1MJ8L

High resolution crystal structure of the fab fragment of the esterolytic antibody ms6-126
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
219
structure length
214
Chain Sequence
EIVMTQAAPSVPVTPGESVSISCRSSKSLLHSNGNTYLYWFLQRPGQSPQLLIYRMSNLASGVPDRFSGSGSGTAFTLRISRVEAEDVGVYYCLQHLEYPFTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution crystal structure of the Fab-fragments of a family of mouse catalytic antibodies with esterase activity
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords IMMUNOGLOBULIN MS6-126
total genus 46
structure length 214
sequence length 219
ec nomenclature
pdb deposition date 2002-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mj8L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mj8L01
1LO3L 3X14B 1KBGH 3MOAH 1SVZA 1WAAF 4ODTL 3RZCB 4JZOA 1CZ8H 5DWUL 4L3ED 2XZQH 2FLRT 3RWEB 4LPYA 1RJYA 5J13C 2Z31B 4G8GB 2ED8A 3VXUA 4HKXB 3I9GH 1MF2H 2MKLC 3TV3H 1ZS8A 5J3HD 3CXHK 3KPRD 4GOSA 2P49B 3ZDZE 4OSUH 1FNFA 1Q94A 1A2YA 5DC9B 1XGYH 1AP2A 3MRGA 5FHAH 2A0LD 5FOBB 2VXTH 4QHMB 1H5BA 1OP3K 5I75B 4QXWA 3N9GH 4LCUB 5IVZB 3X13A 3RTQD 3CGTA 2YC1A 3H3KA 3DX9A 2IGFL 1NGYA 1NCUA 1YNKL 2IQ9L 1FG2A 4I48B 4RRPG 3QEHA 1S7SA 2VDKH 2M26A 3MO1B 3FO9B 3OV6A 4XC1H 4Q6IB 3QUKB 5HY9A 5A2FA 1ZHNB 3P0YL 4F58L 4FQLL 2DIJA 4NCDA 1S7QB 3C5ZC 5I2IB 4PJAF 4HLZG 5EC1A 3W82A 3KPSA 4TULL 5IFHL 4LLWA 5J0BA 3BZ4A 3IU3A 1KTDB 4OZFA 4OZGA 1YNTA 4OF0A 1A1OA 3QIWA 4M1CD 1R5VA 3QUZC 3T3ME 5JHLL 3AS2A 5GQBA 3SDCA 3QUYA 1U2HA 1CGXA 1VKXB 5FB8B 3G5VA 3P4NA 3OBAA 4HXAL 4YDJB 5FECB 4PBVC 3QA3B 4XHJD 1OF2B 1INEL 5MEPA 5I30L 5K9KB 1U93A 3MRLA 2EZ0D 3QI9C 3C5ZB 4DGIH 4MJIA 3D5OF 1P6FA 2C1OB 5C08E 1GZPB 4PR5B 4WW2A 4PV8B 4K3DL 3O2DH 3RVVC 3JV6B 4LSRH 3OAUL 7CGTA 3DMMC 4LOUC 1B0RA 5JOPD 1IAKA 2BSTB 3BP5A 4IDLA 4XNYL 5KN5B 4NO3A 4QHKJ 4L8SA 4XVSL 2FSEB 2DD8L 5AEAA 5KJRL 2IANE 2X89D 4Y2DC 1FZJB 5FO7A 3VFWA 4G9FD 4NBYB 3UYOD 1CDIA 4IJ3C 2L7UA 2R2HB 3VMOA 2BNRB 1P4IH 1FQ9C 2C4XA 5C07E 3BKML 4XCYA 4P59L 4U1GC 3U1SH 5DMJB 3J8F7 2BJMH 2H2SC 2CJUH 1H9VA 1WICA 2VRAA 4LSSL 