2VW7A

Nitrite reductase from alcaligenes xylosoxidans - 1 of 3
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
335
structure length
335
Chain Sequence
DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title On-Line Optical and X-Ray Spectroscopies with Crystallography: An Integrated Approach for Determining Metalloprotein Structures in Functionally Well Defined States.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Oxidoreductase
total genus 92
structure length 335
sequence length 335
chains with identical sequence B
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2008-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2vw7A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2vw7A02
1ZPUA 1AANA 2QDWA 1GY1A 1WAEA 4PCYA 2OCCB 4F2EA 2DWSA 2YAOA 3ABKB 3NJJA 3S8FB 1GS6X 1AS6A 1CC3A 1E67A 1CYWA 4YSSA 2XYBA 5D4HA 4NB7A 5B7FA 2Q5BA 3SQRA 1ET8A 2IDQA 3WG7B 1XB3A 3FQYA 4E9YA 8PAZA 2R7EB 2UXTA 1ILUA 1XMEB 2AANA 1IUZA 1BAWA 1SF3A 3FU9A 5I6MA 1NDTA 2J55A 2PCFA 2OV0A 3FT0A 1L9OA 3IN2A 5I5IA 4KO9A 2JKWA 1PMYA 3IN0A 3X1FA 2FQGA 4A2FA 1SF5A 4RH4A 4BWUA 3CVBA 1AIZA 1OCOB 1IC0A 2VSKB 4FA7B 3D12B 1J9SA 2GI0A 2IWKA 1NWOA 4KNUA 3NYKA 2BP8A 4P5RA 2IDFA 2XX0A 3NJMA 2VW7A 1PNDA 1KDJA 1MDAA 2I7OA 3FPYA 3QJUB 4HIPA 2GHZA 3OMAB 4M3HA 4YSOA 1AAJA 1MG3C 3WI9A 4YSCA 1RZQA 3ABMB 1AZCA 1OOWA 9PCYA 3GXUB 1F56A 2ZOOA 2TSBA 1BXUA 1J9QA 1FFTB 2DY2A 2UXGA 2H5UA 1NIFA 5AZUA 1W8EA 4A2DA 2QDVA 1PZCA 4G70B 2I85A 3X1BA 3SBRA 3OMNB 4DP8X 4AKOA 4JHVA 1OE2A 3G5WA 2EIMB 2ZXWB 4F7KA 2CALA 4N8UA 5F7BA 1JZFA 1JVOA 1A4AA 1NTDA 1BQRA 4PAZA 4CSZA 3UAEA 3BVDB 2VW6A 1W6WA 2OJ1A 2BWIA 2IDSA 2Q9OA 4A2GA 4A67A 1PLAA 2YAMA 4WTQA 1HAUA 3BQVA 3FU8A 1AG6A 5ANHA 1SNRA 4K9JA 2UXVA 4GP5B 4A2HA 3EH5B 4N4YB 1ASPA 2FQEA 5B1JC 2XVBA 4YVNA 4E9QA 4JHUA 4YSUA 2R7EA 2XV3A 4UAHA 4DPAX 2N0MA 1AS8A 4G71B 3MX0B 3WIAA 1R1CA 3UGEA 2GC7C 3UADA 1OE1A 1JZHA 4HCFA 2HXAA 1TEFA 1FA4A 1KGYE 1GS8A 1N70A 2YXWA 4EF3A 1SDDB 3S3DB 3ERXA 4HCIA 1A4BA 1GW0A 4BWWA 5I5JA 3T6WA 1JZIA 2HZHA 1GYCA 1OCCB 2IH8A 3PAVA 1JZEA 4DP0X 3KW8A 2VW4A 1E30A 1KBWA 4HHWA 4BWTA 2FNWA 1BQ5A 3V9EA 1BYPA 3CG8A 2DV6A 1NIDA 2E86A 3WKPA 2FJSA 1WA1X 2PPCA 3AG4B 1PZBA 3JTBA 1ASOA 1PF3A 1KYAA 3CDZB 2J5WA 4AI7A 2VN3A 2YXVA 5I5MA 2BHFA 5A7EA 5B3SB 1CUOA 3S3CB 4AKPA 4YSQA 4QKTA 1J9RA 4DP1X 2DYSB 2BW5A 1TKWA 5LDUA 1AS7A 1ADWA 1DZ0A 3FSVA 3ABGA 3V9CA 2YAEA 3AG2B 1L9QA 1QNIA 2GIMA 4G7RB 3ZDWA 3TASA 4DP5X 3T6ZA 1BEXA 2XLLA 1AZBA 2IDUA 3DTUB 3X1EA 3TA4D 2FT7A 4BXSV 1J5DA 1FWXA 4GY4A 1T5KA 2Y69B 3X1GA 4UANA 1M56B 2PCYA 2H3XC 5F7AA 1VLXA 5B1AB 1PCSA 1SFDA 1JXFA 1GR7A 4NAJA 3OMIB 1JXGA 4E9SA 1BXAA 2XUWA 2PPFA 1KV7A 1JOIA 5PAZA 4E9TA 2NRDA 1XB8A 4GP4B 1WS7A 1SHXA 3FYIB 1E5YA 3GDCA 2ZWNA 3QJRB 3WNJA 3CVCA 1N68A 3FU7B 2VSMB 5TK4A 3NJGA 5D4JA 2HLEB 3KW7A 5D4IA 1JZGA 3AZUA 2TSAA 1EHKB 2CCWA 1KCWA 2GB2A 4Q89A 3NP3A 4KO5A 4W1TA 4W9ZA 3QJSB 4HAKA 4YSTA 5E9NA 1L9SA 3QJQB 3OM3B 1MZZA 1AZUA 5B1JA 2AVFA 4KNSA 3H4FA 3T9WA 4YSDA 2BZ7A 1AZNA 4E9XA 1RKRA 2UX6A 1L9PA 6PAZA 4HALA 2DWTA 2WO2B 3CZUB 2VMJA 3L45A 3NJNA 1V54B 1ETJA 3IBOA 1BXVA 2EIJB 2FT8A 4BXVA 1NIBA 3NSCA 2FT6A 2HRHA 1ZIBA 1NINA 2EILB 1JZJA 5I6LA 1BYOA 2YAPA 4CSPA 2PPEA 2BWDA 5I28A 3NT0A 2H47C 1WA2X 2YAHA 3CDZA 4KNTA 3WNIA 1NIEA 1ASQA 2FWLB 3MBWB 2XV2A 4KOCA 1ZDSA 2J57A 2PPAA 1PZAA 3T6XA 4G72B 1SFHA 5AFAA 1ET5A 1KDIA 2IWFA 4DP7X 2HX9A 3NSFA 2X88A 4KOBA 6PCYA 1PLCA 2XX1A 2BO0A 1HAWA 3IE9A 3T6VA 3U25A 4AKQA 3QQXA 2JXMA 2BP0B 3IEAA 2CBPA 4GXFA 1OCRB 3ZBMA 1NWPA 3NJKA 4KO7A 3NJFA 2MRYA 4YSEA 2VM4A 4G7QB 1QHQA 1E5ZA 2QPDB 3H4HA 4P5SA 5I6OA 4GP8B 2HX7A 1A4CA 2VM3A 1A3ZA 4YSRA 3FU7A 5B7EA 2UX7A 1V55B 2CAKA 1URIA 3JT2A 2XXFA 2IDTA 1M9WA 3HEIB 4A2EA 2IAAC 4ENZA 3S3BB 4Q8BA 3TBBA 2XWZA 1ET7A 3EH4B 3SBPA 3ZIYA 1AACA 2XXGA 3AG1B 2DYRB 1KCBA 1AR1B 3UABA 3FQ1A 5TK2A 3EH3B 1RCYA 2A3TA 2FTAA 3TBCA 1PAZA 1AG0A 2J56A 1X9RA 4X4KA 2W8CA 3DKHA 3X1NA 2I7SA 4HHGA 3N2JA 2YQBA 1PY0A 4HZ1A 1JXDA 1MZYA 7PCYA 3FSZA 1GY2A 3HB3B 1IBZA 2BZCA 2GSMB 2MTAA 2YARA 1ILSA 1EZLA 2Y1AA 5EHFA 2W88A 4HCGA 1QLEB 1JERA 3OD3A 2PLTA 1IBYA 2EINB 4BDVB 3QPKA 2AZAA 1ZIAA 1TU2A 2YAQA 1E65A 2JFCA 5IY5B 1A8ZA 3QJTB 1GS7A 1NIAA 1J9TA 4DPCX 2XV0A 1X9UA 1AQ8A 4ZK8A 1L9RA 3EF4A 1XB6A 4GYBA 5B1KA 2IH9A 3GYRA 1WS8A 3TU6A 3NP4A 5I26A 5I6KA 2QPEB 2QT6A 2PP8A 5B1BB 3ASNB 1I53A 1BQKA 4A66A 4E9RA 5PCYA 3AG3B 2WSDA 2BW4A 1GSKA 3FQ2A 1PNCA 1W6LA 2FQFA 1ZV2A 4BK5C 1WA0X 5I6PA 3AY2A 3ASOB 1SDDA 3SBQA 3NJIA 1B3IA 1OV8A 2BP0A 4DP9X 1J5CA 3C75A 4KO6A 2CUAA 1KBVA 4FAAB 5FC9A 4E9WA 1ID2A 4QLWA 1AOZA 3FSWA 4M4RB 1JVLA 2X87A 3AW5A 2UXFA 1OCZB 3FPXA 4YL4A 2AFNA 4AZUA 1CYXA 3PPSA 4DP4X 4MFHA 3PAZA 1OE3A 1UATA 2WO3B 3WKQA 4DP6X 2EIKB 3OQRA 4AX3A 1HFUA 2GBAA 2AZUA 1RZPA 3FSAA 3S8GB 4A68A 4NERA 3DIVA 3H56A 5I6NA 1DYZA 1V10A 2B3IA 1MG2C 2P80A 1SHWA 4UF7C 4YSPA 3RYMA 4JKNA 3NSDA 2BP8B 2PP9A 3NSYA 3FS9A 4DPBX 1NZRA 4YVUA 2RACA 1ZDQA 3QJVB 3EHBB 3ZX1A 4F2FA 2FQDA 2XU9A 3UACA 4G7SB 4L0PB 2CJ3A 4WKXA 1L9TA 3CVDA 5B7MA 4TXVB 2YAFA 2P80D 1YLBB 1NPJA 2LLNA 3PCYA 3T71A 1IKOP 5AKRA 3N55A 3NJLA 2PP7A 3PAUA 1AZRA 3FYEB 2HRGA 3ABLB 3PXLA 4YSAA 2B08A 7PAZA 4DP2X 4BDVA 1SJMA 1NPNA 3PLYA 3UAAA 2HX8A 2ZONA 1NICA 1TEGA 1PLBA 2PPDA 2GC4C 2IWEA 1M57B 1A65A 3X2QB 3NJHA 1CURA 1OF0A 4E9VA
