2VW7A

Nitrite reductase from alcaligenes xylosoxidans - 1 of 3
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
335
structure length
335
Chain Sequence
DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title On-Line Optical and X-Ray Spectroscopies with Crystallography: An Integrated Approach for Determining Metalloprotein Structures in Functionally Well Defined States.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
total genus 92
structure length 335
sequence length 335
chains with identical sequence B
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2008-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2vw7A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2vw7A02
1PAZA 1ZV2A 2B08A 1CC3A 4BXVA 3OQRA 2I85A 2UX7A 5TK2A 2GB2A 1A65A 2FQDA 4AX3A 1JZEA 2I7OA 4MFHA 1L9SA 1BAWA 2QPEB 2J57A 3KW7A 4P5SA 4Q89A 3S8FB 1SHXA 2AZAA 1ID2A 3FPXA 2PCYA 1EZLA 1J5DA 1NINA 1CUOA 4A2HA 1BQ5A 1GR7A 3FSVA 4W1TA 4BDVB 4DPBX 2PP7A 3X1FA 3GXUB 4AKQA 4E9YA 1SFDA 3TA4D 3PXLA 2ZOOA 3NP4A 2VN3A 3FS9A 4WTQA 4YSRA 1XB3A 4A2GA 1WS8A 1KYAA 1TKWA 2FJSA 4G70B 1WA1X 1SDDA 1HFUA 2HX9A 2J55A 2X87A 4HZ1A 2J5WA 2PPCA 2XV3A 3EH3B 2Q5BA 4PAZA 3MBWB 2XLLA 4KNUA 3NJNA 2H47C 2P80D 3QJTB 2I7SA 1NIDA 1CYXA 3JT2A 4L0PB 1PZCA 2IWKA 5I28A 2VSKB 2YAQA 2PP9A 5LDUA 1W6WA 3G5WA 3U25A 3HEIB 4KOBA 3NJHA 3AZUA 3T9WA 3C75A 1NIEA 4YSPA 1PF3A 2XX1A 3BVDB 4KNSA 2YARA 3ABGA 1KV7A 5I5MA 3WG7B 2BO0A 2UXFA 1JZFA 4TXVB 1X9UA 4CSPA 1DYZA 3IN0A 1L9PA 1JZJA 2PPEA 1AZRA 1XMEB 2YAEA 2XXGA 5I6OA 3UABA 2XXFA 4PCYA 4JKNA 1ASOA 2XU9A 1OE3A 5D4HA 1L9QA 3X2QB 1PNCA 1XB6A 1OCZB 3ERXA 2AZUA 1CYWA 4DPAX 1IKOP 5B3SB 5B7FA 1A8ZA 3WKQA 3OD3A 2HXAA 2DY2A 1V55B 3PCYA 3AW5A 2CBPA 2HX8A 1PMYA 2J56A 1NTDA 5F7BA 3WNIA 4DP0X 3CDZB 1JERA 4Q8BA 3NJMA 2CJ3A 1J5CA 4FA7B 5B1BB 1PY0A 2YXVA 1AOZA 2HZHA 3IBOA 2DWSA 5F7AA 2CAKA 2IDTA 2GC7C 4GXFA 2TSBA 1KCWA 4G71B 4KOCA 3X1NA 1SHWA 2BW4A 2W8CA 4DP6X 4ZK8A 1WAEA 5I6KA 3PAVA 2GC4C 3CVDA 1GW0A 3FU8A 4HCIA 6PCYA 2VM3A 3OMIB 2IDSA 3PAZA 1GY1A 4DP9X 2FT8A 2AVFA 1NWOA 1KBWA 2YAHA 4YSDA 2GBAA 1V54B 2FT7A 4JHUA 2YXWA 2A3TA 1UATA 1J9SA 1KCBA 9PCYA 3NJKA 1A4BA 1BXUA 2PP8A 1QNIA 5E9NA 1MDAA 4A66A 2XX0A 1B3IA 4F7KA 4KO5A 4WKXA 1PNDA 2HRGA 1QLEB 1CURA 3QJSB 1OF0A 4KO6A 5I26A 4BK5C 3FU7A 2XUWA 4M4RB 3AG2B 3L45A 1RZPA 1GS7A 2IH8A 2ZXWB 2GIMA 4UAHA 4AZUA 3QJRB 3AG4B 4DP7X 3CG8A 1JVLA 2EIMB 3UAAA 2OJ1A 2QDWA 1ET7A 3AY2A 1SNRA 3T6XA 1JXDA 1EHKB 2H5UA 1NIFA 2GSMB 1L9RA 1ASPA 3S3DB 2JKWA 1PLAA 1ILSA 4ENZA 5A7EA 1ASQA 2PPDA 3NJLA 1AIZA 2Q9OA 1PCSA 3UACA 2HRHA 1SF5A 2BP0A 3S8GB 1KGYE 3TBCA 1WS7A 3CVCA 3DTUB 3UADA 3H56A 5D4JA 3X1EA 2EINB 3OMNB 1A4AA 4F2FA 1A4CA 2P80A 5EHFA 4YVNA 2RACA 1JVOA 2TSAA 5I5JA 1OE2A 3SBRA 2R7EA 2XV2A 1JXFA 1GS6X 4DP5X 1OCCB 4E9XA 1NIAA 2YQBA 4KNTA 2BP8B 3ZX1A 2XV0A 2ZWNA 3ABKB 3NJIA 1BXAA 2IDQA 2AANA 1ZPUA 2IDUA 1AZBA 1IUZA 2MRYA 2FTAA 2VW7A 1F56A 2B3IA 1V10A 5B7EA 1FA4A 1OV8A 1YLBB 3NSDA 2IAAC 3FT0A 2VM4A 4QKTA 4DP2X 4QLWA 2VMJA 1KDIA 4NERA 3QJVB 4GY4A 4HHGA 4FAAB 4HALA 2JXMA 5I6LA 1KDJA 2BW5A 2H3XC 2OV0A 4UF7C 1NPNA 3DIVA 4UANA 3N2JA 1JZHA 5ANHA 1BXVA 1URIA 5B7MA 2BZ7A 1JXGA 2PPFA 2XYBA 2HLEB 3UGEA 5AFAA 1GY2A 3D12B 2UXGA 3FU7B 4GP4B 2EIJB 1N70A 1RKRA 1AANA 3CZUB 3AG3B 3ZBMA 2IH9A 2CALA 4GYBA 3FSZA 4A2EA 1JOIA 4HCFA 4BDVA 4HAKA 2DV6A 1MG3C 2AFNA 2QDVA 4YL4A 3NJGA 2FQEA 4JHVA 1L9TA 2GHZA 4YVUA 2QPDB 2X88A 1FWXA 2VW4A 3BQVA 4E9VA 2UXVA 2Y69B 5TK4A 1SDDB 5IY5B 1AACA 2FWLB 1DZ0A 4HCGA 3T71A 3V9EA 1M57B 1TEFA 4DP4X 3EF4A 2JFCA 7PAZA 2FNWA 1NPJA 4A2DA 1A3ZA 4E9WA 1MG2C 1AZNA 5PAZA 1JZGA 3QPKA 2DYRB 4YSUA 1OOWA 3HB3B 1HAUA 4NB7A 1M56B 4AKPA 2YAFA 1TU2A 3ZDWA 4KO9A 4DP1X 1NZRA 3H4FA 3NP3A 2QT6A 3FYIB 1RCYA 4HIPA 2UXTA 4HHWA 4M3HA 1BYPA 4N4YB 2WO2B 1GS8A 3FU9A 2IWEA 1AZUA 4GP8B 4P5RA 3AG1B 3ASOB 5B1JC 3NJJA 2EILB 3T6WA 2PPAA 4K9JA 1PLBA 4KO7A 3V9CA 3TBBA 4G7QB 1AS6A 3TASA 2IDFA 3PPSA 4F2EA 1RZQA 2BWDA 2HX7A 6PAZA 1HAWA 1AZCA 2UX6A 3FQYA 2VSMB 2CUAA 1PZAA 1IBZA 1BYOA 3H4HA 4YSSA 3GYRA 4YSEA 4E9QA 1E30A 1JZIA 2LLNA 2BHFA 3PAUA 3NSFA 3JTBA 4YSOA 1GSKA 1SF3A 1OCOB 1XB8A 1N68A 2GI0A 1ZIBA 3X1BA 1ZIAA 5I6MA 1OCRB 3SQRA 1KBVA 3EH5B 4W9ZA 2FT6A 1ETJA 5I6PA 1BEXA 5B1JA 4RH4A 1AS7A 4X4KA 1TEGA 3CDZA 1AS8A 2PLTA 4GP5B 1M9WA 1SJMA 3IN2A 3FSWA 3FQ2A 1ADWA 3DKHA 3FYEB 3SBPA 2CCWA 4A2FA 3NYKA 4A68A 1W6LA 1GYCA 2MTAA 2IWFA 3KW8A 4E9TA 2DWTA 3EH4B 4AKOA 3WKPA 1IC0A 1J9RA 4YSAA 1WA0X 3N55A 5I6NA 3X1GA 4BWWA 2YAOA 3NSYA 2ZONA 4E9RA 1AG0A 3ABMB 3IEAA 4YSTA 1L9OA 1ET5A 1E5YA 1IBYA 1OE1A 4BXSV 2XWZA 3CVBA 4NAJA 4DPCX 4A67A 2FQGA 3WIAA 1NICA 1MZZA 1ET8A 1NDTA 2E86A 3FQ1A 4N8UA 1PZBA 2EIKB 3SBQA 1BQKA 1QHQA 2OCCB 4E9SA 2BZCA 4YSCA 1AR1B 1W8EA 3T6ZA 3QJUB 3RYMA 1ZDSA 1SFHA 1E67A 4G72B 1E5ZA 3EHBB 5AKRA 3NSCA 1J9TA 3QQXA 4G7SB 3S3CB 4BWUA 1NWPA 3WNJA 2BP0B 5B1AB 1X9RA 2XVBA 4AI7A 4BWTA 1VLXA 5I5IA 4YSQA 5AZUA 1MZYA 1BQRA 3NJFA 3NT0A 1ILUA 2NRDA 2R7EB 3ABLB 2YAMA 7PCYA 1AQ8A 1WA2X 5FC9A 1AAJA 3FPYA 1FFTB 3ZIYA 2WSDA 2BWIA 2W88A 3ASNB 5PCYA 2BP8A 2WO3B 2PCFA 3S3BB 3OMAB 2FQFA 3TU6A 1E65A 1T5KA 2VW6A 3QJQB 3MX0B 1NIBA 3WI9A 3PLYA 2DYSB 2YAPA 3GDCA 4DP8X 4EF3A 2N0MA 3T6VA 1ZDQA 5B1KA 8PAZA 4G7RB 1I53A 3OM3B 5D4IA 3FSAA 3IE9A 1PLCA 4CSZA 3UAEA 2Y1AA 1J9QA 1R1CA 1AG6A
