2E27H

Crystal structure of fv fragment of anti-ciguatoxin antibody complexed with abc-ring of ciguatoxin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
116
structure length
116
Chain Sequence
QVQLLESGAELARPGASVKLSCKASGYTFTTYWMQWVRQRPGQGLEWIGAIYPGNGDTRYSQKFKGKATLTADTSSSTASMQLSSLASEDSAVYYCARSDYGGDYWGQGTSVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords anti-ciguatoxin antibody, light chain
publication title Critical contribution of aromatic rings to specific recognition of polyether rings. The case of ciguatoxin CTX3C-ABC and its specific antibody 1C49.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 24
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2006-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2e27H00
4Y88A 1J5OH 5JLZA 3QPQC 3MJ6A 2W9DL 4AEFA 4X4ME 3ROOB 1NCTA 3B5HA 1XF1A 3LQZA 1WLHA 4LQFL 4K3JH 2E9BA 3IYLW 4M7LH 4D9QD 3P30H 1E28A 1T80A 4B7LA 4MJ2A 5EBMA 1FPTH 2HRPL 2VUYA 5JZ7C 3D3VE 4HC1A 3IFNL 4RAVB 4PS4H 1KF9B 4JQVC 4YDKH 4XVUD 5IHUH 2EH8L 5FYKU 3QDJD 1FYTE 5H94A 1U8QA 1INEH 5HVHB 1IGYB 3FZUD 4X7DC 1HEZB 5T3XD 4Y5XC 5IG7A 3N85H 3CK0L 4E5XA 2DL9A 5EU5B 4MHHG 5SWQA 1U8OA 1XR9B 4MA3A 3VFPA 3QDGE 4LARL 1UKQA 3AB0C 4MB3A 2DWDB 5EUOB 1PFCA 1DLFL 1MIML 1A6ZB 4J3WA 3S9DB 3LH2L 2NXYD 4Y1AA 1NCAL 4KVCL 1V7NL 3ALXA 3GI8H 3HPLA 4TSCH 5C3TA 4G6FB 3MJ9A 5HHNB 4N8VA 2YXMA 3DMMB 1V05A 5CMAB 1YYLH 1KOAA 5EOTB 1IFHH 3BXNA 4KJYA 43C9A 1JWMB 4OD3L 4POZD 1I3GL 2R1XB 4OZIA 4LLDB 4M6AA 3D18B 4YC2C 1B6DA 3O3DB 2FJGA 4OLXH 3IXTA 5HD8C 5HJ3B 4U1GC 2DBLL 4L4VE 5F96H 1SJHA 3N1PC 3F58L 3W0WB 4PGZA 3TO2A 1MCKA 5EBWB 1YECH 4NUJB 4PTUB 2G75B 3WEXA 1BEYL 4L3ED 2CKBB 3GK8H 2R9HC 1Y6NR 4R7DB 2Y06L 3VGBA 5CEYA 2X4NB 4RBPK 2R56L 3PHOB 4M9PA 3KPRA 1UA6L 3FO0H 3X13B 2ARWA 2MCPL 3ZKMC 2VISA 5C0IB 4UUJA 4X6EB 2VLKE 1WQVT 5MEOB 1F6LL 4WFFE 1T1WB 5I17B 2HT4C 5IW6B 2EXYC 2ZCHL 5IV2A 3DYOA 3MRCA 3MLWL 5CJOH 1R3HA 4HXBH 2P8MB 4JN1H 4YFDB 2JIXD 1MI5E 4N0FB 3BKYH 4LCIL 1I7TB 1A3LL 3U9UB 3QEGL 5IF0A 3Q1SH 4ODTL 4NC0B 2DMCA 1NCBH 5D9SA 1FVEA 4YXKH 1X5JA 4UIMA 3OF6D 4KJQC 1KV3A 5IMOB 5D7KE 3GI9H 4NJ9H 1UJ3A 4PRBB 4P2YA 5M7QA 5HDLA 1SYVA 1MOEA 4JKWA 4L9LC 4WV1B 3QUYC 3B9DA 3JWOL 4H8WC 4EOWL 1ZHBA 1TETH 5C0DB 1ZTXL 3GJFA 4JRYD 4Y4FC 5FA3B 5HGHB 3U48A 1PYWA 5SWZD 3IGAB 4WO4B 4CMMA 1L9NA 3LDBC 5I15H 4UNTA 5TFSL 3O6FC 1DUZB 2IAND 2VKWA 3QDMB 4FQJL 5J89A 1IL1B 1Q0YH 1FV1A 3V6BR 3VFOB 4NQEB 1WISA 1MHPL 3FN3A 4WI7A 5I16B 1TQCC 1KPVB 5ADPL 1IZKA 3MRKA 4M6OL 3MROA 3P0YL 4X8JA 3DBXB 1JPGB 1QSFD 4RGNB 4Y0GA 5L7XH 2DS4A 3E6FB 2NY5C 4PJDF 3O0RL 3MLZH 5FYKE 2IADA 4ZPVA 4HW6A 1SM3H 2VQUA 4XHJD 1A6AA 2CGRL 3CVIL 4LEOA 5EZLB 2AEPH 3N9GH 1YMHA 3HUJA 4FQ2H 3SKJL 5C0BD 1V7MH 4PJBE 3ARDA 5JW4Q 1CICD 5GS0L 2RBLA 2DJ4A 3BT2L 1NH6A 3PHQB 4CNIA 1D7FA 3IDNA 3X3GH 4I77H 3U9PL 3N1GC 1RZ7L 4V1DD 2YOCA 3IKCA 5M94B 3RTQA 1UQSA 3QRGH 1MUJA 2ZNXA 1FO0B 3BKJL 4O2CB 4H25B 1DQJA 3FB5B 2XA8L 4TUOA 5D7LE 4KTDL 1T03H 4QTHA 3GZKA 1J18A 3VGDA 2X4UA 1E6OL 2A9NH 4UB0L 2GKIA 1INDL 4OF7A 3TH4T 1I9RL 4JM2B 4Q9BA 3SO3B 2XZCH 5J1AA 2B1HL 4CN1A 1MVFA 1JMZA 1DVFB 1P69B 5FYLH 1RZJH 3HI1B 1R5IA 1ZKAA 3WUWG 2E3VA 1KELL 2A6IA 3CDFA 1CTNA 5HHOA 1HQ4B 3ZHDA 1DZBA 3D39E 1KCLA 2HVKB 4NZUH 4IHOB 5DFVD 2E9JA 1DLHB 2ITDA 3LN4A 5D1QB 1EVTC 5JNYA 4NZTH 1CFBA 1NKRA 3VFSB 4TQEH 3QULB 1SEQH 5FOJA 4IIQC 2NXZB 1IILE 3ZDYE 4Z6AT 5DHVB 1RIHH 2YK1L 4JRWA 5BRZE 4YGVB 1JYVA 3SE3C 1NCCL 1WBXB 3B9VA 1LWRA 5GPRA 2IPTL 3DV4B 4ZSOB 2I26N 4YHKH 3HLAB 2QQLL 2VH5H 3RX7A 3H9YA 1OY3B 3OXSB 3DSNA 1A6TB 1FFRA 5I66A 5CD3B 4KTYA 2UUDK 4YBLC 2X9WA 5DURB 1OQXA 4J6RH 4BKLB 2IH1A 3HA0A 4AEHH 4XVUC 4C55A 3FZUC 4AIXA 3O4LE 2GK0A 4HUXB 1ORSA 3CCHA 1QLFB 5D7SH 5CJQH 3JVGA 1PGRB 3U2SB 1IKNA 2Y07H 3TCXA 2DAVA 5IBTH 3BP7A 5TH2B 1XEDA 2BOCA 4PG2A 5D2NE 3QNXA 5T1LA 3KR3L 4AM0B 3OJDA 3QB7C 4XNQA 5JQ6L 4G7YH 3S36H 4JHZA 2LTQC 3O9WA 4HKJB 2R0WH 4M1GH 2BSSA 3I6GA 3W39B 1HIML 3GMPB 4AEIL 5A16B 3KPMB 1LDSA 4L3CB 3OKNB 4MJIE 5TF0A 3MXWH 4ODUA 1HXMB 4JVUA 25C8L 3SO5A 2BVPB 5IFJA 2HMIC 3GEWB 1CS6A 4F58L 3WNOA 2FLBT 5EUKB 1EHXA 5EZIL 4I3RH 1OPGH 2W38A 1YDPA 3L3JB 3IU3B 3REWB 1T7VA 3TBVB 3K81A 2ATPB 1X7QA 3GSRA 3MLSL 1T5XB 2BCKB 2Y7QA 5C0CE 4MDIA 5FO7A 2ZCLL 3RA7H 2ZOKA 2B4CL 1FO0L 2KDGA 4YHMH 3HNVH 2HH0L 5I1LB 1CVRA 5KVEL 3QEQB 3THML 2FD6L 4OV5B 1U58B 4HCRL 4ISVA 3EOTH 2IMMA 2VLRD 5KSAD 1HSBB 2VZUA 4LU5L 2N4IA 4PV9B 5DD5L 4ZOEA 5A43C 1VERA 4HFUH 4Y5YB 5H2BA 1QQDB 3BD4A 1LDPH 3IB4A 3LIZL 4U1GB 4FP8L 1FN4A 5BVJB 5F7KC 4U1JB 2XKUA 9CGTA 3KYMB 4M4PA 5T1DL 5BZWA 5EU6E 4Z18A 3MGTB 5F6IC 4JGMA 1ZT4B 1YQ2A 4JANB 1TIUA 1KEGH 4Y4HA 5GGVH 4Z78A 3MSPA 2VXVH 3VJ6A 4LIQE 3QJHA 1C7TA 4XH2A 4AIZB 3EGSA 4PJBF 2R69L 3E0GA 3SE8H 4JFYA 5EO0B 4E41B 3O2DA 1FZOB 4F33B 5KW9H 3MMEB 4WI4A 1KN2L 2D7PA 1MCLA 1S9YA 4N8CL 3AM8A 4R96A 1CXHA 1IEAB 3C09B 4ZUUA 5DGRA 3FN0L 3I50H 4FXGB 3HMXA 2IBZX 4ZUVB 4EDWL 5IJKC 5DUBB 2D9CA 4DVRL 1R5VA 1T04B 2Z31B 2XXMB 3OAYH 4TUKH 1AGFB 5D70H 2ZUQC 1QBMH 3NPSC 3RL2A 3R0MA 3Q0HA 5D1XD 1B6UA 4HZLA 4Z8FH 4XHJC 2X1XR 4L8SB 3ZE1E 3OKOB 3VG0H 3VFVB 3MO1A 4LCCA 2ZJSL 1NGPH 