4AMKH

Fab fragment of antiporphrin antibody 13g10
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
215
structure length
215
Chain Sequence
QLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWVKQTPGQGLEWIGVIYPGNGDTSYSQKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYYCSRGGAGIMAYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords FAB13G10, HEAVY CHAIN
publication title Crystal Structure of Two Anti-Porphyrin Antibodies with Peroxidase Activity.
pubmed doi rcsb
total genus 41
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2012-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4amkH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4amkH02
1C5BL 4HLJA 1K4DA 4UILH 1CGWA 35C8H 3LPFA 3VG0H 3RWDA 4UAOC 2COQA 5DRXA 1FO0B 2H8PB 5D70L 3GSNB 4PJ5D 2WSKA 4HGWA 4OIIL 1I1AC 2B4CL 4I1NB 4TVPE 5BZWB 2FECL 5J8OA 1YEDA 4GS7B 2I07A 2YKLH 3ILPB 2YEZA 1D9KD 3OKKB 4HV8A 1U93A 3B9KA 1MUJB 3OWEA 4YK4B 1OP5H 2H1PL 5CEXB 1U2CA 4MS8C 4ONHB 5JHLH 1RPQA 5EIQA 1DZBA 4OLUH 1U8JB 3W9EA 4F57H 1FNAA 1F02I 4P9HC 1NPUA 4PGEB 1WT5A 4LCWE 2N4IA 4Z7WE 2I26N 1G7PA 5ACLA 1RUKL 3I9GL 1J05A 5D5MB 5EORH 2BNRB 2YPLA 4LNRA 3F5WA 1N0XH 3D18A 5CBEB 1KEMH 3KG5A 4XCCL 2VKWA 3MXVH 2LFGA 5TE7H 3PHOA 4GW4B 2VDRL 3UMTA 3ZYOA 1J8HB 1KPRB 2OMBA 1U8KB 4GH7B 1CFNB 4HFWB 1W8OA 5ILTH 5D6CB 3EOBA 1QRKA 4XNYL 5EOTA 5DJYB 4UB0H 2HT2C 3SGDH 3GNMH 5IJVB 1UA6L 3HI5L 4G8EB 3AXLB 4EDWL 4GG6F 1BJ1J 4LF3A 1T1XA 1MWAB 5IBTL 2CIIA 1R3JA 3O3UN 3G6AA 4FQCH 4NRYA 3QNYA 4WVRA 4JFFA 2EDKA 1KIPA 3DARA 4ZPVA 3ULVH 3MBEB 1BZ9B 1AGEA 1RUAL 1DBBL 4XXCC 3PV6A 2BMKB 2PN5A 1FYHB 3O3AA 1U3HC 2AK4D 3A6BL 4WU7B 2ZOKB 1R3LA 1LO2L 4F7TB 3QRGL 3C08H 4XPTL 3WKNA 4N1EA 5BXFA 1MPAL 4WDIA 1TIUA 3ZDYE 5C09B 3OKEB 5H37H 3GK8L 2ORBL 1J0IA 1W0VA 3C9NA 4NO3A 4JO2L 1NCDL 3VXPA 4HKXB 1NQBA 3SKJL 1N5YL 2QBWA 5E5RB 4NKQB 3WS6C 2XTLA 5ACMA 3CFIC 3ARPA 4H20L 5DGQA 5J6HB 5L2KA 2V9TA 3VGBA 1WIPA 5MENA 3FONB 4LDOB 5JW5B 3EOTH 2P44B 3L5JA 3VWJB 2NY4B 3PDDA 4NO2A 1LP9F 1U8QB 1HHKB 1U8OA 2CKBL 1ZLWK 2CDFB 5C0DB 3BQUC 4ODXB 3QFJB 3SDCB 3IXAA 2O5ZH 3NBNA 2V2WA 4PJHB 4NGHL 3GHBH 4ZOAA 4GBXB 2VSDA 5GSRB 5I1CL 5E7BA 4D9LL 3HRPA 5KVGH 1A7OH 4PJIF 4U1JA 2BC4B 3TNNB 4RGMC 2AJVH 4KJPC 1UWXK 1FDLL 2NYYC 2X9WA 2F8OA 2VABB 1A1NA 5E8NA 3EO9H 3BWUC 4HXBL 3UTQB 3T3PF 3QFJE 1XF2A 5MI0C 3REWB 3SY0B 5JLZB 1K8IA 5L9DH 2QQNL 1GYAA 3MLWH 2CMRH 2FHFA 4ZQKB 3P0GB 3MV11 4OCSL 4WFHE 5DMKB 4YAQB 3BDYH 2X1PA 3D39B 3IU4H 1GPOH 5D4QA 2JK5A 3IU3B 4OF3A 4M6ML 4EN3D 4FFVD 3L9RA 4G6MH 1BD2B 3MQIA 2FGWL 1AGBA 5DQJA 2BDNL 1BOGA 4I9WE 5AZ2H 5CD3A 3EOAB 3OF6A 2LU3A 1U8HA 4TVSa 4UU9B 5GRZA 4LRIC 1KN2L 4HF5L 5DMGD 3TA3C 1EFXA 5HBBA 4GAYB 2G5RA 5BO1L 3O3EA 5B4MD 4KKCC 3V6OA 1RZFH 4R97C 3NZHH 4JFEE 1HYSC 2Y5TB 5SWZB 3INUH 4NC0B 4R6UA 3U48A 3WNOA 3JWOC 5GS1A 4Y5VC 1BD2E 1A7RH 2UWEE 1GGIH 3V0WH 4GKNB 3F6IA 1L0YA 3L7FB 3GB7A 3RVWC 4XWGH 3BN9D 3BP6B 5IB2B 3BDXA 4JM2D 3V9FA 4JLRB 4QTHA 4YZFF 2LVCA 3BZEA 4PPTA 1NAKL 1IILE 4UNTA 3IGAA 3S37L 4P49A 3KPMB 4HK3J 5SWZE 1CS6A 4PJ8C 2LU4A 5BVPL 2HRPH 1GZPB 2DDQL 5CD5C 3QIUB 1GRWA 1G9ML 1IGYA 4OCRL 2APWA 5HHOB 1QQDB 3OPZH 3O2WH 3TBVA 1IGFL 1IAKB 5JIKA 3VXUE 1MVFA 4IMKA 1F6AB 3KPRA 3NAAL 4AL8L 5JPMB 4LCIH 4S1QL 1RV6X 2X1WL 1PSKH 4Q97A 4RMUA 5JOFA 2EDDA 5F7HA 1KGCD 5D1XD 4MQXC 2DI7A 4NNXA 3EYSL 1E0OB 3FO1A 3SE9H 3PF2A 3SJVA 3FB7A 4J7RA 1K8DA 3QIWB 3FCTB 5DZLA 5BS0D 4MSWB 1MFEL 1Q9LB 43CAB 4YPGB 2X5PA 5KJRH 5E2WH 3WNKA 4N5UA 4Y19D 3PQYA 1MIMH 4YX2L 2BRRH 5C0CD 3FB6A 1MRFH 1NMCC 3KYMB 3AU1A 1X4YA 4PJAA 1EZVX 2NZIA 2R2EA 1F4HA 2FH6A 1OCWL 3H9SB 1I8IB 1L4IA 4BUGA 1I8MB 5IW6A 2AEQH 1UXSA 5DDHB 4GLRI 3QIBA 2D7QA 1HHHB 1U8MB 1AIFA 5GRYA 4C83A 4FMFA 2XZCL 5ETUB 5EBMA 4U05A 2KQNA 4M7JL 3IF1B 5JIHA 3GJEB 4HZLA 1JPGA 3OGOE 4G8FB 5HYSG 5ENWA 1HI6A 4LHUD 1U8NB 1I7ZA 3P4NA 5E6IC 3V5DA 4HPYH 3BKCL 1L7IL 4H25B 5GGRB 4IJ3B 5J9PA 1NFDE 2F54D 3T2OA 1BX2A 3DBXB 3HMWL 1ZT7A 1PAMA 4DOHE 4ZNCD 2WAHA 5F7EL 3SDXA 2ICWJ 4AM0B 1ROWA 1NEUA 4FTVB 2X40A 3CXDL 3EJZC 4K7PX 5IW3A 2ATKA 2Z31B 2AV1B 4ALAH 4IMLA 4OI7A 1FL3B 1NEZB 2AVGA 1G9EA 1CVRA 5T1KD 1D5MB 1AO7D 5C9KA 2AV7A 3HUJE 3TBWB 5I1GH 4YDVA 4OF5A 4TVPH 2ADFH 1T7ZA 4L3ED 4RRPG 2WQRA 4DFIA 2DWEB 2HTKD 2CXGA 3MLTB 4S2SA 4HV8B 3VXMA 3BKML 4PJ9B 4YDIL 3QG7H 2L4OA 3RWFA 1OGAA 3F7PC 1QSED 2D4FA 1MI5A 2O5YH 4NCDA 5TE6H 5KSVA 1EMTH 1JGVL 1U58B 2X1QA 5DC4B 4XMKH 3ECBB 4OLEA 1G7PB 4N5ED 1BZ7B 3T8XB 4PB9L 4J1UA 5DUBB 3RGVC 3D85D 1CF8H 3Q1SL 1BFOA 5CGYC 3ZO0A 4WFFD 4RGOH 4JCMA 3LQAL 3QZWA 3G5YB 4JFPA 3LIZL 5HI4D 1UJTA 4BZ2L 4KK5D 4L8BB 1A0QL 4JPKL 1V7MH 3TH3T 1H3PH 4CNIA 5D71H 2HJLB 5AAMA 5ANMA 2NY7L 5CP7B 4JZJC 4UZGA 3OQ3B 2YPLE 3BIKA 4JKPH 1R3JB 3QHFH 3G6AB 1UKTA 1WFNA 4MJIA 1A22B 4H1LB 4LCCB 4OZHB 2K7PA 3BGAA 3QDMD 4RX4A 2EDJA 2R1YA 3PV6B 3BW9A 5C0IA 2WM0A 3E1F1 2BSED 5DFWH 3O3AB 1T66C 1MJ8H 4KDTA 3HFMH 1C5DA 1UVQB 2EYTB 3U4BL 3C5SB 3KLAB 5CILH 3EDFA 3S3SA 4NYLA 2FGZA 4F9LC 3ARFA 1B0GA 4XNXL 5GGVL 4TQEL 5AG8A 5F3BB 4JFFE 3GO1H 1IL1B 3O2DH 3PP3K 1O7SA 1YUHA 4ZS7L 5FCSH 1ORQB 1NCAL 5J1AA 4K3JH 3JTTB 3CX5J 4MX7A 3MGTB 