chains in the Genus database with same CATH superfamily
4LLVB 3FN9A 1HOCB 3L5HA 4GRLC 5C8JB 2ZOKA 4FQPA 4X5XB 3V4PH 3TCLB 4U1MA 2HLAA 2H9GB 1HJCA 2R2CA 3A4EA 3PS6A 4HW6A 4QXWA 3TFBA 2BRRL 4X98B 3D06A 4E42A 1NEUA 4IK7A 3VXSA 3W11D 4EN3A 1KOAA 1FZJA 4JJHA 1CC3A 1GOFA 5AW1B 4YSSA 2A73B 4LLWB 3F83A 2A74C 1T20B 2Y5QA 3JZYA 2FUTA 1U3YA 4BSWB 1RL1A 1BLNA 4X0KA 4GG8B 1QUPA 5AZEH 1DLFL 2IIJA 2O4EA 3TZVD 1S7RA 2LVEA 3FUFA 4OIFA 3IKCA 2ADFH 3MGOA 4UM8A 2X2UA 3M1CA 2VO8A 4Y7OC 5EOTB 5FYLL 1D5ZA 1G4MA 1L9OA 2NMSA 3T4YA 1RPUA 3IYLW 2XTJC 2JKWA 4Y1SA 3L95A 1Q0YH 5IFJB 2AHIA 1IEAA 1C12A 2XYCA 1D6VH 1NUNB 4NQDA 4CSTA 1IKFH 1CE6B 2I5YH 4UU9A 3PP3H 2AITA 2GI0A 4JFQA 1PKQB 4L4TA 4X9GA 1F58L 1XGYL 4YHLL 2B3RA 3D50A 2ZF9A 5IJCC 3TEUA 3DHJA 5FGCB 1AFVL 3DYOA 4YHOH 1U33A 5JHLA 2W95A 5CZXC 3HZVB 3IE4A 4I87A 5IFHH 3CIQA 4JANA 1BFSA 2E5EA 3CFCH 1WICA 2UZIL 3OQ3B 4TVPH 4NKQB 1PYWB 1W8OA 5EFIB 1P4UA 1XGRA 5ID0A 3QORB 5IEKB 5C0DB 3MACL 4NI6A 2EEDA 4ZZKA 2D0GA 3BIKA 5DJ2B 4U3HA 4NXSA 3TFKC 4NO3A 4BELD 1CBJA 4U1HB 1TQWA 3DPBB 3L5XH 1H0DB 1KLGA 1SYVA 4OF0A 3VGAC 3O11A 1KFGA 1XGTB 2FX9L 4PRNB 2VH5H 2WJ5A 2CIIB 4F7MB 1OTTC 2EEAA 4G70B 1ADQH 4MYPA 3BPNB 4G2AA 2HAZA 4ZJ9A 4LB8A 2H8PB 3PRZA 1HHJA 1H8SA 1Q9LA 4GKZA 3ZW3A 1T0MB 1WAAE 4JN2A 1TJIH 2G3NA 3FTYA 4TS6A 3PJNA 5F7BA 2GABA 3KM2A 1BWWA 4WWNA 3AVEA 2LW3A 3U6XA 3L3GB 4MD4A 1GPOH 2ZKHL 2HKFH 4FD0A 1KCVL 4MX7B 3D0AA 1HXYA 1MFNA 1KN2H 4GS7C 3PWUA 1TTBA 3DK0A 2SODB 4XO5A 4X6FB 1HEZA 3TT1H 2EDBA 4OUOA 3TH3T 7TAAA 3GGWA 3MROA 2BP5M 4UBDC 4U1NA 3FU8A 4ZUTB 1KBGH 2R2EA 1QI4A 2YOAA 4GPVA 4U1SA 1P9MA 2AEIT 2C9XA 4HZLB 2EEFA 1EXGA 2RQ8A 1NSNH 2OMNA 4EQ3A 3MLYH 3DIFA 3ETBJ 5E2WH 4MASA 1AHWC 4UAHA 5E2VH 1MFAL 4JL2A 3JV0A 5H35A 2B1OA 4ORZC 5KZCB 7CGTA 4JB9L 1CU4L 2GK0A 4R4BB 5D8JH 3N6YA 2R0LL 3HZKA 1I1RA 3AM8C 1F4YL 2WLJA 5EB9A 4CNIA 1IC5L 5D9SB 4JFFD 1XAUA 4GI6A 1CFNA 5I5JA 3G5ZA 2ADJB 4OTXH 3LPOA 4AQ1B 3MRLA 5IB4A 4ZAKC 4U3SA 1XX9C 3QZWG 3SPVB 4X99A 4KTEH 2W9DH 3O3BB 4IRSA 4PREB 4WWOA 3VXPB 4J6RH 3QB7C 3GLZA 4TNEA 4JY4A 4A04A 3TVMC 3OKOB 3PREA 4G1MB 5C08A 3SD2A 3EKCA 2K4WA 4HZAA 1T1ZB 2WW8A 4HKJA 3DHUA 1P7KA 5L4IA 4WW2C 3LRMA 1KJ2A 2X53A 3NRPA 4FFYA 3SGJC 2NNAB 4BHUI 5AYQA 1F41A 4ZUWA 3C60B 3IFPB 3SDDC 4LP8A 5HBBA 5JHAA 2CO3A 5FEBA 1E27A 2NXZB 2DQEL 3I02B 3GSVB 4OJFL 1ED3B 4W6XB 4ATTA 2GIMA 4KU1A 4OCYL 4XZ4A 2RMNA 4O51B 5DVMA 2UWEF 5E8PA 4OGQC 2AQPA 1Q1JL 2FECL 1I8MB 2JMRA 1XDTT 1OAUL 1J8RA 2Z34A 4AENB 2PMZA 5EEUA 3O8XC 4YS4A 3OZLA 2CE6A 2ITFA 4NUJB 1BEYL 1FSKC 3ES6A 1MNUL 5BS0D 2DQHL 1WFMA 2XN9E 4YDIH 1A1NB 3WEMA 3WYRA 4AIEA 2QQNH 1WS7A 4FXLA 4ODTL 5H4YA 2IXQB 1RUKH 3HMXL 2ICWI 3JV4B 2ZOLA 4LPYA 2P5PA 5JMRA 4AE0A 1MWAL 4OLWL 4PG2A 3EJSA 4OGXH 3TBYB 3MOBH 1EHKB 1U91A 5KVGE 3RIAK 4W1TA 3PWPB 3BE1L 4HJ1A 3NGBB 4UWQB 5D1ZA 2IADB 3FOMB 5DEGB 3EYVB 1MZZA 3O6FB 3R0MA 4MSWA 3SKNB 5IB2B 3MKGA 1KY7A 1CI3M 1YEGL 1M05B 3PWNB 4U6HA 4FYRA 1R3LB 2YKLH 3IXAA 7FABL 4PGDA 1WCBA 4IGBB 4HALA 2DIJA 1P7QD 3STBA 1ETJA 1DVSA 2OMXA 3NCBB 1MCNA 2FBJH 3ENEA 1AIFA 4JO5A 3REVA 5AUMA 1MJ8H 3DJ9A 1YPZE 3FHAA 4J8RB 3X3FH 2EILB 1JZJA 3UYRH 3E6HA 3K4ZA 3QNFA 1I4FA 3T8MA 3G6JB 5J12B 1HT6A 1OCWL 3MUGA 1KTCA 1CGSL 4Z95L 4NQTA 4Y0GA 5KAQF 3GINA 3O3AA 2XWDA 3KPMB 4L2LA 2H47C 3LVTA 1JYVA 3TIDA 2H32B 5I2IB 3MBWB 3IMVA 4JRXB 1JYNA 1NKRA 2FGZA 2R51A 3BW9A 2EH8H 3SN6N 2EYSA 5E1AB 5EU6D 1YY9D 3CU7A 4BV1A 1EEYA 1P6WA 2HX9A 3S88H 4FMKA 1KJVA 2P48B 4KOBA 1XZ0A 1NA8A 1TJHL 1X5AA 3VDCA 3CGTA 1ROWA 1I3RA 5TFSL 3ZR5A 1OXYA 5HYSA 1FRGL 2C1OA 4HT1H 5DCCA 3VCLB 5B1CA 3T04D 5GSVA 2AJZB 1OCRB 2N3JA 5G4NA 2XQYA 3D0LB 3NJFA 4HWUA 4QI3A 5EOCJ 5IM7B 1MUJA 1C5BL 3SSGA 2GJ6B 3DARA 3K6NA 3LN4B 3PQYB 1BMWA 3S97C 4LQ1A 1MCPL 1YZZA 5JIQA 2EECA 3ZL4L 3TNMB 2DDQL 3L1FA 4PV8A 3GHBH 1AJ7H 1AMXA 3FB7A 5IHZB 5H37H 1DUZA 4YE4H 1XGPA 2ZYHA 2FWSA 1UZ8B 4YWGH 5F3BB 2APTA 4AJYV 5D2NA 1X5IA 3MRPB 4UIKH 3DX7A 5EBWA 4FI7A 2X1XR 3BPCB 5TDOA 3VXOB 5J06A 2A3TA 1U58A 5DJZA 1EHAA 2ETWA 2A1WL 2A9DA 3CLEL 4TF4A 3R18A 4K3HA 3HE7D 1J8HD 3T2NH 5I1JH 1USQA 2AMUA 5I1AB 2AF2A 4DFIA 2PF6A 1UWGL 3ECBB 3CK0L 4ZUSA 2GSIB 1RMFH 3EJCA 4H1LH 1EHNA 2P8MA 1GZPA 1DN0A 1BZ8A 4V1DB 1CMOA 1MFBL 2D7TH 2BJMH 4KJQD 4NRXA 5KSBE 3W11C 1QBBA 5BMFL 3VWJB 4K3DL 3UC0L 3HS0A 3VXUA 5L9DL 2EYTB 1T7ZA 1JERA 3MFFB 3QUZB 4P59L 4U4BA 2PR4L 5IW1B 1PEWA 1W0VB 2X6UA 5GGUA 4NIKB 1E65A 3LNGA 4MA8L 4P5TD 4XHQA 4AOFA 4TPRH 3R8BB 4L9LA 3TZVC 5CUSL 3LAFA 4BZ2A 2C9VA 4ZK8A 3ARDA 5E2TH 5FKAA 1C5CH 2IEPA 3FSOA 4GOSA 1JV5B 2PP8A 1TYRA 5GGVL 3U9PH 4PH8A 2Z7UA 4L5FE 4NQCD 4JGMA 4F27A 1PNCA 1CK0L 3AQYA 4HPYL 2WZ0A 3J07A 2F9BT 1JRHL 5DU7A 3ZRFC 1ZEAH 1UT2A 5D70L 4AEHL 2V5TA 4ZXBD 4UILH 2CLVB 2OMVB 2H1LM 3MBXH 4KO6A 1J5CA 4IU3A 3DBSA 5F89B 4DW2H 3Q2CA 4GLRI 3OB0H 4LCCA 5E9DA 4AMWA 5T1KA 4OFKA 2NR6A 4NBYB 1U8KA 5FHBL 4FFVD 3C8HA 4HU2A 5F7DA 4PLKD 3AS1A 4M7KL 5LAPA 5HGHB 4A38A 2MHAA 3B5TA 4OVUA 