5JR1H 4BUHA 1CICC 4BQBA 1TVHA 1G6RA 4OZFH 1FZKB 4L9LB 3QRFM 3PDGA 4PJCE 3QUYB 1R3LB 5CEZD 3B4NA 1BVLB 4NN6B 5D6DC 2H2PD 4K3DH 1U3HD 1IM3A 1N5YL 3C6SA 3BMVA 4Y4FB 1A9EB 1H0DB 1CZ8H 4FZEL 1E4KC 1NEZB 3BDYL 3ZDYF 3LDBB 4F8QA 4JKMA 1LQSR 2MNUA 3QUZA 3OX8B 1N4XL 5IBUB 5HBBA 1JJUA 3NCJH 3O6FB 4N0CD 1YYMH 3MRFB 5M95B 2F5BH 2Q8BH 4K9EC 3HI6L 3BN9C 4XMLL 3RNKA 3V6OC 2H9GA 4I2XA 5DDHB 5E8EB 1I9JH 1DTUA 2CXKA 1T20A 1KENL 4HIEA 4OM0L 5ISZA 4NWUH 5C0FB 3O8XA 4YFEA 4X6FA 5HPOA 1FGNH 3UTSB 2DIBA 1Q9KA 5DFVC 3K46A 3W2DL 3S4SA 4H1LH 2AVGA 5JIKA 1DFBH 4RNRA 4P9ML 3OAUL 4U1SB 4MXWH 3MOBH 1CL7I 1KJVB 3SCMA 1I8KA 4QY8A 2EZ0D 1A1NB 4PYGA 3CMOH 4M5ZH 1IC7L 3BP6A 4RDQF 5F8RC 4E42A 3V95A 2DLFL 4TVPL 4NQDE 2ADIB 3Q3GA 4KUZH 4NGHH 3QDME 2Q8AH 3QNYA 2VAJA 12E8H 3JV6A 1UM6H 3VFNA 4TRPH 5GRUL 4NQEE 3MA9H 4OV6F 5IOPA 3T3ME 4O2FA 3VXPA 3WO3B 3IRPX 4YFLF 3TFKD 1K9TA 5D2LE 4OBRA 2X89D 4GQPH 3IJYA 2VDRH 4GRMA 1RSFA 1JN6B 2JB6A 2HLFD 1VEPA 1VGKA 3VWKD 1FZMB 2W65A 4RSVA 4XCYA 1WZ1L 2VLME 5JHDB 4LCUA 4MS8D 1CXIA 2H32H 3B5GA 1JWSA 4MD4B 1FE8H 3OL2A 5K93A 4MSWB 4GW5A 3VFUB 4Y19D 5FDWB 5ICZA 4R0LA 1D5XB 4KI1A 1SBSL 4WTZG 5FK9B 1TZGL 1A14H 4PTTA 3LSOA 4IIQB 4QXUL 4OLEA 5CJ5A 3H9SA 3FQTB 4GRLD 4PJ5E 2AK1L 4AT6B 1DQML 3LOWA 3QCUH 4XP6H 4NQCE 5I6XC 3WSQH 2AJUL 3MLTA 1ZWIB 3SDXB 4ONGL 4F15C 2HLAB 5IB1A 1DN0A 1K5NB 4KK5D 1NGXA 1WWWX 2A77H 3GIZH 3MNWA 2Z4QB 3TCLB 2GIYA 4KVNH 4D0BA 5D72H 3WJLA 1BIHA 4LKXA 3U79A 5EC2B 2AJSL 5LAXA 3VRLE 3FL7A 4H8WL 4OCWH 2EIDA 5HHXL 1BQLH 4WEBL 3DX9B 5CILL 4O00A 4UTBL 5CP3A 1T89A 3JTTA 1A47A 3S88L 3MUGB 2I9TA 1YEJL 2B5IC 2NXYB 3OB0H 1CFVL 3GRWA 5ALBL 2AXFB 3TP4A 1UM5L 1NC4A 2VOTA 3U83A 3MRQB 3WXVL 4G5ZH 4YHOL 1HI6B 5KSAC 4CJ0A 2QBWA 1PY4A 5LGHL 2FEEL 3WN5C 3SOBL 1A3QA 4LSSH 4GAJH 3V5DB 4N0YH 5FKPA 2NY5L 3GSNA 4P9HL 4XP5L 1JGEA 7FABL 1V8HA 1EHLH 1YA5A 5T1MA 1AE6L 5MEPA 3IDGA 3FFDA 3VXUE 4J3TA 2VR4A 2R29L 5DD0H 4L3EB 2J8UA 5IFAH 2YMXH 5E8OA 3ES6A 3P11L 4G3YL 1P6FA 5L6YH 3IVKB 2CDFA 5I1GH 4PRIA 2VLJD 5SWSE 1N64H 1VFAA 2I5YH 3BPCA 3Q6GH 5DK2B 3R06B 4PLNC 1WCBB 1Q9WB 4KK8D 1G7MA 2NLJA 4YWGL 4QHKJ 4PJCF 5H8DA 4ERSH 2VRAA 1UB6B 1RPQA 1DJSA 4EBQH 1VPOH 1ZVHA 3DURA 2DQHL 2HFGL 3NCFB 5IK3B 2Y1VA 1N7ML 4MD5B 2X40A 2WUBH 2BFVL 4L4TB 2JIXB 1LILA 1MHEA 4ZTOL 2OTPA 2W60A 5DJ6A 1T1YB 1W0WB 4ONHB 3D25A 4OSUL 3S6CA 4KZEH 2O26U 3RU8L 1UXSA 3F5WB 2HTLD 3TIEB 2AEQH 3U46B 4UBDD 1N8ZA 1UACH 4PJXF 4UV4L 3TH2T 5DQDH 4ZO6A 4MWFA 5EFIB 1FL3A 2UYLB 1BBJA 3U4EB 3EOBB 5F6IB 5GISL 3SKOA 1Z0MA 2AJVL 4S2SA 8FABB 5DVKA 1O0VA 1U3HC 4U1IA 4JRYB 3AREA 3BD5A 4YO0A 4PP1C 4RBPH 2V5RA 1OF2B 5SWZB 1OCWH 2R2BA 1WAAA 1H15B 1F3DJ 3VXMD 4U6YA 2IANB 5IM7A 4YBQD 3V79C 3SJVB 3G04A 1RULH 4U1NA 1EAPB 4PJFA 1T0NA 4TVPE 5IB4B 5CIPB 4OF8A 1CFSB 2UWEE 5TDNB 5ESVA 4G8GD 3HG1A 1FRGL 4OQTL 4TNWF 5JHLL 4Z76A 3T3MF 3LN5B 2VSDA 5KN5A 1XR8B 5T3XL 1EGJL 2NZ9C 3ILPA 5D2LF 4QXTB 1TCRB 4NKIL 3BKCH 1R3JB 2PYEE 2BNRD 4TN9A 3VRIB 1C5BH 1ORQA 1LO3H 3AS1A 3FO2A 5HI4D 3GFUA 1ITBB 3VGGA 1S7XA 5ETUB 5C0BB 3KXFB 2EZ0C 1LO0H 3WDIA 1CICB 3QHTC 4XT1C 5DQ9A 3M1BB 5GRJH 4EI5A 4MJ5B 5MEQA 4KGJA 1W72B 4V1DB 3WXWH 3K80A 2G60H 4E41E 1LEIB 3ULSB 1FNEB 3HZMB 1HNGA 1JNLH 2KQNA 3ARGD 5KANG 2DI7A 4M7JL 4POYA 3F65A 4QOKE 1QUNA 1C1EH 1S7QA 3EDEA 5F6HJ 3O6LH 1AFVL 4YUEH 3TFKC 5DJDA 4CW1B 2FH6A 5LQBH 1G9EA 4BM7A 5F3HA 5DJCA 3DX8A 2HLFC 3KPQB 2XA3A 4HKBA 1A4JB 4UDTA 1G7HB 2P24B 4QRQB 4FN0A 4W6XB 2WANA 3TV3H 3ROOA 3CDCA 1NLBL 5DFWH 3RY6C 1E4XH 1WTGT 2YRLA 3VRLF 2MSPA 3T4AB 4XP1H 4FFVD 5AD0B 3LKPB 1OQOA 4OGZA 4X5XB 4NNPH 4WJ5B 1BGXL 1QRNA 1QLEL 4RAVA 4GRLC 5EN2A 1DBAL 3EO9L 1U3ZA 1A21A 2WIIB 2BMKB 1IGYA 3EDDA 1A9BB 1A4KB 1KXQE 4OIBA 1HEZA 5I1CL 5EOQL 3P9WB 2OLDA 3T8XA 4JPKH 5BS0D 5B3NA 1ZGLB 6FABL 5FUOL 5TDPA 2C5DC 2DWDA 5CWSA 1EJOH 5EUOA 1A6ZA 5C9KA 4HWEH 2ICWI 2Z8WC 2IGFH 1Q8MA 2FX9L 3EOAB 1YPZE 3VFTB 4IOIB 5I1EL 5HHNA 3IXAB 2YKLH 3KS0H 3DMMA 4JKKA 5CMAA 1WT5C 1FBIH 2VDQH 5EBGA 3EZ8A 2P5WD 1JWMA 1QVOB 2R1XA 2RJMA 3D18A 1G1YA 4XTRD 3O3DA 4AG4L 1KCSL 4U1HB 3QFJE 4P3DB 3UROR 1M4KA 3RL1A 1MF2L 4A6YB 5L9DH 3LAFA 1JWUB 3T04D 3W0WA 3MOQA 1MY7A 4P5MB 3WHE1 2G75A 2DQJL 2XWTB 2AGJH 5IMMB 1UGNA 1YJDL 3H0TA 1JZ2A 1FFPA 5GIRB 4NIKB 5EIIB 2VL5B 5E7FA 2ZUYA 4LLQB 4RMQA 4R7DA 5I6XB 4PP2B 2FECL 1X4YA 4X98B 3QXAB 5TPWH 3RY5A 1UG9A 2UUDH 3ZDZE 2BOBB 2F58H 4KY1H 5IVXB 1KCVL 3S35L 4WIQA 4W4NA 5C0IA 4JHWL 5JHDE 5MEOA 2D7MA 3DXAD 1T1WA 5I17A 5IW6A 1YEKL 2VNCA 3STZA 3ARYA 5TF1L 2CK0H 1SJEB 4OGXL 4KK8C 2P8MA 3MXVH 2W0FB 2MCG1 1W72L 3K8LA 3OG4B 4N0FA 3KYNA 3U7WH 1I7TA 4O2EB 5HDBE 2D31B 2EIZB 3ARBD 2B5IB 3BD3A 1LD9B 4IRJC 3RUGA 1P7QB 1MCRA 1P6AB 1B2WL 2YPVH 5EBLB 1TTGA 2K3TA 4P2QD 4OLZH 4K9EL 4P4RB 4WHDA 4XPAL 3UJIH 2VLRB 3ZDXE 4EUPG 5IMOA 5B38A 4FXKB 4PRBA 4B53A 1OD7A 1ZANH 4J2XA 4X99B 2HTLC 3WN5B 3GMQA 2IBGA 5AUMB 5JW3L 1NCDL 3T2OA 2UWEF 3BH9A 4UBDC 4O4YL 3DYPA 5KS9B 5C0DA 3KG5A 1X5KA 5C92A 5C1MB 5FA3A 5HGHA 1OAXL 3IGAA 4X4YB 3C2AL 2XN9D 1QBLL 1OARL 2EO1A 1DSFH 5JOFA 3LEYH 2P5ED 3U6RB 4HJJL 5E08L 5F1IB 4ZS7H 3VFOA 3MACL 1EIBA 2DYPA 5A1AA 4NQEA 5HDQL 3VFWB 1QTYT 2X1WL 1AHWB 1ZA6B 4H88H 4IOSD 