2E27H

Crystal structure of fv fragment of anti-ciguatoxin antibody complexed with abc-ring of ciguatoxin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
116
structure length
116
Chain Sequence
QVQLLESGAELARPGASVKLSCKASGYTFTTYWMQWVRQRPGQGLEWIGAIYPGNGDTRYSQKFKGKATLTADTSSSTASMQLSSLASEDSAVYYCARSDYGGDYWGQGTSVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Critical contribution of aromatic rings to specific recognition of polyether rings. The case of ciguatoxin CTX3C-ABC and its specific antibody 1C49.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords anti-ciguatoxin antibody, light chain
total genus 24
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2006-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2e27H00
4XP1L 3VFGH 1U58A 3DRQA 3WHXA 3TIEB 3TBTA 4L5FL 3MC0A 2AV7B 4JFZL 2WIMA 2DRUA 2VLKA 3LKQB 5IB2B 1UEMA 2HFFB 3P11H 2GFBB 4UILL 3IAPA 3Q5OA 4O00A 1RUQL 5A2FA 3KPSA 2X4TA 5F1SA 3MLUL 3M1BA 5BZWA 1CL7L 1X6LA 1EJOH 4DZBB 5CKGA 1Q0YL 5B8CC 5J13C 5F9WB 2BOBB 3BZ4A 3MZGB 3SOBH 3BKCL 4OQ1A 5C70A 2GAZA 2VDMH 4WEBH 3TVMB 4PRID 4GKSB 2KQMA 5CEZL 5KVGH 1EA9C 3CUPB 5GZND 3PHOB 5FM5O 5TQ2H 3N1PC 5FV1L 5LXGL 2EIZB 4Q97A 3C2AH 1UC6A 5J13B 4DOHE 1PKQB 4MD5B 1W72L 4ZSOB 3MRIB 4PJCE 2H3NB 2YS4A 1JGUL 4BJLA 2JCCE 3WIHL 4V1DD 5GGTL 2E5EA 4ZODA 3RNQB 1OTSD 4Y88A 5HHVH 1AXTH 4JR9H 4KROB 3QWQB 3MV11 1RZGB 3PNWB 4P4RB 3F7PC 3AMKA 3A6CH 4OFYD 4AEEA 3ILQC 1WWBX 3QXUA 4LARL 2DWEA 4QGTA 3ARDA 3CSYB 4ZO9A 3MLUH 4PJGB 4XPAH 4H26A 4JQXC 4M03A 4TNWK 4H0GA 4NCDA 4XNXH 1N0XH 1HNGA 3OKOA 4UINH 5MP6L 4ACPA 4ZUTA 4TVPD 4R97B 1ITCA 4OZFB 4JZJC 3KLSA 5EUOF 2I24N 1R3HB 1WZ1H 5BVJA 2RGSA 4AM0A 1WZMA 1MAKA 3KGRA 2W65A 4KKCD 2AXFB 4FTVE 4G80A 5E8EB 3LKSB 2J2ZA 3RGHA 3DX6B 4N5UA 1ZHNA 5K59F 1BMGA 3V4UL 4POZD 5IB5A 3IS0X 3A0OA 3QJFB 3VI4E 1QLEH 4B5EA 5ADPL 4BSVA 4FQQA 1I75A 3Q2CA 3PP3H 4XAWL 1ONQA 4X0KA 4CL7A 1MVUA 4JVUA 1WISA 1AGBA 5E2WH 1XR8B 4KQ4H 2A1WL 4EDWL 3WIHH 1NAKL 4YE4L 4K55A 3I02A 3VGDA 5AD0B 4MJ5A 5BXFB 1EMTH 4M7ZC 3EDKA 2VLRD 1PKQE 4G6FD 3QG7H 2UY6A 4XP6H 1DSFL 1UCBH 1NCAH 2ADIA 5BJTA 2EDWA 3ARQA 3RA7L 1F2QA 4WWID 1ZHBB 1OAZH 1BQLH 3G9VA 3U4EA 3BQUC 5JHLL 4MB5A 4KZDH 4XCYB 4GKZB 4LCCC 3VFPB 1MI5B 3B8SA 4LDOB 4D3CL 4NDMB 2W65B 1KGCD 3GMQA 4PRAB 1KTDB 3HE7C 4KHTH 4MHHG 3OKMA 5TDOB 3BSZL 1IGYB 3TZVD 1ZGLM 1KF9B 1CE1H 1I3VA 4Y4FD 4LRIA 2DQDL 5JXEA 5HI3C 3U6RB 2RFXA 3GSQA 4P5MA 3QFJE 1RFDL 3I6LD 4JGJA 5EORH 3RVWC 3VFSB 5SWZB 3QEQD 3N50A 4HZLB 1QACA 1PY9A 3OPZL 4UTBH 5CBAA 4RRPG 4EVNA 4R9HA 2CGRL 2A1WH 3M8OL 4EDWH 5HHQB 1H0DA 1AGEA 1B3JA 2EDHA 5SX5K 1TCRB 4NPYB 3I75B 4TVSa 3KJ6H 3BMWA 5F89B 2AEWA 4H26B 1NCAL 2EC9T 4XH2B 1TETL 4JKWA 3SKOB 5IMLB 4LHUB 1IM9D 4K3EH 3TT3H 1HK6A 4N1CA 4D0CB 3WUWG 4WWKA 2HG5A 3KXFD 3HFML 2FJGA 4NO3B 3FFCB 4RMSA 2XIDA 5DUMH 4XPTH 5A16A 3IRZA 3S7GA 2NR6D 5EZIH 2VWEE 2X4RB 5EZLB 4JFDD 5IESL 5F1NA 4FZ8H 4C56B 4Y8AA 4XNYL 1T0NA 3MRIA 4WI5A 4RSVA 3ARGB 5JORA 2W9DH 2UWEE 1DR9A 5SWSB 4P2OD 1D7FA 4NO2A 2R2CA 4FP8H 2JCCA 2Z35A 2WBJD 3FONB 2DI8A 4MXVE 6FABH 4R0LA 3BAEL 3TNNA 3VCLB 5EORL 4FQXC 1Y6KR 4OLXL 1OSZB 4S1RL 2ZOKB 1IEBB 3QXTA 2XV6B 4XVTH 3FT3B 1ES0B 4Y5VB 2MPAH 3VXTB 4DVBA 5A43C 3BMVA 2ENSA 3OXSA 3VGHA 1XIWC 4QHNA 3W9EB 2FH6A 3DIFB 2ZCLH 3UPCA 5I71B 2DWDB 3H42L 4I0PA 2EDLA 5FA3A 4ONOA 3KJ6L 5CJOH 4P5TA 1NH6A 3FHQA 4NNPH 1AGEB 2VJXA 5E03A 1NGYA 2DLGA 3GSRA 3W5MA 4FQXB 4GRMA 4Z7VA 3TO4B 3D0LA 1L6XA 3BN9D 3GSVB 4YQXH 3U46A 4I13B 5F8RC 5T3XL 4Y5VC 4X4ZA 1MIEH 3VFSA 43C9A 5IVXB 1RJCA 4JQIH 1FO0B 2R69L 4J3SA 4LSPL 5CLWA 2VDLL 1A6VL 1S7RB 5JXED 3ARGA 5CHNA 1CXLA 3MROA 2C1PA 7FABL 2NW2B 4U1SA 2MKLC 4ZFFA 1IGFL 3PV6B 1SBSH 4HK0A 4IIQA 6FABL 3UTTB 4GT7A 1DBMH 1Q9OA 3GHBH 1SHMA 4IOFD 1FNAA 2JJUA 3AY4A 4PREB 4UTAL 5DHVH 4XVUD 4XNXL 1C08B 2JIXD 4P57A 1GGYA 3CX2A 5BMFH 4N1HB 5MEOB 2GEEA 1Q1JL 1FORH 2XTJB 2VDPL 2IPTH 3OR7B 3X11B 1EHAA 1ZE3C 1EVUA 3H3PH 1WTLA 3LZFL 3QDGA 3HNSL 3MV8E 4ONGH 1IGTB 1HHJB 4OCSH 3TBTB 3IJSB 12E8L 3GSRB 3ZDYE 4PJEF 5L0QC 1SY6L 4W4OA 5DDHA 1HQ4B 5GISH 4OGXL 1ETZA 1S7RA 3QRFM 3UPRB 3MRBB 4OI8A 4YHKH 4L3CB 3C5ZC 2KPNA 1RZJC 3QUYA 4XCNB 3PABB 5KTEH 3IDYC 5JA9A 4XXDA 4YDIH 1BOGB 3EZ8A 4RNRB 2BNRB 5FHAH 2XRAL 1NBYB 3BIBX 4JZJA 5DO2C 3K4AA 3VWJA 4JE4B 4JHWH 1ITBB 2I5YH 3IKCA 5I9QB 4NWTH 1YECH 5J6GA 5ISZD 3D18A 5L8LB 3BZEA 5HGHB 4O58H 1ZT1B 4KDTA 5KVDL 4QHLA 3EFDH 3QQ4A 3VW3L 4JO2H 4N90D 2CUIA 4NO5A 5AZ2L 1AD0A 3RY5A 4TSAH 1U8IB 4N8VG 1HQRA 2P7TB 5EUOB 1PW3A 4P3WA 3MOAL 4PJXE 4QXUL 5FUOL 4JFZH 1RZ7L 3MA7B 3PHQB 1YY9C 5GJSL 4KUZH 1LEGB 5EUKA 2AEIT 1RZGA 4EBQL 4MGXA 1JF1A 1QFWI 3H3BC 4X9FA 4XTRC 5B38B 1JPSL 3DXAE 2YRZA 3O11A 5JA8B 2E7LA 1CD9B 4U6VL 1UXWA 2RAMA 4JCLA 2BNQD 3QJHA 2H3NA 2Z93A 4HAGA 1NGZA 4MD5A 1TDQA 1A3QA 4AYFA 4MXVF 5IVOA 3FO0L 1L6ZA 2NXYC 1BLNA 2O5YL 3RKDD 2BVEA 2EIZA 5C2UB 3RWJA 5ITBH 5KVGL 1DL7L 1J0JA 4L8SB 3NABL 4HIJB 4TTDC 1B0GB 4CJ1A 5E6ID 4XPGL 1UT9A 1K5NB 5E94B 2BSTB 2HJKB 3WFHB 1LD9A 4DN3L 4OF0A 4S0TD 3B9AA 1FZMB 2AK4B 3RFZC 2NY6B 3D85B 4BSJA 4ODVH 3KPPB 4KI5D 1MCBA 3HFMH 3HZMA 5D1QA 3ROLB 4LCYA 5IP4A 5AZ2H 2J8UB 