 4NC1E 5DTFA 4OLUH 5I8CB 1QSFE 4J3WA 3ULVF 1ZT7A 5L2KD 2F15A 4XNQA 2OL3B 1IEBB 3MA7A 5C0JB 2EZ0C 2NXZB 3ULVE 3WO3B 4P2OA 4FABH 1NCBH 4PGEB 1XIWD 4JHAL 5HVHB 4P99A 3KPSD 3T0BA 4KQ3L 3RWJA 1PBYA 5JZ7C 4P46A 3GI8H 4KHTH 5DQJA 4KDWA 3HRZA 4YWGL 5FYLE 4MDJA 4MSWA 4GT7A 1J05A 1KJVA 1T5WA 1CR9H 5GZOD 2E8ZA 3QIUD 3MLWL 1QBAA 3N1PC 2WP3T 1WLHA 1G7LB 1TNNA 5IBUB 3U7YH 2NY1C 3MV8A 4B5EA 4PJFA 3CXHJ 4P23A 4AH2B 4HMEA 4JLRB 4MMZC 3EHBC 1K9TA 3V5KA 1SY6A 5E2JA 1G7IB 2CIKB 3GFUA 5I1CH 3MREA 1NUNB 3PDGA 2J4WH 1A4KB 2Q8AL 3WIHL 1L6ZA 5T3XE 6CGTA 1Z5LA 4XXDA 3U46A 4UINL 3BN3B 5JXAL 4HK3N 1DQQA 1B4RA 4KTDL 4Y5YA 5I75B 3DRQA 2W92A 4QF1B 3NZHH 3U4BL 4JPIA 5EU7C 3RP1A 4RBPK 4DN3L 4WU5B 2VDMH 2NY3C 1J12A 4J6RL 1QHOA 2OK0L 4NM4L 2LVCA 5F97E 2WQRA 5I74C 1OOAA 4FOMA 1WZMA 3G5YA 3OBAA 5IK3B 3A67L 4NO0A 1OGAD 2P1YA 3HG1A 5BW7C 4J4PC 4QRSB 1M7IB 4JPVH 4U1MB 3U7AA 1HSAA 4PBVC 2AS5M 1XF2B 2IANB 2IG2L 1MH5B 5GS2D 4NN7B 1AKJD 2MQCA 4GG8B 5FEBA 2DQTL 4ZOCA 5E9DA 1AHWA 4P48A 2BJMH 4X4ME 1YEDB 3U79A 4WWKC 3T4YB 2BY3A 1IC7L 1ONQA 2I07B 3QUYC 3VFNB 4EI5A 5B39B 5I73C 4KJPC 4KDTA 2EYTB 3MCKB 2RIKA 5HGDB 1DZBA 3WS6C 2J8HA 2CLRA 4JKMA 4DZ8B 5L8KB 2PYED 3C87A 1DDHB 1DCLA 3KPRD 4X8JA 1EO8H 1Z0MA 4XP5H 1CFVH 4U1NB 4UIMB 3VXRA 1U58B 4LCUB 3MBED 4BZYA 3SY0B 3NIFE 2XWBA 1RJZA 4OLXH 5D93C 2M1KA 1CE1H 1KB9J 1PVHA 4S11A 4ETYA 1AI1L 5HSFA 3CPLB 2FX7L 1WV7T 5D5ME 5DD3L 4S1QL 4G6JH 5I6XC 4MAUL 3IFNH 4Z5RA 3BO8A 1S7UB 5LGKA 4OF0A 5SWSA 4JREB 2XY1A 2XWJB 4JAMA 3TT1L 3B2VH 4L29A 1SEBB 1F6FB 5HD8C 3HS0A 2H2SD 3CX5J 3FB5A 3U1SH 2VLRE 3UTTB 4CDHA 1FVDA 3KR3H 3BP6B 3SE9H 2YPKB 5GS0H 3H9SB 4KUCD 4ZAKD 5EU4B 3TGXA 4NIKB 1MHHA 3CAFA 1KELL 5LWYL 4ZMAT 3GGWA 4WTZA 3EYSL 2IALB 1GRWA 4OZGB 2BX5A 3KHOA 2E6JA 4QXTB 2ORBH 3RVUC 4DZBA 1KTLA 4NNXA 5I15H 5C0EA 2IPTH 3QJHB 3C5ZC 4JFHE 1NEZB 4GSDL 3PWPD 2DLIA 3MLTA 3O4OC 3HI5H 1AIFB 3RY5A 2H6PA 1DEDA 2OMNA 3NN8A 3IJYB 3RAJL 4NP4L 1EAPA 3MRPB 5DRWB 2AV7A 5IFAH 1OAUL 3IFLL 1ED3B 3PQYD 5DR5L 3QI9D 3O2WH 2ZG2A 5BW7A 5EOCH 3EOBB 3K4ZA 4XNZC 3PWLA 4HZLB 4XCCL 3UROR 1ZHBA 3D18A 3MGOA 1HEZA 4BSWB 1QA9B 1MCNA 1HN1A 2B7DT 4LCWB 3ULVL 3L95B 1UXWB 4KY1L 1JWMB 3WNPA 2J88H 3NPZB 5C0DA 1MCPH 4FZ8L 3OX8A 3QUYA 1TJGH 5ID0A 4JEGB 4EIZC 2XRAL 3RU8H 2DTSA 5FYLL 3PV7A 3VD5A 2JB6B 1LNUA 3WS6A 4RFOL 4M6OL 5E8EA 5KG9A 4AY0A 2DI8A 4GAJH 4MXWL 5DK0A 1WFOA 1XFPA 5HGAA 4O02H 4D3CL 1NLBL 3D2UA 4YHIA 1JFQH 5KVDH 2X4OA 4ENEC 1KGCE 1GGBL 1D5XA 1I75A 2XIDA 4KROC 4GOSA 4JY4A 1JRHL 3QG6A 3FAWA 3QEHA 5LG1A 4NJ9H 4Z8FH 4PJAA 3SOBH 3DNKA 3QFDA 4Z0XB 4NHUA 