3RWCA 4I5BB 5I16A 1Y6KR 5D1ZD 1F4AA 4RGOH 3T0BA 3O3AA 1BM3H 3ZE2E 1JPGA 4YH6A 1CIUA 4YBQC 3T77B 4WI6A 2F53D 1T7WA 3E6FA 5K9JL 1WFTA 3DSFH 1OAKH 5DMIL 5JTWA 3CAFA 2BNUB 4Y4KA 4PGDA 4PJAF 35C8H 3VGEA 3C60B 5IGXL 1FZJB 5BW7A 1OT2A 1KLGB 5EZLA 1LP9B 3C6LC 5CAYB 2I60H 5D1XB 3TYFB 2CK2A 5F1OB 1P2CB 3AFLA 1NSNH 3CUPB 5HI4C 3L7EB 4S1SH 4QRPD 4LK4A 3PGDB 2JK5A 1FO0A 4H25A 1EAJA 5CEXB 1EUTA 1F4WL 1U2CA 4A6YL 4UI2A 3ARGC 4HCRA 1U3HB 1WEJH 3TO4D 1KPRA 2YXFA 1DVFA 1FGVL 1AQDB 1TZIB 3CSBA 3MLYH 3HI1A 4B0MM 4W6YB 2HRLA 5L0QB 3ZMRA 1HQ4A 5BOZG 1S5IL 4L4TE 3UCRA 4X6BB 5E6YA 2RIKA 4IHOA 3O2WH 1DLHA 2X70B 4KRLB 4B41A 5EB9A 4I48B 1QSED 3HFML 3BSZH 3FO1B 3VFSA 1HHKB 2DI8A 1Q38A 3QUXA 2GJ6D 5ICYB 4JCMA 4YGVA 5GSRA 5EOCH 4OLYH 1WBXA 4P23D 1CU4L 4ZSOA 1Q1JL 3HLAA 3V4PL 1QFUL 5KSBB 1MFCH 4FFVC 1YPZF 3L3OB 3OXSA 1A6TA 4ETYA 5ACLA 5CD3A 4YIQB 1S7TA 4PV8B 4LGSB 4BKLA 1CXEA 4J12A 3DX7A 4XP4L 3TN0B 1M7DB 5E56A 4HUXA 3KYOB 1T2QL 1QLFA 3SJVE 1OGAD 4OUUA 1MHHA 1QG3A 5FUCC 4XB8A 5DJ2A 3U2SA 5I71C 4NQTA 4P2OD 1KB9K 4U6TA 4F7EB 5AG9A 4X4XB 1IAOA 5TH2A 4RA0C 1HCVA 2EDXA 3E3QE 4AM0A 4U2YA 3VWKB 5JXAH 2YD2A 3ZDZF 1MCSA 2H8PB 5CJBA 4HG4J 1NFDB 3ETBF 1V5JA 3Q2CA 4LSTH 3IETB 3QCTL 4HKJA 3C5SA 3RQ3A 4BFIA 4Y19B 3W39A 1XGQB 2RCSH 3OAZK 3OB8A 4RRPG 3KXFE 4PRDB 2VXUL 2B7DT 4O5LH 3B9EA 4XTRC 4HF5L 3KPMA 3OKNA 2VXSL 5LCVL 4IDJH 1LO4L 5JORB 1MJJB 2DDQL 2GK2A 4M7KL 4V1DE 2BVPA 4FXLA 1JGDB 1WIUA 2DWEB 4H26B 1TJHH 4XHQA 3ULVD 4GRLB 3QWQB 1MFBH 1II4E 2XTJB 4YDLC 3L3JA 3IU3A 1RJLB 3ZDXF 3TBVA 2VDPL 1U92B 5EWIL 3IRZA 3VXSE 1JTOA 4Y5XA 2UV3A 1F13A 1T5XA 1TITA 1BMGA 2BCKA 4WFGD 1JYXA 1T21B 2DQIL 2VITB 4Z0XB 1X5XA 1KYOJ 1D5IH 3LQMA 4G9FB 1MCWM 1A7PH 5I1LA 5LBSL 5IQ7L 2VLLB 2J5LC 3QEQA 4HBCH 2P49B 5CEZL 4OV5A 2RAMA 3DO3A 4XVJL 5KTEL 5HDOA 1HSBA 3VE0B 4TSBH 1GSMA 5FCUL 4UILL 3ARBC 4PJGE 4PV9A 5JUEH 4GAYB 3P73A 5GSVB 3WFEH 1MCOH 1QQDA 2ZKHH 3RVXD 4YFLI 1GGCL 5C07D 3ZE2F 4BFGA 1OAYH 3WIHL 4DEPC 3B9KB 4P46D 5BVJA 4OZ4B 3KYMA 1YY9D 1Q94B 3BYYA 2OK0H 3MGTA 3KNBB 4G6KL 2AK4E 4FTVD 1ZT4A 4ONFH 1T4KB 1ZHKB 2VC2L 3CFEB 4JANA 5JA8B 2GUOB 5MERB 1Q0XH 3HZVB 5BMFL 1ACYH 1DL7H 3MGAA 1A7QL 3UBXI 4CVZB 1NKOA 5HYJD 4AIZA 3NCBB 4YEEA 3I3BA 5EO0A 5I1KL 1UB5B 3ROLB 1F2QA 4F33A 1ERNA 3MMEA 3SDYL 3TBTB 3PV6B 3X3FH 1RZJC 5H35B 3PABB 4FXGA 4PRHD 2VLJB 3CH1B 1JHLL 4ZUVA 1BLNB 5D1ZC 1CD0A 4OFVA 5DUBA 1AP2B 3QHFL 1YEIL 4IJ3C 3VFRB 5ILTH 1T04A 1LVEA 4NDMB 2CKNA 2P47B 1AGFA 1JGVL 1MFAH 2X10A 2FX7L 4LEXH 1QFWM 2DQEL 4L8SA 1A1MB 3K8KA 4NN7C 4N1CA 4WGWB 1ADQL 3OKOA 3VFVA 1Z9LA 2CPCA 3U1SH 4BSVB 3O11B 2X4PB 1P53A 1K3ZA 3FB6B 1FZKA 4L9LA 4HIJB 3QUYA 4LVNB 2Q3AA 4TTGA 1R3LA 4X7SH 5F7WC 3AMLA 1BVLA 4NFDA 2I07B 4PG9B 4F7TB 4D9RE 1H3XA 1XGYH 4Y4FA 3KLHD 1A9EA 1H0DA 2VZVA 1NEZA 2BC4B 5J6HB 1PKQB 3OX8A 5HHVH 3WDJA 3GBMH 1HYRC 3O6FA 2FWOB 4JPVL 1J8HD 1HQRB 3MRFA 4XAKD 1H5BC 3TO4C 3G5XB 2F8VA 1QFWI 2OBGA 3MUZ1 3L5JA 4KTEH 1HHGA 5E8EA 5F7EL 1VHPA 4M43H 3VXMB 3LQAH 4N8VG 4ZFGL 5C0FA 4NN5C 4GG6E 3HNTH 4X4ZA 3UTSA 4KQ4L 4NHCL 4KZDL 5IQ9B 1CFTB 4P4KB 3MCKB 1WBYB 1IKFH 1UENA 3P9LB 4JQIL 5T5FL 3SBWC 3EFFA 4OLVL 2WQ8A 4NOBA 4U1SA 1KJVA 1YN7B 1F4YH 3MCLH 4G9DB 4LPWA 2BRRL 1H3WM 3OHXB 1EJ6A 3QAZB 4P23C 1EFXD 1RUML 1I9IL 3QIWD 2ADIA 2FRGP 5TGBB 1PQZB 1WFUA 4QTIL 3X14B 3CZFB 1A6VL 1WWAX 3KYKL 3NTCL 2J4WL 4PLJD 1EERB 3ARGB 4HWBH 2H26A 3U4BL 3IAPA 1BAFL 3O45B 2ESVE 3FT4B 1JN6A 1WZKA 1S7WB 4WRLA 4P2OC 3KJ4B 4JFFE 1U8KA 1FL6B 1IGFH 5D7JD 5I19H 2CMRH 3G08B 4MD4A 5DQJA 3QPXL 4MSWA 1LP9E 3C8DA 3PGFL 1BD2D 5FDWA 5ENWB 3VD5A 1D5XA 5FCSH 4EIZC 1J1OL 4S1QH 2JJWA 3L1OL 4KKLC 4JFEE 5FK9A 3UC0L 1KLFA 2BVYA 4ETQB 4IIQA 4C56D 5B3JE 4NKDB 5A2JH 4BZ2L 3BUTA 2NW2B 3FQTA 3SE3A 3HE7B 1IEBB 2EDWA 3O4OC 5CINH 4AT6A 1QOKA 3PP4L 4GS7C 1KCKA 2BJMH 4Q9CA 1ZWIA 3SDXA 5CEZE 4FQHB 3D0LB 1G7JB 3LHPL 2HLAA 1FAIH 4JY5H 2VYRE 4O51A 5C7XH 1OSPL 1IC5H 3ULVC 3N0PB 3UJJL 2ITCB 1J88A 4PJGF 4R8WL 3ZYJA 3QG6B 1K5NA 1EH9A 1I4FB 2EH7H 3QDJA 1J0JA 2KH2B 4OQTA 4N90D 3TCLA 1AJ7H 4FFZH 5DRZA 3MTRA 2NNAB 3REVB 1EGJA 5EC2A 5JW5B 4OM1L 3TGXA 5BS0B 3QNZB 3VWJD 4J4PD 3DX9A 3G9AB 5GJTL 1XF3B 3EDKA 4G6MH 4L4JA 1CF8H 5ITBH 3MUGA 3L95B 4PY7B 4UINH 1G9NH 4UT9H 1FJ1B 2BSRB 2NY1D 4OIIH 1HI6A 2HT3D 1A6UL 3GBNL 4AK1A 4JO3L 4NCC1 4LGRB 2DQCL 2P5WB 1KN4H 3CDYA 4X7EC 3VXQB 3V5DA 1WVZA 4JY4B 1RUKH 4WU5B 4P46C 1X5HA 2FJFB 4H0IA 1YY9C 3VH8G 4LRIC 1R24B 2YD3A 4Z7VE 3Q5YA 3Q5TA 4L3EA 4K7PY 1HYSD 3VXNB 5L2JB 3IVKA 2PF6A 1RFDL 1P84K 4M7LL 2NZIA 3P30L 4FS0A 5JO5A 5DK2A 3NA9H 1WCBA 1Q9WA 3BW9B 4GOSA 4L8BB 3VA6A 2VQTA 3WMSA 1DQDH 1UB6A 2W59A 4GMTH 4JFHD 1NFDE 1BJ1J 3DXAB 4KPHH 1ZS8B 3T0VA 4YDKL 2QQNH 2VXQL 4LL9A 3PE9A 3MRJB 4MD5A 4OD2B 3PWLB 1S7VB 1BQHG 2JIXA 3SE9H 2DLHA 2W9EH 3I6LD 5B8CB 1HHJA 5HHMB 4ZFOB 2YD7A 3TIEA 1QR1A 4WVRA 4DN3H 4M6NL 4PLKD 1YC7A 3TLRA 1U8MB 3MLVL 1UWGH 3OF6A 3HC3H 3EFDL 3U46A 4APQD 4X7FC 1MCPH 3TVMB 4GH7B 2XTJE 4DEPB 3D85A 4GG6F 3AUVA 4PRPA 2UYLA 3U4EA 3ARVA 3EOBA 2R2EB 1N3NB 3VDCA 1EHNA 3KAAA 3RZCB 1QNZH 3CX2A 3BX7C 8FABA 2R1YB 2BERA 4GLRI 4JRYA 1E4WH 3RDTD 1ZEAH 4OLXL 4UAOC 1OF2A 3MLUL 4U31A 5SWZA 3ZYOA 5DMKB 