2E27H

Crystal structure of fv fragment of anti-ciguatoxin antibody complexed with abc-ring of ciguatoxin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
116
structure length
116
Chain Sequence
b'QVQLLESGAELARPGASVKLSCKASGYTFTTYWMQWVRQRPGQGLEWIGAIYPGNGDTRYSQKFKGKATLTADTSSSTASMQLSSLASEDSAVYYCARSDYGGDYWGQGTSVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords anti-ciguatoxin antibody, light chain
publication title Critical contribution of aromatic rings to specific recognition of polyether rings. The case of ciguatoxin CTX3C-ABC and its specific antibody 1C49.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 24
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2006-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2e27H00
2ZJSL 2Z31D 4PRDA 1S7TA 1XCQB 4FFVC 5AWNL 4JFOA 5D1QA 3RKDC 1ACYH 3KLAB 4HX1A 5DFTA 4K94C 5ESQB 5GRUL 3MRKA 2Q8BL 5DD0H 2F19L 4ETYA 1KPVA 4PY8I 5F21B 3T2PA 4Q74A 4OZGF 2O5YH 4L3EA 4OCSH 4LDEB 3TA3B 4L9LC 1OY3B 1S9WB 4JFXB 3QXAB 4B7IA 1RAMA 2ARJB 1BZQK 5JW4N 3Q1SH 4HW6A 5CSZA 3BGFC 4UTAH 4QHUA 5B8CB 3RY4A 1C5DA 4GMSL 2X2YA 3GJFA 4JFHE 1KIQB 1RD6A 3PHOA 4QRUB 4AL8H 5K9JH 1OARL 5J0BA 1CDIA 3G04A 1WZKA 3PWPD 3ZYJA 5F7FA 3CFEA 5GZOC 4HGWB 4FTVD 5IT2H 1GC1L 5KSAD 5INCA 1R5IA 1X5FA 2QQLL 4XVJL 4JPIA 4Q0XL 5HHNA 2E6JA 4XC3H 2VOTA 2IAMB 3UMTA 4MJ5B 4BA8A 4G3YH 4W81A 5AZ2L 1PG7W 5D6DA 1GCFA 1XF5B 4MJ2A 2VDMH 4Z7QE 2AI0H 2CJUH 4CADB 4LNRB 1WBZA 2GSGA 4DW2H 3VFTA 1A6UL 4XTRC 3UTSD 3GI8H 4HV8B 1HI6B 2AEQL 4HWZA 5KANI 5DLML 3TFKC 4LQ1A 5C0BE 2VABA 2NY1B 3VH8G 5C0CA 1ES0A 3RL1B 5GS2D 2CR3A 4WI4A 5KG9A 1U8NB 4HIEB 1FG2B 1RZKH 4OIAA 3LN5A 4U3CA 1RUKH 1F4XL 4NFBA 5EORH 4XPFH 2X4UA 4HDIA 2AJZB 5TE6L 3PL6D 4KKCC 5DZNA 1HXMA 3QFJD 4GRMB 4JB9H 4RISL 3HLAA 3C5ZD 4Q97A 4ODTL 1P5UA 3F58H 5C0BA 3U0WL 2W38A 3B2UC 1IM3B 3RWIB 2LU4A 4X80L 5HVGB 3H9SB 3OKLB 3QZWA 3X13B 5LGHH 4JRXE 4PBVC 1X5ZA 3MRJA 3TZVD 4K9EC 1I7ZA 4PG2C 2A1WL 1QFWM 3WS3B 2HMID 2DWDB 3MQIA 3RX7A 3ILQD 4AG4H 4LSTH 2B1AL 1TETH 2GYSA 1SQ2N 3OL2A 1U8QA 1NCAL 1P1ZA 4M1GH 5CP7A 3QRGH 3IFNH 4X5WA 1W72B 3PDGA 5D7KE 1KCSH 2DQUH 5EZJB 4K71B 3MRHA 5AAWA 5IW6A 1U3HD 4N68A 1RUMH 2A0LC 1QFWH 1VEPA 2V9RA 2FO4B 3PV6A 5GGQL 4PJ5D 1DEEA 1UZ8B 1UACH 5DHXB 4KTEH 4POZD 3LS4L 3S4SB 1D5MA 2HTKC 3V6FB 4IIQC 1JWSB 1MH5A 4QRSA 4KFZC 3O4LB 2CKBB 2OTUA 5CCKH 2EE6A 3MBED 4MAUH 3NTCL 1ZVHA 2PUQT 2E7LC 1P4LA 1KT2A 4X7CC 2W0FA 1OAQH 3QNXB 3I02A 4XBGA 4LCCC 5I8OL 2KKQA 2Y7QA 5FF6A 2PO6A 2I9LB 3PWJB 3W39A 1WSST 1BOYA 1BZ7A 1A4JA 1FZMA 2UYLB 1KC5L 3LPFA 5DWUL 4U1NA 1G0DA 3BH8A 1ZLUK 2VIRB 1BWMA 5I73B 2P7TB 5C2BL 1F13A 1EGJL 4ZG1A 1HCVA 4J6RL 1ZEAH 1OGTB 2DBLH 4S1QH 3GO1H 1CFNA 5HGDB 5JQ6H 4KTDL 2UZIL 3HMWH 4RGNE 5E6ID 5C0RL 1S9VB 1BEYL 1QZ1A 3EIFA 3D3VD 2MFNA 1YEIL 3CMOL 4PJ8A 4TOYL 4G42B 2F54E 4X4YB 4Z5RB 1PLGL 1IC7L 3A67L 3ULVD 2DQIH 4Z7OF 3MOAL 3QUMH 4OGXH 2JK5A 5FYKE 5FA4A 3EGSA 2EDBA 2MPAH 3QQ9D 1C8PA 3CFJB 3V5HA 4IS6B 1JUFB 3TBYB 1T03L 3FONA 1DQMH 5I8EA 1PEWA 2XWTA 2EEDA 1WC7B 3B9KD 2Z93A 1BD2E 1QPPA 5I19H 2BSTA 2F54A 1IAMA 2WUBH 3G08B 2VUYA 3T0EC 1LDSA 4L9LB 3HUJF 4KRNA 1GPOL 4OZ4B 4NNPL 4HUMB 4JFFE 5I1DB 2NYYC 1CFVL 2NY0D 4NQXB 3FFCE 5KS9B 3BGFB 2N7AA 2I9TA 2DM7A 3UJTH 3LB6C 4WCYH 1OP9A 2ED7A 1JWMA 3QCVL 2HN7B 3CZJA 4GG8B 4JQXA 3MLSH 1CL7H 2VERN 1NBQA 3MUZ1 1F11A 4X5LA 5CINL 4PRAA 7FABH 3TJHC 1MPAL 1A5FL 1BD2A 4XMPL 5EPMA 1AFVH 3GSXA 3QHZL 5ITFB 4JFFA 1ZVSB 3DX7B 3N85H 4KDTA 1KB9K 3FFCA 5HHVL 3WO4C 5FUOL 1OB1A 3BVNB 3NOIA 5I8KL 2V2WB 1X5KA 5D8JH 3V6ZA 3VG0H 4FQQB 2XKNB 1AQDB 4OZHB 1NGQH 4MNHA 2G60L 4LSSL 4FFWC 3QG7L 3P9MB 4L5FH 1PDKA 3D39A 4IOIB 2HP4A 5F7NC 2V17H 5FHBL 3RI5K 1JE6A 1T7WA 1ZVYA 4LARH 4PRBB 1I9RL 1NDMA 2J1KA 3MRCB 4IOFD 4ACPA 2Y06L 2FX9L 1V7MH 1U3YA 3THML 2Z31C 4WUUB 3NFSH 1IKNC 1S7XA 3S37H 4KRMB 5EO0A 3QJHB 3L3KB 4NGHH 1MCSA 3NCYP 5I17B 3LD8C 4MJIE 3H9HB 3KLAA 4XI5D 5DQJB 4TYUA 1NCCL 3EW3B 3V4PL 3DVGA 2GIYA 4XMLH 3WD5L 4OKDA 3FT2B 2P5EB 2K1MA 3NMEA 4OZFG 2DI8A 5SWSD 1KSRA 3PIQA 2A74B 4CU8A 1M7IA 3FT3B 3TNNA 3IDXH 3WFDH 4Z9KB 2BRRH 4TSCL 5C71A 5CFHA 5MHSD 1KIQA 4QRUA 5EOCH 1MHCB 1U92A 4MJIA 5T1KD 4OCWL 1LD9B 5KSAC 4XC1L 1P84J 1FLTX 5TQ0L 4HGWA 4JN1L 5F7KC 4GLRH 2J8UB 1CYGA 4WY7H 4TRPL 4EOWL 5D2NC 1RJZB 3IVKB 3T4AB 4U3HA 4E5XA 1HKLH 1J10A 1LK2A 1MCKA 1CFQB 5HHME 2ZUSA 4E0RA 5BRZB 1KB5H 3NIGF 3SGEH 4Y7MA 1EIBA 3I6LE 1LP9F 4G8GD 1NC2D 4MCYA 4CADA 3MXVL 3MV7E 1I7UB 4IIQB 1HI6A 3D2UA 2XZCH 1X4ZA 3OJVC 4O4YH 2D9QB 1XF4A 1TJHL 3KS0J 2GT9B 3I3DA 4OLXH 1SMAA 2PYEE 2XZZA 3IS1X 4UQ3B 1UFUA 2QSTA 3O8XB 5EIIA 3RL1A 4LCCB 4ONFH 4JGUA 5ALBH 4WI2A 2HT4D 1U8NA 4HIEA 4ZFOL 2YZ1A 5IMLB 5GGUA 3NAAH 1UXWA 1TCRB 3PL6C 3RNKB 4ETQA 3GSOB 4XX1E 1Q0XL 3WUWG 1YMMD 3MV7A 3BW9B 3CX5K 3C5ZC 2AJZA 2ZUYA 5EUOE 4H25A 4Y16A 5DUBA 1DBJL 4M3JA 4H0GA 3HCVB 3KPNB 4ODHL 3TZVC 3FQWA 2P5WB 2PYEA 3G6DL 3RWIA 2HMIC 4PD4K 3SDYH 3EDJA 5GGVH 4W6WB 2MWCA 3ILQC 4BH7A 3T2NL 1SJEB 5FYLD 3PXJA 4K3GA 3WS3A 4C4KT 4DJMA 5ICXB 2DWDA 2VC2H 2VE6A 3PP4L 1EO8H 3OPZL 1EDQA 1WEJH 3KHQA 1N0XH 4XAWL 4Z95H 1ZWIB 4PV9A 5EUOA 2F8OA 3TVMD 2CR6A 3Q6GH 4DVBA 