4A6YB 5T3XL 3K1KC 4GG6A 4FFYL 5GIRA 1B2WH 4MQ7A 4XAKD 4M03A 1MHCA 1JZ3A 2X9WA 4PJBF 5CGYC 3VJ6B 4V1DA 2K7PA 3D0LA 3P4NB 4M6ML 3L1OL 1RULH 3CFIC 2O5XH 4L9LC 2MQ3A 5CINH 3OXRA 4AT6A 1IQWH 5IBUG 1I8LC 2A83A 3REVB 3FQWA 1U8LB 1U95A 4MAYC 5J7CC 1CXHA 4X7SH 2YEZA 4R4FL 1A6UH 3GJFA 2D4FA 3MV7A 4X98A 5DD0H 3GHBH 3OHXA 4XGZB 5C09B 1GC1L 1QD0A 4BM7A 3NGBB 5JOFA 3HFMH 4FTVB 3C5ZA 3WNKA 3U4EB 4N0FA 1RPQA 2DJUA 5C6WH 5C07B 1MQKH 2BNQA 1F11A 4QRPB 3I6LE 4PRHA 4TSCL 1JV5A 1I9JL 1IQDA 2X4NA 2W59A 1CFSA 1WTLA 4RAUB 5C8JA 4M61B 2F5BL 2VYRE 3LKSA 1FZMA 4I0CC 1I8MA 4JQIL 3WUWA 2FO4A 5GGSA 3ZL4L 1FJ1B 1E6OH 1CICD 2DMKA 1LP9A 5IVZA 2Q6WA 4PJ5B 4PJIB 2DQUH 4Y4KC 4DGYH 4RX4A 1NBVH 4EN3D 1HI6A 2Z93A 4D9RE 5EU6B 4O4YH 2DAVA 4N0YH 4C83B 5ALCH 5DMIH 5DFVD 2YSSA 5IMOA 4OI9A 1F4WL 3OJDB 4QHNA 4Z95L 1BGXL 4U49A 5E08L 1BZ9A 4PS4L 1PLGL 3WO4B 1KLGA 1W72A 3Q3GB 4JM4L 5B39G 4K7PL 4Z7VE 2NX5A 5CJQL 1UJTA 3LS4H 1S7SB 3QQ4A 4OZFH 3T8XA 5I30H 2IF7A 4QHUA 3BN9C 4KVCL 3P9MB 2OLDA 2I60H 1CDUA 2BRRL 3SQOL 1S7TB 3VFUA 4G8GE 4WW1B 2VO5A 2A0LC 4DJMA 2AK4B 1IAMA 1S78D 3I6KA 3L9RB 5JW5A 1H0DA 1FYTE 4HQQL 4K71B 1L0XA 3PABB 2HKFH 3BKCL 1EO5A 1T04A 3TNNA 2VH5L 4KMLB 2D3VA 1QVOB 4L3CB 3ZYZA 5ITBH 1G9NH 3SKMA 4WJ5A 2FATL 1MOEA 2Z31C 4L9LA 5FYKH 5DUBB 1I8LA 1I1AD 2XI9A 5F9DC 4Z0BH 5E8DL 3BVNB 1QYGH 1CFNB 1P7QB 1DVFD 1KF9B 1FZOB 1U8JA 5HDBE 3VDAA 1SYVA 3S3JA 5F70A 5B21A 4NUGL 2P5EA 2RB8A 5EA0L 2GY5A 4HFUL 2C5DC 2VXSH 3DMMD 3RJDA 2H32H 4OF5A 3JTSA 5K33A 3L3GB 2VE6A 4X6EA 3WFHB 3P2TA 4DK3A 3ARFD 3GJFK 2GJ6D 2P7TA 5EU3B 2GSIB 5AYQA 4P5MB 1A02N 2JB5L 1NEZG 1ODAA 3TN0B 2VLKE 4P2QE 3DTXA 4YGVB 3PHOA 3TH3T 2XZCH 1FL3B 1IT9L 4YHNB 4WUKH 2DRUA 4PGJA 4MS8D 4AQ1B 4BUGA 2NXYC 4WCYL 2Y06H 1ZLVH 1INDH 1MFEH 4GBXD 4ZUWB 1JZ5A 3KG5A 5DJAA 4POZC 4JCLA 2FLRT 5E8NA 5J57B 2VWEC 2DKUA 4YFDB 4O9HL 1KACB 4HZAA 1LK3L 2GTZB 3PWJB 1HNFA 1JPFB 4OJFL 2IQAB 3KS0J 3FZUD 2PO6B 2NZIA 3QO1A 1EH9A 3ZYIA 1QO3B 2GUOA 3NCMA 4APQD 1JGVH 2DN7A 5L2KE 4N0UE 4FXGB 3ECBA 2ESVB 2ZNXA 3JBG7 4LPCA 1EIBA 3ETBF 5I9QB 5FOBB 5KSBB 2CIIB 1PX3A 1AD9A 2HT2D 3KPSE 3FRPG 4Y19D 5D6CA 3BYTA 1D9KC 4RZCA 1QRKA 4N1CA 5F1NB 5E2WH 4NQSB 3MCLH 3QNZB 2JJUA 3LEVL 3L5IA 1A5FL 1RUAL 5DRZA 3AVEA 1S3KH 4M00A 4OM0H 4ERSH 3BKJH 4HIEA 1JBJA 1U3JA 1QBML 5IW6B 5LKNA 3B6SA 4MZ2A 2YA1A 3NBNA 1EGJH 2J8UB 4L8BA 2Z31A 4PLJD 3DRTB 4HJGA 1HIML 3N9GH 1DEEB 4M48L 3SN6N 4PFEA 1PQZA 3OZ9H 2BHZA 2BVOB 2X4SA 5IVXE 5GGQL 4HAGA 2P8MA 3S96B 4I4WA 4M6NH 3DUHA 5M7QA 3RBSA 4R96A 3T2QA 1INEH 4ORGA 4QCIB 3ABZA 4I2XE 3HE6B 4DW2L 5HYEA 2CSPA 3BZFB 