1WZ1L 1LD9B 4EBQH 3GMQB 1TTGA 4C56A 1A9EA 3T4AB 1OB1B 4IRSB 4MHHI 4D9RE 2AJYL 3LKNB 4JRYB 4NQDB 5T5FH 1EUUA 3RWEB 1YEFH 4G9FB 3UJIH 1CDYA 3WS3B 3O9WB 1BQHA 4RGND 4BZ1H 1FFOB 4K8RC 4LVHC 5I66B 5JTWA 1AKJA 5CJQH 2I25N 3OGCA 4KY1L 5KVDH 3CH8A 4PY8I 3BZ4A 5L2KE 4H8WH 4P4KD 3SCMC 5MENE 3TO2B 3HG1A 1MCCA 1WSST 3W5MA 3B9DA 1PG7H 4TSCL 3QO0B 4G9FE 3GSUB 2FDBP 1RUMH 2H9GA 4YIQB 2YK1H 2BJML 3FTGA 5FUCC 2OTPA 3MNWA 4U1SB 4WWKB 4S11A 1K8IB 1RIUL 1QZ1A 4HC1A 3D48R 3D9AH 4DK3A 1LE9A 1FYTB 5T33H 3L3IB 5E2TL 1PDKA 3GJFH 1QYGH 5FUOH 1ZKAA 4S0SD 5ADPL 5A40E 4BFIA 5MEOA 1QLRB 4JN2B 1HHGB 3TYFB 2V7NB 5IT2L 3DYMA 3GHEL 3C6LA 4QT5A 3V6ZA 1LK3L 3FO2A 1I1AD 1CI5A 2EDHA 3WJLA 4KROC 2VISB 1MEXL 4S10A 2WBJB 2EKSB 3RL2A 5A2LH 3HZKB 4JY4A 1NSNH 1T21A 4BKLB 1MCPL 1M7IA 3T0WA 5FYKE 4QO1A 4PBXA 4MZ3A 3DX7A 4I18C 3VE0B 4LLQA 5D9SA 4MS8D 2IGFH 1JV5B 4OSUH 2ITCA 5IHBA 1YEKL 2Y36L 5EC1B 3JUZA 3K2UH 4P2RA 3SE8H 4IIQC 3HTLX 3WKMH 2BVEA 5IFHH 1D5BB 4N0FB 4ZDHA 4AIZB 3AS2A 4X98A 5TDNA 4HBCL 3BD5A 3OKNA 4NN7B 3LKRA 5A2KH 4YPJA 1BQLH 1H3XA 4OD2B 5FO9A 3V6OE 3ZT7A 2WIMA 1OY3B 1NFKA 2FLRT 2AKRA 1JMZA 4DW2L 1OAUL 4WI7A 3MRFA 5DD6A 2A2QT 4Z9KB 5H35B 1YQVH 1IGML 5E8PA 2E7MA 4PUBH 1F3DH 1REIA 1E6JL 2DTMH 2ZCHL 4S1DC 1YPZF 1JHKL 1F3JB 2Z8RA 2XRAL 5HI3D 4KWUA 3D0LB 1OPGL 1JGEA 2RBLA 4OJFH 1AD9B 2ADIB 4LRNL 2DQHH 1I3GH 4X99B 4C55A 1LE5B 4V1DB 3PNWB 2CLZB 2OSLB 1OAKH 2D3VA 5C6TH 1NC4A 3O6LH 1SMAA 5ABDE 2BVOA 4KPHH 1YC7A 1MY7A 3O0RL 4NNXB 5KSBB 3CSPA 3P9WB 3E6HB 2ZJSL 1QRNA 2JCCB 4NKDB 1CGXA 3LEVH 4HS6A 1HSBB 5TH2B 4D8PA 4DKEH 3O6ML 3MPCA 4OF7A 5CMAB 3KXFD 4NN5C 5HJ3A 1FV1B 3S5LG 1PKQB 3F7VA 4CU7A 1KF9B 2FSEB 3BRGC 4PIRF 4HXAH 4H26A 1C16B 4PJBF 3KWWB 4GAFB 4PRHD 4QOKD 1IC4L 1IM9D 3LS4H 1KT2A 4HWZA 1DBAH 3CZJA 4WHTA 3T4YA 3ARBC 2OYPA 2BOBB 3SJVE 1FGVH 1U95A 2WBWB 5M94B 2VXSL 1T0MA 1XCTA 5BRZB 3KPOA 1AXTL 5ESAA 4WEUD 2XPGB 1JF1B 2YHGA 3MFGB 4L8DB 3PQYE 3BQUD 3TVMC 3BT2H 4YHOH 1GGBH 1M6OA 4UOW1 3WEXA 5DRZB 1A14H 4F8TA 4G43A 3NCBB 4HUMB 4YC2C 4FABH 4YWGL 5EU6D 2F5AL 1LNUB 5F7DA 1CICD 1G9NL 2DD8H 5I0DA 1JK8A 3QHTC 1HOCB 4Y5YC 4KJPD 2AXGA 3GGWB 1W72H 5D96C 4K3GA 3SO3C 5TJWK 1MCKA 4ODSL 4IOFC 5L0QC 2ADGA 3JV6A 3KPQA 4ZAKA 5DJXB 4YDKH 3ZHLA 3R06B 4P23D 2A1WL 3CK0H 1KTDA 2R1XA 3DV6B 4Z77B 5FO8B 2VDML 1OAQL 1Q38A 3SDXE 4YDLC 3HE7C 5DC9B 3B9VA 4NO5A 4NCC2 5CSZA 2CK0H 2FJGA 4NN6B 3BHBA 4Y4KA 1U91A 5CZVH 3ULUC 1T1WA 3K1DA 4HKBB 4U1NA 4AT6B 3IDNB 1IQDA 2VZ1A 3E8UL 4GQ9L 3RU8L 1QVOA 5F93C 2O61A 1HYSD 5DJ6A 3O6FB 4LMQI 4PRPD 5FECB 3FFDB 4IOIA 5ERWB 2VLKB 3MBXH 5I71C 3CFKA 4ORGB 2J4WH 1C5CL 1FORL 3VXME 7FABL 2J1KA 3T2PA 3N1QC 3LMJL 1OGTB 3SDYH 1N5AA 3F7RA 3HPJB 5E8DL 4ZUTA 5A3IC 1OGAE 5HI5C 4PJFF 2MQCA 4JHZA 3TYGH 32C2A 1UCBH 3QEGH 1MI5E 1MJ7L 1S7QB 1CFVL 5JXED 1DR9A 3WMSA 2IANA 3MLSL 3L3GA 4FZEH 1YNTA 3H3PH 2V9RA 2IBBA 5LGJB 1V3JA 1KN4H 1XR8A 5T1DH 4RMSA 1JPFA 2VLKE 4XWOC 1S5IH 2VKXA 4DGIL 1ONQA 4LSUH 2Z92B 3BIAX 5AD0B 1WWWX 2PO6C 3QBTB 3WN5C 2NZ9D 3MO1A 2OQJB 4NWUH 3D25A 4P46A 4G6KH 5E8OB 1KLFA 2FBJH 4OD3L 3BEWB 5I30H 5DMYA 5IMLB 4ZS6D 3TH4T 4F33B 1J1XH 1JUFB 2VDNH 4RMVA 4M48L 2NLJA 4JM4H 4LSPH 2EYRB 4Z7VA 1GSMA 4XBEL 1HSAB 1P4BL 5EO1B 4KRPC 5D7KE 4M9PA 4LSSH 2Q6WA 3ALPA 2G5BA 4KHTH 2VDOH 4MJIE 2BNUB 5DVKA 2QHRL 2R2HA 3RY6A 2YR3A 4AH2A 3HHRB 2DL9A 2DOCA 2X7LA 4KJYA 1CWVA 5L2JB 4ERSH 2DS4A 4AEHH 3DGCR 4O02H 3TO4C 3OKDA 1JGUH 4XCNA 1ZHKA 2QSTA 3B8SA 1T1YB 1FN4B 2A6DA 5IR1A 3C8KA 2DI9A 1HHJB 5HGDB 4LSQL 4M5ZL 3ZKSD 2BNQA 3HS0B 4JREC 4WW2A 1NFIA 3MCKB 5BJTA 2Q86A 1IQWL 1Z9MA 3VMPA 2JB5L 1JNJA 3MOAL 4F8QA 3NCJL 4Z5RA 5INDA 4M6AA 4P4RA 4C56E 1FFNA 3X11A 1HEZA 1MY5A 3LH2L 4IHOA 1U2HA 4U6XA 3LS5H 3U9PH 4MDIB 2NY5L 5CINH 3ZE2E 4ZO7A 5F1IB 4HUVA 3B3IA 3GMOA 4Y16C 4NJ9H 5EU3A 3QUZA 3MRGA 4FQHA 3C60D 1S9YA 3IJSB 4RISH 2YOCA 5E1HB 3SDAC 1FL6A 1OAYH 4NPYB 4OD1L 2FIRT 1Q0XL 1X5KA 3OKMA 3L6FB 1TZIA 3KYAA 4X4MA 1XIWB 3AM8C 5F44A 2G60L 5D6DC 1SJXA 4WEBH 4G3YH 3X3GL 4U0QB 3HG1E 4DN4L 4Y5XA 1P7QA 1CTNA 2B0SL 2CIKA 3QUYA 5TF1H 4U1LA 3T08A 2GK0B 2AQ3A 2A6IB 2P46B 2X4NB 2GI7A 3O4LD 5JHDA 3DROB 1YN7B 2I9LA 1RJZB 2EXWC 5KSUB 2GUOB 4Y4FC 3DMMD 3PP4L 4NJAL 5FYKH 3WLWC 4F58L 1BAFH 4MXQC 5DA0B 4KV5E 4OZ4A 5C0AA 4J4PD 3DGGA 4JZOB 2I60H 2QQLH 2DJSA 4IRZL 4WU5B 3U83A 1CFSA 5JQ6H 3STLB 2J8UA 3T0EA 5KZCB 3L5HA 5FHBH 3GSVB 5C2BH 2D03L 3U46B 3P4MA 3TIEB 3HNVH 3CVHL 3HI6H 3UBXG 1SYSA 1DEEA 4CADB 3K74B 1NBZA 4F80A 4IRJD 4FFWC 1CL7L 2DQUL 3RGVD 2HVJA 3SKNA 4I13B 1TENA 5CGYD 2LTQB 5D2NB 4HUKB 3G6DL 4RWYH 3MRHA 3DO3A 5FYLE 4PBWD 4L29A 3LZFL 4OLZL 2D7TH 1TJGH 4AJ0A 4RBPK 4AK1A 4DEPC 1QLEL 4P2RE 2APXA 3DURA 4NQXB 1DE4B 3JWDC 1MELA 5K93A 2VB5A 1KOAA 1AJ7L 1PVHA 1U8PB 4XHJC 3TBYA 1MCRA 3TZVA 1VGEL 3QT2A 1W0YT 4X7TB 1MLBA 1F6FB 4OFIA 4XVJH 5E2JA 1MLCA 2HJFB 2X44D 4QXTA 4XC3L 2EO9A 1RULL 3DVGA 3WE6A 1Y6MR 3DX8B 3KPPB 1JPST 4BH8A 2HMID 5JXAL 5GIRA 6FABL 4OFDA 4X6CF 3BOVA 2R69H 4TOYL 3E3QE 1NC4B 3JVGA 4OM0H 1T66D 1X3DA 4WHCA 2YN5A 3HR5A 3IKCB 3ZDXF 3MA7B 1D9KA 2FIKB 1NMAL 2LVEA 3I84A 1QFUH 1ZHBB 1OTUC 1ZS8B 5IP4A 1UENA 3SO5A 3W39A 3T1FB 2DQIH 3V4VH 1HNGA 3DETC 