chains in the Genus database with same CATH superfamily
4L3EE 3ZJAA 1TQSA 1IAOA 2WLNA 2XFXA 3OPZL 3QDJE 5GS2D 3BP4B 1MREH 2BOBB 3K0WA 2MCG1 5K9QG 5KYWA 5D7LD 2GT9B 3ESUF 3TJEH 4W9IC 3VXNA 1HL9A 3QHFH 4AX3A 2IEPA 1JRHL 1ERNA 2QTEA 4UDTA 2AV7B 1SHXA 2EVJA 1C7SA 1Q0XL 3QE5A 4NKDA 3VXPA 2Y07H 3EYOA 1AGDA 3B3IA 1Z9MA 4L5FE 4V2BA 5CJOL 4BELD 2JKSA 2ZD0A 4DGYL 2DIJA 4KK9D 1JPEA 4M8QB 4EI5A 4B3VA 4GSDH 4WK0B 4XNQB 4P46D 2DQHH 4IRJC 4L29A 5FXCH 5IMOA 3K6SB 5JIDA 4B95C 5DFWH 2ATAA 4WTQA 4PRNA 1JAEA 4KZ0A 3V4VB 3F7LA 4YXLL 5KBPA 1V3LA 4OJAA 1EQWA 4OLXH 4WNJA 2X87A 1O6SB 1SDDA 4H8HA 1SLVA 4NYLA 2PPCA 4U1GC 2WVVA 3BPOC 4G80A 4TYUA 3FQWA 3G5VB 2EDDA 3L1OH 3WCYA 4ETQB 4N2IA 4LVNB 5IGXL 2GJPA 3MV9D 1CU4L 4UILH 1CYXA 3TZVB 4A37A 4AUYA 4ZG1A 4QRUB 3LMJL 1E43A 4LSTH 1MFMA 3IAQA 2WKLA 3SGDH 2BVEA 4RQQA 4YDKL 1EXUB 2FRGP 4WWKC 4AV5A 3II2A 3WIFA 3Q43A 4YHKL 2CCLA 1P7BA 4OIFA 5EOQL 1J1PH 1OHQA 4OCYL 1AGFB 1UB6B 2VL5A 4YHML 3DO7A 1NFIB 2YMXH 3QHZH 4CKVX 5E2VL 2IPTL 3DO4A 1QBLH 1J8RA 3QC5X 1PZSA 3ABGA 1T0OA 5ID0A 3HNSH 2YGVA 5KW9H 3GNMH 3CFIC 2Z31D 1JZFA 4F93B 4RMQA 4LKCB 5CJQH 4POUB 1FDLH 1JVKA 4Y9CA 4Z0XA 5HDQL 1M7IA 1NDGA 1HQRA 2LAGB 4J8QA 4AH2A 1EUUA 2YBRA 4ACTA 4JAMB 3ZL1A 4J3OF 1GJUA 4OD1L 3GJFB 3PGDB 2BY0A 1KENL 1ETZA 5I17A 2J72A 1MF2L 2VUYA 5FYLH 1E8WA 3DWTA 5B3SB 2ICWJ 4MX7A 1TMQA 1K6QH 3HPLA 2TRYA 3HC0A 3RWDA 3IMBA 2N1TE 4HOMA 5F72S 2CBPA 2ORBL 3H9SA 1UH2A 1D5ZB 4X6CF 3DXAB 2ADIB 3B9KA 4WW1A 4OBRA 3SBWC 2A4ZA 4IRZH 3NJMA 3ZTJH 4I0PC 3UZEA 1OCWH 2Y36H 1KLFA 4LEOA 3G6DL 1EJOL 4M5TA 1OANA 5E4IA 2NSXA 2EDOA 4G71B 3GO1H 3SE3C 2BW4A 5D5ME 2R0ZL 3CHOA 4C4BA 3ULVH 2R51A 3L5JA 2MQCA 4BH7B 1QI4A 2P9RA 1ZEAL 3BWUF 1KIPB 4G5ZH 2F5AL 5IVZA 4PRAA 5HJ3A 4EIBA 4LEEA 1I8KB 2YJLA 2VDQL 2VM3A 1C1EH 3TVMB 5KVFL 4DP9X 3HR5A 3WUWB 1AJ7H 5HYQA 1QFWH 2F7PA 4HHAA 4YBQC 1V54B 1KEGL 4TVPE 1JD9A 4XPAH 4WGWB 3V4LA 1GYAA 3O2VH 1D3CA 2WXKA 1KCBA 2J3SA 3FO9A 3G9VA 3LN4A 1BXUA 2XIBA 4XH2B 5IOPA 4JJHA 4QY8B 4UM9A 4PWKA 3DRQA 4AM0B 4LIQH 1NCDH 3JWOH 3UPCA 4N6RA 4K2UH 1D5BB 3OSVA 4LPVA 3CDYA 2H32B 3QUXB 5DFAA 5GRWA 3D0VA 4PJAE 1OT2A 1YPZF 2WOYA 5TQ0L 3DGGA 5J6HA 2NY1B 2GIMA 4JREB 2LT9A 1IL1A 4AZUA 5T8IA 5C0EB 2VDLB 5DJAB 3ARBD 2WXGA 3ISWA 1ZPLA 1TVHA 2QVFB 1J8SA 1NCGA 2VLJD 2ZCZA 4KRLB 4PN6A 4NZUH 4LCVA 1C12A 1ASQA 1NMAL 1PD6A 1U3NA 2Y72A 2D73A 1BD2E 2ZCLL 3MRNA 3QJZA 4PGDA 4UDUA 3VCLA 1DDHB 2HKHL 4OCNC 4FL4C 4OIBA 3QJFA 1FP5A 2ZCHL 1MKFA 3IS1X 2UZYB 4ATTA 3K6NA 5INDA 3HNTL 1LTXA 3IJEB 3QH3A 3H56A 1DJIA 4HD9A 3TN0A 4F91B 1DVYA 3OL2A 1IBDA 1A4AA 3S4SA 5CSZB 4QHUB 5CSBA 4NXKA 3ZHFA 1X9QA 2ZKHL 1MUJA 3BAYA 3JYBA 4PJ8D 1N8ZA 4Y19A 4ZOAA 4MNHA 1N19A 2ED6A 2D7MA 4U0RB 4OUUB 3GB7A 3VMPA 4IIZA 4MNQE 3C5JA 4K7PX 3OQ3B 2IPUK 3EOAB 3WN6A 1TSRA 2P42B 1CLYL 3E6HA 4X8JA 4TNGA 2XY2A 3HI5H 3M7OA 4PB9H 1CTOA 1PG7X 4JW3A 4RX4D 1L9NA 2AEQH 2I69A 5T5FA 3JVGA 3T2OA 3VWJA 2OI9B 3FT0A 3NFPA 3QIWB 4ES8A 4IMLB 3BZFB 2YIHA 4NHCH 1NBZA 1Q9OA 3OXSB 3SE6A 1HCYA 2Y4SA 1VADB 4GW4A 3I2CH 3X3GH 2VXUL 1JZHA 1NGXB 1OLLA 4HIHB 1RIVH 2I60L 4B7LA 2PPFA 3FTGA 4BGLA 4PGBB 5IIEA 2VE6A 4LVNC 1G9MH 1A1OA 5DJXA 3V0EA 1B4JH 5F1OB 3KPOB 3TZVC 5CLXA 1H5BC 1S7VB 5BZDA 5J1TC 3FQXB 2CIKA 1CFQA 1U8JB 3FSZA 4PJ9B 3O6FA 3QORD 2VDNH 4EAEA 2NY4B 3KD4A 2R59A 4YL4A 3TWCH 4YVUA 5FCSH 3U7WH 1E50A 4D7BA 4Y8DC 5T1KA 3ARYA 4AG4L 4FHKA 5L88H 4N2GA 1WTGT 3CV5A 4LGSB 3IXTB 1M7DA 4I1RA 2QZQA 2NTFA 3LKSB 4A2DA 2CK0L 1UXLA 1U21A 4JPKH 4YQXL 1OAQL 3HN3A 5AW8B 3QXDB 4NB7A 1X5GA 2R27A 4FFVC 5IEKA 2LHAA 2WQVA 2NXZB 3QAZB 1QNZH 3ZDWA 1IGCL 4UQ2A 1GGIL 2LVEA 5C9JA 5JQ6H 3UIZA 5E6YA 3SE9L 3P4MA 2WJ5A 1AE6H 3MR9B 4NUJB 2M83A 3T1FB 5E2TL 4FYQA 1HZLA 3RVVD 1N10A 1QPPA 3MRDB 4WNQA 5IHWA 4K4KA 2WN3A 4N4YB 4DCQB 5ADPH 2WINB 2QHRL 4GAJL 4XVJL 3TEXA 1MFCH 4JM2B 4LHQB 3SYPA 2NY0C 3ULUD 3T6WA 2KUTA 2Z31B 5LNEA 4G9FE 2FATL 2NW3B 3TNMB 1EVUA 2CZNA 2H4EA 5LGKA 4HG4K 3L4ZA 3OJVC 5E4OA 4AMWA 43CAB 4BZ2H 2AJ3A 5K9JH 1DQMH 4XCYA 5DD0H 1BYOA 3OJDA 4B6ZA 4IMKA 4JHAH 4JKKA 3ROOA 2DPKA 3AB0B 2BHFA 2O5XH 1RZIA 3DV6A 3GZPA 4HISA 1QSEA 4NCDA 4YSOA 3V4PA 5IFJA 4E42B 2I9TB 2MMXA 2PF6A 3V5HB 4KZEH 2P45B 3P4NA 4ZZKA 1XTMA 1KC5H 2R2HA 5A6MA 1I3VA 3TVMC 1FO0A 3UERA 1BF8A 5EIQA 2Y24A 4UQEA 4W9ZA 3UJIH 3UPRB 5DZ9A 4X6DF 2XBDA 4IU3A 4CGTA 1MVYA 1Y6KR 4LESA 4HPHA 3N85H 4ONGH 2C4FT 5MP6H 1FBIL 1CE1L 5CLZA 4HIXH 4ES9A 5JQIB 1KJ3H 2CWRA 3IPEA 6FABH 3HG3A 3QUXC 1EZUA 5DD5L 5I0YA 1S4IA 2X7LB 2NY1C 3FUKA 2NDFA 3DLQR 5AB1A 4ZXBD 3RDTB 1UA7A 5CD3A 1GZHC 2DWTA 2P8PA 3PP4L 4DKEH 5KS9A 5DK0A 4AKOA 5KVDH 3ZGIA 1XFPA 3Q2WA 3DIFA 1YEKH 1UM6L 3NA9H 5TDPA 1UG9A 3RG1C 2XTJE 5EU7E 1F5WA 5K5YA 2X4QB 4X4ME 3ZYOA 1NCAH 2DQCH 1L3NA 2R69L 1L7TL 3MLWL 5D8JL 2OS7A 1I1YB 4FG6C 1NJ9B 1Z5LA 2W07A 4N2NA 1C5DB 1CGYA 3CJJA 4RMRA 5CJ8A 4PBWD 5ES4B 2JKTM 2L3BA 3JZ7A 1QHPA 5C0FA 4NQQA 2V2WA 4JHWH 4O2EA 4PJIF 4RNRA 3NRFA 2QADD 5FLUA 1J12A 1QLFA 4TVPH 3WY1A 1ACYH 