1GGCL 2OTWB 3NFSH 3AFLA 2CJUH 3CZFA 5SWZD 2KDGA 1UYWL 3KXFD 4GKZB 5E8PA 3QHZL 4HKBB 4Y4HD 4QRQB 3C6SB 4LRNH 4MJID 3WSQH 5GRVL 3LQAC 4JRYB 3QR2A 1J7VR 1NMBL 3HAEB 2CXGA 2EH8H 5I0DA 1FC1A 5E2UH 4Y7MA 5FO7A 5IWLC 4XNUL 3GI9L 5L8LB 3IFPB 3O81A 4PJCA 3VA6A 3IDJA 3BEVB 4PGBB 1DQDH 4OCLC 4OIBA 4YPJA 4Y5VB 3KS0H 2UV3A 4UT6L 1KYOJ 4L8DA 4QNPE 2VDKL 1TXKA 4MDIA 3JV6B 4XWOC 5H37H 5IEHB 4MNQB 4LARL 5DLML 3VRIA 3VD7A 2A73A 1BLNA 5EORL 2HG5B 2DQEH 2WWMC 4LCYA 4UMGA 4XBPA 4FZEL 5CEYA 1WT5C 4Q2ZA 4R90H 5JHDA 5ADPH 3MUHL 1DN0A 1I9IH 4Y1AD 4YDKL 5C1MB 2VITA 3SBWC 5CIPH 3TA3C 1MCQA 1MJUL 5EC2A 4TQEH 3T65A 5ICZA 2CLZB 2CK0L 5H2BB 3IGAB 1DFBL 1P7KB 2W91A 1QSEB 3K74B 4Z7OF 5TE7H 1HOCB 4R4BA 5JPNA 3LEXA 1SBSL 3I85A 3HMWH 4R26H 2XTJC 3NZ8A 5DJ6A 1MIMH 1MWAL 2WW8A 4K3DH 43CAA 5C71A 3DO7B 4JPKL 1D9KA 5F7UA 1F3JA 2HTLC 2ICWA 3OJVC 2EE3A 1A6TB 1C1EH 1T03L 5I66B 3MUZ1 3UJTH 4HUWA 4G7YL 2X1WL 1R24B 2CR3A 2EYRB 1T80A 2HJKB 5GHWH 4DGIH 4X6CA 5CBEA 2XNAA 2NY5L 2VLLB 1G9ML 2IPUK 3KYNA 4M8QB 3CFEA 2CUHA 4KUCF 1S5IH 1BWMA 4ODXB 1QFUH 1FHGA 2WAHA 3S36L 2P47B 1FFOA 4W70A 1UXSA 1HWGB 5E4EB 4P3WA 2NW2A 1ZGLA 1M7XA 1BQHA 3TYGL 2R69L 3RDTC 5IBTH 2H26B 3MLSH 3V4PH 4JO2L 5C0CA 3VD9A 1FRGL 4NNPL 4ZUSB 4LMQI 5EUOF 1X5XA 3N1MC 5A16A 4CVWA 1AO7B 1WF5A 4NQCD 3OF6D 1CLOH 4HFWB 4TSAH 2RGSA 3O3DA 2OJEA 3V4UL 1JPGA 4FG6C 2COQA 1RIVH 5FHBH 4ZFOL 3PL6D 2APBA 1T0MA 4Q58C 1T7WA 1IRAY 3PGFH 5BMFL 2DWEB 4PG9A 4Q6IB 4XVJL 2UYLA 3MNZB 2GJZB 1ZSDA 4Y5XC 4HMCA 1FVEA 2BCKA 3TO2B 3PQYE 1ACYL 1YEHL 2PXYD 4WO4D 1OL0A 1QBLH 1H3WM 4HV8B 4YXHL 2UWEE 4IOSD 4L4TD 3QDJA 3LMJL 3O4LD 1C12A 3RNQA 3MROB 1HQRA 5C7XL 3UBXA 2NW3B 4NZJA 1FQ9C 1AR1D 3MRRB 4DCQA 3M17B 4WUUD 1R3JB 5KAQF 2D0GA 4XP1L 1WT5A 4LSUH 3QUKA 4NDMB 1MFBH 4YDVB 1FZJB 5C0BD 1TQCC 3TA3A 4JFOA 4U7MA 4KVNL 3MOQA 4G6AD 4EDXB 1DLHB 2AJUL 4NQDA 3RGVB 4QRUA 4NYLB 3ARGD 5BQ7A 4PP2B 3O6LH 2GAZA 4IDLA 3M45A 1JNHB 4UU9B 3PWUA 4PRPD 3FOLA 2XKNB 2VABA 5KW9L 5AEAA 1CD1B 4NKMA 5T1KD 5E5UB 4BJLA 4YDLB 1I85C 1PG7H 2BNRB 3N1FC 4GMSL 4G5ZH 4LSRH 2Y6SC 3ARXA 2A9NH 2C3HA 3X3GL 3GIZL 3O8XC 2VXQL 4Y16D 5DJ0B 4FQLL 2DLTA 4XAKE 4U4BA 1OD7A 3QRGH 1IGFH 1M1SA 3OPZL 5DQ9A 3AUVA 4JM2A 4ZO6A 4WU7A 1ZEAL 2P5WD 4K3GA 1OP5H 5FA4A 4UNTA 3FCTA 4MA8H 5K9JH 1MVFA 3JZ7A 3RDTA 4DUXA 3ELAT 2ED7A 4OLVH 4EDWH 3ZZ1A 2Z9TA 3BAEL 2VQ1A 2BVQB 4PJGF 5F3HB 4NN5C 4KDVA 4LF3A 2QQKL 1J8HA 1SMOA 4PLNC 3CVHB 3U9UB 4PJGE 2VDQH 1GYAA 3HHRB 2OZ4L 3KLSA 4MJ4A 3ZDXE 1FN4A 1EEYB 1DUYA 1KB5L 2YRLA 2A6KB 2MNUA 5E6IB 1PEZA 4U6HB 2IFFL 4X7EC 2L0DA 4Y5XA 2R39A 1V3KA 1SM3L 