5KSVB 4LSRL 4DGYH 1H15A 2GJJA 1NBYB 2AQ3A 1T0PB 4G9FE 2DQGL 2IANA 2P5EB 1YECL 1EDQA 1RIVH 3LKRB 1EAPA 2OMNA 4PJ7B 5IB4A 5CIPA 5CP7A 5D1ZB 1CFSA 3QDHA 5IJKA 3KHQA 5TDNA 4XBEL 5D5MB 4RFOH 5E4EC 4R7NB 1QSFA 2A2QT 3CSYB 2F53B 1OHQA 3BPLC 3FO0L 6CGTA 3LN5A 4KI5E 1XR8A 3NN8B 3ZKQD 4ORGB 3LD8C 5C08D 1R3JA 2X4RB 4F7CA 5FYJH 3I3DA 4LKCB 4NN7B 2XNAB 5CJOL 1FNLA 5C0BA 1KTDB 3FT2A 4Y2OA 1F45A 4GXUM 1CICA 4QGYA 1KG0B 3BKYL 1RIUH 4QRRD 2FO4B 3M1BA 1NAML 4LLUB 4MJ5A 3QIWC 1NMBH 4XPFL 3Q1SL 1W72A 4V1DA 5C0GB 1LEIA 4QRPB 5D6DA 1HH9B 5AEAA 1G7IB 4YXKL 4KROD 1RHHB 1YNKH 1E4KA 5B3JF 5MP6H 3MLXH 3CXHJ 2YD1A 4NJ9L 5HHPB 2Y5TA 2OYPA 1YEHH 3MV7D 4JG1H 1R3IH 1CDIA 2HN7B 2VR9A 4KKCD 4S0SD 3KPOB 3D0VB 4J3VA 4OCRH 3VXTB 1TETL 3KPQA 4CRPA 4DGVH 1L0YA 4YZFE 3D69B 1X6NA 2BK8A 1A4JA 3S97C 5D7JC 2XQYG 5I15L 1G7HA 1DBBH 5KVDH 4NN5B 4QRQA 3TJEH 3K1KC 4Z0BL 1NCUA 4DUWA 1Q0YL 3U30C 2MQ3A 1J0KA 1SBBA 3H42H 3IDXH 4BUGA 2D0HA 1QSEB 3WIFB 2IAMD 2HJKB 5C6WH 5DVLA 4CBPA 3T4AA 3JBG7 5CFHA 3LKPA 4KMQA 4OCSH 4X5XA 1L7IH 4HIXL 4Q0XL 2F74B 1ED3A 4OBSA 5GS1C 2V17H 4P23B 2QHRH 2O5ZH 3MLZL 3QCVL 1YN6A 4C57C 2R0KH 2WIIA 3FMGL 2BMKA 4MAYB 1A9BA 1SM3L 4DW2H 1A4KA 3GMNB 4Y5VC 3T0AA 2AEPL 1JIBA 2EDNA 4FQ2L 2XRAH 1JFQH 3NFSL 4Z7QE 4DQOH 4HC1H 4GXVH 4WI9A 5KG9B 3TNMA 4KKNA 5I1AB 1MCWW 3X3GL 3B5TA 4I77L 4Z7UB 5T3ZH 5IEKB 1OGAB 1QSVA 5EU4A 2D7TH 4YDIH 1GXEA 4R3SA 4P2OB 4Z7VF 3X17A 3VMOA 2FNBA 4J4PC 3EOAA 3VWJC 3VFTA 4IOIA 1W0VB 1HHIA 4GLRH 1HE7A 1NUDA 4DKAA 1UEYA 4MNGE 1GPOH 3TWCH 1BZ7B 2A9NL 1QVOA 3W82A 5L8KB 1G0YR 3HR6A 2ILLA 3UTTD 2NY1C 1JZ6A 2XZCL 3MV9D 4U1HA 1XF2B 3NCCB 1DBML 2HT3C 3BP4B 2D0GA 4A6YA 1RZJL 3GNMH 1JWUA 4ODVH 4YDJB 5HXMA 1IGIH 4HS3A 4P5MA 4M62L 3MJ9H 1CLOH 2ADFL 2XWTA 2DTSA 1MJ7H 5IMMA 4NZUL 3K2UL 1M6OB 3O4OB 5GIRA 1IEHA 1U2HA 5EIIA 4LLQA 3LCYA 4GS7B 1KB5L 4JHAH 4PP2A 2HTKD 4O9HH 4L8CB 3KLSA 5MHSD 4X98A 3QXAA 4PBXA 4NZTL 3CFDA 4JRXD 1CBVL 4JKPH 2Y4SA 3QEHA 2BOBA 5IVXA 3PWVB 1RIHL 4Q6YA 5DLMH 5F9JB 3UYRL 1HYSC 1R3KB 4XXCC 5F7FA 2VDLH 2P48B 4YHKL 1D5BA 3UTQB 2VH5L 3KDMB 1FFOB 1SJEA 2L0DA 3GSXB 3IFPB 4ODHH 3V0AC 1JGLH 4O2EA 4J6RL 3S4SG 5FDYA 1MCCA 1GVIA 2EIZA 1HKLH 5CBEB 1LD9A 4LRNL 4TNVK 3PF2A 5E2TH 2AEIT 5EBLA 1N6QH 5SX4I 2VLRA 5KSAA 3WNMA 3GB7B 4FXKA 3VMPA 3WO4B 4M7LT 3V5KB 3WN5A 2E8ZA 5MEND 4PLKC 4Q6IC 2FGZA 3K8MA 4IRZL 4APQC 5KS9A 1MCQA 5C07B 1PSKH 3M45A 3RWFB 4G7YL 3S36L 4OZFB 2F8OA 4FQCL 4KI5F 4RGMB 2CRYA 1KULA 4X4YA 5CSGA 2CD0A 2YA2A 4FTVB 3UZEA 3K4DA 1I3RB 5K59E 4KAQL 2R0WL 1JRHH 2J1KA 3MPCA 3RWHB 4M1GL 1BP3B 3U6RA 1LEGB 5F1IA 3MLRH 3D3VD 4MXQD 3VFWA 5HYJB 4XCFH 1AHWA 1IT9H 2AV1B 4MNHB 5FGSA 1QA9B 3GJFH 5CCKL 2DM2A 3U0WH 1FYTD 2DOCA 3T77A 1YEGL 1X6LA 2OP4H 4M1DH 4NC1C 4JREC 4PRHB 1MQKL 1U42A 1CVSC 4XPTH 5AYUL 2A83B 3OQ3B 1FZJA 1AD0B 1NL0L 4AH2A 1KLGA 3N50A 4H1LB 3I2CL 5CJXC 1B4JH 4UTAL 5LJYH 5D1XA 5E5MB 3TYFA 3BZEB 1MJUH 2G5BB 1P2CA 3RA7L 3ZTJH 4YZFF 2MJWA 4YHML 3W5NA 1T66D 1IE5A 3L7EA 2B1AL 3NGBC 4ODSH 3CPLB 2ZUUA 2G2RB 1IBGH 3IU4H 3PGDA 1CD8A 3V4VH 1M1SA 1A7NH 5LG1A 3BOVA 3A6BL 1F3RB 2NY6D 1LE9B 4O02L 2ATKA 2ZSWB 4Z7WB 4L4VD 3L5XH 3NCYS 1U3HA 1FNHA 3DETD 4KFZC 4MCZB 4ZAKD 4HFUL 4GRWF 4YXLH 3HMWL 4JVPA 3BN3B 5KVGL 1AQDA 4XX1E 2X41A 2D03L 2ZP0T 1ZT7B 1UEMA 4KKCC 4Z7NF 1DUYB 2ZNWA 3ARWA 3NH7H 3WIHA 4X6BA 4JFPB 4UT7H 3O2VH 3QHZL 3WS6C 5GGVL 1CK0H 2VXVL 3ULVL 2X70A 4PR5B 2H32B 2IMNA 5HHME 4GFTB 4I48A 5E4EB 2VLKD 4Z7QF 3FO1A 4WFFD 5KW9L 1OP3H 4D8PB 1BIIA 3T1FB 3ARZA 5FV1L 3MFFA 5CSZB 3KPSD 3LKOA 1GGBH 3I50L 1MI5D 5L88L 1NMAL 2IAMC 5KSBA 1N59B 4XCNB 3T1WA 4OTXL 3IDJB 1MRDH 3L3OA 4WUUE 4EQ3A 1MAML 2VIRB 4PV8A 4X80L 1EFXB 4NJAL 2NW3B 3DGGB 4TSAH 3WLBA 3ZHKA 5D7KD 3I84A 4GT7A 4XVSL 1M7DA 4FQPA 4Z8FL 1Z2KA 2H1PH 1U95B 3F7RA 1XGTB 3E8UH 3KYOA 4NNXA 1JZ4A 3VG0L 5FYLE 3LN9A 3ALWA 3GSVB 5JR1L 5TE7L 1M71B 4F7EA 4X4XA 3MRMB 1ADQA 2X89A 5D5ME 4K94C 5DEGB 1VADB 1DANU 1NCNA 1Y18A 4OB5H 4UDUB 1GOGA 3VWKA 3ZKXB 5F3BB 7CGTA 4MNQB 2XZQL 4DVBA 3TYGH 1CZ8L 4LSQL 5D7JB 3NABH 5BZDB 1I7ZB 3T4YB 3IETA 4BQ9A 2Z91A 1Z5LB 3NCJL 3LKSB 4YXHL 4Y19A 2Q8BL 4PRDA 5FGCE 2CLZB 4HFWB 3RY6A 1I9EA 5ESAA 4RX4D 1WBZA 2E9IA 1LMKA 2EE6A 4MD0B 3ARQA 5JORA 1MJJA 1FC1A 1P4LA 1E6JH 1MH5B 1UZ8B 4H26A 5D71H 3LV3B 4GRLA 4LPYA 1Z9MA 3QXDB 4YPJA 2WUCL 1RJLA 3BISA 4HIIB 1U6AH 1DFBL 1U92A 4QT5A 4Y5VB 4MXWL 4ZUSA 1H3UA 1UM4H 2OR7A 4N8PA 1PAMA 4YE4L 4FQ1L 2ED9A 2OR9L 4M5ZL 1I7RB 4Y4HC 1T21A 4U0RB 2VZ3A 1XGRB 2VITA 4Z0XA 3I9GH 3QFDB 2QLVB 5JOEA 2F5AH 3MV8E 5D7LD 4NGHL 2Q8AL 1FNSH 12E8L 2VLLA 1P4IH 3BE1H 1TJGH 3MA9L 1QSEE 3VE0A 1EO8H 1WT5A 4DKDC 3MRIB 2NCMA 1A8JH 3QI9D 5GSVA 5GRVL 2FDBP 4KUCF 3FT3B 2NY1B 5I8OH 4OF0A 5IW3A 4KQ3H 3BIKB 3D39D 4X8XA 3L6FB 4OZ4A 3RZWA 4DOHE 4YHNB 2GJZB 4KGLA 3KNBA 1FE8L 2LFGA 4CDGC 1T4KA 2ZG1A 5MERA 2OX5A 5EH1A 3A67H 3BKMH 3HZVA 5CSBA 5FAAA 5C2UB 3QSKB 5FGRA 5BRZD 4CVZA 4ODWB 2K1MA 4UV7H 3UBXG 5CUSL 2YWZA 1A14L 1UB5A 3ROLA 1F8TL 3QZWB 4LP5A 4RISH 4HD9A 4DKFL 2R2HB 1Z0NA 5I30L 3PV6A 5H35A 4MXQC 3PABA 4NPYB 3IDYC 3R0NA 3ZE0F 2VLJA 3CH1A 3H3BC 1KXTB 3QCUL 4LLWA 4XP6L 4DTGL 1BLNA 4CL7A 3EYSH 1AP2A 3MRRB 1DQTA 3VFRA 2EYTA 