4X7SL 1S7XB 3H7LA 1FNEB 1ED3B 4KMTH 1DUZB 2X2YA 4LPWA 3LSOA 4MXWH 1A9BB 5B39B 3C5JB 5EA0H 1P84J 2OR8A 3VGFA 2HN7A 1DDHB 1MFBL 1FFQA 5J6GB 1UJ3B 2NX5B 1ZANL 2OI9C 2EXYD 5HHMB 3RWJA 4W68A 2WNGA 1NGXA 1YY9D 3SQOL 1LDPH 3UYOD 3CFEA 3T04D 2P8LB 2GSIA 4PGZA 1PX4A 4CW1A 1KCRH 3HZMB 5L88H 5EPMA 1TVBA 3PG2A 3WEXB 4XP5L 4FQXD 4OKVA 3MNZB 3ULVD 3NPSC 4N8VB 5GS0H 2DBLH 2FX9L 1JMXA 4M8QB 1F13A 1HXMB 5IK3B 1P6AB 5F3HA 3RZCC 3SCMD 5CIPA 4P5MA 2VXQL 1R0AH 3H3KA 4PGBB 5AEAA 4I0CC 4KKAC 4ZNEA 5EN2A 3G9AB 4XPGH 4P2OB 1NH6A 5LXGH 1FG2B 2CKBB 1ZSDA 5FCUH 1HWHB 4MGXA 4MAYC 3U4EA 3U9UB 2I5YH 4LEXH 4XPFH 3QNXB 4MJ4A 3UTOA 3QQ3B 4U6HB 4JJ5A 1IC5H 4WNQB 4RDQF 5SWSD 2ESVA 2F53D 3IJHA 4PV9A 3NPZB 4HJJH 1UQSA 1QFWI 1A7QH 4GKOA 4DKFL 1D5ZB 3TC9A 1H3UA 1A7NL 5TGBB 2J3SA 4KKNA 3HNTL 4JKKA 1UZ8B 4MNHB 3ZTNL 5T3ZH 1JRHH 3BPLB 1RK1A 1AI1H 1ADQL 3BP7A 4XC1H 3L3DB 1LVEA 1T1WB 4KROD 1SQ2N 3VFWA 2DQFB 3L3KA 1XGYH 3TNMA 2C3GA 1F90H 2C5DC 2YXFA 1CDHA 5I1HL 1RZ7H 4XXDA 1RZIA 4PJXF 2DB8A 4OUUA 4Q9QH 2VLJB 1FVCB 4KI5E 3GBNH 2HT4C 4GAGH 2KUTA 2E6QA 4N8PA 1F4YL 5ACZA 5HD8D 3QFDA 1M7DA 3RZWA 3KPSD 3H9HA 4ZUTB 1I75A 1NLDL 3MRPA 3B9AA 1RJCA 1JF6A 1CGSL 4IDLA 4Z0BH 4BFBD 2AJXH 4PR5A 1BFTA 1NKOA 1DQQA 2EH7L 2E6JA 4JVUA 2DQEH 3RAJH 1SEBB 5DT1H 2MMXA 1PY4A 2ZCLH 4HT1H 4R96B 1F42A 3O3DA 3OAZK 5JQHC 2B1AH 4UTBH 5D8JH 3FO9A 5GRVK 3C09B 5DUML 1I8KB 3BWAA 1YYML 1YA5A 4E5XB 5E94A 1EUTA 1KCUH 4O58H 4MCYB 2R8SL 4I77H 4OGXH 2QEJA 1FC1A 3OG6B 1J0HA 5I15L 1WIUA 2IANE 4MD0A 2Y72A 3WHXA 4WJ5A 3W0WD 2Z9TA 3EYUH 4HWNA 3OL2A 3G6JF 3BE1H 5DMIL 4S1SH 4P3DA 2YD3A 1HQRB 4K7FA 3BX7C 4N9GA 1CGUA 2BCKB 2XWTB 4MNQB 2J6EA 1E6OH 4QRRB 2JELH 4WW1A 3B9KC 3DI3B 3E0GA 4GMSL 3W9DA 4ACPA 3S35X 2G5BB 3TH2T 4GRMB 4HLZG 2W07A 2PR4L 2CJUL 1CXHA 1D5XB 1KENL 4JFYA 2FR4A 3PWVB 1CU4L 1CLZH 4NC2B 5DD5H 5F7LB 1ZWIB 3UPAA 3GDBA 1HH6A 1FH5H 1O5DT 1YN6A 2X4OA 1S9VB 3LHPH 3IDIB 4NP4L 4Z7VE 5D72H 1Q9OA 4KTEH 4PG9B 3ROOB 3ULVF 1FL5A 2EDBA 3BESR 5EZIH 3CXHJ 3VXSA 4JAMA 1IAIH 1ODAA 2XTJB 4MLIA 1DP0A 5DXWA 4JM2A 3IDYC 5C1MB 4LSVL 1AGCB 3SBWC 4X6BA 1IBGH 2HG5A 2PW1B 2P5EA 5INDB 4X9HA 5T3XD 2V2XA 3TVMD 1UT9A 1FFNB 2VQUA 3LRSA 1HIMH 3LN5A 5ICYA 4NQEA 5BZDB 4ELKB 1F3DJ 2OL3L 3NTCL 2VDKH 4UV4L 3AREC 3VXQB 5B8CA 3MRGB 2BNQE 1KXQE 1WISA 1NBYA 3GEWB 3FFCA 4HWUA 3MLVH 3HZYA 3ME0A 1M71A 5F89A 3MRIB 3SOBL 3H42H 5EOCH 3ZT5A 4JANA 4NUJB 4IOFD 2DQDL 2AW2A 5C07B 4O9HH 3JZ7A 3TT1L 1NAMA 5C0GB 4DQOL 4GG6B 3WO3B 3EFDL 1CQKA 3QCTH 4CMMA 4MJ6A 1OSZA 2EDYA 3P73A 2VL5B 1A3LL 3SQBA 1ZLWH 1GZQA 2DIBA 5JIIA 5DK3A 4ODHL 4FXKB 5T5NF 4B5EA 3HC4L 1MFNA 4M4RA 4RMWA 2YMXL 1IC1A 1Q8MA 2JIXD 2HFEA 2R4RL 5BS0A 1NGZA 4HC1H 3VGAC 1QSFD 3VRJB 4QF1A 5H94B 4AEFA 1NBVL 3MOBH 5IBUB 4JFZH 1TDQA 4X4ME 3MXWL 2AERT 4Y19A 3ULUD 2DBJA 1UWXH 4Q9BA 1F8TL 1AE6H 3QAZC 3WFHA 4OLVH 1T03L 4I2XB 5D7JA 1VACA 3TPUB 5JHDE 2H2SC 2ZSWA 4JFDB 3LKQB 2HYMA 2HH0H 1AHWB 4MB3A 1NCCL 5EZLA 3VXRA 4PGCB 2DKMA 1VGKA 1Q72H 2HVJB 5C0AE 4ZFOA 5FKAA 1P53A 5FYLH 2YSSA 3OR6A 4N0UA 2B5IC 4Z0XB 5HI5D 2J8UE 3T0EE 3PL6C 2P43B 2X4SA 1T4KB 4OV6F 2F54A 3LVEA 1DBJH 4FQ2L 1TETH 3IFNL 3IFOB 4JFDE 3OXSA 2HWZL 1IT9H 2R23B 4ZXBA 1LP9B 2UVFA 3WXVL 3MSPA 5F1NB 2W60A 4XWOD 4TVPD 3GI8H 5IHZA 3IDJB 3HI1A 4R0LC 4FFYH 2PO6D 3GMRA 3OAUL 1XT5A 1CT8B 1KJ2L 3G5VA 3V5HB 2X89D 4PJIB 1KACB 4NKMB 2XZQL 3K0WA 2OTUA 3UJTL 5T1LB 2P47B 5D1QD 4FRWA 1JL8A 4L8SA 5EWIL 3WFEL 3PWPA 4PJ5B 1EZVY 2R0KH 4K3HA 5JUEH 4KTDL 5EZOH 4HS8H 2WWKT 4X7CC 4KRPD 5BOZG 2RAMA 5JZ7D 3W2DH 4X4YB 1KXVC 3ZYJA 1D5IL 4CBPA 4YE4L 4MA1B 2OP4L 1H8SA 5CKGA 3V4UH 3B2VL 2QQQA 5C0FA 1Q9WA 2B2XH 2WBKA 3ARDD 3B6SA 4QXGH 1T5WB 1UB5A 4LDEB 1UACL 3FZUD 4M00A 4KQ3H 4NQUA 2AAVA 2H26A 35C8L 3VG0L 1DN0A 3T65B 1MHCA 1L7TH 3GI9H 4G7YH 2GJ6A 4CJ0A 1CIUA 1NANH 1TQBB 1ND0B 4TUKH 5F71A 2GAZB 1WBZB 2YKLL 2EE3A 1MOEA 1F2XK 4FQQB 3VG9C 4JG0H 2GCYA 1EV2E 3P0YL 1BFSA 1FGNH 1VB9A 3RVXC 4WV1A 5IF0B 4UV7H 4X6DF 2IADB 3GSQA 1G7HA 4F57L 5F1SA 5DJ0B 3UC0H 3NH7L 4O5LH 2VYRE 3EYFB 4M62L 3CX5K 1CXLA 2IALA 4DGYH 4XTRD 1CD1B 4ZUUB 4PRDA 3V7MA 3TWCH 2WINA 3CCHB 4Y16D 5EORL 2V5MA 4IMKC 3LDBB 4D0DB 5DK2B 3BKYH 1N0XL 3H9ZA 2GT9B 1KEML 4GW1A 3VFVA 3QDMA 2AJ3B 5E2UH 3SDAD 2ADJB 3MXVL 5TE7L 3UCRA 4X5XA 5F9WB 1MAJA 4JJ5B 2H32H 3P9LA 5ILTL 2AK4B 6CGTA 2VXVL 2WP3T 3O41A 3QULB 3AY4A 4UB0L 5B22A 1KTLB 1R3HB 5JPNB 4ZNEE 2VLRD 3OKOA 3NVQA 2YC1A 3GUTB 1BMGA 4KK8C 3F58H 4TNWF 1BIIB 1PYWB 2WMPA 2EXWD 3WD5H 4F7MB 4FQCL 2VMFA 4Y4FD 2MKLC 3C8DA 3QWRA 3U30C 3WLWD 4L1DA 3BXNA 4BM7A 3ULVL 1QLFB 2ESVE 2MPAH 3MJ9A 5GRJH 3BEVB 4OCYL 3AUVA 3UPRB 1XR9B 4JGUA 4R7DB 4G42A 3L95B 5DS8B 1YEIH 5M7QA 5HYJA 1I7RA 3H9HB 3C08L 4JG1H 4MMXC 4NQCB 5LJYH 4DCQB 3QEHA 5HHVH 5I73C 3VMNA 3EYOB 4JDZB 1E27B 5DI8A 3IT8D 3MFFA 1WFTA 1QBAA 2ED7A 1HH9B 4RNRA 4LLVB 1FSKC 3U82B 3RQ3A 1ZV5A 1JYVA 5TQ0H 4YHYC 4WFHD 1J0JA 5I76A 4YBLB 3ILQD 3MR9A 1S7RA 4K94H 5JNYA 1XZ0B 5DD3H 1NC2D 3V8OA 2D9CA 1TXKA 3PGDB 2BSSB 3CMOH 3Q5TA 4OCWH 2WWMD 1YEJH 5GGUB 5FF6B 4Z7WF 2GTZB 5F72S 1OTSC 1XF1A 1S7SB 4XRCA 3VFNB 5GZNC 3QUXA 1OSPL 2FX7H 2O5ZL 1XGUB 4NSKA 3VFTB 4JFED 2CD0A 4EI6A 1BF2A 