4G6JL 1W72A 2A9MH 1KJMB 1U3HC 3ARFD 43C9B 4N0FB 2HLAB 1QFWI 1F45A 5EZJA 3RU8L 2AJUL 4LCWD 3G5ZB 3CFKB 4OCMC 4GQPH 4ZS6D 3T0EB 5F71A 1OLZA 3WJJC 1QYGL 4PRHB 3ARTA 3LKSB 2FO4A 3O6LH 3EOBB 1XCTA 4YR6A 4FFYL 3X3GL 4LSQL 1TJGL 4PBXA 5E8NB 3IT8D 2I26N 3GBMH 3MBEC 3RIAF 3S4SA 3AVEA 4NRXA 3F65A 3L3DB 1H3PH 4FA8A 2OP4H 3V6FA 1JWSA 1E4JA 4R8WL 1CICB 5D7SL 3QPXL 2A9NH 1U8HA 1A1MB 3VDCA 3QNXA 1QA9A 5BOZG 2WV3A 3MLZH 1Z9LA 4JO1L 4MQXD 2VDQL 4RMWA 3P4NA 4HCRL 3EYOA 3QDJB 3DECA 4XCYB 4EN3D 2YUWA 3D18B 4MNQD 3WO4B 1IFHL 4BFIB 5AD0B 2P7TA 4U1SB 4P2RB 3ZDYF 5ILTH 1NCBL 5E6IC 1PJ9A 2BNRD 3MNVA 5TJWK 1CFTB 3JWOC 1BP3B 4FQ2L 3ULVC 1JPGB 1YEJH 4GKZB 2OK0L 1I1AB 2A38A 5C2UB 4Z5RA 1ZT4B 4H26B 1J1OL 1BJ1H 3DV6A 3QQ9C 4X9FA 4CN4A 3VMPA 3HPLB 5IV2B 3CFJA 2EYTA 3V95A 1UEMA 3CVIH 5L7XH 3NCFB 4IS6A 3LD8B 3TBYA 3B9KC 1S9XA 4ZQKB 3RFZC 3SCMD 4P3WA 2DYPD 5IW3A 1IARB 3VD4A 1GIGL 2VNCA 4MXVE 3OXRB 1Q38A 2X4TA 3F7QA 2NY0C 2X4RB 3SBWC 4OZ4A 1MFCH 3QDGE 1HILB 1F4YL 3MODH 2R29L 1BJMA 3SDAA 4LPXA 5AG8A 3NA4A 5F1NB 1XFPA 3UROR 2WNGA 5DT1H 1CL7I 2R1XA 1IEBB 2BVPB 3F6IA 1D5IL 2Q8AL 4GG8A 4FTVB 5KSAB 2MHAB 3HC4H 1GGBL 3VFSB 4N0YL 3BZFB 4OLYL 5D2NB 1WFOA 4YHML 2BSSB 5CIPB 2KQNA 1F6AB 5DO2D 5ITFA 3T2OA 4DZ8A 3QDGA 1CGSL 4XNUL 1ZVSA 3DX7A 3RAJL 1LO2H 1NEUA 3VWJD 2CDFB 3RWEB 3W2DL 4LAQL 3CVHB 3OF6D 1V3LA 4OLZH 1S7XB 1KCUH 1INEH 3BVNA 2VZSA 1N3NA 5GGSB 1HEZA 4JKPL 2H6PA 2BX5A 4IOFC 3BN9D 4MWFB 1AIFB 4CBPA 1ZTXL 5DD5L 5IVXF 1F58L 2E6QA 1P7KB 1L7IL 4R3SA 3FCTB 4KJWD 1F02I 1QACA 3IDUA 2ZNWA 3CFCH 1VSCA 3GMQA 5TQ2H 3P30L 5L88H 1JF1A 5HBBA 3HN3A 3CFDB 3LIZH 3PL6B 4TVSa 1LEKB 3QFJB 4XI5C 2KUTA 2E9IA 3O6FD 2Z8VC 3BXNA 3QJHA 4PYHA 3ZSSA 2JCCB 3C5ZB 5JHLH 3H9HA 3NPZB 4RGOH 1Y6MR 3AFLA 5F9WC 3SE8H 4FFZL 1I3VA 1IGCH 3LKOA 1P6FA 4FMFA 2P45B 3FB5A 4GRWB 2P5EA 5HYSB 2ZJSH 1CCZA 1X7QB 1CTOA 2N56A 2A74A 4LRNL 5AWNH 5FUCE 3S5LG 1C5CL 5BRZE 2MJWA 4PRPD 4LEXL 1HOCB 5GRUH 4U1HA 3IETA 2Q8BH 5C92A 4GLRI 4AENA 2F19H 5GSVB 1MHCA 2W07A 4RAHA 4OT1L 1FGNL 3GMMB 4JZJC 2FHCA 3SE4C 1OHQA 3UYOD 2YN3A 2XQYK 2L0DA 5F9AC 4X6EA 2OYPA 3I75B 2FYYB 3IVKA 5IJKA 4PJ5B 4GMSH 4ZOBA 3D0VB 2XNAB 2DQFB 5BRZA 1DVFD 1OARH 1TMCB 4UV4L 4OFDA 3EUUA 3RVVD 3MBEB 1GC1H 1I7UA 3HFML 4IIQA 2QQLH 4XVJH 4Q0XH 2H3NB 5FKAA 3SE9L 4YZFF 1A7RL 5AZ2H 3QO1B 3S97C 2D9CA 5FO7B 5IW1B 3MYJB 2HT4C 4I9WD 4QY8A 2YS4A 4ZSOB 1MJ8L 3O8XA 2P48B 4LCCA 2GKIA 5DJ6A 4XPHH 3ARGD 1A6UH 4N8PA 3BJ91 5E00B 5IMLA 2AEQH 4DFIA 5DLMH 3JSSA 3RNKA 1S8DA 3CFIC 2H32A 3BW9A 1W0YT 4NUGL 2GK0B 2J88L 5E6IB 5BW7C 4XVSL 5JZ7D 3D3VB 1CVRA 4LVOC 2NY4B 5I71C 4NN6C 1J8HD 1URLA 1LGVA 2VISB 3FB7B 1CU4L 5D7JC 5EULV 2LFGA 4M7LT 1MFBL 5T3ZL 4XHQA 5GS3A 4JM2F 3I6GB 1VKXB 3W81A 4LMQE 1MRFL 4A6YA 5TE6H 1G9NL 4AM0B 1AGEA 1SJEA 2C4XA 4RISH 4KKLD 5ICXA 4LEOB 3BWUC 1SYSA 1VHPA 3ULUE 3TVMC 3O6ML 1OCWL 4ODTH 1T1ZB 5J6GB 3MO1A 3U0WH 1SM3L 1ZWIA 1UADC 1RZKC 3JVGA 4X80H 4FZ8L 4OCNC 5D4QA 4ZS6C 4N0FA 4P5MB 2FJGB 1CT8B 4L4JA 5CLTA 3UX9B 5DTFB 5IBUB 2IF7A 2A1WH 3CFKA 5ICYB 5MEND 2NY0B 3OTTA 5CD3A 3T0EA 3C08L 5E9DE 2B1AH 4L8SC 1WK0A 3WFCH 1NCAH 1BFVL 3I6KA 4N0UB 4WVRA 5IB5B 5DJ2A 1A1NB 1CS6A 5EU4B 5E8NA 1KCVL 2PTTB 4U7KA 4HXBL 4Z8FL 1PY9A 3ZKXC 2VDRL 4QRRD 1MCWW 3DYPA 4WWKA 3SEPA 2WINA 1CICA 3QISA 3HI1B 4MQXC 1A1MA 1CFBA 1YQ2A 1ZSDA 2DKSA 1NGXB 5GGQH 4HAFA 4UNVA 3T0WA 2RB8A 4OQTA 4EN3C 4AT6B 3LS4H 3K4AA 3RBGA 4RCAA 1A7QL 4PJ9A 2VXUL 1YN7B 5ESVB 4YXKL 1TVDA 1TZHB 3OAUL 4KHTL 3TYGL 4X6DE 1DUYA 3NTCH 1EX0A 5AD0A 5I8CA 4U1SA 3A6CL 4K55A 1RPQA 3K0WA 2B4CL 2IC2A 3WSQL 1BIHA 35C8L 1K85A 4PJCF 1T04A 5I8OH 1P2CB 3PGCA 4Z0XA 4YBLC 4KK9D 1KC5H 4M00A 1L9NA 2FBOJ 3PP3K 1ERNA 5DWUH 1I1AA 4QHNA 3EYQD 1Z0MA 1ZT4A 5DHVH 5C2BH 3MGAA 2HVJB 5EUKB 2FIKA 1EGJH 1C7SA 5D1XC 2VAAA 4X6DA 1IL1B 3RRQA 4DN4L 4L4VE 3CUPA 2UZIH 4KTDH 4KXZH 5H8DA 3SCMC 5C0RH 3VMNA 4XT1C 1BEYH 3MRGB 4IMLB 1YEIH 4TOYH 5HYJE 1KJ2A 4ZQKA 1XAUA 1PLGH 3WE6A 5IVNA 1IC7H 2FJFA 3A67H 5F9WB 3MCG1 5IHUL 5FFLA 3MOAH 3NCYS 5D93C 5SWSB 5LAXB 2Y6SD 3M17A 5F8QC 4BFBD 1HILA 4J4PC 4L4TD 1H15A 4Z0BL 4KK8D 4GXUM 4YHOL 1T03H 1DCLA 3L9RA 5T1KB 4L4VA 4F3FA 1DQQA 1I75A 2W9EL 4PV8B 2ENSA 4PTUB 4R9HA 5DJ8A 5HYJA 3MREA 4P2OB 4BUGA 3QEGL 2BVTA 4JZJB 1GPOH 4U1GC 4NNPH 1MVFA 5DO2C 3VXUD 3MOBL 1YEHL 4IEFB 3VFSA 3X14B 1CFVH 4ZUUB 1NKRA 5D7LD 1D6VL 3V7MA 4DUXA 3QIUD 3MLRL 3HAEB 4G8GB 3QCVH 1NC2B 4B41A 4OZGB 1ZGLP 4R90L 3IU4L 4JJHA 3RWEA 3GBNL 3CVHA 5HGBB 4BSVB 1JFQL 5I15L 3GSWA 3BN9C 2DTSA 1MPAH 4X4XB 5IOPB 1A5FH 4ZTOL 3L3GB 4NO5B 4XMPH 4RWYL 2VZTA 4NNXA 3H3PL 2BCKA 5IBLD 1A47A 1CGTA 3QHZH 4KJWC 4MWFA 5MEQA 1P7KA 5HHVH 2W65A 4NO3B 4OF6A 5FUOH 3BPCB 2PR4L 5JMRA 4MAYB 5I8KH 1PKQE 3O6FC 4LBEA 1SYVB 1ZT1B 4PGBB 3NIDF 3CFDA 2G60H 1RK0A 2M26A 4LSSH 3QG7H 3HB3D 5FHBH 2IJ0C 2GY7B 3RWHB 1QSFE 1I9RH 2JCCA 2GTZB 4XCCL 1J9CT 2Y06H 4LVOB 2FX9H 4XVTL 3TC9A 1TNNA 1TNMA 2YPKA 4YAQA 4NN6B 3P40A 3THMH 5D2LE 3E6HB 3VU2A 2VLJB 5D7JB 4M1DL 4AZ8A 1JZ5A 3QUXD 1PKQA 1L7TL 3QNYA 3KYOA 4RFNC 1W8NA 5C0IB 1BOGA 3ORJA 1YDPB 1HOCA 5DVMA 2P4AB 3B5GA 1NCCH 3LOWA 3V4PH 3VRIA 1R3HB 3CPLA 3WD5H 4PJ7B 4D8PB 1ZLUH 4I3SL 4F7CA 1RFDL 3HG1D 