2WUCL 2DYPB 4ZS6C 4TNWF 3MRHB 3N85L 1D5ZB 5JDSA 1XF4B 4JFEA 5C6TH 1ZTXH 2X10A 3QO0B 4KJWD 5ADOH 3HAEG 3MRMA 5BRZA 3DWTA 3R0NA 5IP4A 1GGYA 3LH2H 4JRXD 1N5YH 3SDCB 1KEGL 3QXDB 5GGTA 5MENA 1ZHNB 1P4BL 3QT2A 4Z7QF 1YECH 1A7NL 1T1XA 5AZEL 3T2PA 4Z7QE 4I13B 1AFVH 2QSQA 1TPXB 2VLJE 4S1DC 5CD5D 3VFOB 2HFFB 5IB2B 4TRPL 1ZOXA 4PJ9D 5KSVB 3K46A 1U2HA 1OTTD 1ZA3B 2FWOA 3EDJA 4F58L 2QADC 4AMKH 1JPSH 1NMCB 1G7MB 2KBGA 1XMWA 4ELMB 4NKDA 5AYUH 1LEKB 1HXMA 4P3DA 4XI5D 4KRPC 3W9EB 4PJEE 2I25N 1ZVYA 1NGXB 3F58L 1C08A 1LE9B 3BE1L 4YFLF 3I75B 3ZKND 5ESVB 3O8XA 4G3YH 2PR4L 2BRQA 2CKBH 5D2LB 3W39A 1JYXA 3QB7C 4GRLB 2V5RA 3BDBA 4JZNA 5IBLD 1RZIA 4YK4B 3V7AE 3WCYA 2R23B 4HJ0D 3KVQA 3O9WC 3DECA 4LDEB 5C0FA 2HMID 4N0CD 4WDIB 4OV6F 2OQJA 3HA0A 3MA9H 3QFJA 1MPAH 5EZIH 1SJEB 3BPCA 2EEDA 4R7DB 1D6EA 3IDYB 3KYMB 3RKDC 3TYFB 2O5YL 4G8IB 5ECJE 1JZ2A 3X11B 1X5ZA 2DWDB 1CK0L 3LKOA 4YX2L 3TZVB 3FTGA 2R4RH 1I7TB 1P4IH 3O45A 3WXVH 3P30L 3Q5YA 4O00A 4JO3H 3D3VD 3RGHA 1AGDB 1MELA 5J06A 3FFCD 3T2NL 4HS3B 5F96H 4U6YB 4NUJB 4LGPB 2EDBA 4IRZH 4MX7B 5EC1B 2R2EB 2GJ6E 4D0DB 3EYOA 3UPRB 3UYRL 4M7LT 2HP4A 3QAZC 5D7LD 3RQ3A 4Z76B 1A1NB 3TV3H 1DTUA 3FT2A 3F12A 5DURD 43C9A 3OG6B 3L5XL 5I8KL 5HGHA 3I3EA 1WK0A 3O6MH 4MCZB 1U3HC 5A2KH 5BXFA 3MRNB 2Q76B 1NPUA 2V5SA 3LS5L 3IVKB 2QLVB 2B4CL 4OQTA 3CNKA 4U1JA 4X9HA 1RJYA 3GNML 4EBQL 1CGUA 3B9DA 1X5JA 1ZLWK 4CJ1A 4MVBC 4NWTL 1HXYA 4WHTA 2AGJH 1MAMH 5F88B 1XGYL 5HHME 5FYJH 1EXUA 4MWFA 2WBKA 2AJSL 1AE6H 3A0OA 1X4ZA 1QUNA 3MZTA 4PJ7B 1KBGL 1CN4A 4HWZB 2EKJA 2EIZB 4KI5D 15C8H 1FSKC 5F1IB 1YYLH 1L9NA 3CSGA 3SDDD 4I5BB 5IF0A 1NBZB 4Y19E 3RA7L 3W9DB 2YRZA 5GRYA 1WICA 5F1KC 2NXZC 4K2UL 2H3NA 1OGTA 5EZOL 5L0QB 4YO0B 3MNWA 2W0FB 4IIQB 4RQQB 2ZCKL 5HVHC 1RUPH 3QUMA 4P2OD 5LCVH 2XKUA 4MA1C 2E7HA 2HRPH 3GEWB 2AK1H 3O9WA 1U93B 3WFEL 4LCCC 3QQNA 1S7XA 3RL2A 1CXKA 2AV1A 3UTPD 1HZHL 5HHOE 1JZ6A 3UTZB 5EB9A 3LHPH 4OZ4A 4ZODA 1WBZA 2CLVA 5ISZA 5H35B 2AJXH 3FB7B 1IBGH 2AI0H 5E7BA 1DBJH 2J6EA 3MSPA 2Y5EA 2VN4A 4UV4L 1YUHA 1NGWB 3GSNL 5DVKA 1XGUA 4ZYKB 4X4XB 1T6WA 5KN5A 4GAYB 2X1QA 4P23D 5DHVB 1ZA6B 5K9OA 5KS9A 1A14L 4MXVF 3QIBD 3KPOB 5AWNL 5HI3D 3QP3A 3KXFE 1NMAH 2Q7YB 1YEGL 4JANA 2AP2A 2R9HD 3X13A 2VC2H 5IFHL 2NY6B 5CJXC 5L88H 3O0RH 1AXSA 3LKRA 5I75C 3GSOA 4MJIE 3Q1SH 4XCFH 1JN6B 1FCGA 4RMWA 3SE8H 2G2RA 3MRQB 4CGTA 4JDZB 4JZOB 5J9PB 3UO1L 1T3FA 4HXBL 1A8JH 4B7IA 2KZ1B 5EU5B 4LFHD 3RPIA 3U0PB 4OGZA 4JFPA 4OZIF 3NIDF 3QXAB 1NFDB 4YDJB 2WNGA 4NO0D 4RGNB 3T0WA 1WBYB 3HG1D 4DOHE 4WFED 4KUZL 4OZIE 4HCRH 3NIDE 4JFFB 4JO1H 5TH2A 