2R0ZH 4F9PA 2FJHB 2C1PA 5KVGL 1A7OL 1MVUB 4U31A 4L9LB 3BP4B 1VFMA 4EN3B 2AJVL 4NO0D 3WDHA 1I1AA 1EXUB 1A4KB 1FVEB 3U2SA 1CL7I 5BQ7A 2LQRA 3EO9L 3VWKC 4XNMB 1OTUD 2FLBT 3Q6FA 1OAXH 3BMWA 3KJ4B 3QDAA 2J8HA 1JZ6A 1EJ6A 5C0EA 1N3NA 1CE1H 2F9BT 3MLWL 2CMRL 1EHXA 3KNBA 1RIHH 1X9QA 3DETD 2R2BB 2XN9A 2X4TA 5D1ZC 3ZMRA 3IDGA 3WJJA 2XY1A 1KJVB 3BDYL 2UYLB 1GPOL 3IU4L 5J12C 5E9DD 4OKDA 4M7LT 4HJGB 4NT6A 3BP5A 3G04B 1FZKA 2QJDA 4G6ML 1PBYA 2D7NA 1MAMH 5TDPA 5IV2A 3FQUB 1ZHLB 4ZUWA 3QNZB 3VXUD 4WUKL 1G7MB 3ZDYF 4AYFA 4HK0A 2FATH 3X13B 5IB5A 4PJGA 3IB4A 3MOQA 4JY6B 2CGRH 3WIHA 3MRKA 4I4WA 3VXSE 3WUWB 3PP3H 3INUL 3TN0C 2VIRA 1JHLL 5DRWA 3RZCD 5B8CB 2DLIA 4JGJA 1A7RL 4GG8A 3V0WL 2XACC 3HZYB 3S96A 3BPCB 5IFJA 5GHWH 3HMXA 5IGXH 2VTFA 3MV9A 4XWGL 2P5EE 4U1KB 3BUYB 4MQ7B 4O51A 3O8XC 4QLRA 4GMTL 4XXCA 5LAXA 3UDWC 1MCIA 1LO3H 4NQEE 3TCLA 5I19H 5D1XB 3RTQB 1QA9B 3RWCA 3V6FA 1U3HA 4EI5C 1EIBA 1DVFC 2HRPL 5CBAA 2PW2B 3Q3GA 2YD8A 4LIQE 3RNQA 1TTFA 3MROB 5TE4H 5EFIB 1WLHA 4P99A 1NDMA 1VESA 3OJDB 5C08A 1XH3B 3OPZL 5EZJA 3O2WL 5SV3A 3P9MA 2HFGL 4X8JA 5ICZA 5C0CB 1VADB 1R5IA 2H41A 4PRHA 5DURB 5HDLA 5TDOB 1Q9KB 1OW0C 4LCIL 3WS6A 2H6PB 3DRQA 1PSKL 1K5NB 2WLZA 5ID0A 4G8IB 2VQ1A 5BS0E 2FEDC 1RJLB 5H2BA 2W1NA 4I0PC 1I1RA 1CFQB 1J5OH 3FOMA 5C71A 1YMMD 3SE9L 5E5MA 4Y19E 4LHUB 2NW2B 4EUPA 4WI8A 4LVOB 1RZKC 5DEFA 2AJZB 5CZXD 3IRPX 3U7WH 4KXZH 5KJRL 5E2WL 2KDGA 3WSQH 2EYSA 4Y2OA 5MEPB 4TTGA 3UZQA 1MRFL 5EU6A 3FMGH 2MFNA 2E3VA 3VXRE 5GGQH 2QADC 3PIQB 4I5BA 2AEQL 5C0JA 2OXHA 4XNQB 4W4NA 1FNLA 4JVWA 2X70B 5DK0B 3DUUA 4LK4A 2BERA 3ETBF 2F8VA 1YECH 4N0UE 2UWEF 1PZ5B 2BVTA 3G5VB 3QCVH 3REVB 3ESVF 5E03A 2F54E 1FNGA 2ITDA 5T1KB 5LGKA 1AO7B 1I3RA 2ZUTA 1ZEAL 4HPYL 2AGJH 1G7LB 4L8SB 4L3EB 3QO1A 4PY7B 5MP6H 1HQ4A 4F7PA 5DVLA 4YR6B 4APQB 5IM7A 5HHQB 5FEBA 3VFUA 3F7YA 3B9KD 4LFHG 5FYJE 5FIEA 5IBLC 1UWGH 4FXGA 4NFBA 3VI4E 1T6VN 1QSEB 3BAEL 4YHIB 4EDXB 4S1RH 4LRIA 4R3SB 1KB5A 2JJSC 1JZ4A 3TA3A 4HIHB 4TPRH 3EJYC 2XQYG 4ALAL 5L7XH 1CFTB 5F88B 3PWPE 1P6FA 4FZ8H 1WV7T 3FB5A 3EYQD 1IGIH 5J11B 4I48A 4TVPL 1C7SA 2ADFL 3D85B 3QXDB 1ZT4B 2YPLD 2Y06H 1UH3A 4Y5VA 3BGFC 3GSRB 2YBRB 4KKBC 4TNVF 1WBYB 3S97C 2CR3A 5FKPA 1ZT1B 4D3CH 2X4RA 4XZUB 3S4SB 3JV4B 3QG7L 3WFCH 4PS4H 1KELH 3DWTA 3LKSB 5E7FA 5TE6L 3ROLB 1ZGLB 4FQPA 4PJ8A 1EMTL 4WHYH 1D6EA 2EDLA 3O4OC 2GJ6E 2IALB 2SEBB 2VUYA 4XX1G 5E4EC 4TN9A 1X5FA 1P4LA 4JFFD 3ARED 1U8LB 3BZFA 3EO0B 4WENB 3S37X 3HE6B 1CF8L 2P24A 4RGOL 3HC0B 2Z91B 4PRIA 3SDDA 3MRMA 3UP1A 1UADC 4N0CC 1TVHB 3ZZ1A 4PRAB 1BF8A 5CIPH 3D2UA 4RMQA 3BPOC 2JB6A 1MHEB 2H3NB 4U1MB 5D71L 4ZD3H 3PGCA 1CFBA 5D7IA 1OLLA 1NFDF 1HZHH 1YPZB 2DQCH 1IKNC 1RHFA 4JKPL 4O2EA 3QDME 3M07A 1AFVL 1DLFH 2XT1B 3U4AA 1QTYT 2P8MA 1H0DB 1KLUB 4H0GA 4BA8A 1LHZA 1S7VA 5JW4N 2XKNB 3FT4B 2W91A 1MNUL 1A7PL 4HDIA 5CEYA 2AS5M 1R3IH 1I4FB 4V2BA 1ZVSB 5MEND 2EIDA 3RDTB 3U36A 3HFML 3NCYP 5INCA 4AEIH 1H5BC 3L3JA 3HUJF 5CILL 3V5KB 4HIIA 3STBA 4Q9CA 4HW6A 4LBEA 5DJZB 4XVUC 1CGTA 4RGNB 4PJBB 1QD0A 5GJTH 2ARJB 3GO1L 5DI8B 2YD7A 2EZ0D 4HIJA 1XGQA 1N6QH 4GAJH 5GQBA 3MLYL 4P4KB 5E6IA 3X14A 4BQ6A 4K3JL 3PL6D 5GGSB 4EBQL 4HSQA 4WO4C 3OKLA 3QXAB 4XGZB 5I1IH 5FOBB 3CVHB 5HYJE 3CC5A 2E9BA 3TBSB 3JWNC 1A6PA 3BGMA 3EFFB 5T5FL 7CGTA 5C86A 1YEFL 1NDGA 5EOCJ 5F97E 1G7IA 3UJIL 4GS7C 5IVZA 4BZ1L 5FYKD 4OV5B 1KXTB 2CLRB 4PFEA 5CJQL 4BSVA 1J1PH 1OT2A 3LV3B 3M45A 5KVDL 2DM2A 2C3VB 3PABA 4FS0A 4H8WL 1FJ1B 4PG2A 4KZEH 4UAOB 2QSQA 1E4XI 2MCPH 2PXYA 3HAEG 4XP6H 3V52H 1A1OA 3H2WA 4WFED 4PP2B 1PG7L 4DZBA 4M1CC 3UTZB 3AS3A 3OF6D 1RUML 2N7AA 1CK0H 4GRLB 5HGBB 2YK1L 3VXTB 1UXWB 3T1WA 1IMHC 2DMCA 3QDJA 1EFXD 5KN5A 2C4XA 4XBPB 2CR6A 4XCFH 2VDPH 3VFRB 4DVRH 2J6EH 3D9AL 1GOFA 4IS6B 2VLLA 3VRIB 5T33L 4NWTL 2R9HC 4OFVA 3IDGB 5FUOL 3VFMA 3IFLH 2GTWA 1UCTA 4X5WA 3QR2A 1VKXA 4L4VD 1N59A 2L0DA 3RGVA 2ENYA 1CE6B 3STZA 2A74B 4MCZA 3BPNB 1N8ZA 1Z9OA 2FCBA 1TZHA 4YFDB 1KIRB 1NSNL 5E0QA 1VFAB 3ARWA 3MBEC 5CS7A 5SWQA 2XN9E 3MRNA 4X9FA 1QR1A 3RVXD 2VLME 4OSUL 4LVEA 3K2UL 4JZJA 4PRBB 3SE8L 3DXAB 3L3HB 4PJFB 4Q6IB 4U3CA 4PLKC 3WKML 5EBGA 4DZ8A 4MJ5B 5IFHL 1JCKA 3O11A 4RAUB 4Y1AA 1QO3A 3ALWA 1DEDA 2ZUQB 3KPRD 5IEHA 1XAUA 4PJGE 3MGOB 1PW3A 1BQLL 1KCKA 3VXOB 1CXKA 1ZGLM 2W0FB 4U7MA 3RPIB 4LIQH 4OCLC 5IKCA 3EJJX 4LAQL 3QA3B 3SJVD 1XCQB 4UDUA 1YQVL 1S7WB 2B1HH 4F9LA 3VI3E 1FVDA 3RY6C 4PUBL 5I18H 3KXFB 5I16A 1F00I 4KK8D 1G6RA 3MV9E 3MRJA 1NAMH 1BFVH 1A4JB 3DTXB 3P0VH 2DTML 4LLDB 5DHVB 2ICES 4PRNA 3VWJC 2NY4C 1H15B 1SMOA 2PTTA 4LARH 3PQYD 5I1DA 2XWJB 3S35H 4QOKB 4M93B 1IM9B 3PWNB 4CN6A 3ZLQC 3QSKB 3JBG7 4OJFL 3CFBB 2DQHL 1I3GL 4FQIL 4K71B 4WCYH 2FNBA 3IDMA 3QIBD 1OAKL 3IS1X 5HVWA 5C6TL 5ID0B 3O6LL 1YYLH 5EUOA 3OR7A 2XKUA 4KPHL 1CD9B 4WW2C 3KXFE 4J12A 2O26U 4UQ2A 5C08E 5FDWB 3LEVL 3FQTB 3LKPA 4Z7QF 4DKEL 4P2QB 1SYVB 1KJMA 3CVIH 4JJHA 3BQUB 5K9KA 2ICWB 5MERB 4A2LA 4PRHE 1GC1H 3WNPA 1T04B 1XGPB 1A3QA 4IDJH 3QI9B 4QRPA 5CJXC 4HXAL 2QV2A 3NIDE 3RX8A 4N1CA 3AS0A 1CICB 3J7HA 4QHUB 5SX5K 4QHMA 3P11H 3KS0H 4UIMA 2XFXB 3SGDI 2YXMA 2ID5A 5HYQA 1FGVL 1Y0LA 2NXZD 4QRTB 1ZA6B 2GFBA 4JE4B 4P57A 3FQWA 2HFFA 