1CDJA 2GY5A 3DVFA 3O4LD 1W8NA 3G6DL 3GKWH 3NCMA 2KUTA 4MDJB 2A77L 3J8F7 4LHQB 5LXGH 1VGEL 3VDBA 5FKAB 3BYTA 2ORBH 3OGOE 4KVNL 2AERT 5D72L 1A1MA 3HMXH 3HCVB 3QYCA 5J1SC 2VE6B 4OCWL 4N9GB 3O11A 1S3KH 2QTEA 3MBED 1CT8B 4YAQA 1IAKB 3BGFC 4LLYB 4Q6IB 4BA8A 1T66C 4HIJA 4PREB 4APQB 4IM8A 2X05A 3BZFB 1EA9C 2OSLB 4XBPB 2F54E 4P49A 3NCYP 5F88B 5JDSB 5GGSB 4LF3B 3OKEB 4G5ZL 4R26H 2BC4A 2NY6C 1PKQA 3C5JB 1BF2A 4MJID 4NRXB 1FLTX 2FWOA 4LSSL 1G6RH 4ZAKC 4GAJL 4ESKA 3RDTB 3V6ZB 4HWZA 2XWJB 4KK6D 3VW3H 4C4KT 3QISA 1JTTA 4R4ND 3VXMA 3DLQR 4M6MH 2FZ3B 4OZGF 2ARJQ 5DD0L 2XTLA 3X11A 5IFAL 2OQJA 1HHHB 5IQ9A 1T3FB 1CFTA 1LO2H 2HKFH 2L7UA 1WBYA 5L6YL 3P9LA 2JKXA 4PJ9D 1CL7L 4JG0H 5C0CD 4G8GA 1N0XH 1MFEH 3LMJH 4MZ3A 1N64L 1YN7A 3SDAB 1JZ3A 1WCQA 4F7PB 5C07E 4Q97A 1ZLWH 4ERSL 3P9MB 3KHOA 3OHXA 2BNRA 4EBQL 1VPOL 3OZ9H 2VUOA 4NNYB 3ABZA 5IMKB 2BVTA 5DRNB 4YNYB 3RKPA 3EYUL 5DZNA 1NGQL 4QHKI 3X14A 4PB9H 1SVCP 4G8IB 5HYJE 4KZEL 4LAQL 4RMRA 4D2NA 2GCYA 3ARGA 1V3LA 3F7PC 5H37G 1CDUA 2M2DA 3O45A 4KROB 1JHTB 3FT4A 5EU6D 2A0LD 4DFIA 2QL1A 1RURH 1UACL 5ANMB 1MFDH 1QFPA 2AW2A 1S7WA 5DQDL 1RMFL 1FL6A 4LCWE 4M9OA 3VXRE 1EK3A 1PEWA 3ULUE 4PD4K 5BXFB 3U36B 2CIKB 3WFDL 5C8JB 5ENWA 3ME0A 1PLGH 3H7LA 1HK6A 4ZNEA 1NAKH 1LNUB 5IFHH 4OLWH 1RU9H 3PNWB 4ELKB 1HXYB 4ETQA 3NIDE 3SGKC 1NANI 2HA1A 4HUUB 1OAQL 3DWTA 3ZLQC 5AAMA 1RULL 2NW2A 1UVQB 1KLUB 4F9PC 1IEBA 3BRGC 2P46B 1YNLH 5J9PB 4JLRB 5J11C 1F00I 1A7RL 2IAMB 1F58H 4YQXH 5D6CB 3BESR 4Z7WE 3D0LA 4YPGB 4Q7DA 2ADGB 2ITCA 1YEDA 1K4CB 1ZXQA 3QG6A 4LVHB 3NAAL 1G6VK 3WHXB 4FFYH 3DX6A 2FLRT 1I4FA 1UJTA 4NFCA 1D6VH 3RWJB 3LEVH 1LO3L 2R4SL 4XAKE 2J6EH 2NNAA 3BJ91 1FVDB 4NP4H 5BS0A 2VDNH 2XICA 3QP3A 2XT1B 2FIKA 3QNZA 5GRJL 2EDBA 2HVJB 1KIQB 1EMTL 3L3DB 3GUTB 3RWIB 3WXWL 2E27L 5HGDB 5KBNC 4PY7A 1IM9D 4ZO9A 5E8DL 3WDHA 1FJ1A 2BSRA 1IC4L 3P0VL 2P8PA 1NAMA 4HJ0C 1RZIB 3WFCH 4WEMB 3D5OF 3WL9B 1EEZB 3LB6D 3O6LL 4QEGA 2P5WA 4YUEL 4K07A 3QI9C 2A6KB 3WE6B 3QA3B 2ZUWA 3UTTB 5TDOB 3DO7B 3PP3K 3I3EA 3MV9B 4JY4A 2CJUH 2C3VB 3F6IA 4NWTH 2FJFA 5JW4N 1OTSD 3GRWH 3V4UH 4PB0H 4C4KO 4OFYD 4PLOB 1S7RB 4RFNC 4JDTH 1FLRH 5EZOL 1KNOB 1V3JA 3VXNA 5L2JA 5CZXD 1F90H 3I75A 4JRXB 3CSGA 2FSEB 3GSNH 1TJIH 3NMEA 1MCEA 4WO4D 3SN6N 3BW9A 4L8BA 4BH7B 1UWEH 1F11A 4NQDD 4AMKH 3QDMD 1VFOA 2DKUA 4MNQE 3PDDA 3DXAA 4LOUD 4XMPH 1ZS8A 5DJ0B 4KKBD 3TZVD 2V2XB 4OD2A 1D5ZB 4WHYG 4XC1H 3PWLA 1S7VA 1U41A 4XPHL 4PJDB 3ESVF 2YR3A 1RJZB 4QRTB 3CFJB 1U8LB 5C09E 3IDMA 4Z77A 4HQQH 2BSTB 3ARBA 1J1XH 3LY6A 4G7VH 2VLMD 1QBAA 2WBJB 1FCCA 1ZLUH 3G6JB 2HRPH 4P2QA 5D2NC 1XH3A 2OXHA 1BECA 3IFNH 2IGFL 5BO1H 1TNNA 2Z35B 4LFHD 2GYSA 1N6VA 3P2TA 1A7OL 4Z5RB 1A0QH 3MBEC 4I18C 1IQWH 2EH8H 2YKLL 2R2EA 1N3NA 3EUUA 5MENB 3LRSB 1FBIL 2R1YA 5J6GB 2UVEA 2FATH 5AAWA 3CK0H 5EORH 5KSVA 5F44A 2XN9A 1NBYA 2X4SA 5L9DL 4PJ5D 4D94A 3RWDB 4LP4A 2Q6WB 1N26A 1Q9LB 1ZT1B 2P5EA 4NQCD 5AZ2L 3S5LB 1C5DB 3MUJA 3ZL4L 4ZUWB 3D3VB 3LH2H 1F3DH 3LKRA 4KK6C 2NQCA 4TVSa 1NCAH 4PJ7A 1V7NH 5F1NB 4JM2D 3QIUD 5D1ZA 4HX1A 1A6WH 1OW0C 4JN2B 1UXWB 1FYTB 3ARUA 2EYRB 2F53A 1FH5L 2B20A 1BBDL 4KY1L 2VDOH 1KB5A 1I3GH 4I0PD 3NN8A 3PWJB 4ORGA 4H5SB 1AGEA 1BVKB 4PJ9C 4WWKD 1X5YA 1S7UB 3HZYA 4U1MB 2XNAA 3LPFA 2C26A 3JWOC 2QKIB 3MXVL 1JI1A 1R5WB 1KTDA 1ULVA 4KMLB 3ULUF 4K94L 3EO0B 1KG0A 2NXZD 4K7PX 2DLIA 3U7WL 2FO4A 5DS8B 3T0DA 2Y06H 5I73C 1CN4A 4NKOA 4XC3H 5C0GA 4U6HA 4QRPA 3CD4A 4KWUA 3L5WB 1UCTA 4X7CC 3ISWA 5E6ID 4MLIA 4DZ8B 2YPVL 1BJMA 1RHHA 4KHTH 4OZHE 1K6QH 3NIDF 3UJIL 1DQLH 4EUPA 1T5WA 2BDNL 5HHPA 4L4VB 5T3ZD 1VEMA 2HN7A 1OM3H 1H5BA 2ZCHH 3SKNA 3TO4A 4U6VL 4JO4H 1XGUA 3VXUD 3KPOA 2D9QB 3D0VA 2E9WA 3VXTA 5LVEA 4YBHA 5IKCB 3D69A 1A3LH 1RAMA 4OF6A 3QEGH 2IH3A 4GKSB 3JXAA 3MQIA 1SEBB 1OB1B 1TZHB 1DSFL 3AAZB 5SWSD 2GT9B 3LEYL 2CUMA 1JPST 2K7PA 4JZNA 4ZS7L 5GS0C 4FQQB 3SBWA 2VLKB 2HJKA 1YMMA 3EO1B 4M4RA 5F21B 1HINH 1BM3L 3DMMC 2GJ6A 2F74A 3KPSB 4EOWH 3AXLA 4P23A 1ZTXH 4WWID 1NCWL 1MI5B 4JGJA 3EYFB 43CAB 35C8L 1OP5H 2PW1B 2XZAH 5KAQF 1Z6JT 4I3SL 1SVZA 3GMNA 5TFSH 3IKKA 4FQJH 4L29A 4UIKH 5ESQB 3EDFA 1QEWB 4X7TB 4H20L 3OJMB 5KG9A 4X9HA 5I1AA 3AS0A 2QR0A 2V2TB 5C0EB 4FZ8L 4MX7B 4FQLH 4Z7UA 5IEKA 1OGAA 2E5EA 4HGWB 4P2OA 3WIIL 1KTLA 4ZFFA 4I0KA 3L3GA 1C16A 5C0JA 4ELME 5E2VH 1D5MB 2R0LL 3SHSA 3WNKA 4GG8A 1WEJL 2CGRH 3CVIH 2KKQA 2W0KA 4DUXA 3BI9X 3SKJH 5F9OL 1RZ8B 5I8EB 5IVZB 2HJFB 3ECBB 4XGZB 3OAYK 5ITFB 3LB6C 4YDJA 1ODAA 1KUMA 2X6MA 3U9PH 1GGIH 4IOFD 1RZ7H 3FQNB 3X12A 3H7BB 4LGPB 1M6OA 3O2WL 3T0EE 3HAEA 1WC7B 1EBPA 3K0WA 1OTSC 1NEZG 4L8CA 2XA8H 5F7UA 2PYED 3GSOB 5IBUG 1G1CA 1E6OH 3PWVA 3RVTD 1INDH 4WV1C 5DR5H 5IHLB 3RKDD 3CX5J 1R3KA 4PJBB 5E0QA 4OLYL 4LSUH 3HE6D 4DGIL 3U7AA 3UTQA 1VENA 1MFCL 3KDMA 1FFOA 4WO4C 5DEFA 1KELH 3GSXA 2M1KA 3OTTA 3ZKSD 3IFPA 2I9LB 4E41D 2XFXB 2A38A 2JF1A 3GMLB 1UADC 1CFNB 1ES0B 4LOUC 3U7YL 4KKBC 4QOKD 1QP1A 3ZKND 3D48R 2NY2D 5D7LB 5CBEA 4NM4H 2X4QB 4JFXB 2V2WB 2CO7B 2AI0L 2Z31D 3B3IB 4R4FL 5CBAB 3GB7A 3GJEB 3QWRD 2NTSP 4LDOB 1NCCH 2IPTH 3QI9B 4ZO8A 4ALAL 3B83A 2CLRB 1TQBC 5JPMB 2QV2A 5BJTB 2H6PB 3D39B 5JXAL 32C2A 2OMBA 4P46A 5IHZB 3RWFA 4OZFA 4FTVA 