5SX5K 3SB3A 4EDWH 2XPGA 1UATA 1PU0A 2FECI 2V3DA 5G4OA 5SWZA 4ZMTA 3GUTB 1MH5A 3L6FB 12E8H 1UACL 2IJ0C 3ISYA 1A7PH 3L16A 4I9WD 4CRPA 2JTDA 1UXWA 1WWBX 2B3IA 1KPVB 2H6PA 3HG5A 1LILA 1GKEA 1SHWA 3KPRA 4YSPA 5DO2D 3I75A 2H0EA 2DQJH 4O9HH 8FABB 3RZCA 2YBGA 4ZS6D 1F00I 2XKNB 3GMRB 3HE6A 2J4WH 1VDGA 1HL5A 4RCAA 3ZO9A 5FDWA 5DVPA 3AT9A 4F2FA 3SIKA 1DVFB 1FHGA 4B3VA 5DFTA 4UQ3A 3LRLA 5MHSD 5DFWH 4OSUL 3MLSH 5JQ6L 3GB7A 1P5UC 1VB9A 2DQUH 2L0DA 5FO2A 5C9KA 3FN0H 1KC5L 4GRWH 5D1XA 3T3PF 3CBKB 1R34A 5D7IA 4FQ2H 4A63A 2GAZB 3MGTA 3MZTA 5JA9A 2JKRM 1SY6A 3KPOB 1ZTXE 1NBVL 3KH3A 4MB4A 4DVRH 2NX5D 1TCMA 3DX2A 1BG9A 1FVCB 4PP2A 4D0CB 3LRGA 1FZMA 5E00A 2DBJA 3NEOA 3ZYOA 4DEPC 3FFDA 1VIWA 1AQKH 4L3FA 4FLQA 1Q94A 4U7KA 4E9VA 1BGXL 4R4ND 5DMKA 5C2BL 3FO0L 2XTJE 2J8UB 3UTSB 4P46D 3ARGA 1CGTA 2ATPA 3VFSA 3KWVA 1SXCA 1UD5A 3SKMA 3FQWA 3CQPA 4FNTA 4NJ9H 3G5YB 2Z31A 5FDYA 1MCOH 5IQOA 5FO8A 1MFEL 2VXVH 4FQLH 1WYJA 4N9OB 4OD1L 5EUKA 4J3OC 2HT3D 2JLLA 2OMTA 3SE6A 4TRPL 2JCCE 5GSRB 4AQAB 5IBUG 4F8QA 1QSFE 2E0PA 4IRJB 4UZGA 1T1YA 4R5VA 3CZSA 2EDMA 3ZE2F 2H6OA 3KDPB 5MEQA 4NO0B 3IU4H 2OULB 2YD4A 3UG5A 1ZGLP 3ULVF 1NDTA 2FSDA 4WGKA 1AKJD 1EPFA 4OJYA 3OC8A 2YPVH 4FQJH 3MSPA 3TA3B 5I16B 3K1DA 5CCJA 4G8AC 4EUPH 3K1KC 4BWUA 5E1IA 3HAEB 2QKSA 2EE2A 4FNPA 4OFDA 4AY0A 3GBML 3GIZL 3WFCL 1JGEB 3UBGA 2HVKA 4MA3B 1X5HA 3LQMA 2WCPA 2BP8A 5FUOL 4C58B 3F6IA 2MEJB 2YUVA 4HIIB 3U9UA 5GGTH 2H41A 4XHJC 5CD3A 3H9ZA 1OF2A 1O5PA 3KS0H 2I7OA 1ZVNA 4X83A 4E5XB 1A8JH 3B7TA 3CBRA 3OMAB 2JJSA 2MQ0A 2X4TB 3LKQB 4HDIB 1LE9B 1AAJA 2Q76A 2UY7A 4PJ7F 2P7TB 3ABMB 2XT1B 4N8CL 2WP3O 2ZOOA 8CGTA 3EZJB 4IU2A 3DO3A 1FFTB 3MC0A 1E4KC 5KJ4A 1MAMH 1R17A 2D03L 5DQDL 4APXB 5DO8A 2L04A 4PRHE 4HSQA 5B39B 5M94B 4H7VA 3VRJB 4WEUD 4IKNA 1FHNA 3V5KA 3T1FA 1ONQB 2A83B 4JGNA 2ZAIA 4DP8X 3GBLA 2XWRA 1OE2A 5L7XL 4X4XA 2UVFA 4F7KA 3HS0C 1FPTL 4JPIB 2VLJE 4XZUB 4XC1L 3IU3A 3K81A 4K7PX 4OGZA 5EDSA 3DLQR 1L6ZA 4CSZA 3AROA 5B3NA 2Z65C 4QRFA 4H13C 2R59A 4L9LC 4G80B 1YA5A 4LPXA 4OAWB 2OSWA 5A2CA 5JTWA 3IFOB 1RJYB 3UO1L 4XP6L 5FYLD 4R7LA 2LFEA 2GUOB 1IM3D 3LXCA 1FV1B 5HHMD 2IGFH 3CZGA 3P4NB 1XHHA 4KFZC 4MWFB 4ZMZA 2QFRA 4GG6A 4Z8FL 3RTQD 3TYFA 3UJTL 1XCXA 3DSNA 1UUNA 4Y1AB 4EN2A 2CD0A 2CRYA 1ES0B 1N7MH 1T03L 2YS4A 4XNXL 3L3IA 2YPKB 3BIAX 3I6LD 4FQQB 4PJDE 3VH8G 2MQ3A 5I17A 1A9BB 3MV7B 1KG0A 1L3WA 1NMCC 2DIBA 2D3LA 1XCWA 4HCFA 1HN1A 4YHKL 2RJMA 2HXAA 1JRHI 1XR9B 3U0TA 3FU5A 3AWEA 3RGVB 2B1AL 4MB5A 4HU8A 3ZE0E 1EMTL 4ZX4A 2V0AA 5IQ7L 4JQIH 3HFFA 2XFXB 1O6SB 4NKDA 2RAMA 2HMID 2AEPH 2QZ5A 3CSBA 5I15H 1E30A 4GO6B 1U3HB 2HKHH 3K2UL 4G42A 1ANUA 3KXFB 1QSEE 3GTVA 2W0KA 2F7QA 5J1AB 2E86A 1IKNA 5CZRA 3CFEA 4LSUL 4R8WH 3ZE1B 4NZ8A 3QDJB 4AT6B 1A4JB 5I5MA 3H55A 3F65A 4IDLA 5B3SB 5DS8A 4WGVB 5L0QB 3UBXI 1JG9A 5TD4A 1CD1B 2EVJA 1UM4L 1F13A 1DZ0A 1TVHA 4LDOB 2Q86B 1LD9A 3E3QC 3AG2B 3L8QA 4NM8L 3MBED 1A22B 3TJEL 4HWEL 3RWJA 3VXSE 1AO7A 4K3JH 3IFNL 1U8CB 4PCSA 2VMEA 4AK2A 3CHXA 2YMTA 4JDTH 5GRZA 4Z7NB 1R3JA 3E2HB 1JK8A 4KJPD 4L29A 2GITA 3GM8A 5B22A 2EH7H 3CFJA 4S0SD 5JXAH 4FL4C 2XKSA 3MMEB 3SKOB 3TV3H 3HE7C 4ZQKB 2XUWA 3NIDE 2BY2A 4RMQA 3QWQB 2BSTB 2E8ZA 3SY0A 4IS6B 1LP9B 2R29A 3EDEA 4ZNEA 3H6AA 5CIPB 3EO9L 3UGUA 4RGOL 5D93B 4X8JA 4LIQL 3FTXA 1VFMA 2E9IA 1S7XA 4GKNB 4NQDE 4KJQC 4WU7B 3P0VH 3QCVH 4QF1A 1LO3H 2D7PA 4G9FA 2OM5A 3MQIA 4WEBL 1JWUA 3P4OB 2BH0A 1A1OB 3QJSB 2ZXEB 4P5TC 1E7UA 4OD3H 4XH2B 1R3IH 4Z7WB 1HILB 4MDJA 2WQSA 3ZDZB 2VR7A 3GI8H 1O6TA 4KNSA 3GLDA 4JM4H 5KYXB 3RNQB 1AZNA 2NYKA 5F9WC 3MCKA 1RKRA 4OJAA 1NDGA 1K8DB 1G7HB 3GS4A 2KH2B 4YQXH 5E8EB 3QIWB 1N0XH 2BNRB 2BIHA 2CHWA 3OMZA 3PWJA 5DZAA 1PZ2A 3E1ZA 3CVHA 4RA0C 4BXVA 1WZLA 4ODHH 4XN8A 3RFZB 3R4DA 3ALPA 2R2BB 4YZFE 2VLRB 2AJSL 2AQRA 2ZAHA 1S5HA 3SE4C 1QBLH 2V5RA 3H3PL 2ITCB 3SYQA 4LVNB 3UMNA 2ISDA 4QLRA 5DHVA 2A9CA 4YHZH 3X14B 1LEKA 3ARRA 1OSPH 4FFVC 3TNNA 1VFBB 3WNIA 4PLKC 3DBXA 3KCPA 2AGJH 4TUJA 3RUGA 5AOIA 5JOPE 1RVFH 3IFLL 2DWEB 4LXFA 5C0AE 4N0RA 3ZGIA 5FA4A 2C3GA 3J8F7 5HHOB 3C9NA 5CCKH 3VD0A 3IAPA 3ETBF 1PW3A 5JPNA 1R47A 3CZNA 3OPZH 5AOZA 2ZSVA 4D0DA 4X6CF 1LO0H 3EYOB 1NAKH 3LH8A 4O58L 4CGTA 3VSUA 3OC5A 4ZW8A 4LCYA 2GHWB 2VR6A 3B43A 4X42A 5BCAA 3I50H 5AVSB 5DO2C 2OL3H 5F1SA 5JW3L 4ZS6C 3OKKB 3S96B 1K5WA 1FYHB 4LLDA 4Z5RA 3KLLA 4MS8C 1S7UB 1A0QL 3BI9X 3MJ9H 3WIHA 1LO4H 4HUCA 3BRDA 1EHXA 2E46A 2J5LC 3TEXA 2QADD 2B9AA 1EDYA 2BERA 1JCVA 2HA1A 4JFDB 2VM3A 5C0JB 2FYYB 5H8DA 2VIRA 1U8OB 5F7HA 3DXAD 4XGZB 2X1OA 1V55B 2G60H 2Y3AA 3MCG1 4MQ7B 2FBRA 4RMRA 2NTFB 4YC2C 1OWWA 5HY9A 2WV3A 3HZMB 1KTKE 4XBGA 4LLYA 3BQUD 5AW0B 4HEPG 1ET7A 4PW4A 3RX5A 1WGOA 4OF7A 3BAWA 4TYUA 1K6QH 3P73A 5BVJB 1AYOA 1NJ9B 4YXKH 3T4AC 1RCYA 1WT5A 2E27L 2Y5EA 3D85D 1MJJA 1U8MA 3QUMB 5C08E 2XG4B 5IUCA 4XPGL 4L8DB 2AJXH 3H9YA 4HUVA 2XHNA 3HC3L 2VOTA 4MMXA 2DTML 2UZYA 4R4NC 3BKCH 4LK4A 3C6SB 2N1TE 3HUJF 1BMGA 1GSMA 4P46C 2VXTH 1KTBA 1XH2A 4MQTB 4PJBF 4AXWA 2X2YA 1E6JL 3JVGA 4F37K 2CBQA 2GSMB 3ZRCC 3AMKA 1RZGB 1HINL 2BM3A 2HT3C 4IM8A 4ZPVA 5CZVL 4G83A 2WB7A 2WXGA 3D8MA 1QLEB 4NDMB 2BCKA 2GK2A 4WUUD 1NMBH 2QQQA 1GGCH 4TUKH 5CKAA 