5JXEA 5D2LA 5FB8A 5E94A 2F8XC 1Q9KB 3IFLL 1MI5E 1DVFC 5L0QC 4QHKI 4TSCH 4DVRL 3RVVC 5E56A 4L8SB 2XNAA 3P4MB 3ESUF 1WT5C 4ZUVB 1OP3K 4LLWA 4OCWH 1NFDE 2WSKA 4Q2ZA 4XC1H 5ACLA 5BVJA 5TQ0H 2Y72A 1UQSB 4JN1H 3IDYC 4EOWH 4TRPH 2YKLL 5ICZB 4OQ1A 3V0VB 2F9BT 4CW1A 3ZKXB 1U8PB 4MZ2A 5C07D 3IJHB 1E4WL 1NFIB 5DEFA 3WFBL 1EFQA 1LMKA 5FO7A 2H41A 5L8LB 2PETA 2A6JB 1MI5A 2AW2A 3LKPA 1HHIB 4EN3B 4X6CF 1I7TB 3MXVH 4MNQB 3MV8E 4EUPA 1NFDA 5DK2A 3RY6A 3OSKA 5JZ7C 4F2MA 1MAML 2BNRB 2W1NA 3M45A 4MJ6A 1TJHH 5IROC 1CTNA 4N0CD 1HZHL 3PABB 4I5BA 5IMMB 1G7LA 3MSPA 4YBLB 1K3IA 1XZ0B 4P46D 5DVKA 3P73B 3U30C 1OQOA 1Q0XH 4W68A 3SPVB 4KKLC 3LEYL 3T1WA 3BWAA 5B21A 3MRFA 3MV8A 5KSVB 1OWRM 4R7NB 1I8KB 5FYKL 4AM0A 5D1XB 2DKUA 4KKAD 1DBJH 4LEOA 4HS6B 4R97C 5IB3B 1FL5B 3SCMB 3IS0X 4CUCA 4ODHH 4JHBA 1K5NB 2DYPB 3DO7B 1S7WB 3G6DH 2BNUA 1KJVA 3EO0A 3FO0L 2YD8A 1AXSA 1MCEA 4P5MA 2J6EL 4MD4B 5DTFA 3T2NH 5J56B 2NW3A 5ICYA 3L95B 3IRZA 3QDHA 4NWTL 3PP4H 4JQIL 3OPZH 4QNPE 4FXLA 3T8XB 3V4VL 2ZUWA 4XGZA 4XAWH 5C09E 1PQZA 3FMGL 3CDCA 1S7QB 5IB5A 1EH9A 4G6JH 2OZ4A 2QTEA 1CDYA 1WWBX 1FL3A 4JM2D 5FCSH 3RU8H 1J0YA 2AJUH 2PTTA 3LV3A 1FAKT 4GSDL 4Z7UE 3QUMB 5I1LB 3CAFA 4MLIA 4B53A 4UDTB 4U1GB 1QYGH 4FQXA 2JTDA 1T20B 2YRPA 2OM5A 2VZVA 4NKOB 2BNQB 4FFYH 3X3GH 4LSQH 1TJGH 1K8DA 3HR5B 5J8OA 4WHTA 5C09A 2XZAL 2NXZC 3HUJB 4R8WH 3X11B 2D0FA 5J57B 5D7SH 3QPXH 3ZE0E 5KSBF 4KKNA 4Z7UA 2ATKB 4EIZC 4ZO8A 1P2CA 3HE7B 3MTRA 1G7QB 3EYQC 4JO1H 4I18C 2VDQH 1A22B 2VLKE 4HCRH 1NCWL 3QIWA 3NPSC 3N1GC 1IE5A 5DSCB 3IFPB 1IFHH 3E2HC 1BQHG 4QGYA 4AEIL 2ORBL 3OB0H 5EUKA 3O6FB 1HHGA 4U1JB 2WUCL 1IL1A 3FB6B 2R39A 3FAXA 4FQ2H 4Y5VC 4M03A 1MCBA 2OK0H 1YY9D 2Y6SC 4YBQC 4Z76B 5FYJD 1A6VL 1IGTA 1QBAA 2WANA 2YWYA 2IALA 1C7TA 5LAXA 1HXYB 4XP1L 4KK8C 4N8VA 4PPTA 4YE4L 4CVXB 4X83A 3V5DB 4PRPB 1FYTE 4UINL 4R4FL 3TH2T 4RFNB 4YNYA 4YHPB 1BF8A 1FN4B 3C60A 4NDMA 2R0WL 2YBRB 5JW4R 4LLVA 3O3BA 1CIUA 3LQMA 1JK8A 3KPQB 4YFLF 1BVLB 1GIGH 1T83C 5IBTL 43CAA 1FC1A 1I8IA 4MB3A 5TE4L 4NZUL 4P2OA 4GMTL 1JPST 1F4YH 1ZA6A 2R29H 3X14A 3QIUC 5JPNA 4G8EA 3TT1L 1F3DJ 1OT1A 3OXSA 3U1SL 4P2QD 2XN9D 1DVFB 5L0QB 1J88A 1MQKL 1NBYA 1FYTA 1D5IH 4EXKA 1DN0A 2Q8AH 1U8KA 2AQ2A 3U6RA 4Y19B 2I60L 4FG6D 5IBLC 4BSVA 4ORGB 2AXFB 3HZYB 4PGDB 1INDL 1GGBH 4N0YH 5DYOB 3QRFM 5IOPA 4OLYH 3L3GA 4EEEA 4YHMH 2J8OA 1RZ8A 5I9QC 5E2WL 4EI6A 4HD9A 2CO7B 1CGSH 4XNUH 5AZEL 3RAJH 4K3HA 5I66A 3W2DH 3QEQE 2VLJE 5CILL 4NOFA 3FJTA 4X6BA 2J8HA 2EECA 4HK0B 3OBAA 1C5BL 4MAYA 1OSZA 2EDRA 3HB3C 4F8TA 1EEUA 1MSPA 2P8MB 1LO3L 4JKPH 4PGBA 1J11A 3SOBL 3DI3B 1D9KD 1RZJL 4IDLA 1ZTXH 5DD5H 3RWHA 5CZVL 4LNVA 1S5IL 2DN7A 3HE6A 1J8HB 1F58H 1WAAF 1L7IH 1LP9B 5B39B 5HYQB 4PJ7E 2GTZA 1KB5B 4I0PA 1KLFA 5DJAB 4U2YA 3P30H 4NQSB 3QEQA 2VLJA 4Z7WE 5D7JA 4HKBA 1Q94A 3U30B 3EJZD 5E8EB 3TBSB 4JHAL 5ERWA 2YD6A 3O3AB 4LPWA 3GDBA 2BVEA 4MCZA 1K2DB 1MWAA 3CU1A 5C0IA 3ZE1E 3O45A 3LEXA 1JMZA 1N2RB 5H35A 2ZWLT 4R97B 2F53D 1MREL 4ZNCD 1R3HA 4PJ7A 2O5XL 4TNWK 3WHXB 3LZFL 4YDVA 5C3LD 5MENB 2OSLB 3GM8A 3LRSB 5L2KE 4LRNH 2K3TA 1EEYA 2EICA 1C5CH 4Z7WA 4HJJL 3U83A 4LEXH 5HHQB 3ZMRA 2GAZB 1D6EB 2EKJA 2KBGA 3JUYA 4DOHB 8FABB 3D0LB 4ZUVA 4JRYD 4N90D 1U3ZA 4OT1H 4PJDF 1FGNH 1G0XA 2NPLX 4MD5A 4R26L 1KV3A 3TF7C 5H37G 2EXYC 1B0GB 3DYMA 3RZCA 1ZXQA 4ZS7L 2X40A 5ICZA 3V0VA 2DI9A 1NFIA 4HIJB 3FQTA 1VENA 5L2KA 3LQAL 4R96A 2EDNA 4ELMF 1U42A 1KIPA 5C0FB 1ORSB 1RI8A 5DQDL 4UV4H 4ZUSA 1HHIA 4Y89A 1F4HA 5D9SB 4M7KL 1OF2B 2CIKA 3HFMH 2HJKB 2RJMA 4XAKE 4NC1C 2NXZB 3UBXG 1SHMA 3SE9H 3B2VL 1WFNA 4N0CC 1A7RH 3VI3F 5DRXA 1KJ3L 5J9PB 4Y4KA 1J05A 4P46C 5T1LD 1MJ8H 3RVXD 2H26A 2X09A 1IT9L 5IMMA 4YFEA 1CN4A 4I18B 1XZ0A 2F8VA 3GSNL 1GC1C 3NPSB 2B5IC 2GJ6D 3P73A 1A2YB 3E2HB 4IRSA 4KKAC 3C5JB 3SPVA 5JXAL 4GAYB 3RWCA 4NUGH 2IBZY 2J88H 3BIKA 4E42A 3QQNA 2ZG2A 4XVSH 4Y2DA 5D1XA 3VD5A 3KPPA 4ZODA 3BEWB 1EUTA 2G2RA 2HH0L 5IB3A 5JORB 3GB7B 1QQDB 1ZT7B 4Y5VB 1Y0LB 1CU4H 4JY4B 4OI9A 2XOTA 3X17A 2NY2D 3DO7A 2OMBA 1MFBH 5T3ZH 3N50A 3TBVB 5M7QA 1Z5LB 5A16B 3ETBF 3QEHB 1MRFH 4YGVB 1G9NH 1AHWC 5J13C 4L4TB 3L95A 4JPVL 2JB5L 1PYWA 2BNQE 4PLNC 3O6MH 1OCWH 3DOSA 1JZ3A 3DX6B 5D1ZD 3WUWB 3RTQD 1SM3H 4J4PA 3ROOA 2KPNA 3EO1A 5F44A 1S7QA 3NA9L 3OKOB 2YC1B 4FZ8H 4NKMB 2PCPA 5CJXA 4APQD 3VXUB 2XFXB 3VJ6A 3QUMA 4MX7A 4G6KL 3ARDC 3C08H 5H37H 4UDTA 1FHGA 4XPAL 4MHHG 5D7LB 4HKXB 2PYFB 1BFVH 3RP1A 3QIUB 2NR6D 3FKUS 3AM8A 2RCSL 2BNQA 3KWWA 2ADJA 1KCVH 3HR5A 2G9HB 1PKOA 1BECA 1ZS8A 4HXBH 2BVOB 5T5NF 4Z8FH 3GMPB 2VDRH 5BV7L 2XRAL 3X11A 1CDBA 5DRWB 2YUXA 4ELKB 2B8OT 5D5MF 3UPCA 5I9QB 2ATKA 2FIRT 3FRUB 3HE7A 2N4IA 1JPSL 1A7QH 2VXUH 3PGDA 4YXKH 3UO1L 3OAUH 4HWBA 4KHTH 3TYGH 2AXJA 4XNQA 1P7HL 1UJ3C 3A6CH 1ONQA 2B4CH 1NCUA 3RHWK 1YJDL 3WSQH 2MQCA 2BDNL 4F9PC 3T0DA 35C8H 5E5MB 3QZWG 1YY9C 3VGFA 5K59E 2M2DA 2ADGB 1QSED 1EO7A 2BVUA 3DVFA 4JFEE 1V8HA 1ZGLB 2AJ3B 4C56E 4HPOH 2GQHA 3F7VB 1AO7E 3UPRA 3MRQA 4DN4H 3V5DA 4OZIE 3KHOA 5IVXB 3MRNB 4X4ME 1NJ9B 1KELL 1FVEB 3BRGC 2X4NA 3ZYIA 5EO1B 3HG1B 4N0RA 1P4IL 4KJYB 4BQ6A 1T1XB 5K9QI 5HY9A 1B6DA 3VDAA 3N9GL 4D9RD 4JFEA 4Z0BH 5F72S 3LS5L 4C56A 1J0IA 1OD7A 4U6TA 4YHOH 