3QIBD 5GRVK 2YD6A 2EDBA 2CLVB 3P9LA 4LSTH 4MA8H 4M7LT 3TVMA 2VDLH 3MCLH 4RDQF 1BZ9B 4K9EL 5GS0D 5DMGC 2MCG1 3LPFA 1HH6B 35C8L 1WBYA 4Q9QL 4KTDH 2DQCL 5FOJA 4ZMAT 4GBXD 2CR6A 5GJTH 3BKYL 5CGMA 1KLGA 4NO0A 4RBPK 3B2VL 4JB9H 5D72L 4LLDB 4X8JB 5JHDE 4E42A 3GIVA 1FHGA 4EOWH 4AK1A 4XNXH 5T1KA 2R0KL 1YEJH 4Z7WA 4JFQA 3O45A 4MA7L 3BEWA 3V7AG 4X4XB 3AU1B 1UCTA 1NMAL 1IL1A 5C6WH 3LKSA 4GQ9L 2P5WD 2R39A 1QNZH 3TN0A 2B2XH 2VQTA 3OGCB 5EBMB 3A67H 5I17A 1Z9SA 1LNUB 3TN0D 4GRMA 4NKQB 4PJ7F 4JO4L 1WGOA 1GGIH 4QF1B 3F7QA 1I7ZB 2FL5B 5HHQB 3L3KB 2H1PL 4HHAB 4LMQE 1G7PB 1T0NB 2IH3A 3FFCD 3BEVA 3T2PA 3MXWL 1A3LH 4XAKD 1UB5A 2VXTL 5LBSH 4NHCH 3QPQC 2FD6H 1A3RL 3VXOB 5GIRB 3UPRB 4G8EB 2A6DA 1L7TH 3NPZB 5CZXD 1K4CA 1G9NL 5LWYH 1AD9A 2KH2B 3AAZA 1UXWB 3QISA 3T4YA 2H3NA 2OM5A 4FTVB 4U1NB 1OGTB 1KFAH 4D3CH 5D7JC 4P2OD 1Z5LA 1CGTA 3MRDA 4P3WA 4X6FA 3O9WD 2VSDA 5D72H 1FVEB 1GAFL 1XF3B 4LLVA 5BQ7B 4OF5A 4NZDA 5DHXB 4XT1C 3G5YA 1A64A 1CU4L 1UWXH 3HE7B 2J8UA 2KUTA 2VMFA 4U1SB 3T1FA 3TBYB 1PG7X 4U1HA 4LVHB 4M1CC 2FO1A 5F9DC 1OVZA 2APFA 3OKOA 3MLTB 3VXNB 3R1GH 3UTQA 5JORB 5I1HH 3PIQA 1DFBL 3WDJA 2BSRA 5FFLA 5EG6C 5DD3H 5JNYA 5DC4B 4X6BB 2OLDA 3QUMA 4J4PA 1MRCL 4NSKA 4M93B 2VDRH 2EXYD 5DJCA 3UZVB 1ADQH 2PW2A 3UYPA 1NGZA 5F7DB 4K71B 5MEOA 1JP5A 4P46C 3GIZL 2DBJA 3ZKND 1EEZA 3OAUH 4YHYB 1S78D 3TPUA 1IEAB 2GFBA 1Q0YL 2X4NB 4RNRB 4YO0A 3CZFB 5T5NF 3WBDA 3MLPA 1ACYH 4AG4H 5KJRH 1KXQE 1T89C 3BUYB 1IQDB 1YY8B 4XC3H 3PWLB 1U8PA 1RUPL 2PO6C 5KVGH 3K0WA 3GEWB 4HSQA 5JLZA 4UI2A 3PWPA 3EYQC 2NY4D 2QKIB 4PB9L 4WW1A 4Q58C 1PKOA 2NY5L 5GJTL 1AGEB 4TSBL 3PWPD 2NY3D 4YHKH 5IT2H 4IM8A 3OKEB 2WK2A 1E27A 2IFGA 3WIHL 1T4KA 3G6DL 4LSVH 2FIRT 1CBVH 3M17A 1GGUA 4NNPH 1W72L 4G8FA 3SJVD 3BAEH 3SKUD 2ID5A 4JDVB 5GHWL 5KSBB 2YRLA 2HH0L 4PJXF 1JHLL 3BWUC 2J8OA 5C09E 2X1OA 1MIEL 3MOBL 2WWKT 2IQAB 1T04A 3O3EA 1QRNE 4XPTL 3IETA 2BVYA 4IIQC 5I1JH 1RZ8B 1UADC 1HSAB 1OP5H 1FCCA 4YBHA 5JPMB 2HVJA 5KVEL 1WAAA 5F1IA 4NO0D 1QQDB 2FECL 1CN4A 4DGIL 4M5ZH 5A1AA 4OFYA 3GMNB 5EOTA 2DN7A 3HI6L 4KKBC 4X4YA 3QH3A 1DQJB 3TPKA 1T83C 5C7XL 4I18B 