2E27H

Crystal structure of fv fragment of anti-ciguatoxin antibody complexed with abc-ring of ciguatoxin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
116
structure length
116
Chain Sequence
QVQLLESGAELARPGASVKLSCKASGYTFTTYWMQWVRQRPGQGLEWIGAIYPGNGDTRYSQKFKGKATLTADTSSSTASMQLSSLASEDSAVYYCARSDYGGDYWGQGTSVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords anti-ciguatoxin antibody, light chain
publication title Critical contribution of aromatic rings to specific recognition of polyether rings. The case of ciguatoxin CTX3C-ABC and its specific antibody 1C49.
pubmed doi rcsb
source organism Mus musculus
total genus 24
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2006-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2e27H00
1T20A 3ULUE 5BS0D 3D1MC 1M7DA 3MJ9L 4K2UL 3WHXA 2HFEB 3F5WA 5L0QB 4DKDC 3U6RB 5D7JA 2YSSA 2DLTA 4PJ8C 5D6DC 3FFDA 2XWJA 3LDBB 4FQ1H 5EOTB 1D5BB 4DVBB 5FO8A 1NUNB 1DQML 4U6TA 1A6ZA 3NFPA 2C3XA 3JSSA 2DQDL 2EDJA 2FBJH 4BSWB 1BLNA 1W2KT 3PQYA 4FS0A 3NOIA 4EN3A 3A67H 5EU3B 2Q3ZA 4JFPA 3TEUA 4AJ0A 3CDYA 1KCUH 5EOQL 4GKNA 2R4SL 1T0MA 4UT6H 3QO1A 4YHLH 1I4FB 3LAFA 4Z8FH 1LILA 2O61A 5I1GL 4K23L 4NRZA 2GKIA 2OXGA 1JHTB 4W70A 5KOMC 1G84A 4TTDD 4ELME 1GIGH 4MX7B 1UACH 3VU2A 2Z8SA 4K7PH 5C8JB 5GS0D 5ALCH 4I8DA 1JPTL 1ETZB 1NEUA 2BFVH 3MCLL 2R23B 4JJ5B 1CU4H 1CBVL 4TUJA 1FAIL 3WSQL 3LB6D 1XMWA 4X99A 5EBMB 4PRHB 2VISA 5F9OH 3KPMA 5F7DA 1NCDL 4PJFB 1LD9A 5GPRA 3MLZL 1KLFA 4XWOD 4NCC1 3RDTB 1CIDA 1LP9E 1LEKA 3SE9L 3UAJC 3X11B 1ACZA 3B6SB 5I66A 2VTFA 4IM8A 1JWSA 3CVHL 5JTWA 2VUOA 1U95A 3T4YA 3MJ8B 1UADC 3QHFL 4AQOA 3CC5B 2DB8A 3O6FB 3C60B 3DVNB 1YN7B 4UOJA 5HHOA 4JQXA 4WY7L 2P5EA 1QSFD 3I85A 4D9QD 4Y5XC 1T7VA 2BOCB 2C5DC 5EC2A 4KZEL 4P3DB 3VXNB 4KPHL 2VLMD 3QISA 3VXUB 1MRFL 4OKDA 3U30C 5ESAB 2KQNA 4OQ1A 5F1SA 2I07A 1YEIH 4NDMB 4LLYB 3KPQA 2WBWB 2ZOLA 3RA7H 1ZHBB 2NY3D 1AHWA 1M05A 1IGJA 1HZHL 1HSBA 3QUZC 5HDBF 5IMOA 4LASL 4OCSH 5CILH 5DR5L 4HZAA 3OX8A 2CO6B 2XPGB 1KN2H 2Z31D 3CH8A 3HG1D 1S9XA 1V3LA 2Q6WB 1BD2A 4POYA 4EVNA 2HTKC 4R9HA 4OIAA 1UB5B 4QY8A 1MAJA 4MB4A 4O58H 1PZ5A 4XZUA 5F6HJ 1Q9KA 2FEDD 4HFWB 4L4TD 4HFUL 1JZ4A 3N0PB 4HV8B 4KRPC 4O02H 3UTTB 4X4MA 1I1AB 3O8XA 3S96A 1DDHA 3GZKA 3S88L 5JIHA 2OZ4A 4L3CA 1MPAH 4S0TD 4HJGB 4MS8D 4CDHA 2VZTA 2P8LB 3IDGA 2AV1B 4L9LA 3A6OA 4PRIA 3ZDZE 1MHEA 2Y7QB 3QO0B 5DVNA 3L9RA 4ZSOB 2UYLB 1RZGA 2X4QB 3L3HB 5BVJA 5J3HD 2D7QA 2Q1EA 1U9KA 4K3EH 1U8MB 3G5YB 4S1DD 5IVOA 1EGJA 4WI4A 5C6TH 5IB4B 4HH9B 1I3RB 5KVGH 3K1KC 4LPCA 3QUXD 4HPYH 2NY6D 3O3UN 2PO6D 3D18A 3REWA 3M17B 3JV5A 2JIXA 2F19H 1Q8MA 1RK0B 4ODUB 2IAND 5DD1L 5LJYH 5C08A 2M2DA 5B3JE 2FHFA 5KSBE 5L9DH 1H5BB 1YYLL 5A1AA 1CF8H 2GJZB 2IPUK 4F57L 1Q94A 2GK2A 4LBEA 3UX9B 4NP4H 2LVCA 1NGWB 2Y36H 4TULL 1S7SA 5CCKH 1ZV5A 3GNMH 2UZIH 5DJZB 3IDXH 3MRRB 2XTJC 3LZFH 3OKEB 2PYEE 4C56B 3OPZH 2BXZA 2QHRL 2YD8A 1N8ZB 3D0LB 5C07E 1NC4D 3L7EA 3SGJC 4DFIA 2VE6A 3BDYL 4KRLB 5GSVA 5EO1B 1MIML 1FHGA 1G7LB 2A83B 3SE8L 1EFXD 1QSED 3L3OB 4QHKJ 2DD8L 5JW5A 2OQJB 4JG0L 1GGUA 4PY8I 1KPUA 5T33L 4U49A 1JZ3A 3MLVL 1PY9A 1LO0L 2FEEL 4UQ2A 5LCVL 3BPOC 5FHAH 4M8QB 3SGKA 2FNBA 3N1QC 4JZNA 4KJQD 1QR1B 2QQNH 4PB9H 5INCB 2F5BH 1AIFA 1QSFE 4D9QE 2XN9B 4R7DB 4JAMA 3PIQB 1FZKA 4P3WA 1Z5LB 2ESVA 2VLME 3UTPE 4BFIB 3KPPA 2NY4B 4Y4FD 5BVPH 1OAUH 5M94B 4QRRA 5EU5B 5HI4D 5I1IL 3ZMRA 3TBTB 2D0GA 3O2DL 4K8RL 1Q38A 3S37L 3W2DL 3QQ3A 1FCGA 1FG9C 3QCTH 3HG1E 3O3BB 3MGTB 1J0KA 5LBSL 5I1DA 4I77L 4PJXE 1DVFB 4PV8A 1H9VA 5BQ7A 3O3EA 3H7BA 4JCMA 3NIFE 2A74A 4Q9QH 4FABH 4H1LH 1H3UA 4L4TE 3EYSL 4U33A 1WZLA 2YOCA 4J4PC 1T0PB 3B9DA 4MA7L 3SKUD 5CUSL 2A2QT 2HH0H 2DLFL 3IJYB 3TA3D 3DIFA 5SWZB 3R1GH 3SKOB 4PGBB 1VGKB 2QSCH 4PGJA 3WJJC 4U31A 4YGVA 1I3GL 1XF3A 2FO1A 3PWVB 1DLFH 2O26U 3EDEA 3IDNB 4MJ6A 2AJXL 4GSDH 2JCCB 1G7QA 3TIEA 3TYGL 2Z92A 3ALXA 4OJFH 3KPRD 2A38A 3NZ8A 2E5EA 3MV8D 4KROC 5T5NG 3REVB 2VDPH 4MAUH 3GUTA 5IP4A 5D1ZC 2DTML 3ZYZA 1FNEA 1ZS8B 5EIIA 4ETYA 5GGRB 3WIIL 1MIEH 3KPNA 5DJXB 1CYGA 4HUMB 4OCWL 2IANE 3EJYD 3DROA 3OQ3B 3D25A 3D69B 4XCFL 4HDIA 1FO0L 4UAOC 2J8UA 2EXYC 2O5XL 2VLLB 2BC4B 4WGWB 1MFEL 4ZDHA 2A0LC 3HC4L 3P3YA 1IC5L 6FABH 1A9BA 4YDVB 4JRYD 5GGVY 1CD0A 1DQQA 4QXWA 1HH6B 4PJ5B 5FK9A 5JXAL 5FOJA 5K9OB 4I3SH 5HYSB 4DN3H 2DKUA 1ERNA 1LE9B 4ONGL 2AJUL 4P2CG 2PR4H 3CMGA 3OB0K 4TNVF 5HY9B 1XF5B 1NEZB 4TUKH 1HHHB 5L8KB 4QOKD 3DNKA 3HRPA 2NXZD 1S7QB 5DJDA 3ZSTA 5D1QB 4UV7L 1FLTX 1F13A 4LLQB 1I9RL 3BH8A 5DHVA 2YRLA 4N0FB 2CRIA 3EIFA 4CADA 1QSEE 2FX8L 2BDNH 3DSFL 5D7JD 4LSQL 1MHPL 2P48B 3MRBA 3U4BH 3BZEB 4H1LB 2H32A 4LSRL 1KJ3H 2F54E 1WCQA 1W72B 2CSPA 2HLFD 3CLEL 2FSEB 4WJ5A 3RUGA 1S5HB 2XZZA 1U41A 3PQYD 4EN3D 3UTZA 3G9AB 3QXDA 1MQKL 3C87A 5D71H 4OZHA 3HZYB 4F15C 4QHNA 3O0RL 2LVEA 5I16A 2R1WB 5BXFA 1G1YA 1G7HB 1OAXH 2P49B 4TOYL 2DLHA 2M26A 1BIIA 4JZOB 3SO3B 2HKHH 1U3HA 3O6LH 1QBML 2AK1L 2GTZA 4ZAKB 5GGVL 4DKAA 1D5MA 4BSJA 4H26A 2NZIA 1KPVB 2ITCB 4L4VE 4FNLH 4N9GB 1U8NB 5IESL 1UZ8B 3MNWA 1RZJL 5TDNA 5BV7L 5HDBE 2XXCB 3RWCB 4P2QB 1EMTL 5JMRA 2MCPL 4HUVA 1M4KA 3D9AL 1I85A 3EFDH 3L3IA 1LDPL 2DWDA 