3U9PL 1AO7A 4OF0A 3RKPA 4ZNEE 4HLZH 2IQ9L 4FG6C 1T3FB 2W9EH 3BDBA 4X4MA 3QUZC 5E4EC 1MCQA 3WXVL 3NZ8B 4Y19A 5E70A 3QEGH 5FOJA 5EOCJ 1DSFL 2ENYA 2AXFA 4PGDA 3BX7C 3BKML 3MOBH 1YEHH 3VRJB 2GCYB 2XTLA 5JR1L 2X89D 2LAAA 5GGVY 1UKSA 4NRZB 5D96C 4C59B 1K4CB 1D6VH 1VGKB 3MLRH 5F97E 2BSRB 3QWQB 5F7EL 2Y23A 4R90H 3IU4H 3HZKA 2R0ZL 3GBNH 4PLOB 3IJSA 2WWKO 3QG6B 1JFQH 2ZZUT 5I15H 3LN4B 3X12A 4A6YL 4Z7QF 4WFGE 4PRID 4ZTOH 4RWYH 1P6AB 2Z8WC 1MY7A 3H3PH 4N9OB 2VR5A 2XPGA 3ABZA 1ZLVK 1U2CA 3LVEA 3ARZA 1MUJB 4DGIL 5D71L 1TFHA 5B39A 4P46B 3ZYOA 4U1IB 5HHPB 3EJZC 3BP5B 2PR4H 1IQDB 3AREA 6FABL 3ZT5A 1A64A 4TUJB 4K3DL 1ZA3B 2B5IB 3RWGA 4NQDD 4A2LA 1DL7L 3MROB 3QIBD 2MQ3A 5E8EA 3TBSA 3BKYL 3O3AA 1GGUA 3KXFB 1JNNL 4LLYA 4Q6IC 4WFHD 1YPZE 2P8LB 1LILA 3ULUL 2ZKHL 4XCCH 4JM4L 3DRQA 1N2RA 4XVTH 3O41B 2CUMA 3DMMD 1XGYL 1M71A 1WCQA 4M1DH 4O51A 4HEME 4CJ0A 4K3EL 2CLRB 1L7TH 3LRSA 1WWCA 5BZDA 4X9IA 1AHWB 3D85B 1HNFA 1JPTL 5J13B 5IF0B 1FFRA 4QHMA 4OQTL 4RGMC 3OZ9L 3VXNB 4NJ9L 3T77B 5EIVA 1D6EA 4X0KB 5I76B 4JGJA 2HFTA 2Q1EA 5SWQA 1YPZA 1R3KB 4B50A 4I3SH 1RFDH 2IPTH 1LEGB 4EKXA 5JO5B 4QHLB 1B0GA 4J3XA 1WZMA 5I1HL 4HIIA 1U8LB 5MERB 4JFYB 1EK3A 4BKLA 3K74B 1CGXA 2DS4A 3FTGA 1OLLA 3EYFA 4I4WA 1E27A 4HIJA 3ARDB 3KPRB 4X7EC 4ZD3L 4DVRH 4UU9A 5I1CL 1S7VA 15C8L 2BC4B 4EDXB 5EZOL 3S5LB 5C0FA 4FABL 2E6PA 1F2QA 2UZXB 4HMCA 3GRWA 5GJTL 1CLCA 5AEAA 2FEDD 5D9SA 2YKLH 1OF2A 1WQVT 3MV11 3JWDL 2ZSVA 5HYEA 5L8JB 3GM0A 1T7ZA 2YN5A 4RAVB 3TGXA 1E4WH 1QO3A 5HJ3A 3RVXC 3WFBH 4IBLT 2DLEA 2A6DB 4R0LA 2NX5D 1VFAB 2VXTL 1KJ2L 3P0YL 4WEUD 1HQ4B 1JGUL 1Q9OB 4I18A 2ZG3A 1EBPA 4JR9L 3BKCL 1FO0L 3O9WA 1Q9LB 1UWGL 5CJOL 3F7PC 1A2YA 3NFNB 1MAMH 4HH9B 3C5JA 1UJ3B 4GAYA 2PXYD 2HVKA 3WNNA 3HZVB 3SKOB 1CE6A 1HZHH 4ALAL 2NY2C 4FOMA 3GSRA 1VEMA 4ODVL 4KQ3L 2GSIB 1QQDA 1ZT7A 4QRPD 3DSNA 4WNQA 3H3BC 3LEYH 5C0AD 2H8PB 1H3XA 5A3ID 4YGVA 1QKZL 2PW2A 3CSPA 4OKVA 5D1ZC 5FYKH 4PJCB 2IPUK 3RTQC 5BZWB 4L4TA 3LKRA 3DJ9A 4DK3A 4I2XE 3DX6A 4UBDD 1DQLL 3IGAA 4APQC 2LQRA 3MGTA 1EJ6A 3FO0H 3OKOA 2YC1A 4MVBD 1PZUB 2J6EH 3KPSD 2E7HA 1QSZA 2XFXA 1SVCP 2NR6C 4NWTH 1A21A 3T3PE 3H9YA 2X1PA 4JQIH 5DR5L 1U8OB 3V4VH 3GK8L 3FMGH 2D31B 3KYNB 3SKNB 3MV9E 1VFMA 3QUZB 5E4EB 4C54A 4GSDH 1HDMB 3GMPA 2NTFA 3BYTA 2EZ0C 3UBXI 2ICWI 4P48A 5DJXB 5DRWA 4UNTA 1BHGA 2ESVD 1P7QB 4ELKA 2EC8A 1BWWA 4RRPA 2DQHL 5D96B 2AAVA 2W9DL 4R2GD 1BX2B 3MUGB 1UT9A 3RWDA 3WL9A 5IKCA 4OFYA 4IM8A 1AGCA 4JCMA 4WEBL 3CU7A 5IVXE 1GOFA 2ZUUA 3U9UA 3RDTA 1B4RA 1T7VA 4WW2A 1NCWH 2Z91A 1Q72L 1OP3H 2QHRL 3TV3L 4NQED 3K81A 2OQJB 2ADGA 4XX1G 3MA7B 1M1SA 1IEAA 2AJSL 1M6OB 4MXWL 4PJFE 5FDWB 4AEIH 2ORBH 1T89A 2YPVL 3W0WD 2AP2A 2WUCH 2W0LA 2C5DC 2JE8A 4JDVB 4UIMA 1JF5A 1I7RB 5IVXA 1BMGA 4M61A 3MRNA 4NQCD 4UOJA 1WVZA 4Q6IB 3BFOA 1PBYA 1UH3A 4LCYB 3IF1A 4M1CD 1A6VH 5EO1A 4QOKE 2Z8SA 2HFEB 3BRDA 4D94A 4XP1H 4H5SB 3JTSB 5EOTB 4YE4H 4JANB 4JLRB 4PJFA 3S4SG 2VSCA 3RJDA 3ARBA 4UINH 4R4FH 5D1QD 3QXWA 1HHJB 2R0WH 4JRYB 3E8UL 4RGMB 5JDSA 3WDHA 1UH4A 2YWZA 1T3FA 2W0PA 3K8MA 3SDCA 2FCBA 5IBTH 2VZ1A 1MHEB 2Q86A 3F6LA 5TE4H 4L3ED 1MHHB 4NZUH 3Q48A 4GMTH 4L3CA 1Z9SA 1CFSB 4XNMB 4QOKA 2R1YB 3VRJA 3TT1H 2XTJD 1WWAX 5I74C 3U79A 1QFPA 4NRZA 5I30L 3D9AL 1MQKH 5E4IA 3CC5A 4Z7VE 2BSRA 2X4QB 4TPRL 1KXTB 1XGPA 2I60H 4H8WL 1KLGB 3RNQA 1XGTB 3GSVA 1INDH 5E0QA 2EEBA 2FJHA 2X44D 2V7NB 3C6SB 3KXFE 3DX8B 4I0KA 1EVTC 1U8JA 3HTLX 3OHXB 4OM0L 5CP3A 5E2WH 5T1LB 4OD2A 2OR7A 5AZEH 5IJVA 1X6LA 3RX5A 4Z77A 5CILH 4LGRB 4CNIA 2VYRE 3PWNA 3QIBC 1C5BH 3BP5A 1HSAA 3F7YB 4JFHD 4Z7VA 5TDNA 1ACZA 5ESAB 2DWEB 1LO3H 5FDYA 1AY1L 2OBGA 5DMKA 3JV0A 3SOBH 2XY1A 3B8YA 1RZJH 3KXFA 4GBXA 4PP2A 5CZVH 1S5IH 3KNBB 1T22B 5T1MB 5IB4A 4X6CB 2YA1A 1JMXA 1KBGL 2P8LA 2Y1VA 5HVHC 2NY2B 1L4IA 4YFDB 5EUOF 4EIGB 1QBBA 4U1KA 3S36L 4OIBA 2HA1A 1YC7A 4KAQL 4PB9L 1DR9A 4JHAH 3SDDA 1P69B 2CLRA 3KPRE 1JGVL 3LKNA 5D1ZB 3D85A 3FHAA 2BVQB 3O4OC 1PG7L 4YIQB 5C0JB 5E95B 3VXNA 1XH3B 1FZKB 3MRBA 5C0BD 4P5TA 4X0KA 2EIBA 5I76A 1MREH 3HRZA 4MA3A 2O5XH 4ZFOB 3E3QE 4APQB 3LZFH 1YY8B 2KDGA 4H0IA 4DZBB 1WZLA 2X4PB 4DKEL 1NDGB 4TNVK 4XCNB 2EDLA 4HJJH 3WJLA 2N7BA 1XGQB 2AV7B 3ARDA 2ZOLB 3KPRA 3MLTA 3RVWD 2BOCB 1MCOL 5JNYB 1EXUB 5FCUL 2FEDC 1FSKC 5F9DC 3LRGA 1Q8MA 4R26H 3LSOB 4O5LL 4ZS7H 2DICA 3V6OC 3MXWL 4GKSA 1OW0A 2GUOA 1EJOL 4PJXB 4RAVA 3MLVL 4G9DB 3L3IB 5DJYB 3LQAH 3S35L 1SMOA 1SVZA 1WBYB 1IAKA 3ZTJG 2YOCA 5DQDH 4S10A 5B38A 4M7KH 1Q9OA 5IUSA 3CH1A 1U9KA 1KN2L 2X70B 3F5WB 5F1SA 3B2VH 5D7KD 2C9AA 2YD4A 5F3BA 1KTRL 4HH9A 3QR2A 1KJ3H 2C3HA 2Y5TB 4WU5B 4HJ0D 5IFJB 3HZVA 3SKOA 3HS0A 1IT9H 2PO6D 1O5DT 1QSEB 4R4BA 1E6OL 1T21B 3V0WL 5A3IC 4NYLA 3GSNH 3VW3L 3TPUA 2RQ8A 2AABH 2F5AL 5KSBB 2JJSA 3KJ4C 4WI9A 3AAZB 5JXAH 3FT4A 1TZIB 2H8PA 3O2WL 3HPJB 1AD9B 3MUJA 2RR3A 2EDXA 4UBDC 5CJQL 4XNXL 2HH0H 1F90L 4V1DE 4OCXL 4HK3N 1N4XL 4MVBC 1FFNA 2QKIB 5B22A 4PJ8D 2CDGB 4JHWL 2Z35B 3BO8A 1B4JL 1W2KT 4Y88A 3QUYD 5DHVA 1MJ7L 3BHBB 3DNKA 3SGKA 4JPVH 4L3AA 2JB5H 4K7PL 3N1FC 4MXVF 4JFDB 4M4RA 4PJAB 1HHHB 1U8OA 1BFSA 2LU7A 1RUQL 3GMRA 3LQZB 4GXUN 1OP5K 4XNYL 3QDME 3NA9H 3FQRB 2ICEB 4RGND 4V1DA 3KYNA 3SKNA 