3MJ9L 4PJAE 1AI1H 5EUOA 3RGVB 5CP7B 1TMCB 4GG8A 1OCWH 4NCC1 4LMQE 1WZKA 1GIGH 1HHHB 2GTZA 3RVVC 5M94B 2D31B 4ZXBB 1PSKH 1KB5A 4U0RC 2QEJA 3MFGB 1A6AA 1N0XL 4ODSL 4WFGD 4QRUA 1WCBB 2H2PD 1OP9A 2O5ZL 3P0VH 1FAKT 1JPST 1TQCB 1YMME 4P3DB 3KPRE 3U7YL 5TF1L 4ORGB 3BH8B 4H8WL 5LWYH 1U8IA 4MD4A 2HKHH 1N2RB 3KLAB 1X9QA 4R26L 1DQDH 2ADIB 2NXZC 2YMXL 4PRNB 3WFCH 4GOSA 5HYEA 1ZHNB 4MQ7A 4ZXBC 3X3FL 1UZ6F 1X3DA 2F58H 2WK2A 5IM7B 2D7QA 1WAAF 2B1HL 3I2CH 3EOBB 2IH3A 1NL0L 1YNLH 4LGPB 4ESKA 1F4XH 2AXGA 1XMWA 4U1HB 4MLSA 5E2WL 3MRGB 2VC2H 1HHKA 4IOSD 4OQTA 4I3SH 1JPGB 2EH8L 5L7XL 2DBLL 1UZ8B 2BDNL 1QBBA 4LVOC 2AEQH 3N9GL 5DVMA 2HVJB 3HI5H 3AAZA 4IHOA 5ALCL 4GBXB 2DJSA 1F6AA 1D9KC 2A0LC 2DL2A 3ME0A 3KS0H 3TA3D 4J8RB 5C0AA 2R0ZL 1UKTA 5ADOH 4BH7A 1GZQB 1FDLL 2QKIB 2NY5H 2VWEC 2CKBB 3O9WD 1BJ8A 3V52L 2EXYC 3RJDA 3U6RA 4M62L 4X98B 1YY8A 3FT2B 4OQTH 4PJAA 3RVVD 2W0FB 3T8XA 3B9DA 4P23C 4R90H 4U2ZA 2B1AH 4GQ9H 1TJGH 3PWJA 5LJYH 3C8KA 3FMGH 2HRPL 4Y4FB 1R3LB 4UNUA 5E2JA 5IMKB 4FQIH 4OLZL 2NX5E 4N0CD 4OCSL 4S1DD 5I8OH 5IHUL 3FJTA 5F1OB 2PTVA 1EGJL 4W6YB 2BSSB 3KPMB 3PXHA 1IBGL 5F1KC 1MHHA 1OT1A 4TSBL 5C3LD 4HT1H 1BFOA 2EH7L 1CYGA 1H3PH 4OCMC 3HE7B 3LN9A 5GGRB 3FZUD 3GSUA 1AR2A 1J18A 3B9KD 1NAMH 5DJYB 1TTFA 3GFUA 5FYJE 3QFJD 4JRYE 2ITCB 4OZHE 4G8GB 1HSAA 3GO1H 4F8QA 1PG7W 5FM5M 2C4FT 1AE6H 2C1OB 3T1FA 1MH5A 3R0NA 5IK3A 1SMAA 2HH0H 5D7IB 4XPFL 3WHE0 1R5IB 3RWEB 2EIBA 5JORB 2EDNA 3VD5A 1ORQB 5D6CA 5EO9A 1LO2H 1YQVH 1DVFA 5IB4B 3KPPA 2X4UA 4XCCL 4QNPF 4PJ9B 4KMLB 1FN4A 4MZ2A 1CN4A 5KZCB 4KUCD 2G2RA 1FNEB 4UQ2B 5IR1A 3OKOB 3OJ2C 4DQOL 3FT3A 4NO2B 3CJJA 4IJ3B 5E2TH 3ZT6A 2WBJB 4M1DL 4JM2F 4OI7A 4NM4H 3QIUD 4OBRA 5C3TA 2VN7A 2V5SA 4JFDA 1RURL 3VXTA 2CIIB 3O6ML 4L1DA 5I15H 1UA6L 4I9WE 1J05A 4XAKD 3MODL 5ERWA 1INQA 3FO0H 4RWYH 4HJ0C 3TV3H 4WFHE 1UB5B 2V9RA 3MV8A 3EOAA 2ED9A 3HC4H 3I50L 3CMOL 3VRLE 1D5BA 4MNGB 2W92A 1I8LA 1PG7H 2E7MA 4Y2DD 2HJFA 3MBEB 5C0BE 2NTFB 2Y9RT 1CD0A 1UJTA 1YN6A 4KJWD 4NKQB 4MDIB 3UC0H 3VD3A 5ISZE 1FH5L 2YUXA 4LCCA 1ETZB 3BESR 4BQ9A 1AI1L 4ODUB 5BS0D 1DUYA 1UWEL 2SEBA 4JFPB 1II4E 4O9HL 1MRFH 1S7SB 4GXVL 4Q6IA 1HHJA 2EDBA 2LE9A 2CMRH 3CU1A 2KH2B 4I9WD 5F7LB 4PJ8B 3L3DB 5C6PB 1XAUA 2CDFA 4KQ3L 3ARPA 4M61B 3IKCB 4RQQB 4LLVA 4X6FA 3FO9A 3JXAA 2ATKA 2WLZA 3DVGA 4N0UE 1EEYB 3NGBC 3Q5YA 5FYKL 4HH8A 2FO4A 1C5CL 1NFDF 4ODTL 2MTPA 2EKSA 2ZG1A 3D9AL 2JELL 1IGYA 3UPRA 1U8NB 3ZDYF 1OARL 3OTTA 1M71A 4JKPH 1G7PB 3AUVA 2BVOB 4HUVA 1P84K 1RVFH 3MZTA 5DK2B 2LTQC 2YMXH 4HKZA 1CGWA 3C5JA 4JGUA 3D2UD 1J1OH 3T0EC 3V0VB 3ISWA 4ZPVA 2H2PC 5ESAA 3QFJB 1SM3L 1OSPH 1NC4B 4NHUA 3QJFA 1IQDA 2FB4L 3NH7L 4ODUA 4UT9H 1JZ7A 3C60A 3C9NA 4WNQA 5IROC 3LN5B 1HILA 1UB5A 5JOPE 5DURB 1R3HA 5BVJB 4A6YB 2LTQB 2P42B 3QQ9C 4PR5A 4G8EB 1D5BB 4MNGA 4X4YB 3VGBA 1T04B 1AO7B 2P5WB 5DT1H 3X17A 4AENA 3FFCA 1KB5L 1FJ1A 1AY1L 4X6CF 4LCCB 1SEBB 1A6TA 4AEFA 5DJ6B 5F6IB 1CGSH 2JF1A 2EKJA 5BVPL 2EKSB 5JQHC 2BCKA 2YKLL 1EHLH 4PP2B 4K71B 3GHEL 3B2UD 4LPTA 4HAFA 3DIFA 3REVB 4JQVA 4AH2B 1XZ0B 3KWWB 5TF0A 5FGCE 5DK3A 1F3RB 2DM2A 2FNBA 1JL8A 1MCEA 5I1CH 3V6BR 1G7HA 5CD3A 1VFUA 2ADFL 4M9OA 3S36X 5GHWH 1V3KA 3BPCA 3R06A 3LQAL 4OLWL 1X7QA 3QWOA 3C8DA 4OCWL 3CIQA 3ULUE 2GQHA 3HE6D 2BOCB 1DBKH 2HMID 3ZSTA 4S1QH 4RISH 3VMPA 3CFBA 1KLUB 1NAKH 3K2MC 1Q9LB 2JCCF 4YC2B 4PJBE 4X4YA 2QQNH 4D0DA 3EJJX 4PJCF 3RUGB 3VGGA 1CDIA 5LGHL 4AZ8A 4M5ZL 1ZSDB 2YPKB 1RFDH 5J12C 4ZD3L 4GKSA 3GMRB 1KB5H 3IF1A 4PGCA 2GTWB 1OM3H 1DEEB 1XCQB 3C09C 2VQ1B 2XKUA 4QRUB 2NY2D 4PJHA 1MJ7H 4P2QE 2QADB 3ARFD 1DUZA 3B2VL 3NN8A 4D0BA 1XCTA 4ORGA 1FO0H 4EN3B 5CGYC 5AWNH 1A7PH 3O2WL 3BSZH 4GUPA 5C8JB 3MJ8B 3WBDA 1NGPL 3K8KA 1HEZB 4BFIA 2ZUUA 2X89A 5D2LF 2ID5A 2LQRA 3EZJB 4Z5RB 3RY4A 4NQCB 4FFYL 4G9FE 2D7PA 3HR5A 4BZ1L 3LKQA 2LU3A 3FRPG 2ADFH 4Y1AA 2O61A 2MQ3A 1S8DB 4P5TC 1U3HC 5I73C 4CUCA 1HIMH 1JGDB 3L9RB 3HAEG 1I7TB 3PP3K 3JVGA 2EEBA 5I1HL 4XMPH 4QOKA 3Q48A 3MYZA 5B22A 3SDXF 5DD3L 3HNTL 5ESVB 3I6LE 2BJML 2CGRH 3QRGH 3MLRL 1FNSH 3L3GB 2AJUL 3IYLW 4Q9QH 1UA6H 5LCVH 4YC2C 1NEZG 4ZXBD 2Q8AL 3O4OB 4YO0A 4HMDA 4H88H 2AV1B 4CADB 3CXHJ 1RUKL 2F58L 1HHIA 3RWCA 1N3NB 3L6FB 1G9NH 5FB8B 5J11B 1UCTA 5ETUA 5KAQF 4JVWA 2DWEB 5GS2H 3FN3A 1U92A 3O9WB 3P0GB 4J3TA 2IH3B 4O4YH 4J8RA 4MQXC 4WU5A 5DGRA 4PRIA 3KHQA 1XGRA 1S3KL 5E0QA 4LIQH 2HVJA 5IESH 2A83A 1A0QH 3VXMB 1DBJH 4N1EA 2I9LA 4JM2C 3WFDH 1Z5LA 1CS6A 1DBAL 1GZPB 5E4EC 2CO7B 1LNUA 1WLHA 3BAEH 2IAMA 3G08B 2GSIA 1P7KB 2YWYA 4CRPA 1ZA6B 2W0PA 3CK0L 3FN0L 4V1DB 2MPAL 1F45A 1FL5B 2AXFA 2AJXL 3H9SD 2W38A 4CAGA 4JPWH 1AC0A 3QRGL 8CGTA 3EJZD 4NT6B 1TNMA 5ICYB 4PJCA 3BGAA 5DHYA 2V5RA 4NOFA 1MAML 2EIDA 3MV9A 4M7ZB 3B5HA 2HLFC 2WNGA 1I1YA 4UDUA 1IAIL 4WTWA 2X70B 1DQQA 1KFAH 4J6RL 3U82B 4JFFE 4GBXC 3O9WA 5HVWA 1D5XA 1U8KB 4QTHA 5HD8D 4PIRF 1LE9A 1HHIB 3UJJH 2ZPKL 4O4YL 2DTSA 5C09A 4BSWA 4UT9L 5EIIA 4Z9KB 3L3KB 4HPOH 4YHLL 1YPZE 2I25N 2NLJA 3PP4L 1IKNC 1BVLB 4HIJA 4LIQL 3BISA 3OXRA 4C56E 2CIKB 4OF3A 2VLRA 4G8IB 4LRIC 4HBQA 3ARZA 5C09D 1K5NA 3D25B 1BLNB 2CH8A 3UBXG 1YY9D 3P40A 3WFDL 4D94A 1N6QH 2O5XL 1CLOH 3GSXA 5D1QC 3A6BL 1HHHA 1IGTA 3ZDZF 3IDGA 