1F3RB 1RFDL 4CU8A 4L8BA 2GJ6A 4NFDA 2OCFD 3NIGF 2NY0B 4L5FL 3PP4L 1CFNB 5DQJB 3HNVL 3VWJB 5JA8B 1UWEL 1DQDH 1IC4H 1XEDA 5GZND 4PYGA 1A8JH 1VFAB 4WFFD 3FOLB 4PJ9B 1TNNA 3HUJB 5HI5C 3GI8H 1HDMA 1NGZB 1WUNT 2Y9RT 1TENA 3BZ4A 3DV4B 2H9GA 2BOBB 3QFJA 1EFQA 4U1JB 1VB9A 1MVFA 4Q0XH 5HHOD 3SPVA 3KPRE 4I0PA 2VXQH 4TYUA 2P5ED 5E2VH 3MV8E 5AAWA 2GY7B 3SE4C 5DK0B 4JRXB 1CTNA 1PW3A 5JIPA 5D7SL 1I1FB 2VQTA 4MQTB 1CICB 5DD3L 3V8OA 4X0KB 4HGKC 2ZCKH 4ZODA 5KSUA 1XGTB 1FL3B 2XTJD 4G6FD 1AXSA 4YXHH 1OM3L 4X6DA 8CGTA 2H8PA 3BZDA 3ECBB 4PJCF 3VMOA 3VI4F 3DVFA 4RGND 3TCLA 3RGVA 1EAPB 3FAWA 4U6VL 1BD2D 1WTLA 4RBPK 3VA2C 3TO2A 4M6NL 1G0DA 4CAGA 3GI9L 1BX2A 1CFVH 3BH9B 4JRYE 3MBEC 3RKDC 1RULL 4JFFE 3CXDH 2AXGA 5DT1H 5MEPB 1IM3A 4XXDA 3KJ4C 4BK5A 4LPTA 1GHFL 3O8XD 2HJFA 3MLSL 4ZNCD 2CKBB 3Q5TA 1WGOA 2FR4B 4PG9A 5C0BA 2GT9B 5ISZA 4R0LB 1HCFX 2V7NB 3K4ZA 1TJGL 5A16A 1ZT1A 2GITB 5F6IB 3G6DH 2DAVA 5MEQB 2HLAA 3FT3B 1EJ6A 2E8ZA 4L29A 5E6IC 1ZT7A 2HVKA 4PRID 4AM0A 3MCG1 2OR9H 3Q5OA 3T2NL 4WU5B 4M7LT 3RIAK 5JPMA 1RZ7L 4D8PA 2OL3H 4FFZH 4RAVB 2EO9A 3AM8C 3PQYE 4JVWA 4U2ZA 3RIFK 2V2XA 4XVUD 4N0UA 4MA3B 4P23A 5DDHB 5C86A 2VH5H 5FUCE 3CK0H 4PP1D 1EA9C 4AIZA 3O2VL 5HYJA 4LVEA 1N5AA 5CEZH 4DAGH 1FRGL 3EYUH 3LEVH 4PS4L 2JIXD 3IDIB 5DD5L 1YC7A 2J8UF 4PLOB 2AK4B 5C08D 1IZJA 4HMDA 2B39A 4ISVA 1BM3L 5DMIH 2WINB 3VW3H 5LWYL 3O6ML 1WEJH 5GS1A 1X7QA 2KKQA 2NTSP 4P9HH 3W9DA 4ERSH 5IOPA 1FV1A 3HLAA 3Q1SL 4JY6B 3RVTC 1OAYH 3QIUC 3BPLC 5FM5M 3K8LA 5JOFA 3NN8A 4IIQA 2Y5TA 3FQNB 5DO2D 1RJLB 2QSQA 3BKCL 1OTSC 4TNWK 2D0FA 4MWFA 1ZT4B 5F9JA 4XP5H 3VRLF 4EOWL 5JHDE 3KPOA 1I9EA 5E2WH 1PAMA 4OLWH 5FGBA 4D0BA 3L5XH 3STLB 2VDMH 3ARFB 3O4LB 3BXNA 3HA0A 4CUCA 1F4YL 3PG2A 1A14L 3CH1A 3MMEB 1VERA 3RUGF 4LEXH 3TN0C 1A6UL 1RVFL 5EPMB 3VGGA 1EERB 3OJMB 4KHXL 1PZUB 5DHXB 2X89A 5AZEL 3FONA 1YJDL 4TSBH 1TVDA 1F8TH 2FGWL 4P5TA 3CX2A 5FYLD 5T3ZH 2VZVA 4LSPL 5ALBH 4RGOH 5HHMB 5HHOE 2QR0A 2P5EE 5JW3L 1N7MH 5C2UB 1OARL 5GQBA 3L5HA 1U8OA 2ESVD 4G3YH 1ZWIA 1S78C 4HS3B 5CZXC 4UT9L 4K55A 4Y16C 4FQCL 1XGRB 5DRWA 4QRRD 1FYTE 2BY3A 4HPOH 1G7JB 2ADIB 3MODH 2XTJE 2CIIA 2HFFA 1KEMH 5B38A 1SY6L 3BIBX 4RGNE 4PRAA 5JQ6L 3R06A 1NMCB 1QEWA 2F8XC 5HGHA 3HR5B 1RUAH 4M62L 2IPKB 4DZBA 1YEJL 2EDXA 1KTDA 2N56A 4NT6B 4NOBA 3VFPA 2H3NA 5A2LH 4ZUVA 2VWEE 3K46A 1T66D 4OAWB 4AEHH 2ZSVB 2XA3A 2FB4L 1E6OH 2E8YA 3WV0A 5F96H 4PREA 2JJVA 5ABDE 1FFNB 4O4YL 4Q9CA 4JO1L 3OKOA 3EJJX 4RZCB 5AWNH 1HXYA 3KGRA 3FRPG 5FKAA 3TNNA 5BZDB 4H88H 2FYYA 5IJKC 1EEQA 2WUBL 4Z7WB 4HMEA 4LP4A 4TUOB 1G7MB 3C08L 4PRIE 2HFEA 4JN1L 1WIUA 4A6YH 3T0EB 2PETA 3U6RA 3HRZB 1NBYB 3I3BA 3B8SA 2ICWJ 5EOTA 1D5BA 4DVBA 3AMLA 3OAZK 4HUUB 3NMEA 4AZ8A 2VDNL 3LIZH 1OW0A 3MRDB 2E9IA 4NUJB 5TFSH 1FNSL 4PLJD 4X6DF 1DBML 4UTBL 2DIBA 5EU3A 3IXTB 3EOYG 3TH3T 3VXPA 2CRMA 4CVZB 1HNFA 2WIMA 1JNJA 5C08E 4MQXD 1I4FA 3IS1X 1BP3B 4JZJC 3T04D 1BHGA 5F89B 1KLGA 1U3YA 4U3CA 1TJIL 3L3KB 5JW4M 3V7AG 3VD3A 4BFBD 4MX7A 3WNKA 4PJ7B 5C8JA 3IFOB 5EN2B 4KKLD 3UYPA 1DQLL 2CH8A 5KOVC 1OWRM 1K8DB 1KV3A 4H20L 3G9VA 1VHPA 2R23A 2APWA 1T2QH 3G6AB 4JJ5A 4XP9H 3IDJA 4YK4B 3W5NA 2W59A 5HGDB 4ZO8A 4PRHA 5JIIA 1G6RL 3NIGE 4PG2C 3ZLQC 4PJFA 3QFDB 3NBNA 4J3XA 3RDTA 3ARPA 2WLYA 1MVUB 3WXWL 4B41A 3G08B 1AH1A 3B6SA 4NUGL 2YD9A 5FYLE 3MREB 4XPBH 3B2VH 3UDWA 1AJ7H 5C0NC 1AE6H 4J12A 3O6FA 5I1LB 3C60A 3DVNA 3V5HB 2VKWA 1F90H 1YN7A 4U6HA 2E6PA 3GIVB 1F11B 1ODAA 4OLUL 3BJLA 2BOCA 5FHBL 4RMVA 4W6XB 4P3DA 1A1NB 3GHBH 3JWOC 4QRRE 2J6EL 4M6AA 4JVUA 3VXUA 3WEXB 1U3HD 1MFBL 3X3FH 4WI7A 3TFKC 4NDMA 1XF2A 4LLYA 4KV5F 5FO7A 1G9MC 1OVZA 1ZHBA 2X40A 4RGMB 1SJEB 1JNNL 15C8H 4TVPH 4N0CC 1K2DB 4PJCE 4ZQKB 1IC7H 3FFCE 3VI4E 2XPGA 4K71B 2VDLL 3TJHD 4J3WA 2HKFL 4YHKH 2Q6WA 2GJ6D 1YEFH 3F7PC 1UWGL 2EIEA 4U6XB 2CLZB 2IBZY 3OB0H 1SJXA 1UB5A 1JHLH 1NCTA 4MGXA 3RVXD 2Y4SA 3KLHC 5DMYA 4JB9H 3LPWA 4HFWA 1PY4A 3AS0A 4OLVL 5DQDL 4HV8A 3UTTA 5HBBA 2DM2A 2DJUA 2QQQA 4L8SB 4P5KB 5E94B 1I1AA 4R8WL 1WZ1L 3F58L 5FGRA 3IRPX 3C2AL 3MLRH 4R97B 3RRQA 3IFLL 3WYRA 4LGRB 3QFJD 1MEXH 4HJGA 4BZYA 4RMSA 5CJXA 3BN3B 2VSDA 1BWMA 4I0PD 2IBZX 3S3JA 5D96B 1R5VB 4M8VA 4XNZB 3UYRL 4G7YL 2CDFA 2AV1A 4IOFC 4JKWA 3RI5F 3UMTA 2Y7QA 3QO0A 5IHUL 5M95B 1EVTC 3FRPA 4ZSOA 5IQ9A 2X4QA 3L3HA 1QBAA 4JPIB 4DUWA 5IHBA 3HAEH 1IGFL 5CIPB 1U8MA 3G5YA 4XBGB 4GRLB 3WLBB 2I9TB 4EIGB 1UCBL 5IB4A 4HH9A 1I3RA 4LKCB 1CLYH 1IKFH 4FQXA 5I1JH 1J0JA 1XZ0B 3WJLA 1BMGA 4WI6A 3RGVD 4XPAH 1RK0A 4ODUA 3BT2H 2J8UE 1VEPA 1YY9D 4NKOB 3E1F1 1B9ZA 5HYSG 5BMFL 1V3MA 1R3LB 1H5BA 3B4NA 3NPSB 3WD5L 2GJZA 2XNAB 4F9LA 1HWGB 1NEZG 1NGWA 4QNPF 3WFZA 1Q1JL 1ZGLB 4KTDH 2J5LB 4WHDA 1RUQL 3IT8D 4AMKL 5DJZA 4KHTL 4UIKL 1OAQL 3VFTB 4C56A 3KJ6L 5DFVD 1AO7B 1FP5A 1N8ZA 3D0LA 1OF2B 2C1OA 3VFSB 1GH7A 4H0GA 4IOSD 5C0BD 3C9NB 3VRLE 5ISZD 4UDUB 5KSAB 4H1LG 4KK9C 4LSTL 1OP3K 5EO1A 3EFFB 3VXRE 4PP2B 2A83A 1SJVA 3R8QA 5K9QI 3T65B 4BJLA 1OAZH 3L3OA 4WEBL 3RBSA 4FFYH 2H26B 4WO4B 4NCC2 1NCCL 2OQJA 1MFCH 4K3JH 5CZXD 4ZD3L 3RUGE 4MNQE 3AS2A 2NYYD 4UDTA 3ZTJG 3QH3B 1RUPL 3HE7C 4P23D 4TRPH 4TSCH 4HBQA 3BIKB 2CD0A 5DQ9B 2FIRT 2APXA 3S35L 2BVUA 5HYJD 1G9MH 