2Y4SA 5I8EA 1RURL 1QSFB 4P59L 4N8CH 1BFTA 1OLZA 4NN7C 4Y1AE 1A1MB 4JCMA 1OAZL 4J8RB 4DEPB 5FO8B 4QWWC 3B5HA 4FA8A 4P9HL 3OR7B 4YR6A 4KK5D 1ZT1A 4EI5D 3BP7B 3BEWB 3HC3H 1NC4D 3GUTB 4YWGH 5I8CA 3B5TA 1GOHA 1UT9A 3QIWB 3VWKA 1IEBA 3DGCR 4YFEA 3OKMB 3BRGC 1FO0A 2X6MA 4PGEA 2EZ0D 3VDCA 3DLQR 3VXRD 3D25B 2QJDA 1ZHLB 4EI6A 3MRKB 2EKSB 4LCCA 1CQKA 3FFDB 1FORL 5DYOB 2HFTA 5JZ7D 3WIHH 1MIEH 4JREC 4H25A 4Y2DB 1JK8B 3UYOD 4OT1L 1EVUA 5ICXA 3G9VA 5SWSD 1N6VA 1YEIL 5JXAH 3FHAA 1LO2L 2C4FT 1QQDA 4UQ3B 2CXKA 4KV5F 4YLQT 3C9NA 3QXVA 1K5NB 5AUMB 1CL7L 4KK8C 2DQGL 4RDQG 1F02I 4MD5B 2MTPA 4JLRA 4Z7UF 1L7IL 1YN7B 4X4YB 5GGRY 3QH3B 4WI5A 2CIKA 1CU4L 4NQCE 5GRWA 2OK0H 4NM4H 1FV1B 1G0DA 3T3PF 3NPSB 2PF6A 1P5UA 3HZVB 3VG9C 3QXWA 5TQ0L 3A67H 3T3PE 3TBYB 4XBGA 4FQIL 4Z77B 2V5MA 4RMVA 5IW1A 2BOBB 5AD0B 4QF1A 5CMAB 3NA4A 4HPOH 3SCMB 4K23L 5F9JA 4ZS7H 1ROWA 2R0WL 5CP3H 5KBNC 2FEEL 4FQHA 2DBLL 5GPRA 4Q9RL 4L4TE 3L6FB 3QCVL 5IHUL 3O4LE 1TVHA 5IK3A 1IC7H 1R5WB 4GUPA 2PTUA 2O5ZH 1M7IA 4QRRD 3HE7B 4UAOB 5E1AB 2DQCH 4Z7WF 1NUFA 3BW9B 1AP2B 4U0RB 2CQVA 4WUUE 1FE8L 1LO4H 5C0GB 3KPQB 2D31A 1XF2A 4G6ML 2IANA 4Z7WE 4HD9A 1MH5A 4PJ8B 2NZ9D 4GAFB 4WRLA 4G6KL 1YC7A 3L3JB 5C0BE 2H2PD 1GAFL 1ND0B 1SJVA 1YEDA 2ARJA 3CLEL 4YE4H 4TULL 3T4YA 5DEFB 1MCBA 2ADJB 4LAQH 2Y36L 1B0WA 5B39A 5DEZA 5J0BA 1LE5A 2EYTA 1CGVA 2A6JB 1AI1H 5HGDA 1M71A 4NQVB 3ILQC 1RZKL 2FX7H 2XPGB 4KJPD 2YD6A 5LGJA 4AIZB 4PRPE 5D5MB 4ALAH 4ODTL 3MLXL 4DZ8A 3H9HA 5E6YA 5BCAA 3VH8B 4U1IB 5EBGA 2BC4A 3EFFA 4U1NA 1JGUL 4U3HA 1U91A 4LCUA 2VLRB 1RU9H 4HG4J 1IKFH 4MB3A 3AY4A 3LY6A 4UTBL 1KUMA 5DI8A 4HC1L 4YUEL 3HNSH 4JO4L 1UZ6F 2P5WE 4GXUN 2BSTA 3KPPA 4RAVB 4GKSB 4C56A 4M9OA 5E00B 5DO2C 2IAMB 4LIQH 3EJJX 3ZLQC 4FQ2L 3FQNA 1RK1B 1A6VL 1UWXH 3FO2A 2YPKA 4V1DD 5IFJA 1KIRB 1NSNH 1P69B 1XGPB 2FH6A 1EEQA 3H9SA 5EU4A 3RUGA 1VFOA 5DWUL 5F9OL 2VL5B 1A7RL 3OKOB 2QQLL 2VKXA 3PP3H 3CFBA 3RAJH 3HUJF 4NP4H 1BX2A 2IALA 1GZPA 4GXVH 3TH4T 2W9DL 5JA9A 3P4OB 3O6KL 5DR5H 1U3YA 5GRUL 3SGJC 3MV7D 4TOYL 4X0KB 1ETZB 3MOAL 4CMHB 4XCCH 1JRHI 1NEZA 4LP5A 1NDMB 4U3CA 4MNGE 2R2BB 3MUGA 3FN9A 2VSCA 4QOKA 2HLFD 1AIFA 1MRFH 1IKNC 2YOCA 5KVGL 4FZ8H 2BNQD 3BPNB 3MRPA 5DRWA 4PRHD 1ED3A 32C2B 4JRXE 3D6GA 1AY1L 4XPGH 4JDTL 3WHE0 2NTFB 2XRAH 1J18A 4GKNB 4O2EB 1M6OB 3EOBA 2V5YA 5GRJH 5IB4B 4RFOH 4XB7A 3G6AA 4HS6B 4M6OH 9CGTA 5ETUA 1NL0L 5D1ZB 1QA9A 3VXSD 4BSWA 4P0DA 1NH6A 1UXWA 4LNRB 4YJZL 1JWMA 1NLBH 5F9WB 4HBCH 1EUUA 4RX4D 1GGBH 2YBRB 1BVLA 3B3IB 1JRHH 3L3DA 1KCLA 3DARA 3BPOB 2Y5TB 2VZSA 3NIGF 1R6VA 5IB1B 1IM9B 5IT2H 4ZXBA 