4LRIA 3LS4L 3RWHA 4RFNB 1QYGL 1ND0B 1LEGA 4O5LL 1I1FA 1RUAL 3GSUB 4OKDA 5BRZB 3OKMA 4ZYKA 2P43B 5HYJA 4AQ1B 4IDJL 1G7QA 1UKSA 2AV1A 1OLLA 4MNHA 5F7DB 1KBGL 4RAUB 3KR3H 3RGVD 1TJHL 1FIGL 1IGML 1MFBL 1M05B 3F12B 3QQ4B 4NUGH 4PRHA 5JQ6H 4JM2C 1TFHA 4M5YH 4QNPF 1EFQA 3QIUC 4XZUA 3SO3C 4OZHF 3TNNB 2A83A 1JV5A 3PGCB 5IB2B 4OLUH 1FVCB 4NC2B 1U91B 3UYOD 3O4LB 1HIMH 1J05A 3VXOB 4H1LA 4ZPTA 4AEIH 1MY5A 3BZEA 2G5BA 2ZSVA 5DRWB 3FFCB 2HFEB 5D1QC 1QKZL 3CPLA 2AV7B 2G2RA 2Q7YA 4QF1B 4F58H 4HBCL 1FFNA 5EZIH 2NXZC 3KWWB 1KJ2H 4EN3D 2EDEA 4I18B 4I1NB 4TSBL 1I8IA 3IFLL 3QFJD 1RJYA 2ZSWA 2XQBL 5GGUB 4JFOB 2Q86B 5F7HA 3TA3B 3DIFA 3WFEL 4MCZA 1MCOL 4BFBD 4GRWH 2ZKHL 5IR1B 3C87A 1X4XA 1J0IA 3E1F1 2ZCLH 1J8HA 2OK0L 2B4CH 1FO0H 2ZUSA 1J1PL 2HH0H 4PJDE 5FYKL 2FEDD 5EZJB 4N1EA 4PR5A 1ACYL 2FD6H 1DL7L 4X6CE 2H32A 3THMH 2JELH 1GZPA 1UYWL 4CMHB 2FYYB 5I1IL 1JZ5A 2I25N 3WS3B 3M07A 5JHDD 1RZGB 2FIRT 4LU5H 5DD5H 3G6JE 3RBGA 4GW4B 1I8MB 2AABH 2ZZUT 3X3FL 1P1ZB 3SY0B 3LIZH 4PJ9B 3OB0K 4FP8H 5HTSA 5C0CB 1T1XB 5B4MC 4FHBD 5T1DH 3HHRB 1N59A 4XCNA 4CVXB 5EU3A 2HKHH 2J8OA 4ELMF 1VFBB 4F7MB 2VIRA 1MFAL 1EFXA 3N1QC 1GHFL 3BHBB 1M7XA 3GO1H 1INQB 2DLGA 3QIWA 4LEXL 4ZQKB 2NW3A 2ZUTA 5I73B 2FJHB 2AEWA 5K9QI 1BQSA 5FF6A 2BXYA 4YR6B 4LPVA 5IIEA 3GSVA 1JPFB 1M71A 4N8CH 3G6AA 3FN0H 2YPLE 3JTSB 4JFZL 1XCQB 3MRMA 2A9ML 5EU6B 2J88H 1VADA 2YS4A 2NYYD 1NGWB 4GMSH 4DVRH 3MREB 3MRNA 5F3BA 3TJHD 3R8BB 3UAJD 3C5ZD 5D7JA 4NO0A 5BZDA 5TE4L 1I7ZA 2QADB 4R9HA 2RHEA 1Z5LA 3LKSA 1DCLA 1BD2A 4PRAB 2CLZA 3DPBA 4HFWA 5IP4A 4R2GD 4QLRA 4KTEL 2ZJSH 5D8JH 4NSKB 5K9OB 3SDDD 1HOCB 4MD0A 3WFHB 3TIDA 4C56A 1MH5A 1PJ9A 4JAMA 4OJFH 3ARFD 5GS1A 4TUJA 2NR6D 1N5YH 4RWYL 3MRPB 4Y5YC 5CGTA 1IKFL 3BDYH 1K2DB 2I24N 4HIIA 3VA2C 1Z3GL 2YPKB 3WD5L 1N4XH 4Y5VA 4ZFZA 4DN4H 3MCLL 3RVTC 3HI6H 3S3PA 4XMLH 3RKDC 4Q2ZB 5GZND 3O3BB 1AGBB 4HLZH 3TC9A 1PX4A 3QFDA 3HE6C 2GITB 1A02N 4HPYL 4OM0H 4L9DA 3B2VL 3S34L 2DKSA 4PJCB 1RI8A 5IJVA 4F3FB 1RK0B 3VWJA 4J4PA 3W9DB 3ZKNC 1U8NB 3C09C 3MRIA 1S78C 4XCCH 1IM9B 2WNGA 4EQ2A 1O5DT 3OAUH 3P4MB 3IDUA 4S1RH 3FT3A 3ZTNH 3S98A 3KPSE 4MAUL 1K85A 3O6KL 2Z31C 4KRNA 3BIKA 2DMBA 3L6FA 4L4TD 1IC7H 3QQ3A 1IGFL 2JB5H 4YHNA 3Q6FB 1PW3A 3FQXB 4PJXB 1C5CL 5T33L 1P5VA 5GJSL 3RWEB 2VERN 4L8SC 5L8JB 4XRCB 1CG9B 5C6TH 5GRUH 1AR1D 2WM0A 4ODWA 3UTZB 4MYWB 4S1QL 1CCZA 1W0YT 2ENSA 2ICCA 4NYLB 5E5UB 3QZWA 1NC2D 4Z7OE 1SHMA 1JF5A 4NN6C 5KVFL 4XXCA 3OGCB 4NPYA 1WZ1H 5CINL 3EOYG 2BJML 4KRMB 3MRRA 1CTOA 4PBVC 3GMOB 4OAWA 4X0KB 4NQDB 1FAIL 3PJSA 5F71A 3RGVC 5C7XL 4EI6B 2WMPA 3TT1L 5EO9B 2QHLA 3SJVD 1RUQL 1Y0LB 1KJMB 3TZVB 2CO6B 4N5UA 4P3CH 5AWNL 5FKAA 1U8IB 4FFZL 1TZGH 2PR4L 4QHNB 5D2LB 5C0AE 3RHWF 3HCVA 3GSWB 5IROC 3GMRB 4P9HC 4WCYH 2OI9C 2AK1H 1RZKC 1BFVH 5GXBB 1DQMH 3I6KA 1CT8A 3PP3H 4G6ML 1IAKA 2AAVA 4LIQL 4LLYA 4Q6IA 2AJUH 1DQQB 1TQBB 4X6CF 4PREA 5E1HB 3VRJB 5ITBL 2UZYB 4APQA 2K7QA 4BK4A 4UT9L 3BZFA 2OSLA 5F88A 4A2MA 4LNRA 5JDSA 3G6JF 5GGSA 3KXFD 4LF3A 3OKEA 1MCJA 1JHKH 3C5JA 4J1UA 4NRXA 5L2KE 1QFWL 2HFFB 4R97B 1KN4L 4C54A 3MODL 3PQYE 2V5MA 1A3RH 3RDTA 3V6ZA 2XWJA 1NDMA 3K4ZA 5CHNB 4H8WH 1VB9A 4GQ9H 3HZKB 4PJ5B 4WEBH 2AQ1A 3VH8A 1KIPA 5CILH 4NQCB 5GRWA 2FZ3A 4BZ1H 1YEJH 3RAJH 1JE6A 1CFVH 5ID1B 3VXSD 2FEDC 1HHHA 1JTPA 3JWDH 4EDXB 1UM5H 3KPLB 4QXWA 3CXDL 3QIUB 3G5VB 3WV0A 4QRSA 3U0TB 2CKBL 4H0GA 3NA9L 3QT2A 4I0PB 1YUHB 3PWNB 4F7PA 5CJXA 5C08A 4KDTC 3IFOB 1U8JB 4LBEB 3HR5B 2NY5H 3CVHH 4WWKB 4NNYA 1JGUL 7FABH 3CGTA 1REIA 1AE6H 5IMKA 1MREL 4L5FL 5DRNA 4YNYA 2V6HA 4XNUH 2YD9A 1BQHA 3MRGB 3HRZB 4E0RB 5INCB 4QRRA 3W11D 3BFOA 2EXWD 2W9EL 3LQZB 1JI2A 1E28B 5E2JA 5E6IB 4NT6B 1JHTA 1UWGL 2AK4D 4K3EL 5ANMA 4YWGH 4RZCB 1BZ9B 1ZV5A 3MV7A 4HMDA 3U36A 2DQHH 3VXUB 2CIKA 2NYYC 1QNZL 1DN2A 1F42A 4RAHA 1BJ8A 1N7MH 3WS6A 3OG6B 3QUMH 2BFVH 2UY7A 4MHHI 5C8JA 2YD6A 3TJHC 4E5XB 3UAJC 4ZTOH 3C5ZC 1G9MH 4HH8A 1ZHNB 4JO2H 4JZOB 4MA3B 4XI5D 1LNUA 3FFCE 2WV3A 3CU7A 3NZHL 3PNWA 4ELKA 3LZFL 3DRQB 1HXYA 5SWSB 4NBXB 2EKJA 4HUUA 3O6MH 2YSSA 2D7OA 1RIVL 2NXYC 1KLUA 4R2GC 4W6WB 4NO2B 1IGTB 3NACL 5J9PA 3LKQB 3SDDC 4JLRA 4L8DB 2IAMA 4PJHF 5EIQA 5E99L 5D6CA 4GW1B 5GISH 4RFOL 4XBGB 4YPGA 1CYGA 3ARFC 1OLZA 2ADGA 4POZC 2NR6C 1WTLA 1MRCL 1K4CA 3GHBH 3WHXA 3GM0A 1I1CA 3RWJA 3BQUD 2GAZA 5GHWH 1KIRA 3TO2B 4M00A 3WEXB 5GZNC 1RIUL 1UZ6E 4D9RD 1H3PH 1NMBL 1CLCA 3GUTA 4BSJA 4CU7A 5CEYB 3NFPB 4PGBA 1FRGH 4JPWL 1UH3A 5JHLH 2FECI 2VZOA 1D3CA 2DM3A 1EGJH 2Y6SD 2P7TA 5MP6L 4E9LA 1Q9OA 4NKIH 4P2RE 4Z7OF 3WL9A 4UU9B 2EIBA 1YEHL 5EA0L 4JG1L 4NM8L 1R3IL 4JM4L 2A6KA 3WE6A 3UTTA 5TDOA 4KU1A 3DO7A 2YD8A 4WTXA 1P7QD 3MV9A 4OCRL 5DTFB 4DGVL 2AXHA 2C3VA 2RQ8A 1UH2A 4WY7H 3BIAX 1I3VA 5IW1B 5IF0B 4RMSA 5KVDL 2UWEB 4HT1H 3MZTA 4MA8L 3TJEL 4BFEA 1S7RA 4K71C 2GI7A 5FUZH 3INUH 1KNOA 4M7JH 3D6GA 1F3JB 3H42L 2AJ3B 3EBAA 2PYEB 4PJIE 4JRXA 2OXGA 2FSEA 2VL4A 1AFVH 4BH7A 4OCSL 3A6CH 2YRZA 2RFXB 1CLZL 1XGPB 4S0TD 1CIDA 1X5IA 3HE6B 4NQSB 2IFGA 2R0KL 4CMMB 1A5FL 2V2XA 4W4OC 1D5ZA 5I9QC 5DJXA 3MRHA 4F2MB 4QRTA 1JFQL 2ESVD 1AIFA 3CFJA 4PJAB 5IESH 1NLBH 5D7IA 4NQXB 4QOKB 4DQOL 1PG7L 2X44D 4K3HA 2BSTA 2NY2B 4JFFD 