1CG9B 5T3ZD 1UH4A 1IEAB 4M61A 5IMMB 1QFHA 5GZND 1M05B 4JZNB 4P23B 3D69A 3QUYC 1CLOH 3BT2L 4YHOL 2F53A 3ZL4L 1CDUA 1LEIB 5EU6E 3IKKA 1V5JA 4ZFFB 4HKZA 4G80A 2CSPA 3WDJA 4U7KA 4DTGH 1T7XA 2X41A 5FYJH 5AYUL 4GLRH 3ULSA 1NLBH 5HHNB 1BP3B 3VXMD 1J0YA 1W72L 1RK0B 4MYWB 4RBPH 4QHKI 4MQTB 1HHIB 1OGAD 4RSVA 1CDBA 3VWKD 4PB0H 1EEZB 3T09A 3MUHL 1MI5D 1G7JA 4YHNA 3LB6C 5DA4A 4OBRA 4YDKL 4JO1H 2D7MA 4XP1H 4PRPB 1A6VH 1VSCA 1S7TA 4OLYH 4PREB 3MRCA 3GJFK 4XCEB 4IIQA 5D1ZD 4OGYL 4FFZH 1V7NH 2YRPA 1QSVA 2X4QA 4U6TA 3QIUC 2R1WA 1Z9SA 3FQNA 1NMBH 5DR5H 2CK0L 5A2FA 4WIQA 3OBAA 1JN6A 3RIFK 4JHAH 5I1LA 2W0PA 1ZE3C 1EAPB 1YEHH 4L1HA 4HX1A 1FPTH 2BRQA 2P8PB 2NY0D 5HYFA 2C3XA 3OB8A 3KDMB 4P3WA 3QDGA 5D7KD 4ODWA 3TN0D 2CLVB 1JHTB 3BH8B 3MBXL 2J4WL 4MJID 1KUMA 4GXVH 2BXZA 2EH8H 4RX4D 4K9EC 3RFZC 3BRFA 1WITA 3W0WA 3TYGL 3WBDA 4Q2ZB 1UCBL 3QEGL 2IBGA 1A6TB 3FO0H 1DQLH 3FRUB 3IS0X 4P5KB 1IGTB 1R5VA 5TFSH 2JB6B 4FZEL 2EC9T 3N1MC 1NBQA 5B39G 4QKXB 4PJAF 2PETA 1KN4L 3ARFD 4LLUA 5T1DL 2OL3B 4NFCA 1TFHA 4NZDA 2KBGA 1S5IL 2A83B 4JO3H 4LMQE 4X6CB 4PRIE 3DV4B 3NGBB 1JJUA 1NCNA 1KPUB 4EZMA 3H0TB 4JDVA 4NWUL 1B4JL 1ES0B 4G6KL 1OARH 3CDYA 2LAGB 2FBJL 4JQXA 2EDEA 1TCRB 1D6VL 1NMCB 1T5XA 5IMOB 1J1XL 5D7IE 1G0XA 3FN0H 5A2JH 2F15A 1X6LA 2VDNL 4IJ3C 3GMLA 3ARBA 4JM4L 4LSPL 2HJKA 4HIIB 1NGPH 3CDFA 5JDSB 4XHQA 2C7UA 2PYFB 3L3OB 3HAEH 4OZFB 2FEDD 3LKOB 1IZJA 3MJ9H 3SDXF 2VDOL 4DAGH 3F62A 2D31A 4POUB 3C2AH 1AKJD 3TESA 3TVMA 2UY6A 2I27N 3V79C 2WIIA 3DHJA 4ERSL 4AEHL 4O02L 2ZNWA 2Q7YB 3I3DA 4P3CH 1JGUL 1G84A 5IB4B 3C60B 4HKJB 4UIKH 1FAIH 2QADD 4QYOA 3DVNA 1DQTA 2HKHH 1JE6A 3RNKB 4QEGA 4HHAA 1WEJL 5HPMA 1BIHA 1Z6JT 4PJ9C 1NGQH 4HUXB 1ZVHA 2NNAB 4D0BA 3VA2C 1HXYA 2YD1A 3ZDZF 4Q74A 4NM4L 5HDQH 1SBSH 3LN4A 3O4LB 4JPVL 1F5WA 3LS5L 3NCFB 4JRXB 3U9PL 5CINL 3HE7A 1K3IA 3DMMB 2NY3D 4LGSB 4NJ9L 5DD1H 3NIFE 5F1KC 2KZWA 1AGDB 2DWDA 4RISL 1KJ2B 3OAZH 4QCIA 1MRDH 3UTSD 2IMMA 5KN5B 5FYLD 3WL9A 1RHHB 5CHNA 5C9JA 1BPVA 2V5RA 4TUOA 1TJHH 3EZ8A 4P2RD 4WEBL 1KBGL 4G3YL 1B0RA 3U0TB 4L8CB 5J06A 5TF1L 2Z8VC 4TSAH 4X5WB 4IRJB 4N8CH 1G7QA 5DHYA 5DJ8A 3LQZA 2XNAB 3RGVB 2Q1EA 5JO5B 4KKBD 4QHNB 3RHWK 1WF5A 3QDJE 4A6YA 3WIFB 5KBNC 5FYKL 3TBTA 4M43H 4PJXB 1BAFL 3QEQA 4OT1H 4P9HH 5DYOB 1MCFA 2IQAA 2I60L 4TYUA 3TEUA 5CWSA 1B2WH 1CDCA 3ARYA 5JQ6L 3KPTA 5FHBL 4QRQA 5C2BL 4ENEC 4F7CB 2PYEA 3DX6B 4O2CA 3HNVL 3HI6L 2DQGH 1KFAH 4I3RH 4LDLB 4LLWA 5T1MB 2PO6A 5IFAH 5FFLA 4F2MB 3WN5A 2Y7QA 4PJXE 4OF8A 2VE6B 3WIHH 1LO5A 2BHYA 4N0YH 1CCZA 1YJDC 1IZKA 1DJSA 1YEGH 1MIEH 3P4OA 2I9TB 4AZ8A 4MNGA 5KSAB 2D7TL 5I8EA 3MRDA 3HRZA 4L3CA 2BOCA 4TTDC 3GSOB 1QRND 2NY6D 2JE8A 5HVHB 4ZTOH 3ES6B 5EOQH 5AUMA 4XH2A 3KR3L 4Y1AE 2R0LH 2DMBA 3ZE2F 1PZUB 3EBAA 3EO1A 5EO0B 3HZVB 2B39A 3G6JB 4NRXB 4PTTA 4TUJA 2VJXA 4PP1D 5CKAA 4E41D 4KKLD 4HUUA 4XP9H 3EYVA 1BVLA 2R69L 3BH9A 3TO4A 3CSBA 3RVTD 4GSDH 4OM0L 3QJHA 3HB3D 3SKMA 5DFVC 4X6FB 2EIZB 1FZOB 4K07A 1T22A 5DO2D 3GMPA 3G6JE 3ABZA 2IH3A 4XVUD 1N6VA 1QFUL 4GO6B 3MV7A 2H1PH 4FQXB 2YPKB 4WWKC 3G08A 4KV5F 3KLHD 4RZCB 3V4VL 2DQIL 2YS4A 1EBPA 4DWHA 4J3TA 4Y88A 3KYNA 3M17B 3NACH 4KMTL 3SCMB 3X17A 5EUOE 3GIVA 1NGWA 4HBQA 4UTAH 4MXWL 4MXVE 1EHLH 1YDPA 3B43A 5EA0L 5IEKA 1JI2A 4Y16A 5I1JH 2DLEA 4EUPH 2VAAB 1SJVA 4XAKD 1WAAA 5FK9B 1PLGH 2UUDK 3O2DA 1IRAY 1LDPL 2WBJC 1BBJB 3PDOA 3D69B 3H8NA 5SWSB 3EGSB 1K3ZA 4FXLA 1I7TB 3O3BB 4RMRA 1ZOXA 1R24B 1KCRL 5L88L 1OLZA 5D6DA 4ZOCA 3R8QA 1I1FA 2AXFB 5GS0L 1QKZH 3TJEH 4X0KB 3QJFB 2VLRA 2AP2A 4KI5D 4BQ9A 2G75B 1MCLA 5IBTH 1Y18B 1Z3GH 5FUCE 1R0AL 4Y4KD 2QR0B 4M1CD 3QG6B 2FB4H 4XPGL 5IG7A 5LXGL 4YHLH 5FCUL 2F53E 4HS3B 5C70A 2D0FA 2I5YL 4LEXL 4XPFL 3SHSA 4I18B 4NN7C 2QTEA 2V7HB 3ZTJG 2NXYB 3I2CH 5IB3A 2R9HD 1U8IA 1A64A 3A6BH 4Z78B 2CRIA 3MLPA 1JNNH 1TPXB 3KPSB 2QSVA 2I24N 3JV0A 4XPTH 1KB5H 3CPLA 5K59E 1AI1L 3UROR 2K9UA 4NQVA 1JYXA 1Z0MA 2A73B 5C0RH 2ORBH 1C8PA 4XC1L 1A6UL 2IAND 4X9IA 4ODVL 2BY0A 2AEPH 1XGYL 1NCDH 1F90L 4ZXBC 3JWOH 3VJ6A 4QHLA 1RZ7L 3FHQA 4CGTA 3ZKMD 2G9HA 5F9OL 3GJFA 3NIGE 4KMLB 3MJ8A 2GJZA 1NC2A 5IOPA 3KPSE 4Q9QL 4ODTH 3U7YH 1BBDH 2Z0BA 3OJMB 4NDMB 4GAGL 3UEZA 2FRGP 4PLKD 5D2LA 1JVKA 2ICEA 2Q7NA 2CK2A 3VXNB 4Z0BL 4BSWB 2AJXL 4OQ1A 4NGHH 1R5VB 1AXIB 2DQEL 4JFQB 3RAJL 5DT1L 43C9A 1P1ZA 3NFPB 2ZCLL 4HT1L 3QDGE 3MCLH 4JN1H 3CAFA 4ZPTB 2B1AL 4RFNB 5D8JL 1S8DA 3OG4B 3ZKNC 4ELMA 4YHPA 1R5WB 1KCUL 4O58L 3W0WE 5DJDB 4OGXL 3RWHA 4MDJB 4CJ1A 1TLKA 2NY4D 1N2RB 3EYUL 2CDGB 5EB9A 2HLAA 5FA4B 3BE1L 3QUKB 5HGAB 2FO4A 5E9DA 1YMHA 3B5TA 4PBVC 4CVXA 5I9QB 1E6OL 2JELL 4P5TA 2BNQD 4M6MH 1JNHB 3HCVB 4BH7B 1KG0A 1NGYA 3K4AA 4M02A 2AJUH 4HCRA 3LRHA 3AROA 1I3UA 1KN2H 3BJ91 3V7AE 5J1TC 4X9BA 3OKYA 5DD5L 1I7UB 1LK2B 4KK6C 1BEYH 2JJWA 2P7TB 1X7QA 1E4KC 5HYSA 1JGDB 3FB8A 3LHPL 5D72L 4KTEL 5FA3A 1T0NA 4Y5YB 5EZIL 1UKQA 4YXKH 1XGRB 3QP3A 1WCBB 5GS3A 4MA7L 4KI5F 1IAIL 5ADOH 5D96B 2DKSA 2YUVA 5B38B 3FT3A 4QXWA 3FQRB 3V95A 4X6DB 5T3XE 3GRWL 1DTUA 4MAYA 1XF5A 1P7QD 2EDOA 3QUYD 5KVFH 5DQ9B 1T7VA 1DLHB 3GKZA 1HIML 4D0CA 5JHDD 1EGJA 4LKCB 3KPNA 4JKMA 4YGVA 2XQBL 3O6FC 3M1BB 2JIXB 2JJTC 3RL1A 3T0BA 1QSFB 1NJ9A 