4X7TA 3QUZA 2BXYA 5HDQL 2F54D 1JWUB 4PR5B 3K46A 4G6KH 4XPAH 1KG0B 5DJXA 4FXKA 3MOQA 4R2GC 1P7QA 5FYKD 3TT3L 1R24A 3Q6FB 4HKJA 2RCSH 4WU7A 3R1GL 3VE0A 3VXMB 3MLWL 1BX2A 2FHFA 1FV1A 5C08E 4D0DB 1BIIA 3MUGA 5BV7H 2XRAH 5DQ9A 2AEPL 3QDMA 1FAIL 1JV5A 4MQSB 3MCKA 2C3XA 1XR8B 1T66D 4H0HB 1MWAL 1P84K 3HR6A 3EOAA 1BD2D 4BQBA 4ISVB 1RZGB 1TQBC 3UYRL 3BPLC 2HYMA 5IM7A 1AP2B 5JQHC 2C4FT 4NC2B 4JFFD 5I18L 5F3HB 1JPSH 3DLQR 5DK3A 3IXTB 3CLFL 4S11A 5DRNA 3FFCD 3UO1H 4PB0L 4NQDB 1RVFL 3QIBB 5C08A 1A6PA 2F74B 1OOAA 2KH2B 5I1AB 1YJDH 4LKXA 2BDNH 4LRIA 3BI9X 3G5XA 4YLQT 1NAKL 3RIFF 4M1CC 4BQ9A 5I0DA 4DQOL 3RJQB 5HVHB 4LCYA 4QF1A 4PBWD 4WENB 4JREC 3VXOB 4TSAL 4Z78A 1IM9A 4FRWA 3FOLB 4D0CB 2B4CC 5D1QC 2HFEA 1X5IA 5FYJU 1HK6A 1Q9WB 1RJYB 4JLRA 5C0GA 1BQHB 3OJDB 5EU6E 4NBZB 1KELH 1HHJA 1MFAL 4RQQA 3O4OB 5KJRL 4MLSA 5CD5D 5TF1L 5DJDB 5IEKB 1CLYL 1P4IH 2NW2A 3IDIB 3OKEA 5D6CA 5TDPB 3VFRB 1PZ5A 2XTJC 3ROLA 3N9GH 2ERJC 3QUKA 4UOW0 5HI4D 5DFWH 1KULA 3LS5H 4LQFL 4GG6E 1N0LA 1OQXA 1RZ7L 3U9PH 4PFEA 3KYKL 4O2CB 2CRZA 4JVWA 4L9DA 5EU6A 4MJID 3WXVH 1FH5L 1FSKB 4X9HA 5JOFB 5FO8B 1DSFH 2C7UB 3UJJL 2H32H 5JR1H 3BKMH 3WXWL 2V7NA 5EBGA 3HNSL 2EYRA 2NX5B 3O0RL 1MVUB 3NCCB 1NGWB 3VGGA 1K8IB 2VITB 3OAZK 3I84A 5T1LA 1TVBB 2JKXA 4QXUL 5F7EH 1KTDA 4PJDB 1A7BA 1EHXA 1E4KC 2R0ZH 4U3XA 3MJGX 1C08A 3BEVA 4WIQA 2J7LA 4JDZA 3F7YA 4LHJB 4A6YH 4EI5A 1MRCL 1TPXC 3D2UD 2DWEA 2W91A 1G7IB 1X4XA 2EDDA 1JIBA 5I6XC 4QCIB 1F8TL 5CEXB 4NNYA 4ELMB 2OI9C 4DGIH 3C9NA 5D71H 3QQ3A 2NY1D 5T1MA 1EEQA 4JFPB 3BRFA 4QT5A 1YNKL 2X7LA 4B5EA 5HHMD 3RWJB 6FABH 4P23A 3L6FB 5C6PB 4DCQB 4K3DH 1DL7H 3I6LD 3KJ4B 2G5RA 5EFIB 3MV7D 3BKYH 4DWHA 3U2SB 1JNNH 4Y16D 5D1ZA 2BVQA 3IDNB 3ULUH 2ZKHH 3BMWA 4YIQA 2DLTA 5GJSL 4JM4H 1XF2B 3DXAB 5C0JA 5DC0A 3AB0C 1FZKA 4RZCB 1ODAA 5E1HB 4RMVA 3ULUF 3MRIA 1XGYH 5DA0B 1I9IL 2PYED 4J23A 1ZLSL 4ZFOA 4PJXE 3VFUA 4K3EH 3BUYB 4RFEB 1M05A 1MCNA 1NDGA 2GTWB 4XCNA 1LE9B 3RVWC 2MMXA 1JPTH 1V3KA 4OQTH 1L0YA 3OZ9H 5BXFB 4NJ9H 3K2MC 2AV7A 5JOPE 2ZOLA 4U6XA 2GITB 4PGZA 3WUZA 4HWBL 3OAYH 4XBPB 5LVEA 3M1BB 3LSOA 4RNRB 5E6YA 1U0QA 3OKNB 2ZSWA 3U4EB 5I1HH 5KSUA 12E8L 5EG6C 1YQVL 4NZRL 3O2VL 2ESVB 4NKQB 2W92A 1RUPL 4PJXA 1AQKL 5FOBB 2QHLA 4G9DA 4ZD3H 5I1CH 1DBML 5DJYA 15C8H 4O02L 4OGZA 1WBYA 5DEZA 2NY5L 5EZOH 2IH3B 4FABH 2XZQL 3W9DA 3UZEA 5GJTH 5IHLB 2XWJB 3JWDH 4TUOB 2X70A 4IRJA 5F9JB 2R0KL 1UB6B 3VXTB 4P49A 5CJ5A 3CXHJ 2PO6C 4X6DF 4WU5A 1BGXL 4FQLL 2VXTH 1KJ2H 1TQBB 1F2XK 3BPLB 3NCMA 2W60B 3P0YH 4NQEB 2B20A 1NGYA 5FM4A 5EU3B 1JGUH 1T21A 4JR9H 3BKCH 1I8MB 1SEBA 1A6ZA 1FO0H 1UENA 1NANH 1UWGH 2HTLD 5CJOH 1F4WL 2UUDK 3DVNB 4WI6A 5KANG 3W0WB 4JO2L 5IG7B 4JFDE 4PJAE 1TZIA 4JVPA 5D5MB 3HPJA 3QULA 1AD9A 3PWLA 4YK4B 1OD9A 5FV1L 4PJ8C 2DM3A 5DJZB 3K7UA 4ALAH 3UBXB 1QLFB 2ICWB 4KQ3H 3G5VB 4FQHB 4RSVA 2QKIA 3PGFL 2CDGA 3QUYC 4PP1D 4HCRA 4GW5A 2ZUXA 1T1YA 4JREB 4KUCD 1QKZH 4PRDB 4PS4L 1FVCB 4JFOB 2D2OA 1ZLVH 3KPTA 5AYUL 4HX1B 3ILPB 4JFDA 4N1HB 4PJAA 1HHHA 3VXME 1I8LA 4RGNC 3MRKB 5GSRB 1DQLH 1HQRB 3LQZA 5C9JA 4HAGA 1G6RA 1KPVB 3FQRA 4L3EB 2VR4A 3L7FB 4RBPK 1EBAA 1A1OB 4RMUA 4JG0L 4ODXA 5CJ8A 4YHLL 4XCEB 1BFTA 4PR5A 3GMOA 2XTJB 4NT6A 5DR5H 4MD0B 4QHUB 1F4AA 1H3GA 3GJFB 4NSKB 3SDAD 4EUPG 3GK8H 3PHOB 1OTTD 4JQXC 3G04B 4EJ1C 4JAMA 1H3TA 5GPRA 3VXMA 3WFZA 3ZT7A 4D0DA 5CUSL 5ENWA 1T66C 5B3NA 5C6TL 5DMJB 4H88L 1H9VA 1R5IB 5FA3A 1FYHB 4JPIB 2X9YA 4OLEA 5IGXL 4KC3B 4YXLL 1QRNE 3HNVL 4K94L 1XF3A 1N6QL 1RZGA 2DQHH 4KK6D 1I3UA 1MLCA 3MC0A 2ED9A 2W9DH 3QDGD 5F7DA 1WBZB 4AJ0A 1BQLL 3VFTB 3CFBB 3DUUA 4HWZB 2CLVA 4XH2B 4WEBH 1E28B 2F74A 4OM1L 1TPXB 4XTRD 1OVZA 4ESKA 3SQBA 3UDWA 2AJYL 1AGBA 1JPFB 4LSUL 5ID0A 1ES0B 2OI9B 2VKXA 4OUOA 3MZTA 2KL6A 1QRNA 5CMAB 1Q72H 3WHE0 2M1KA 1CR9L 2FL5B 2QHRH 3TV3H 2XQBL 3BPOC 2AJSH 3LN5B 3VXOA 4ZOEA 4MXWH 1DTUA 1UB5A 3Q5OA 5M94B 5BVPL 3T0AA 5JW5B 2QSQA 1ZHLA 5DD3L 4D0CA 4HDIB 2YPVH 1HXMB 4ODUB 5D2LF 5M95B 1EEZA 1Q9WA 4F15C 5CD5C 3O6KL 3HLAB 1DQTA 5C0BB 3UTPE 2CPCA 3I50L 3U7WL 1BZ9B 3GRWL 1Z6JT 5DGRA 3AB0B 5HI4C 5KZCD 1XF1A 2IWGA 2NNAA 2CIIB 3MRJB 5H2BA 3ARUA 5TDPA 2AJXL 1RZIA 2P5ED 4FQ1L 3CLEL 2OL3A 2Y9RT 1REIA 3AMKA 4NWUL 4PJDE 1U8QB 5CP7B 5LG1A 2J4WL 4X5WB 3E8UH 3STZA 3PDDA 3O3UN 4EUPH 2YPLE 2B2XL 2ITDA 3VCLB 3MRHB 2WQ8A 5IW6B 3BQUA 5GS0L 2QQKL 1IGML 5JOFA 1GH7A 5FO8A 1NFDF 2C7UA 4P3DA 2NXYC 4JRXB 3EJYD 2ITCB 1EMTL 1T0MA 3BOVA 2K7PA 1NGWA 2C1PA 5I30H 1K8IA 1NLBL 1DEEB 4GKNB 4KROB 4YDJB 3D9AH 4D3CL 3BDXA 3IYLW 1D5MB 4PJDA 5BRZD 4TPRH 1MH5B 4J8RA 4H8WH 4CN6A 2OTUB 4K9EL 2YPLA 1NFKA 1KT2B 1QLRA 4G43A 1UVQA 2NY1C 3GEWB 2WK2A 4OM0H 3REWA 1A6WL 3I02B 5I1JH 4F58L 5CEXA 3DXAE 4ELMA 1Z3GL 2Y7QB 5FF6B 5FXCH 2PO6B 5DK0A 1KEGL 4ONHA 3W39B 1BZ7B 3F62A 1FZMB 4JFPA 1EAJA 3O8XD 4N8VG 1NC4B 5F7LB 1JBJA 5TFSL 3U0TB 2K7QA 2NLJB 4LLMB 2RGSA 3L6FA 1AY1H 1T0NA 5EO9A 1U36A 4Y16C 3CMGA 4G9FB 2FLBT 1I1CA 1KBGH 3IDNA 1WV7T 1ED3A 2Z8RA 2IG2L 1XF2A 3DXAA 3BZ4A 5T3ZE 3S36H 2BY1A 2PTUA 4KAQH 2HAZA 5I1KL 3QUYB 1FBIL 1QG3A 3MRMA 2IH1B 1ZAGA 2JK5B 4PB9H 3EGSB 2D03L 2CQVA 1JGVH 4LKCA 1RZJC 2XXCB 5FGRA 1LE9A 4KKBC 3BSZL 2XT1B 4TVPE 1G9MC 4ZTPL 