2WVTA 1ET8A 1CDGA 3FQ1A 4FG2A 5D72H 1IARB 1VKXA 4ORGB 4DETA 1ETA1 3O6KH 4PJGA 2V7NB 4APQB 4ABUA 3RYMA 3W57A 3WFZA 4FNLL 4OZFH 2VLJB 1FYTA 5GGTL 1A4KB 4GKOA 2P5EA 2DQJH 2ZPKH 4M7KH 2OI9C 1BM7A 5GS1B 1ZCRA 3QIWC 4LLVA 1ZMYA 5JHDB 5KJRH 1TFPA 3PRZA 4L37B 4J3UA 1E27A 1BBDL 1R6VA 5CM1A 4X6CB 2WVUA 5KG9A 1L5GB 4MB1A 1I9IL 1OKEA 4ZD3L 4ZBJA 3TURA 4RFEA 3QYMA 3EH2A 1NFDA 2DI7A 3GZKA 1D5XB 1P7QD 3FULA 3TTYA 4QHNA 1EEYA 5C1MB 1CR9L 1NGZB 3QZWG 2AQPA 3T65A 4KK9C 5L2JB 3CZKA 2DL2A 1QWUA 3DSNB 4ZPVA 3W0WA 2WWMD 1ZT1B 2OZNA 3FSAA 3FB8B 1UOWA 1KELL 3RTQA 1N0XL 1IGTB 2ITFA 3WHXB 1BSIA 2FB4H 1M3JA 1X7QB 3KVPA 4ENEC 4Y4KB 4NO3B 3BWSA 3FTWA 1R5IB 1G7HA 1SJVA 2WSKA 4MFHA 1WF5A 3WTVA 3B9EA 5IF0B 1H0DB 1VACA 1KCUL 4PQXA 3Q6FB 4AV4A 3FPXA 1JZ3A 1U3HA 4L4VB 1YQ2A 2XZQH 1K8DB 4Z7WE 3RQ3A 1NCNA 1YPZB 5ELIA 2NXZC 3FCTA 3KXFB 3N91A 3L3GB 2RQ8A 1AR1D 2FX7L 5FUOH 3NP4A 4FQPA 1S7TA 3CFBA 2VN3A 3FRPB 1IAMA 4N68A 1E8ZA 4XOAA 2HJKB 1ZD6A 1TKWA 3D08A 1I7UA 5F88A 1GGBH 2V9RA 2OJEA 3F04A 3EW3B 1LHZA 2E9JA 3X17A 1TLKA 3VYOA 3WEXB 2Z31C 4F24A 4KNQA 2B4CH 3CXHJ 4QXTA 4UQ9A 4BQCA 4LHUD 2WWKO 5IHZA 3SDYH 1LWHA 4AL8H 4NJ9L 4Y1AE 3B8YA 2KH2B 1QTSA 5GSVA 4X5RA 2FWOA 5ICYA 3TFKD 1JL8A 3OZ9L 3QDMD 1NSNL 1MAMH 1Q9LA 2ZJSL 3AB0C 3FXIC 2OTWA 3UIYA 3VXRB 1I9JL 5F7EL 4C56E 1IEBB 5CCHE 2WWNA 3NJHA 4G42A 4JO1L 3KG5A 1Z32X 4M03A 3VFWA 3J8F7 2ICEA 3TYGH 5T3XD 3KL3A 4WEBL 5I5MA 5DRWB 4BINA 3F64A 3IN0A 5F3HB 4LT7A 1DQVA 1A6UH 1BZ7A 3W37A 2FHBA 3TYFA 1ASOA 4N9GA 2R29L 4PJ7F 4HUXA 1RQ5A 1SOSA 1EAPB 4JFXA 1IM9D 3MRIA 3CC1A 3QRLA 3QAQA 2JK5A 1JWUA 4N0UE 3SE8L 5CWSA 4YZFF 1VB9A 1XF4A 4IJ3B 1EFQA 1TZGH 3TBYA 3QNYA 5GGUA 3UTSB 3WHE0 2GCYA 1LVEA 1TEYA 1FG2B 1O9ZA 1HZKA 2ESVE 3EJRA 1MVFA 3GFUA 2OXGB 4K3JH 4JFOB 5F7YC 4PJHF 3WSQH 5GS0D 1JPFA 2W9DL 5LAXB 1CVRA 4FA7B 1PY0A 4KKQA 3IBOA 5TQ2L 5F7AA 3P0VH 1SBSL 5D1QB 1YEHL 5L4FA 1ZT7A 1M6OB 2VDMB 1C9SA 4FKKA 2MQ0A 1MVUA 3JWNC 3O4LD 5BVPL 1AD0A 1WLHA 3C5ZD 3MRJB 5I1LB 4R0LB 5EA0L 5T3ZD 2XCMC 4QRQB 5TE6L 2NX5A 4APQC 4JFEE 4N28A 1CDHA 4J3OC 2K4AA 3BGFB 5EBLB 5LWYL 2Z35A 4OZHA 2YAHA 5SWZB 4UQBA 2HFTA 3LRSA 5CJXC 2FT7A 4QGTA 5GS1C 3A3YB 2DJUA 3GMLB 4OD2B 1U36A 5HGDA 4R7DB 5BO0D 5SWQB 1YEFL 4N9OB 4DESA 3Q2NA 4LCCA 1NCCH 3PQYD 4IOIA 1H6EA 2V3EA 3DRTB 4YO0A 4GXVL 4F15B 5ETUB 3TO2A 1XGRA 3HZYB 2AJZA 3S34H 3UAAA 4E9LA 3AY2A 1T6WA 1MCKA 3VSTA 4IIQA 4JUSA 5SWSE 5EF2A 4NT6B 5G4NA 3DYMA 3H9HA 4MMYB 4Y88A 3SIKA 4DW2H 4OZIF 1HEZB 1HCVA 1ZANH 3BWUC 1KCRH 2HRHA 4P2OD 2DWDB 2J6WA 1B0WA 3V6FB 1F02I 1GYUA 2XWDA 4FTVB 1G6VK 3VD4A 1JBJA 1EAJA 1F4YL 1QR4A 1DJSA 2WGNB 2P7TA 5I5RA 1P1ZA 4ABWA 4X6DB 4Y4KC 3ARDB 1A1MA 3TT3H 2VXVL 4LSRH 2RGSA 5DRNB 1NMBL 2XZZA 2PCFB 1HJBC 3DGCR 3GI9L 1J18A 5B38A 2DQIL 3J2PA 1XGZA 3FFOA 2M2DA 2MRYA 4KHXL 1OD7A 1OGAD 2JQZA 5T1JA 5IK3B 2NNFA 2XG4B 3U46A 4NQDA 4S1QL 1KUMA 4HMCA 3ZMRA 3BEVA 3QORC 2I5YL 3FT2A 3I6LD 4XPHH 2VIRA 4NN7B 1KTDB 3ZT6A 4XMXA 3HIZA 4J2QA 4ZUVB 3DIVA 3M8OH 1YN7A 3CX2A 4KROD 4UOQA 3WDJA 1DEEA 4G6KL 3STZA 3W5MA 1S7WB 4MD0A 3CZSA 4PJBE 2HLEB 5KANG 1JWMA 1SVBA 4G8EB 1EGJL 3VFUB 1DN0B 4PJIB 1FGNL 2YWYA 3POCA 4EQ2A 1N59B 1U8HB 3LXAA 5FECB 2WUCH 3AITA 5JDSB 2GKIA 1H6UA 2DV6A 3P73B 5E8EA 2IWGA 3UAFA 2GSIA 3NJGA 1K2DB 3WELA 4P23B 3D18A 5IB2B 3CQFA 2OJZL 4NENB 2H3NA 1CBJA 4I18A 4Y2LA 5D2LA 1ZSHA 3D0LA 1R75A 2ZSWA 1RUML 4XAKE 3EF4A 1P5UC 2WBWB 1A3ZA 1E8YA 2VUKA 2APVA 3NCEB 3RFRA 3VX1A 2BSED 1TT6A 3PDDA 4P3CL 2D4FA 3L3OB 1HL4A 4LHUB 4E5XB 2A9ML 2FEEI 4RFNB 5KYXB 1Y18A 2HFGH 2NT1A 1PYWA 3N40F 4KO9A 5DUML 4QRPD 1QD0A 3QDMB 5KSAB 1NLDH 4XI5D 1S8DA 2WTPA 3TWYA 4GW5B 4O4YL 3DX8B 4MJ5A 5AOIA 2JCCF 1QBML 4Z7OE 3T2NL 3U7YL 4IRSA 2ZKWA 3CVHL 4UV4L 3LZPA 3FONA 1OAYL 3ARFB 2IG2L 1M7XA 1LK2B 1T1WB 4Y4HA 1YEEH 5AW2B 3A67L 2IXQB 2VC2B 3MPCA 3TBBA 4XBPA 2PABA 3Q8CA 1T0NB 1TDQA 2YLHA 2X4UA 4L8BA 4HJGB 4KKCD 2NUPB 2XWXA 4OZGE 3VFVA 2WQXA 4QMEA 1N5AA 2WSPA 1XZWA 1OAUL 4CUCA 3LPFA 1WZMA 1R9FA 2QSVA 3V6OC 4QHMA 3NAAL 4QRTA 2R2EB 4XO5A 3RWFA 4MRBA 3JTBA 2FECI 3D48R 3LRGA 2Y2YA 3APNA 4ZXBC 2XQBH 2E5EA 2CO7A 2X3BA 4GG8B 4P2QD 5IM7B 3BGFC 4EIUA 4EN3D 2F8OA 3VD0A 4H1LB 3KPRD 3SKNB 5K93A 1DSWA 2BSSA 2OXHB 4ANKA 2BC4B 2D0GA 1X6LA 2HLFC 2WQWA 1BVNP 2AK4D 3GK8H 1HE7A 1TMCB 1AS8A 4P8QA 4AYFB 4P2RD 4JY4A 3SY0A 4IBZA 2WGXA 4YE4L 4RGNB 3C5SB 5F9JA 5CS7A 4FHJA 4HUUA 4WU5A 3KPNB 5F9OL 3O4LB 2FR4B 1FFPA 1H3XA 1HXKA 4JMNA 1DBKH 3NCWA 5EZJB 3C5ZB 3HPJB 4F15C 3FQ4A 4LPYA 5AYUH 5A2JH 1OSZA 1GZPA 5E08L 2WBJB 3NSXA 2VSCA 2HG0A 3AAZA 4N2HA 1WA0X 3F6LA 4ZW7A 2HMIC 1A7OH 2OK0H 3NESA 5CZKA 4ANVA 1NKGA 5B3JE 1JV5A 2OMUB 1GJWA 4MAYD 3DV4A 5HYJB 4M4PA 3F00A 3VXSA 1PQZB 3ZYIA 5E94B 2QLYA 3MCYA 3QXWA 3DMMB 2GJ6E 3HZKA 4U1MA 4YC2C 4ZW6A 1EMTH 1MHEB 1QUNA 3CFEB 1EEQA 4UT7L 5ID1A 5MEQB 4N8UA 4LU5H 1ZTMA 5AWNL 1P4BH 4FQ1L 1MCQA 4O00A 4PJ7B 2W95A 5DD6B 1SFHA 5CEYB 3BH8A 3QQXA 2GITA 3BZ4A 4UI2A 3KNBA 2YEZB 3KVDD 4JJ5A 5FS5A 3CNKA 3PWVA 4P2OB 3CK0H 3LZFH 3HAEB 4NN7C 1G94A 2AEPH 2CBMA 2QVKA 1YNKL 3AXLB 2OTPA 2OQJB 1ZRUA 4LB8A 1TJHL 1ZE3C 4PJHB 3GSQB 1UENA 1V3JA 5HHOD 3UAJA 3UC0H 4ODHL 3B83A 4BFFA 1TZ8A 1UXWA 