2IH3B 1QZ1A 1NCWH 1QR1A 2QJDA 5INCA 5TE4L 3TPUB 3FQUA 2IGFH 4Z78B 2XN9A 3QDGB 5FFLA 4X7TB 5E00B 4ZFOL 5JPNA 3PIQA 1L0XA 1AY1H 2YZ8A 3JV4B 2YPVL 4BFIA 2R0WL 4S11A 4Y8AA 3SE3A 4U1GC 5E6ZA 4LPVA 5EU5A 3N06B 1WF5A 4HK3N 4RBPH 4RFOH 3V4VH 4HXAL 4R2GD 4J3SA 1FFRA 1OPGH 2O5YH 4HIHB 5IQ7L 3O3BA 3LMJL 2CK0H 1JPFA 1F4XL 2R2BB 1DBBL 5LQBH 2GJ6E 3GRWH 4XI5D 3DVGB 4OSUL 3TBVB 1DVFA 4LFHG 4WV1A 1A3LL 1H0DB 1CFQA 2YWYA 4D3CH 4GXUM 5D7IB 1JF5A 3W81A 4YQXL 1J8KA 1Q0XL 4NM8L 3UC0H 4LNVA 5K33A 1H3PH 2RFXB 5SWZA 4PUBH 2X89D 2NY7H 5JXEC 5E9DB 1VGKA 4KK6C 4P5TD 3ZYJA 3PWVA 3SDAB 1NAML 4U0QB 1PG7H 3VE0B 2JCCA 5KTEL 1I3UA 1JWMB 1X4XA 4U3HA 3REVA 4F7TB 1KIPA 4U6YA 1RUMH 3RZCB 2G5BA 2A6JB 5GS3A 3LD8B 2AGJL 2X44D 1A0QL 1QO3B 3V5KB 2XWTB 4MD0B 1ACYL 1ZS8A 1UJTA 1HQ4B 4X6DE 1EO8H 5GGRA 5DJXA 2ICEB 4NC1C 3E6FB 1BZ9A 1QNZL 5EBLA 4DQOL 3V6OA 5D2NB 1BQUA 1X5IA 4NIKB 4EI5C 3VWKB 4XHQA 4LSUH 4WUUE 4JO3H 1J9CT 4GW5B 4Z95L 3D69A 3MJGX 4DJMA 4IMLA 2VLLA 2BC4A 2QL1A 1AXIB 4K2UH 3MJ9H 2Z8VC 4YDVA 1FORL 4G6ML 3LS5L 4CDGC 5JZ7D 1EH9A 4XMPL 1HH6A 4PJ5A 5K9OA 5HYSA 4PFEA 1DQMH 3MUHL 1LE9A 4LPUA 3SDCB 5LGHL 2DQDH 1K8IA 4MQSB 1XF5A 5C0BE 5ISZE 3MNVB 1NEZA 1HHHA 3NZHL 1GYAA 4ZUUA 3PP3K 1S7QA 5CGYC 1ROWA 4OCYL 5EOQH 1PBYA 2R4SH 4LLQA 4N0FA 3ILQC 1GZPB 3GKWL 5I1GH 3MTRA 4M93B 4K23H 3T0XA 4LRNL 2EDWA 1OL0A 2XKUA 3BZEA 4H1LA 4GT7A 2FSEA 4N0UE 1UVQB 1S5HA 1T83A 3FTGA 2V2WB 4M48L 4YC2C 2Q76B 5HYJE 1JPTH 3ROLB 4YE4L 1A7QL 1YEKL 4QRQA 3T8XB 3E8UL 1UB6B 3MCLH 3HZYA 1HOCB 4MJIB 1KT2B 2R1WA 4KMTL 1G7HA 1CBVH 1FAIH 2AXHA 3WSQH 1MHCB 5FGCE 4JZOA 4ORZC 5SV3A 3V5DB 4RIRB 1PKQB 1ZEAL 1NCDH 1NDMB 1QFHA 1IRAY 4LVNB 4ZAKA 3NCYP 3MLZH 4KV5E 1KPVA 1S7VB 2VOTA 3SE9H 3WNMA 1U8NA 4DEPC 1UZ8A 2MWCA 2OMNA 1XCTB 3RWCA 1UZ6F 3CVHH 4P2QA 1YNKL 1P7KB 2L7JA 3W0WB 3QHFH 4PGCB 1INEL 2YMXL 3NCBB 2LU3A 4X6FB 4PRHD 4APQC 3CU1A 4V1DA 4WY7H 1Q72L 1CFNA 1CLZL 5DQJA 4KZEH 3RZWA 3RDTD 3BZFB 4EDXB 1JPGB 4OD2B 3VWJA 1N6UA 4R26L 4KPHH 1MRFH 1X5GA 3BGFB 3EKCA 4KQ4L 2DQFB 4KDTA 4LCYB 1VFAA 3HB3C 1XCQB 3FOLA 4PJ9A 3HUJA 2E27L 1FAKT 5CKGA 1NGZA 3DV4A 1HZHH 1EHNA 3OAZH 3O6FD 5D1QC 2VERN 3C60D 4LASH 4U1JA 2X4PB 2DQTL 5DR5H 2W65B 1M7XA 2Y6SD 3L3JB 5JHLL 4M7JH 5DK0A 2VJXA 4JRXA 1TZIB 5BW7A 2NCMA 3C5ZB 4M7ZB 3VXUD 1I1FA 1LK2B 4CNIB 5I17B 3EW3B 4M3KB 1CICA 1W8NA 1ED3B 4X0KA 1BF8A 4LPXA 1KBGL 4HFUH 3ARVA 1DSFL 1FL3A 1XGTA 2N1KA 1LEGB 1F6AA 3G5XB 1NPUA 2Y23A 3WO3B 3ECBA 5FYJD 4JCLA 5FM8A 4YHZL 3S88H 1KB9J 1U8PB 1EAPA 2HFTA 2ZZUT 3OGCB 1T5XB 43C9B 1A2YB 4X7EC 1OCWL 2PNDA 5ITFB 1WK0A 3FZUC 4GUPB 3BH9A 1FVDB 3BRGC 3EZ8A 4YHNB 4QGYA 4QNPE 4XVJL 3UTTD 4V2BA 2Z35B 5MEPA 1A4KA 4HKBB 4FQQB 1I1AD 1BOGB 1J1XL 5J0BA 4K94L 2CKBA 2FR4A 2GT9A 2ERJC 3CAFA 3CVHB 4R0LA 2JCCF 2YPKB 2GITA 3T4AB 1E4KA 1QA9B 3IAQA 3ULUL 4F7EB 5MEQA 3FT3A 1BWWA 4MD5B 5DD1H 3ZL4L 3C6LC 4UOW1 4UILL 1YYLH 3MYZA 1QSZA 4WU5A 3BESR 5IW1B 4F57H 1EZVX 3WKML 1P53A 5CD3A 4PY8J 4TULH 1WWWX 4YFEA 3I6LE 2WIIB 3O6KL 5C71A 3JUZA 2OP4L 4MA3A 5DDHA 4HGWB 1FPTL 2BVQB 2GSGA 4X9IA 2QHRH 3OR7B 1FFPB 1NLDL 1BFTA 3UPCA 3IDIA 4B53A 4I13B 2BK8A 3BDYH 3MJ6A 3MUJA 1WWBX 3K74B 4UQ3B 2AI0L 1MIMH 4TQEL 2WW8A 3SE8H 4JY6A 4FXGB 2DD8H 5IW6A 4B5EA 1UH2A 4JG0H 5T3XL 5J9PB 4C56D 5T33H 3EO0A 3FQNA 3MLVH 5KAQG 1ZT4A 4MD4B 2IH1B 3QUYC 5LCVH 4K07A 5DYOB 4PRHE 4L8DB 5E08L 3SCMB 3STLA 3ARFA 3O4LA 2X70B 3FN3A 3GSNB 3MMEA 2Q8AL 2W0PA 2OR8A 4I18A 5EPMA 1BPVA 2R56L 4OCMC 5I1IH 1H15B 1L9MA 3O2DH 3HMXL 4K8RH 3S37H 3UZVB 2ITDB 3W2DH 4ALAL 5F6IC 4DVRL 3G6JB 2NY2C 1CXIA 2XN9D 5LBSH 2DS4A 4I77H 2AJZB 3VXUE 2NY4D 2AQ3A 1FH5L 5T1DL 1WFOA 3WNPA 1XGRA 2AJVL 1TMCB 3AU1B 3EYSH 1G7JA 3SY0A 2ADIA 3MLTA 3DHMA 4MA7H 5CUSH 5BV7C 4XPHL 2IEPA 2DLFH 5FYJE 3NCJL 3LRSB 4NBZB 4HSQA 1DL7L 4DGYL 5HTSA 2ORBL 5FA3B 1A3QA 3G5VB 2BY0A 1I3GH 4YXLL 5K9QG 1DVFD 2Z4QB 3HR5A 2IPKA 2FRGP 2AJXH 2F5AL 3GMLB 3TYGH 4G6KL 4NT6A 4M1CD 3N1PC 3PL6B 3UTTE 3ZDXF 1MWAB 1OP3H 4OAWA 3IAPA 3P77B 4OUUB 1VKXB 5SWZD 3DMMB 2DTMH 1KPRB 4XAKD 1K4CB 4JRWA 2WBJC 1FFNA 3WIIH 2ZCLL 2JE8A 4RZCA 5BZDA 3H3PL 3QG6A 1HI6B 4Z7WA 1S9YB 4TUOA 1G7MA 4XCFH 4YWGL 3T0EA 1FO0H 4E0RB 5ICYB 3HRZA 5J06A 1NBYA 3ZTNL 2O5XH 4JDZB 4EKXA 5SWQB 3HC4H 1IC5H 4HUUA 3G5ZB 3DI2B 3HNTL 1I7UA 5F9WC 3MRDA 2HWZL 4NUJA 4HJ0D 5JXAH 4XCNB 1O5DT 2JJWA 5GRYA 4X5LA 4MSWA 3IXTA 5IT2L 2A6DB 5LVEA 5HXMA 4ONGH 2AJUH 3PDOB 1WT5C 2CK2A 1O7VA 3MLXH 2MKWA 3BQUB 1GJIA 4UV7H 3RAJL 1I9RH 5F89A 4KKCC 2FX8H 3DSFH 3L3KA 4LSQH 4F9PA 4PJ5D 4C56E 4PJ7A 1NCBL 3IFOA 5T1KB 5KANI 4XHJD 4LSRH 5EN2A 4ZTPL 2HFGL 3CLEH 4F2MB 2X1XR 2LAAA 3BP7B 1K8DA 2L4OA 3V7AE 1UZ6E 1ZTXL 4XNUL 3GBLA 5F7YC 2VL4A 1NJ9B 3H9HB 3G6AA 4NOFA 4POZD 1NMCC 5IK3B 1MQKH 1QVOB 4H25B 5E95B 3GBML 5HGDA 4H8WL 1A64A 1CXHA 3O0RH 1PKOA 1OSPL 1HINL 3QFDA 2EXWC 4TOYH 5FM4A 1MVUA 3G08A 5IB5B 1QBMH 2AK1H 1RJCA 5GGVH 4PGEB 4Y7MA 2FEEI 3MREA 4NC1E 4P4KB 2PF6A 5IESH 2E9BA 1RZJH 4MHHI 2V9QA 5BV7H 5I1LA 5IEHB 2XN9E 2VXTL 4WW2B 4YR6B 1EMTH 2MCPH 3SBWC 4AT6B 2R9HC 3D9AH 3GIVA 5D7LB 4XPFL 1F11A 2LE9A 3QSKB 1LDPH 2PUQT 1P5UA 1F5WA 1RFDH 3RWDB 3GKZA 1A1NA 3PWPB 3BPCA 3WEXA 3OF6A 4L5FH 3PP4H 2ID5A 4ZAKD 