5J6GA 3O3AB 3WFBH 5KZCD 4OF8A 5IMLA 1HQRB 4F15B 1TNNA 1DE4B 1RV6X 1U8LB 3U4EB 4S1SH 3E2HC 4QGYA 5LGJB 2O26U 1KIQA 4RNRA 1XGYL 3CFIC 3DIFB 2BHZA 1KPUA 3L3OA 4JO3H 4FQHA 3B9KC 3MJGX 3MSPA 4L8SC 3VFPB 4AL8H 1IZKA 4O4YL 2AAVA 4J3UA 4S1RL 1WTLA 3MBEB 3TN0C 3K74B 1EVTC 1NPUA 2VKWA 1YEFL 2J3SA 1B2WL 2HH0H 4P0DA 1FBIH 1PSKH 4ETYA 4HCRH 1WWCA 1XGUB 2BFVH 1NCWL 5M94B 1RD6A 1CDCA 2DQFA 2EE9A 1W0WB 2NZ9C 5HYSG 5E2TL 2LAGB 1IGCH 3BFOA 3O6MH 5JOPE 4DN3L 4JFOB 4G7YL 3BZEA 5DJ0A 2SEBB 3GB7B 4EI5C 4X4ME 4NJAL 3G6JB 4YBLC 4HIEB 2P5EB 2R2EA 4KPHH 3HR5A 4HXBL 4OZHE 4JANB 2BVOB 1FVEA 1DEEA 2WV3A 1MFDH 1ZT7B 5C92A 4I3GA 1RJLB 1FC1A 4DVRL 1ZT1A 3IVKB 5DQDH 1NMCB 2E6PA 1J0JA 4HIHA 4KJYB 1SY6L 4X6DA 2LV4A 4JZNA 1ZLVH 4LRNL 4LCWA 1LO5A 5FDWA 2VH5H 2WINB 4YHOH 2XRAH 5IBLD 1B4JL 1HWGB 3VFVB 1HZHL 5F6HJ 1OSPH 5IEHB 3H9HB 5IP4A 1CLOH 5EUOF 2F54E 5BZDB 2OS7A 4QF1A 3ZSSA 1KG0A 3EOTH 4D9RE 3QDGA 2DLFL 5J1SC 2V7NA 2VJXA 1XF5A 4OIIH 5DRXA 1HI6A 3OGCA 3H9SD 4OFIA 3K81A 5DMKB 5F9AC 3LKSB 1IL1B 5ID1B 2NXZB 3CFBB 1MNUL 4LEXH 4CDHA 3EYUL 3DX6A 5IBTH 1RUAH 4XVTH 3PWJA 3SKMB 3N1PC 4WFED 4HC1L 5LCVL 1U8NA 2VAJA 1EJ6A 5EZOH 2FEDD 4JZJC 2FEEI 1I7RA 3JBG7 3O6KH 2AKRB 4NJ9L 4PJXA 4KV5F 3RFZC 3MJ7B 1ORSA 4NQSA 3OGOE 1NGQH 4NO0B 2DLIA 3H2WA 1OCWH 3MV8D 4KXZH 1TPXB 2YA0A 2LVEA 1FP5A 3MLRL 3BD4A 4ZS6D 2W9DH 4HAFA 1Z9OA 3VXTA 3MOBH 5CLWA 3RNKA 2KQMA 4G6JL 4F7EB 3NIDF 1UA6H 4TRPH 1BQHG 4YXHH 4N8VB 2ICWA 3QJFA 3BDYH 5C0CB 2X4TA 3HB3D 3WKML 5L8KB 3T0AA 3MA9H 3NH7H 4NIKB 5B8CC 5MI0B 3BJLA 4XZUA 2NY2C 1R24B 2GI7A 5EUOA 3RUGA 4X6EA 1GGCL 5CJXC 2JJTA 5IW1A 1EFQA 1VGKA 3RL1A 1IGML 4PREB 4R0LA 4KAQH 5FYKL 5IMKB 4MQXD 1ADQL 4D8PB 3MFGB 3MRMA 2R2HA 5ANME 1NDMA 3LHPL 2YOCA 4YDLB 1ORQB 3DV6B 4CU8A 4HZLA 5IQ7H 2R1YA 3MCKB 1P9MC 4MJ5B 3WS3B 4W70A 4XP9L 4LPXA 4O2CA 2IG2L 4NZUH 3PGCB 1T2JA 1U6AL 3PL6B 3QDAA 4LAJH 2HFFA 5CLTA 1T89A 1FH5H 3NPSB 5C70A 5HHOB 2JCCE 2R0LL 2BK8A 1DBMH 4XBPB 1LK2B 5CHNA 5DXWA 4CVXB 3U2SB 3P9MA 1NSNL 5C0AE 4HXBH 6FABL 5ICYB 2M2DA 1YEDB 4KRMB 4R6UA 4OZGB 3K1DA 4M00A 1HILA 1TTGA 1IC5H 1MCWM 2J8UF 1TZGL 4PJFF 