1A2YA 5I30H 3BQUA 1B2WL 5E00B 1FZMA 4LKCB 5TH2A 2XQBL 1MY7A 1IC7H 2EE9A 5EOCH 3DX8B 4JAMA 1RUML 3V5KB 4F15C 2XRAH 3CLEH 2OP4L 5IHZB 3O3EB 2BSED 3ULUL 4Y2DC 3NPSC 3ARED 2YBRA 5FAAA 3L6FA 2IQAB 3VRIB 4BFIB 1IEHA 3IU3A 1MI5D 15C8L 5CJ5A 1AGCA 4BH8A 3G6JB 5EIIB 4U0QB 4HH9B 5IFJA 1ZHKB 4QHLB 4ZUVB 4OZFH 3HNVL 4OF5A 4P46D 4P4KD 2XZAL 4KRPB 1BZ7A 1DBKL 1DCLA 1WZ1L 4QRQA 2CR6A 4GMTL 3DPBA 5FUOH 1RAMA 4JGMA 4HGWA 4TULL 3OAZH 1VGEL 1UZ8A 3BP5A 4HFUL 2D9CA 2VRAA 3T3PE 3TO4D 4FQXA 4GRMB 4FTVB 4JPVH 1WAAA 4Z7VB 4PJDF 2DYPA 1MF2L 3HG1D 2Z8WC 1K2DB 1MFCL 4KGJA 1XF5B 3MLPA 4G5ZL 3LEXB 2XN9A 4RZCA 3B2VH 5F6HI 1OTTD 4KQ4L 5GS3A 4UV4L 1FQ9C 4NJAH 2D4DA 1UYWL 3GBLA 1AQKL 1YPZA 4HLZH 2VXQL 1I1YB 4K8RD 4UDUB 4CVXA 2ZOKA 3WO3B 3DETD 2FO1A 3LSOB 3E3QE 4N8CH 4NZUL 4X4XA 1DSFH 4JFHE 4NRXA 3DBXB 1ND0A 4KQ3H 2AK1L 3RRQA 2HKFL 2BVOA 4HUVB 3ZT5A 1ED3A 3DWTA 4XNQB 1GH7A 5DR5H 1QO3A 1LNUB 2XTJD 3HI6H 1KV3A 4AIZB 4D3CH 4HUWB 2IAND 3FZUC 3TC9A 1JGLH 4ODHH 3BPOC 3UTPD 4EUPH 3VXMD 5DEFB 5LCVL 3SDCB 5FUZH 3N1FC 4ZFFB 2ZWLT 4HPYL 2B4CH 2HJLB 1JN6A 4IIQC 2DI9A 1E4JA 3IDNB 3UTTA 3GBNL 2VL4A 1QFUH 4JPVL 1DLHB 5K9KB 1KN2L 1TENA 5JHDA 1HH6A 4HF5L 1NBZB 1J11A 3VG0L 1D5MA 3OPZH 5GIRB 2BNUA 3JV5A 1BX2A 3REVA 4FRWA 3MJ9H 2QJDA 1HXMA 3MRBA 3QI9D 2ZUYA 3LKRB 5ANME 4JZNB 3EDFA 3AMLA 2VL5B 3BIKB 1KCRL 4G6KL 1PEZA 4XBPA 5HHOA 3ABZA 4U1SB 3WFCL 3HAEA 2VDRH 5TQ2L 4E5XA 3ULUC 5DJ6A 5K9JH 4NQDD 1DQLL 2A73A 3QDGB 4K94H 4MNQA 3C87A 3EYQC 3PDOB 3QPQD 5EU7E 2BFVL 3LD8C 1ZVYA 4LDEB 1EIBA 4ZSOA 4XNUH 4J3WA 1KTDA 4HG4K 1EO8H 4P57B 1GGCH 2VLLA 1I8KB 4OD2B 5D1XD 1I7UB 3VXME 3SKJH 3N85L 2CK2A 3U0PA 2B5IB 3HN3A 4PGZA 3QDGD 1PQZA 5EBLB 4JRXE 3MLYH 1ZSDA 4CVXB 3P4NA 3ZYJA 3GBNH 3QPXL 1XH3B 4PJHB 4K8RH 7CGTA 2QADD 3OB0H 1SYSA 5JHDE 1DN0A 1ZT7A 1OAXH 1XCTB 4UIMB 2GTWA 4Z0BH 3AXLA 3P4OB 4FQQB 3FT4B 5HYJA 4LSTH 2WM0A 4I3RL 4EOWH 5HGHA 4DKDC 5LAXA 4XAKE 3WL9B 1LGVA 4Y16B 2IPUK 4KVNL 2HT4C 3BW9B 3OKKB 4RGOH 4NC1E 3DO7B 2A9ML 2BMKB 3FB5A 1UG9A 2PW1A 2CLVA 3GMPB 3MRFA 4M5ZH 5HDQL 4LLWB 3QIBB 4KVCL 4HUXA 3BH9B 4ENED 4HXBL 4KC3B 2XTLA 3QZWA 5K9JL 1OM3L 4PTTA 3TBYB 3RTQA 2NY6D 1U3JA 1CD1B 3ARGD 5LG1A 2XQYG 1V3JA 3W0WA 4PJ8A 3G5ZA 1CDUA 3TZVB 3T04D 2HG5B 2APFA 2X10A 4DJMA 4P46B 1FDLH 2R69H 3H9YA 2J7LA 4TUJA 4BYHA 4YZFE 5JOPD 2Y06L 3CDGB 4OIIH 1U95B 1H8OA 5AYUH 3HG1B 5SWZD 4Z77B 2IPUG 1DBBH 4LF3A 2CRZA 4OZIA 3IDMB 2Q8BH 2Y07H 3PGFL 4UV7L 5MEND 5JW4M 3SE4A 1MCFA 2G5RA 5LAXB 1TIUA 3RWFA 1EGJH 2NY1C 3DOSA 1E0OB 1OW0C 4XCYA 5FYJU 2P5ED 4H0IA 3TGXA 5C0GA 3O3BA 1IQDB 1MH5B 3DARA 4KVNH 4Y4HD 3WJLA 3VXNB 4YHZH 5E5RB 2ORBH 5C0JA 5ESAB 3W11C 4JPKL 4YHIB 1HDMA 4HXBH 3ZKSD 3P4NB 4IOIA 2WWKT 5HHME 4PRBA 3H8NA 1A7QL 5DQDL 3QFJA 1FC1A 1G6VK 1RSFA 1JHKH 4LSQL 1CR9H 1Z3GL 1I8KA 2CXGA 1KEML 3GMNA 1EGJA 4F58H 2QQQA 3IJYA 4O5LH 4YHYC 1Y18B 1KG0A 1KCSH 3OR6B 1A9BA 2IMMA 2YZ1A 4H20H 5L88H 2VB5A 2CPCA 4JQVC 1AJ7L 3O4OC 3O8XC 1AKJA 3I9GH 4PJCB 3RUGF 2E6QA 4K3EL 1MHCA 3HZVA 4LU5L 2BNQA 4JRYA 4OIBA 4XBPB 5HHOB 1HHGB 3WE6A 1PG7L 5EN2B 3PL6D 1ZTXH 4NM4L 3MRHA 2VITB 3QCVL 1HKLL 1IEBA 1LE9B 3ECBB 3QEQA 5HHXL 3GNML 3OKNB 1WJ3A 2NTFA 1H15B 1PLGL 1KIRB 2OTUA 1DQJA 4JG1H 4PUBL 5TE6H 4HIIA 1HDMB 3S37H 2NY1D 1T03H 3QNXA 1N7ML 2R0LL 1Q9WB 4X8JB 2N1KA 1SMOA 1FIEA 3HB3C 1T5WA 5DXWA 1P1ZA 3ESVF 3IJSA 4J6RH 4NQVB 3UX9B 4X5LA 5IQ7L 2H41A 3W9DB 4X6BB 1A7QH 3DMMC 1XEDA 2D0GA 3VI3F 1MWAL 3E8UL 1IGJB 1MJJA 4NKOA 3M07A 3KYNB 5EBWA 4HPOL 2C4FU 5H94A 2VISA 2VLME 3MUGA 1OARH 3QWRA 3EO0A 5L88L 2IFGA 4GXVH 1T1ZA 5KSVA 3NABH 3Q6GH 4M7JL 1T1YB 5B39G 1D5ZB 3QI9A 4NQSA 4U3HA 5CEXB 4H5SB 1GPOH 3MTRA 1GOFA 4CNIA 3L7FA 1B0RA 2AI0L 5FIEA 3OX8B 3C5SB 5HHMB 1IC7L 5D1ZC 3RU8L 1K2DA 3NAAH 4JY6A 4D9RD 2WWMC 4NNYB 2CK0L 1GGCL 1QQDB 3KYMA 3ES6A 1CFSA 4L29B 2V9QA 3U48A 5FFLA 1T03L 3JWOH 2X44D 5I8EB 1I9IH 4HKJA 4L3EB 2G5BB 4PGBB 3O8XA 4M1CD 2FEEI 1KSRA 5FHBL 3QIWA 5HJ3A 1VCAA 4F57H 4JFYA 1EBAA 1U93B 3CH1B 5KANI 1J0IA 5C0DA 4GKZA 3O11B 3OKEB 2XFXA 1MWAH 1RZIB 1JWUA 4QOKB 3CPLA 4HS3A 1S9YA 4LSTL 2BSSA 1QBAA 4HLZG 4WFFE 4MA1C 5DJ0B 3DMMD 3HC3L 2KBGA 4ONFH 5B3NA 3DURA 2A74A 1IFHL 4L8SC 3OSKA 3HE7A 3WLWC 4AY0A 3DGGA 1K8DA 4L8DB 3BD4A 2CSPA 3EYVA 3MBED 2PUQT 1MVFA 3UBXI 3TFKC 3SGKA 1FZKA 2J5LC 1MRDL 3QO0A 4I0CC 1G7QA 1F3DJ 5F9OL 4YNYA 4ZUUB 2QQKH 5E2VL 1MUJA 1JZ2A 4PV8A 4KUCF 5TDNB 1LVEA 2CQVA 2UV3A 4NFCA 2VC2L 2ZG3A 5KSBA 4I3SL 4Y19E 4QNPE 5A16B 3VXQB 1NCWL 4RGNE 4WFED 1T22A 5AYUL 5HVGB 1HQRB 1YEKH 1DE4A 1FE8H 3D39E 5I1CL 3MGOB 5IW1A 4G6ML 1FVDB 1P9MA 4GG6E 2EDFA 1UENA 5EU7C 4X9HA 2FIKB 4IMKC 5JHDB 4X7TA 3VW3H 3MA9H 4FMFA 2WW8A 2I9TA 4S2SB 5C0FA 2YD8A 2OMBA 4JRYB 1T20A 2F74A 4S1QL 1T1WB 4PRHE 4K3DH 3K3QA 3MPCA 3EO9H 5T1DL 5HI5D 3BFOA 5GJSH 1ZANL 3EYQD 5L8JB 4JPKH 3PGCB 1RJZA 3OJVC 4OM0L 5DVLA 1YNTB 4LHJB 1YN7A 3ARDC 3MOBH 5EC1A 5HGGS 1FIGH 1WV7T 1F3JA 3BP7B 4PRIE 1MPAL 2DQIL 4WY7H 4Z8FH 4JKMA 1I9EA 1A6WH 4WW2F 3LRHA 1K8DB 4R4FL 1RHHA 4ETQB 3U4BH 1I7RB 3C60B 4C59B 2O5YH 4GRLA 3EOYG 3NFNB 3O41B 3HC0A 5E4EB 4XX1G 1T21B 4KK9D 4FFYH 2A83B 1BD2A 1MRCH 3GSOB 4GG6F 5TGBB 1K4CA 1QZ1A 2R2BA 5FGBC 4K94L 1KC5L 3V0VA 