3GEWB 3BE1L 4NKMA 3HNVH 2NR6D 3DHJA 1IILE 4YHIB 3DYPA 3I6GB 4DUVA 4R3SB 1SJEA 3IYLW 2X05A 1UWEH 1RD6A 4ODWB 4P2QD 1K2DA 2AVGA 2BSRB 4AENB 4P59L 1C08B 3O2WL 2MQ3A 2AAVA 4YZFF 3D5OF 4JREB 1J88A 2OS7A 3RWIB 2CLZA 4JFYB 1EPFA 3PWNB 4GKZB 2NY0D 1G9NL 5GGSY 1M7IB 4U4BA 1OLLA 1T21B 3PWJB 3VWJD 1HHKB 1AGBB 3PP3H 4LFHD 4LCWB 5D7SH 4NJ9L 3BEVB 5SWZE 3ZZ1A 5DD3H 4XAKE 4L8SA 4P5KA 5E94A 1BFVL 4PJ9D 5FCUL 3U1SL 1T7XA 3JV0A 4X9FA 1RY7B 1OM3H 4WHTA 5HPMB 1ORQB 2JCCE 4YO0B 5EU4B 3KXFE 3RY6A 1R5VA 4HQQL 4U6VH 4AL8L 4M6NH 4JRXD 4YBLC 4XXCA 3GI9H 4Y4HB 4YBQC 4NQCB 5DJ2B 5F7UA 1CICD 4O2CB 2VITB 4JPIA 3MUGB 1ZHLB 1RULH 4JE4B 4XBGA 2BVTA 4GRLA 3WLBA 2I9TA 3EJZC 3V6OE 1GHFH 4LKCA 2A9ML 4GRWH 3MLSH 4EDWL 1AKJB 2EC9U 2JJSC 1FNGB 1B0RA 5ID0B 4NQXB 4NKOA 4I2XB 4RMRA 1JRHL 1TJGH 3H42L 1R3LA 4LLWB 4Y8DC 4DTGL 1E4XL 1UH4A 2XNAA 3NGBC 3OKMB 1U42A 4FZEL 4PJ5E 4Y5YB 1AGCB 2YS4A 1ZGLA 3T2NH 1GOGA 2VLKB 4OB5L 4HUNB 5BRZA 1RZ7H 3VFTA 1UT9A 1DE4B 1AO7A 2DQEL 3FRUA 1MOEA 1OF2A 3VFSA 5I75B 4MJ5B 4K71C 4HKXB 3C9NA 2R1XA 4PJBF 2ILLA 4UDUA 5KSAA 1GOFA 1ZA3B 4HC1L 3O2VH 4Z7WF 3PABB 1FRGH 4PS4H 1YDPB 4XP1L 5DD5H 3EFFA 3WDJA 5IIEB 3V95A 4PP2A 2FECL 3S7GA 3U0WL 3T65A 5DGRA 1BM3H 2C7UB 3X12B 4WO4A 5LWYH 3O6MH 1JCKA 1B2WL 1N0LA 1R24B 2E6JA 3DURB 2EE2A 3Q1SH 4MLSA 3QH3A 5E1AA 1YPZB 5D2LF 3BIKA 5DQ9A 3P0YL 2ARWA 4P9ML 1ZSDB 5CJOL 2IH3A 3HE6B 4U1KB 3BKCH 1JGLL 5HHQA 4I0CC 3TPUA 3ZSSA 5IM7B 4Z78A 4EOWH 3QDGA 4BA8A 4X7TA 5J1TC 5E00A 2CXKA 3JV4A 1AI1L 1U6AL 1T80A 3MV01 4XNYL 5DVLA 4PJ7F 5KBNC 3BIAX 1QYGH 4OGXL 3TH4T 1F4YH 4JDTL 1A14H 1WFNA 2APTA 4ZOAA 2UV3A 5EFIB 5E8OB 1A6UH 1RVFH 5E0QA 1J86A 3IJSB 4P2QE 5JW4Q 4KHXH 4NRYB 4HIHA 1FYHB 4NWTL 5AZEH 2EC9T 1YJDH 4GRWB 4D9LL 3HPJB 4RMUA 2R2BA 1QP1A 4LSPH 3DVGA 4EUPH 3TBVA 5KAQF 3CFKA 1H0DA 1OGAA 3BWAB 5JW3H 1IKNA 5E03A 3IU4L 1OARH 4X8XA 3ARFD 3O4LD 4OGAC 5D7IA 3MRPB 4MQ7B 2J5LC 4NRXB 2X1WL 1AD9B 3ZDXE 4UT9H 4FQCH 3U0PB 2RFXA 4Z7VB 4IDJL 5E9DA 3O45B 2PO6B 3INUL 2X4TB 1OT1A 3SDAA 4GG6B 2FJGB 1SY6H 2YN5A 1YNLL 3B9KA 1LVEA 5KVDL 2ZKHL 3VE0A 3LPFA 1YQVL 5JQ6H 4LLMB 5C0CB 1QG3A 3RX8A 5F6HI 1JWMA 1V8HA 1D6EB 2VC2L 1A4JB 4M62H 1XR8B 4F7TA 3QUMB 5IWLA 1U8HB 1YEJH 4HLZH 3RZCA 5EH1A 4GAYB 4QWWD 3GB7A 3P9MB 1JP5A 1QO3A 4R7NB 3V5KA 5CJ8A 2XWTA 1KULA 4MD0A 1FVEB 5KS9B 1HQ4A 2DMCA 2FB4H 3E6FA 4NYLB 3D87B 5A43C 3VXMB 3MLPA 4KMQA 5CEZD 5I30L 4O4YH 5IMLB 4JO1H 4GW5A 5EWIL 2UY7A 2KDGA 5DFWH 2WUBH 2I5YL 3BP6B 3C08H 4JN1H 5DS8A 5E8PB 1I8KB 3EHBD 4KK8C 3RHWK 4G43B 4M4PA 4LHUB 2CUHA 3BKML 2CKNA 1DN0B 3FQWA 2VDNH 4L3EA 2DIAA 3BEWB 1JPSL 3SDCA 4AQ1B 1FNSH 2PKDA 3MNVA 1DBMH 4UTBH 1CGXA 5KSVB 4FFWD 5F7KC 5SX5K 5I0ZA 2OI9B 1PYWB 4U3XA 1DTUA 3MUZ1 3GRWA 3DX8B 1BOYA 2B7DT 4QLRA 3WNOA 3T0BA 4JQVA 1U93B 5E8NB 1GZPA 3T0ED 5B8CB 1MJUL 4RRPG 5EU7C 2VN4A 2H2SD 3ZT5A 1U58B 3KYMB 4P5MB 1RI8A 3P0VL 2Z91B 4XBPA 1WCBB 1LE5B 3W11C 2V2WA 3RWHB 4QHMB 4PB9L 2Q76A 2HRPL 2IMNA 2Y72A 3ROLA 1DQLH 5IBLC 3GMPB 3P4LA 3T8XA 5T3ZD 4DW2L 4H20H 1UB6A 2AK4E 4MJIA 1KT2A 3LKNB 1QTYT 5CZVL 4HWZA 1JPST 3LQMA 2R0LL 3LEYL 1MHCA 2EIZA 3QAZC 5GZOC 1A22B 3EDKA 2BX5A 1G6RH 3V5DA 4RIRA 1PKQA 2YXMA 1NDMA 2DN7A 3LD8C 2Q7NA 4EI6B 5FA4B 3TA3B 3VMPA 9CGTA 1S7VA 5CSBA 3EOBB 1TPXB 2P42B 3FQTB 1LO3L 4IRJA 3QXAB 4WU7B 5D2NC 3MFGB 4NUGH 3M8OL 2EYSB 4HKZB 3VWKC 1P7KA 3W0WA 1HH9B 1CCZA 5E7BA 3OL2A 4PGCA 4YZFE 4BH8B 1DCLA 1EHAA 2FL5B 2D2OA 4Q6YA 3SKJL 3O4LE 4P3CL 4CJ1A 5M7QA 3BP4B 2VQUA 4OLUH 4HEME 4RFNC 5FHBH 3FHQA 3PNWB 3BZFA 5CKAA 4EDXA 5SV4A 1JPGA 4OD2A 5CWSB 2E7HA 4J7RA 5DVOA 2QSCL 4JR9L 5ECJE 1VADA 1MFBH 2DQFA 1LK3L 4LCYA 2XIDA 3DO3A 1MCSA 3ESVF 3L3GB 1XCQA 5I2IB 3CVIL 5HHME 1AP2A 1JNNH 1FC1A 3ZT6A 3RVVD 3RVUD 1HXMB 2X4PA 3EYQC 4HX1B 2VDLH 4ZPVB 2HKFH 2IJ0C 3L3JA 2MCG1 1N5YL 1UWGH 4X4XB 1TZIA 2RHEA 3C5ZA 5CD5C 1LK2A 3OF6D 4OD3L 5I17A 1ED3A 1MIEL 1HHIB 1DQJB 4OLVH 5DQDH 2ICES 3UJTL 1X5AA 3AAZA 4FFVC 5EIVA 1LEGA 3G5XA 4QOKB 4R8WH 1WZ1H 5IB3B 3F58H 1LO2L 2NXZB 3C2AH 1U8PA 3IFLH 1OTUC 4ORGB 3OGCA 1P4LB 1T5XA 3MOAL 43C9A 1A2YA 4JM2C 5D7IF 4MJ4A 5ITFA 7CGTA 3ARQA 4P57B 4GUPA 4CU7A 1RUKL 1FVDA 3UYRH 4G7YH 4F3FA 2QADB 4YHNA 4YHYC 3QIBC 5IHUH 1R3JA 2LU7A 2QSTA 2Z35A 5HHVL 4FQQA 4JFPB 1BOGA 1IGFH 4XPGL 4M9OA 1UCBH 5J57B 1M71B 4PJBE 3CVHA 1KCSL 1A7PL 1JFQH 3QNZB 4ZO9A 4Z7WE 4MXWH 1D6VL 4KU1A 3H2WA 2O61B 2YPKA 5DUML 5A3IC 3T4AA 3T0EE 1QA9A 4F7EA 2ZSWB 4MD5A 5BMFH 4I5BB 1BECA 4LCCA 3WD5H 5IW1A 3WDHA 3TO4B 4LKXB 1I8LC 3V0VB 1E27B 2XQBL 1Q1JH 3O3DB 4GRLD 1VGEL 2WIIA 1RUQH 4AMKH 4GBXB 3C5SB 5D2LE 4RRPA 4KHTH 4JO2L 2BVQA 4UIKH 1OAQH 3KJ6H 3CSPA 1OAXL 3VRIA 4ODTL 1BREA 1FFPA 3FL7A 1CDJA 3QEQB 1A1MB 2VISB 2HKHL 5F7DB 4S1QL 1K3ZA 4ZYKB 1LD9B 4LSTH 4UQ3A 1S7WB 5LG1A 5AAMA 4FN0A 3JVGA 1CZ8L 4PJ7E 3L7FB 4R6UA 4FXGA 4WEBH 3AROA 2Q86A 4E41B 1G0YR 2EECA 5BRZD 1NCCH 2D3VA 2QSVA 4X9BA 2ADJB 4ZD3H 4BQBA 2I27N 3DTXB 4AIXA 3UJJL 1AO7D 1I8MA 2YPLB 1RUPH 1JZ2A 4WHYH 5AYUL 4HS8L 4ZO7A 4MD4A 4CW1A 2IH1A 3ALPA 2BNRB 2HRLA 5KSAD 3S35H 2Q3AA 5DYOA 3C8KB 4L8DA 3L1OL 1KN4H 4XH2A 1P9MC 5TE4H 1F6FB 3IVKB 5CSGA 4KKAC 3TZVC 3KWWA 4GMSL 1QRNB 3IDMA 1L9NA 1HIML 3ARGB 2M1KA 2X70A 4WO4D 