5HYFA 4N0UE 2X1QA 2RGSA 3C60D 3MRKB 4X8JB 5T3ZL 4UQ2A 2GTWA 1YJDC 4AL8L 1BGXH 3E3QC 2ICWA 4Z5RA 5EU7C 4CN6A 5HGAA 1T83C 3L7FB 3RWGA 3U0PB 5MENA 4JZJC 3LRSA 3ALPA 1SJXA 4ZPVB 1GPOL 5ALCL 3GHEH 4JFED 1A6AB 4JR9H 5EPMB 1J11A 5EOQH 2ICWJ 4X4MA 5JQHC 4XVTH 3GNML 3KGRA 5ID0B 2IALA 4ODVL 4CNIB 2Q6WA 3BP5B 1SY6L 1Q9LA 1ZT1A 2F19H 5FFLA 1MSPA 4ZUWA 3D3VA 1CLOL 2BY2A 1MJ7L 2DM7A 2FX9H 4Q9RH 4F57H 4O9HL 2ZCKL 4JN2A 5I1EH 1UXWA 3N06B 1FYTA 2X4UB 3RGVB 2EYRA 4WHTB 1OWWA 3PDOB 3PWJA 4G6JH 5DLML 5D93B 1JNNL 4H5SA 1KCSH 3RP1A 1BVKA 2CRZA 4K8RD 1MF2H 2D0FA 3QDGA 1RQ5A 3WFZA 1S7UA 4PJXE 3EYQD 1KCUH 4LLVA 2QKIA 3ULUH 2CLVB 2DQJH 3EO0A 3OJVC 4GKZB 3MRBA 2OI9B 1JGLL 2A6JA 4LPTA 4P57B 1YPZB 5JNYB 2PXYD 3O3EB 4MJ6B 2VMFA 5I1JH 2BVOB 2Y25A 5E2TL 3MNVB 4DZ8A 4PJEE 3D2UD 1N6QL 4M7ZB 1KCVH 3FOLB 3W11C 4EN3B 1NFKA 1ZA3B 2DI9A 2R39A 2EXWC 3WYRA 5HYIA 3RIFF 3QFJB 4OF5A 1PX3A 4JHWH 1JPTH 3QO0A 4L4VA 1YEKH 5KJRL 1F2XK 3BAEL 2XXCB 3T2NH 4ZAKA 3WUZA 4OGXH 3TN0D 2YBRB 1C7SA 1A1OB 5ICXB 5I66B 5I8KH 4U4BA 5HGGS 1AI1H 1ZHLB 4HKXA 3D9AL 1OB1A 1TZHA 2BY1A 3AAZA 5FO9A 2GK0B 1TNMA 3MLRL 3QQ9D 1RVFL 4D3CL 4XP9H 5FYJE 4FQQA 4TYUA 4LSPL 2YC1B 1BOGB 4XCFL 2MTPA 1IT9L 2VLKA 4R6UA 2ZG3A 2VWEE 1OT1A 5DO2D 3STBA 4NRZA 1GGUA 5IEHB 4OCLC 1UZ6F 4NQVA 2BOCB 3U0WL 3QNXB 2JCCE 4MA1B 3FRUA 5JW3H 5DSCA 4LVEA 3KPSA 4M1DL 1MI5A 4XPTL 1DDHB 1OGTB 1OAXH 3OJ2C 4P0DA 1CE1H 2Q76B 1QBLH 3VD4A 1CQYA 1OARH 1ZGLP 1P7KB 2BSSB 4WW2F 5JPNA 4HJJH 5ESQA 3MACH 1QEWA 3VGHA 3P40A 5GS2D 2XTJD 1U8PA 2B0SH 4ODUB 2V2TA 3EIFA 5C0EA 1R0AH 4MX7A 1TMCB 2IPKA 1DR9A 1U93B 3IU4L 2HT2D 3V4VL 5T5NF 4QHLB 5IVOA 4X6DE 5DMIH 2DQUH 5DMYA 1YDPB 4WNQB 2EEBA 5IT2L 2ED8A 3L9RB 4PJIF 4G9FD 4ZNCD 2C9AA 5TQ2L 3C5ZB 1RV6X 4RWHA 1RZ8A 2Y6SC 5I8EA 2HJFA 2AXGB 4XGZA 4S1DD 1CFQB 4LHUD 4MDIB 5ITFA 4PGEA 4PY8I 4LMQE 3SGKA 1LE5B 2ZOKB 3NH7L 1Q72H 3QUKB 4R2GB 4UT7L 3OR6B 4F9PA 3H7BA 3O2VL 4RX4A 3TH3T 3SDDB 4KI5D 2IQ9H 3GIVB 3B9KD 5DRXB 3V52H 5E8PB 3GSOA 3ARFB 4HK3N 3S37L 1WV7T 5E2UH 4FRWA 5F7YC 2ZPKH 5H2BB 4BH8A 4PJBA 3M8OH 2VR5A 1GGBL 2AJXL 5T3ZE 1LK2B 1RZKL 4KC3B 4LASH 2E7MA 5CKGA 3H2WA 2I9LA 2XFXA 1KT2B 4Z78B 3GMLA 1CFNA 1YQVL 1ES0A 3QJHB 5DA0B 4TSAL 4JJ5B 4XH2B 2WAHA 4YHYC 3HFMH 5D7LA 1AHWC 1OL0A 2H1PL 2X4QA 4JFXA 2V2WA 1E4XI 3E8UL 3DTXB 4HS6B 1MWAB 3UZVB 3GJEA 2O5XL 1SJVA 4R96B 4XNMB 5A3ID 1ETZA 3U4AA 1CU4H 3QI9A 1QFUH 1J10A 1T0MB 3C60C 2CLRA 5JPMA 5CZVL 3CC5B 4QHMB 1R5VB 5BJTA 3D39A 4OZIE 1RZFH 1KJ3H 1AH1A 3TYGL 3NABL 3RL2B 1MEXH 5D1XC 1PDKA 4XP4H 4HSQA 4K71B 3RIFK 1ND0A 3G9VA 2C1OB 2NY3B 1T2QH 5F89B 3QEUB 1CDBA 3GSUA 3MO1B 5BRZA 1VFMA 4AENB 4KJPD 4C83A 4YDVB 5FHAL 1TVHB 4RAUA 3MOAL 4UQ3A 1S9VB 1NC2B 1T1ZA 3C8HA 3KPRE 3QH3B 3MJ8A 2H2PC 1M05A 4MB5A 2DM4A 4PJEF 1WIPA 3TNNA 1EHAA 4XCEA 4EXPX 1U6AL 3PGCA 4HULB 5IB2A 2NX5D 3OMZA 3QCTH 5I9QB 1FVCA 1MRFL 4X9FA 1UM4L 1U91A 1EEQA 3AROA 3QG7L 4N0CC 5L0QC 3O4LA 4MA7L 3LS5H 3VXOA 3N1MC 3RNKB 1MHCB 1WZLA 4NO3A 5FECA 1RJCA 2VXSH 5DUML 5LCVH 4K8RC 4P4KD 3IDIA 5DRWA 3I9GL 2HFEA 3DJ9A 3LEXB 1LO4H 1T20B 1G7LA 2DDQH 2F5AL 3AC0A 3EYQC 3RVVD 5D2NA 1FNSL 3CFCL 4X6FB 1P4IL 5DK0B 1MIEH 3KWWA 4U3XA 1TJGL 4OQ1A 2DIAA 4CKVX 3MBEA 4I18A 2SEBB 5C0ND 4JZJB 5GGUA 2Q86A 4JFOA 5EWIH 1JNJA 3SCMB 1AGCB 4KQ3L 5IR1A 3PWPD 3CNKA 4M61B 2JCCF 3BO8B 1NLDL 4MJIA 1CR9L 1QBBA 2BRQA 2W91A 3NBNA 4PGJA 5IHBA 1MJ8L 3TN0C 1FIEA 3MV11 3NZ8B 5LBSH 3QNYB 3A67L 3BKML 2Q87A 3JV6B 5IQ7H 4G8FA 4PJAE 2R23A 1P4BH 2FYYA 4NOFA 1OW0A 4HK3J 4XVJH 5I2IB 5KTEH 3B8SA 3UBXA 1RZGA 4O2FB 3VXPB 5FCUH 2YN3A 3MLPA 4RISL 1OAZH 3VXSB 4CJ1A 2YZ1A 4GW4A 3QQ9C 1GGYA 3SY0A 4YLQT 4PJ9A 1GGCH 3VWKC 4XCYB 3WIHH 5C0CA 2ZOLB 1I75A 3L5IA 5DO2C 2DD8L 2O61A 4X6DF 3EYSL 1CGXA 4MS8C 2ARJB 4CUCA 5AZEL 1JWSB 3BPNB 3DVNB 1VFBA 1T7XA 4F7MA 5F1KC 3HUJE 5BMFH 3GKWL 4YX2H 3BUYB 2BX5A 1CLYH 1INQA 4ZQKA 3HE7D 1A7QH 4F9LA 2BSED 1MWAL 2OL3H 4PJGB 5I1KH 3LSOB 3HMXL 4J3SA 3SDYH 5ABDE 5C0RH 5LKNA 4YR6A 3DARA 3E2HB 2XTJC 5CGMA 4GBXD 2VZSA 3JTSA 4TULL 4XX1G 1GJIA 1XCQA 1JHLH 3V7AG 1K4DB 5EU6A 2AK4B 5GRZA 3MREA 3SGEI 2HT2C 5GGVY 5EU5A 2FX7H 4KK5C 1XR9A 4R26L 2FBJL 4KUCD 5GGTH 4PRAA 5HHOE 1ADQH 4XNXL 1XF5B 3V6FB 1YC8A 4NSKA 4S1DC 5K9OA 1NBVL 3RX8A 1HOCA 2XIDA 3WFHA 2ZWLT 4M6ML 5DZOA 3JTTB 2BHUA 3AU1B 1NGZB 5EOTA 4LLDA 2HKFL 3MRPA 4ACPA 1CXKA 4KI5C 5HD8D 5HJ3A 3FTGB 1K2DA 3BZ4B 3B9KC 1N0XL 2YPKA 4S10A 5DUPH 2IFFL 2GTZB 4JPVH 2HP4A 5EBWA 2R8SH 4NUJA 3O41B 4PTUA 1NFIB 4N0RA 4Q2ZA 3O3BA 1AGBA 2CKBA 3BQUB 3GSNB 3CZJA 4OZIF 1CGYA 4N68A 3WKMH 5F7EH 5BV7H 5T1MB 4EKXA 2X4NA 4JGUA 3PHOA 4PJCA 3CFIC 2IC2A 1B0GB 3X13A 4F3FA 1RK0A 4KQ4H 2J8UB 4NHCH 4KZDH 4PB9L 1KGCE 4X6EA 1U8NA 2NY4D 1MPAL 1VACB 2CDFB 1IM9A 1I3UA 1VFAB 3P4MA 1G7MB 2Q7NA 2NY0D 1MFDL 1D6EB 3QWOB 4TNWK 5A3IC 1RUMH 3QXTA 3U9UA 3Q6FA 3FQXA 5HHMD 1AR2A 2HJLB 4HUVB 4DKEL 1P7HL 2XKSA 3RWEA 4GG6B 1CG9A 3DNKA 4YHPB 1CDCA 3RBSA 3CIQA 4KJQD 3TVMD 2GW5A 3SE4A 3D25B 2NTFB 3KYKH 4OLWL 3F8UB 2J4WH 3AY4C 2UZIL 4OFYA 4QHUB 2CIIB 4NYLA 3U4BH 1BAFH 4WV1A 4LVNC 3RZCD 1N8ZB 4WUUD 4YHZH 3UPRB 3TT3H 3OGCA 4KJPC 4XNZB 2GSIB 4WO4A 5EDXA 2G9HB 4NQDA 3QPXH 4CVWA 1DUZA 1NPUA 3QDMA 4S2SB 