1T20B 5KS9A 2C1OA 3A67H 2AK1H 4RRPA 4Y0GA 4Q58C 3RWGA 5CLWA 5KG9B 3MLVL 2VR4A 1IGFH 3H42L 5EOCL 3DNKA 4OF0A 3T2NH 2Y07L 1S5HB 3NAAH 4BFEA 2BSRB 4O9HL 3J8F7 2DF3A 3MNVB 4ZFZB 4UUJA 2P45B 3QCTL 5C3TA 4CVZA 4JFOB 3CSGA 1AGFB 3QPXH 5I8CB 5CSBA 4LCYB 1OT1A 1QEWA 4X6EA 1YMMA 2DIAA 4QRSB 1YEEH 3K8MA 2IH1B 1CIDA 3PXJA 4U1HB 3FQXB 3ULUE 3QQ4A 3QIUD 4HC1L 3SKOB 1MF2H 4LOUD 3ISWA 4LPVA 3RVVC 3MOBL 5HY9A 2E8YA 4JFZL 3AS1A 1U92B 3MMEA 4HGKC 3F12B 1ZTXH 4RFEA 5KTEH 1KCVL 3B4NA 5HHPA 1AE6L 2F74B 3KS0J 4OLVL 4UDTA 3IXTA 1R3KB 3I3EA 4UNUA 4Z7VF 5D7LA 4WTXA 3CH1B 2HH0L 1AD0A 2PO6B 1ZA3B 2XWBB 4NM8H 2IAMA 3QEQE 4OCXH 1Q72L 1AXSA 2B7DT 5GGTA 2YRLA 5FYLL 5ID1A 3SGEI 3TGXA 3ZHKA 4F9PC 3MLZH 3BKCH 5D1QB 3PE9A 4R4FL 3MRDB 3QWOA 4OFKA 1DBJL 4LCWB 1BVKB 1TETL 2VXUH 4HH9A 4Z7WB 2CDEA 2EDWA 4J8RB 2CRZA 1IT9L 3RWIA 3WNLA 2HRLA 3CSYA 3AMLA 2ZOLB 3GI8L 4UBDD 5DRNA 4FFYL 5EUKB 5IQ7H 4WW2F 1JPSH 4TUJB 1MH5A 3GMNA 1HNFA 3WLBB 3WV0A 3ARDB 4MNGE 4KRNA 4KC3B 5IHUH 4LQ1A 3Q0HA 3WJJC 1DUYB 4NBYB 1P2CA 4U6YB 2WWKO 1MRCL 4MD5B 3WUWG 1A2YB 1G6RH 4XP4H 5GXBB 5I2IA 3NN8B 1KSRA 4KUZH 2R0KL 5JUEL 3VCLA 2X4UA 4HS8L 1E4JA 2IF7A 3H7BB 3I6GB 4ETQA 3W2DL 1P7KA 2XZZA 3X12A 2FL5A 3SBWA 4LCUB 3V4UL 2YD4A 4PJ7A 2AJSH 2B2XL 1XIWC 1JGVH 1JI1A 4KQ3L 4XVSH 2OJEA 5EO9B 1PQZA 2BVPB 3MRRA 4W6XB 3I3BA 2RFXA 4QGTA 4POZD 3AREA 4K8RH 3GI9L 4G7YL 3I75A 3ARRA 5F7WC 1A6AA 3Q1SH 3T0VA 3MV7E 3SDAB 4TUKL 4MA3A 3MUGA 1PG7W 5DEGB 5E8EA 4I0KA 2P5WA 2Q76B 3N1GC 2ESVD 1DL7H 1MCJA 4JR9H 2W65A 4ESKA 2J8UF 1FGNL 4FQ1H 1W0WB 4J3OC 4ONOA 4UV7L 2FYYB 1RMFH 2Z35A 4NNYA 2Q8AH 2FWOB 3RA7L 4D94A 3UC0L 4O5LL 1VEOA 4XCYA 1RUPH 2BY1A 4DGYL 1IC7H 1UB6A 3PWJA 4YFEA 1KPVB 4O2FB 2B4CC 4Y4FB 5F8QC 1IAOB 3TWCL 1MHHB 1WAAE 5IG7B 1FCGA 3BKYL 2WP3O 5HVGB 4KH2A 5E2UL 4NQSB 4LASL 1C08B 2LTQC 5D2NC 2GSGA 4MJ2A 5MEQB 4U7SA 1IKFH 4PLJC 1GHFH 2VLRE 5DMJB 2YWYA 3PWLA 1K2DB 4M6NH 4YQXL 4K23L 2EEAA 4H5SA 1A6ZA 1OF2A 4PV8A 3O45A 4NKOA 3F58L 2BY3A 1CYGA 4X4XA 3VFSB 1A5FH 4EVNA 1P9MC 3WD5L 3NFNB 1Z5LA 5BVJB 1EJOH 4PGDA 1QBBA 3TJHC 1I9EA 3P30H 4DN3L 3PL6A 1WC7B 1BJMA 3WFBH 5IMKB 3PWUA 2MPAL 5GRJL 4ZSOA 2AQ1A 1QFWH 1ACYH 3MJ8B 5H8DA 3F6LA 2AJYH 3E6FB 4Z76A 3KPLB 4YDJB 3VH8G 1YEIL 1TNMA 1GIGH 4ZUVB 4ISVB 4GUPA 4R0LA 5K33A 4Y2DA 1IVLA 3L7EB 2IBZX 2Z4QB 1SM3H 5ESQB 3L5IA 2FEEI 5HHVL 3CGTA 3BO8A 5AWNH 4JFXB 3D87B 3UXFA 4LLYB 3AAZB 4NHUB 4JFEB 5FO7B 3VFOB 2KPNA 5C8JA 5TQ0L 5SV4A 5E00B 5EULV 4ZO6A 3LEYH 3PJSA 1XGTA 3C5ZC 4NO0B 1KNOA 3GSXA 1S9WB 4K94L 3DX9B 2UWEB 3UYRH 5DD3L 2F19H 5D2LE 4ZUSB 3JTSB 3CMOL 3THMH 4OCWL 1HDMB 1HINL 1UJ3C 1YEJL 5E1AA 2LAAA 1RI8A 4LLMB 1OP9A 2B20A 3B5GA 5I1AA 3QPQD 4P2CG 2C9AA 4PY8J 2O93L 1HK6A 2FX7L 3S5LA 2D7OA 3UJJH 5IVXA 2HLAB 5I8OH 5CP3A 1XF3A 1AR1D 5ESVB 2EIEA 1MQ8A 1S7UB 3VXSD 1CLYH 4ELME 2R0ZL 3K4ZA 1T0PB 3V0VA 4L4VA 2PCPA 3GMMA 2W0KA 1MJJA 1RJYB 3MRBA 3DRTA 4AG4L 3VXUB 3EDDA 1SJHA 4P2OC 2QLVB 2ZKHH 3EAKA 2P5ED 4OIAA 1MCPH 4G9DA 1OAXL 4YGAB 3IETB 4CVUA 2N7BA 4YFLF 4NQED 5HYSB 2BVQB 2G2RA 1HILB 3FB8B 5E9DE 1RIHL 1VERA 3RZCB 4KZDH 3CDCA 1F11A 1QBLH 2J88H 3L5WB 1TJIH 3FFCD 1T3FB 5T3XH 3SDDC 3C6SA 1J10A 1WZMA 1MAML 2IPKB 5DTFB 2EC8A 1MAKA 4G8GA 4P59L 2HFTA 2ZNXA 4U2ZA 2X4PA 3A6CH 4WGVB 3FT2B 1WZLA 2VITB 2FATL 2K1MA 25C8H 4LKXB 4R90H 3OXRA 2LE9A 4D0CB 5HGHB 1LEGA 3AVEA 2FZ3A 3U0PA 2EIBA 1QACA 4LEOB 2QKIA 3K8KA 4EIZC 1X6NA 1SVCP 2XICA 3N1PC 4ZYKA 2NMSA 3BKJH 1T1ZA 1JHKH 8FABA 1P7HL 3ARQA 4K3EH 2XRAH 1ZLVK 2DRUA 2ZUYA 3NZ8B 1OPGH 2ATPA 1NFDB 5D7JD 5IQ9B 1DBMH 2J5LC 4LRNH 3NFSH 1Q94B 4F3FA 4NZTH 1T2QH 1LO3L 5AAWA 5I19L 4XBGB 5B3JE 2IPUK 5EIIB 1IGJA 3W81A 4DOHB 3VXRD 4IOSD 5KS9E 1BOYA 5DJAA 3U6RB 3MC0A 3ULUH 2NR6C 5L8LB 2ZJSH 4HUWB 4U1IB 1W72B 4GKZA 5LKNA 4JB9H 4MWFB 1DQJB 5F9JA 3G5XA 1PGRB 3BDBA 4R4BA 5HHPB 1OP3K 2BVYA 3HUJB 3OHXB 5KANG 1ETZB 4ZXBD 4RIRA 2P49B 3UZEA 1XF4A 2CUMA 1YMME 2BSTA 4A6YH 3BRDA 1R6VA 3O81A 2OK0H 2DKUA 4DVBA 5GISH 5DUPH 3ZKXB 1G9MC 4ODUB 5FYJD 4F7EA 1J5OL 1IFHH 4NHCL 5IW1B 3HPLA 2A6KB 5IEKB 1EEYA 1QPPA 2Q8BH 1K4DB 4BJLA 5BW7C 2UZIH 4L5FH 4PG2C 3RWDB 4GW5A 5DRXB 1V3KA 3U7WL 2PXYC 2V6HA 1RZGA 3PWPD 3K7UA 3WSQL 4HGWB 4QTIL 5D7LE 2FJFA 1YEDB 1C12A 1RQ5A 1RZJL 2I07B 3FMGL 2YEZB 3VFPA 1U93B 3B9KB 1RY7B 3S6CA 3ZE0E 1AP2A 3I02A 3ZKND 4YBQC 3MLUH 1KC5H 3CZFA 3VWKA 1YECL 2XTJC 4R7NA 4HMEA 4JM2F 3W9EB 3QCVL 5BRZD 4MA8H 3SGJA 1BREA 2EEBA 5BCAA 4LP4A 3UTTA 1J05B 2AGJL 1I9RH 3IFPA 5D1ZA 5IB1A 2YPLB 3ELAT 4LNRB 5MP6L 3F5WB 2GJ6D 3MYJA 3D18B 4HQQH 5GRWA 5K9OA 5ITFA 3D0VA 2ZSVA 3IAPA 4OLXH 3PHOB 2UZXB 1RZ8A 4PJCA 3EOBB 5J3HC 5EOTB 3GIZH 3MREA 4S1RL 2W9EH 4WUUD 3E8UH 4TPRL 4C4KT 5L7XL 4FQLH 4LF3B 1T1XB 3RU8H 4OZIA 2CIIB 4RAVA 5FV2A 4KK6D 3NCMA 3MRRB 1JWUA 4FZ8L 4J3SA 5EU4A 3TN0A 4FN0A 4NRYB 5E6YA 4B50A 1X5GA 5HHXH 3QNYB 5IWLA 4JFFB 3AREB 3WNNA 4CMHC 1KIPB 4ZPVB 4PJEA 1CZ8H 4PJDA 3VA6A 1AGEB 1EO5A 5E8DH 4LQFH 1AR2A 2XG4A 4JO4H 1U9KA 4BQ8A 4D3CL 4QGYA 1CFVH 3WFCL 3O8XA 2X05A 2DLHA 4PS4L 1KELL 2NW3A 1ZVYA 3UDWA 1R3LB 3H9YA 2HT3C 3BN3B 3CLFH 5I17A 2BZDA 4EI5A 5BXFB 4JHWH 4WDIB 1DVFA 1E28A 4H0HB 1AHWC 1GH7A 3OZ9L 1W0VB 3C9NB 4NO3B 