5T3XH 2V7NB 3NIGE 4UDTB 5T33H 4FFYH 3MGTB 3WO4C 3FRPA 5D7KD 4HK0A 4TUOB 1R3HA 5IMMB 4O51B 4FQXB 5GS1B 1EUTA 2ZOKB 4HLZG 4OFVA 4YEFA 5JNYA 3L1OH 3QG7L 5FYKU 2VB5A 2NX5D 4ENED 4PJBB 3T0EE 1EJ6A 3P0VL 5HGGS 4X83A 1YEKL 4KROD 2SEBB 4WVRA 5ERWA 3VFGH 5E70A 4Z0XA 4A6YA 1YNLH 4TPRH 3GSQB 1WFUA 3D85D 5DD5L 1DE4A 2OR9L 3MR9A 3VJ6A 1CGWA 3DX7A 5CSZA 5MERB 3PGCB 4I3RH 4I3SL 5CGYD 3TBVB 4X9IA 3O2VH 2NLJB 4I18C 3REWB 4OF7A 1NC2B 1DQMH 4L4VE 1RMFH 5D2NA 3WKML 1WCBB 5KSUA 1GIGH 2BNUB 1I9JH 4NQTA 4D8PB 4ZFGL 3D3VE 3EOAB 3RVWC 4M02A 1X7QA 2HWZL 4GRWF 3U4EA 4Y8DC 3SDYL 4W4NA 1BBDH 5C07A 3BGFC 1N59A 1G1CA 2RJMA 4QRPA 4ZO8A 4YAQB 1IKNA 1T22B 3RWHB 1RZ7L 3VFVB 4N9GB 3LIZH 4XHJD 2EICA 3SE3A 2G75A 1G6RL 4M61A 3TN0C 3D39A 4PGDA 1NGZA 3BPLC 3MRIB 3ALXA 1BGXH 2ZSVB 2E7CA 2PW1B 2EE2A 5E08H 3D0VA 4MQXD 3EYUL 4RISL 4PJ5A 4PJIA 4OCSL 3CJJA 1IC4H 2DD8L 5MEOB 5I1GL 3I02B 4CN4A 3FB8A 2FL5B 3WD5L 4YHOL 1OPGL 2R56L 3S88H 3L5WB 3PV6A 3O6FD 4Z7VB 1HKLH 2XA3A 4C83A 4KVCH 4KI5F 4FNLL 4HULB 3TBTB 35C8H 3OJDA 4DWHA 1BVZA 2ZUWA 3L3OB 3SQOH 2BRRH 4KI5E 4WW2F 1ZANL 1YEFH 3L3IB 4OBRA 1R3LA 2W65A 5D9SB 4G8GB 2PO6C 4FQCL 2OBGA 1HH9B 4P5TB 5EOTB 3OKNB 2DKSA 2ZP0T 1TJHL 4ONOA 1FYTB 3MRFB 5D72H 1HCVA 3BKCH 1RZ8B 3Q3GA 5F44A 1A9EB 3G5VA 1F8TH 1S7SA 2VDRL 3ILPB 5LQBH 4R3SB 5IQ7L 3AU1A 5I9QC 1Z9MA 4RIRB 2FATH 1UM4L 3BN9D 4ONFL 4Q9CA 3VH8G 3QJFA 1S7TA 5GSVB 1MWAB 1LWRA 4WW1A 1HDMB 2AK4A 4OSUH 3PABA 2A0LD 5T3ZH 4E9LA 5JHLL 1PKOA 3UAJC 3B4NA 4N8PA 2HLAB 1P6FA 2LU4A 5FA3A 4L3CA 2WBJD 4DAGH 4PG2A 1CLZL 4G8FB 1J8KA 4I18A 1OT2A 1MAJA 4PJFF 5EBMB 1KJMA 4F37F 2Z31D 4PJFE 1CXIA 3OXSA 3SKOB 2E6QA 1UH2A 5IESL 2VIRB 1IJ9A 1CFNA 1ZS8B 4UB0L 2JB5H 4YIQA 4X99B 5CGTA 5DFWH 1N3NA 2GY7B 3K8KA 2C3VA 1MLBB 3HE6C 2VLKB 1LDSA 1SJHA 4P2QB 1F4XL 4JPWH 4BQ6A 4WWID 4K8RH 3OG4B 2EC8A 4AEHL 3O41A 1Z9SA 1H3UA 4WCYH 1X4XA 2GCYB 1DLFL 4LVHB 3PIQB 4XMLH 2ICEB 3DUSB 4P5MA 3BD3A 1TTUA 5EFIA 4ZFOB 3TN0A 3OR6B 4YGVA 1Q0YL 1LK3H 1R3KB 2QHLA 1NCBL 4FABL 3LN4B 5DDHA 1Y0LA 1A2YA 4P4KB 3W2DL 3DV4B 4F7MA 1OAQL 1QRNA 1NCDH 3IETB 4F7CB 4NRZB 3SDXE 1PDKA 1FLTX 3BT2H 3WNLA 2NXYD 1L7TH 2E9BA 4KHTL 5L2KB 4N0UB 3HMXA 2JJSC 3F7QA 1HINH 4IMKA 2GQHA 3GK8L 3D69A 1AGFB 1XIWB 3GO1L 4PY7A 1WJ3A 3E6HB 2VDOH 3KPSB 3LPGA 3PWJA 4YZFE 1DANT 1JPFA 2IQAA 4N9OB 4G9DA 3ZMRA 1S9KC 5JHDD 3JTTA 1HK6A 2PO6A 1YQ2A 4KRMB 1BFSA 3SGKC 1QO3A 5D96B 1A5FH 1TZGL 5JOEA 1T1YB 1KCSH 4WEUD 2ESVA 3E8UH 3QIUB 3GKWL 4HEPG 5FOBA 1NBYA 1S7QB 4EUPA 2BMKB 3G5ZA 5FOJA 3VXRE 4CMMB 1HIMH 4RWYL 4G42A 1D9KD 4KKAC 4PV8A 3WBDA 5GGQH 2R0ZH 5IVXB 