3K1KC 3V5HB 1PG7H 1CD0A 3FONB 4DFHA 4MDIA 4PG9A 1X5LA 2GITA 2XWTB 2UVEA 4RGNB 4ZFGL 4BK5A 4QNPF 4G7VL 2Z93B 2BSTB 2F54B 2DRUA 3M1BA 4RNRA 4DKEH 1U8IB 2DQTL 3G6JF 3E6FA 1FORL 1Q0YL 3T0ED 5FOBA 4Z7UF 3RUGE 1MCOH 3F7RA 4MGXA 1X5AA 2R23B 4FNLL 5FCUH 1JWMB 4UT6L 2IH3A 3ULUD 5F6IB 4EVNA 5ADOL 1BJ8A 3T09A 4G6ML 4O5LH 1SY6L 2E27L 5E2VL 1F11B 4Y8AA 4PRAB 5AUMA 2ADIA 3GKZA 3MXWH 3WEXA 1BD2B 1EJOH 4WWKD 5SWZB 1CICD 3MLVH 5EPMB 1UB6A 3GSXB 3S35H 1A9BA 1NBZA 1NANI 3CD4A 3FFCB 2W60A 5E9DD 2HTLC 1OB1B 1N5AA 3RUGA 5C3TA 4PJ9D 1GAFL 4RDQF 5MP6L 3V6ZB 4YPJA 3QO0B 1KN2H 3D69A 5JHDB 4MNHB 1ZLWK 2R2EB 3JUZA 1QR1A 3RGHA 5JW3L 2PKDA 5CEZE 3ZYZA 1RU9L 1NDMB 4MSWA 4PP1C 4OLVL 1XEDA 5E5UB 2ICWA 1E6OH 3G5VA 3V0WH 4YPGA 3P77B 3HC0B 3VW3H 4O2EA 2H45A 1I1AD 2YK1L 4J3UA 2F5AH 1FLRL 3BPOB 3LN9A 4J12A 3O2WH 5EO0B 2NY7L 3TYFB 1OWWA 3FQUA 1FVCA 2FSEA 2LV4A 4ZXBA 5CJQH 1K3ZA 4XNXH 3ILPA 4FQIL 1F90H 4OCXH 4F15B 1N4XH 5GSRA 5CHNA 1HQRA 3DVGB 1D3CA 4JHWH 4NP4L 1B4JH 4P99A 3L7FA 5HGAA 1A1OA 1MJ7H 3FOMB 3PIQB 3MLUL 4FQJL 3WNMA 1M7IB 4YDIL 3SDAC 4U1MA 3TNNB 1KOAA 1T2QL 4XCEA 4K7PH 1AR2A 1OTTC 1HHKA 2KZWA 4MD0A 1BQUA 4NSKA 1RUQH 4XNYH 4MJIB 1U92B 4L4VD 1GOGA 3RVUD 1NBVL 2YRLA 3B5TA 2R8SL 4U1LB 5HDQH 5HYJD 2A73A 4CDGC 5DUPL 1IAOA 4KK6C 2WIIB 4E5XB 4F9LA 1LK2B 5GRWA 2NXYB 3ZE2E 3TT3H 4E0RB 2EDKA 3R1GH 1AKJA 3MLWH 4MCYB 3UTZB 4LU5L 2D3VA 3QI9A 2K9UA 3KLHC 1E4KA 2AEPH 3CFBA 1FAIH 3D1MC 3KJ6L 3D2UB 3LH2L 1SJXA 1CQYA 3MV01 4XH2A 3ULSA 1MWAH 3VWKC 1E28A 1I85A 1XF4B 3WFEL 3UYRH 1UKTA 1JPFA 2EIZB 3VGBA 3WHE1 4DUVA 5EIIB 5I18H 5EBMA 5CMAA 3CLFH 5KAQG 5L9DL 5HHMB 2FL5A 3H42L 4LCIL 2CSPA 4PB0H 5GGUB 4EXPX 5BV7C 1UXWB 1PY4A 3BD4A 3LCYA 1RVFH 4M5ZL 4ETQB 3EDKA 1T80A 4PJ7F 5JW5A 1MCFA 3MV7B 2A83A 5DZOA 2J5LC 4W4NA 4H25B 4ODUA 4Y16B 3MRLA 5DUBB 1NAKH 2D4DA 4LF3B 2MCPL 4Z7WF 2EDFA 4DQOH 5DRZA 1ZHBA 1KFAL 1QRKA 3FQWB 4OCYL 1P9MA 2PYEB 4TSAH 1BZ9A 1XMWA 3ZE1F 3O2DL 4WFEE 2CIIA 4BH7B 1YJDC 1UA6L 1D5ZA 4K3JL 2FECI 4GRLA 1RJLA 5F89A 2FGWL 3BAEL 4GAJL 4RWHA 2VE6B 1OPGL 3L3HA 4PV9B 5EUOB 5KJRH 5TF1H 4MB5A 5J6HA 3RQ3A 4LL9A 4DVBB 4BSWA 1CLYH 1XR9A 3SE3A 1QSFD 3TCLA 1CGUA 2LU3A 3VCLA 3REVA 1BM3L 2DAVA 3EJYC 5E6ZA 5IVZA 5JXED 5IJKC 4Y1AB 4PJGB 3AUVA 1B88A 4K8RL 3N1QC 2VLRE 4LQFH 2JF1A 4JRXA 5FUCC 2ITCA 1RZ7H 3B43A 1AXIB 1MEXL 3KYKH 1XCTB 4YR6B 3CIQA 4GKNA 2O61A 5E8PA 4YDJA 4NRXB 3PHSA 3QA3A 2XWBB 1FH5H 4LLDB 3DWTA 2APVA 4POYA 1TVHB 5DEGA 3UJJH 3WXWH 2D4FA 1JGEA 4G9FE 1U8HB 3HNSH 3O0RH 2VDNL 3VFWA 3TIDA 3K4ZA 4NIKB 1QA9B 5IESL 3O8XC 2FX7L 3WKML 1KF9B 4QXUH 2VLRA 2HRPL 1OP5H 3P4NB 1MI5D 4ODBD 3T04D 3EYOB 3GFUA 2HJLA 5F6HJ 1NC4A 1KIRA 3U0TA 1JTOA 2NLJA 5GRXG 1MRCH 4LLMA 4UMGA 3UP1A 1IGFL 5A2KH 3AY4A 1F8TH 2E3VA 3MNVB 5KAQF 5EZIL 3UZQA 4MXQD 3DRTA 1AC0A 5FV2A 4G9FA 4A2MA 1DQDL 4LHUA 1LDPL 1YNKH 5GRYA 2NY4D 1MCHA 5F70A 1EFXD 3DGGA 5LQBL 3DV6B 3ZKMD 2OXGA 4BM7A 3QUYA 2DLHA 2IH1A 1N6UA 5ETUA 3MV8D 2DQEL 2UWEE 1OL0A 5F8RC 2G5BA 2EYTB 3OWEA 1DQJA 1ULVA 1TDQA 4H1LH 5ITBL 5GJSH 3SO3C 1S9XB 3JV5A 3JVGC 3V6BR 1KYOJ 3QHFL 2VLLA 1I9IH 1ZLSH 1QPXA 4DTGL 5JTWA 3GSNB 3DTXA 5SWZE 2LAGB 2X4TB 1U8IA 3VDBA 5CZXC 1JHTA 4UUJA 3JWOL 3SDAB 3KYMA 1OTSD 2X1QA 4OF3A 2QLVB 1ZOXA 3ZZ1A 3ULUC 2UWEA 2R1XB 2HKFL 2R23A 3MGOA 4HWBH 4LPUA 2I07A 3KS0H 4FHBD 2ZPKL 5JHDE 3MLPA 2DKMA 4WWKC 5E8DL 5CGYD 1CICC 4G80A 3IDMA 12E8H 2APWA 3ARVA 2J6EA 1YQVH 5B39G 3O2VH 4N1EA 3RWFA 4CMHC 1FFQA 2VRAA 1RUPH 5SWZA 1AQKH 1JP5A 3U7AA 1JYNA 1DBMH 4FQXD 4DZ8B 2G75A 3QDGB 4O02H 4EDWL 3AGVA 2NY5H 4PJ9C 2GJZB 2XZQH 5HDLA 5GHWL 2JIXA 4R7DB 3L5HA 4GS7C 5C09D 1N3NB 5JIIA 5EDXA 3QO0A 1HEZB 3MA9L 2H6PB 2R0KH 4KVNL 5JHDA 1WIPA 1OAZL 2R2EA 3VWKB 4YHIA 1BGXH 3BISA 3TBTA 2C3VB 4FQLH 4R3SB 4XZUA 5T33L 1I1AC 1G7HA 1RMFL 3QIWD 3GMQB 3P77A 3HC0A 5K59F 1JF1B 1F4WH 5BV7B 1CDJA 4JO2H 1I9JL 3TYFA 3BXNB 3IXAA 5LXGL 2J5LB 3OAZH 2XI9A 4X8JA 1OTUD 1OAYL 3PGFH 3LKOB 4OZIF 5KZCB 3FB5B 5FGSA 2IANE 1H0DB 3OR6A 3WKNA 2BSED 3T65A 2HFGL 1J0ZA 4KGLA 4LLQB 3FOMA 3FO9A 5AYUH 4CDHA 1VADA 3RVUC 3CDGB 5D72L 4WFFE 4F8QA 4U1HB 3IETB 3EO9L 3C60D 4AENB 4OI7A 3ZTNL 1I3RA 5HDBE 4JG0H 5CJBA 1U58A 4YHLH 1A4KB 1N5YL 4LPYA 4U1LA 4N1CA 4X6EB 5CSBA 4P2OD 5IQ9B 1P4BL 2IANA 4E9LA 2WIIA 3P4OA 4YX2L 4DGVL 3FO1A 4O58L 5IHZA 5FO9B 3MUHL 1KCKA 1FYTD 3UTZA 1S9KC 5CUSH 1KXQE 4AEFA 1LWRA 4K7FB 4H88H 4G7YL 1TJIL 5IGXH 5FKAB 2DDQL 4AQ1B 1EZVY 4YXLH 3HNVH 4K94H 1N6QH 3CGTA 4QY8B 2DQCL 2Q76A 2EIZA 1BQLH 5DJ6B 2UY6A 4G5ZL 4Z18A 4JPWL 4MAYD 2IPKA 2WLYA 1S8DB 2VUOA 3E0GA 4OM1H 2H32B 3L5WB 2AJYH 2X42A 4LSUH 3MYZA 4LF3A 2AQ1A 3HE6D 1CR9H 2XQBH 1KENL 4I0PD 2H2SC 3F8UB 3QT2A 3LKQB 1YPZF 4PJGE 4Y1AE 5BVPH 3GSQA 5DD3H 3QEQD 2VLJD 1G6VK 4PRNB 5D7JD 4A6YB 2AXHA 1AGEB 1R3JA 1NAMA 1SYSB 1X5XA 3O6KH 3VFPA 4PTTB 2R4RL 3FO2B 4ZO6A 3MO1B 3I50H 5TE7L 3U7WH 3GRWH 3SO3B 1WCBA 3B6SA 5JXEC 3PWUA 3R06A 4S2SB 3S8WA 4KU1A 1FGVL 4RRPG 2AJXH 1CDHA 4OLUL 2NY6B 2VL5A 4FQ1H 3CLEH 4Y1AA 4PJGA 4YUEL 5CD3B 1A6TA 4HF5L 4NWUH 3I6KB 2J4WH 5DJ2B 4HGMA 4GXVL 4MA7L 4PJIE 1CE1L 3W5NA 5FYLL 2B2XH 1ORQB 2XWBA 4LLDA 5GS0H 2QQKH 2X4SA 1IGMH 1A7OL 1I1YA 1TVHA 3RZCD 4WWKB 2WINB 4M02A 