3QWRD 1TVDA 2P5WE 3VXPB 1FZMA 4NUGH 5SX5H 4GRWE 3UZVB 3DO7A 3RI5K 1YNKH 1GOHA 4HIXH 4M1DH 3MLRL 5L2KB 1AH1A 5MENB 5HTSA 2M26A 1OW0A 1G1CA 4AMKH 5FB8A 1PD6A 5KW9L 4ZD3L 5HYJD 4NO2B 1U8OB 1BHGA 2CQVA 4R26H 5A16A 2PKDA 4KGJA 4JQIH 1HZHL 4BQCA 4I0PA 3ZE1E 3IXAB 2DQCL 3ZYIA 2V2WB 2QHRH 3VGGA 1TZGH 3CUPA 3UBXA 4M3KB 3IJYA 2XA3A 3LQAC 1DLFL 3VI4F 3VGHA 4U1JB 1K4CA 5J0BA 3CFCH 1A7BA 3VFGL 2V2TA 3QEUA 3EHBD 1A1NB 1R3IL 4WY7H 5E8NB 2GITA 2M1KA 1XF2B 3QUMA 4AEIL 1F45A 3FOLA 1JWSA 1SJEA 3WFDL 3QUXD 2IWGA 3WO4B 4KJWD 1N6UA 4J6RH 4AENA 1TQCC 3JWDH 4YUEH 5HGGS 1N6QL 4GAJL 3TIDA 4ZSOE 3P77A 2JK5B 2V5YA 4Z7QE 3L9RB 5M95B 3MJ6A 5DQJB 1AGBB 1BOGB 5EBLA 5I1IL 4L4TA 5CD3B 4ONFH 3I6KA 3MV8A 4OAWA 1U8HB 4HFUL 1WBXA 3G5ZA 5KAQF 2NTFA 5FGCE 2Z93A 5E99H 4PYHA 1TQBC 2FX8H 1EFXB 4HIEA 5TPWL 3O3EB 4XPBH 3UTSA 5EU5A 4ZO9A 1J86A 2IEPA 2JJSA 4MVBC 4OFYA 2XN9D 3QRFM 5FYKU 5ICXA 4U6VH 1LMKA 5GS1B 2VLMD 4Z7UA 4WFEE 1CGVA 1FFPA 4MAUH 4L4VB 2PCPB 2MCPL 3GB7B 4XP6L 3V52L 4MD4A 1IM3A 1I1YA 4QTHB 1JWMA 1CK0L 3BZEB 1VA9A 5JOPD 3LDBC 2WK2A 4F58H 3IGAB 4LL9A 2K7QA 2HVKA 3T77A 5IVXE 5HXMA 2W0LA 5CUSL 1LO4H 2HT2D 4DVRL 4XCFL 2VDPL 2J6EL 2V5TA 5GSVA 3T2QA 1A6WH 1IGYB 4WTZG 4L4VE 5LCVH 3CJJA 1IEBA 4HCRH 2FECI 4EEEA 2MSPA 4M7LH 3TBVB 3IFLL 1CL7H 3MV9D 2DQUH 3KPRB 1YY8A 5EU7C 3MZTA 4ETYA 3O6KH 2GYSA 5JOFB 3D3VA 4OLZH 4JPIA 2MHAA 1U3HD 3LEXA 1ULVA 3HC3L 1CD8A 3FO1B 4WHDA 3SJVB 1KV3A 1C1EH 3FB7B 2BX5A 1EO7A 1EAJA 1K8DB 3QQ9C 5KZCD 4OZFG 5F8RC 3CD4A 3MJ7A 1IKNA 5C08D 1TNNA 3KPRE 5DJCA 5ISZA 1BLNA 5IIEA 4G8GE 4JQXC 8FABB 3PQYB 4PTUA 4D2NA 3MRQA 3U30B 3FB6B 4E41A 3AU1B 1S9XA 4QXUH 4PJAB 1EGJH 2R2EB 3KYOA 5IW6B 1UXSB 3RUGA 2YUWA 1FFRA 3QIBB 1VFBA 1AIFB 4C83B 1LWRA 4LIQL 4LU5H 1JZ8A 1I9JH 2CKNA 5EBMB 1X5LA 1H5BA 1MFCH 3HN3A 2OLDA 2B1HL 1KLGA 2APBA 4HZLB 1JPGB 2XXMB 5ENWB 3WHE0 1HI6B 3CDGA 1I7ZB 1VEMA 3P4NB 3V5DB 1BFVL 1NAML 5DZNA 3P0VL 4FG6C 1A1MA 4PJAE 5JW4R 5J9PB 3IDXH 1FSKB 3CFDA 4LARL 3TJHD 4OQTA 3S35L 1BX2B 2A9ML 4R8WH 2H32A 3RX7A 1ZT7B 2OJZL 4XPHH 4NNPH 4WO4A 4WCYL 3SKUD 5HVFB 3SDXB 2NYYD 1KTKE 2NXZB 1U3ZA 2ZZUT 1MFBH 4DVBB 1FO0A 2H8PA 4Y4HC 1ZANH 4RDQG 3GSNA 2ATKB 1UWEH 5BZWA 2BK8A 1WCQA 4MMZC 1INQA 4IMLB 3CVIL 3ILPA 3OKKA 4LSTL 4NZRH 1J7VR 1EHNA 1MUJA 2AV7B 1GC1L 3QDHA 3KJ4C 5CEXA 4YDVB 4IDJL 4ONHA 2AABH 1U8JA 2WUBH 1J88A 3UO1H 3P11L 4S2SB 3C5ZD 3VXMB 4ZFOL 5GGTH 2W9LA 4NZUH 4PGEA 5T3ZE 1AQKL 3RWFB 3BSZH 1OGAB 1GAFH 1RUQH 5D5MA 2BNRA 4YHKL 1MI5B 5I0ZA 2NX5D 5KSVB 5DVMA 3TA3D 5CBEA 4U49A 5HHMD 2V17H 4KDVA 3BZDA 4KKCD 4LPXA 4GW4A 2FHBA 1J8HA 1KPRA 3K2MC 1CLOL 3N85H 4PJGF 1CFNA 4HFWA 5D6CA 4J1UB 5D1ZB 4YHMH 5DJYA 4DTGL 1BFOB 4M7ZB 5J12B 1UM5H 5IJVA 3RX5A 2GQHA 3MACH 3QZWB 5FYJL 4G8EA 4JFPB 3AXLA 1NLBL 3RVWD 1VEPA 1MWAA 4FOMA 1EVTC 3VI3F 1LO0L 3ZDZE 3EZJB 5BV7H 3X3FH 2HA1A 4CNIB 4PB0L 4P2OD 3QCUL 5ANMB 2NY0B 3MBEA 1T83C 3UTTE 2YPVL 1BZ9A 4PJ8D 3BIKB 4JO1L 5I74B 5CD5D 2FHCA 2BMKA 4XP1L 1A6VL 5D1XC 3RTQC 4OLYL 3DYOA 1G9NC 4MJIB 4WU7A 4FFZL 2ZOKA 1V7NL 5F6HI 4F7TA 4PRID 3U0WL 1PJ9A 1NMBL 2R1YB 3SDDD 3BW9B 5C0IB 2R4SH 5C09A 1CGSH 3OKEA 5ANME 1G0YR 3D2UD 1YZZA 1C5DB 3SE3A 4OZIE 4NYLB 3FL7A 1YEHL 3ARFB 1FPTL 1B0GB 1F4WL 5KVMC 4HKXA 1GCFA 3NIDF 4MQXD 3UX9B 4QNPE 1DFBH 4PJEE 2HP4A 1B6UA 3ARGC 4PJDE 1YUHB 1RAMA 3MA9H 3FONA 1INEH 4GRWH 5JW5A 4XNUL 2B8OT 2CO7B 5J1AB 3DJ9A 4MX7B 4GXVL 2EH8L 3VWJA 1X5YA 4C58B 2HKFH 1U8QA 1HHKA 4C56B 2CDFA 1A9EB 3NMEA 5FGSA 5C0DA 4ODXA 3FO0L 4LVOC 1DQLL 4PJHA 3T0XA 4GBXA 5TFSL 5DMIH 5ELIA 5GSRA 4LHQB 1QBMH 5I1EH 3NCYS 2UUDH 2BC4A 3TNNA 1CR9L 1BQHB 3EW3B 4Q0XH 5C2UB 4JO3L 2NR6D 5H37G 2VABA 2PR4H 1AKJB 4C57C 3OGCB 3UTQA 4F37K 1DBKH 3BZ4B 5E6ID 1OARL 3LOWA 3HG1B 3REWA 3SY0A 5L8JB 5JLZA 5CJXA 5EC2A 4ZQKA 3ALXA 2H9GB 5DF0A 2ZUVA 3FTGB 3FN0L 5DMKA 2VWEC 3MNWB 5E08H 4OZGA 3D39A 4Q7DA 1JFQH 2W9DH 4APQC 1JWSB 3IU3A 3BI9X 1NGPL 4MNQD 4QRRD 3EJZD 1CXEA 1BD2A 3MJ9L 1LE9B 1DQDH 4DAGL 1GGTA 2HAZA 3EOAA 3L5XH 5I75B 3C2AL 1FBIH 5T5NG 4UU9A 4BFIB 5MEOB 3BJLA 3U1SL 4FP8L 3SGKC 2OM5A 4GAYA 1A02N 4QT5B 1FC2D 3C6LB 2PXYD 3V6ZB 3R4DA 3FO2B 2Y5TA 1JBJA 1FRGH 5SWZA 2NY3B 5AZEH 4P3CL 2XQYK 3RL2B 3Q5OA 2JKXA 3UPCA 5J11C 4JY4B 1T21B 1FAIL 4UIKL 1M7IB 1CVSC 3OAYK 3QDJD 3DX7B 4RA0C 4GKNA 4LLQB 5D9SB 3L7FA 2XTJD 2ITCB 3BP6A 5IB2A 1NGQL 5F7YC 4P2RB 4JLRA 3WUZA 2HTLC 4U1GB 4L4TE 3KPMA 1JZ5A 1A3LH 5HDQL 1SBSL 5CJOH 1F97A 3MV8E 4ZDHB 5K9JL 4ODHH 3T0DA 1GZPA 4ONGH 4X98B 5TDNB 3BD3A 3OKNB 2OR9H 3MJGX 3LKRB 3QIUA 3UTSE 5FO9B 5DD1L 5HHOA 1QQDA 5CP3H 3HE6C 3HA0A 3UYPA 2AKRB 3MXWH 5J3HD 1IAKA 5GRVL 5DD6B 3MRFB 4Z7UE 5GSVB 2C4FT 1F6AA 5E8PB 5JPMA 1TJHL 1E4XH 4TSAL 5D7IF 1KYOK 3VRLE 1NCCH 2NY5C 3LAFA 2O5XH 2QQKH 4Y1AD 2ZP0T 2DM7A 1JGEB 5LQBL 3QIWA 3FCTA 3VGDA 1V05A 4M43L 4MSWA 4OT1L 4P9HL 2F5BL 1Q9LA 4JPIB 2BVOB 1B2WL 2RIKA 4YPGA 43CAA 1G6VK 2VZVA 3NA4A 4G6FD 1QRNB 1U36A 2NY6B 2Y9RT 3KYMA 4HS6B 4D8PB 2HWZH 4HWEH 1LGVA 1ZXQA 3RDTC 5HJ3B 3H9SA 3F7VB 1WTLA 3BYTA 1I8MA 1N64H 3RKDC 4M7KH 3WFZA 5DDHA 2DQGL 5CCKH 1KTRL 4I3RL 1HHHA 1U8MA 2EDFA 4H26B 2E7LC 5IFAL 4RGNC 5ETUA 1S9XB 3D3VE 2VZ3A 3WIHL 3IF1A 2XZQH 1KT2B 4HWZB 3T4YB 