2FX8L 1ZGLB 2JFCA 4XP1H 3Q43A 5IVXB 2A9AA 3QS2A 2V2TA 1C08B 3QO1B 4DKAA 3G5XA 3NABL 3EF4A 4GYBA 4XVJH 3HJEA 4KTGA 3VYOA 1KZYA 2DJ4A 3RVUD 3GEFA 5C07D 3D39D 4MB3A 1G43A 3K6SB 1TZGL 3WE1A 2AQ3A 2I9LA 5IQMA 3BKML 2C9PA 1KT2A 1IGTA 4WDIB 4UIMA 4PJHF 1RHHB 1ND0A 5CINL 3FT2B 5D5MA 1T22B 3HLKA 1YEJH 2JI2A 3LKOA 4LLUA 3QIUB 3UPRB 1E4WH 3EJQA 1EEUA 4DGWC 1SJHB 4JJOA 1VZGA 3C5ZB 4QHUB 1RZ7L 3DVNB 1FQ9C 1WFOA 3AAZA 1YDPB 4WEEA 4MQXD 5J6GA 3GK8L 1OE3A 4LU5L 2VXUH 2ARWA 4LF3A 5FA3A 3MTXA 2R1XA 1T0OA 3FL7A 3I84A 2GBAA 3RWEA 4CN4A 1XIWD 3DOHA 1RPQA 2CJUL 3OKEB 4OQTL 2CPCA 4P4RB 4JKPH 3LQZB 3TYGH 5KVDH 2XIDA 4NERA 1DQDH 3AFLA 3HMXA 3ULSB 1JGLH 2X3BA 1E9OA 3QZPA 5ERWA 3V0JA 3AY4A 3BWAA 3VB9A 3HI1A 1HESA 1UB6B 4DPBX 3GSXA 2O26U 3CVIH 2GPZA 4KH9A 2BNQB 4X5WB 5BJTB 1MJUL 2XFGB 4R7NB 1KN4L 2QV4A 1DL7L 5GGRA 3TTYA 1WP6A 1CE1H 1LDSA 2FWUA 3ZSTA 1P1ZA 2OX5B 5B7MA 3MNDA 3QYNA 2CSPA 4QXTB 4XNQB 3W9DA 3HCVB 4PJFA 4KZ0A 3N55A 3FRPB 2BFVL 4NRZB 3WHXB 2GTZA 4D3CH 3LZQA 4JRYA 1XAKA 5JIIA 2ZYSA 3F85A 3PAUA 1XTMA 2AJYH 1WDAA 2C3WA 4NN7C 4X80L 1OWRM 4NHCH 4G8IA 2FH6A 1QSZA 2ZUVA 3GBEA 4YHYC 2I26N 3RTQC 1HE7A 2NY2B 5C7XL 4GB9A 5GZOD 4PJ5B 2PPDA 2WLMA 3EG9A 4H20L 4YPGA 2VLME 4EO5A 5FUZH 3SDCB 5EO0A 2CCLA 4JZJA 3UDWC 1FNSH 2IQ9H 3VGEA 3W37A 3N1FC 4Q9BA 5AKSA 2FATH 4OM1H 4PCYA 1MW3A 2Y36H 1ECZA 2AEOA 4Z77A 4WI0B 2WLIB 3LRSB 1LQSR 1ZHBB 4YNYB 3IGUA 5IVOA 1Y7VA 2HMIC 1AS6A 4FYSA 4JM2F 2J21A 3ATBA 5C3LD 4QRSA 1MCHA 1N6UA 3HBZA 5B7FA 3FQTB 3ARBB 1WWWX 5GS1C 3SQRA 2WQRA 1MCWW 3OKNB 4KI5C 2DEWX 1U4FA 1M42A 1Z9LA 3WG7B 5B8CA 5CCHE 4E9YA 5HYEA 4Q2ZA 5BS0E 1TR7A 2IMMA 3UJIL 1BAWA 2HFFA 4PJ9B 1X5ZA 1R24B 2PCFA 2BRRH 2F68X 4KNQA 4G5ZL 4HC1L 2WQVA 4UTAL 5DJCA 4RVBA 2B77A 1KTJA 2JB6B 3KPPA 3VWKB 3MTRA 1WLHA 1W72B 3BPLB 4ZNCD 5K9QG 6CGTA 5ICYA 2YBRA 4OQ1A 3AUVA 5F7EL 1DLFH 2X2HA 4FA6A 3DDGA 1KB9J 3QAZC 1ZHLA 1BYNA 3EF7A 3G7TA 3RDTA 4I2XA 3APCA 5FYLH 4KJPC 3WIFA 1ZSDA 3LNDA 4L0ZA 3N40F 2GHZA 2WIMA 4XAKD 4FG4A 1PAMA 1TUPA 3LEYL 3WO4B 1JN6B 4DO5A 4H1LG 1U8NA 1E3ZA 4MMXC 4BE5A 4HJ0C 5L88L 1I8IB 2E7MA 4PCKA 4K5MA 5IJKA 1F58H 1XGYH 2XDHA 4YHLH 5AVQB 1NCOA 2VRKA 5D2LE 1AFVH 1J05B 2IVFC 1KYUA 4OZ4A 1SVBA 4NQVA 4CW1B 3OG4B 1UVQB 3OMNB 4N1CA 1M2VB 4X6BB 1S7TB 2UZIH 3N42F 5ALBL 2P5EA 4K73A 2QMKA 4PRPD 1EJOL 4P2CG 4FDWA 4MXWL 5IQNA 3MACH 4FI6A 3V0IA 4UQDA 2CNYA 4B60A 3T0BA 2ED8A 1EUUA 3FTVA 3MRKB 1G7PB 4ZFOA 5IB3B 3WS6A 5AW9B 1OHZA 3HR5A 1T0PB 1WD8A 3PUUA 5A2LH 3MRDA 3RVVD 1DSFL 3GSOA 5SWZE 3RBGA 2FJUB 2CO6B 3DUUB 2FO4A 4AYFB 3OTTA 2WIIA 1G0YR 1YJDL 1U8HA 4QEGA 3TJHD 1EWHA 2YMXL 3T8XA 3V4UL 5DEZA 1QLFA 4PWGA 3KPRE 2R7EA 5AD0A 1GW6A 2ZKHH 3FAXA 1KCVH 4ZO9A 3TXAA 4JDEA 3N44F 3UROR 5MENB 3B2XA 4QYAA 5DRZB 2J6WA 2WXPA 1MXGA 3ZLQC 3UYPA 3MAWA 4MZIA 2ITDA 3BCFA 4TQ8A 5INCB 3AS0A 1PSKL 1KGYE 2V9QA 3RWDA 2V7HB 2YXWA 4XVOA 4H2AA 4QRTB 1NCTA 3FMGL 2PTUA 5DJ0B 3WFZA 3E3QE 1NGPL 2WHVA 1VFUA 4JFSA 2LU4A 4R26L 5DHDA 5EBLB 1FZOB 3QO0B 5D1XE 2QVFB 3TBWA 5D7IE 1I7UA 1JWSB 1MFAH 2W94A 1FFNA 4Y4KD 5DK3A 3KWWA 4BWTA 3U6RA 5IF0A 3JV6B 1I82A 3EYFA 4RMWA 1K2DB 1NEZA 1NGWB 4JB9H 1CU4H 5CSGA 3BP4A 2DI7A 1Y0LA 3HR6A 4E9LA 1F4YH 4EBQL 4LBAA 3BAEH 1HYSD 3KPSA 3UX9B 5AW5B 1PZBA 1J8HE 3JTBA 1ASOA 3U30B 4CVXB 4HUUB 4XTRD 3DOSB 3RL1A 5BO1L 4R97C 3O6ML 2FLBT 1Y18A 2O61B 4XX1G 3ABGA 2AQQA 3QK0A 4Y19D 3QORD 5HGAA 15C8L 1I1AB 2D31B 2IDUA 4U2ZA 1UKSA 2OR9L 5BW7C 1OL0A 2FT7A 2IOOA 4J4PA 3FCTA 4XNZC 5KSVB 1BJ8A 5LQBL 4P9HH 4EZLA 1J86A 2HRPL 2H3XC 2P28B 4GLRH 4MNHA 3Q44A 2L7JA 1DLHB 4F33B 5DRXA 5HDRA 1S9YA 2DQEH 4OJFH 5SX4I 5K1VA 4YLQT 4ZMWA 4M6OL 4OCYH 1BZ9A 2AXWA 2JNZA 4NNYB 5MEOA 3ZO0A 1QO3B 3QZWB 2VSMB 1Q1JH 1B4TA 4OFIA 3DVGA 4ZTOL 5EC2A 4WSJA 4NKIL 3IJ7A 5DDHA 4JFHE 1BEYH 3T0AA 1MNUH 1W91A 5KSUB 2DQHH 4QRPB 1FYTB 4UMSA 1FN4A 4TQHA 4WZ9A 4XNAA 3QZBA 3UFIA 4C83B 1BD2B 1MFMA 1I7TA 2AVFA 4ODTH 3ZVVA 1LDPL 3D07A 2BRQA 4EMZA 1N59A 1I8KB 3HMXH 3U4AA 3RVUC 3V6FA 3VXMA 4GAYA 1MWAH 2Y2WA 1CFSA 2WO2B 1UOWA 3P3SA 3B83A 1HOCA 4L37A 1WJ3A 3GDBA 3IPBA 4I9WE 4UNUA 5C8JA 1NKGA 2FT6A 4X6DA 2R0ZL 3CLFL 3BE1H 2NCEA 1DUYA 1S46A 3P3YA 4OZHF 5L2KB 2ICEC 3ARVA 4LSRL 4PRIE 5CP3A 3FOLB 3BP6A 3O2DA 4TLKA 1L0PA 3FW6A 2VCOA 1YEGH 4JVPA 4QRQB 2PPEA 3RZWA 3ZDXB 2A73A 4R3SB 2X9YA 4N2HA 3CDZA 1E9PA 7FABH 1R6VA 5GGRY 1T20A 1ZWIB 2DMHA 3FFOA 1CF8L 5E2JA 5C97A 1ZCRA 5MHSE 4OZIF 1DJGA 3INOA 3MV9A 3QNZB 4MNGA 5ICZA 1FJ1A 5IB5A 1XIWC 4XBPA 4FKKA 2I9TB 1OCWH 3LDBC 4QRBA 4YDVA 4NXKA 3SPHA 5AVYB 5IFJA 1CGSH 4Z95H 2XA8L 5SWQB 2V5MA 3DGDA 3C60D 3FO9A 3H9SA 2E7CA 4Y16B 4GXFA 2NXZD 5DC0A 5ENWB 1PKQA 3OR6A 4P0DA 4HJTA 2LABA 5C09D 5I18L 2FL5B 1HC1A 2RA1A 3HZVA 4HG4J 4P5SA 3NQIA 2G75A 3MLVL 5IHBA 1MHPL 5A43C 3D2UD 1EX0A 5TH2A 1TJHH 3FU7A 1I3GL 3I6GB 4Q6IC 1TMCB 3CC1A 2UX7A 3OR7A 5TFSH 3QJZA 1HXKA 5DJ2A 3PHOB 4DT2A 4U1HA 4I89A 5DMIH 3QIBB 5H2BA 4APQB 4OH2A 1AACA 4HIEB 2BXYA 4QRUB 5ABZA 2X4RB 4RRPM 3WFBL 5GZOC 5K33A 4IK6A 4TSAL 1C5BH 1UB5B 3LZFL 3F5WB 4OB5L 4PJ7A 4BFIB 4Y8DC 4ODWB 3TN0A 3NIFF 2W8CA 1G1KA 2I7SA 5HI3D 5E94A 1MCPH 1H8LA 1X5MA 5IT2L 3ZL4H 3FTGB 2DDQH 5DVKA 2FIKB 4UOW0 4YDJA 