4NQTA 3NCBB 5J11C 2Z92B 1EMTH 1ZSDB 2VWEE 4CMHB 1NLBH 3MNZA 5K9OA 5L2KD 4D3CH 5E9DB 1LO0L 4PJ9B 3RY6C 1LQSR 4K9EH 1IAIL 4RBPH 3VA6A 4PJIA 1CDCA 1DUYB 4GS7B 2YA2A 4YHNB 1G7PB 5I8CB 4MXQC 1Q1JL 1A6AB 5D70L 1A6WH 4F58H 1JGDA 1T04B 2NY4C 2YD2A 1Z3GH 3PGCB 4Z0XB 2OTWA 5KW9L 4Y4KD 4UDUB 3ZKMC 2C3WA 1G6RL 5TFSH 2NZIA 4QHNB 4LSPL 1G1CA 2FIKB 1F3JA 4LCUB 4O2FB 4IRSD 2VAAB 4X6DB 4HUVA 1HCFX 3CUPB 4XAKD 3QAZC 3QNZA 1CBVL 1SJHB 4Y2DD 1MCIA 5D1XD 4Y5YA 3PHQB 1MCPL 1WZ1L 1KJ2B 3WE6B 2FJFB 3ALXA 3BP7A 1NUNB 1FBIH 1FO0B 3GSNA 2WBJC 4XCFL 3M17B 1OTSC 2D03H 2YRZA 2YZ8A 5TDOA 4IHOA 2FR4A 3BSZH 4P4KA 3ALPA 5IK3B 1H15B 4ZTPH 5TH2A 4F7EA 4XVUD 3L9RB 1T0PB 3B3IA 4L4VB 4F3FB 4X7FC 1DQQB 4J4PD 5CGYC 3T3PF 4ZFGH 4NUJB 5EZLA 2VXVL 3HHRB 4G7VH 5DJ8B 4LPCA 1DJSA 5HYJB 1MCLA 2IBZX 3MREB 2DQTH 5F7UA 3DX9B 1DEDA 1T7YA 1FORH 4FQXC 1Q0YH 2ZUQC 4LSVL 1IBGL 1MFEH 4D9QE 4WHYH 5CKGA 3I85A 1FVDA 4FNLH 4OB5L 4UT6H 2GJZA 1T5XA 2BNQD 5ADOH 4WW2F 4G6MH 4R7DA 5JPMA 1SY6H 3MRPB 4KMTL 2E27H 5E2VH 4YBHA 3GSWB 4XWOC 3S9DB 1TTFA 2V2XB 4WI7A 5EU7E 4V2CB 4NNXB 2BCKB 2VDOL 1U91B 3PQYE 1FCGA 3VWKA 4AH2B 3EOTL 3QIWC 2C3VA 3MLYL 2CXKA 5MEQB 4WHCA 1JI1A 2R56L 1GL4B 3HE7D 2W65B 4BFGA 2C4FU 5JIPA 1GAFH 5MP6H 3WIFA 4F80A 1C16B 2MPAL 4LBEB 4G6AD 2WWKT 3O11A 1MCWM 1GXEA 3S37X 1RK0B 2OL3L 2DD8L 4NO0A 3WBDA 1OT2A 5JW3H 1OTUC 4PJFF 4HKZB 4KZDL 2Y07L 2WW8A 4OLVH 5GQBA 4FP8L 4RIRB 2N1KA 3PQYA 1ADQL 3U0PB 2X9WA 1DBKL 2YPKB 1FNGA 4YAQB 2YK1H 5L2JA 1FLRH 1H0DA 2OX5A 4HUUB 3EYSL 2NY7H 4LLQA 1AR1D 1PKQB 3LAFA 2YUVA 5HPMB 3QNYB 3KYOB 1KPUB 1MJUL 3FB8A 1BOGB 3C60C 4FQIH 1BBJA 3CDGA 3TBWB 2EDTA 5LBSL 4NCC1 4YDKL 4P57A 3AXLB 1QSFB 3VRIB 1QHPA 3CPLB 4F7CB 4NP4H 4P2OC 4IMKA 3STLB 4UIKL 1P5VA 3DROB 1JYWA 4FQJH 3MLUH 1A4KA 1AFVL 5D2LB 5FB8B 5E94B 1T2QH 5CP3H 5IQ9A 1JRHI 5B38G 4JFED 3UXFA 4Q9QL 4C56D 5BJTA 1AO7D 4LLWB 2Q3AA 3LPWA 4HZLB 4Q2ZB 5FO9A 3V2AR 5EA0L 1GZQA 1NBVH 1I1FB 2C26A 5BVJB 4J3VA 2R8SH 1X5GA 4Y19D 4K7FA 4Z7VF 4CW1B 5DUPH 2ZUTA 4NFDA 5DEFB 4XP6L 1J7VR 5J11B 1MI5B 2F58L 3LKPB 4XPGL 5EC2B 4D0BA 1LNUA 4LU5H 4HUWA 4MAYC 5J7CC 5DMGC 4EUPB 1MELA 3KJ6H 3LH2H 1NFDB 3QH3A 5DK2B 4WTZA 1OAUL 2LABA 4F2MB 1LE5B 3RIAK 2E5EA 3WFEH 4MJ6B 2WP3O 3QSKB 3HE6C 4ZMAT 3L5WA 3QXUA 5DHYB 4I5BB 2GJJA 1CZ8L 1G7LB 1EFXB 4I0PC 3EDEA 1S9YB 3HRPA 4BK4A 4RX4A 5L9DH 3H42H 4LCIH 3ISWA 4QO1A 4M5ZH 5JOEA 1F4XH 3LKQA 3ARED 3BP6B 3BWAB 5FKPA 3MRFB 2DOCA 3MV8B 4PRNA 5E1AA 2V7HB 2DTML 2BOBA 2MCPH 1RQ5A 2EO9A 2OR9L 4WFGD 4ZPVA 2D7TL 4JKKA 4PTTA 3QAZB 4TVPL 3FO2A 3FQXA 1KFAH 4OCYH 2BNUB 1KJVB 2MSPA 3EO0B 3O2DH 1AXSB 4S2SA 4WJ5B 2WBKA 4HS3A 1FNSL 5GS2H 4K3JH 3DV4A 1ZLWH 2NW3B 3KG5A 2GY5A 5KVGL 4JEGB 2FGWH 2WBJB 3BAEH 4ZAKA 4GAJH 1G7JB 5IR1B 1OPGH 2GFBA 4XGZB 1PQZB 2CMRL 1OAKL 4P2YA 4YH6A 3RZCC 1FL3B 1ORQA 3LV3B 1BM3H 4U0QB 3DUSA 4AYFA 1J8KA 2OJEB 4K8RH 1JGLL 2Z92A 1J86A 1WTGT 4FQXB 1CF8L 3VA2C 1MEXH 2ZUQB 4FXGA 1WITA 1K8DB 3ZO0A 5E9DA 1T2JA 2XA3A 5ID1A 5ADPL 4WHTB 5C09B 3OKMB 3NH7L 3N1MC 2CKNA 1T2XA 3G6JB 3MJ9A 4YHNA 1EUUA 1G7PA 4QXTA 2NXZD 2VDNH 4Y4KC 1A6AA 4Z7UB 3CXDL 5IESH 5LWYL 2FX7H 3KAAA 3WKMH 2HRPH 3EHBD 5SV3A 5CEZL 3QIWB 3QWRA 4UDUA 1PGRB 4HFUL 4G8IA 5ALCL 3QCTL 4IRSC 4L8BA 1IGFH 3O9WD 1TZGL 1HHGB 1O0VA 4LCUA 4O2FA 4Y2DC 5GS0D 4J6RH 2ICCA 1GVIA 1JJUA 5EZIH 4XRCA 4I3GA 1DQDH 1SJHA 1LDPH 3BP4B 5HHOE 3CMOH 3PHQA 1XT5A 5LQBH 1IGTB 1BPVA 1FNLA 2VLKB 2IALB 1IQWL 1FO0A 3JWNC 4YBQD 4WO4B 4N8VB 5EH1A 6CGTA 4KQ4L 4XVUC 2YD7A 3ZT6A 2DQEH 1NCTA 1ZANL 2IQAA 4XPTL 4PY7A 3B83A 4QRQB 5JA8B 3WFHA 2A6KB 5IK3A 4HXAL 1CD1A 2NMSA 4YNYB 5ITBH 4OGAD 4NDMB 3C60B 5FIEA 4LLVB 3O3BB 2VAJA 4WV1A 5CJXC 3QHFH 1JK8B 2VQ1A 4NUJA 43CAB 4DTGH 5HHOA 1I8IB 2AK1L 4GT7A 4LVHB 4OCLC 2XKUA 2ARWA 4M6OL 3DX9A 3IKCA 1S7UA 4QRPE 4XWGL 1ZA6B 1VFBB 3JWOH 5JPNB 4AIZA 4FS0A 4G8EB 1JNLL 3AM8C 4OFVA 1K9TA 3OXSB 1U93A 1QFUL 2FBJL 4PY8J 1NBYB 2HKFH 3HI5L 1FYTB 4HBCL 1DN0B 4WI8A 2DM4A 3VI4E 1U8KB 3L1OL 3U6RB 2DJ4A 2ZPKH 5E8DH 3MRPA 5KOVC 5CINH 4PJHE 5CKAA 5T5FL 5C6WH 3FN9A 2VZUA 2V2XA 1RZ8B 1U91A 4U2ZA 2P42B 3CSYB 4HIHA 4PREA 3W82A 4EI6B 3HE7C 4EDWH 3VXSB 2EE9A 4AH2A 1HYRC 2L7UA 3X3FL 4HC1L 4I1NB 3S98A 5I66B 5GHWH 4U6VL 4KI5E 4X6BB 4G6AC 3WYRA 1DANT 3UPAA 1L6ZA 1OSZB 1TTUA 2IEPA 4OFYD 2ZOKA 2IMMA 3MA9H 1FZJA 1C16A 4PYGA 3TN0A 5K33A 4KVNH 4LK4A 1IGJB 4Y4HA 1OAZH 3MV9D 5GZND 1FNHA 2BHYA 1PVHA 4HUXA 4PJHA 2BHZA 3RDTD 4HKZA 3HE6B 2WQRA 2NY5C 5A2IH 5T33H 2O26U 4RIRA 1CIDA 1RMFH 2B39A 4I0PB 4PJBE 3U0PA 1AR1C 4OAWB 3QEQB 4HKBB 1Q94B 3GMNA 1I9JH 4N9GB 3ESVF 3C6LA 4HUUA 2P24A 4HH8A 4LVEA 5ERWB 5TPWL 4MCZB 3N1PC 3IKKA 1MWAB 5HPMA 5LXGH 2I24N 1KPUA 4JVUA 4NPYA 4NQVA 3O45B 4CKVX 2CDEA 3LEXB 2R69L 1OAYH 1MOEA 3TBWA 5H35B 3U36A 4ERSL 2CH8A 3RZWA 3AXLA 1QSFA 5DI8B 2RFXA 4YDVB 3SDXE 2HFGH 3OGCA 3STLA 4PJBA 3DROA 4YWGL 1EEYB 3MFFB 3GJEB 4Z7WB 4M7LL 4GAFB 2EXWD 1CXFA 4L29B 5D72H 3ARBD 1MHPL 1MLBB 3EO9H 4M93C 3JV4A 5J1AA 2CLZB 4HZLA 1A7PL 4GG6F 4MD5B 3ZTNH 2EO1A 1I1FA 3SDCD 3RZCB 1N5YH 4NHUB 1A3LL 3SJVB 1P4BH 2R2HA 5AAMA 3SDXA 5BS0E 2EXYD 4QOKD 3FQTB 4GUPB 4DGVH 4YX2H 3FL7A 5L2KB 4R96B 4O58H 2RAMA 5ISZB 1KIPB 4GJTB 3PXHA 4ZUSB 