4EI6A 1IL1A 5EO9A 5FYLD 1Y0LA 1KJMA 4ONOA 4YHYB 3LEVL 1U8IA 3L1OH 2J6EL 1KPVA 2DKMA 3UC0H 4QHNA 2HYMA 5D2LA 3DBXA 4NP4L 1A2YB 5IM7B 2ESVB 2Q1EA 3GSWA 4BZ2H 3GMRA 3G04B 2VDNL 3FAXA 5F93C 5I0DA 3KLAB 2OTUB 3ARSA 4P4KC 4JFFB 3SGEH 1DQQA 3NIFE 4FNLL 4FOMA 3VRJA 3RVVC 1AY1L 4Z76B 3UJJH 4R8WH 3L3HB 3MUY1 5I74C 3WFCL 3ILPB 4YGAB 4EZMA 3F7YB 3PHQA 2H3NB 3QAZC 1ORQB 2HFFA 1W2KT 4JFEB 3P0GB 2FGWL 1S7XB 5DJ8B 2X5PA 4OM1H 1CGSH 3UPAA 3NVQA 5CHNA 4NWTL 4O2CA 4PJ5A 4U7SA 3C08L 3HUJF 3FB5A 4EI5B 4M48L 4NQCA 4PB0L 5MEQB 2B8OT 3L3KB 5KANI 2IPUK 4NFBA 2LVCA 3WBDA 4JDTL 5DVNA 4EDXA 1BQUA 4JM2A 3KPLA 3QIUA 1F90L 2G5RA 1A6UH 3GBNH 3G5VA 3KJ4C 3VFMB 3U0TA 4HS8H 1TJIL 4ZDHB 4GSDH 3PWNA 3MV8D 2HVKA 3IFOA 3FRPA 5F3HB 1U8JA 2IQAB 3HAEG 4WWKA 4XMPL 2CQVA 5D1QA 3BEVB 4UDTB 4XC1L 3QULA 4PGCB 3MRGA 3HRZA 4G43B 4BQ8A 4E0RA 5INCA 3BDXA 5DHVA 5I76B 5FM4A 3HE7C 4HQQL 1RFDH 4XWGH 4EVNB 2PXYB 1J1XL 4G7VL 3BDBA 2VDKL 3DV4A 1C12B 5E6IA 4P59H 5FHBH 4NT6A 3D2UB 4MAYD 4UT6H 4HPOH 4UMGA 3EHBD 4RZCA 1QRNB 5BO1L 5INDB 2FO1A 1BZ9A 3OKDB 1JF6A 2DQFB 4GBXC 5EN2B 1A0QL 4TOYH 5ACZB 1IQWL 4AZ8A 2P45B 3VXUA 2VXQH 4Q9QL 1MLCB 5SV4A 1BFTA 4Z7VB 4OT1H 2FATL 5EORL 3T8XB 1CWVA 4HMEA 3WNNA 1ZHNA 1ZOXA 4I2XE 2IBBA 4JZOA 5I75C 5DWUH 5TDPB 1XF4B 1FG2B 3HTLX 5CWSB 3DRQA 5ISZE 5SWSA 3HC4L 4GKOA 4M6NH 3T3PF 3MLVH 3EFDH 4NO2A 1IGTA 2LV4A 3QIBD 3LKQA 1SY6A 4L8DA 4OZFG 5DJAB 1A6WL 2OTWB 4GW1A 2EICA 4XBGA 4TTDD 4OFDA 1FDLL 3VGAB 3GMPA 2VDOL 3ELAT 3IAGC 5D4QA 5A16A 3FQUB 2A1WL 4L3CA 4ZTPH 3BGAA 3MLUH 4LSRH 3RL1B 1HXMA 2NY7H 3GKZA 5FA4B 4R90H 2DQGH 4KMTH 2HMID 2APFA 1BOYA 5EUKA 1UT9A 3H0TB 2P44B 1FFPB 2F54D 4WI2A 5J56B 3REWA 5JW4M 2AQ2A 4XC3L 2MOVA 3NFPA 2E7LC 4XBEH 2ATPA 1FORH 5GGQL 1HNFA 1XIWD 4KHTL 3V7MA 1K6QL 3GJFK 3FAWA 1H8NA 4H1LG 1DQLL 3UJTL 4JB9L 1AQKH 4UU9A 1KB9J 2NY4C 5IUSA 1OM3L 3STZB 2MMXA 4FG6D 4JO4L 4PJ8D 1NEUA 5TQ0L 2ZUXA 2NY0C 3FHAA 5DTFA 1UWXH 1BVZA 4LHUB 1U58A 3KYNB 3FOMB 5IW1A 1NAMH 1JK8B 4G80B 4LAJH 3UYPA 2GQHA 2B2XL 4XPFH 2UWEA 5SX5K 5B8CC 4QXGL 2IWGA 1WGOA 3RUGB 5EC1B 2YUVA 3H9SE 4Y5YA 1F3JA 3LKNB 2AJ3A 3DI2B 5B38B 4FQXD 3TVMC 3SKUD 1VKXB 2DTMH 3D85D 5E03A 2PYEA 4U1JA 3ZT6A 5DHYB 4PRPD 4K8RL 4UNVA 5I18H 3MV01 5HSFA 1HINL 3DGCR 2BVEA 3GMQB 3VFGL 3VMNA 3RZCC 2RFXA 3BH9B 3NIFF 3V2AR 3MA7B 4LQ1A 1XGPA 3HI5L 3HE6A 3ZZ1A 2VN7A 4NQSA 2XZAL 5GGSY 4RFEB 1KC5L 4E41A 2VB5A 1FZOA 3JWDC 5JOFB 4UIKL 5E9DD 4F2MA 4Z0BH 4PJAA 4XWOD 1TENA 2XG4A 1JYNA 2DYPB 4NQXA 4QOKA 5KAQG 1IEAA 4IMLB 3A0OA 1GC1H 3RWCB 3VXRD 5B39B 4LCWD 3T2PA 3MNZB 4FQLL 4Y7MA 3ULUD 3DUHA 3O3AB 2Z31A 2DQTH 4OFKA 4HIXH 4Q0XH 1EPFA 3QWRA 3UP1A 3H8NA 1I85C 2OCFD 3I02B 3B43A 1OP3K 4Y4KB 4D9LL 4PGDB 3L7FA 3QCVH 1EV2E 5J1TC 5E2VL 3U0PA 2KPNA 3FMGH 5D7IF 3NIGE 4ZOCA 1KJ2B 5EPMA 2VXTL 4BQ6A 1LK3H 1Y6MR 3NFSH 3SQOH 2OZ4H 1QFOA 1FYHB 2PYFB 4OCNC 5DD1L 5ID0A 5J13C 1G0XA 3CLEH 3BP5A 3MYJB 4GRWB 1GGIL 1JF1B 1U8HB 2R4RH 2J8UE 3DROB 2EDLA 5DA4A 2JK5B 1EXUB 3ET9F 2WP3T 1H3TA 1BWMA 4PRIE 1QD0A 3RGVA 3W81A 4WHTA 3PDOA 4PBWD 1KPRB 1SQ2N 3BN9D 1G9MC 2EDFA 5DR5L 3JUZA 2N7BA 3RVUD 1XMWA 1DBMH 3B9AA 5DDHA 4LSUL 4C59B 2NX5B 4KDVA 1TTUA 2AS5M 3DI3B 4HDIB 2J3SA 4N5ED 4XPGL 5IROA 4MXVE 5DD3L 4M62H 2CLVA 2ADFH 2VAAB 4GKZA 3HN3A 2C3GA 3K2UH 1J87A 2X4OB 4P57A 1KB5H 1YPZA 4LSVL 3O3EA 2QSVA 4MJ6A 4NM4L 5KZCD 1EX0A 2BVOA 2Y23A 1CBVH 3MNVA 4MNGB 2FHBA 2GHWB 3FOLA 3QUXB 5I74B 5HPMB 1A1NA 4EN3A 1ZA3A 3UYRH 1BHGA 1DBKH 5GSRB 3QFJA 1GAFL 2O5YH 3NPZB 4UOW1 4MAYC 4WI8A 1T7YA 2YBRA 1WWBX 1A1OA 3PWPB 3EHBC 5ICXA 5IMLB 4X5LA 2EECA 4XXDB 5MI0C 4PPTA 1S7TB 1ZHLA 4GAGL 1WAAE 1WFOA 3DX7B 4EUPH 5E8NB 3BRDA 4LRNH 2C7UB 4OUUB 1VCAA 1MHHB 3CFBB 5DVMA 1OAUH 1FZMA 5DJ2B 1KCRH 2YC1A 4JCLA 4PJFE 1BOGA 1UCBL 3MRDB 5JHDA 2CUIA 4MNQD 5IEHA 1IAOB 1Z9OA 3PUCA 4OGYL 3HG1E 1V3KA 4KDTA 3VFUA 4IRZH 1HWHB 3QIBC 3B6SB 4NUGL 1IGJB 4M5YL 1DDHA 1OGTA 4FQCH 5C09D 5DC4B 5FXCH 3KLDA 4V2BA 2Q76A 3SKMB 4KAQH 4OLUL 3C5SB 3EJZD 1OP9A 4TTDC 1P7KA 5FM5M 3UTOA 2L4OA 3QZWG 4BFIB 1KXVC 4KHXH 3KJ6L 3CMGA 2MWCA 1ZE3C 2XQYK 3RJQB 5C86A 1DEEB 3JV4B 3OPZL 5C2BH 1BPVA 5CCKH 5ELIA 1HWGB 1LHZA 2WLZA 1U93A 1YEGH 4QHLA 4GBXB 1KJ2L 3AS3A 2CDGB 1MQKH 4WNQA 3AVEA 5AYUH 1H8OA 3DHJA 2Z4QA 4K2UH 3EAKA 3L9RA 1NL0H 4Y5XB 1XIWC 3C5ZA 1NMCC 3I2CH 2AXGA 4UTAH 5I75B 1CFQA 4W70A 3AB0B 2J12B 4P48A 1FFQA 1LE5A 2PW2B 3TBSB 5E2WL 4FG6C 1QPPA 4J8RB 3VD7A 4FABL 3QUKA 2B1AH 4PJ8C 3ZT5A 5LWYH 3OR6A 1DP0A 2AXFA 3SDDA 1T2XA 5EO1B 2JELL 3MRQA 3GIVA 3A6BH 5DRXA 4O02H 5E8PA 5F72S 3ARFA 3WO4C 1G7PB 1YNTB 3P73B 4YHLH 1N6UA 1X4ZA 4YC2B 2AABL 2WP3O 1QRNE 4LCYB 3RVXC 3HMWH 4FQXC 2EEAA 5KVGH 1LK2A 2D03H 3HAEH 4RGMC 1J5OL 4XPBH 4K7FB 2HKHL 3QJFB 4X9IA 2DJSA 3NIGF 1KT2A 3B2UD 3QHZH 1JZ8A 1I1RA 3ULVH 3R1GH 3GO1L 4HJGB 4K3JL 4G42B 5F7LB 4JJ5A 5EUOE 2FL5B 5KVMC 1FPTL 3R06A 3TPUB 4P5TD 3DTXA 4HS6A 1MWAA 4XWOC 2EDJA 4PS4L 4XNMA 2NY4B 2J8UF 4HUNB 2X7LB 3KPPB 4LMQI 5L88H 5IHUL 1NMAH 4AQOA 1T0MA 1INEL 3JWNC 2J88L 3ULUC 4OTXH 3CC5A 5IK3A 1OTUD 4GMSL 4QHMA 3PV7A 2NY0B 2EDDA 4L4TA 2AJYH 1MAMH 3N85L 4HHAB 3L3IB 5JOPD 2VTFA 4X80H 1T1YA 1W0WA 4NJAH 4ONHA 3V8OA 3IF1B 1ZLWK 4XVSH 3F5WA