2YPVH 3BDBA 3FCTB 3GSNA 1RIVH 1N64L 4TPRL 3KPQB 3B2UD 2R0WH 3BJ91 4FMFA 1YA5A 2EDKA 3MBXL 1IGJB 1HSBB 1H15A 1CGUA 4F7CB 5CEXA 2JKXA 5FYLL 4HXAH 4GG8B 1G0XA 1S9XB 3LV3A 3RL2B 2ITDA 5IQ7H 4LRIC 1QFWL 3G6JA 3LMJH 2NMSA 3OGOE 1F4XH 3QDGD 3T2QA 1JWUB 4LLUA 1DBBH 4FTVB 4OSUH 2AJZA 3NCEB 1A3LH 2E9JA 1IMHC 2NW3B 4IJ3C 1RK1B 4QCIB 5DHYB 4S0SD 4OKVB 4HUKB 4X7DC 4YQXH 4YXHL 3WXVL 3O3AA 3AU1A 1Q0XH 4NM8H 3K2MC 3LRSA 1JIBA 4LNRB 3D3VB 1QHOA 2FJFB 4L9DA 2JJTC 5FA3A 5I0DA 3G5VA 1I7RB 5E56A 2EDTA 3QIWA 4WTZG 4KFZC 3UBXI 3U9UB 1NAMH 1OGAD 3SKNB 3U7WL 3SQOL 4BZ2L 1FBIL 4TNWF 1Z3GL 3GMLA 5KTEH 1RZGB 3LHPL 3PL6A 1WZMA 5IG7B 1MWAA 4Y4KB 3TCXA 1L0QA 3P77A 4OUUA 3U82B 1VKXA 2AGJH 3DMMA 3AMKA 5E9DD 1KPRA 4U1HA 1K4CA 1ACYH 3PXHA 4M61B 3GBNL 5ESQB 4DWHA 3KHQA 4OFYA 3CSBA 5MERB 4OCNC 3SDAD 1R3HB 3TJEL 1QNZH 3B9KD 4DQOH 3SCMC 1QFWM 4JJHA 1HI6A 4W6YB 2ATKB 4OF3A 1Q94B 2YD5A 4LBEB 4MCYB 4Z95H 1MELA 5HVWA 5ICYA 3UJIL 1GOHA 2I9LB 4JPKL 4JDZA 3RZCD 5SWQA 2C26A 5F8QC 1FORH 4G6MH 3LS5H 5CSZB 4ZTOL 4XMPH 4KKBD 5JORB 4XCNA 2HT4D 1F3DJ 2YA0A 1JTPA 2A6DA 5LGHH 3O2DA 3PDOA 5F9DC 1SQ2N 1PG7W 4YHOL 4Q6IC 3O41B 4PJEB 1OP9A 1T7YA 3GO1L 4DKFL 4OCYH 1IM9B 5FXCH 1ES0B 1CI5A 1MJ8L 2BHUA 3CPLB 1KPUB 3GKWH 5I73B 5CEYB 3K2UL 1I9IL 4LRNH 3V0WL 1RURL 4WTWA 1AO7E 3MV9B 4J3OC 4L3ED 3U9PL 4UQ2B 4Y2DB 3SDCD 4F2MA 3BP7A 5A2KH 1Y6MR 2H2PC 3AVEA 5E2WL 2IAMB 2YA1A 3OTTA 4KWUA 4M48H 5FIEA 2X4NA 1NJ9A 3H9HA 2GAZB 5IK3A 4YE4H 1A7QH 5FV1L 1YEKH 3ULUC 1QVOA 4H25A 4CRPA 3RPIA 3E8UH 2WZPD 5C70A 2ESVB 4X7CC 2NY1B 4R4NC 1NAMB 4D0CB 4KMTH 4YFDB 4LEXL 5SWSB 3FKUS 1Z2KA 5CFHA 2NX5E 4OTXL 5KVFL 4X9HA 1NUFA 1BVKB 1ZEAH 3S4SB 5JDJA 1RU9L 4ZXBB 5IB5A 4PGEA 3SDDB 1T04B 4Y89A 3RPKA 5IEKB 4NM4L 3SO5A 5IEHA 2EDHA 3QDGE 4MJID 4WW2A 4YR6A 1YNKH 2WBKA 4AT6A 2QTEA 5SX4H 1P7HL 5D7LA 4P2OB 1INEH 2YMXH 1CGTA 1KGCD 3O4OC 3RWDA 5I19L 3PWPA 2PW1B 4NFCA 2VDKL 4O5LL 2ICWB 2R2HB 1Q72H 1CLZH 3CMOL 1S5IL 5EBGA 3O9WC 4YHIA 5J13C 1YEGL 3BPNC 4Y0GA 3TVMB 4R3SA 3FAXA 4YGVB 3BN9D 4IRJD 1P4BL 4KQ4H 5I71B 4ODWA 4ZFGL 2B5IC 5DEZA 2E27H 2BSRA 3W0WD 1FG2B 5F1NA 4AENA 1C08A 3GSWB 1T1ZB 2HTLC 3QQNA 3BQUC 3PHQB 4NKDB 1JGUL 4K7FA 2DQTH 3RWIA 2FHCA 4JFYA 5D7IE 2JLLA 1RV6X 3PWNA 4GKZA 1MH5B 5EU7E 1M7IA 5JHLH 2YRZA 3C09C 1T21A 3PWJA 5SX5H 2X1PA 1EXUB 1HHKA 1AGBA 1C1EL 4WTZA 4LCWA 1VEOA 3BEVA 4OBRA 5E9DE 4EXPX 4U1SB 1K4DB 1NC2B 1NH6A 1JYXA 2DJSA 1KBGH 1DSFH 2BY2A 1ZMYA 3G6JF 3HZMB 5HPMA 1ORQA 4YHZH 4D94A 1DEEB 4YO0A 1W0WB 1LO5B 5DRNA 5EU4A 1GCFA 1MF2L 3UTSB 1ZVYA 2YXFA 1IAOB 2GSIB 3ARYA 3C5ZD 1OCWH 4Y4HA 4NQCA 5EUOB 5DJ2A 1PD6A 3QPXL 4O2CA 2VITA 1KCVL 3MUGA 3TV3L 4P46B 4I9WD 2R8SL 4P4KC 2LTQC 1YMHB 2DLGA 2XFXB 5D2NE 1XIWB 1J1XH 3OKDB 1AKJA 4K94H 4O51B 2YUVA 4CN4A 1FNGA 3DXAB 4Z18A 5ID0A 2UWEB 4WCYL 4NQXA 1UXSB 4LHUG 2YEZA 5CP3H 4LLWA 5TJWK 1KIQB 3ULUH 4X98B 3X3GL 1IAIL 2A6KA 3OKMA 4U1IB 3MSPA 3ZL4H 1AGCA 4JKKA 1OP5K 3WLWD 4LVHB 1X5LA 4NN6B 2R4RL 5DA4A 5I9QB 2VLKA 5AYQA 3VRJB 1N0XL 4JDVB 3WKMH 1KEGL 3PJSB 4DCQB 3VGDA 2YZ1A 4LIQE 4W4OC 3O6KH 1KENL 2AKRA 2EO1A 2OP4H 4MJ5A 4ZOEA 1FPTH 4HKXA 3OXRB 3SKMB 1V7ML 3OXSB 1ZA3A 1BEYL 3PABA 3BGMB 1NLDH 1KB5B 1YDPA 2XZAL 2F15A 3E3QE 3BFOA 3AFLA 1IZKA 2C7UA 5GISL 2DTSA 3X12A 2AI0H 5C0RL 2DM3A 3SJVB 4TQEH 1JMZA 2RBLA 1A5FL 3LVEA 5J4MA 1F58L 1I7ZA 2YUXA 3MNWB 4XPBL 5HDLA 1C12B 2EDEA 1YPZA 5JUEL 1UG9A 4NSKA 2BHYA 5T3XH 1C16B 1F2QA 5IMMB 1ZSDA 1SVZA 2DF3A 3VG9C 4MJIE 3HE6A 4U1KA 2XV6B 3ZT7A 2AXJA 4OQTA 3KR3L 1NBQA 4KUCD 4TTDC 1KGCE 1G7PB 5E08H 4Y5VB 1PKQE 2HT3D 2CLVB 5GS0C 1IAIM 1V7NL 5CINL 2Q8AH 4GS7C 5EFIA 5E8OA 3VDAA 2A77L 4LHQB 2R56H 4YDLC 4KDVA 3LB6C 3T3MF 3BZ4B 5C0JB 3QFJB 4NRYA 3W0WE 5IUSA 1UJ3B 3AREB 5DD6B 2DMKA 5SX4I 3HMXH 4H8WC 4E5XB 5C6WH 1K9TA 5F70A 3CDGA 4KJPD 3BWAA 4XWOC 4Y5YC 4RX4A 1FNLA 1C5CL 1FVCB 3MRPA 4MQ7A 4NRXA 3U79A 1T6VN 1YNTB 1AD9A 3GMNB 1Z9SA 1FSKB 4CN1A 1FH5H 5T1DH 2NY5C 4ZG1A 2AJVH 4HF5L 1AXSB 3IXAB 3U0PA 1D7FA 1RHHB 4KI5F 3O45A 4XPHH 2X4TA 3LN5B 3NCJH 3HFML 4GG6A 2FJGA 1DL7H 4DGYH 1MJ7L 2ORBH 2Y5EA 2IG2L 5GRXG 4QXTB 1F3JB 4LPYA 1BX2B 4YXLH 5C0CA 1GC1C 1D6EA 1XR8A 3ZE2E 3QUMA 1U8HA 2F5AH 4NNYB 4QGTA 2NY3C 1IM3B 4GAYA 3P9MA 4UOW0 4R7NA 1CLYL 1FVEA 5I1JL 1CG9B 4P4RB 4NHUB 2Z31C 3P30L 4NYLA 1P2CB 3VXMA 5A16B 4LMQI 3L6FB 2W91A 3QIWD 4NN7C 5IMLA 3CDFA 2ZCLH 3H3PH 3W5MA 5T5FL 5LKNA 2FEDC 2EH7L 5DGQA 2CJUL 3BP6A 3FT4B 2ENYA 4YWGH 1I8KA 4KC3B 3PL6D 4G43A 3RWEA 1SMAA 4LHUA 5I1HL 3ZTNH 1SHMA 1CXLA 5HSFA 4RDQG 3HNTH 3BEWA 3DMMD 4G8EB 3E6HB 4ZS6D 4AIZB 2HWZH 3QDAA 3WFEL 1N5AB 5IGXL 4MS8C 3V2AR 4OFYD 5KSVA 3EOTL 5IT2H 1MLBB 2EYTB 1B0GB 4PLKD 1ZLUK 1PYWA 1CLOL 3DX8A 5HHXL 1U93A 5E8NA 5J8OA 5B8CA 4X6CB 5J3HC 2YWZA 2MTPA 3HLAB 4W68A 3JWOL 4OF0A 4S1DC 3RAJH 1U58A 3KYMA 4P5MA 2R69L 4OZIA 4I48B 5HI3D 1HWHB 2D9CA 2FHBA 2YHGA 3MRQB 2Z91A 2CUMA 3FB6B 3QUXC 1WCBA 1LE5A 2NY6C 2PO6C 1NCBH 3RWHA 1X5FA 3S3SA 4QHMA 4WI5A 4ZTPH 2HFGH 2VZ3A 4JM4L 3GMPA 3QHZL 2OMBA 3VFGH 4K8RD 3UO1L 3KPOB 4K3DL 3E2HC 1ZTXH 4UU9A 4XNUH 5DXWA 3LKNA 2P44B 3Q0HA 3WN5A 3IETB 3GBMH 1TNMA 2GTWB 3BXNB 2XKSA 4H8WH 4O2EB 5EBWB 3PDDA 3BKYL 4IMKA 4WUKL 3QXUA 4FG6D 