3O6LL 4FXKA 1YJDC 4K3JL 1AXSA 4HFWA 3LQMA 3MRNB 4KY1H 3JWOC 4OCYL 3I6GB 1T7VA 2VO5A 4NHUB 4A2MA 5HHXH 3W9EA 1M6OA 1U8OA 2FGZA 5MENB 4GRWE 3V7AG 1CE1L 5KSBE 2ILLA 4DUWA 1DBJL 4IOFC 1VPOL 3FB6B 3C08H 1AC6A 1F13A 3EO9L 4JO3L 4LRNH 1M71B 2GHWB 4UUJA 3DXAD 3QIBC 2WV3A 4KU1A 4DGVH 4K8RL 2BVQA 3RX8A 1CD1A 2UVEA 3O8XB 4PY7A 4D9QE 3CFEB 3QZWB 1AGCB 1NUDA 3ZTJG 2Z8SA 3P3YA 3S97C 4IRJB 1TZGL 2BSRB 4EOWL 4K2UH 3FB5B 5GGSY 3WJLC 5HYSA 4K71C 5I1KL 1MHEB 32C2B 5FECA 3QIBA 1MEXH 3V6OA 5ICXB 3U36B 4W68A 4EUPA 1KB9K 1NGWA 3FKUS 4M9PA 3CDYA 3L5HA 2YOCA 3DSFH 3WFEH 2ICWI 4WW2B 3MV7E 4ZTOH 5J6HA 1KFAL 1I9RH 3W2DH 2H8PA 4LF3B 1F90L 3UTZA 3I50H 4XZUA 2ZUSA 3F5WB 5KW9L 2C26A 1U3HD 1M7IA 5BV7B 2EDXA 2E7LC 4KMQA 2HLAA 4ELMF 5I1DB 4U1JA 4NQDE 3ARYA 2RIKA 3NN8B 4YGAB 1I3RA 4QY8A 3QG6B 5D2LE 1OGAA 4HC1H 2ESVB 1F97A 3S8WA 3PQYD 1SQ2N 3OL2A 1GGUA 5MI0B 1AIFA 2YN5A 4FQXD 3QUKA 2G2RB 1BQHB 3D6GA 1TJHL 4IRJA 2OBGA 3MYJB 5GZNC 3AREC 4YH6A 2CUHA 1AHWA 3MRPA 2BVQB 4PJIF 3P9LA 1U9KA 3QQ4B 4LGSB 2DB8A 1K3IA 3L3IB 3CFKB 4KDTC 1FV1A 4KRLB 2EDQA 3QNYB 3EJZC 3WN5B 3O6FC 3ZYOA 3H9HB 3IXAB 4N5EC 2R56L 5KG9A 1WIPA 5HI4D 1BOGA 3KPQB 4M8QA 4YHMH 3FN9A 1Q9KA 1A9BB 1DQJB 2P24A 3DROB 2QSCL 3S4SB 3INUH 4AEHL 4KKBD 3B6SA 2ZUWA 5BV7L 1J8HE 1JPFB 1HZHH 3FQXA 4NN6B 4EEEA 3SDYL 3ALXA 5MEQA 4PJEA 4XNMB 4LP4A 2D03H 2APVA 1BZ9A 3BEWB 1KG0B 4LSPH 3KPOB 3PDGA 4UT7H 4HUNB 1NANH 5EA0H 3GMNB 1RZFH 4HX1A 3VD7A 3IXTB 1U91A 2FX9H 1Y18A 1K3ZA 5BXFA 5JOFA 3O45B 3LS4L 4HGMA 3WO4C 5IIEB 5DVOA 4NN6C 3AS0A 4E5XB 5DT1L 2FD6L 3G9AB 1G7JB 1LEIA 3O41A 2VUOA 4G9FA 1W2KT 3IFPB 1AGBB 4QRPA 1S9KC 4JRXA 4HIEB 1ZMYA 4NRXB 1MCSA 1I7UA 4LSRH 4X6CE 4RX4D 3WIFA 2FSEA 2R2BB 4RFNC 1JYVA 2Q86A 2FATH 2OL3H 1MI5A 1EFXB 4RAVB 3OKDB 4OFDA 2R4RH 3VRJB 1RHFA 2VDPH 5C7XL 4MNQE 5HHQA 1I8IB 1IVLA 1QD0A 3ZKNC 4PRPD 1KENH 3UTZB 2EYSB 4P9HH 1K8IB 1G7IB 4WI4A 2C4XA 4EI5A 1FSKB 3P9LB 2UYLB 2H26B 5SWZE 5L0QB 2LU4A 4QRRD 1AQDA 1CXEA 5IB3A 2HTKD 1QFWL 3G5XA 3NMEA 2CO6B 2VN4A 4JFXB 3TYFA 3T0ED 1AO7D 3W0WB 2YD6A 3DO3A 5DQ9B 5CJXA 2OJEB 4P46C 3MRPB 5ETUB 2Q7YA 5INDB 4ODHL 4NM8H 2QTEA 4DUVA 4UQ3B 5I17B 3RBSA 4IMLA 3BH9A 3MODH 4OFKA 1H3UA 1RZFL 4Y4KC 5GSVA 1AQKH 1A3RH 1T7WA 3G5ZB 4L4TD 4APQB 2AQ2A 2E9BA 1LWRA 4AIXA 1NANI 3L7EB 5IBLC 3L5WB 1ZGLA 1CDCA 1AFVH 3MGTB 4OLUL 3AGVA 4PLKD 1M05B 5BZDA 1XF1A 2D4FA 3DV4B 1EEZA 3SEPA 5J1AB 1FV1B 1OPGL 1PKQA 1LO5A 1NUFA 1FZKB 2CLRB 2X4NA 5DJAA 1SEQL 2ADGA 4LAQH 1NMBH 2DQUH 4UOW1 2A6JA 4OLYH 5F9DC 3CC5A 5D93C 2HMIC 2R9HD 1A1NB 1R5VA 4QF1B 4RBPK 5F1NB 5IVNA 1ORSA 4QXUH 3DURB 5EZOH 1K6QL 5IHZA 1ZVSB 4HXAH 5D1XC 2VXSL 2IEPA 2PETA 4L3ED 4ZQKB 1Q8MA 4YNYB 4KXZH 3HZYB 1JFQL 3S6CA 3DX7B 4N90E 3OKYA 3UXFA 5I1HH 5GRJH 1JGUH 2RR3A 4HJGA 3RZCA 2NX5A 4NJ9L 1E27B 4P59H 2P8LB 2X9XA 2Z31B 4NHCH 4QRPD 3D3VD 4ZUVA 4J3UA 2AK4D 3VI3E 1ZOXA 3PQYB 4PJ9D 2OI9C 1OP5K 2V7NB 3T0XA 4HV8B 1FG9C 5DJYA 1CWVA 3ZT7A 2Y25A 4JFXA 4Q2ZB 2YBRB 3S37X 4GS7C 5ECJE 5ACMA 3GMOB 3PG2A 1CIDA 5T1KD 3QHFL 1F5WA 4FFVD 4RRPA 4XPGH 1I9RL 3KNBB 2H26A 3VFOA 5FO8B 1IT9H 3T2NL 4TOYL 2ZNXA 4R7DB 1OVZA 2ZCKL 3BQUB 3OGOE 1SEBA 3Q6FA 2YSSA 3TM6A 4LSVL 1ACYL 4XWGL 3MRDA 2XZCH 2UWEB 3LN4B 4FN0A 3NA9L 1EAPA 1YMHA 3TLRA 3VXSE 1S3KH 3VMNA 1C5DA 3SKJL 3GRWH 1E4KC 1K85A 5IG7B 1NQBA 5HDQH 4JO4L 3OZ9H 1OCWL 2DQHH 1YEKL 3MMEA 1ZWIA 3P0YH 9CGTA 2ZOLB 5E99H 5TDPA 3CVHL 5DJDB 3T0AA 2VLKD 4OLVL 1S7XB 3QUXD 5E08L 1KPVA 1ZXQA 3DMMA 1G0YR 4AQ1B 3DX7A 3MRRB 1F4AA 5TE7H 5F70A 2ZSVA 2XTJE 1KJ3H 4YXKH 4Y5XA 4M1GH 4QHUB 1F2XK 1RJZB 3NZHH 3RIFK 1T21A 4BZYA 5C92A 3BDYH 3BZDA 1QBMH 2Q8BL 2YXMA 3LPFA 4NN7C 1PD6A 3BT2H 1OAZL 1Q9WA 4LPCA 4MAYB 3UYRH 3EBAA 4XGZA 5DS8A 4DN4H 3OJDA 1GHFL 5F96H 2PW2A 3ZE2F 4NKMB 4PG9A 4CGTA 4KPHH 4C4KO 2ZZUT 1G7MB 2VNCA 4U7SA 4Y89A 4N0CC 4JZOB 5DRNB 5IEHA 2FECL 2VLMD 1INEH 2V2XB 4MCYB 1LDPL 3WHXB 1GXEA 2D3VA 1IJ9A 4HWEL 4KRMB 1KT2A 4M7KL 1NBQA 4JHZA 1KXVC 4OIIL 3DNKA 5LGHH 5ABDE 1DUYB 1IC5L 4JFPA 3PWUB 3GB7B 3RWDB 3BP4A 4X7FC 4U1KB 3GGWA 3RIFF 2V17H 5IW6A 1CFNB 1KC5H 3KPLB 4NQXB 5JNYA 5L6YH 1VGKA 2R1XB 3CVHH 4XC1H 5TE4H 5MEOA 1NLBH 1CR9L 1Z3GH 1T2JA 2LABA 2VXUH 3HUJB 4OZFA 1RY7B 3MLXH 2X1XR 1EX0A 3JBG7 5IJKC 1V3MA 5DJDA 5DJCB 4N9GA 4YAQA 4NZRH 2P5EB 1GGBL 4JREC 4JY6B 5EB9A 3UPAA 1WGOA 1PYWA 3MRDB 1CDJA 5EZJA 5HPMB 3VXSA 2V5YA 25C8H 1OTUD 5HGAB 1CU4L 5IG7A 3CDFA 5D72L 3T3ME 3UYRL 3NVQA 1VKXB 1MNUL 3TT1L 1Z2KA 3RAJL 4LU5H 5K33A 2YC1B 1EHXA 3B4NA 3SO5A 4L8BA 2APWA 4FG6C 2JJTC 4M6OL 1JWUB 4HIXH 2BNRE 3W5NA 4AT6B 3MCLH 4J23A 3MXWH 3MCKB 1MFDL 4FABH 2F5BH 1KYOK 1QSEE 4O5LL 2AXHA 2IBBA 5JW5B 1GGIH 5FYJL 4G8GE 1JZ6A 1BD2D 5HYSB 2IGFL 2YRPA 3U0TB 3SY0A 3E0GA 3QHTC 1N7MH 4JLRA 5HHPA 2ZUXA 5IV2A 5JW3H 4XPHH 4Y1AB 2GI7A 2VAJA 4RA0C 2IBZX 2YHGA 4YXLL 1Z9SA 2UUDK 3BYTA 1NEZB 5GS1A 1M1SA 2E6PA 3TO2B 3HPLA 1FBIL 2MHAA 3QSKB 1CXHA 1NC2B 4YPGA 3FO2A 3QDME 1D5ZA 3QI9B 4NQSB 2ZCLL 3VXUD 3PXJA 3IAQA 1FRGL 1KEGH 5E9DE 5F3HA 4G7VH 3HUJA 1OGTA 1QHPA 1L7TH 4CNIB 3QEQE 4LCYB 2FZ3A 2BRRL 1P7HL 4OLYL 4WDIB 3L3HB 1KT2B 2BY0A 2W0KA 3BVNA 5HYQB 4WRLA 2QHLA 3LKPB 4DK6A 2BMKA 1CU4H 4NT6A 3BW9A 4MJID 4KWUA 4UBDD 