4CVZB 2BWQA 4PSRA 3OG6B 5CP7B 2NZIA 3FPYA 4X6EA 5INCA 4GQ9L 1ULVA 1IAIL 2BWIA 2Q6WB 4Q9BA 2P8MA 3ZMEA 2OL3B 4JANB 2DQEH 4GO9A 2D3VA 1KEML 5SV4A 4HWEL 3WXVL 3D30A 5DK2A 1YN6A 1G1OA 3LDBB 3ZDZF 3FCSA 4LLYB 2IQAA 3P3TA 3OGOE 8PAZA 3LHAA 4Z7VF 2CHNA 1J9QA 3ULVF 4P23C 5EU3B 1KCKA 2BVOA 2E8ZA 5H4YA 2ZXAA 2BRRH 3CFNA 2G9KA 3S35X 4M62L 3HG4A 4F57L 2X44D 3KPTA 3CZNA 3MCKA 4JDTH 4KROB 1RUKL 1ZTXE 1SHSA 2R1XA 3BUTA 3PWLB 4Z5RB 1CJYA 4M6AA 3FHAA 4ZFOB 2EIDA 2PO6D 4MMZB 4CVWA 3T8MA 2WZPD 2J57A 4KFZC 4KKBD 4P5SA 4S2SA 1Y7VA 4E0RA 3QUMB 1TQBB 3L3OC 4XXCC 5FCUL 3ZHKA 4JRYA 2VOTA 1L0QA 4I0KA 1LO3L 2WYIA 1IO4C 3CAFA 4LFHG 5AB9A 5G55A 3SKJH 2HRPL 1KXQA 5HYFA 1MPAL 3TFKC 3X13B 3VRLF 2C1PB 2FX9H 3GZOA 4DT2A 4C4KO 4Q9QL 5KSAC 3PXLA 4GAYA 4LXFA 3QIUA 3ALWA 1AO7A 3V2AR 2YSSA 4Z77A 4MLIA 4OZIB 3S37X 1BMZA 3LSOB 2F58H 2GK2A 4EVNA 4UAOC 1NPUA 5AOZA 3ARXA 2AV1A 3QA3B 1DBML 3R8BB 4XR8C 1J1XH 1BECA 3UFIA 4A7SA 1QWHA 4PS3A 5IUSA 4R3SA 3QFJD 4Y8AA 5EO1B 1GOFA 1HI6A 1MNNA 2Q87A 5FYJD 5I9QC 1UZ6F 2IWKA 2F7QA 3LCYA 2PXYD 4DKFL 2HJLA 2G5BB 3GM0A 3O3BB 2AJYH 4W9FC 5ALBH 4PJGE 4YHLL 2XSKA 4KK8C 4IRJA 4JX0A 3FT1A 1KWKA 4BSVA 2CIIA 1U93A 1EJ8A 4S0TD 1Q94B 3AZUA 2GTQA 3WL9A 7CGTA 5IESL 4IK6A 3NCJL 2XKUA 4FNRA 1XSKA 1LP9A 4V11A 4JFFE 2YPLB 1N26A 1U3YA 3WG7B 4CSPA 1ORSA 5GS0C 1JGEA 4OGQC 2BY1A 5J4MA 1I1AB 5KVGE 4Q6IC 2WPGA 4KKLD 1RZJH 4NJAL 1YO4A 4IDJL 5E6IB 3ZUNC 5IB5A 5JOFB 1L9QA 3GXDA 1MRFH 3L4UA 1J86A 3GBLA 2ATPB 2B15A 5LUMA 1JP5A 2IAMD 4N5ED 3X11B 1HWWA 1FVDA 5IWLC 1PIGA 3C5ZC 3VG9B 3RZCA 5IJVB 2IH3A 3NJVA 4G43A 4KAQL 3MRKA 3GLDA 1RVFH 2ZWLT 4P2QB 1JNLH 3B1UA 1FYHB 2ARJB 5KEZA 4FQLH 4LGRB 5F6HI 3V7AG 3VFMB 1PMYA 1NTDA 3MRPB 3D52A 1MW0A 3QWNA 4OGAD 3PDOA 4TNWK 3F6JA 4I9XA 3VH8B 1J5CA 2AK4B 2VN7A 2X6UA 1UWYA 4GS7C 4QXUL 5T5FH 4JFQA 1KJ2A 2CDEB 4P2RB 5T5NF 2HUHA 2J73A 1LILA 5IFHH 3C8HA 2CAKA 1RK1B 1WDAA 3AMLA 3L3DB 4OI8A 3GSOB 3DMMC 4R84A 1BMGA 2XRAH 3LZOA 4FQ2L 3OHMB 3BHBA 3ZE1E 3MSPA 3RU8H 4M5YH 2UUDK 5DSCB 2EDWA 5CF3A 4XP9H 1Z66A 4BGDA 2W65A 1B0RA 3CVDA 3H42L 2BNUA 3MOAH 1EEZB 1PFCA 4HCIA 4HDIB 4KQ3L 4GQRA 5EUOF 3CZLA 5BZWB 4AJYV 4Y4FA 4XN4A 5L7XL 1JHLL 4RGOL 5IFAL 3EJZC 2IH1B 1IB5A 4JRXB 3WFDH 5FYJE 1WIPA 2JCCB 2A3TA 4GRLD 1DBAH 1OB1B 3LQAL 5CZXD 1F18A 1HQ4B 4OH2A 4P2OC 1FL6A 5C6WH 3KPSE 4UB0H 2R0WH 3C09B 1JNHA 1OARH 1PNDA 1OGPA 1PLGH 2R2BB 4PRDA 3C2SA 4NO2B 1JGUL 2O61B 3FN3A 4EUPB 1RZPA 2FLBT 2XBTA 4G8GD 5DQJB 2X4NB 1ECYA 1PY4A 3GRWL 3LKNB 3VXOA 4YE0A 3K5RA 5DDHA 5CCKH 5F7HA 1GJIA 5DJ2A 2WP3O 1CGTA 3IJ9A 3OF6D 3ZHLA 1OP3K 4HKXA 1BEYH 2H5UA 4TUKL 1U8LA 4TL4A 3LDBC 3RI5K 1JRHI 1WBZB 5FWQA 4EE2A 3BE1H 1AIZA 3SDDD 3W9EA 4HH8A 3KCPA 1KGYE 2G3NA 1RZ8B 4I8DA 2NXYB 4ZMPA 3WNNA 4PRID 3LH2H 1YEIH 4NZFA 4KROC 2OMWA 1IAIM 3O0LA 4PJFE 1M4KA 4UTBA 1RIHL 3GSVA 4MMZC 4E9XA 4LLDA 5ISZE 5ERWA 5EU5B 5DLML 4XP4L 3KAAA 3CSYB 1MCNA 4K7FB 1TQBC 4D9RD 5AYTA 2WNXA 1A25A 1MFEL 3L3IB 5M7QA 3CVIH 3PL6B 4PHXA 4G9DA 5JXED 4AQZA 5B7EA 4PWEA 5J11B 3KYNA 3KYMB 1S9XA 2WLHA 5J56B 3ZL4L 3D25B 4MNGB 3UTTA 3LEVL 4L9LB 4LCWA 4NERA 5DRXA 5BOPA 3QJVB 4NKIH 1DFBH 4Q6YA 2C4FU 2F54A 4UOW1 2R8SL 3KJ6L 4OT1L 3CD4A 3BAEL 1EO5A 4UF7C 1QFUL 1HYSD 2P8LB 2ZCKL 3BP4A 3OVUB 3V4PH 2HWZH 3QHTC 2HTLC 1Y6MR 2EH8H 5IW3A 4L1SA 2NCEA 2MOVA 1WK0A 2DD8H 2QPUA 1NOAA 2XYBA 5D5MF 1FO0H 1UVQB 1I7TB 1ZXQA 3WKMH 3ULUL 4TPRH 1RKRA 4HK0B 1KSRA 1ZTXH 1BG1A 1WFMA 1KTCA 4HS8H 3P4LA 4KKRA 3EGSB 1ZVYA 4M8QA 2XOTA 5C0AD 1Z3RA 1DLFL 3AS2A 4XVSH 4YDNA 4JHVA 3QDGD 4HS6A 2VJ8A 4XAWH 5BRZE 1L7IL 1QFHA 3C6EA 2X1QA 4J6RL 1XGQA 1WFUA 4O5LL 3V4VA 4Y5YB 3LAFA 2ZUUA 1BAFH 1JGLH 1O6SA 3RJDA 4AQ1B 1F6AA 2BDNH 3G5VA 3V9FA 1AZNA 3MKGA 1O7DC 3VWKB 4ETQA 3GMMB 1SZNA 2OMTB 3NFSH 4LCYB 4F7TB 1OOWA 4N0YL 1I1AC 2FD6H 5BO1L 5HGHB 1QFOA 4MB5A 5E6IC 5AVTB 2BVQB 4ZFQA 4P3WA 2APWA 3MBXL 4JFDE 5DCCA 1FVEA 4NM8H 4HUMB 1INQB 3N9GH 2BIOA 1H8LA 2J88L 3N43F 4DFIA 1GC1H 3LQMA 1E9QB 1AGFA 1UB6A 1LO2H 4JO4H 4I3GA 1ND0B 1KTLB 1NFIA 1BYPA 3JV6A 3OC8A 4KI5E 4UV7H 3UGXA 3ZDZB 3WLWC 3MLUH 3WAKA 3VGDA 3S0PA 4F7EB 3FQNA 2A74B 4P5RA 4Z7VB 1TIUA 4W9EC 1V05A 5HHMB 3RVWD 4HOZA 2SEBB 5K9OA 5IB3B 5AB2A 3TT1L 1FNFA 4YIQB 2AJVH 4U6YB 3IVKB 3ESPA 3B34A 1PIFA 4YK4B 4YL9A 4EO5A 4XP6H 1IBZA 4JAMA 2AEIT 1NEUA 2UUDH 5E23A 3RBGA 3GJFA 2IAMB 3PGDA 3PJSA 3QXAB 5EN3A 3D2UD 2TAAA 4P9HC 4XC1L 5CP3A 1N68A 1MCPL 4K3DH 5L2KE 5I6MA 4QJ4B 1IVLA 3K2KA 4NWTH 3TOPA 4WEEA 4EZLA 3BP6B 3LZLA 3TBVB 2IPKB 4YHYB 2CHDA 5BMFL 4ODVH 2DQTH 1D5ZA 2ADIA 4X4KA 3HMXL 1P4LB 5LVEA 2Y6SC 3EYVB 3SDAA 1FZKA 4W9JC 2ZTBA 4EJ1C 2V4LA 2ODHA 3C09C 3VXMB 4ALAH 2FH6A 4HWZB 1QSFA 4WFGE 5HDWA 3P3UA 3CLFL 3RHWK 3FFCD 4JG0H 4A68A 1W6LA 2VRKA 4RRPA 5EC2B 1T83A 4BH7A 3SJVD 4Y2NA 4OLUH 3GTNA 4PWJA 3ZRFC 1KIPA 1OP3H 4JM4L 1ACCA 3MUGB 2VLME 1I8KA 2JV6A 4YFLI 4UINH 3FOLA 3ILPA 5IV2B 2D0FA 2CO2A 2AQ3A 2AAAA 3CFDB 1HE8A 1MFDL 2XA8H 2F9BT 1UM4L 4M61B 2O93L 4ODSL 1T03H 3U4BH 3V0VA 12E8H 3EFOA 2X6BA 2NXYC 1A6VH 5CLTA 5JOPE 4AM0A 2MNJB 3KWXA 4R4BB 1PKQB 3IBEA 4PRBB 4HAFA 1THCA 4GINA 2XN0A 5DFTA 4WW2F 1I8MA 1AXSB 4QXGL 2H32A 1CQYA 3QUXA 4QHPA 2GAZB 2DW5A 4I88A 