1QRKA 1T2JA 1OSPH 3ILPB 1HINH 4TNVK 4EI6A 3H9SB 2CMRL 2EYRA 5FUOH 5FA4A 4XC3L 3LCYA 3TYFB 1C7SA 4LSVL 4OI8A 3FQTA 4P5TB 1O7SA 1J8HB 5I18L 3QXAA 4WU7A 2YD4A 4FQJL 1NCAL 1ULVA 3SEPA 4HKZA 2UY6A 2YD2A 3HC0B 1HHJB 3WO4B 1HH9A 1P6FA 5EULV 3TNMB 4BH8A 4GW1B 2VXTH 2FL5A 4EJ1C 2ZUYA 4XPFH 3BP4A 5J7CC 4ELKB 3PNWA 2YUZA 5CWSA 4RAHA 4HD9A 1U0QA 2F53B 3KYAA 1YPZF 3I6KB 5B38B 3L3GA 5JLZB 4KJQC 5I2IA 4IS6B 4KI5D 2OI9C 3PHSA 1INDL 5IHZB 3G6JE 1KJVA 3TGXA 1S9KC 1HXMA 1JZ7A 2XOTA 3PWLB 4P59H 4WWKB 5D7LD 4HX1A 2E3VA 3VFMB 3O2WH 2NQCA 4GOSA 4FA8A 4ZPVA 4Y4FC 2GCYB 1PJ9A 1WC7B 1QBLL 3PWPD 5HI4C 3GGWB 4K7PX 4X4XA 1FCCA 1SYSB 2X2YA 4QF1B 1VA9A 1F4WL 1HHIA 3NVQA 4AH2B 1DQJA 2DM4A 1NDGA 3N50A 4NJ9H 2E7LC 2HMID 2JB6B 4PREB 5FYJL 2CIKB 1HXYB 4GRWF 1BFVH 5IFJA 5IB3A 1KTKE 5FCUH 2PYEB 3U1SH 3FB7B 1A6PA 3BAEL 4LGSB 4QT5B 5GSRB 5C07B 4G5ZL 3JTTB 4ORGA 5C09E 3TBWB 1IAMA 1CGSL 1QKZL 1P4LA 3ARDB 5DURB 2I24N 3QZWB 4P57A 3DPBA 4HQQH 4AL8H 2OTWA 3TA3C 1K85A 4LCWD 3QI9B 1EEUA 4NHCL 1KTLB 3IFPA 4Z7VF 3I75B 3BDXA 1A6VL 4O9HL 3VXPB 4J6RL 3ZE1F 1DZBA 2MFNA 2NXYB 4GG6F 1M71A 3TC9A 1MHHB 4PBXA 3JWDC 3QNZA 2A9MH 5ETUB 4EDWH 2D7PA 2DWEB 2PW2B 2ZSWA 4LL9A 1KLGB 5BZWB 1JRHH 3VFUA 3H42H 4I5BA 4HWBL 4DTGH 3VXSB 1E4XH 4Y4HD 4NQCD 1TQBB 3TO4A 3TLRA 4LKXA 1X5YA 4FZEH 5KS9F 3V0VA 3WUWB 1E27A 5I74C 2J6EA 3O3DA 1UKTA 4YHML 3C5JB 4PLNC 4OB5H 4GBXA 3C5SA 1Q9WA 2WP3T 3BVNB 4GH7B 3EJYC 1JUFB 1MCIA 1RQ5A 3IDJB 3QCVL 2C4FU 3WUZA 3IB4A 1AKJD 2DQEH 3QEQA 1A1MA 3QNXA 1WFTA 4HC1H 3MO1A 4ZYKA 2ZG2A 4XP1H 1S7WA 3QDJA 1GXEA 2ZOKB 3DJ9A 2KZWA 3BWUC 4CMHC 3EGSB 3U0WH 4QRSB 3L7FA 2X4UB 3ARBB 2VLKD 4PJHB 4E41A 2B1HL 4OCRL 4HS6B 4MAYB 1B2WH 2ADJA 2W0LA 3DTXA 2DLIA 2YPLA 3HZVB 2NXZC 3T3ME 2AXFB 1XF4B 1LGVA 4JANB 3P0YH 2BNRA 4U6HB 4P9MH 3MRJB 4MJ2A 5CJOH 1UGNA 3C8KA 2PXYB 3U46B 5D7JC 3OAUL 1G6VK 2UVEA 3RX5A 1JGLH 2F8OA 3S4SG 3D48R 3IVKA 4TSAL 3TT1L 3VG0L 4N5ED 3U7YL 2HLFC 1QRNA 1BJ8A 3MRHB 3ARGA 2VLRB 1AI1H 1U6AH 1NMAL 1XF2B 3FCTA 4EN3C 4IRSB 5FO7B 4XNYH 3RVWD 5DMKB 4N90D 4OGXH 5FUCC 4JDTH 5AZ2L 1CL7L 4F7CA 4KI5E 5HVFB 1F00I 2MOVA 4GG8A 1NUDA 2B1AL 3HE6D 3RL2A 4M7JL 5EOCJ 5D7LE 1T7ZA 4NWTH 5GJSL 4D9LH 2OJZL 1JWUA 4FTVA 3PWPE 4MXQD 1RIHL 1R3IL 2NW3A 5FKPB 2H1PL 4XMKL 3IU4H 1BFOB 1RK1A 4QCIA 5DHYA 4OKVA 5GGRY 5GGSB 1N26A 3B5GA 3WIHL 1ZLSL 3TBSA 4XC1L 4POUB 1JYWA 3GM0A 4LNRA 3D3VA 2A6IB 2C4FT 2FJFA 1QLEL 1DUZB 4IDJH 5BS0E 1DBJL 1OP5H 3INUH 4OGYL 4XCEA 1FFOB 1I7RA 4NZRL 1EO5A 1WLHA 1JV5B 3ZKMD 1QQDB 3MCKA 3U9UA 2CDFB 4WEMB 1YNLH 2X41A 3SKNA 5KVDH 1AQDB 2ZKHH 2OK0L 1YQVH 1F2XK 4RX4D 5IQ9B 1H3VA 5GGTL 4LCWE 2VC2H 5IG7A 5GZNC 4Y4KA 3V9FA 1MY7A 4QYOB 1XGUB 3QR2A 4FQXB 1TTGA 5MENB 4M61A 5ESQA 4JQXC 5MERA 1F45A 2B4CL 1R3HA 1N59B 2MSPA 3IU3B 5H37G 2C3GA 5J12B 2ATKA 5I30H 5EC1B 5C0CD 1A7BA 4MCYA 3T0AA 1TTFA 1F6LL 4NQCE 5EWIH 2I9LA 3BMVA 2J1KA 4U0RC 4ZFOA 2I5YH 2MQCA 1AHWC 3D39B 3H3KA 3WFBL 5CSZA 4PJDB 1KIRB 2C1OB 2J88L 5JORA 1ZHNB 3BKMH 3RY5A 3VGAC 2FH6A 4RGNC 4RQQB 5AEAA 4RISL 1JPSH 1U2CA 2X1OA 1MCRA 5E2TL 3VXMD 2F8VA 4I2XE 3O41A 4PJEA 1UM4L 1JRHI 5EZIL 1E4XI 1IM9A 5HD8D 1DANU 1ES0A 2BNUB 4LPWA 1D9KB 1AFVL 3CPLA 2DDQL 1A1OB 2VWEC 3MFFB 5CHNA 1MJUH 2VLKE 5C7XL 5CEYA 3O8XC 4UDTB 4LHUD 2B20A 5CGMA 4PJ8B 2B0SL 5HYQB 3P0VH 1IGCL 3MV9A 3ES6B 4Y2DA 3S34L 3BYYA 4KI1A 4XNXL 1FGVL 2DI9A 2IAMA 1SBSL 3RL1B 5TH2B 2HRPH 3FQUB 4RDQF 2GAZA 3LQZB 4L9LC 3KDMB 5JPNB 4DW2H 2P24A 3CZJA 3IDYC 1NAMA 2FECI 4D0CA 1D5XB 1Y0LB 5CZVH 5JOEA 1JVKA 2E7BA 3M1BB 4FOMA 2R0LH 5SWSA 3LEYH 4XVUC 3D85A 1W72L 4LLVB 4D0DB 4E9LA 5HYFA 1BVKA 4OCXL 4N90E 2V5RA 3S4SA 4PP1C 1YPZE 4ZXBA 3DRQB 3QP3A 3SDDA 1T04A 3MV7B 1JPFB 1T89A 1MCBA 5IEKA 2VNCA 1ZANL 4AG4L 1H3GA 1ND0B 1LO3H 1CFTB 3M8OH 2DQIL 4WV1B 5CLTA 1CFQB 2PTUA 3WL9A 1SBBA 5EUKB 4OLYL 4P2OA 1BQHB 4QRPB 2PW1A 3SKJH 4P3CH 3WFHB 1UWXK 1CQKA 2ICWA 4MCZB 2R2HA 1AGFA 3MGOB 5DO2C 5C0FB 5A40E 4OF7A 3TVMA 4JR9H 1M1SA 2J8OA 5CJQL 2R2EB 1BFSA 1LK3H 5HGAB 3T77B 2W9LA 3LY6A 5IVNA 3B3IB 1FG2A 3CVIH 1OT2A 1J0HA 3GSWA 1T1ZA 2BXYA 2IBBA 3EO1B 3PHQA 4NKDA 3PGDB 3WNLA 4KMLB 4Z7UA 1KIPB 4U6YB 1DANT 4G9FA 2G5BB 1MH5A 4X6EB 4ZUSA 2D7TL 2VDRL 2ZUXA 1N5YH 4Y5XB 1EXUA 4RA0C 1ZLUH 2XQYG 1T3FB 3OKLA 1IE5A 4OD3H 3TT3L 4Z7VE 1VSCA 4Q2ZB 4PV9B 4U1SA 1K4DA 3SGKC 4OV5B 1NC2A 1BZ9B 2WM0A 5EBLB 3ZE1E 3UJTH 4GG6E 4B0MM 3AY4A 2J4WL 5IFHL 1CLCA 1F02I 3HZMA 5L88L 1MRCL 3Q5YA 1LO2H 4FQLL 1DEEA 3QUZB 4JFEB 1RZIB 1W0WA 4IMLB 5C0CE 1LO5A 1A6AB 3BUTA 3UTSA 2HT2C 5ADOL 2APBA 2NNAB 1A6TA 2X4RB 3MOAH 5MI0C 3BRFA 1DQTA 1IAOA 2GSIA 4I0KA 2DBJA 3X17A 5EUOA 5AG9A 1RUKH 5J6HB 3RP1A 5KS9E 1J10A 4P46A 2GW5A 4N0RA 5DA0B 1K8IB 1J1OL 3CUPB 5HHVH 3MLXL 1YMHA 4DZ8B 2XFXA 3LKSB 1XIWA 3VXME 4ZUUB 4XPGH 1FE8L 3OKDA 3STZB 4O51A 2VDQL 3DXAA 2UWEA 3GMRB 1ZVHA 3BISA 1UXSA 1KCSH 1A7PH 1D6VH 5DUMH 4WI3A 5JHDB 1KIQA 4X4YB 4X98A 5E6YA 2Q8BL 2QADD 4U1IA 1T66C 4JFDA 2EDRA 4KK5D 2R0ZH 4JO4L 4DKEL 5I1KL 4PYHA 3VRJA 3FTGB 4JDVA 3LN4B 4QXUL 5F3HB 4F58L 3PJSA 4DCQA 1MCDA 3WS6A 2CKBL 1FGNL 2XQBH 2CO7B 4G6AD 1VGEH 4QRQB 1NUGA 1J12A 4RNRA 3OXRA 1OAKL 1FZJB 3SKMA 3F12A 1WQVT 2VUYA 2YD1A 4JO2H 3RI5K 4Z9KB 