2ARJQ 4L29A 5DJ2B 3I6KA 4XP5L 1JI2A 1U6AL 2E27H 3OHXB 1TJHH 4KMTH 2DS4A 3SN6N 1JWSA 4K9EH 1S7QB 5KJRH 1A7OH 1J88A 2FR4A 4GW1A 5FM4A 5E8DH 3V4VL 1X5YA 2VH5H 2VLKE 1NCNA 4O2CB 3S88H 4YEEA 4I5BA 1I8MB 1A1MB 2CK0H 1WFOA 1RQ5A 2EZ0D 5B21A 4OFYA 1OWWA 3GI8L 1RJLA 1S9WB 4EQ2A 2DLIA 1XZ0A 4L9LC 4XH2A 3EYFA 5IVXE 4AQOA 3BXNB 4KJYB 5FCUH 3QUXB 4LKXA 3T65A 1F3JB 3EFFB 1G7HB 2EDEA 1OAYL 2P49B 3QUZD 3MNWB 4W4OC 3PL6C 4HIEA 4V1DA 1FBIH 4NKDB 3LB6C 5GSRB 1L4IA 3GZKA 2A2QT 4PJDB 1FVEB 3RWIA 5CJXC 3FQTA 3LRSA 3PGDB 3L3OA 4P2CG 3UYPA 2BCKB 2EDTA 3TBSB 2OLDA 3ULSB 5HGAA 1G7LB 2K9UA 1FFOA 1A47A 3NFSH 2H32B 3MREB 3KXFB 3FB7A 3O3AA 2YN3A 2DMKA 4JO4H 2A9NL 1XIWA 2F5AH 2AS5M 2NTSP 4PJFF 2R0KH 4M4PA 1HYRC 4JM2A 4OZIE 3GSNA 4PJIA 1MRDH 2N4IA 3SDCD 3MRGA 1J0KA 3LEYL 1KJ2B 5ID1B 5DQ9A 3CZJA 1K8IA 4OZ4A 1JGDA 4PLKC 1YDPB 4EI5C 4UB0L 3EJYC 1T83C 3VFUA 2IC2A 3C6LD 3LKNA 3QUMB 5FO7B 3W11D 1UJ3C 1DDHA 5ESVA 3HRZB 3HUJE 2NY0B 3TBVB 4L4VD 5H35A 4M7LT 1HEZA 3FFCE 2W1NA 4PLNC 1KENL 3BP6B 1TJIH 2A6KA 4WI2A 2HJLA 4KXZI 1WFNA 5KN5A 4HQQH 4WI7A 4H1LB 1D9KD 2QR0A 4ODWB 4GKNA 3TZVC 1WBYB 2PCPA 3DHMA 3MR9B 1T3FB 5TQ0L 4AG4L 1OSPL 2EDDA 1AKJB 1NMAL 3O2DH 3RPIB 2WMPA 3VJ6A 4Z0BL 1FL3A 3LAFA 3VGAB 1MCKA 4HBCL 4RFNB 5FGBA 5T1LD 4NYLA 1INDL 1L0QA 4BQ6A 2XN9E 1W8OA 2P8MB 3IJYB 4FQ2H 2VUYA 3QCUH 1VGEH 5C9JB 5JW4N 1HSBB 1P4BH 2ARJB 2W0LA 3IS1X 2C3XA 1GC1L 4JPIB 5J1AA 5BW7C 4KJQD 5FDYA 3HE6C 4GFTB 3BHBA 1SVCP 3JTTB 5E7BA 5GSRA 3WNPA 3D69A 1AO7E 3IVKB 4ENEC 1KCVH 5CHNB 4UV4H 4MJIE 2NYYC 1YDPA 2R29L 4X6CB 1IRAY 4NZRL 1GGBH 2EO9A 4X8XA 2DQGH 1EMTL 1OB1B 5F3HB 5EZOL 3QG7L 1YMHB 1T5XB 1BFVH 4N8CL 2DLFH 3E3QC 4CJ0A 4I0KA 2ZKHH 1F4HA 5CZVL 1MRCL 2Z92B 1S5HB 4O2EB 3MLTB 4YJZL 3BPNB 4LL9A 1CK0H 4OB5H 4K7PH 3GBML 3QNYA 5JHLH 4KZDL 3VFOB 4JANA 4GMSH 3TBSA 2V6HA 3TVMD 2QQLH 3QCTH 4U6XB 1QRND 3UJTL 2IG2L 3IFOA 5BS0A 3EO0B 4XBGB 3MOQA 5C9JA 4YFLI 1A6PA 1HI6A 5I2IB 3T77A 4LNRB 3LKOB 3QDJB 5JZ7C 2YPLA 4ETYA 2CLVB 4HSQA 3K7UA 3VFPA 3DVFA 3RHWF 3D69B 5CWSA 3ARXA 1NFDB 4HF5H 1KCUL 2Z0BA 3MLVH 1DVFB 1G9NC 2A73B 2L0DA 3BKCH 2FJGB 4JRXD 2VXTL 1JCKA 3QDGE 5F7EH 3CFEA 4HWBA 1NCDL 2X1QA 1KXQE 4XBEH 3PDOA 3NIDE 4K9EC 2VE6A 5MEPB 1LQSR 4LQ1A 1DQDL 1G7JA 4JY5L 4QGYA 3SGJC 1AH1A 3DSFL 4ZUWA 3C60C 4LHUA 1FNHA 4JO3H 5ICXA 4ODWA 4ISVB 1JF6A 2ZKHL 3O45A 2V7HA 4MB3A 1CFBA 3QQNA 1KNOA 1TVHB 4MAYC 1NL0H 1YNLL 2FRGP 4M43L 1E6OL 2OQJB 3ESUF 2GJZA 4OLVH 2GJ6A 1D5XB 1U8KA 3I75A 4UU9B 2XNAA 3SE9H 3ZL4L 5C0DB 1FFNA 4OGAD 2ITDA 4Y1AD 1OP3H 4MVBD 5I76B 2DBLH 2MCG1 3FQUB 3DV6A 3O3DB 2R1WB 3VFVA 1N4XH 4HCRH 3MXVL 4Z7UE 2QHRL 5I8KL 5DYOB 4FP8L 3HPJB 4BFBD 5F3BB 1WFUA 4W81A 3MRMA 4U1IA 1TVBA 4LSSL 1MLBA 2R1XA 4L9DA 3KPQA 2OTWB 2OZ4H 4LEOA 5D1ZA 2CLZA 1YNTA 1I1RA 4NQED 4HC1A 1FVDA 2IBGA 4WHTA 2R2HA 5ITFB 3S35L 2VXTH 4NQXA 5T3XE 1YJDH 1RMFH 2A9MH 1IGIH 4Y4FC 1T4KA 2WINB 4K7FB 3G6JF 1CVRA 3VFRB 5I6XC 4KVCH 4R3SB 1N6VA 1NSNH 1EZVX 2V17L 3ZKND 2F5AL 4NQCE 2P44B 1J8HA 1RK0B 4ZMAT 2NY1B 4WWKC 3MV7A 4XC1L 5TE4L 4U0RB 5DRZB 1IAKA 3QAZB 4OZHB 1LEIB 4WU5B 3L95B 2Y36L 4MJ4A 5F21B 2VXVL 3NAAL 1Q0XL 2ICWJ 4QOKE 4QTIH 4PRNA 2DIAA 4PJ9A 3D87B 1WCQA 4ORZC 4XI5C 3KPRA 3O2DA 4RA3A 5HGBB 1KPRA 4EXKA 3RL2A 2DBJA 4JJHA 5DRWB 4WCYH 4JHAH 2PN5A 5MHSE 1ZLVH 1BM3L 4Z7UB 5F7KC 3CCHA 1LILA 3TO2A 5LQBH 3P30H 1MREL 1AP2A 3MJ7B 5HHPB 5IV2B 4TSCH 3HC3H 1NGQH 4IDLA 3T0DA 5CJ8A 3LZFH 3QEGL 1CVSC 3L5XL 3CLFH 5B8CA 5BS0E 4PJGA 5D5MB 2YA0A 3U2SB 1KN4H 3GMOA 4EXPX 2FR4B 5EWIL 5MERA 2Q20A 1FLRL 4PGDA 5CEZD 3VH8A 3V9FA 4G7VL 2OL3L 4QRRA 1A6ZA 4JDZB 4NNYA 5T5NF 1KTRL 4CW1B 3F8UB 1UKSA 5C8JA 1DQTA 1NCWH 4JFEE 2C7UB 4IM8A 1JE6A 3U30C 3I9GL 4S0SD 2KDGA 4PRHD 1U8LB 4I18A 1DUZB 5DO2D 4JFYB 4GAGH 1YA5A 2CD0A 4LSUH 3HI1B 3UO1L 1JJUA 2IANA 5TH2B 4WJ5B 3OKEA 1LK2B 5JPNA 3VXOB 1LMKA 5FA4A 4ZPTB 1UM4L 1DTUA 4FZEH 3MFFB 3MRQB 3QJHB 4TSAL 3L95A 2WZPD 4OZFG 1G1YA 5FDWA 1T7XA 1MCQA 4JN1H 1RI8A 1H5BB 1CDGA 5IF0B 3TJHD 1NMCC 1GC1C 1MHEA 2OS7A 3CLFL 1HXYB 3P77A 4FXGA 5C0AB 3SKNA 2BC4A 3G5YA 2QSQA 2VDNH 4MYWB 3BP4B 4KTYA 5DD5L 4P2OA 2FWOA 4JDTL 3NGBB 3X3GL 1JPSH 1X5AA 1S5IL 4I48B 4ZS7L 1VGKB 4H1LH 1F58H 1NGZB 1KIQB 1SVZA 5C71A 1GAFH 4EQ3A 4ZS6C 3O2VH 1ZA6A 3GIZL 3PHSA 5IROA 2BX5A 3ARTA 5K9QG 3HA0A 4JFOB 1BJ1J 2P8MA 5GJTL 5HYJE 4NFBA 3MRFB 2WWMD 4H1LG 3JTSB 1DE4B 3Q6GL 4M7JH 1I1AB 3OAYK 5GGQH 3IU4H 3ARBB 3AFLA 3F12B 3QHFH 1KJ2H 3VXOA 3OKMB 3V6FB 3O6LH 2XA3A 4NUJB 3L3JA 2VDLH 1YEDB 2FH8A 2VR4A 4XPBL 5F1IA 3QT2A 1VFMA 3MV7B 3UZVB 1I4FB 1A7RL 2ADJA 5FKPB 2XZCL 7FABH 1MCHA 4P3DA 2HFTA 4HIHA 3WYRA 2UUDH 3BP6A 4O51B 4WFGE 3VA2C 3U7WH 1E4WL 4QRTA 4Z95L 1Y6NR 5BJTB 5CEZH 3Q1SL 3RVUC 3BUTA 3CFJA 3B3IA 1QSED 1TPXB 4LPUA 1J7VR 3ARUA 4G6JH 1DVFD 3C2AL 5F7NC 1ULVA 2VAAA 4WENB 2R2EA 4Z7QE 4IRSB 4LASH 3T0EB 4W6XB 3NCYS 5E6IB 2UZIL 5IIEA 1EXUA 4PJBB 2YKLH 1EHLL 5DJ8A 1KELH 1YEFH 2YD5A 1NUGA 2XFXB 2DQFB 2XKSA 4K2UL 4F8TA 5E7FA 5A2LH 5DUBB 3IFOB 1MLCB 5I1LB 3O0RL 1LDSA 4FQ1H 3H0TA 4KTEH 1MHPH 2YA2A 1QPPA 2YPVH 2XWJB 3GRWL 4Q6IC 2CDFB 2HT4D 3UJIL 2VOTA 3LDBB 2L7UA 1BVKA 4I48A 5HI5C 3P0YL 1GHFH 3SJVD 3CVHA 2LAAA 2NZ9C 5D71H 1R24A 