2E9IA 5I8OH 1JMZA 4DSYA 3DROB 5CLWA 3NABH 1E28A 3QEGL 3F6IA 1AR2A 1UACH 3K0YA 5C0EA 4I3SH 4TSAH 4FFTA 1ZDSA 3UYOD 2AITA 4X6FB 2B1OA 3PL6C 2CGRH 4XMLL 3WIHL 3QIBB 3ZQ9A 1YCSA 5J11C 4XMZA 5EORL 1NEZB 2VISB 3G5YB 4JVWA 1IBBA 4L9LC 3V4UL 1DDHA 4UM8B 3FT3B 2AI0H 3P2BA 5F0JB 4FLSA 3O0RH 3QQ3A 4LK4A 1H6FA 2F68X 1QW9A 3IDJA 4L3EB 2UZYA 3N1MC 4XXWA 4BUHA 1OAXL 2A4CA 3FSOA 4ZX3A 5CKAA 1WZ1L 1SN2A 2A77H 3TCLB 4LDEB 5D1ZB 1FFTB 1E7VA 4M6NL 1WWWX 4KKBC 4WUKL 2VDNB 1YNTA 4JDVB 4O51A 3CFCL 5H94B 3EOAA 3RY4A 3ARSA 4PWHA 2B1AH 1AHWA 1FH5H 3BI9X 2VW6A 5KYUB 3ATAA 4RSVA 3WMQA 3LN5A 4D9QE 35C8L 3FT4B 4HFWB 1I53A 2MKWA 2OR7A 1IC5H 4CSZA 5EUOB 4RLDA 5D6DC 1DE4B 3B7UX 1IKFL 3MLRH 4IMLA 4JHBA 4L2LA 4HZAA 43C9B 3A24A 1CS6A 3OXSA 2K6WA 3KVQA 1VADA 4Y5YC 3OKLB 1TF4A 1JDCA 1NGXA 3F7YB 4ZNCD 3DYOA 3KLSA 1TETL 1L9SA 1MHCA 4HIHA 5HJGA 5T3XL 1U4EA 3KLDA 1MW2A 1KYFA 3HUJA 5CBAB 3NIGE 3VWKC 3NDYE 4HC1A 1UH4A 5DQDH 1IIKA 2DQGL 4YOKA 1SGKA 5F7DB 3KPOA 1NINA 5E6ZA 2OAAA 4A2HA 2HPOA 3FW6A 4JFYB 1S7VA 2EDKA 2H6PB 3FQXA 2PXYC 5BV7B 3NIDF 1QYGL 4E9YA 1U8JA 4NHUA 4PJ9A 5HXMA 3G7TA 1T22B 3D39D 2ZOOA 5EDXA 1TSHA 5LNDA 3A6CL 1E3FA 4A2GA 1GZQB 5D55A 5MEPB 1KPUB 2OSYA 3ZIMA 1FNSL 2W9LA 3A22A 1MWAL 1GPOL 1I7ZA 3PABB 2VUOA 3HW7A 3L4CA 1GCFA 3IXTA 2RIKA 3MBWB 4NZTH 4ZFFA 3ULVC 1D5MB 3APCA 4FZ8H 2MPVA 5JHAA 4GIAA 2XT1B 1NAML 4PG2C 2DLEA 1BLIA 2OR9L 5HI5D 5GS0L 2Z1KA 5FHAL 1NGQL 3QXDA 4KKLC 3MRMB 1CFVL 4ZAKD 4YK4C 4J39A 2KPNA 5I74B 4YDJB 2CLZB 2ZOKB 1YHPA 1H8OA 1QVOB 2ED7A 2IAMC 4N5EC 2UWEE 3U25A 4YUEH 2QGDA 4KOBA 1YC7A 1BGXL 4DO4A 4TSCL 3MR9A 1K5NB 4GPVA 4NUJA 1SHMA 1PZ5B 1PF3A 5IB1B 2W0FB 5GZNC 3JWOC 4FQXD 3GJEA 2AJXH 2ZG3A 2W59A 5MENE 4XZUB 2EDJA 4JM2A 4EDXB 4YHYC 4OF3A 2XNAB 4OIIH 1ZWIB 2DTML 3VB8A 1KXTB 1PS3A 2NW3A 1INDL 1FAIH 1P69B 1TNNA 1HINH 3P69A 1GOGA 2PPEA 2X4OB 3NN8A 4FULA 3TNMA 2C9QA 4LPWA 2XU9A 1HKLH 4HKJA 3RDJA 43CAA 4JN2B 4L1HA 4DQOH 4WI9A 5D5MB 2BXZA 3HE6B 5FFGA 4Y9EA 5E1QA 1RUQH 3LKQA 5I1IL 2ZOWA 3LRLA 4NFBA 2BHYA 1RPUA 1W72A 5DI8B 2NY3D 4E42A 1T1YA 2I9TA 3COOA 3V8CA 3E3QC 1PBYA 2VH5H 1KIRA 1RZKH 1RUAL 3P11H 1T5WB 3DJZA 3L3KA 4XC3H 3MNVB 1A6ZB 4D8PB 2GTWB 3O2DL 4K5NA 4QTFA 3UYPA 1X5MA 3DOIA 1EO8L 1M2VB 2Z8RA 5CZXC 2AXJA 3JV4B 3D7PA 3WTWA 3DK2A 4CN6A 2X9YA 4HWNA 4PLJD 4PY7B 1CCZA 3C8DA 1R17A 5DHEA 2Y5TB 2VN6A 3MJ8B 3WJJC 1F11B 4DZBB 5DYOB 2CKBA 4OZFB 4TULH 4GFTB 4NI6A 4ZMQA 5C2BH 2CO4A 4Z7WF 2W8CA 3QWOA 2RFXB 5I23A 1P7KA 2ENPA 4G3YH 4OBSA 2X7LA 3SJVB 3U0WL 4AGPA 4D2NA 3PAVA 5I6KA 3FCUB 3STLB 1PDKB 1ORQA 3JXAA 2JVUA 4FZEH 5BS0A 3RDTA 2R0LH 2EVIA 4M02A 3GBMH 3DX1A 1NWOA 3QIBC 3F01A 2Q8AH 4OZ4B 2X4QA 4XMTA 4JHUA 2Z8WC 3N43B 1BD2B 1UB5B 1KGIA 1LWJA 1VPOL 2GJJA 2V9UA 4XHJD 3SDDC 4U6HB 3VRJB 3IJHA 4OVVA 1QNIA 4N8VB 4DH2A 4HPYH 1G9MC 5FF6B 1CDIA 4U1SB 4RA3A 3WUWG 1UFUA 9CGTA 5I8KH 1FRGL 1KCSH 2YD0A 5KVMC 3L45A 3UO1H 3G6AA 4N1CA 4MCZB 2VDPH 3WEOA 3AG4B 2APSA 4MNQB 4MTMA 3IGFA 3OAUL 4ORGA 5JIHA 2EP6A 3VQ1C 2FSEA 5DJ0B 3GPEA 2V7NA 1J5OL 4ENZA 1PLAA 4W4OC 5JXEC 1AHKA 3VTTA 4BHUI 4AENB 1A4KA 1N18A 2Q9OA 1Z9OA 5CJXA 3UACA 1AXTL 2VL4A 2X89D 3CLWA 3DC0A 5EB9A 1UH3A 4GKSB 3RWCB 5JZ7D 1QWNA 4N8CH 2MSPA 1I8AA 5ANMA 4UOJA 1ZHKB 4HF5H 4M93B 5CGMA 3GBDA 3BKYL 2HVJB 2NY2D 4XPGL 3QUZD 5IQ9A 2NCMA 3EJYC 5CINH 5FUZH 3MBEB 3SO3C 1D6VL 2D9QB 3POHA 4Q9RH 2XN2A 4S11A 4LNRA 2ZWNA 1TCMA 4WVRA 2J8HA 2P24B 2V17H 2Z7ZA 1MCHA 2AANA 3QR0A 3S35H 4B3EA 1D5XA 3BRDA 3B6SB 3UMNA 4HLZH 2DEWX 3K72B 3IFNL 4HJJL 3AT8A 4TL5A 1NGZA 3NSDA 3RWHB 4AVKA 3DPBB 3AGVA 3DSNA 1KDIA 3DX9B 3BSGA 5D7EA 3J07A 1DVQA 4JPWL 1ZT1A 4DGIH 1C5BH 1OOAA 2IGLA 3P0GB 2R4SL 3VD7A 2OV0A 2XZCH 3Q1SH 4MDJB 1IGTA 4GUPB 5D7HA 3ZU8A 3WHXA 1RUPL 3VQMA 4W9LC 4ANXA 4HT1H 2WYTA 4Y4KA 4NO3A 1R5IA 2JKRM 4D0CB 1U92B 4PH8A 3HG1E 1H0DA 4TVUA 2CGYA 3S5YA 2DS4A 1NUGA 2Z9TA 5K1NA 2DJMA 3H54A 2F6AA 3HLKA 2DMBA 4XCNB 4DTGH 4L4VA 4WW2B 3QVAA 4UZSA 4HIIA 3RNKB 3BW9B 4H8WH 5J6GB 3S37H 3D3VD 5I74C 1YPZA 2MCPH 1QATA 4XCFH 4UQAA 4DN3H 2WYZA 3KXFA 1ZV5A 3WGUB 3Q01A 3CH1B 4QCIB 1OZTG 4OKVB 5CZVL 2QTVA 2L7EA 4FP8H 1RULL 5DR5L 3CN0A 5HHXL 1NC2D 4HZLA 3OC5A 2P5WA 2K9UA 4EKXA 3RVWC 3RY6C 5CSGA 3L5XH 4FLRA 4QRSB 2CO1A 2XPGB 3WV0A 1FPTL 2NNCA 1DANT 4G9FB 3EO0B 1AGCA 1XV8A 3ZL2A 5BW7C 2YFNA 1E6OL 4L18A 4Z8FH 4O02L 4TQIA 1K3IA 1HDMB 1HAUA 1INEL 4FNQA 4H7VA 5GRUH 2FZ3B 3EJPA 2NYKA 5DZVA 4K07A 2AGJH 1CFNB 1VFOA 2CXGA 1RK0B 1XEDA 3HE6C 3US9A 2KERA 1M1XA 1NAKL 5LN8A 3FYIB 4PRHA 1F58H 3VXRA 4Z7QE 1IEBA 4NX0A 1SMDA 2OSWA 2CMRH 1JPTL 3VDCA 3WENA 32C2A 2W80C 4Y2OB 5B1JC 3BCDA 4NC1C 4Q74A 4YDLB 3OB0H 4DKAA 4PP1D 1BPLB 4N2BA 4PJ6A 4IOFD 3CPUA 4X7SH 5DRWA 1JFHA 4MXQC 5F3HA 5ACZB 2NQ3A 4MA7H 4HIEB 1H3TA 2IOMA 2XWJB 1HAWA 2ALWA 2VZSA 3BDYH 2VSMB 3L2LA 4BFEA 4LSQL 3MRHB 5FHBH 2QVIA 4WEUD 1R46A 3UZQB 3VGBA 1MJUL 2CE6A 1CN4A 1E30A 4ZOEA 4R5XA 4OM0L 3U9UB 4M8UA 1TQUA 4ATWA 2Z7YA 5CJ5A 2EDFA 3A0OA 4AITA 2Z4TA 5EO0A 1Z9NA 4HOXA 5IMLA 4HUKB 5DVPA 1MLCB 3UTSA 4KJPD 3GTTA 4JBSA 3SQRA 1JHTB 3NIDB 3SGEI 4RFOH 3SKMB 2A7BA 2XTJB 2AAVA 4K73A 4MAUL 3MGTB 5AW1B 5KSBE 2OXGA 3T0VA 1SMOA 5IJCC 1B6UA 3LZQA 4HIJA 