2ZUVA 5GRVK 5EC2A 1U95A 4OSUL 3I3BA 1NUFA 2VO5A 2IBBA 2CIKB 1ZV5A 2VMFA 5ECJE 2AK4E 4G7YH 2X1WL 3FHQA 2D0HA 2DDQH 1BAFL 1LE5A 5DRXB 4OD1L 3RGVA 5J4MA 3B9EA 4Y4KB 1J05B 2VTFA 3MZGB 3P9LA 2DQCH 4IOSD 3SE8L 5BS0A 4XB7A 2H26B 2VDLL 5DHYA 1SJVA 1AD0A 1EFXA 1S9YA 3AREC 3SGJA 5DGQA 2Q87A 1Y6KR 4G5ZH 4L8DA 4EBQL 4YEEA 4JPWH 1NEZA 3OKDA 4P59L 4ZUTA 1YEDB 3BP6A 4IRSB 3RWCB 1RULL 2AK4A 2V7HA 3BIKB 3HAEH 3MBXL 4E42B 2DIJA 1V5JA 4Y2DB 1UM5L 3NFPA 5B4MC 3VFVA 4EZMA 3KXFD 3KPPB 2G2RB 4GBXD 3RY5A 1XIWC 1INQA 2YD1A 5E5RB 5B3JE 1CG9A 2PNDA 1F3DH 1YN6A 3WNKA 1KENH 2APTA 1AC6A 3VG9C 5DS8A 3ARPA 2E9BA 4WJ5A 1ZHNB 3TO2B 4Y4FA 4KMQA 3E1F1 1L6XA 3SDDD 2WBJA 4TQEL 1PYWB 1G7JA 5IR1A 1LO5A 4RAUA 1H8SA 4PJXF 3AS0A 2R4RH 4HBQA 3D85D 1QEWA 3ROOB 5TE7H 2R2BA 3EO1B 3RI5F 1N7ML 3G5YA 1MFDL 4QXGL 3T0BA 3G6JE 4P5TD 5F7WC 2PCPB 5C0CE 1YECL 4Y0GA 4K23L 1FGVH 4LLAA 2V5TA 5ACMA 5K9QG 4OLUH 3VJ6B 3ALWA 4YUEH 2OJEA 4MX7B 4HF5H 4CU6A 1N8ZB 1EPFA 1QR4A 2EC9T 3P11L 4QTIL 2VDKL 3ARDD 3KPRD 3KWWB 4GXVH 4H1LB 4MA7H 1CE1H 4XPHL 4CGTA 2ADJB 4W6XB 5FYLH 5HHXL 1IAIM 1VESA 1ZS8B 4WGVB 3OKMA 3NCEB 2HG5A 4HJGB 1A7OH 1X5YA 3PG2A 3G6JA 4RMQA 1EV2E 4F37K 4R0LC 3ECBB 5BMFL 3EHBC 5SX5K 2CK0L 4NFCA 1UH2A 5HGGS 1KTLB 4FQCL 4K7PY 1LO0H 3O9WC 3PGDB 4QYOA 1IAIH 3PE9A 5GS0C 4XNQB 3QYCA 1YYML 4F33B 1ONQB 2QSVA 4AIOA 1Q1JH 5D70H 3TM6A 1NCBH 4TTDD 1VERA 3CH8A 4JFQA 4K8RD 2H2PC 5KW9H 5F7MC 4PJAF 3BP4A 3R8BB 1G6RH 3TO4C 5GRVL 4HZAA 3P2TA 4LSPH 4OTXL 3MCLL 1J1OH 2PTVA 2VLKA 2M8XA 3K1DA 4HFWA 1GOHA 4U31A 3OV6A 4WO4A 2VZ3A 3UPRB 3MRQB 3AS2A 4OGAC 3WFCL 3GMLB 3V8CA 1CBVH 3C8KB 4QRQA 3G9VA 2A6KA 3IFOA 1J87A 1MCPH 1WZ1H 2X4NB 1SBSL 1IJ9A 4LASL 5E7FA 1T5WB 2SEBB 5K9KA 1JN6A 1QVOA 4E41E 5GGTL 5DDHA 5HY9B 5F9OL 2Z9TA 4XCFH 3BIAX 4XXDB 3T4YB 4JFEB 3H3KA 5FUZL 3VXSE 4C56B 1VFBA 5FYJL 1AO7B 2YR3A 2Y5EA 4OZIB 4NRYB 5K93A 3UTTB 4M93B 1ND0B 2VXVH 1FJ1A 4V1DD 4S0TD 3ZKSD 3QUZD 3VXRE 4E41A 4LSVH 1FCCA 3V9FA 1IBGH 3VFOA 4YDLB 3CSYA 4CN1A 2P8PA 4OFPA 1P7QD 4LLUB 3VXSA 1X6NA 4XPBL 1O7SA 4OB5H 3O3EB 3HZKB 1MJJA 4LAQH 4WHDA 4ORZC 3IJSB 4KMTH 3PWVA 3X12B 2BXZA 1H3WM 5GZNC 3QDMD 2Q6WA 3BUTA 1I9EA 4MDJB 4YEFA 4QXWA 3RDTC 1SEQL 2VDOH 2XPGB 1IGJA 1NAML 3WNOA 1ZK9A 2EYSA 1OGAB 4OUUA 3EOTH 4WW2C 3VXRA 4CMMA 3LEVL 3MLYH 3VD7A 1QTYT 2DM2A 5KVDL 2R56H 4OIIL 2YEZA 3C5SA 4OJFL 3UTOA 3WLBA 3MJ7A 1JTTA 3ZDZE 5L8KB 3AREB 4OAWA 1T89C 1S7RA 3RWGB 1EA9C 5EOQL 3IJYB 2OL3H 5C08D 2DD8H 4N9GA 5HXMA 4KMLB 1UKQA 3SHSA 2RIKA 3BD3A 4LLYB 4CL7A 4KZDH 2Y07H 2FDBP 4QGTA 5IEHA 4HWEL 4FP8H 5CEYB 3DRQB 1KPRA 3DO3A 1ADQH 4ZDHB 4FFZH 1DBKH 1XIWB 4JRWA 5DI8A 3SJVE 1M71B 4CVZB 3VG9B 2XICA 1IM9D 4O51B 1CXHA 3EYSH 4U6YB 2EXWC 4JN2A 1FNFA 3ARBC 2J2ZA 3MFFA 1MJUH 3GJEA 2A6IA 5BZDB 4XMKL 2V9TA 5ISZE 1IMHC 1LK3L 4QHMB 5A43C 4L29A 2IBGA 5LBSH 1FFOA 1MF2L 4YDKH 5LCVL 1MLBA 3QFDB 3QWOB 5EBWA 2F5BL 3SDCC 5KVFL 4JQVA 5SWQB 1KGCE 2CLZA 1YPZB 3GNML 3D39E 1RIHL 3LRHA 4UIKH 1U6AL 2DJSA 5T1DL 4I0CC 4HIIB 4NHUA 3SJVA 3TNMA 4BKLB 5J1SC 5IQ7L 4GW1A 3FTGB 5T5NG 2V5YA 3EYFB 4I4WB 5CWSA 4Q9QH 1E27B 4F7TA 4GUPA 5IIEA 4UU9B 1WF5A 1S7VB 5TGBA 3ES6A 1RZFL 3H6JA 3KR3L 2JJTC 5ISZA 5EA0H 4X5XA 2VDPL 5EU6D 1HYSD 4NJAL 1W0WA 2ZSVB 4W4OA 1RJCA 1GZPA 5DC4B 5DXWA 1FIGL 1L0XA 1R5WB 4HG4J 1QO3B 5HJ3B 4XP6H 4R0LB 1G0YR 1C1EL 4KJPD 2F58H 1NMAL 3BJLA 4XPGH 1KLUA 4URTB 2DBJA 2XV6B 5EU5A 2XQYG 3O9WB 1YEDA 1XCQA 1OAUH 4EI5D 1X4YA 3GZKA 2AEIT 5C0ND 4GBXC 2HVKB 3JXAA 5ESQA 1QLEL 1CE6B 4BFEA 4ODWB 3GSRB 1CZ8H 4OFIA 4LIQL 4YHZL 1DFBL 1JVKA 3CXHK 2R1WB 3TA3A 3N0PB 2A77L 3OG4B 1S9WA 4JFXA 1UEYA 5AYQA 3TO4B 3QXAA 1HWGB 4S1SL 2ARJA 4WNQB 2VQTA 3SDDC 2B1HL 4KDVA 4P23D 1ZHNA 3TO2A 2PW2B 3O3DB 2DTMH 4JO4L 4OKVB 5B8CA 2RHEA 2EDQA 3LKRB 2OR9H 1HE7A 2D7TH 4P5TC 4TVPH 3WNPA 4XHJD 2EDYA 5DVLA 3IGAB 3I9GL 3MGTB 1B0RB 3OB0K 1JNHB 4HQQL 2OS7A 3OJ2C 1FNSH 3V7AE 4KUZL 2P1YA 1PX4A 2IAMA 2O93L 4MJ5A 2HWZL 3WJLC 5KVGH 1YC8A 5SV4A 4HLZG 1XF5A 1N8ZA 2CMRH 1OAKH 4LNRA 4H1LA 1HSBB 4I2XB 4HV8A 2QJDA 1GHFL 3JBG7 4N8CL 3RUGF 3E3QC 4HJGA 4NOBA 2YD9A 1UM6L 3H2WA 2FD6L 1OW0C 2NTFB 3WIIL 5ACZB 4OD3L 1JGLH 3ECBA 1CF8H 3WS6C 2EZ0D 3H9SE 1YZZA 1IAII 1FG2A 1KTLA 1KTKE 5ADPH 2H9GB 3NH7H 3RWDB 3WL9B 5IKCB 3RBSA 2HLFD 5JOPD 4TTDC 1AGCB 4F33A 1JZ2A 3MV9B 3GIZL 4GRMA 4K8RC 4IRJD 3CXDH 3U9UB 2E7MA 3RDTB 5LWYH 2Q7YB 2CUHA 4XXCA 5CEZH 1IM3A 4WW2B 2Z91B 5DD1L 2JJUA 3H9SA 2CUIA 3OKLA 2V6HA 4HFUH 3X13A 2JJSC 5ALCH 4M3KB 1IEAB 3QCTH 3QPQD 4FN0A 2BVYA 1TZGH 4OZFH 2R15A 1T1WB 5BOPA 3EBAA 3GMLA 4UIMB 3T3ME 5KBNC 3O4LE 3C8KA 4M61B 3ZL4L 3UTTE 1J1PL 5T3XE 3IF1B 1T5WA 2SEBA 2GI7A 5IHUH 4PLJD 3SGKC 1IQWH 2EIDA 2WZPD 3H9ZA 3NACL 4POZC 4KQ4H 4XXDA 2CRMA 3Q3GB 4NCDA 4KK5D 4PJFB 3T4YA 1ZANH 4XPTH 3ARBB 1UZ8A 4HXAH 5JIHA 1JL8A 4HPYL 4JFDD 2BHUA 2IADB 4L8CB 5JDSB 4HT1L 4I3RL 4OZIA 3O4LA 2CKBA 4NRYA 3S3JA 3UTTA 3SDCB 1ND0A 2AK1H 2Q86B 1MIEL 2CO6B 4L3CB 4M6OH 1OGAE 2VSDA 4QOKB 4XWGH 2WWMD 1JNLH 2I9LA 3PWJA 1CI5A 1UCTA 1QFUH 1S3KL 1YNTB 2FBJH 2OTPA 2UYLA 3IAGC 3HI5H 3CC5B 4HBCH 4LLUA 3O3EA 2VIRA 3L1OH 3ZE2F 1XGPB 3VXMD 4ZNEA 3RNQB 1I1RA 4N5ED 3MJ6A 3C2AL 3GSVB 4JCLA 3P9WB 4LHUG 2FJHB