1OM3L 1RJCA 3MODH 2AJYH 2VLKE 5CEZH 2I25N 5ERWA 3WUWA 3PHOB 3EZ8A 2UY7A 1ORQA 2EIZB 1F4YH 1MH5B 2DRUA 2A6JA 4M93C 4D8PA 3X17A 3ARBA 4ZQKA 4ELMA 3RL1B 1E28A 4RGNE 3JTTB 5C9JA 3MRKB 3ULVL 1MRCH 2EYRA 4RIRB 5C0BA 3QXDB 4EEEA 5IFJA 3HHRB 1MFCH 4CVWA 1RULH 4Z76A 3EFFB 2YC1B 3MLYL 1ZE3C 3DUSA 4XCCL 2F58H 3OKYA 1A7NL 3OXRB 3ARUA 2B1HH 5ABDE 2FBJL 5IUSA 3GNMH 4H26A 3LOWA 2XICA 4NQEE 4E41E 2VDML 2AJVL 1CLOL 3KLAB 1HQ4B 5HGHA 1A2YB 3GO1L 4Z18A 4BFIA 1TJHH 5F3BB 1IMHC 3SE8H 4R26L 1G6RH 3L5HA 4WVRA 2EDYA 3M1BA 3GMPA 1DJSA 4EXPX 1K5NB 3SDAD 2F53D 4DZBA 3IAPA 1GCFA 2WIMA 2NXZC 3PWVA 2BVEA 3T3MF 4JO3L 3BPNC 3MR9A 5IVXF 4JRYE 4DAGH 5D7JD 1NEUA 1U8NB 1HKLL 4YDVB 5TE6H 5I19L 1UM6H 4LLUA 4Z5RA 1N5AA 2DLHA 1NUGA 3MXVL 4P9HH 1EUTA 1UZ6F 1XZ0A 4D0CB 1QSFB 3AY4C 5CCKL 4JHZA 1QSFD 5FGCB 1BQHA 1YY9C 5DQ9A 2AQ3A 3QPQD 1IM9B 4MLSA 4ZFZB 2DWEB 1YEEL 2IALA 3O4OC 2J6EA 2VISB 3GK8L 1A14L 3FQWB 3FRUB 4XHQA 5BXFA 1KB5B 2MCPL 2HRLA 2OK0L 2W0KA 1I8IB 2IMNA 2Q7YB 4R96B 3U0PB 1WFUA 1Z3GL 4TUJB 4B7LA 4ZUTB 4HC1A 1JWSA 5J12C 5DJ8B 2UWEA 4U33A 2BNUA 4FQXD 1EZVX 1U6AH 3VXPA 1MCSA 3I6KA 3OR7A 3VXUE 2AXFA 2JCCA 5EO1A 4FHBD 1HHHB 4U6VL 1HHIA 3IFOB 4FQXA 5DD6B 2FWOB 4EI5B 1E0OB 2N7AA 3LB6C 1FFOA 1CICB 2FH8A 4PB0L 4LEOB 1U8HA 4PRIE 4JQXC 5CGYD 5C0AA 3MV01 4LDLB 5T1LD 4S1SL 4Y19B 5JTWA 5L6YH 5C0AD 3V7AE 1EX0A 4Y8DC 4XCEA 5T1LA 3RPIB 3HI1B 2DM7A 5GGRB 3QEUB 2NLJA 5JA9A 1MVUA 3FO2A 3RGVA 1RZJH 1JGUH 5GGVY 4PJIE 4L3CB 5A2KH 5FK9A 5F8QC 2X44D 4EN3C 1W2KT 3KPRA 3MZTA 4YEFA 3RBGA 3DO3A 1KYOK 3HFMH 4F7CA 2HTLD 4D0BA 5KS9F 3LV3B 2ICWJ 1A6TB 3P0VL 4WUUE 3EYQD 4NN6C 5TDNA 3KPSE 4NJ9H 3ROLB 4H1LA 1HH9B 1CXKA 3K2UH 3T0EA 1FL6A 4NRXA 3DO7B 1JV5A 4MA7H 5HJ3A 4NN7B 3W2DH 4B53A 5ALBL 3SCMD 4PRAB 4NQEA 2RR3A 3PNWA 4P2RD 1WT5C 3QUYC 4M6NL 1F6LL 1MFDL 4CN6A 2EO1A 1ZGLA 3EAKA 3AS0A 2A73B 3O3AA 2AK4E 4J3XA 4V2CB 4X4YB 4JFEB 3ZDZF 1YN6A 3GMNA 5EOTB 1G6RL 3RWHB 5DRNA 1F2QA 1MAML 4HWZA 4F7MA 1JZ2A 5BZWB 1NEZB 2IBBA 5H2BB 1VADB 4XCCH 5I76B 2WLYA 2EKJA 3HB3C 4LLYA 4OZ4B 3D0VA 2B1AH 3VRJA 5EFIA 3O0RH 3ZSTA 1OARH 3I3BA 4YXLH 4KY1L 