3P3YA 1WFNA 3T4AB 4OFIA 3Q2VA 3VTMA 4HBCL 5FO2A 4PB0H 5D1QA 1QKZH 3AS3A 4URTB 3SBPA 4A63A 1O7VA 4ANUA 3TV3H 5J0BA 4FQHB 3NYKA 4ZX6A 4NUGH 3GKWH 5GGRB 2Y07L 2LTQC 1BV8A 3G6JE 5JLZA 1MCEA 5I1LA 2I07B 4R0LA 5TFSH 5HGBA 4X9HA 5A2FA 1T6BX 4NZ8A 4WFEE 2QPFA 1N7ML 4JKMA 2G0KA 3WJMB 5SWZA 3L8QA 4I1PA 3L6FB 1VGKB 4FQJH 2ETWA 3GMLA 3MMEB 4YSTA 4OD2A 1P1VA 1KTBA 3AT9A 5SWQA 1V7NL 2CXKA 3NH7L 1ONQA 1AQMA 2X6AA 3L1OL 4KRPD 4LQFL 3VA6A 4BFKA 4ZFZB 1E4XH 1T7XA 4A67A 5KVEH 4UILL 2FO4A 4V2CB 1MCRA 3DRTA 5IVXE 5C08E 1XGTB 3P9LA 3MBEC 5EG6C 5AVXB 4Y16A 5H2BA 3DX6A 4M00A 4UMGA 1L6ZA 4WK2B 1EV2E 1QTYT 2A9DA 3FC8A 2B7DT 4M7LT 3LNIA 2P44B 5E5UB 3E2HB 3H8NA 5AKRA 5LBSA 5KBLA 4W9CC 4NLAA 3WY4A 5LLIC 4G7SB 2O5ZL 4NT6A 3W38A 1HEZA 5I1EL 3N1PC 1EANA 1P0SE 3V6FA 2B4CC 3RGHA 3H9SD 1N0LA 1MOEA 3F7PC 4WCYH 3ZDYE 3B9KD 2ALAA 1FIGL 3L4YA 4AL8C 4NPYB 5CILH 3BUBA 1FDLL 2KI6A 3L54A 3IFLL 4OZGF 1WA2X 3ARDA 3UTPD 3W81A 4PR5A 5E9AA 1LE5B 4FQQB 4N0CC 5AUMB 3MLZH 2EH7H 2H0JA 5HDLA 3L7EA 4AEEA 4MVBC 2PCFA 2DTSA 1E65A 1FFNB 1HZHL 2MH4A 2L7UA 4WW2C 4XB7A 3MX0B 1R3KB 5CGBA 4Z7WB 4XNYL 4UIMB 2VITB 3U0PB 4LVEA 1KTRL 1YEJL 5IBUG 5FYJL 3TEUA 3QEHA 3ZDXE 2BNRA 2CH8A 1J11A 4WHYG 1D5IH 4OTXL 2H0FA 1C5CH 1A02N 2VLKE 2ZOUA 1VGEH 2G2RB 5BPPA 4JFUA 2FX8H 2Y36L 4AK2A 5T1LB 5HTSA 3S88H 1S7WA 2DZEA 4UM9D 4JCMA 2UZXB 3MNZB 3H85A 4FXKA 3VSUA 1LLAA 2WZ5A 4AY0A 4Q89A 3GO1L 5B39A 1UQSB 1X4XA 4ZO9A 4ICXA 3HC2A 3B2PA 3VFUA 4PV9B 5C3LD 3B9VA 2AJSH 1R5WB 4PJIA 1MIEH 4AZ8B 5C0CE 3GS0A 4UT6L 4P57B 3U48A 1OHZA 3MLXL 4G5ZL 1N59A 4Y1AB 1KJ2H 4F8NA 5FECA 4F9LC 5J1SC 3NCFB 1SFDA 1E9OA 3IDNB 5JDSA 3F84A 2G9HB 2VDKL 3P73A 4HEME 1IBGH 3BSHA 4M1DH 1K2DA 4IEFA 3MA9H 4OJCA 4P23A 1HILB 4C56B 5IB2A 3WN5B 4NENA 1WAAE 5B3JF 4YGVB 4H44C 5LDSA 1BM3H 1KGUA 1ROCA 4H13C 3LHPL 4YDLC 5KWYC 4EPSA 3TN0D 1HU8A 1NCDL 1HWHB 4JKPH 5I8CB 3DJRA 4K2UL 3FRPG 2B16A 4N3TA 1JD7A 4EZJA 5AVVB 1UJTA 4Y19D 3JT2A 2EXYD 3CU7A 4E5XA 2WB1A 3RWJB 1I9EA 4FNUA 5GZOA 3TA3B 2JTDA 2DEYX 4PW4A 1SYVB 5J1AB 5KSUB 2KL6A 4WFHD 3B5TA 1ITBB 4WK4B 4N0UB 4GW5A 1LGVA 1BOYA 3DX8A 4NZUL 4PD4J 5E2UH 3T0EB 3VWJD 4M9OA 1MCLA 5C7XH 1CG9B 4KNSA 5F70A 2ESVB 4F37K 3ARFA 4J3TA 1I8LA 1KV7A 2XTJC 2O6DA 4QRRE 5EU7C 3W2DH 1T1WA 2IC2A 3QEUB 2HUEA 1IAOB 3AVEA 4KX7A 3V0JA 2LLLA 2XFXB 1X9UA 3F62A 3MLPA 3IWUA 3T4AC 5KYWB 3O6MH 3BN9C 1PEZA 2YAEA 1WVZA 3K4ZA 4R5VA 1EHAA 3FMGH 2ZAIA 3RX5A 4L3AA 3IDGA 5HI4C 1ICTA 5D2NE 4O2CB 2Q8BH 3IMRA 3K46A 3VGFA 5FUCC 2ZP9A 5AL0A 3VXPB 3ZTCC 3AJ7A 4Z7NE 1SOKA 1AGDB 1CYWA 3HI5L 1WP6A 4K94L 1TPXB 2AEQL 1JK9B 3M1BB 1CTMA 4EI5B 4GXUN 3QUGA 4J7RA 4GG8A 3O6FD 2GG1A 5IM7A 2XDHA 1JJUA 1U2HA 4NHCL 5A6IA 4NWUL 4I85A 5HD8D 3SKNA 3WNIA 4PRNB 3CDZB 3I9PA 5T1KD 4U6VH 2OXHA 1ZK9A 1HEHC 4XHJC 3ME0B 4AYFA 3UH8A 3EADA 4KDVA 2WVVB 3I3EA 4AEFA 4G80B 4JPIB 2VR4A 2QV2A 1W0VB 1KCWA 1K8IB 3C5SA 3A4EA 2ZNWA 1Y0LA 4KKAD 5IWLA 4CMHC 4DF9A 4KITB 3FUNA 2WLLA 3FU8A 3BKMH 1F4HA 2QFPA 3FUFA 4N2DA 3K6DA 4XMPH 3RB5A 2WBJA 3WIFB 1VSCA 3TWCL 5ACLA 3NTCH 2Z34A 5JYMA 4F5CA 3BCFA 3BJLA 3EGDA 1IAII 4P2CG 5IROA 3DO7B 1X5AA 2YXWA 5J6SA 1XX9C 3WDIA 3LS5H 5MERB 3LZNA 1N64H 5L0QB 2EEBA 5FYKE 3JUYA 3HFML 3T3PE 3Q6GH 1PQZA 5E94A 4PGZA 5GHWL 3AU1A 1UWEH 2Y6TE 1M7IB 1NDGB 2LFGA 2ZUSA 3ARUA 4TNWF 3TH4T 4PJGF 3V0WH 2ZF9A 1JVLA 5EOCH 1BDYA 2Y7MA 1NGYA 1QNZL 2PTTA 3QP3A 1CT8A 4ZTOH 4KQ0A 4PJ7A 5L4MA 1U9KA 1QLEL 5JQ6L 2OW6A 4P99A 2WXHA 4PPTA 4MX7B 4BFJA 2WXFA 5FA3B 2MKLC 2YEZA 3HPLB 5JMRA 1IZKA 3CC5A 4PJEE 3DTUB 3SYOA 3H9SB 3MQIA 1TTUA 4Z76B 4ZS6C 1MCOL 5LQBL 2P28B 5HGAB 3ISRA 3NGBC 4IBVA 2OQJA 4IBYA 2KLTA 3GMOB 5C0IA 4PJHA 3MXVH 3GSQA 3CMOL 5AW5B 4CNIA 1NFDF 1KLFB 4LEOB 5CP7A 4BZ2L 5K9JL 2ZUYA 1M05B 4NGHL 1Q1JL 3DSFL 2DJ4A 2IDQA 5CZRA 2BINA 1R19A 5TF0A 1MFBL 2FTAA 2YWZA 3ILQC 4JEGB 4NOBA 5C0ND 3F85A 5IVZB 1QRNA 4PJXA 4PRAB 2VM4A 4KJYA 5TE4L 1GMEA 2A0LD 1U8MB 2WXPA 1NANI 3HR5B 5HYQB 5BZZA 5IR1B 1MLBA 2X0VA 3UJIL 5EU3A 4AIEA 3WN5C 2VDOB 3VXUE 4F1ZA 1DBBH 3WU1A 3FF8A 5C6TL 4JKLA 1X5XA 5CP3H 1KGJA 1J8HA 3FO9B 4JL1A 3CCHB 5MP6L 1CICB 3RI5F 3PWLA 3DRQB 4HIXL 4ZFOA 3RVUC 4U3XA 5FKPB 5HBBA 4N6RB 1X3DA 4D9LH 3D0VB 1AANA 1I3GL 3DGGB 1SXCA 2IH9A 3NIFF 3X14B 2Y2TA 3UGUA 5KVDL 3TA3C 4DKEL 1YYLH 1RZFH 4N0FB 5EWIL 1U6AL 3X13A 5EDSA 3NA9L 2JH2A 4LAQL 1QX1A 4N90E 4PGCB 1CGUA 4F7PB 2QPDB 4GRMA 3EXJA 4P5KB 2P5ED 1ED3B 1O6TA 1ZS8A 2DQCL 4X5PA 2L8AA 3T0EC 3VG0L 4UDUB 1ZA3B 4PGDB 2NSQA 1OT4A 2Z0UA 3NZ8A 1XL6A 3LSOA 5AAWA 5INDB 2R69A 2VDRB 4PP1C 4XO9A 1SDAB 4JHWL 4PFEA 3DARA 3S4SB 3VM7A 3QPKA 4WFFE 2DYRB 5HHNB 2BFGA 1IFRA 3HB3B 1N8ZB 5M94B 4MNHB 1UWXK 3EOBB 1RZ7L 5D72L 1MFAH 4OZGB 1J87A 3LPOA 1HWGB 1SVZA 3MRLB 5IQ7H 3O6KL 5DUJA 3O3BA 2QT6A 4OIAA 1WPCA 2YS4A 1TPXC 1CFSB 2DQJL 4LHUG 4LRIC 2Y9RT 4ZO7A 1D7CA 4EI5C 4NBYB 4KJPC 3RL1A 4FE9A 4EIGB 3KEHA 3W0WD 1A9EA 1T2JA 3VDAA 5KJRL 4TOYH 2DYPA 1BQLH 1NCOA 4BKLB 3ASOB 2VDLH 3RTQD 1Q9OB 2YPLA 4YDMA 5HVGB 1PLBA 3P2DA 4GW4B 5C0BA 1FAKT 2XVKA 2ZYRA 3BAXA 1BA9A 3NEOA 3UJTH 3ZRSA 2X4RA 2F1BA 4OSUL 3FTGB 5AZ2H 4MHHG 5ENWA 5E6IA 5JOFA 2KDYA 4NI3A 3ECWA 4EZKA 3CQPA 4E9QA 5DJXB 4ZMOA 2EABA 5EPMB 2LLNA 