3MRLB 1CI5A 2P47B 3BGMB 4F80A 4K7PX 4NP4H 5F7WC 3TF7C 3RWFB 4XPBH 3L1OH 5C0CD 2VABB 5CEYB 1X5GA 1SBBA 5C0RL 2FSEB 4MB4A 1A9EB 4WV1A 3HLAA 3CUPA 3GUTB 3QDJD 4Q6IB 3N85H 4JHWL 4RGNC 4N0YH 5IBUG 4NQCA 1NFKA 2ZSWB 4P2QD 4G6JL 5CZVH 1BQUA 4MNHA 4B50A 2Y72A 2K3TA 4IDJH 4ZUUA 4KAQH 4NQVA 3MUY1 4Q0XL 3RL1A 1OQXA 4G43A 1NCCL 1KTLB 5E2UH 1YEEH 3CVIH 3MGTA 4JB9L 2NY5L 4F33A 4J7RA 1F4WL 2RQ8A 3DTXB 4FNLH 5I0DA 3SHSA 4E41B 4V2BA 4BELD 3MJ9A 4FQCH 5FXCH 3S36L 3F6LA 2VLKB 4RGOL 3HAEH 1W0VA 5HD8C 3CC5B 4TUKH 1OSZA 4TVPL 5T3ZD 3U46B 4MDJA 4EBQH 3QDJA 4OM0H 3PIQB 1GJIA 4Y4HC 4MLIA 3TP4A 1LO3L 1ZT4B 1KGCE 1X5HA 2J88L 4R7NA 5E5UB 3L5WA 1ZGLB 1MCOL 3B9KB 5CSZA 4PRDA 4OTXH 5DMKB 4R6UA 1TQBB 3BZ4B 3JWDC 2XQYK 3CXHK 2JTDA 3RNKB 3EYOB 1T2QL 3MLRH 3MRCB 2VITA 4FQPA 1QA9A 4DZBA 4L1HA 2DQDH 2Z31C 3VFUB 4UT7L 3UBXA 2NNAB 3E6FB 3MLSL 1DL7H 4E0RB 2X4UB 4JO1L 5D5ME 2FEDD 1ZLSH 5IHLB 4Y4HB 5JW5A 4NKIH 4XP6L 3T0EA 4R8WL 2OZ4A 3FQUA 1K4DB 3O3DA 2EECA 3WUWA 3BGMA 1TFHA 1AXIB 3OAYH 4ZOEA 3UTQA 3R06B 3HG1E 1F8TH 3UP1A 2FD6H 1TQBC 4WI9A 5IK3B 2IAMB 3NZ8B 2NY3C 3CVHB 4UTBL 5GGSB 3ZE1E 5GGVL 2QR0B 1P9MC 3GSNL 3TBVA 1HOCA 2OQJA 2D7OA 1WUNT 1QBLH 1BGXL 5I1GH 2EICA 5C08A 4XT1C 2A6KB 3CXDH 2OK0L 5D70H 4L9LB 4MQXD 2R15A 4MNHB 2E8ZA 3DTXA 5KVFH 1UWGL 3RQ3A 2R8SL 1WBYA 2PCPB 4Y4KA 1U41A 5I8CA 2AEPL 5D7IF 5EBGA 1D9KA 1QFOA 3RPIA 1U6AH 3ARRA 5C0EA 1L7IH 3GMQB 4PRAA 4ZS6D 1AR1D 3U7AA 5EU6A 5IT2H 4YBLB 4GKNB 2BVUA 4LSQH 3H9SB 3FOMB 4ZS7H 4LCWE 3NOIA 1NBZA 3LRGA 1J1PL 5E6IA 2ZUQC 3STZB 2BSRA 5DZOA 3KPOA 1JTTA 4PJ7E 2FBJH 4O2CA 3VFWA 1FVEA 1QEWA 3CFDA 3PWPA 3IXTA 5SWZA 3VFNB 5D1XB 3RPKA 4P2RE 2VZSA 2XWTA 5KS9F 3X3FH 5GGSA 1E6JL 3FQWB 5CCKH 4OUUB 3Q5TA 2GIYA 1VA9A 3GMLA 4X80L 4U1LB 2BNUB 4QKXB 4QRPB 5C08B 1I1AD 1FPTL 1DFBL 4GW5A 4R97C 1EEYA 3QCVH 1FCCA 1R5WA 1JK8A 5ID0B 5ID1A 1J5OL 2VH5L 2ICWB 2WUBH 2VZ3A 1Q0XH 4QTIL 5IB5B 1FC2D 1UFUA 1EK3A 3FFDB 1S7TB 4CU6A 5D4QA 3QIWD 2R8SH 3F58H 2ESVA 4Y5XB 3IXAA 1ROWA 1IARB 4LOUC 1I85A 3BYYA 3A6BH 4PRDB 4HXAL 1N8ZB 2H1PH 1IAII 3DI3B 1CLYH 4PJFE 2V5MA 3D3VA 1X4YA 1MFBH 4NKMA 4JFDE 5J9PA 2R9HC 3G04A 3WEXA 3WV0A 1MJ8H 5DQJA 3QG6A 4WUKL 3P4OA 5HYJB 4JG0H 1LP9B 5FYKE 5C08E 1SJHB 2Z8VC 5CJOL 2O93L 2XT1B 3B83A 4WHYG 4N0FA 3L5XH 4K23L 1U8QB 5HDBE 3T1WA 2FX8H 2DDQH 3MO1A 4WU7A 5D5MA 5D1QB 3ROLA 2ZJSL 4CN4A 4M8VA 5CBAB 3QUYD 5CMAB 3W82A 5HHOE 1B0WA 1A22B 3MR9A 3X12A 5F7FA 3S3PA 3TESA 5EA0L 2DLTA 3WD5L 2DQTL 4L4TA 2PXYB 1BIIA 2FZ3B 5FKAB 1RIHH 2OXHA 1GOGA 1U95A 2FIRT 4XCFL 4D9RE 4PD4K 12E8H 2OJZL 4RIRA 3MLZH 4J3OC 5I16A 4ZFOL 4EVNB 4JLRB 4GAGL 5KANG 3GJFK 4G5ZH 2FHCA 3SKNB 3RNQA 3LOWA 2YEZB 5I75B 1KIPA 4WUKH 4PJXA 2P1YA 1F00I 2IMNA 1HHKB 5GQBA 4X5XA 4YXKL 1H8NA 1V7NH 4FQCL 2I5YL 4MMXC 1IFHH 4OV5A 4FQ2L 2GJ6E 4NRYA 4K23H 3EOBA 2DLEA 3A6CL 4NQEE 4RGNB 5KVEL 2HFGL 1U36A 1PZ5A 5D6DC 4L4VB 2WLYA 4GW4B 4Q9RL 1S5IH 1PFCA 3FCTA 1MCOH 3VE0B 3EW3B 2A0LD 4UINL 3VXSD 3NCMA 3WIIL 1VB9A 1F6FB 3QAZC 1S9VB 2V9TA 5DWUL 1IQWL 1P5VA 2DQJL 2VSCA 1YEGL 4PPTA 3FFDA 4M6ML 3OXRB 2BHYA 4LLUB 4OD1L 4J4PD 1F6AB 4KKAC 2E9IA 1QSFD 3VH8G 3UTTE 3V6FA 4JFOA 3DYPA 2RJMA 1P4IH 2EDRA 4U1HA 1J12A 3E2HB 2R2EB 3NIFE 1RK0A 4OB5L 5DLML 3RVXD 5D2NE 4HG4J 2GKIA 2A38A 5BZDB 1I1FB 2P8PA 2B2XH 4CMMA 4IRZL 5IMOB 1JRHI 4WHYH 4YDKL 5CD5C 1NBVH 5HBBA 1CTNA 3V6ZB 4YE4H 2B8OT 3QB7C 4TVPE 1NCBH 4RGMB 4TRPH 4ALAL 3QUZA 1FL6A 2OI9B 4LLDA 1YC7A 3IDYB 1R5WB 3QUZC 5INCB 5F9JA 3HMXA 1WICA 4NQDB 5F7DA 1CZ8H 4CVZB 4QHMB 4XB7A 5CZXD 1S7WB 3M17B 3RAJH 4BFGA 4F9LA 1L7IL 3BKYH 5JIHA 2Y7QB 3MRMB 4PJ7A 5HDLA 5C0CB 2IADA 4F7TB 5DD3H 1R0AL 1VACA 3KXFA 3MREA 2BVTA 2CLZB 1NCDH 3VFTA 1E27A 1FNSL 4HZAA 4KJPD 4UNTA 5GRYA 3SDAD 3DUSA 4M00A 4NRZA 1GCFA 3PGDA 1PZ5B 4XHJD 4R0LC 2AV1A 3WJJC 2F19H 2JK5B 4P2QB 2IQAA 3VRIA 1B6DA 3LV3B 1P5UA 5B38A 2F53D 4F9PA 1BPVA 5DD0L 1ADQL 1CF8L 1CL7H 5FB8A 2DKUA 1S9VA 1E28B 1SM3H 4YWGL 4CKVX 3H7BA 2CDGB 4PJXB 4GW4A 4MWFA 3X13B 1KIRA 4XRCB 1U93A 2DI7A 3P9MA 2VDML 4PGDB 4QEGA 2GITB 3PV7A 1FN4B 2NY4D 3LHPL 5F9JB 2NXYD 4OZIF 3T09A 1BBDH 1MSPA 1FGNH 2Q6WA 4ERSL 1UM6L 1KBGH 1KJMA 3QUZB 4HLJA 1F4YH 4KI5E 4Z76A 2QHRH 4FTVD 1LO0H 3AB0C 1NSNL 2WSKA 3D18B 4YFEA 5DJXA 5CSZB 5J1SC 3BKML 2OR7A 4K8RC 5E1AA 1TZIB 4I3GA 4R7NB 5IUSA 1SJEB 3SDXB 5HPOA 5E08H 5IB1A 5T3ZL 3ZTNL 2ATPB 2YD3A 4CVUA 3D1MC 1TZGH 2BNRA 5TJWK 2IF7A 3KLHC 4HWZA 5I8EA 3S36H 3F62A 1T83A 3TO4C 4WW1A 4QRSB 4R2GD 4Z18A 3RTQC 1VDGA 4C83B 3GJFH 3O6FD 3WDHA 3GKWL 5IFHH 5BQ7B 3LKOA 2MCPL 1U3YA 5DD0H 2PTTB 3S5LB 4S1DC 2UWEF 3C5SA 4W6WB 5EH1A 3OXSB 5ADOL 3LQAH 2DDQL 1C16B 3WFBL 2Z92A 4C56A 3FOLB 3CSGA 4XCEA 1FLTX 1ZKAA 3U0PB 1VACB 1CICC 3ARGC 4LFHD 5GGUA 5JHDD 2G5BA 4NQCD 1OF2A 2EXYD 3S9DB 4MD0A 1BF8A 2BDNH 4QLRA 1EO5A 4EUPB 3MLSH 2CR3A 2F53B 3FRPA 3SKOA 1S9XB 1I3GL 1LO0L 4JN2A 5I8CB 3O4LB 2M2DA 5GGVY 4CN6A 5L6YL 2YD7A 3GM8A 3LS5H 1CFQA 1A4JB 4YX2L 3RWHB 3FT4A 4PJ5D 2WANA 1C12B 4NZJA 2X6MA 4NO0D 5AWNL 3S3JA 3AS3A 4JZNA 4A6YA 5HYSG 2I9TB 1KCSL 3FQNB 4QRSA 1V5JA 2P5EA 4TSCL 3K80A 2M8XA 1AO7A 4WNQB 1TJGL 5BOZG 1DQML 1WF5A 3NCJL 2DN7A 3RTQB 2CRIA 2PXYC 1B4RA 4OF6A 5F72S 4Y16D 1DBML 