3OXSA 3MLYL 1VDGA 4ODTH 4JPWL 1AR2A 2K7PA 3BGMA 1KB5A 4CGTA 1L0YA 5AUMB 4X7SL 2CUIA 4NNPL 1CDHA 2V9TA 3MLUL 4QXGL 4S1QH 2DQJL 4LEOB 1VACB 2RR3A 1E28B 4PLJC 3TO4D 3SJVA 3MRMA 2D03L 1ZLVH 1CZ8H 4WW1B 2JELL 4H5SB 1C12A 5K9JL 4GBXD 1QLRB 4OFIA 1C16A 5IMMA 4OLXL 4MQXC 3UJJH 4MVBD 2B2XL 2BNQB 5AYUH 3RWFB 4RMTA 5FYKD 5GS2D 3QEQD 4HS8H 3E0GA 2DKSA 5TQ0L 1YEEL 1XGYL 1QLFB 4V1DB 4N8VB 3L1OH 3QPQD 1G7PA 1HK6A 4Y5VA 3P4NA 4OGZA 2NZ9D 2CLVA 3HPLB 3BD4A 4GMSH 4KKLC 4FQHB 1HIMH 4E41D 2FATL 1FNAA 1N64H 4TPRH 4FQPA 4XVSL 1TTUA 2W60B 4JFHD 4CU6A 4H0HB 2YPLD 4F37K 3MBXH 5C0JA 5FCSH 3LKPB 5EOCL 4M3JA 1UJ3A 3AREA 2BNRD 5FYLH 2MKLC 3MACL 5DD6A 2FWOB 1H3XA 1EHLL 4E5XA 3BPOB 1MLCB 3NACL 4KVNL 1QFWH 5B38G 2WMPA 1QRND 2DQUL 3ARGD 1FVCA 1ZKAA 3FJTA 1YNTA 4Q97A 3GMNA 2E6QA 3IXAA 3WXVH 4ZO6A 1RHHA 1F6AB 3F62A 1EDQA 1U8QB 2BCKB 5C3TA 3RU8L 3LN5A 4M7LL 4XMLL 5HYIA 1LO4L 3CZFA 3ORJA 4TVSa 2VQ1B 3BD3A 2J3SA 4HKJB 4FTVD 1I1CA 4QXTA 1F3JA 1U3HC 3CFBB 4NBXB 5J1SC 1T4KB 3U7WH 3SQOH 4BZ2H 3V7MA 1V3KA 1FBIH 3ZKND 1Z3GH 1ORSB 4NNYA 1OQOA 1A4KB 3LHPH 3TP4A 4GKSB 3HC3L 1CG9A 4P4RA 5I1CL 4QOKE 4NHUA 1I85C 1TIUA 3QZWG 4OFVA 3TJHC 1U36A 3D3VD 4X80L 1P2CA 4GW4B 2JK5B 5HHPB 3GBNH 3L6FA 5HDOA 1QFPA 3ELAT 5C1MB 4G42B 3VD9A 5FDWB 3TJEH 5C3LD 4NWUL 3RVXC 5K59F 2MQ0A 3I3DA 4N5UA 3P9WB 3FT4A 4Q9RL 5F93C 3UJIH 5CD3B 4JPKH 4KROB 4Y4KD 3PWUB 4OLZL 4FZ8L 1R5WB 4MDJB 1DLHB 3VD7A 2GSGB 2P5WB 5EDXA 5F97E 4G8EA 3E6HA 4ZTOH 3HN3A 5FF6A 1LP9A 5D1ZB 2BSTB 4I0PC 1MLBA 2EYTA 2XG4A 1B0GA 1XT5A 3HMXA 3KVQA 3WUWG 5TF0A 4YHOH 2YKLL 4G8FB 1JZ6A 4PGZA 5GRJL 5F1KC 4XAWL 4JFOB 1KTRL 4HWUA 4X6CA 1IBGL 5DMGD 3GO1H 4DKFH 5EUOF 5JOPD 2FD6L 2WP3O 5HGBB 2EZ0D 5L8LB 1FSKC 1FJ1B 4UAOB 5IW6B 2DI8A 1XFPA 1MJ8H 3WE6B 4I48A 3KNBB 4YJZL 3MRQA 4JFZL 3EO0B 2HYMA 1VPOL 3FB6A 3ROOB 3K2UH 1I9IH 3V0WH 1X6LA 3NCYS 1RURH 4WFGD 2D7NA 2IC2A 3RGVC 3U9PH 4L4JA 1YY9C 5FYKE 4AK1A 2UWEF 4FQ2L 3MC0A 1QUNA 2IQAB 3RTQA 1GGCL 1YYML 2K3TA 3DV6B 3GM8A 3JBG7 3IFNL 3IETA 3DX9B 4PJCB 1BJ1H 1IM9D 2GTWA 1QYGL 4X5WB 4ACPA 4O2EA 5EBWA 4KZDL 2MPAL 5TF1H 1S7RB 4E41E 3ILPA 4I18B 3H9SA 5DFVC 7FABL 5B3NA 4WFFE 2H32H 1EX0A 2PN5A 1ZHKB 4OTXH 5KVFH 4S1RL 3MV9D 4JFHE 2AJSL 2YPLE 3TYFA 4Y2DD 2DOCA 4OZHF 1RU9H 1J8HA 2UVFA 5DRZB 5B4MD 2BNRE 2IAMD 5FEBA 3S36X 5LGKA 3HC0A 5H2BB 1HHJA 1MFAL 3QULB 1VCAA 3TNMA 4NM4H 2VN7A 4GW1A 1WITA 2NY1D 1QRNE 4JHAL 1H3WM 2HT2D 3MOBL 4QO1A 2XRAL 5SWSD 2NYYC 4ELKA 2YR3A 3D85D 5I19H 4PRNB 5DK2B 4P23C 3SY0B 2OL3B 2VDKH 4O5LH 3MLTB 1MCOH 4XRCA 4UBDD 2F53A 4ZXBD 3ZO0A 3I6KA 3CMOH 1S5IH 43CAB 4Y2OA 5GGQL 3SDDD 1NL0L 3ULVF 5JLZA 4IDLA 1GL4B 4IS6A 1YEGH 3D6GA 2NW2B 1BD2E 5D72L 1P4BH 5IHZA 1JBJA 4ZFGH 1QFWI 3PWLA 5L2KB 4WWKA 5GS1C 3S36L 3VFMA 4LQ1A 3ABZA 4P2OD 1GPOL 2GCYA 4BQCA 1WC7A 1JGUH 1TZGL 3GGWA 4IIQC 1SYSA 4QF1A 2I60L 3UCRA 4X4ME 4R2GC 3MR9B 4PJAB 1KCRL 4AH2A 1C1EH 3ET9F 3TVMD 2OJEA 4LDEB 2JB6A 3D3VE 2CIKA 3U36B 4XI5C 2QQLL 2PYEA 3FB7A 3QG6B 4BYHA 1BZ7B 5FGBC 5IF0B 4QT5A 5GSRA 5C07A 5HVHC 4U2YA 3PF2A 3JTTA 3KYKL 4NGHL 3TBWA 5DD0L 1CFSB 3ARDA 3NH7L 3QZWA 1OTTD 3EYOB 1MF2H 2ZWLT 4XWGL 2G5RA 1I7UB 3VXRB 4G6JL 5T5NF 3I9GL 3QI9A 1KTLA 3QPXH 1WV7T 2EICA 1IT9L 4MSWB 3GSRB 4P5TC 1KCVH 3I75A 3S97C 3TV3H 2AEIT 2W0FB 1NC2D 2R8SH 2DQHL 4M7KL 4C54A 5DF0A 1MHHA 4P2RB 3TM6A 1TFHA 4NQVB 1NAKL 2DQGL 5ETUA 3UPRB 3ZHKA 1MCKA 2DWEA 3UTSD 3IDUA 4WCYH 2PW2A 3CU7A 5I8CB 5BZWA 1T0NA 1EBPA 2D31B 4MA1C 3VXSA 1OQXA 3SOBL 4OT1L 3ZKXC 3X3GH 1IAIH 3WUWA 4P46D 4WDIB 4PGDB 4WFGE 3MBEB 1DBAL 1INQB 2R4RH 3C5JA 4QTHB 1N0XH 3BVNA 1KEGH 1XIWD 1JUFA 2DM7A 1UWXH 3KJ4B 5IROA 1KENH 3DXAD 2FX9L 1V7MH 2DBLL 3FMGL 1S7UB 1TZHB 4KUZL 1BEYH 4PJGB 5JZ7C 1JZ8A 2XZAH 5A2FA 4CJ0A 2ZOKA 1ADQA 3EGSA 4QRSA 2AEQL 5E6IB 3EDDA 5GISH 2X4UA 3MV9E 3ARBA 4PJHA 3LN9A 1XR9A 5E5MB 5J11C 1X5KA 4HS6A 4MAYA 5C0RH 4B7IA 1A5FH 1GAFL 4HH8A 1F58H 3DX6B 5DMJB 3HZVA 5CJ5A 2EDDA 4G8GB 2AXFA 1XF4A 1UM6L 5DEGB 4JANA 5JUEH 4CVUA 3VMNA 1D5ZB 3MRJA 2ESVE 5L0QC 2PXYA 2QLVB 2VO5A 3U46A 3H6JA 3HNSL 4X6CF 3LDBC 4A6YB 5SWSE 3KR3H 1CTOA 4I4WB 2CRYA 3BPCB 4HXBL 1OW0C 3MRHA 5CS7A 2VLRA 4NKMB 5K9KB 2VLJB 5C92A 4IRSA 3SJVD 1V7NH 4LLAA 5DMKA 5CINH 2X7LB 3L5WB 3QIUB 4NO0B 1BQHG 2A77H 3ULVD 3NCMA 2RAMA 3WFDL 2I25N 2EDQA 1YMMB 4HAGA 5KZCD 1QBBA 2X9XA 4NQTA 1I9JL 2RQ8A 4LOUD 3VGFA 3B9AA 3L5IA 1IGYB 5FKPA 2UUDK 1ZGLM 1BFOA 1C5CH 5GGSA 3THML 4K9EL 4HF5H 3DARA 1P7QB 2CDEB 3TN0B 4WHTB 2EDYA 2A6IA 1MCWM 3ARED 4ENED 1DUZA 1CQYA 3JWNC 4JN2B 3K4DA 1FFOA 1JV5A 1QQDA 5DI8B 3HFMH 1IL1B 1MJ7H 4MLIA 5K59E 2BERA 3RDTC 1MSPA 1AQDA 2IG2H 4HC1A 2H6PA 5A2IH 5KJRL 5FV2A 4NO3B 4CVWA 2KPNA 5C0AB 3V6ZB 4LSSL 4Y16B 3UPAA 3P2TA 5IFAL 4QYOA 3UDWC 1XGUA 1JFQL 3O6FC 2F54A 3C60C 4MXWL 4URTB 3FO0L 5I1AB 5MENA 5BJTA 2V2TB 2Y6SC 1B0RB 5DC9B 3P30H 1N59A 4WRLA 5D70L 3IU3A 5IW3A 3UTSE 5EC1A 4HCRL 2BJML 5T5FH 5EUOE 3T1WA 3BD5A 1H8NA 2EDBA 2EH7H 2CJUH 5BRZB 3D39A 4OM1L 3NFNB 4PJDA 5I1HH 3FRUB 1KIRA 1J0ZA 1F3DH 4LDOB 1ZHNA 1LWRA 2R1XB 4RQQA 5T3XD 4YX2L 2EKJA 3WFEH 3WHE1 2F58L 2UWEE 4L4VA 5IGXH 1HE7A 2WQRA 3EOTH 4UNUA 4AY0A 5FOBA 4HWEL 3SGDH 4DGIL 1CLOH 2BNUA 3F7YB 4YEFA 5HHXH 1IAII 