5IVOA 4U6XA 2BHYA 4MQXC 1DBAL 4NM8H 1IKFH 4XMKL 4TPRL 2HMID 2APVA 4HAGA 2KQNA 1DVFA 5DMIH 1UYWL 5C0RH 3IJHA 4KRLB 2XTLA 3VW3L 3KPRB 3I85A 1IM3B 1CR9H 1G7JA 3DHJA 3U30B 3V2AR 1OGAE 1J12A 4Y5VA 2N56A 5I75C 5A3IC 1NSNH 3VFNA 1DSFH 1BVLB 3LKQB 4BSWA 5GRUL 1H3XA 4XX1E 4YHYC 4CADB 5EWIH 1U8PB 2ZCKH 5CD5C 3KYKL 3L7EA 1J8HD 3F7VA 2C4FU 4JFXB 4WI5A 4YWGH 4NQUA 2ILLA 2YBRA 5B39B 1JNHA 4PB0H 3EDEA 5EZLB 3TH2T 4JY6A 3A6CL 1YECL 3QDJB 3CAFA 2MHAA 5F7DA 3I6KB 1HE7A 1K4DA 3MA9L 5L2JB 5IBLC 4JFPA 5FGSA 4H0IA 4ZFFB 5BOZG 4NUJB 4OCNC 5C0FB 1IGMH 2DM4A 4XC3L 2A77L 2NY4B 5KSBF 2EH8L 1NC4D 1ZGLM 1T66D 3PQYE 4KV5E 4KHTH 4S0TD 4YC2C 2Y06H 5JW5B 3ARRA 1ZSDB 1S7RA 3S35H 3BPLB 1SJEB 4OZGE 2VISA 3ZTNH 3O2VH 4WUUA 3TFKC 4OFKA 1INDL 3BSZL 4HK0A 1K9TA 2AABH 4XVJH 1BVZA 1CDJA 4D0CA 4P4RB 4OJFH 1GIGL 1H3VA 1XF4B 2GKIA 3A6BH 2H3NB 1M7DB 1WJ3A 1AFVL 4RGMC 1J10A 3F58H 4GXUM 3PXJA 1HHKB 2GITA 3MV9A 3OKLA 4O2FA 5GIRA 4WDIA 1IZJA 1I85A 5DJDA 2XA8L 2R4RH 5ICZA 2QHLA 5GGTH 4XCNB 5E2UL 3UP1A 4NN5C 4F57H 5BRZA 2FL5A 4Z95H 4M5YH 1FFQA 2X89A 3QDJD 5D5MA 4D9LH 2YN3A 2JJVA 1T0MB 2W9LA 2CKBB 4BM7A 3DUSB 4BSVB 1C08A 2Z35A 4KDTC 3WJLC 5I66B 4KDVA 5D1QD 5EIIA 2FYYB 1XIWD 2EDTA 3NACH 5IIEB 2VKXA 1DQQB 4HIXL 1J18A 3CLFH 1E28B 1XR8B 1OLZA 1UWEH 2VLJB 2VLLA 2P8LB 2K3TA 5FAAA 1H8NA 3U7WL 1IRAY 4WV1A 1B3JA 2R56L 4XP6L 3VXMD 5ACZB 5ERWB 2EDJA 1HYSD 3THML 2RJMA 4X8JA 4UZGA 4DOHB 4MXWH 1QLFA 5D6DA 4X5WB 2JB6A 5DWUH 5IMMA 2GYSA 1HH6A 2YUZA 3SGJA 3PHSA 5J9PB 1ZK9A 2FO4B 1BZ9A 3SE4A 4ALAH 1LO3H 5ICYA 5HHPA 3P0GB 1MPAH 1TMCB 3JWDH 3V0AC 2E6QA 4XTRC 3U2SA 3FHAA 1VENA 3E6HB 2E7HA 3O6ML 1QBMH 1RZKH 2I60L 2FZ3A 2V2WA 5MENE 3CMOH 2D7QA 1UKTA 4LHQB 1EJOL 4C55A 3MREA 1VB9A 3S37H 1P5UA 2HMIC 4RMVA 1NCAL 5F7HA 1NEZA 4JFED 5GGSB 1RSFA 4ZUSB 4CU6A 3BH9B 5FYKU 5JO5B 4R4ND 1H0DB 5GRJL 4KRNA 3BPOB 2C3HA 5D2LA 1NCDH 3ILPA 1V5JA 4Z7UB 5ALBH 2I9TB 3A0OA 3EJJX 5IW1B 3IDYB 5IHBA 5J3HC 4F37F 3I50H 4IS6A 4JY5L 3H0TA 3V5HA 4CJ1A 1U93B 3OHXB 2H26A 3OZ9H 5IVNA 4OZIA 5HJ3B 3QA3A 3RZWA 2BZDA 3T0EB 3NZHL 3OWEA 2BDNH 2GJ6E 1Y18B 5B38G 4LMQI 3FRPA 5K33A 