1XF5A 2FJGA 4KTYA 2VDML 1S5HB 2WWKO 4F2MA 1A6AA 5SWSE 5FFLA 4I2XB 5IW6A 3VFSB 5JPMA 3VCLA 4KJYB 3DRTA 3ARZA 1V8HA 5A43C 3MYJB 1DEEA 3QHZH 5E4EC 3WFZA 3DYPA 5K9QG 2A6DA 3NCCB 4JPVL 2BVOA 1TTFA 3LD8B 2XA8H 4PTUB 3S96A 4UBDC 1CVRA 1E4JA 1C7SA 2IC2A 4QCIA 3VXUD 3SE4C 3BZDA 4YNYB 3LSOA 4E42B 1ZGLM 5C0CD 4XNUH 2BJML 3MPCA 1A1OA 5DEGA 1A6ZB 4LLAA 1NEUA 2G5RA 4GKZA 3AS3A 4QT5B 4XZUB 2EDFA 3WKNA 3Q48A 1T2XA 1CYGA 4HKBA 4J1UB 1P4LB 3VG0H 3EDEA 4BK4A 4Q6IC 3STZB 4LARH 1AKJB 1KB5B 4MCYB 4DQOL 4JRYA 2WV3A 5EORH 2C1PA 4LNVA 3LV3A 5MEQA 4FZEH 2LE9A 4XP5L 3IFPA 4FQJL 4QRRE 3T0XA 5GQBA 3BEVA 4PGBA 1A7OH 1NLDH 2FJHA 2EXYD 4OLXL 1ZGLP 2EDWA 2BHYA 3QDJD 3WIFB 3JV6A 4OLWH 2JJSA 4Z78B 3IFNL 1SBSH 3MUY1 4LDLB 4H26A 2F58L 3IDGB 1X6NA 1MWAH 3KWWA 4JPKH 3B2VL 1E6JH 5J1TC 3MBEB 2HT4D 3LQZB 5C9JB 4QGTA 3KR3L 1BM3H 2D2OA 1INQA 4M93B 5TJWK 5GS0L 4TUKL 3SGKA 4QXGH 1LD9A 2HTKC 3TA3D 3RGVC 4G7YH 1P7KA 3DGGB 4XPAL 1TVDA 5SWQB 3QRFM 4NQDD 3ARUA 1IGCL 5F3BB 4D9QE 1N7ML 1G9MH 5B8CB 3QWQB 3SPVB 2DF3A 3DO7A 2XTJD 2EH7H 4ODWA 3GMLB 1B4JH 1HQ4B 2ORBL 4XRCA 4YDLC 2DDQH 4OGXH 4PJAF 1A6TA 4WNQB 4ZAKB 1ZAGA 5I15L 5I66A 3LDBB 5EIVA 3H3KA 2IPTL 1WWWX 4GG6F 1R24A 3GSRB 2EYRA 3VWJD 4AL8L 3UJIL 4PJDA 5FYKE 4EUPH 2APTA 5I1IH 4GG6E 4K94L 2VLLA 3P40A 2ZG1A 3PGDA 4ODXA 1W8OA 1U8MB 4JM2D 4CVXA 3P77B 3V4UH 2C7UB 2UZIH 3BRFA 3O2WL 5EOCL 5E99L 1TIUA 1R5VA 4LVEA 1U2CA 3D87B 5KJRH 4XVJH 4M3JA 1DUZB 3BUTA 3RDTD 2FR4B 1K8DA 3QHFL 3TWCL 1EEZA 3CK0H 4ZUSA 3SE4A 1T4KB 2XXCB 3GMRB 1AO7A 2J88L 4MB4A 3PDOA 3PQYB 3MJ6A 3QI9B 3EYQD 1J8HD 1L0QA 3MV7E 1QFHA 1TJGL 2W1NA 3LMJH 1S9VB 2UWEB 1CFTB 2R15A 4LL9A 3RU8L 5C7XH 3BUYB 5CUSH 2YHGA 3LKQB 2YD2A 3C5JB 3EFDH 3S7GA 2GJZA 3HZYA 1SYSA 1I3VA 4ZTPL 5FK9A 1LK2A 4PRHE 1A47A 4O02L 1YQVL 4ZFZB 4OFDA 1V3MA 5KVDL 2BK8A 3IKCB 4TN9A 2E7MA 3KPNB 1YMME 4HV8A 4JFED 5AG9A 2AJUH 1LP9F 2DBJA 3VXSE 3C8HA 5DHYB 2NW3A 3SDCC 4NJ9L 4Z8FL 3SOBL 3OTTA 1LP9E 5KANI 1P2CA 3D1MC 1U92A 1FFNB 4ZNEA 1R3JA 1XH3B 2Z91B 1MRCH 4F15C 2DM7A 4OCWL 2O26U 1TPXC 1G7PA 5HBBA 2VAAB 1RULL 2XFXB 3ZT5A 3X3GH 2O5XL 4EDXA 3GIZH 1DLHA 1EPFA 3ET9F 4LPWA 2VXQH 5F9AC 3V6OE 3CFDB 5DHXB 5I18H 3S3SA 5BZWB 3IU4L 1N4XL 1NMCC 5D7KE 2EEBA 1OP3K 2ZJSH 3ES6B 4LKXA 1JNHA 3EKCA 4X7SL 1F5WA 5F6IB 2B5IC 1A6UL 1ZEAH 3V2AR 2ATKB 3B2UC 4LBEB 1CD1A 5DD0L 1YJDL 4DUVA 4XBEH 1CDGA 2YPVH 5J6GB 3HFML 3RVTD 2Y6SD 1OVZA 3P73B 5FDYA 4GRLC 3BAEH 1E27B 3O8XD 4TVSa 4YK4C 4WFFD 3HNVH 2XQYG 4HLJA 4AENA 1MQKL 4U1LB 3IS0X 1KEMH 1AD0A 1NGYB 1W2KT 1PX4A 4PJGB 4ODHH 1RJLA 1KFAL 4KKBC 4MD0A 2DL2A 5IR1B 