1EFQA 3GSWB 4PP1D 1C5BH 5MHSD 1OP5H 4CDGC 1C08A 2IQ9H 1D9KB 4U1IB 1YYLH 1BBJB 4F3FB 1EAJA 4YDJA 3HNTH 4UNVA 1FFPB 2WWKO 5IKCA 1EHNA 5FA3B 1FZOA 4GRWB 4URTB 4HK0B 3QDMA 2FBJL 1UKQA 4G42A 4X9IA 5FCSH 1GGIL 4Z76B 4YHYB 3RZCC 5DHYB 3WFZA 4C55A 2NW2A 3GKZA 3VFWB 4EIGB 4NGHH 4MXWL 3GMLB 5E2TL 5C0ND 1PY4A 3FO1A 1A6AB 2VDNL 4HS6B 3HS0B 4FQJL 2AJYH 3CX5K 4OGYL 3H9ZA 2ZOLA 5JPMA 2Y6SD 2W9LA 3M8OH 3WN5C 1N8ZA 3FAXA 1F11A 1E28A 4R2GC 2G75B 3SOBL 3PWPD 4PLJD 2B2XL 2GJ6B 3HHRB 3SE8H 5TPWL 2E7BA 2MOVA 2CRYA 3LN4A 4UBDC 1UYWH 5DD6B 4XCCH 2DJ4A 5E6ZA 3CFBB 4WI6A 1WIUA 3IF1B 4PGCB 1L0YA 2LVCA 1DBAH 2D0FA 3JV4B 5B4MD 2XPGB 4WI8A 2A77H 1YECL 3QIWB 5HJ3B 3O4LA 2H1PL 5D2NA 1I1CA 4HWBH 2E7HA 4RIRB 4ZFGH 4WGVB 4HULB 5KVDH 1IAOA 2NX5D 2J5LB 3E2HC 2HFEB 5HYFA 4JO2L 2AW2A 1G0XA 3CDGA 4ZG1A 4M93B 3NCCB 5GGTH 1INQB 4JG0L 4NBYB 3MRJA 4DCQB 1VERA 4FQLL 1TTUA 4OCRH 2NYYD 5SWSE 4IHOB 4NSKA 3HMXL 5C6TH 3CSYA 1I3RB 2D2OA 4QY8B 5FCUL 4KK6C 5FHBH 1RJLB 1S9WA 3U9PL 4IRJD 4HUUB 1QFWM 3MNZB 1BHGA 1S7QA 4Q7DA 4FQJH 2AJYL 4LPVA 2PYFA 4X6EA 3RGVD 5ESQB 3OAUH 5ISZA 4R2GB 3HZKB 3MA7A 3PHQA 5I1EL 4XWOD 3X12B 2P7TA 3KYKL 2P48B 4KJPC 1CCZA 4X6CA 3O0RH 2FHFA 3L3OB 4XMLH 5DHXB 4KJYA 5J06A 4ERSH 4X9BA 5A3IC 1JNNH 2IBZY 2XZQL 4YFLF 5IBLD 1J1OL 1CLOL 3WNLA 5B3JF 1MCDA 4R96B 5DRXA 4ZNEE 5E6YA 1HOCB 3HB3D 4NKDA 5GS1C 1M05A 5D71L 1UM5L 2F53A 4X7DC 2X4RA 4IRSD 1XF2A 3NZ8A 3HCVA 1E6OH 1G6RB 2YUVA 4I2XA 5I1DA 1JFQH 2DICA 5D7IA 3U0WL 3CSPA 4G42B 2IH1B 2GSGA 5BRZA 1H15A 1KELL 2VZTA 2WQ8A 5CKAA 3OG6B 4XNUL 5DJCA 3NIGF 1BJ1H 5IEKB 4NRYB 3ZO0A 1KTLA 2IAMD 5FO7A 2X05A 3ULUH 1DEDA 1YEHL 2F54E 4PY8J 4C56D 3LVEA 1PKOA 3KPRD 4WV1C 5A3ID 4HCRL 1YMMD 5A2KH 1FE8L 1RVFL 2DD8H 4HX1B 3RA7H 4F9PC 4XNZB 2XPGA 3RWDA 2VKWA 3PWVA 2HT3D 2QSVA 4UIMA 3EDDA 3U2SA 2FEEL 1D5IL 2DKSA 3ZE0F 5BZWB 1ZT4A 5DWUH 1NC2A 4YPGB 1QSVA 2NY7H 2DTML 3Q0HA 4YFDB 4TUOB 3SBWC 1TZHA 3U7YH 4HMCA 2X2YA 4U6TA 4JJ5A 1IGCH 4MJ6B 5E4IA 3MRJB 5KS9E 1EFXA 4RAVA 3TIEA 4WFHD 3LB6D 1H0DB 1RZKL 3U0TA 4TVPH 1NMCB 3RIAF 3DJ9A 3VXSB 1GC1H 1HXYA 1QLFB 3FQRB 1IAOB 2XWTB 1YEIL 2J88H 1MF2H 1I85C 2PYEE 4AMKH 1NEZA 4OLWH 5GS1B 2APTA 1I1AA 4EDXA 1CGSL 2ESVE 1TQCC 5DJZA 1JZ8A 1S7WA 1AXSB 5HHNB 4WFFD 3P9WB 4YLQT 1HXMB 4GJTB 5GS0H 1V7MH 3VXMA 1LHZA 4HMEA 2HJFB 4XRCA 3K81A 4FNLL 4W70A 1JYNA 1I8MA 3RUGE 3AAZB 4B41A 1UXSB 3GM0A 4NWTL 2ED8A 4RFEA 2AK1H 4LQFH 1J9CT 3T77B 1RULH 1RZ8B 1W0WB 4GAJH 5GHWL 4Z7WA 3OHXA 2MWCA 3BN9C 5DR5L 3G5YB 3KPNA 2Q76A 3BKYL 3HI6L 4GMSL 3M17A 4JHAL 1CBVH 2HVKB 4Z7NF 2GW5A 1BGXH 4PJGE 4XHJC 1QR1A 5F1IB 3BUYA 3PWPE 1G6RH 2ATPA 4LVOB 4GBXA 2NCMA 1FZJA 5AUMA 1IKNA 1E4XL 2E6JA 3U36A 3OR6A 2XXMB 2PR4L 2W9EL 1JUFB 1ZA3A 1QYGL 2J6EL 4Y5VA 1U3ZA 3QXDB 1OW0A 4DW2L 1BF2A 5C9KA 2BERA 5KSUB 3MNWA 4YWGH 5EU6E 1F8TL 1KN4L 2GFBA 3PABA 3A67H 4NZTH 4MA8H 4U05A 4JY4B 5C0FB 1JHKL 4JZOA 2F8OA 1J87A 1XFPA 4OUUA 2J1KA 5E1AB 4X6DA 4QRQB 4TSBH 1JGVH 2B39A 5D9SB 3OKLA 3VXQA 2GY5A 1QSFE 5E8NB 1JTOA 4HIHB 1HSAB 3RDTB 3W81A 3ZTJH 3P4MA 1RUKH 1ZVSA 5EOTA 3OQ3B 4XMKH 3G6JA 2J6EA 3W0WE 1JF5A 1MCRA 1MCCA 2XZZA 4HEPG 3LQAC 1TZIA 2HH0L 2Z91B 3PWLA 2V2WA 5FO8A 4LCWA 4J4PC 1N26A 1UM4H 4HWNA 5TFSL 2VE6B 5E56A 4G9DA 3BP5B 1PLGH 3MXWL 4HD9A 1MCPL 3HR5B 5GGUB 1A4KB 1RJYA 5TE6L 3RDTC 4Z77A 2Y5TA 3KG5A 3KPSE 3T0BA 1GL4B 4HK3J 4NQTA 2Q8AH 1YPZF 1GYAA 2R23A 3D2UB 3UTPE 3ZHLA 3VWJD 2IALA 3QEHB 5SV4A 5C0IB 3BD3A 4RWHA 2F8VA 3S5LA 4X80H 1MFBL 5CD3B 2HP4A 2AJXH 3HLAB 3MO1B 1T6WA 1YMMB 5E95B 2NY2C 3QI9C 2AJSH 1CL7I 1ORSB 4MNQD 1FNEA 5IMOA 2H32H 3QZWG 4MX7A 5B39B 2D0HA 4WIQA 4HV8A 3BRGC 1FZJB 1UH2A 4FFWC 5AUMB 4XCNA 4N0RA 3INUL 1DLHA 4AEHH 2XY2A 3BQUD 1NFIB 1RD6A 1I9JH 1LK3H 3EYSH 5T1LA 1R3JA 1NDGB 1IGJA 1MJJB 3L7FB 5SX4I 5GS0C 4XMKL 5LKNA 3QXDA 1MAJA 4OSUL 3BEVB 3IFLL 1BECA 4GRWF 4ODXA 1QR1B 1OAKH 4NUGL 4F15B 4YHLH 1A4KA 1A8JH 3T4YB 4GRLB 1IKFL 4PBVC 3JWDH 5GGTA 4D8PB 2G75A 4B0MM 4XNYH 5D9SA 3CCHB 3ARDD 3K2UL 1CICB 2XTJC 2EYRB 4R0LB 2YXFA 5EDXA 3GI8H 3JWOL 2BNRD 2EXWD 4RBPH 2Y07L 4XCFH 1I9IL 2O5XH 2FGWL 3KJ4B 5JOEA 1WSST 1IAIH 3PE9A 2DAVA 4CBPA 1TLKA 1CXIA 4O02L 3BPLB 3V52H 3S35X 1R3KB 2V2TB 4KKCC 1Z0NA 3H42H 4Y2DA 2CDEA 1KOAA 1JP5A 5EFIA 1NFIA 1AP2B 3MJ7A 4JFQA 2AXJA 4LVHC 4P9HL 3L3GA 2X4PA 3JZ7A 4JHBA 3ZDXF 1LK3L 5A2IH 5IVXA 5AG9A 1LD9B 3D0VB 5ADPH 3CPLB 2XN9D 1ZEAH 3VWKD 1NGXB 2HFEA 1BZQK 1FLRH 3VXUB 5JDJA 1MOEA 3EKCA 2ZUTA 4AK1A 4L9LA 3QQ3A 1A7NH 2RB8A 2XA8L 4UB0H 4PJ9C 2VDQL 3WMSA 2AK4A 4P4KC 3UAJC 5GS0L 4Y4KB 4O2FB 3BDBA 2VQTA 3ELAT 1CGYA 3TA3C 2AJ3B 2R1WA 3GRWA 4EN3D 2AABH 5DTFA 1OL0A 4HKXA 3GO1L 5F88B 2PYEA 4Y0GA 5FGCB 3HE6B 5EO1B 4PJEB 3IJHB 4HUXB 1SYVA 1BQLL 2FO4B 4ELME 4OCXL 3VG9C 2GJZB 4AG4H 2X09A 4ODVL 1X5JA 4FZEL 4P4KB 1JHTA 5D93B 2B4CC 1NCBL 3G6DH 4PJDE 4LMQI 4NC0B 4S1SH 3MLWH 4M6MH 3TVMA 1HKFA 2NQCA 3GSVA 4WI3A 3BGFB 2X41A 4ZPVB 1U2HA 1OY3B 1JNJA 5B3JE 4Z7WE 3S34H 4X6DF 5DFVD 4ISVA 3RI5K 3LEXA 2NMSA 2X4TB 4ODSH 4PFEA 5KSAD 5CILH 4PJ5A 3TNNB 3VCLA 3WUZA 1F58L 4KJWC 5JO5A 1EUUA 3D3VB 4D9LH 1Q9LA 5ANMA 1R0AH 3WNOA 2WIIB 4PJXF 4RISL 3VWJB 1JGVL 2PW1B 3GMPA 4R4FH 4TUOA 2HKHL 4LVNC 1H3TA 1KPUB 