1A22B 1TFHA 3BP7B 3BWAA 3VXTB 3SKOA 1QBLL 3KPQB 2C7UB 4OIBA 5LG1A 1S9WB 1KC5H 5E99H 4L4TD 1UH2A 4ENEC 4WHCA 1MHHA 5EC1B 3C2SA 2AI0H 1KPVB 3QHZH 1YMMA 1DUZA 3TYGL 1EERB 3EDJA 1K8IA 4LSPH 5DQJA 1ZHNA 1YEGH 4RRPA 1C8PA 5EA0H 1EO8H 2YD1A 5DFVD 4C56D 3VWJB 2XN9B 3DTXA 1FVDB 4OCSL 3CK0H 3FAXA 3BKJL 4D9QE 5T1LB 5IROA 1CXEA 5C0GB 3TV3L 3FJTA 5E95B 2Z35B 3EBAA 2A6KB 3DX9B 3O2WH 3MLWL 3KYKH 4FFYL 4ZAKB 3U46A 1Z0NA 3RY6A 5HHOD 3TIDA 1S7VA 4I3SH 2ZJSL 5DJZA 4JFDE 3V6ZA 2A0LC 4FQXB 5DF0A 3DXAB 2DQUH 4X4MA 4AEHH 3D1MC 3GRWA 2JJSA 5I8EA 2UWEB 5EBWA 1BFOA 4GW1A 5CAYB 5C6TH 3HPJB 1TQCC 4WDIB 5C3LD 4RISL 1R5WB 4C4KO 5CUSL 3P11L 1G6RA 3UX9B 3MV9B 2P8PB 3EYFA 4AM0B 1NL0H 2YUXA 3UAJD 2EH8H 4M1DL 1F02I 5BXFB 5D7IE 2FJHB 2J12B 1DN0A 3EO1A 1QSEB 4UBDD 2ENSA 5I1DB 3O4LD 1MCIA 4KWUA 5I1DA 1OARL 3GB7A 3GSXA 3OMZA 2X7LA 3BZEB 4XP4H 4JFOA 4L9LC 2PXYC 3BQUC 5DEFA 4MWFB 4D9QD 1AQKL 2CO6B 1IGTA 3L9RA 2W1NA 3O41A 5CGYC 4UBDC 4LNRB 1UZ8A 3CFDA 3LB6D 1G9EA 4XRCB 3CDGB 1AGCB 4DZBB 2W9EL 3GMPB 4HJ0C 4P9MH 4GW1B 4QOKE 4BZ2L 3R8BB 3KPMB 4MNHB 3CU7A 2CO7B 4WWKA 1YDPA 1P4BL 5BS0E 5DUBA 4K9EC 2MOVA 1E4KA 4O9HL 1D6EA 4GW4A 1I8KA 5I18L 3PJSB 4PJXE 4H26B 2HT3C 1S7XA 4JY5H 4H88L 4RWYH 3VFRA 4R4NC 3EKCA 1E4JA 2APXA 2MKWA 4KVNH 4FXKA 4GW5B 1KTLA 2R1WB 3SPVB 2VXVL 1MREL 4Z0XB 4GRLC 3MC0A 4YDIL 2EYRB 3U1SL 5C9JB 1CFSA 4NHCL 5SX5H 5B38A 4PJBF 4HWBA 5JR1H 4ZQKB 4CL7A 1HHGB 2BY1A 3HE6B 1ZLUK 5D93B 3LY6A 4LVNC 4JY4B 3WDIA 4XBEH 1AO7A 4LDOB 2NX5E 1G6VK 4KJPC 2IGFH 1IFHH 4BYHA 4RGND 3CFKB 4H25B 4R0LC 5I9QC 1LP9F 2HTKD 1GHFH 1F3RB 1HILB 2C7UA 2AERT 1I9EA 2OR8A 3FCTA 2IEPA 3C9NA 4J3WA 4ONOA 4GRWE 1BPVA 5IGXH 2MJWA 1NFDA 1I1AC 1EGJA 5IESH 4TUKH 4WV1C 5TE6L 2DI9A 1WWBX 5E08H 5EFIB 4OCRH 1D5BA 3QUZA 3HRZA 3H0TB 2X9YA 4UMGA 3S37X 5KS9A 3HPLB 4QY8B 5F7UA 4U1KB 1LDPH 3B2UD 3HI5L 3NBNA 4JN1L 1EEUA 1UM4H 5GSVA 5DRNB 3ULSB 1EPFA 1OTUD 1JF1B 4GMTL 3VG0L 3H3BC 4PJGE 5JO5A 3LRSB 1MLCA 1J5OH 3CX5K 5E7FA 2YEZA 2VZ1A 3BVNB 3CSGA 3ESVF 3VXME 2B20A 4DQOL 4KKAD 3KS0H 4PD4J 4GSDH 2HFTA 3RVTC 5A16B 4FA8A 1KCSL 5J1AB 3LN4B 5GRJH 3SE9H 4YX2H 