1KZQA 4WNQB 3PWPD 4LT7A 4KGJA 3ZE2B 1WZKA 4M29A 2VE6A 1KXQA 4HPHA 1T5XB 5CN2A 2AK4B 4Z3EA 3BWZA 3O6FD 5M95B 5DD1L 3SODB 1PDKA 1NBCA 4X6FA 1QRKA 4PRDA 2E74C 2A1WH 3CLEH 1BM3L 2IFGA 2FSEA 4IGBD 2WAQA 2H7WA 5D6DC 2F54A 5JHDA 4HZLA 4HIHA 4P23B 3QJTB 3MRFB 4QHKJ 2AV1B 1QR1A 1BBDH 1UWGH 3CK0H 4JKMA 4AIZB 3QUML 1QPPA 1RZ8B 2QT6A 1G7LA 1MFBH 1ML0A 1DBBL 1NGYB 1IC7L 1X5GA 3BEWB 4ADGA 2DTSA 5BMFH 4K3DH 4FTVB 1IAKB 4ZNEE 2LR4A 3UC0H 5DQJB 5L9DH 4YFLF 5DLML 1JMXA 1XH3B 3GS0A 4P59H 2PR4H 2GCYB 3DUHA 4FEIA 5EIIA 4JRXD 5D9SA 4MA8H 5FOJA 1B3IA 4GW5B 1MNNA 3FQXB 1NCDL 4G9FE 1PG7L 1X4XA 4JREB 3U4BL 4AQ1A 1QLEL 2YA0A 3UXFA 2WXHA 2QSVA 4Z7UF 3VXPA 3CXHK 5JW4N 1WSST 3F62A 1TETL 4HLZG 3S2CA 1U8IA 4KXBA 1KGCD 4K3EL 3G08B 3IDYC 3OKOA 4G1MA 4DCQB 1TT6A 3EJYD 4HPYH 1VEPA 3S35X 2Y1YA 4HD9A 4WHTB 2NZ1A 5FYLE 5D70H 3WUWG 2VAJA 4M7LL 2P8LB 4GUOA 4QXGL 2WANA 5JMOC 4PJGF 4HSCX 2CO7A 4FULA 5I6NA 2GJ6D 4OF8A 5I5RA 4AGNA 3WMSA 3PQYD 2CG9X 3WTWA 1GYWA 2XIBA 2EQDA 2GFBB 3OAWA 5FHBH 3I02A 5KYWA 3GSVA 4IJ3B 4KHXL 5DZOA 3PNRB 3S37L 1JGDB 2PXYB 1XCTB 2RACA 1TZHB 4NAMA 4V2CB 4PG9B 1WUZA 4MCYB 1I8MA 4CDGC 3VQMA 2RR3A 3PL6A 4L0PB 1WRFA 4N3UA 3D05A 3RUGE 1BLIA 4ODVL 4TXVB 1UACH 5SX5H 4NUJA 1UXSB 3Q48A 3RVVC 3SKJH 4GXUN 5DHMC 1ACCA 2DQFA 5TJWK 3WDIA 1A1NA 3KYKL 2XRAL 1YYMH 3TJHC 5JW5B 2YHGA 3QYCA 4GW4B 1MPAL 3NDYE 5EZJA 3UERA 3V52L 2W9EL 4Y4HB 3BN9D 5KSAA 1C7SA 1QFWL 4KI5E 4Y9CA 2EVGA 2CDFA 3RQ3A 3UG4A 3IAQA 4V1DD 1XF4A 2GC4C 3KG5A 2IWEA 3TBYA 2J1YA 4O02L 3VWJD 4LLQA 4OSUH 5FYJU 1O75A 5JQ6H 2VZ3A 3SGKA 3QUZD 2X2JA 1JHTA 1G4RA 1X3DA 1KC5H 1UENA 3HKFA 1QX1A 1RZFL 2VDLB 2ZUTA 1ZJAA 5IB2A 1ZHKB 1M05A 5EU4B 3KAAA 1NBVH 1GYUA 2X4QB 3NCJL 4IRZL 4M3KB 2QELA 3DDFA 4X5PA 3EO0A 2X09A 3F6JA 4BSJA 3TONA 5DT1L 2QJDA 2X28A 4FJZA 2CQVA 1CDBA 2E9JA 5IWLA 1A6AA 2JJTC 1LEGB 5C2BH 3FO0H 3ELAT 2QVMA 4JO4L 1X5KA 2AANA 2EADA 3GRBA 3IDGB 3KBHE 1FBIL 1HYSC 1KB5B 2Q2EB 4L3CB 2GT9A 1BQHG 2DM4A 1C5DA 3NCEB 3LB6C 2CO1A 1XGQB 2P24B 3NESA 4JW3A 4X8GA 5ECGA 5TDPA 4MJ6B 3VRLE 3RA7L 2O6CA 4KO9A 4OD1H 4PM1A 1X7SA 3JZ7A 4J8QA 2C3HA 3MBWA 2IH1B 2WVUA 3QORC 3N40P 2ADIB 3L9EA 3EGXB 1IGYB 5DK2B 3D25B 4HUMB 3CPLB 3IETA 1MDAA 1JSYA 1QWUA 2NSXA 1PZ5A 2IC2A 2XCMC 3P9MB 4RLDA 5C0FB 3VCLA 4BGLA 3HN8A 2R83A 3MA9L 5ES4B 3AACA 4PR5B 4TV3A 3D0LA 3GBMH 3NEEA 3NIGE 4KV5F 3C5SA 3B9AA 3L1OH 3TESA 4A2LA 4K94C 3KDMB 5FUOH 3MRHB 4PWHA 3KYMB 4XCYB 3WENA 1DVFD 5AAMC 5IBUB 4WV1A 2R0WL 3ZHNA 3VQLA 2FNBA 1SXZA 1W72L 3KR3L 1CIDA 3HG2A 5D5ME 3QDGB 1K3IA 3VFVB 4ZSOA 1ERNA 2DICA 1HHKB 3GPSA 4WFHE 3QWOA 3QA3B 3ZDYB 4NJAH 4MJIB 4YHNB 4G8FA 2YSSB 5D1QD 1WBYA 4X8XA 2D03H 5DQDH 1DO6A 4BCXA 2OJ1A 4JHAL 3INUL 3ZL1A 3BPCA 3VXOA 1T21A 3IGLA 4NSKB 4IMLA 2GIYA 1U92B 3GXPA 4U4IA 1J0YA 1QTSA 5L7XH 1TU2B 3GSNA 4OV5B 1FPTH 2WVTA 3ECBA 2UUDH 4I0PD 3V7AE 1KENL 4XC1H 3UTSD 1GOHA 3W82A 1BZ7B 1CDJA 2WMPB 1IAMA 4QHMB 1M7IB 2XV3A 4RIRA 5IFAL 1BPVA 2GVYA 2QVIA 4MGXA 4NWTL 4AQ1C 5IW1A 3HUJA 4YMPA 2MCAA 3NPZB 4UDTA 4XRCB 4XP6H 1XO8A 2WUCL 3RNKB 3P11L 2OA9A 1OY3B 3KJ4C 4PJBA 4PV1C 1KTDB 4IRJD 5EZPA 1FFOB 4HCIA 2IPTL 4PJFE 4NO0D 3V6BR 1E9QA 4RA3A 1LK2B 4Z8FH 3PAVA 3UJTH 1JV5A 5ACMA 5DUJA 1K5NB 3N91A 3TA3D 4RDQG 4XNXH 4XVSL 4JUTA 2HTKD 3P4LA 3C60C 2AI0L 4DKEL 2R69A 3S7GA 3CPUA 4XWGL 3SJVA 2NXZC 4YHKH 5ICUA 1N5AA 3FCSA 3GS7A 1H19A 1IFRA 1KELL 3K6OA 1NCUA 2CLVA 2FLMA 1EMTH 5F89A 1PF3A 2MIZA 3HKZA 2YXVA 4ZFZA 4LCVA 1JNNL 1BXXA 3DV6B 4IMKA 1VHPA 3RHWF 3C5JA 1CGXA 4DNLA 2LTQB 1KNOA 5HGHA 2Z31D 4LCUB 3K2UH 3DX8B 2J71A 3OG6B 2WN2A 3K72A 3BVWA 5GHWL 5IKCB 3RX7A 1HXMA 2DLGA 1H9VA 4ZOCA 1UC6A 4WUUE 4FQHA 3HRZB 3GUTA 1QEWA 2NT0A 2NSQA 4LSUH 3VH8B 1PS3A 2APVA 3BT0A 1M56B 1DE4B 5KUKA 3TS8A 1N2RB 4R9HA 3X11B 5F7AA 2WTRB 3HMWL 5HI3C 2EZ0C 3U0PA 1CFQB 1BHGA 4RGMB 1UM4H 2PPFA 1G9NL 1KV7A 1GAFL 2XKNA 4D8PA 1IC4L 4NM8H 1SHXA 1XSOA 3SGKC 1E5YA 3TJEH 3NGBC 1TVDA 2V8MA 1QFWI 3DTXA 3OJDB 2X4PA 4IBTA 4NYLA 1Q9OB 3IFNH 4AEIL 3TO2B 5TK4A 1U8PA 3O6FC 4LL1A 4IOSD 5BQ7A 2ZXDA 4RWYL 4HS3A 5BZWA 2PYEB 5CLWA 4X7TA 2HFTA 5JNYB 3D51A 4Z7AA 4Y5YA 3Q5YA 3HG1B 3HZYB 5CD5D 3RP1A 4IGBC 3GMOB 2DM3A 4I2XE 3QJQB 2OLDA 5IWLC 3KPOA 2DYPB 2EDTA 3EOYG 3TO4A 3B2UD 4HLJA 2E6JA 3A0OA 5E5MB 1GCFA 3EO9H 3GJFH 4RGOH 1HSBA 1OSZA 4LIQH 3BGFB 4E9XA 4M4PA 4S2SA 3RU8L 4MA7L 4P49A 2YA1A 3CFMA 2H26B 4NFBA 1SEBB 2X70B 4Y1AD 5KOVC 3W5NA 4QRRB 4XOAA 3SOTA 4I8DA 4ONFL 2VMJA 1ODAA 3NJNA 4HXBL 3FRUA 1PPIA 2COQA 3QNXB 5IR1A 4O2EA 1QTPA 1TQCB 3GD1C 3IJYB 4WEBH 5EU3B 4OCWH 2JJUA 4EZMA 4FNUA 3CH8A 4L2YA 4KXCA 3RGVD 3MXVH 3C6LB 3G5YA 1D9KA 1NFIB 3ESNA 3DMMB 4I48B 2WM0A 3DRTA 2ED6A 2P5EE 3V4PB 5CJOL 2GKIA 3C87A 3ZSSA 2V37A 3BDYL 2XG5B 4F5CA 5GSRA 4AQAA 4QOKB 3SDAB 2A99A 1IBDA 3QDMA 5CP7B 1J1OL 1MAKA 3ALWA 2XNAA 3KXFD 2J57A 3REWB 1U8QB 4F93B 2PWDA 2LU3A 4JM2A 2AJSH 2QBWA 4FQXA 2X88A 3PWLB 3K6FA 4RFEA 3WLWC 3WELA 3QDJD 3UCQA 5I16A 3H3PH 3MV01 2F53A 3W56A 4ZFFB 5C0EA 3HAEA 4PJAF 4PU2A 4TUOB 2W07A 5IESL 4ZUVB 5I0WA 3QQXA 1KXTB 2OS7A 2A4CA 4HCRA 3MRRA 5DTFA 1JGEA 3A4AA 3IFLH 1YMHB 2TRYA 5ISZB 1MLCB 2WLLA 3E1F1 2C9RA 3AQXA 3LH2L 4GUPA 4L48A 3GXFA 4MXVE 2VM4A 