2OTUA 2OZ4H 3RIFF 3GSVB 3TC9A 2VOTA 1QACA 4JN1L 5FKPA 3CLFH 2IFFH 1BFVL 4MA3A 5C2BH 3QFJD 3V6BR 5F3HA 1SM3H 2DQUL 3I2CH 4DGYL 3O3BB 4NO5A 2AKRA 4LLWA 3GSNB 3CVHA 3N85H 3U9UA 4NZUH 3TZVC 3VD4A 3CCHB 2AERT 1IEHA 2XYCA 4N0YL 2X1XR 3CC5B 4N8VB 5ALCL 5DMIL 5KANG 1CWVA 1YEEL 2JK5A 3U30C 1F4HA 3QPXL 4L5FH 1JJUA 1U8PB 1R0AL 3RIAK 5AG8A 1FVCB 5ITFB 3FQTB 5F71A 1P4BH 5ICYB 2XN9A 4EN3B 1EVTC 1A7NH 1VERA 4L8CB 2DYPA 3D5OF 3FT4B 2VZUA 3VFWA 4ZS6D 5FYJU 2O61A 3LS4L 4TRPH 2VLJB 3MNVB 2E3VA 3QO0A 1VEMA 5EBLA 3HZMA 2DQIH 1CIDA 2I60L 2AJYH 4RMQA 3SDCA 4Z6AT 4OD3H 4UDUB 4XCEA 4H0GA 4NKOB 5IIEB 4LPXA 2HKFL 3R0MA 1G9EA 2ADGA 4Z7NF 1IMHC 1G7HB 4PJEB 3F58H 3VFOA 1I7UB 2HFFA 5IB2A 3F7RA 1YDPB 4D94A 4Z7NE 2XZQH 4NWUH 1QEWB 2ZWLT 2OM5A 1QR1A 1ZA3A 2AEWA 1RFDL 2CKNA 3OAZH 5FYKL 3FHQA 5C0AA 1G7MA 4ZPVB 4AG4L 1CDJA 2QADD 1ZK9A 4ELMA 3ROLB 4UNVA 1QYGL 1LEKA 2XQBL 5EN2B 4JJHA 3MJ8B 5HDQH 3UZVB 3W9EA 4LSPH 1YYML 3HI1B 1NGXA 1IARB 2X4UB 3N1GC 2PW2A 4D0BB 2OMBA 5E24E 2BOCB 4FHBD 2FHCA 1HHGB 2FJFB 1I1AB 2VXSL 5D2LA 3IDIA 4IIQC 4GRLA 4TTGA 2J1KA 1OM3H 1DVFB 5DA4A 4CN1A 2R23A 1MCRA 1Q9KB 5IB5B 4YX2H 1CK0H 2K9UA 4YBHA 1I8IB 2A6IB 5FUOL 3ZT7A 1AGCB 3MFFA 3UMTA 3SKNB 1RSFA 3HZKB 5EOQH 3BH9B 1AC0A 3DMMB 3T2NH 2EXWD 2UUDH 5ISZD 3MYZA 4XC1L 4CU7A 3KYMA 3HC0B 3VXMA 2Y06L 1INDL 3ARFB 1MFEL 4G8IA 2GJ6B 2XZZA 3UYRH 5TDPA 4OIAA 5DQDL 3RKDD 3X11A 4P57A 2H9GB 3DVGB 2EO1A 2JLLA 4JHZA 3F65A 4EQ2A 3QZWB 3R1GH 3WDJA 3EO1B 2FZ3B 3L5XH 2DM4A 4G9FE 5I8KH 1AGDA 2E8YA 1NFIB 3OB0K 5ACZA 4U6YA 4NUJA 1BP3B 2OP4L 3PHQB 2NY6C 2CDEA 4GBXB 2BVEA 4JDVB 4FQ1H 3GNMH 4IS6B 1SHMA 1JGVL 2R8SL 2OSLA 4MYWB 1A1NA 1RZGB 1YPZA 2CPCA 1K4CA 1YNTB 4DFHA 4PJCF 2OCFD 4OFIA 2AJSH 5ENWA 5HHMB 4YXKH 1J88A 5TE4H 4LHUA 5GRZA 2LU3A 4DTGL 3OGCB 1UJ3A 2GSGB 2Q76A 5E2WL 3IVKA 3ZE2F 4APQB 1KG0B 4ONHB 2OR7A 2WQ8A 3BI9X 4RGNC 4PBXA 5DJYB 3ZE2E 2H41A 3EIFA 3EO9H 1H9VA 1S3KL 1KNOA 4OM0L 4ERSL 5ID1B 3RA7H 3BKJL 4Y19B 1OAYL 4DUWA 5DMJB 2E27L 4MVBD 3MTRA 5JHDE 1EGJL 1QSVA 4DEPC 1N8ZB 3ULVC 2R4SH 4C55A 2ZCKH 4OZHE 3HNTL 4PJ7A 3GRWA 2Z8RA 4CJ0A 2FYYB 3N9GL 3RVXC 3FRUB 3QBTB 2WZPD 2Y1VA 2EIZA 5KOMC 3TBWA 5FDWA 4HWBA 5F1IA 4QXUH 1NBZA 4OKVB 1HZHH 3FN0H 1IGJB 5HHOB 3TVMC 1JHTA 3W9DA 2CO7B 5C3TA 4N1HB 3W81A 3MRDA 4XVTL 2GKIA 3Q0HA 3VWKD 4YO0A 3B9KC 2CJUL 5CS7A 2GITB 2VISA 4IIQA 2NXZD 3GSNH 1KTDB 1FGVH 2DIBA 2MKWA 2X1OA 3N0PB 3VXOA 4X6CF 1LO3L 5MI0B 3WSQL 4YHZL 1A14H 2EH8L 3UTZA 2ZCLL 5CSGA 5E2UL 4YFLI 2A2QT 3KXFB 4H8WH 3X12B 4D0CB 1OARL 5IFHH 1DQDL 3W5NA 4FS0A 2V6HA 4NSKB 4ELKB 1S7RB 4OLZL 5MHSD 1T5XB