4XWOC 5E2WH 3RTQB 3OX8B 2EDEA 1ZANH 2D0GA 2PW1B 1T20A 1QSZA 1BM3L 3I2CL 2X4TB 3ARBC 2DD8H 5HI4D 1BZ7A 1X5YA 3LV3A 4NFCA 3I6LE 5HHPB 5JOEA 2DJSA 4Z7UE 5KZCB 1CI5A 2R23A 1YPZB 3MLSH 5AWNL 5KW9L 2CKBL 3E8UH 2YWYA 1NFDF 3LKOA 2YPLD 3RKDC 1RZGA 3GSUA 3UTTA 4Q6YA 1VESA 2N1KA 4N5ED 5IKCB 1FDLH 2PO6D 5DZOA 1ORSB 3DUHA 3V4VL 3W9DB 5E00B 3FT4B 4ZUUA 1QO3A 3MRPA 2AKRA 2XKNB 3D0LA 5DURD 3T2NL 3WUZA 4XCEB 3RPIA 1IGJA 3GFUA 1U0QA 3SEPA 5L0QC 2Z91A 4KC3B 1I9JH 2NW3B 4PRPE 5I1CL 2C3VB 3LZFH 4L4VA 5AYUL 1A9EA 3EOBA 1QBAA 4NQDB 2NMSA 3OPZL 4LU5H 4EN3B 1WZ1L 4LCIL 5EU7C 5B21A 4PJ9B 2YSSB 5TQ0L 2WIIB 1HHIB 3IFOA 1KYOJ 4KQ4H 1P7QD 4PLJC 1R3IH 3AAZB 2D7PA 3OR7B 2ZCHH 1RZKL 2I60H 3IDUA 8FABA 4PTUB 3VCLB 4MVBD 3VDCA 4WEBH 5GISL 3OKMB 3QWOA 3MNZA 3REWA 3VFMA 3Q48A 3D39B 3WNPA 2Q87A 5L88H 2I24N 4L8DB 4FQ2L 2DDQL 1MCBA 3BEVB 4YE4H 4LIQE 3UBXA 4GAJL 5ADPL 4XPFL 2H45A 5DRZB 3QUMH 4I3RH 3DGCR 1CICC 4ONFL 1R3LB 3ARDB 3NFNB 5IMOB 4MJ2A 5JZ7D 2VWEC 5IR1A 5ISZB 1KJ2B 1I7UB 2VLME 1RJLA 4HV8A 1HINH 3P4OB 4P2QA 1A3LL 5D1ZD 3QWRA 3AGVA 2E9BA 4CMHC 3KXFD 1OTTD 4FOMA 3NCCB 3ME0A 4MNQB 1F5WA 1KEML 1BQSA 4XXCC 2ED7A 3LH2H 3FQNB 4RAVB 1QG3A 4U31A 1UCBL 2E7BA 5LQBL 2BY3A 1J9CT 3F8UB 1D5XA 3M1BB 1FSKB 1U8MA 3TJHC 4QHNB 2P5WA 5F3BA 4WU7B 1R3IL 1R3HB 4Y2OA 1KBGL 4Q9BA 4ZFFA 15C8H 4U0QB 1EFXA 3ARGB 1KCUH 2EO9A 4ELME 3TVMB 1FNLA 4OCRL 5L2JA 3JWNC 5BV7B 1JFQH 1S5IL 2PXYA 3BQUA 2P8MB 2VZTA 4G5ZL 2AXGA 2EYTA 5AZEH 2G9HA 5DJ6B 1E4WL 4Z76B 2VDNH 4HLZH 3ULVF 1J8HB 4Y5XB 4FTVD 1MHEA 1BEYH 4RIRA 5C0BB 3GMQA 4UV7H 5DUPH 3BESR 4LF3A 3CZJA 4UILL 4TNVF 4BZ2H 3L7EB 5I16A 4PJ9C 1A1NA 3UTZB 4M62L 4R97C 3K7UA 1ODAA 4CADA 1NAMH 1AGFA 4XTRD 5I8CB 4OD3H 5HXMA 3MLSL 3A6CH 4D0DB 3PHOA 4NUGH 4EZMA 2AXJA 5D7KD 3BO8B 5CILH 5IVXE 4XPHH 1T7VA 5DD5L 1MY5A 3KYOA 5DZNA 5E6ZA 4LCCC 4HWEL 1OTUC 5EZOL 1HKFA 2B4CH 1N64L 1AC6A 2A77H 4GMSH 1A7BA 3MRLB 4G8IA 5E03A 1AXTL 2ZSVB 1DVFB 2Y5TB 2IQAA 4GAGL 1OF2A 1CCZA 3IF1B 1WCBA 3O6FD 4X9IA 5MEQA 2W60B 2V9TA 3BKCL 4LLQA 1KIPA 2OJEB 3C6LC 1NCBH 2OZ4A 3CVHB 2WAHA 2GJ6B 2D4FA 3GMLA 1A1OB 3VRJB 2IBZY 