4UDUB 1NCAL 1OP9A 5DUPL 1CTMA 1FF5A 2DKSA 3KBPA 3TT3L 4WJ5A 5HHPA 1SRDA 1D5BB 4O58H 3FXIC 4FKHA 4M6NL 3NCFB 1HHHB 2W60B 5DJXA 5JW3H 3VJ6B 4APXA 1IQDB 3GTNA 4P04A 4NKOB 4I85A 4FP8L 2NUPB 1Z7JA 4HX1B 3BN9C 1A0QH 4F7TB 5B39A 2R4SL 4AITA 4W9HC 5FWQA 3WL9A 2COVD 3ATFA 3KGUA 3BRFA 4OFYA 4NUPA 2A83A 3U36B 2VLKB 3EYQD 2H32H 4OZFG 5T1LB 3VWJC 1INEL 1TJXA 1XV8A 1II4E 1M2OA 1XD1A 2WBXA 5LXGL 3QUZC 2WXIA 3W2DL 3VI3B 4MRBA 3S5ZA 3QCTL 3DA0A 1RK0B 1KXVC 5F3HA 4G80A 1YNTA 4OAWA 4XO8A 2PETA 3IJHA 4N0UA 2E27H 1YHPA 4XPGH 3CFIC 5HDWA 4AYEC 1SMDA 2EINB 2A74B 2XJLA 2Z35B 3QIWD 1JGVL 3HC3H 4G5AA 4PS3A 2DTMH 4KROD 4UAOC 1IL1A 3DNKA 3VI4A 3RGBA 1T2XA 4FEMA 3BP5A 4JAMA 2VLRD 3BIBX 3MNWB 5BRZB 2WBJB 2PYFA 1E6JH 1F90L 1JV2A 3NP4A 1CICB 5I26A 2BOCB 1ES0A 4B9IA 1CTNA 4QCIA 2A6DA 4W9DC 2SEBB 2YN3A 1A9BA 3MV7A 1N9PA 1R5VB 2HTLD 1HINH 2A6KA 1GSKA 1BZEA 5CZVH 4WI8A 4HH9B 1W6LA 1QEXA 3ETTA 1IGFH 3O2VL 1OTUD 2OTUB 3SBQA 4GXVL 4P2QA 1THCA 4NZTL 2I69A 3BSZA 3X13B 2XFXA 4YGVB 2CUAA 3W5MA 5CGTA 5FV1L 5HHOD 3VD1A 4M3JA 1GGBL 3NABH 1AOZA 2OAAA 1U3HA 1TKWB 3L3OA 4XXWA 4AZUA 4FQCL 2XVLA 5GZNA 3VA2C 1TZGH 3U2SA 1HZLA 4LCWB 3BKMH 3BGMB 3VXME 1R19A 3ARFB 1EV2E 2NYYD 1QUNB 5DUML 1A4JA 5CINH 4K07A 2EDHA 3QH3B 3VGAB 3D3VB 4EI6A 4FKEA 4JZNB 3WGVB 2V3EA 3MKKA 1DVFC 3ME0B 5LNEA 4KDVA 4K8RL 3QUXD 4X6DE 4JFDD 4AUJA 5IZ7A 3IXTB 1T04A 4LKXA 5EF3A 1RZ7H 3VU1A 1P69B 3LVEA 3Q3GB 3WE6B 4PGEA 1ZDQA 4H8VA 1EJ8A 3BH8B 3GK8H 5IBLD 4DO6A 3KLSA 3RILA 4LU5H 5D1QC 2CDEA 3CD4A 3G6AB 5I0DA 1O9WA 2FJHB 4Q14A 4NZDA 5KVFL 4FQIL 4OQTH 3N44B 4JJ5B 5DJYB 1WBXB 2AXFA 1WAAF 4AZ8B 2EEXA 1LM8V 1KPRA 2PP7A 4MNGE 1B0GA 3NG5A 4WVRA 1MHCB 4ORGB 2BSTA 3WTUA 1AGEB 1ZT7B 4I0PC 4IS6A 2HRGA 2B08A 5CIPA 2RH0A 1FO0A 2BSRA 2CH8A 1KN4H 2LT9A 4GQZA 4M8QB 4UCFA 2NTSP 3ZTJH 3SQBB 4PGCB 4EOWL 4WU7A 5DMYA 3GSQA 5I1GL 1SVZA 3H7BB 1S7SA 1PKQE 4KX9A 4WTZG 3X2QB 2CGYA 3CSGA 1YMMB 5AAWA 2XWCA 3P4OA 5I1IL 4DF9A 2BFVH 4M1GL 3GC3A 3PIQB 4TQIA 4IRJC 1KUMA 3OZ9L 3MN8A 1PLGL 5SX4H 4X9IA 1U3NA 4H25A 2ZWKA 1X9QA 1KLUB 4J3SA 2E59A 4OLVH 2BIOA 2D3VA 2BNUB 3H6JA 1IO4C 5E8EA 4H20H 2OI9C 3TA3C 2BNRA 4LHUD 4X6EB 4AMKL 2HTKC 3MRNA 3L4YA 4NGHL 1L0QA 1VFAA 1XB3A 3PFUA 3VMNA 3CFQA 3QVAA 3TVMB 3NJVA 4MKMA 1V8HA 4P9ML 4KVNL 3RX8A 2ALAA 3N1GC 3NA9L 4GNKB 1EZVY 1AXSB 1N12A 1K72A 2J43A 3IN2A 1UWEL 3GMPA 5I5IA 1JK9A 2DEXX 3O3DB 1GVIA 1VFBA 3QIUD 4N20A 4QIRA 3CVBA 1OAKL 3HRPA 1KXQE 2VDLL 2YPLB 2YUWA 1U8LB 4L1LA 2B2XL 3GSWA 2EACA 1VPOL 4HIJB 1ACYL 4NQEA 4Z76A 1VGKA 1CLZL 4MHHG 4BRVA 2DM2A 5M7QA 2F7OA 4XNMB 1OK8A 1ZVSA 2VW7A 1YJDC 3UCRA 4FNQA 3K8KA 5JHDE 2C4FU 2N7AA 1IC1A 4QWWD 4G5ZH 1OLZA 4HC1H 2GQHA 4JDVA 5FYKL 3BWUC 4UTAH 2YLKA 3HHMA 1KB5L 1MEXL 4D9LL 3IMBA 2R2HB 2BNQD 1WVZA 2YD8A 2H5UA 2VYRE 4GH7B 5F7EH 1K4CB 1W8EA 2QDVA 1M7UA 5C0JA 3VM7A 1T89C 3LPWA 4L8SB 4MTMA 1VACB 3L81A 5A2AA 5IMOB 4RZCB 5CD5C 2NTFA 2CALA 2OMBA 5BRPA 3LEYH 3T08A 3MO1A 3Q1SL 4PAZA 3BD3A 1NPUA 4LDLB 3UAEA 4ZOEA 1W6WA 2AJ3B 2DEYX 1X4YA 1W2KT 3B2UC 3GEWB 1NJ9A 1PFOA 4A6YL 4Z3FA 1Q90A 1CD8A 2NY2D 5EZIH 3L2LA 4PJ5D 1L0XA 1CFVL 5I9QB 4L8DA 4UYQA 1XR8A 4LKCA 2UXVA 3HG0A 1WIOA 2QMJA 1LYQA 4OF3A 5ALBH 4MD0A 3BH9B 1ASPA 4MXWH 4YR6B 4OI7A 2RCSL 4MD5A 3RGVC 4GSXA 5GS0L 5DYOB 4Q74A 1NC4A 1LLAA 4QKXB 4EVNA 4X9YA 1TZIB 1OGPA 1AS8A 3OXSB 1AP2A 1EHLL 1ETZA 1CJYA 3ORJA 4J23A 2GC7C 4I7ZC 4NDMA 4H1LB 2AABL 3JSSA 4AYGA 2OYPA 1H15B 5T5FL 4ACTA 1DSFH 1YCSA 3IRZA 1AGDA 1MFUA 1U3HC 3ARBD 1YPZF 5E99L 4EF3A 3MLZL 1YJDH 3L3DB 4Q9RH 1C08A 2AQSA 2YMXH 3QJHA 4BWWA 1P5VB 2VAAB 2X6CA 4YN3A 4PTTA 3DV4B 3P1VA 4N22A 3V4UH 1RY7B 2V3FA 4PJ9D 1ORSA 2C1PA 2XTSA 4Y9BA 1PCXA 3F7YB 3R7RA 3TIEB 3WO3B 4G8EA 1DBML 1BJ1J 5L0QC 2AS5M 1KJMA 4PMEA 4MS6A 4G7VL 5BQDA 2JIXD 1JZ3A 1AE6L 1PSKH 3VWKD 5DLLA 2VRAA 2PPCA 2WLKA 3IMUA 4ODXB 3FMGH 5CBAB 3PUCA 2WWKT 4PW9A 1NGPH 5A7EA 4R26H 3NRQA 3PWPE 1HH6A 4G6JL 3CE1A 3UPRA 2CPUA 3WKML 3C5ZA 3I9GL 4QHUA 2DYSB 1A14L 3E2HC 5LB1A 5LDUA 2L7EA 4N8VA 3V9CA 1YEKL 1DQQA 3V8CA 4NO2B 2ZXGA 4JX0A 3O9WB 5F44A 1LE5B 4KK6D 3ECUA 3BDBA 3V6ZA 3IWVA 3TEYA 3MUZ1 4YO0A 4R5TA 5D93C 2YGOA 3UZVB 1X5FA 2XWBB 3MLTA 3EYQC 1RIHL 5BO1H 1BFTA 2R39A 3MFGB 3O6MH 3QI9B 5HVFB 3O45B 5F6IB 1UB6A 2Y7OA 3WHE1 2NRDA 1M6OB 3DX6B 15C8H 5BJTA 3HN3A 2W1NA 1TJGL 4RFNB 1CDCA 2OR9H 3FB6A 3JTTB 1R5IA 2EDOA 1AD0B 1QW8A 2QEJA 5H4ZA 4Q4EA 5LQBH 3HCVA 1KIQA 3AZUA 1FNAA 2GB2A 2HRPH 4NRZA 3KYNA 2EDXA 3WHXA 3WNOA 3PJSB 3QIWC 2DI8A 4KROC 2A2QT 1JTPA 4L3EA 3R1GL 4G11A 2ENSA 1HHGB 3CHQA 3RFZC 4WFED 5SWSB 4M6OH 4GRWB 4W4OA 2BMKB 2N7SA 4I1RA 5CR1A 2W59A 5KSBF 2BZ7A 1BX2B 2KUTA 1OAYL 2NY4B 3SDCA 4LVNC 4Z7UB 5MEND 1JF5A 1TTCA 2O5YL 2Z8RA 4N6RB 5DR5L 5AOLA 2HTLC 5FIEA 3U2JA 4NKIH 1MW0A 3AGWA 4IHOB 1CDYA 3PQYE 3HC4L 3V5DB 3TBTB 2VKXA 3WEAA 5IOKA 5EG6C 2WLIA 2X44D 4X2UA 5FAAA 4ONGL 4YNYA 5I8OL 3LKPB 2YAPA 4Q0XL 1HEHC 4JNXA 1LDPH 3O3EA 2YAHA 2B5IB 4JCMA 4KNTA 3GM0A 2R1YA 3N43F 1EVTC 5LAXB 5IOPB 3NCMA 4LOVA 5CJQL 1ZDSA 1Q9WB 4ZPTA 1CB4A 2XJKA 2BSDA 3AADB 1KDIA 2R0ZH 3CLFH 4GEJA 1WCQA 5HGBB 1R24A 1H8NA 4GKOA 3S36L 4LSRH 1ZA6B 2YOCA 3VD3A 4RAHA 5F7WC 3T6VA 4F9LA 2G3XA 