1D9KA 4NCDA 3MFFA 1A1OA 2VMFA 1I1AC 3JWOH 1S8DB 5E1AB 2FCBA 4PJ8A 4RSVA 2WUCL 2R69H 5F7EL 5HYQA 3QQ9D 5D6DA 3ES6A 3G04B 4LIQL 4OZHE 2XWBB 5CJXC 1KN4L 5HHQB 3RL1A 5TH2A 1CK0L 3FQRB 1L4IA 1N2RB 4JM4H 3QHZH 3LQZA 2IPTL 3UO1H 3KDMA 2J12B 4K3DH 3IGAB 1VFUA 5B21A 1RIVL 1HYRC 1D5XA 1Y0LA 3M1BA 4G7VL 3SJVE 2EDOA 4JZJB 4WUKH 3BKYH 4LLVA 4D0DA 4YXKL 3HAEB 3P4OB 4NQEB 2EEBA 3CNKA 2CMRH 3DRQA 4FQXC 2A73A 3WJLC 4N8VG 1CGYA 3ULVE 4XC3H 2R39A 3MV7A 4LSVH 2BVPB 1ZOXA 5GIRB 1ND0A 5I18H 2EDLA 1CFTA 4FQJH 1H5BC 1NCAH 2Y07L 5J6GA 1K3IA 3CFKB 1OGAB 3RTQD 1ITBB 4PJFF 4F9LC 2F9BT 3GSQB 5EUKA 3VCLB 2QV2A 1BQHA 1REIA 4QRPA 2H41A 3LKQB 4EXKA 3BMWA 3WFHA 4PJHF 4MCZA 3H9SD 3MGOA 4Z76B 2DL2A 3EDJA 4WENB 4NZTL 5C0FA 1R3KB 3SQBA 5D93B 3QFJE 4JFFA 5CJBA 1J8HD 1P84K 5F7WC 2R2EA 5HGAA 4UZGA 3T77A 2AV7A 2VR5A 3B3IA 3B9KB 2K1MA 5F7FA 1INDH 3EO1A 5EZJB 2BP3A 4RMWA 4LVOB 1WSST 3PGDA 2OSLB 3H9YA 4AEIL 2IFGA 2CGRL 2ZCHL 4X6EA 2Q87A 1D5IL 5L8JB 5E5UB 1QBLH 1EVUA 3GB7B 4Y5XA 1NFKA 1T3FA 2F53D 3B9EA 1MFDH 4M9PA 4WWID 5D1XB 1CS6A 1G7IB 1CXKA 4Q2ZA 4PV9A 1P1ZB 1SMOA 2RB8A 1F4WH 4OV5A 3GDBA 3TIDA 1B4JL 5F7HA 4R90H 5FYJH 1PSKL 2C3HA 1CXEA 3KPSB 4JFEA 3QUZA 3BAEH 1RZIA 4WWKD 3A6BL 1A6AA 2NY4C 2SEBB 4G5ZH 5E4EB 2NNAA 3SE3C 5DS8B 1CGSH 1QKZH 2X4RA 4GFTB 2P8PB 4OM0L 4IOIA 5IMKA 5J6HA 3FQWB 3GSOA 4L3EB 3DBXB 4YUEL 2L0DA 3CUPA 4NHCH 5T3XE 2Q20A 3OJDB 5L6YL 4DZ8A 3LKSA 1A6VH 4O9HH 3MLWL 1DVFC 2PYED 3FN9A 4WV1C 3WDIA 1KC5L 5CLWA 4J6RH 1HSAB 3STZA 2OTUB 5C07D 3GMRA 4HUXB 4M1CC 5DURD 3ARDD 3L5JA 1EAJA 3H8NA 5JHDA 5JDSB 1WICA 2CDGB 4X4YA 3I3EA 3KYNB 2P47B 4XBPB 4HWBH 3KS0H 4BH7B 3QI9D 4ZUWB 3LN4A 5F3HA 2R29L 1RZFL 4XCYB 4YHMH 2B4CC 2NXYD 1FZJA 1TVBB 3BP5B 2E7CA 3RWGB 3QBTB 3QCVH 4HWZB 3ZE0F 4W4NA 3SGDI 3M07A 1II4E 2BSED 2EIZB 4X6CE 4BM7A 5AUMA 2WV3A 4X9GA 2X5PA 4UIMB 5E8DL 4NZJA 3VXSD 4LEOA 1OWWA 1VACA 4HUWB 1E28A 4HJ0C 5ICZB 2XTLA 3UTPD 4YH6A 4PJDF 4HBCL 4WW1A 4H5SA 3QNYB 4IRJB 3V6OC 1FYTA 1QLRA 2B1HH 4OCRH 5BOPA 1A7RL 5JO5B 5F1OB 3ZKSD 2BNQA 4FP8L 4LARL 4BFGA 3BHBA 3RWFA 2R1YA 1AR1D 4ODBD 3T09A 1QLFA 4N8VA 4JFXB 1NSNL 3SGJA 3OAUH 4PRDA 3SGEH 4TSAH 3H9SE 5TPWL 4XHJC 5E8EB 3TT1H 3UXFA 3VG0H 3HPLA 3U7YH 4F80A 3T0DA 1VADB 4XB7A 4FQHA 1KYOK 3ARBD 1NMAH 4MAYD 2D4FA 5DZOA 4EEEA 4GQ9L 4Y19B 1J8HE 3V52L 1AP2B 1YECL 2W60A 4POZC 5I1EL 3LKPA 5AZ2H 1CL7H 3VDCA 3HE7B 3S5LB 1MFNA 1TDQA 1M6OB 3A0OA 2FWOA 2B1AH 3ULSB 2PXYD 3ZYIA 3L3DB 4XT1C 1X9QA 1MLCA 1OD9A 5GJSH 1R5IB 2OJZH 1W0VA 3DUUB 3BO8B 4WI9A 1RIHH 3D2UB 3GSNL 2IFFL 1R3IH 5GRUH 2VLRD 3F7VB 1T83C 2F53E 4IRSD 3T0WA 2H1PH 3U48A 4XMKH 2XZQL 4JHBA 3AAZB 1CD1B 4S10A 3WS3A 4U1GB 1U8QA 2BCKA 3WIHH 5F7NC 1ZLSH 4JY4B 1BBDL 4XC1H 3VI3F 3W39B 2ZPKL 2VQ1A 1QLEH 4R4BB 1DBJH 4OGYH 1WFUA 3FT2B 3GJEA 4HKJA 4NZRH 3SO3C 2VB5A 2HJLA 3CFBA 3BW9B 2GUOB 4F3FB 3DVIA 4ZAKC 4JQIL 1UEMA 5KVEL 1T4KA 5L2JB 1ZVSB 2NR6C 3GMMB 1R3JB 3PV7A 5FUZL 2OK0H 1ORSA 1TJHL 4HZLB 1EZVY 2K7QA 2P46B 3JTSA 5F7MC 5GGTH 4GKSA 3I50L 2ADFL 3ZDYF 2ADGB 4J4PA 1NCNA 5F3BB 2HN7B 4MA8L 1RMFL 4HHAB 3P73B 4GW4A 2JK5A 1D3CA 4F8TA 5HHPA 1GSMA 3HKFA 4HIJA 4ZUTB 5ITBL 4G42A 2NY0C 2B4CH 3WJJA 5FDWA 4RFEB 4KJWD 2QQKL 4PTTB 3VWJC 4YAQA 1I1YB 1HNGA 4QHLB 4XBEL 4ZFFB 4LCCB 3Q3GA 2EDNA 5GGUA 1MWAL 2XICA 2PTTB 4KDTC 3MJ7B 1S9VB 3CLFL 3HI6L 4PJ9C 4ZNEA 3PWUA 1R5WA 5KW9L 2HAZA 4YPGB 4MDJA 1DLHA 3JXAA 3VFNB 4XNQB 2P5WA 3WFBH 3S37X 3VRIB 2F54D 4FQXD 4J3VA 5D1ZA 5MEND 2BSTA 2J88H 3QEHB 3MA7B 4A2MA 2EE6A 1SM3L 3BI9X 4RISH 1OD7A 5EU6B 5F1IB 5E2TH 4GXVL 4LLDB 5BW7C 4G8FA 1HYSD 4EI5B 5LGJB 4JFOA 3VXSE 1CICC 1UM4H 3D0VB 3RNKB 2IPUG 5EZIH 5HGBA 1FJ1A 4DGVL 3CFEA 1YEDB 2Q86B 1Q9OA 2GEEA 5FAAA 3WE6A 1AFVH 3D39D 2DDQH 3KNBA 1T7WA 5C7XH 4J23A 1PX4A 3ROOA 1I8MB 4WFED 2B0SH 4CW1B 1IGCH 3LRGA 1DFBL 1NGYB 3S34H 1U8KB 2UUDH 4XNXH 4L4VD 4DFHA 1FGVH 2VL5B 4XH2B 1SBSH 2I26N 3HMWL 2IQAA 4PJFE 1IJ9A 1KNOB 3DV6A 3HZKB 1P69B 3KWWB 3DX9A 1C5DA 4PJCA 4X83A 3FFCA 4Z0XB 3IDMB 1ONQB 4X5WA 3DETD 4Z7OF 1D9KD 35C8H 1S7RA 2WQ8A 5HGGS 4PJHE 3U0TB 3PGCB 4KXZH 5E70A 5FECA 1T6WA 3QDMB 1N4XL 4PJ8D 1W72H 1ZHKA 5CEXB 1W0YT 2FX7L 2YK1L 1JNHB 4OCXH 2V5YA 1GVIA 4R0LC 4M6ML 5DRZA 3LV3B 4OZGB 5E4IA 1E4KC 1P5VA 5H2BA 3QULA 4YDKL 4YC2B 2GFBB 4MB3A 2COQA 1QOKA 4LLUB 1ZANH 4AG4H 3WCYA 3ZTJH 1MREL 4KKNA 2VKXA 2DQIH 3MRNB 3SGEI 2APFA 4UNVA 4NO2B 2VLRE 4OLYH 3KXFB 1TETL 3O3AB 4PRNA 4JHZA 5DK2A 1CVSC 2ATPB 2OL3A 3S98A 2C9AA 3BX7C 1J0IA 4L8CB 43CAA 2ED7A 1CL7I 1HHGB 3CFJB 1FZOB 3MV7D 3RQ3A 4MDIB 2HG5B 1Z0MA 2NW2A 4KJYB 4XP4L 4KY1L 5CJQH 12E8L 1SJHB 3QIWB 4DEPB 4NC2B 4WEUD 1B0WA 2FGZA 3EOAB 5CAYB 1NLBL 5L2KA 2PCPB 3WFCH 3AB0B 1NFIB 1EJOL 2VZSA 4QRPD 1MQ8A 4APQB 4MMXC 5FDYA 3RNQB 2D7TH 4L3AA 2VDRH 3HUJF 3MR9A 4PJAA 3WMSA 4WGVB 5DRXB 4U1HB 2ZG1A 4JFFD 3TT3H 2X1QA 2BMKB 2EKSB 3CGTA 3UAJD 4V2CB 1KJ2L 5F9AC 1IQWL 3U36A 3I2CL 4RWHA 2QBWA 1BZ7A 1UYWL 1T1WB 1B6UA 5IF0A 1U91B 1WBYB 2J4WH 5IFHH 4Y88A 3ARFC 5L88H 1MRCH 1CFSA 4FQLH 1AD0B 4ZSOE 3EYOA 5ADOH 1XF1A 4I18C 3VGBA 3VXRA 3SE4A 4FMKA 4NO5B 3GSRA 2W0FA 3MRFB 5MENE 4JEGB 4MNQA 4NZDA 1J1OH 1WJ3A 2BRQA 4MNHB 4P2RA 3T2OA 4NQVA 1FE8H 4JFED 3QUZD 2AQ1A