1KIQB 2ATPA 1U3HD 2YPVA 3X11A 1SF3A 3MI6A 1D9KB 4PW3A 5IJVA 1ZIAA 3KPLA 3R1GL 1YAZA 2WTRB 3QQ4A 4XBGA 1BVOA 5IVOA 2ARJA 1PPIA 3E8UH 3IKCA 3C12A 2WYHA 3LPWA 3VFMA 5LCVL 4JY5H 1BQHG 3HMWH 2K70A 3VH8A 3RX7A 3MZTA 1UA3A 3FRUB 3BP7A 5E8PB 1YC8A 3S96B 3B2DC 4JR9H 3FSWA 2CDEA 5DUPH 1M7DB 4HWBA 4JCWA 1R24B 4M8RA 3BD5A 4KRPC 1RK1A 3L3DA 4H1LG 2CCWA 3ZRCC 1FORH 4XNDA 1XR8B 2FJGB 2GJ6B 3QZLA 5I1JH 3KW8A 4MS8D 2WUBL 3HE7A 2B9AA 5DSCA 5IEKB 3T8XB 1RU9L 3P2TA 3MUY1 4WO0A 5AW9B 4HDIA 2FO8A 4LASH 4M5ZH 4X9BA 1TZAA 5IW1B 3WFEL 2Z0BA 5CR1A 4OZHF 5BZWA 5FUOL 3QNXB 2XN1A 4JQIA 2GBVA 4HC1H 4XMKH 2QQKH 4IW4C 5EIIB 4HQQL 4E41A 3FQRA 4JRXA 4K8RL 1A5FH 2ZXEB 2VZVA 1TCRB 4AC4A 3QZBA 1MJ8H 4DERA 1JFQH 2N7SA 2W9EH 3LNHA 4KH2A 5JHLA 3MV7E 4JMXA 4L8CA 1OM3H 3B9KC 5A2KH 1OIOA 3I6SA 2B4CL 4MAZA 5EU6A 4NO2A 3UZEC 2BNQA 4ZYKB 4LRNH 4EUPA 5E7BA 1GCYA 1PZBA 2WXQA 2Y3NA 4NQCE 5F7WC 1LMKA 4XN2A 4E9SA 4PCTA 3LKNA 1H3WM 3ZMNA 1QEXA 1WBXA 2IBBA 2Q20A 3OJDB 4Z3TA 2HT3D 4G8IB 4X80L 3QEQE 3CN3A 2ZF8A 1RZIB 1X5LA 1J9TA 4RMTA 1QSEB 4ZW5A 3V4PB 4KI5F 4BWUA 4NBZB 5J7CC 1WBZA 3RHWF 2BIMA 1OD9A 4BWTA 1FO0B 2P26A 3K6IA 3V5DB 2CDFB 3F5WA 1RZ8A 4JVUA 2F19L 2QMKA 1IIIA 1CXIA 1UGKA 4L4TE 5FPIA 1A6UL 3C8KB 5DZNA 3PHAA 1NA8A 3U9PH 3GPSA 3OR7B 1ZHNB 1RIUL 4PG9B 1HHJB 2WSDA 2WO3B 1AY1H 3HAEG 4X7FC 4ZNEA 1DQDH 4GSRA 1P9MA 3VFTB 1J8KA 3CSYA 4K7FA 4XWOD 5H35B 4TUOA 2E7HA 3PL6A 4XN1A 2N0MA 4M1CD 1F4WH 4Z9KB 1ZDQA 4RBPK 5EBGA 2PYFB 1B4LA 5CD3B 4V1DE 2P8PB 3PNWA 2C9UA 1RMFL 3DIFB 4WUUE 5TDPB 2JXMB 5I1KL 3MV11 4BJLA 1MXDA 1OAZH 1X7SA 4HJ0C 4BZ1H 5F9WC 5TK2A 2FWUA 4PV1C 1MJ7H 2W07B 4JG1L 1W72H 1RZJC 3MV8E 1NBVH 2G60H 2I7OA 2NDGA 4PRPE 1BQUA 3K6FA 3P0VL 1DBJL 1IT9L 1KY7A 4MA8H 4N2MA 2YXMA 3LEYH 1RLWA 2AZAA 2V2WB 3PWUA 4RNRB 3VFOB 2XHNA 1J88A 1I7TA 1QLFB 1UWXH 5FO8B 5FYJU 4ZTEA 4AVIA 4HA1A 2HVBA 2EXYC 3CIQA 1YQVL 5GISL 2PP7A 2V2XB 3EGSA 1RK7A 2GJZB 4PJGB 5E9DA 2ICWA 2ERJB 2CKBH 2YMOA 4FN0A 1FYTB 3DUUA 1W0WB 4HEPG 3BFWA 5D2LF 4ELDA 4IHOA 3VWJC 1S3KH 3JVGC 4L8SB 1ECZA 1CZ8H 5IHUH 1HFUA 1F0LA 3BYTA 4X42A 4UT9L 4Y5YA 2RQEA 4L2YA 4JFFB 2C3VB 4AQ1A 5EC1A 1T89C 4H8UA 4AT6A 1J0JA 3PV7A 3EXLA 4BH8B 5C8JB 2OM5A 1BBJA 1TVDA 3GMMA 5KG9B 2OMTA 3K1DA 2RR3A 4LCYA 4PJ5A 4FRWA 4F7TA 1TU2B 4RFEB 3PG2A 1NFDB 3ILDA 3N1QC 3S34L 5DS1A 5JIMA 1UA6H 2MOQA 4L8DB 4X50A 2NY5H 1OL0A 4ZS7L 1WC7A 4IRZA 3T65B 4EDWH 4NQDD 1ZANL 1FZJB 1KTLA 1YECH 1QACA 2CUHA 3O6FC 4P05A 5I0VA 2NZ9D 3LEXB 4EBQH 4F7EA 2DBJA 2A74A 5HD8C 4Z7VA 2EXWD 2Q3AA 1MW1A 1IJNA 3KYKL 5C09E 2SEBA 4J3OH 4P5TB 1TR7A 1CE6A 3LNFA 4MBRA 1DTUA 2DN7A 2X4TB 1CI3M 4RMUA 4YX2L 1G7HB 4IJTA 5AALA 4AGNA 2R1YA 3HC3H 1VACB 1RI8A 1IZJA 2K7PA 4NN6B 4DWHA 3QXAA 4OLZH 4A6YB 4N85A 3FCTB 2WNWA 1SBBA 2XKNA 3NIFB 1R3IL 2C9SA 1SPDA 3BZDA 3HLAA 4KVNH 4O58H 1ZV9A 3EOYG 4TTDD 3DTXB 2ZSVB 1MH5A 2D8KA 2H2SC 2PWEA 3FU5A 4PUBH 2IALA 3ETTA 4XPHL 3TBVA 2IPKA 4DGWC 1OSPL 2N4IA 5AG8A 3C5XA 2CJ3A 1D5RA 5CFAA 1TKWB 3MNWB 4OD3L 5F88B 1P4LA 2OJEB 5JR1L 3KPSB 3EYVA 2F74B 3NFNA 1F00I 1SRDA 3MLYH 2TSBA 3I9GL 3VFPB 3VXMA 5D1XE 5ECJE 4HWZA 4JN1H 4YGAB 4EIZC 3ZE0E 3F2LA 4DP6X 4QKXB 5IHZB 1RJLA 2FSDA 2WZAA 2VZ3A 5EC2A 1ID5I 5A16B 2X6CA 4WWID 4TN9A 4OI9A 4RZCA 3K91A 4HPOH 2FWOB 1P4IL 4IMKC 4QXWA 3MUGA 1A66A 3S36L 3DHUA 4PBXA 2DKSA 5DT1H 4G42B 4CDHA 4IRSD 5SX5H 4AW7A 1F3JB 1DANU 3HBPA 5KVFE 4ZMZA 1U8NB 2IADB 2R9HD 4Y4HD 4WJG3 1VZHA 4Z3HA 3EBIA 3KWWB 5D7IE 3N40P 4KO6A 4R4BA 5TH2A 4BCYA 1PKQA 1KCVL 1DSYA 1M53A 1AXSA 1GS7A 1ZLDA 2EECA 2GAZA 3BT2H 3ARPA 4BSWA 4N9GB 3DROA 4HUXB 3QPXH 2UWEF 5C07D 2LU5A 1VERA 4JLRB 3MRIB 3ZLQC 1UCBL 1A7QH 2GSMB 3HJEA 2BSTA 4JVPA 3S3DB 4TNVK 5L6YH 5F3BB 4RBPH 2YR3A 5A7EA 1XF4B 4MHHI 3ZTDC 2GHWB 4Y5XB 3QNYB 2NY7H 2AHIA 1NEZA 1KMGA 4Z0BH 2VISA 1L9MA 5EZLB 3B2VL 1A7NH 2E9GA 2BFVH 3WHE1 4WWNA 3G5YA 3TBCA 1PEWA 3CVCA 3FT3A 1J0HA 2Y23A 1YEEL 5FDWA 4YHZH 4L3EA 1JPSH 3CVHA 2XQYA 3QDJA 4L1TA 4F80A 4R97B 3EYUL 1JVOA 4FCHA 5L8LB 3TCLA 5ICUA 2KC0A 5D1ZA 1U2YA 3RAJL 2NLJB 1ADQA 3SGKA 4MZRA 3A23A 1GC1C 4QTIL 5C7ZA 5IJDC 1AD0B 3IAPA 5CCJA 5KYUA 4ETYA 1JK8B 3KR3L 1GGTA 2GVYA 2XQBL 2WXIA 4HU2A 2NX5B 4HFWA 1Z3GH 5F6HJ 4TMPA 2ERJC 1JZ4A 2Z35B 3H3PH 1DE4A 1IC4H 4OZHB 2H3XC 4XO8A 43C9A 1BJ8A 2YRZA 1MIMH 3CGTA 3LRSB 1GKEA 4PWGA 5DZLA 5ANHA 1MWOA 4NIYE 2IGFL 3OKLA 1KJVB 4YHIA 5E99L 5HGDB 1JXGA 1F90H 4YXKH 3IMTA 3F7YA 5AW0B 4LCCB 1BF2A 4HJUA 4MQTB 1QQDB 4LDLB 3ZK0A 3OHXA 4HK3N 2IOOA 5CBAA 1G1CA 5C70A 4NZDA 4KJWD 4Q6KA 5C3IA 4EZMA 5AYUL 3X3FH 1XGRB 5B1CA 2AJZB 3F58H 2YBGA 4HAKA 4JFDB 4I0CC 3VFRB 3OPZH 2JJTA 2A4EA 1T22A 5F1NB 4ODTL 3MREB 5FLVA 3FN0H 1G9NL 4DEWA 4YLCA 5IY5B 1A7OL 1IKNA 1GZQA 1KPUA 3A4FA 2R0KH 1BIIB 1M57B 4GB9A 5C07E 4ALAC 4DP4X 3HHMA 3PABA 3V7AE 1Q0XH 4S1RL 5G4MA 3RTQC 1TZOA 1DUZB 1A7PH 4I3RH 2IFFH 2P7TB 2ZUXA 1D5MA 1TYEB 3R06A 1P1ZB 4DGYH 1JYXA 4PCSA 1EMTL 5FOBB 4HJSA 4FMVA 4LU5L 4Z7IA 1BFVH 1P4BL 4AYSA 1A7BA 1VAHA 4KBPA 3F7VB 3KGRA 3SOBL 1T04B 4S1SH 1QBAA 2ZOKA 5ICXA 5B38B 1CDBA 5D93B 4NN6C 5D7LA 1WGOA 1F3DJ 3DVGB 5HP5A 1K4DA 1JV2A 1RJYA 1XH1A 4R90L 5DUBA 4NQDB 5L2KB 1QLRB 1K5NA 1CLCA 4A04A 5BVJB 3LVTA 