1T1XA 3QUXC 2IOMA 3L9RB 3BYYA 3LEXA 2JB6A 3FONA 3S5LG 5HGGS 1CF8H 1W72A 4TM9A 2N1KA 2H45A 3EBHA 5HYQB 4F9PA 1I1AD 2ZPKL 3FJTA 1Z2KA 3QQ3A 2Z0BA 4DUVA 4RESB 3K8LA 1E5ZA 2X9XA 5I1CL 3UP1A 4GP8B 1F3JB 4J27A 2WYZA 4Z78A 2CKBB 2PW1B 1C9SA 5CU5A 2CRMA 3WJLA 1SOXA 2XA8H 1URIA 3UJJL 3DHMA 4Y2OA 3IVKB 3UEQA 4IEFA 3TPKA 3S3BB 3EH4B 4AV5A 4L8BA 4P5KB 1KCBA 3AITA 1ECYA 1DDTA 3FQ1A 5I18H 3BUTA 2V5YA 4LP5A 3IJEA 1HI6B 4MZRA 3CSTA 3MLVH 5IEHB 1MHPH 4NUQA 4HUWB 1M2VA 3PP3K 2OMZA 3NJXA 2DN7A 3FUMA 4AGQA 5KYYB 5EO1A 3DO7B 1UM5L 1T3FB 5INDA 1ICTA 3I9AA 1TMQA 2LOEA 1GGUA 3MUHL 3QUKB 1IKFL 4HZ1A 4QRPD 3W9EB 4UQ9A 4UTBA 4MQSB 1FH5L 1UXMA 3FFCA 3TBVB 7PCYA 4JFFB 3G5VA 4D7BA 1BD2D 1LO5B 5JOFA 3FQRA 5T1JA 3CFBA 4GBXA 3O4LD 4PVLA 4TSAH 4Y2NA 3LZFH 4GQPH 4XMVA 3GJEB 4OB5H 3MRQA 2AQ2A 4AYFA 4TVPL 3MRGA 1EO7A 2PWHA 1FNLA 5H94B 2PO6D 4ZFQA 1O7DC 5IT2H 3PNWB 3PF2A 4FCHA 4UNTA 5DVLA 2XV0A 2YC1A 1CLCA 5FB8B 4TNWK 4NCDA 5L2KD 2A38A 4FXGA 4URKA 5DD1H 3D4YA 2JCCF 3Q8AA 3QIUC 2HH0L 3FQ2A 2XETA 1WA0X 3RWCB 1BM3H 1F1GA 3AY2A 4WWKD 1D5MB 5FM4A 4JPSA 4QR7A 4BQCA 4QRTA 1IE4A 1DQML 1I1CA 4ONOA 4AUYA 5J13B 5JIDA 3EBGA 1FZOA 4LDEB 3ZIMA 2XZQL 4QLWA 3QUMH 3MV8A 3RPIB 2EUWA 4Y2DA 4Y2LA 1JWSA 1ZLSH 4BSVA 3PAYA 1DBBH 2I25N 1IC7H 4QWWC 2IV9A 4OU3A 4K7FA 1LEIA 1KIPA 1MQKL 5DLMH 2WO3B 3PYCA 4Y16D 5DVNA 3VXQB 3IDMB 5DRWA 3X12B 2VDPB 1MHEA 4U3CA 2VITB 4CVXA 4HVBA 2MPVA 4UQAA 1NCDH 4H88L 1PG7H 3D33A 3DOSA 4AYSA 4OZGB 2OZ4L 2ZUWA 4IOFD 3UTSE 3U4BH 4D9QD 4DSYA 1QLEH 3FDWA 2O61A 3U0WL 3RWFA 2O30A 1KPUB 3GRWA 5C0CB 2YRZA 1TETH 4K3EH 4JCLA 2D31A 3L7EB 3QJVB 3UYOD 5HYJA 1QKZL 1DQLL 2BX5A 2ZAGA 4HEMA 2FQDA 3H1ZA 4F5CE 4FCAA 3QIBD 3QDME 4P4KD 1DP0A 4APQD 4M7LH 4QXGH 2NY2C 3RJOA 1IKOP 2JQMA 1F42A 2BCMA 3QPQD 2GSGA 2W9DL 3NZHL 3SDCC 4QXVA 3JT0A 4KMTL 1P7QB 1CDHA 3MODL 4GMSL 4KHXH 1A9VA 3S37H 3KHQA 2WWMD 3EDKA 4ZTPL 3PXLA 1I1YB 3E0GA 1N3NA 2F53E 4G8GA 5F71A 4HK3J 1ZY9A 3PLYA 3NFPB 5IB1A 1S9XA 1QMUA 2K70A 3ULVD 2V6HA 1JAEA 2E7LC 1BECA 4HQQL 5F7NC 1U95A 4LOFA 4EI5A 2YWYA 3DJSA 4ZMOA 3KH4A 1FYTA 3ARBC 3MLWL 4I3SH 3WUWB 4AEEA 4J5VA 4LMQI 5F6HI 2PCPA 1RP9A 2XRAH 5ANMB 5GRXG 4C83A 4W81A 4P23D 4NRYB 1N6QL 5EU6B 5DQ9A 1MPAH 2VT0A 2W9EH 4PUBL 4BA8A 1QFWH 3J7HA 5EWIL 4PJ9C 1TSRA 4PJDF 5CJXA 4HS6A 5IJVA 4LLMB 1T1WA 4DZBA 2BVEA 3QULA 3TL5A 2AQNA 4O02H 5D7EA 2IDQA 3T8VA 1KCKA 4AYMC 4Q7DA 4BK5A 3SYAA 4K8RD 3FUIA 3ZE0F 1ILUA 1I7ZB 3VWKC 1BMZA 3OJVC 3KPNA 3UG3A 2H0JA 3BPLC 1RZFH 5I71B 5KW9L 4F9PC 4H0LC 2EYRB 3ARSA 5HDOA 3ET9F 3SGDI 3NCJH 4IRZH 5LCVL 2DQTL 3SDXA 3WS3A 3GXDA 3VFNB 4YJZL 3NMEA 3QFJA 2NSMA 5DT1H 3W39A 3WJLC 3WO4C 5C6WH 3QNZA 5T33H 3KL0A 4JLRB 4JO4H 3NJMA 1INQA 3BAKA 3GZQA 3DYPA 1FBIH 5F7UA 2A9NL 1PD0A 3NAAL 4UT9A 3U4EB 1LWRA 3C5XA 4G1EB 4AQEB 1NBZB 4FXKB 3RA7H 2VJXA 5CF3A 2DH2A 4HHAA 5ADOL 1PY9A 4Y1AE 2ZCLH 2FBJL 2V4LA 5KWYC 2G3ZA 1NFAA 3QRLA 3J2PA 1J9CT 4TSBL 5JXEA 3MV7E 4F1ZA 5K9KA 1NAMA 3VGFA 2W0LA 4PJAA 2OR7A 3LRKA 2AJVH 2JJWA 1DDHA 4UQCA 3I6GA 4HXAL 4JHVA 3ZQXA 4P2QE 4ZMYA 4PN6A 5CMAA 3NIDF 1PGRB 4JG5A 4LRIA 1TFHA 4L4VA 3HPLA 2HVJA 4G43B 1BQHB 3MA9H 2XXMB 1UFGA 3LN5B 5A40E 1WZ1L 2DW5A 4QRUA 1YUKB 3B2MA 4KKLD 3CZJA 3H9HA 1OM3L 1O9VA 4WTQA 1FAIL 2Q0ZX 5J6SA 4Z7QB 2X4NA 5CWSA 3LIZL 2R0WH 4PJCA 1TXKA 3FTGA 3CSYB 4MAYA 3ZE1E 1XF3A 4NQCB 1YEDB 3QDJE 2OXHA 4WNQA 2NY3D 3N9GH 1F11B 1BIHA 5JIKA 1KFAH 5KZCD 3O41A 5E0FA 5I73B 4ZXBB 3HLAB 4NI3A 2CM6A 2WQ8A 3QEGL 4JHAH 3INUH 5A2BA 4JHBA 5HYSG 3MRCA 1MRDL 4NT6B 3T3MB 4BRJA 3AU0A 4DZ8A 3MJ6A 2ZUYA 3WTTA 4RQQB 3ZT7A 5DWPA 2XQYG 1FA4A 1QACA 2B59A 4Z7NE 1N70A 4RNRA 4YZFF 1HWGB 5AL8A 3ZXAC 1H6EA 5FYKD 4GKSA 1VADB 1KENH 5AB9A 4F3FA 1G9NC 4XWOC 5IIEB 4O5LL 1RZ8A 4DFHA 2W0PA 3U30C 2DLEA 1MREH 1Q9KA 3D18B 4F8PA 4FTVA 1SVCP 2DLIA 4PY7B 1IAKA 1BQ5A 2WTOA 3EOBB 2ZUQB 4NWTH 3MPCA 1XH3A 1HDMA 2FRGP 4JR9L 3C8KB 2DV6A 1N0LB 3RWGB 1IFHL 2WUCH 1HX0A 4RMVA 3P11H 5ESAA 1I1AC 4HJGB 2XICA 3L9YA 5J6HA 4FZ8L 4PRAB 2IPTH 2VN3A 2VN5A 4WK0B 1RMFL 3VTAA 3S3CB 4AKPA 4HAFA 3FO1A 3V7MA 3UBFA 2D7TL 2K45A 4R7DB 2ZX9A 3OHMB 5HJGA 4AG4L 2WO4A 1SBBA 3ZDZE 1A6VL 2YWZA 1ZV5A 3G08A 4IBVA 4XVSH 2VISB 3W0WD 1L9QA 5C0BD 4HWZB 4DCQA 2AI0H 4NLAA 3ZDWA 4DKEH 3QRGH 4FNLH 2OJEA 5DHYA 2Z92B 3Q13A 4DEWA 5CN3A 3X1EA 5DJ8B 1OGAA 3TA4D 3K0YA 2P8LA 1IVLA 1KELH 2BNRE 4AM0Q 4LNRB 5KYUA 5JIPA 1WTLA 5F8QC 2NX5B 4LL9A 4I1NB 1JNNH 2IQAA 1PCSA 4Y7MA 3HVNA 5GS0D 4NAJA 1FNFA 32C2B 4PP1D 3H2QA 2PXYA 4IYKA 3ROLA 4GP4B 1ZANL 2IPUG 2V8LA 5GHWH 3GDCA 3SYCA 1WE5A 4XO9A 4OY9A 4D0BB 4WKZB 1N68A 4MJID 5IMKB 4E41A 5ITFA 3CN1A 3MBXL 1YECL 1S8DA 3QG6A 1P4BL 3L1EA 5I1DB 4F15B 1ZPLA 5L2JA 1ZGLM 2EVFA 1OAJA 5CJXC 3HMWH 4KO5A 4D9RD 3FCGA 5K69A 1CTOA 3QUYA 4N24A 4A55A 5JW5A 4JKLA 1G9NH 1A3QA 1GAFH 1RZJL 4DIXA 3VFTB 5E5LA 1IC4H 4X9HA 4EBQH 2KPNA 3T9WA 2W65A 3V0VA 2MMXA 4JY5L 4OF5A 4NZUL 4U05A 3CUPB 1A21A 4PVNA 4RWYH 3MOQA 3IDJB 3UIZA 4H0GA 2C9SA 5EZLB 1RHFA 5FK9B 2HJKA 4WWKC 4U0RB 2FB4L 2DQJL 3BKYL 4GSRA 1EFXD 3MNZB 4GIOA 3AMLA 1Y6MR 4XPBL 1FVEA 2DJMA 4KKPA 4R4FL 1VA9A 5IV2A 2BWQA 3RIFF 2YR3A 3EBAA 3RU8H 4H8UA 4MA7H 3OGCA 1ASQA 4S1RL 5CHNB 5FO7B 4XNYL 