5DRXB 2NY3D 3IDMA 5CJQH 2AP2A 1LP9F 2VQ1A 3AU1A 2R4SH 2J8UF 4P5TB 3LCYA 5MEQB 1X4XA 3A6OA 1GPOL 1WK0A 2XN9B 3BN3B 1UM5H 2FEDC 1HYSD 4TOYH 2Z8RA 2AI0H 1DVFC 1B4JL 4I77H 4PRPA 3MACH 2WQRA 5JLZA 3SGDI 4F33B 3G04B 1I8LC 5FYJD 3SGEI 3WEXB 1A7PL 2Y4SA 2NY0D 4S1SL 1QFPA 3MLWL 1H9VA 4YHPA 5IB1B 5T3ZE 4Z95H 1MCPH 2AK4E 1UM6H 3HE6A 1BFOB 1VHPA 1YEHH 3MOAH 4G6KH 5EO1A 4EI6A 4X5WA 3TCLA 4HPYH 3EHBD 3QFDA 5JXAH 4RFOH 5DEGA 3T2OA 5K9KA 2FX7L 1S5HA 4O2EA 3KPRB 5E5MA 4HJJL 4PY7B 1IEAA 1VENA 4LKCA 4G8GA 4HS8L 1EVTC 1Q9OB 1J05B 5IGXL 2NY7L 5BOPA 5C86A 3TYGL 3RDTD 1QP1A 4EDXB 1A21A 3TJEL 2D7TL 2I60H 1HI6B 5I2IA 4UUJB 3LKNB 3MUZ1 1MHPL 2NXYB 4RFEB 4NNPL 1MLCA 1RZKH 3EFFA 2GT9B 1BIHA 5T1MB 3UEZA 4LBEB 3GKWH 1ZS8A 4IRSA 1QLEL 1AQDB 5IB3B 4DN4L 3H6JA 5F93C 1HHGA 4KZEH 3KPLA 5JNYB 3BKJH 5I19L 3BKMH 2VDKH 4OKVA 2FB4H 3NH7H 1JHTB 5FEBA 1CXFA 5GRUH 4KK5C 5L9DH 2OSLB 3UCRA 4LLQB 2X4QA 3MUJA 3H3KA 3AS1A 4P0DA 4JQIL 4RGND 3HUJF 4HT1L 1FFOB 3NPZB 2G60L 3QULB 1HINH 3QQ3B 4YHOH 3SDAC 2C3HA 4V2CB 1UCBL 3FQNA 1K9TA 4RFOL 4P5TD 3T0EE 5LVEA 4PRPB 2H6PA 2Z4QA 4UIKH 4MNGE 3O9WC 1UACL 1RZJL 1JUFA 3E1F1 4UTAH 1PG7X 4AEIH 5DMGC 1NCCH 1FNGB 4YUEH 4XVSH 1CFQB 4JREB 1H3XA 2FECI 1MJ8L 4JPWL 5KG9B 2VLJD 1KPUA 4PJFB 1Y0LB 4C58B 5DK2A 5MENA 1YQVL 2P8PB 3BRFA 1P6FA 2X42A 1P53A 4KRPD 2N7BA 4PBWD 5CD5D 1WCBA 3N0PB 3TT1H 4CU8A 5D7JC 1QRNE 1FL5A 5T1MA 3RVUD 1ZLUK 2I27N 4MQ7B 3QUML 3WN5A 2GSIB 3HMWL 2GJ6D 3B9KA 3UJJL 2ZPKH 3ALPA 4X7SH 5ERWB 4I2XB 4NN5C 3O6MH 3JUYA 3OBAA 4YHZL 2XA8H 4NO3A 4WVRA 32C2A 4ZPTA 5FYJH 2I9LB 1FZOB 3V6OC 4X83A 4KKLD 1EJ6A 3DRTA 3KLAA 1UB6B 2IALB 3QEHA 2J3SA 2X5PA 3IDJA 3OG4B 1Q72H 1JRHH 4NN7B 2Y5TB 3IB4A 4YBLC 3CMGA 3OGCB 1YN6B 3F7YA 4L3AA 4A6YL 3ARDB 3LQZB 4LCWB 4BA8A 4KHXL 4YUEL 3B9EA 4XVSL 4EIZC 4BM7A 2FJFB 3TYFB 4MNQB 1G7QB 1L7TL 2NLJB 3CXDL 2OK0H 4U6XA 3CZFB 4POZC 3DVNB 2EDYA 3F6IA 3G6DL 1NC4D 2AAVA 2ORBL 1TZHB 3WNKA 2W9DL 1YMMA 5ILTH 2GUOA 2J8UA 4I2XE 5D2NC 4FQIL 4NZDA 4NGHL 5MI0C 4PB9L 2BNQE 4WWKD 1JI1A 1KJMB 4HH9A 2P46B 5KJRL 5IT2L 5C0IA 4JFEB 5IVZB 5IW1B 4HS3B 5EWIH 1KCKA 1EV2E 1EXUB 4PLJC 1QNZH 1R24B 3BI9X 4KTDH 2V2XA 4MCYA 4U6VH 4R4BB 2JJTA 1JWMA 1DZBA 1YEDA 4MA7H 5TPWH 3RWGB 1YYMH 3D25A 4PD4J 5HSFA 4TTDD 3O3EA 3FFCD 3REWB 3I02B 1HN1A 3E6HA 3IETB 4Y2DB 1KACB 4MAYA 3RY6A 4UILH 1T0MA 5DA0B 2AV7A 3RX7A 2WBJC 1I9JL 1BVKB 1CQYA 5IQ7H 5EC1B 5CCKL 1MHHB 3U30B 4H25B 3WS6C 1C1EH 1G9NL 5ELIA 2QKIA 3QEUA 4OJFL 4AL8L 5BQ7A 1J8KA 4KHXH 1DFBH 1LEKB 1YUHB 2OCFD 3QHZL 3KR3H 3R1GH 3MCKA 3T8XB 5IFAL 3UDWA 4OZGA 2Q7NA 2GK0B 5I71C 3C8KB 4Y4FA 5IMKA 4WV1B 4XMLL 5HPMA 1RZ8A 1W0WA 5KBNC 5D7LA 3MCG1 3GGWB 3F58L 3CZFA 5C07B 4K07A 5F8QC 3PGCA 2R0LH 3WJJA 5I18H 3FQWA 5JQ6H 1JZ5A 3KPMA 3LEYH 5SX5H 2C3GA 3DXAA 2W59A 1BD2B 3X3GH 1RIVH 4UOJA 3DVNA 4HZLA 3RU8H 3QDJE 5BVPH 5D96B 2Q1EA 4RX4A 4JY4A 4M7LL 5BMFL 5F7UA 3GHEH 4PGJA 3C5ZB 3O2VL 1RHHB 4BFEA 4ETQA 1L9NA 2X40A 5TF1H 4XXDB 3S5LG 3SKUD 1P1ZB 4BQBA 2I60L 2EC8A 4X99B 1V8HA 2F19L 3AB0B 2OTWA 4KRNA 1HQ4A 5F7YC 4CU7A 5BV7H 4LK4A 4XPAL 3OWEA 2X1OA 4ZTPH 5EBWB 1QG3A 3C5ZD 5FF6B 3O2DL 4OGZA 3QEUB 3HE7D 1A1MA 2DTMH 2J12B 4E41E 3SDCA 1QVOB 4GUPB 5J3HD 1INDH 3IGAA 4Z7QF 1A7RH 2IANE 1IGCL 1T4KB 5SV3A 5L2JA 1WBXA 3OMZA 5L7XH 4DVRL 4YDLC 4G9DB 3GJFA 4PJ8D 2N7AA 2QL1A 2CMRL 3E6HB 3IETA 4U6HA 1U0QA 3S98A 2WBJA 5E8OA 5I18L 2O61B 5DJ2A 3QP3A 3HI5L 3D85D 3H2WA 2R2HB 3IFNL 4IMKA 2X1PA 5KOVC 3QDMD 2YD9A 5EOTB 3KLHD 1QHOA 5FYKH 3C5ZA 2BSTA 2HJKA 1HNFA 1FNLA 2DOCA 1FO0L 4ODTH 3C2SA 3FCTB 5TE7L 4D2NA 2JELH 4HIIB 3RNKA 5DUPL 4Z7VF 4D0BB 2D7NA 2EIEA 2ZCHL 4JKPL 3DGCR 3QEQB 1S7SA 5CP7A 4H25A 2OR9H 3SE3C 2MMXA 1J1XH 3J7HA 4E42B 3PWPB 1C8PA 4TYUA 2FL5B 3V4UH 1LE5B 5DMIL 5DHVA 1RULL 5IB2A 2AQ3A 4X7CC 15C8H 4I1NB 4BSWB 5AZEL 2I07B 3D85A 3K0WA 1PX4A 2WIIA 3FO9B 1S8DA 4UOW0 3HNVH 3WFBH 2GK0A 5E2VH 4U7MA 1AGFA 4ONHA 1NGYB 4M48L 1I7TA 1IBGH 2AGJL 4GRLC 5C0RH 4HWEH 3GI9L 3RWJB 1E4XI 3OAZK 4Q9QL 1M7DB 3BUYB 5L2JB 2V5TA 1IC5H 3ILQD 4N0YL 3RGVA 2CKBL 3WKML 1I3GH 1WT5A 1OAQH 4DW2H 3TWCL 4WUUA 4G6FB 1TTGA 3RDTA 4DN3H 5I66A 2OXGA 4YX2H 3TBYA 1MPAH 5D7JB 2C1PB 5FUCE 1B4JH 4OD2A 1G6RA 4XXCC 5ESQA 2VXQH 4KI5F 5C0CE 1MFNA 5KSVB 1H3VA 1A6TB 1GIGL 4P2OC 3TFKD 5I1IL 3PUCA 2YD4A 4M3KB 4NSKB 5D72H 3RJQB 3ZMRA 3RI5F 4DQOH 4AENB 3QFDB 5FV2A 1X5XA 5K9OB 3WDJA 3U9UB 5DSCB 1A3LH 1T20B 2F74B 3A67L 4NZTL 3ARBD 2X7LB 1HILB 4NBZB 5JZ7D 4JRWA 2AGJH 2X4OA 2XACC 2RCSH 1OAUL 3GEWB 3TJEH 1LP9A 2D7TH 4TN9A 3ULVC 3MXVH 2FDBP 3L3HA 2I07A 4ZYKA 4U1MA 1NDMB 3TN0A 4JFQB 2H6PB 2Z4QB 2CKBH 4OT1L 3WKMH 4F2MB 2BVPA 4JM2D 4XGZB 5DK0A 4R3SA 3Q3GB 2JCCB 1TETH 2Z35B 4G9FB 4YXLH 1X6NA 3ULVE 1CE6A 4I4WB 3B3IB 3I2CL 1FNGA 3CMOH 2R39A 3OKDA 4BUHA 5TDNA 2Q86B 3EDJA 2ICCA 2RBLA 4M93C 3UC0L 1EZVY 1NJ9A 2A6DA 1EDQA 3QO0B 3TN0C 3QUYB 2EZ0C 5C0JB 3SDXE 1JNLL 1BBDL 1FGNL 2OJEA 1NGPH 4YHOL 5FYLD 1UVQA 5ICZB 4C57C 5I74C 1KUMA 3EHBC 3LN5A 5AYQA 2VTFA 3MROB 4PJAB 3HTLX 4YHIA 4N8PA 1MWAB 3WE6B 1QLFA 3FQRA 4PRBB 5J0BA 4BUGA 1LO5B 3WIFB 4IOIB 2D9QB 1UACH 3IFLH 1SYVB 5HDOA 3QH3A 2JLLA 2YWZA 1ZGLP 1Y0LA 4QOKD 5E8DL 3T2PA 3V4VH 2MFNA 3GNMH 4ODXB 1Q