4WHTB 3GJEA 1YEGL 4G8FA 1MIEL 1U8NA 1QRNE 4U33A 4CUCA 1BWMA 4LPUA 4P4KC 1U95B 2JTDA 4P5TC 4H25A 5GGRA 4KHXH 1T0MB 1XCTB 5C0NC 3KPOB 5ESAB 3VDBA 1IEHA 3HMXL 1IAIM 5B38G 3DBXA 5ISZE 5FGRA 2IFFH 4ZTOL 5EOQL 2CRMA 4M6OH 2R0LL 2DQJH 4E41E 1M6OB 4K8RD 1JGLH 1D5IH 4QRPD 3NIFF 4G5ZH 4G43B 4AM0A 4FTVA 5CLTA 3RUGE 5F96H 4XP9L 4I3SH 5F7DB 2H32B 2NY2C 2Z31A 2AV1A 1JK8B 2BVUA 4LVNB 1NUNB 2AXGB 1FL3A 1NEZA 4XNZB 1ZLUK 1D5MA 3ARTA 5T1LD 4GSDL 3TBWA 1OD9A 5LWYL 2DWEA 2ADGB 3JV6B 3KPQB 4ZAKB 5CJ5A 2HLFC 4JPWH 1INQB 3MLTA 2BXYA 4GRLC 4X7EC 5DSCA 1YNLH 1KTDB 2R1XB 4PJ9A 3P0YH 2MWCA 2VQTA 2JF1A 3NACL 4NO5B 4OIBA 5CSZB 1U58A 2FJGB 3NH7H 3WCYA 4UTAL 1EHLL 4M62H 3BHBB 4Y4KB 1U91B 1OWWA 4XAKE 3ECBA 3HKFA 1MFAH 2A9NH 1BZ7A 3T8XA 1KCLA 5I1JL 4U1NB 4PGJA 5DUBA 2BP3A 1IQDB 12E8H 4YFLI 1E4WL 1PLGL 1QVOB 2MNUA 2O61B 3BPNC 3G5YA 1ORSA 1V8HA 5DJ6B 2IPTH 3QXUA 4MVBD 4IOIB 5EG6C 4E0RA 2VXVH 1T80A 3CFKB 3PUCA 4L8BA 4PLOB 5DHXB 1QKZL 3TJEL 1N5AB 2HJLA 1H8NA 2EECA 5CP7A 4OI8A 4EXKA 5D5ME 32C2B 2BNRE 4Q6IC 1Z3GL 2IPUG 3QB7C 5E6ZA 5DD0H 2IANB 3L3GB 1YNTB 5I6XB 4JKWA 2FB4L 5HI3C 2RB8A 1MCHA 1J8HE 1ZLSH 3NCEB 2ZUQC 4YHLL 1XR8B 4H1LA 4LCCA 4OZHA 4YO0A 4JY5H 5FDYA 1INDH 1JPFB 5I8KH 2VL4A 1XEDA 4OCYH 3W11C 4NC1E 1ONQB 3QDGD 3LN9A 3I2CL 3PXHA 2IAMC 3MO1B 1UVQA 2EYTA 1JNNL 2P48B 15C8H 2E6PA 3D25B 3C5SA 4P46B 3KLAA 4S1DD 2ZUUA 1KB5L 5F3BA 3AGVA 3L1OH 1IL1A 1MCQA 5C0RL 4WI5A 2NLJB 1ORQA 2AEPL 4K7PH 4Z7VB 2CRYA 3E2HB 1QHPA 3JTTA 3JWOL 4M93C 3MGTA 4OCMC 1LD9A 2Q6WB 4K71C 3GMQA 4KJQC 4CL7A 1D7FA 3T4AA 1OB1A 2R2HB 4ODTL 4IRSA 3CFJA 1F4AA 1BBDL 3K1KC 5EUOF 3U7YL 3QQ9D 4AH2B 4MXVF 3LKNA 2ARWA 1FIGH 1BQUA 4JRYA 5DWUH 4NQDA 2X7LB 4KJYB 4M03A 1PFCA 5C09E 3RWEA 4G9FA 4X7FC 5SX4I 5BV7C 5LGHH 4NQCD 1W2KT 2DYPD 3WS3A 3O9WA 3OKDB 1OSPH 1FFOA 3FRPG 4XCNB 1ZHKB 5I66A 4NZJA 3QI9C 2GY5A 3EDEA 4X7DC 4X80H 2A6DB 5IR1B 3ARBD 2QSCH 3C8KB 1UM6L 1CICC 3MCLL 4JN1L 3TO2A 2BNQB 4WW2B 1NFIB 4H88H 1NCWH 4XPAH 5BJTB 2Q86B 5TQ2H 5C92A 3W5NA 3ZT6A 1GJIA 3QO0A 3GSUA 1GGYA 4YIQA 4Z5RB 2IBZY 4P4RB 2MCG1 3X11B 1HEZB 2WLYA 4OM1H 4U1SA 4FG6D 4NKIL 4PJHE 4WWKA 4IHOB 4U6XB 5EC2B 4P23C 4UNVA 4HUVB 1UC6A 3B3IB 3GMOB 2EO1A 1FYTA 4KVCH 2D2OA 3L3IA 5EU3B 3QUZB 4FQHB 4JQVC 1S9YB 4PYGA 1I9IH 4OZGB 3V2AR 3V4PH 1X5AA 4G6JH 1FL6B 1QLRA 4UT7L 4JN2A 3N50A 2ERJB 4N1HB 4OB5H 1HHGA 3TYFA 2V7NA 1RZKH 4Y4HD 3OKMB 4YHZH 5CZKA 1TZIB 2AJUL 2QL1A 2D4DA 2VISA 5K59F 4CU6A 2WBJA 2EKSA 4WUKH 4Y5XB 3DUHA 1P7QB 3HZKA 2CIKB 2VAJA 3QUYB 4U1LB 4HPOH 4BKLA 1CN4A 4Z95H 4M1GH 4M3JA 5JHDB 3QUMH 3VE0A 2I9LB 1QPXA 1BEYL 1JV5A 4OZGE 2OBGA 3D39E 3OMZA 4OLWL 3SEPA 3HE7D 5EC1A 5I1KH 1JHLH 3NIGF 1Q1JH 1WZKA 5FM4A 4DJMA 4OZ4B 2CXKA 5C0AB 4YXKL 3DGGB 4L3AA 5ADOL 1D5BA 4N0FA 1CFSB 3U7AA 5GRUH 2J8UB 3T0EB 1K6QH 4AIZA 3KLDA 5JXEC 3P4MB 3LQMA 4GMTH 1DSFL 4J3UA 1A3RH 4OD2A 1SYSB 1DEEB 3UTPD 5KVFL 1NBZB 4EKXA 1J1OH 4GXUM 3SKNB 3EUUA 5H35A 1P69B 4TSBH 5A3ID 1GGCH 3MRHB 3A67L 2AK1L 4L29B 2NZ9C 3QEQD 1J18A 3GBLA 5J89A 4YXLL 4R9HA 3DURB 4GOSA 2HFGH 1F3JA 2X9XA 4ZS6C 3T2NL 2VNCA 3TBYB 3D0LA 4WI4A 3TZVB 1RIVH 1AD9A 1MLBB 2ADIA 2PYED 4X99A 1LE5A 4V1DA 1MLCB 3PNWA 5BMFH 2CLZA 2WUCH 2OSLA 1CXFA 4QXTB 4Y2DC 3QPXL 3RTQD 3DVGB 3WE6B 3M8OH 5KSBA 1L0XA 1NL0H 4BH8B 3E6HA 5HHOE 4LGRB 1YEEL 5GIRB 2JCCA 2NY1C 4NKDA 5TH2A 1HSBA 1MF2L 2KQMA 5CMAA 1FV1A 3NGBC 4HG4K 1PKQA 1Z9LA 2FSEA 5KTEL 1F58H 1ZTXL 3HR5B 1C16A 4R2GC 3KWWA 4RFOH 4ZOEA 3S7GA 1D9KB 5DURD 2MJWA 5CJBA 3RJQB 4WFGE 1MJUL 2BOBA 2E9JA 2W38A 3ARGD 4XMPH 3W39B 5DZOA 4UINH 4NM8L 5BRZA 4OCXL 5DVOA 4HZAA 2XPGA 1P4IL 3LSOB 1JF1A 4L8DA 4TRPH 4UILL 3TO4D 2DAVA 3MLZL 1ZEAH 2HN7B 2F58H 3QHZH 3RIAK 5IJKC 5DRZA 4DGVH 3H9SE 2VXUL 3GKWH 5C6PB 3RWJB 1NGXB 2JLLA 1LNUA 1U3JA 3CFEB 3I85A 2GSIB 1HOCA 3ORJA 5KVEH 3C60C 4K7PY 5ALBH 3GGWA 4CW1B 3MV7D 5EPMB 1TVBB 5F7FA 4OKVB 5JHLL 5IQ7L 3BAEH 1JPSL 4OLUL 4WUUA 4A2MA 1B3JA 5F3HB 5CIPB 5IHUL 4P5MB 1OAZH 5DJXA 3R06A 1E4KA 1N4XH 5EN2B 3EDJA 3DV6A 1G6RL 4XP4L 1ZLVH 4Z77A 5FO8A 2RQ8A 1ZSDB 4KUZL 2OZ4A 1RU9H 3U4EB 1EDQA 3DMMC 4APQD 3S36X 2GIYA 4OQTH 4FTVE 4J4PC 2ESVB 5DSCB 4PV9B 3IJHB 3ULUF 1UQSB 3GM8A 2EE6A 2E8ZA 4HKBA 4AT6A 3IDNA 2OXGA 3GNML 4W70A 4HWBA 1FO0H 2AJSL 3GBMH 3GSNH 4EQ3A 1RK1B 4Y7MA 4XVSL 2XXCB 3BP7B 3O6FA 2JJTA 5FECA 4IRJC 4K3DH 3FFDA 5ERWA 3VFWB 1OP3H 3L3KB 2GY7B 4NIKB 2VLKA 4K8RL 4ORGA 4MXQD 3TNMB 3HAEA 2LV4A 3I50H 4CVWA 1MCSA 1OGTA 3HPJA 4XXDB 1RZIB 1JPTH 1ORSB 4OUUB 1BECA 1X5ZA 1S7QA 1DL7L 4E0RB 4JR9L 1U3YA 5ACZB 1NCBH 3VW3H 4FQ1L 3QFDB 1M7DB 3TP4A 1RMFL 2HTLD 4LNVA 5CAYB 5LGJA 2Q8AL 5DLMH 3MRPB 4FFWD 5LBSH 2E7BA 1RUPL 1IC7L 4HLZH 4PR5B 1DQQB 1NEZG 2Z92A 5AD0A 2MOVA 1AFVH 1EH9A 2VDLH 2HMIC 1GGUA 2OQJA 3HE6D 1WWCA 3O3DB 4YO0B 5E8OA 4F15B 3AB0B 3FO9B 1C7TA 2X09A 1UM4H 3S88H 5F6IB 3BEWA 3BWAB 5F7KC 5IMLA 1MNUH 1IKFL 1A7PH 1GHFL 5E94B 4XHJD 3VD3A 4F33A 5KSAC 1MWAH 1K85A 1JUFA 4M6NL 4U0RB 2FD6H 3EOTL 2EYRA 5FGBC 5EO1A 1HSAA 4MD0B 5HVHC 3WHXB 3P4LA 4WJ5B 4EIGB 4JRWA 1A5FL 1SY6A 4KGLA 2BNUA 3GHBL 4OZHE 4P3DB 2L7JA 1EJOL 4K7FB 3TV3H 3MLYH 4N9GB 3P30L 3WFBL 4WW1B 4XVTH 5L2JA 3GRWA 3W9DB 1FLRH 1QFWL 1ACYL 2W59A