4WEMB 5IB1A 3BEVB 5IGXH 3CK0L 2R39A 4DHLA 4XZUA 3RY6A 4P2AA 4EDXA 4Q52A 1M6UA 5LBSH 1YSOA 2XNAA 1ZWIA 3MYZA 25C8H 1DEEB 3GIVB 3O3AB 2RB8A 3PPSA 5K59E 2BWDA 4MD0B 5CU5A 4TS6A 2CUAA 2GTZA 1KGWA 4WI3A 4RWHA 2BIIA 4JN2A 2D7PA 2XWBB 5D5MA 4JRYD 3MYJB 1CDCA 1I85A 1GSKA 4OFVA 4U1IA 1RFDL 2KT6A 4AOFA 1QRNE 4L23A 5D7KE 2R15A 3IFOB 1VFMA 3K74B 5DHDA 3AUWB 1U95B 3Q0HA 4MD5A 4Q4EA 2MEJB 2YEQA 1ETJA 4R9HA 1T5WA 3D18B 1KGCD 3QIUD 2MCMA 2H3NB 3MNVA 5HDQH 2BRRL 3O3DB 4I18B 1AO7D 5B1JA 4D8PA 2H2PD 1TTCA 2GTWA 5D2LB 1T6VN 4ZFGL 3WO3B 1M2VA 2Q76B 1PGRB 4FADA 3JV4A 1M9WA 2ICEC 2ZSWB 3FH5A 1LMIA 4OD1H 5GXBB 4PY7A 3GC3A 4LGPB 4CU6A 1D7BA 2Y5TA 3P77B 1KENH 3MJ8A 4ZO6A 3GRBA 4JY6B 1F11A 1MI5E 4DZBA 5DYOA 1MF2H 3KLQA 1YMME 4OLYH 4W9GC 3UBXG 3QQDB 1TJGH 3KYOA 1T03L 2ZZUT 3PREA 2MTPA 1W16A 2X12A 2YUZA 4PJAA 4W6YB 3QSKB 3TM6A 4HH9A 1EXHA 1ZE3H 1GKOA 2Z7WA 1IU1A 1PYWB 2ORBH 3STLA 1PDKA 3KPQA 3TBTA 3R7QA 5GGVH 1UJ3B 4XE5B 3B7TA 3NG5A 4IRJD 4MJIE 3SOTA 1S8DB 3BMWA 3UZVB 2X9WA 5I6NA 5K39A 4WSKA 2DF3A 4IRSB 4OZ4A 3G6DH 1EEUA 1BD2A 1EJOH 1N2RA 3IDXH 1T3FB 1JTPA 3VRJA 1ET5A 1KCLA 1OE1A 2F58L 4ZJ9A 4H0LC 2R0ZH 4Y4HB 1JHKL 3TXAA 5J5EA 4U1SA 3FB7A 3HC4L 3UL4A 3B2UD 1J1XL 1PW3A 4R97C 1HXMB 1Y1DA 4XBPB 2V9QA 2DKUA 3W9DA 1AQHA 2CPCA 2VDQH 4W9DC 1ZLSL 2X4UB 2XN9D 3SBQA 4YSCA 3DTDA 5I6XB 4MNQA 3T6ZA 3DNKA 1K4CB 5A6LA 2QVTA 1ZAGA 4IHBA 4NIKB 4XWOC 4Z7QF 3RWFB 3RZCD 2WW8A 4WHCA 4B9YA 1YZZA 4JE4B 3T77A 2XI9A 4XVOA 1T2XA 2Z64C 4P06A 3T2LA 3IT8D 4HSAC 5EEYA 2NUTB 2C9AA 3RWCA 1VLXA 1PD1A 3BQUA 5TQ0H 2DLIA 1BQRA 3NT0A 2KBGA 1ZHKA 3ARQA 2CLVB 2HVJA 4KUCF 2FAUA 1AAJA 1JDAA 3S8WA 1G43A 3MBEA 3ZIYA 5L9DH 4LCCC 4BBWA 3O41B 5C0JB 3KGSA 4X7CC 5FW8A 5F9JB 3MJ7B 2Z3FA 4I5BA 4WU5B 5E4EC 2P24A 1A14L 1FFPB 2BVYA 3F12B 1VJSA 1NIBA 1KB5B 3P3SA 5FR3A 2C1OB 2ZCHH 3B6SA 2Y7QA 3QUYA 4OCRL 1OSZB 1U3JA 3RWHA 4MJJA 3HNTH 4B96A 2IBGA 5JORA 3UG4A 5KSBF 4IIQC 3DX9A 4NQEE 4YHPB 4G8FA 5F1SA 1PAZA 4YHOL 2J1ZA 2B08A 2ZKHH 1MQKL 3OQRA 4JQVC 3CBJB 2QR0B 4N1HB 1KG0B 1AYRA 2RH0A 1Q0YL 1JV5B 2XZAL 5IFHL 1FQ9C 2H41A 3KL5A 3DV4B 5MHSD 2APTA 3VDBA 1CLYH 2EE2A 2FECL 4G1EB 1U92A 3VXSB 5KYNA 1ID2A 3G6JF 1GMIA 2V2TB 2WVSA 4KVCH 4XNXL 4M5YL 3FSVA 4EI6B 2F5BL 1HOCA 3BW9A 5J6GA 1RZKC 4DPBX 3MOAL 1A4JA 4BA0A 2OYLA 3JUZA 2WANA 2AEOA 2EACA 4TQ8A 5D93C 2BIHA 1CD9B 2UWEB 2DMHA 3P54A 1KT2B 1Y1UA 3GLEA 2XN9E 4U1KB 1XQ4A 3BZ4B 4QCIA 4U1NB 3WFDL 2I60H 5I16A 5DD1L 1BVNT 1C16B 4JPVL 3MRFB 1FCGA 2NZ9C 4XOBA 1T20B 2XV3A 4UB0L 4YWGH 5MENB 2EXWC 4JS7A 5J06A 3NJNA 1TQWA 4QRSA 1PLGL 2XPGA 5IVXF 3QJTB 1Q38A 2WXLA 2WTOA 3RBSA 4RX4A 1SY6A 4HXAL 4G9FA 3EO0A 2QPSA 2BNQE 3R18A 2YOAA 5IT2H 1HDMA 2VLRE 1JYNA 4KUCD 1DZBA 1WZAA 4X6EB 3MRQB 5CCKL 2P8MB 3LIZL 2FZ3A 1T1XB 1I7RA 2YAQA 2VO5A 3QWQB 5E70A 4F9LA 1CFNA 4L1DA 3BIAX 4GBXB 4AG4H 2WLIB 5DK2B 1IGFL 2XG5B 4PTTB 5FWRA 5DS2A 1NIEA 3VQLA 4TLKA 1TVBA 2X9ZA 2YARA 2CK0H 3UTTD 5KN5B 4LCWD 4TTDC 5AVWB 1ZLWK 4ZMNA 2F54D 2DLFH 2BVOB 4ONOA 1OAQH 3BPLB 4I18C 2VYRE 4WTZG 1DQLH 1LD9B 3BAWA 5KAQF 1YEIL 4TQHA 1JZJA 4NOFA 4YZWA 2G30A 3WEMA 5HYSA 1AZRA 2YGNA 4F7MB 5I6OA 4P49A 1EO7A 1XCQB 1XHHA 1IGCH 4JKNA 3NBNA 4HIEA 2E56A 2XWJA 1TTRA 1AKPA 3C60B 4M7ZB 3SE9H 4S2SB 3TEWA 3RNQB 4E0RB 3UZQA 3ERXA 1O6VA 4FA8A 5E2TH 4S0SD 3BO8A 1XCWA 2PYEE 2WK2A 3CVIL 5JOEA 2OMBA 1PG7W 4DPAX 4QNPE 2QHRH 3VI4E 4XVJH 1NCBL 5B7FA 2HFFB 2EDBA 5DC0A 1MLCA 2HXAA 1UJ3C 3FKUS 3TS8A 1VZIA 4HP5A 2H3KA 2FATH 3RUGE 1DFBL 2I27N 4GAYB 3QIUB 4GMTL 3MGTA 3SGDI 4X4MA 1AO7B 3IDYC 4IRSC 1GGCH 2YSSB 2YXVA 2FVNA 2F08A 2MJWA 4UQ3B 2VZOA 5BCAA 1NMCC 2EH8L 4M5SA 2Y5QA 4LSSL 1OGTB 2R9HC 4Y4HC 3SO5A 4NZRL 2AQQA 4BIKA 2AV1B 3BX7C 3EYSL 4OF0A 1OQOA 3QJHB 3PWPE 4F37F 3D5OF 3H2WA 3WKML 4XNBA 4X5XB 1IJ9A 4R3SB 1I4FB 3TZVD 5GGRA 5IEHB 4MZIA 5C86A 4KX9A 2I07A 2HJLB 2OSXA 1ZSDA 4YMPA 4HGWB 1G9EA 2R56L 1DCEA 2AVFA 4OZFG 4BSVB 1FI8C 1KBWA 1WAAF 2K45A 4KY1L 4WI6A 4XAWL 1FBIH 4ISVB 3WJMA 4AUJA 1XIWA 3WL9B 3IETA 3L6FA 1IGYB 1BJ1J 2BJMH 2PP8A 1E4HA 1WUNT 3IPBA 2F53E 1YYCA 5DD5H 3WBDA 2PCXA 3SE4A 4GO6B 1ORSB 1QPXA 3U2SA 3FU7A 2XUWA 5ALCH 3AG2B 4H8WC 2OX5A 5IHHA 2ZXWB 2FD6L 2XETA 1WIOA 4QOKE 3CG8A 1UM6H 2EIMB 3GSNL 4N8VG 4NAMA 4XPFL 5DD3H 3H2QA 4NM8L 2B14A 3MLWH 2R69H 1R0AL 1O7SA 4P0DA 1A3LL 1AI1H 4JO4L 1S7XA 3WY3A 3ZZSA 5JHBA 3CDGB 4B0MB 1VFUA 3D06A 2YSTA 3HJ0A 5B3NA 1UEYA 3JV0A 1AGBB 3H1ZA 2XKSA 3WY2A 2CJUL 3PDOB 4JFHD 4XVUD 2GEQA 1F4AA 2YXFA 4OF5A 3SDAD 4JFQB 2BVUA 1KJ2B 1QFWI 4K3GA 1YNTF 2XWRA 3L4WA 1IV8A 2XV0A 3DA0A 3GSWB 5CGYD 4AEHL 1LE5A 1E5CA 3NJIA 4XP6L 5HHPB 5AUMA 4Z7NF 2ZKXA 3INUL 3MU3A 2CKNA 2VLLB 3MLSL 4Z3IA 2WXOA 2KMWA 4RIRB 3BHBB 1IUZA 1NCWH 4KJWC 4XCCL 1FFNA 3QI9B 1R3KA 5DJYB 4Z7WA 1IBHA 5EC1B 5IOKA 2VITA 4K3DL 3U0PA 1BBDH 5B21A 3UBXI 1TO4A 2C9PA 5FK9B 2MPAH 2KZKA 3HNVH 3EYQD 4Y4FB 2Q2LA 4OU3A 5I6LA 1I9IH 2DQTL 4W9HC 4MS6A 2AMUA 1XGYL 2YPVH 5GPRA 1AH1A 2QKIB 4ZD3H 2G2RA 3S5LA 1F1DA 3T3ME 4B5EA 3PGCB 4B50A 3HUJF 2Q7YA 4RAVA 4XHQA 2UZXA 3MNZA 3QXTA 2W81C 5KBKA 1ACZA 1F4XL 2UXGA 4JG0L 3UAJC 3QUXD 3CZUB 2GJRA 3SQBB 4AZ8A 1T0MA 4A2EA 1CBVH 4Y1AA 5AD0A 4F58L 5TTRA 1N0XH 5IW6B