1C16B 4ONFH 3SE8L 2YD5A 4HXBH 3Q06A 1Z5LB 3FN0L 2ICWB 4Q56A 4Y16C 3OHXA 3IDGA 4NPJA 5G55A 3PV6A 4IBLT 5F7FA 4QUOA 1HKLH 4DP7X 1D6EA 1QFWM 1JZ5A 3NACL 4BK8A 1XGQA 2OMUB 1JPST 2MPAL 4JPKL 4YLBA 5E4EB 1K8IA 2XX1A 4IOFC 3MREB 5CJOH 1EO5A 4IKIA 4ZO7A 3BDYH 2OYMA 1Q4NX 3QWRD 1DCLA 1WGVA 3QHFL 4RAVB 2XPZA 3TLRA 1WAPA 3N1PC 5IROD 2MRYA 3DK2A 1KJ3H 4NS0A 4LBEB 4G7QB 4HK0B 4JFWA 2QPDB 3QIBC 5DK2A 5I6OA 3D25A 1H8OA 4APQC 1RIVL 1MVUB 4G7YL 2G4GA 4KDWA 2FWOA 2ZX8A 4FQLL 1V3MA 5IVXE 1ZK5A 5CJ5A 2BSSB 4RSYA 4A2EA 5IESH 2J8HA 2X89D 1UG9A 4M93B 2BVPA 2NW3B 1A5FL 5HHMB 1A3LL 2XXGA 5D71L 2D2OA 3LH2H 3CMOL 3VU2A 3KDMA 3MRHA 3V4VA 4DAGL 4ZD3L 1V3JA 4XCYA 5DD6A 2OYLA 5EF2A 1NCAH 5ESQB 1UFUA 2Z93B 3EGDB 5DUPH 5F96L 5IK3B 3TT3H 2WNKA 3DKHA 4QNPF 3STLA 4AC4A 2Y1VA 2PYED 3N2JA 3DX3A 3QDGA 4J3OF 3VFVA 2YQBA 3EXJA 1WWCA 3HG1D 3QA3A 5F7LB 5T5FA 4M6NH 2VABA 1SXSA 4YHNA 3FHQA 4NZJA 2VDQB 4P23C 5DK0A 1L6PA 1GY2A 5D7JD 5GRVL 1GCYA 2CKBL 4FP8H 3T77B 2DYPD 5EZOL 5JPMA 3S5YA 3THML 2VQUA 4RISL 5CU9A 1EZLA 1SXAA 2WJ7A 1ZLWH 2C7FA 3GI9L 4PCTA 4M5YL 5IMLA 5CEYB 5FGSA 1INEH 5L4JA 3QPKA 2YRBA 4QRRD 4P2RB 2ATKB 1TU2A 4OV5A 2R15A 5IY5B 3VNYA 4K8RC 5I30L 5JW4R 2VZOA 3FB5A 3W2DH 1NC2A 1BZ7A 2APXA 5JYMA 1AQ8A 1UT9A 3T0EB 2EEBA 3NCYP 1JPFB 5B1KA 2IH9A 3ECVA 1EEZB 1FORL 3C6LD 5K9QI 1JI2A 1EZVX 1H3GA 1WO2A 3DMMD 2EAEA 4JREC 1NCNA 4FFTA 2B8OT 4M7LT 4M56A 5JLZB 3PJLA 1SJXA 1U21A 4MCMA 5I8CB 1XXDC 4Z7VB 5HDLA 4UM9A 3I3DA 3RNKA 1VRSA 4QOKD 3SDAD 1G6RB 4EE2A 1KTDA 2ERJB 4N87A 1JGVH 4LVEA 1FFOA 3MBEB 2BP0A 4JHZA 4Q4IA 3MJ7B 4D2NA 3BAIA 3D34A 3ILQD 5F1KC 1LK2A 3DGCR 4A7QA 4GQRA 3CCHB 4OZFB 2DKMA 4WQOA 5DS2A 1OTSD 3FUHA 5LVEA 4L3EE 3AW5A 3GMQA 1N8ZA 1VCAA 3P4MA 1TYJA 4ICWA 5JR1L 4XODA 4PJ5E 3P3UA 1KXHA 2X4SB 4KDTA 4DP6X 3O2VH 2HUHA 4BH7B 2PXYC 4QDGA 5ISZD 4GXVH 3BCDA 4NZTH 3JUYA 1X7TA 1P7BA 5GRYA 4ES9A 5E6ID 4NZRH 3P2BA 1L6XA 1V10A 1QRND 2APSA 5IHWA 5IUSA 3VDBA 3B4NA 1S9WA 4YBHA 1WIPA 1QLRA 1T5WA 3DX8A 1BPLB 3GSRB 2XA3A 5CR8A 4J2QA 1TTFA 4FQCH 4HKXB 3PABB 4PI2A 1SM3L 4W9LC 1MVFA 3MNVA 3HRZA 3GXMA 2C3VB 1YNLL 2NQCA 4KKLC 4M61A 3BC9A 3VH8A 4JFPA 1R3HB 2WVSA 4Y4HC 1L4IA 4XP4L 5DUMH 3QQ9D 2P80D 4JFEA 1S78D 3X11A 1NPJA 2AEPL 2XV6B 2F7IA 1GJUA 1U9KA 3L7FB 3OJMB 3PCYA 5AVZB 3RLSA 4K8RH 3NJLA 4HV8A 5GJTH 4HOZA 3STZB 3CDCA 5BUGA 1NANI 1ROCA 2O5ZL 5EA0H 3X17A 2VDPL 1QFOA 2DL9A 5ID1A 3WTVA 2NY3C 2CO4A 2C7UB 4QHNB 4KQ3L 2QPSA 1NPNA 1AGCA 1F97A 2VSCA 4XC3L 1KGIA 1TEGA 5KVFH 1YEHL 1ZT4A 3GIVA 3ARED 5JNYA 4U1IA 1L5GA 3HZYA 1XCQA 3OAYH 3KPLB 3DIDA 2D8KA 2YA2A 2OCCB 4LP4A 3A23A 2Y06L 3MLPA 1ZT1B 2K1MA 3M86A 4YHIB 5FCUH 1M71B 4QHLB 3T0XA 5BRZD 1CYWA 1NBYB 1YYLL 4YFLI 2WBJD 2G2RB 2H26A 2X70A 3N0PB 4B97A 1CICD 4EOWH 4PGJA 4LSDA 5LUMA 4OFQA 4Q9CA 5I1GH 4AQZA 3WFHA 1EFQA 4ANKA 3KMDA 2EH7L 4P3DB 3IPFA 5I1IH 2Y2TA 3MNMA 1CDUA 2O6FA 3NN8B 1C1EL 5KSBA 3ILPA 4ZW5A 4LEOA 4E0RA 3DSFL 1EGJH 3OZ9H 3DX9B 1PLGH 3GMNB 5E51A 3V4PA 3P9LB 2QADB 2NUTB 3B8YA 5D7IF 4MZ3A 4OLZL 2R0KH 4WU5B 2CA4A 3ZQWA 3SCMB 2KERA 1NDMB 3JBG7 1MRFL 2BY0A 4NQSB 3UBHA 4AMKH 4NGHH 4TSCL 3VYNA 3LCYA 4NPYB 1H5BA 1MDTA 2B7DT 4P9MH 2VDRH 2XX0A 4KVNH 3BQUB 4FHBD 1RZIA 1RK1A 2BVOB 3NA9H 4J28A 1TCRB 3GI8L 4OKVB 1GXEA 1IT9L 4G6KL 4YL9A 2P5WB 2WZPA 4R2GB 3L3HB 4M5TA 1UWEH 3D3VD 2VWEC 4WFEE 3W1ZA 3D85B 2Q7NA 4ZUVA 5GS0C 1OSEA 3EFFA 4MBRA 4MNQD 1OAKH 4IIQB 4PP1C 5GQBA 1PBYA 3OF6D 3U1QA 2VDLH 1BFOB 1I85A 1JZ6A 4L8CB 1YMHA 1MLCA 3GF8A 2DD8L 2B2XH 1VPOH 2VERA 4HUKB 3POCA 5DMGD 1CLZH 3B2DC 2XZCL 2ZJSL 5AZUA 5BOPA 1R3KA 3UZEC 2Y0SA 4HGWA 3RWIB 3KYOA 4WENB 2CDGA 1D5BA 2OTWB 5FR3A 3DJTA 2CMRL 1DBKL 5FYKH 1HEJC 4UINH 3EOAA 1HHHA 1F6LL 1G7MB 1EAJA 5DFVD 1A4AA 2IV8A 1KB5H 1MEXH 1YQVL 1TLKA 4D9LH 4XAWL 2NUPA 2YD3A 4HX1A 1CFTB 3FTUA 5F7KC 1XXFC 1NKOA 1NGXA 3I74A 2ADYA 5E8OB 4KK9D 2F7PA 4QT5B 5EC1B 5HI5D 1MI5D 2DIEA 5T1LA 4Y9EA 2TAAA 4YEFA 5C07B 3D39B 2OPCA 3LQAH 5T3ZE 5LBVA 3WXVL 1YMMD 4PBVC 3K8MA 1ADQA 2ODIA 4L18A 5TF0A 3VI3A 5B1JC 4GFTB 4PJEA 4XPHL 3EO1A 4TUUA 2ESVD 3CDFA 4BD4A 5CEZE 1R46A 3Q1SH 1RURL 1A6TA 1NGZA 5LBSH 1BIIB 1F1DA 4G71B 1J1PL 3MX0B 1A4KB 3WIAA 4A6YH 2PTVA 2VQ1B 3FQNA 4AYBA 5HYJE 1CFVH 2Y7QA 2A74A 1SJEA 1HSAA 3BRGC 4HEME 5C0ND 4TTGA 2C9AA 4FHJA 1H3WM 4ABUA 1SDDB 3I3EA 5JORA 1I8LC 4MAZA 1ZE3C 3HB3D 5D7LB 2CR3A 3T0WA 2RCSH 4B41A 2BVTA 4A7SA 4B9FA 2IH8A 3LPGA 4Z0XA 1JZEA 5GS0H 3OB8A 1CGUA 2VN7A 4TL5A 2SEBA 4C4UA 1UOKA 1EHLH 1KLFB 4NUMA 1AC0A 4JL1A 5AQ0A 4B27A 4HH9A 1BYPA 2AABH 2LTQC 2ENYA 3POHA 3CFNA 3QZOA 3LV3B 4JDZA 1NIDA 2YPLD 3BKCL 2F74B 5IROC 1OVZA 3US9A 3APDA 4YGVA 3MLZH 2VSDA 3F6LA 4S0HA 4ZDHA 4UMGA 3HRZC 1FYTE 1IM9B 1QSFA 3BHBB 4MAUL 1C7TA 2A6IB 4ZMLA 5FO9A 3S37X 1CF1A 2E4TA 1TKWA 4XMXA 4P2OD 2WXOA 5AB0A 2EXWD 3AQZA 4GG6F 4GRMB 4Q6IB 2UY6A 1DBMH 3OX8B 4YFDB 3BO8B 4HULB 3Q1EA 3VGHA 3FO2B 4RGMC 3DOIA 1GZQB 2EABA 4LCWA 1DJXA 5DEFB 5LGJB 3DTUB 4ILDA 1AE6H 2DQIL 3ARFA 1QUNA 5F1NB 1JNHA 5E8NB 2N59A 5F88A 2PCYA 1Z9PA 3GT6A 3ZQ9A 3IXTA 1JXFA 4ETQA 4NHUB 3WKMH 3I9GH 5L2KE 1BXAA 1Z6JT 2J6EH 1XSKA 1XB8A 3VFWB 1UASA 1YEKH 3ARXA 3ZDXE 2ZWNA 3MRMB 3AGVA 3G6AA 2JVUA 4NIYE <