3FQXB 3D0VB 2AEWA 4IEFB 4M3KB 3KPSD 1KXVC 1T6WA 2Q76B 4P2YA 3ZTJH 1T2XA 3TBSB 4HXAH 3WFZA 5T3XE 2HTKC 2RGSA 4TVPH 4IDJL 3LSOB 2HWZL 4YHML 2P43B 4HZLB 2JKXA 1C16A 3GKZA 3CH1B 3SDCD 4IIQA 1UM4L 4PLJD 3SN6N 2XWTB 4HW6A 1WZ1H 4LCIH 4PREA 4R0LB 5IMKA 5IK3B 3S88L 4BKLA 4Y4HC 4OTXH 2XTJE 1VEMA 2AJSH 5D2NA 1OAXH 4P9ML 3RNQB 3VFGH 4CN4A 3PWLA 1OGAA 3ZKXC 1HXYA 1SQ2N 4XP9H 3MOQA 3HAEH 5IVZA 2EDWA 4JKMA 1HINL 1DQLH 1FL5B 1V3MA 1L7TL 5CEZE 4PGZA 3VD7A 3W9EA 1ZA3B 1IQWL 3MRQA 3RAJH 5C0JA 5FCUL 1NGZB 4YE4L 1AP2B 3MRGB 3GBML 3SDAC 5JZ7C 4P5MA 5HYJA 3TFKD 4HT1H 5ICXB 1AQDA 4WO4C 1XGQB 1I1AB 2AJ3B 3B9KA 3MJ7A 2R4SH 3QUMB 1A0QH 3LRHA 2HFGH 4QGTA 1O7SA 5CJ5A 2BCKB 2BY0A 3RGVB 3NCYP 5F7MC 1MVUB 3FO2B 3VFSA 5ALCH 3MRBB 1A7PL 2Q3ZA 4WO4D 3DGGA 1XH3A 2FEEL 3CFBA 1CFBA 1D5IH 2VR5A 3TCLB 3RIFF 5IW6B 1WWAX 4QXUL 5T1MB 3TNNB 3DSFL 2VOTA 3LPGA 5D71L 3VI3F 4L9LB 4LEOA 4X6FB 4ZDHA 4MSWA 3FT2A 5DZLA 2WUCL 2FWOA 4LQFL 5HVGB 4RCAA 5IEKA 4TVSa 1HHJB 1H3GA 3V8CA 3UJTH 2IFFH 4KKCD 1JWMB 4NJAH 3QCVL 3NABH 4WY7H 4HX1A 3J7HA 3SHSA 1MAJA 3WE6B 5A40E 3OXSB 1SYSA 2Q7YA 5DMYA 3S97C 4X7FC 3RVXD 1FGNH 3IDGA 4PBXA 2B2XL 3L3IA 4PLNC 4LLAA 4HUVB 1G9NH 4KUCD 3BN3B 4NZRL 4HG4J 4M6AA 2H41A 1K6QL 5EU4A 2DWEA 4XGZB 4ZTPL 4I5BB 5E8EB 3G9AB 4KQ3H 5DVMA 2V6HA 3QO1B 1FYTB 1JGLH 5B4MD 3UJJH 5EC2A 4XVSH 3L3HB 1RU9L 2AJXL 3S5LA 4MNGE 5I19H 5D5ME 4BFGA 2RFXB 3HNVL 3UJIL 1J1OL 2P45B 1G7QA 3FHQA 4EKXA 4JFFA 1QSFE 3VE0A 4I0PB 4A6YB 1FORH 3PWVB 5DK2B 4Z9KB 2Q20A 2NY1C 3HUJB 3EOAA 3EYVA 1XGPA 4HUUB 4YHMH 4UU9B 4LQFH 3RKPA 1CD0A 3TNNA 3AM8C 3ILQD 1HEZB 5EO0B 4LIQH 2GT9A 3RRQA 1BX2A 3KLAA 5HGHB 1W0YT 3QDMD 4X5XB 2YKLH 3VRIA 3VFSB 1TENA 3IFNL 3HS0B 4BK4A 2CLVA 3P9LB 2BNQB 3BT2L 4UNVA 4YGVA 3DIFA 3HC0A 3TBTA 4OCSH 4EVNB 1QFUL 4PGCB 3U6RA 3SE4C 3VXQA 25C8H 3ULVH 2YN5A 4DUXA 2DL2A 3WFCL 2PNDA 5TQ0H 4ELMB 2VDRL 1RIVH 4FZ8H 4JFZH 4P5MB 5DUML 4QRRB 3U0WL 2A6JB 2AJSL 2BOCB 4AT6A 1VPOL 3WUWB 4LHUB 3D69A 5DO2D 5F89A 2V2XB 1ZKAA 5KVMC 5IB5B 5HGAB 5JPMA 1B0RB 3W5MA 3VWJC 1Q9LA 3PQYA 2Y5EA 1RZ8A 3C5ZD 1JBJA 1Y0LB 5D2NB 3NZ8A 3D18A 2DIAA 3GSQA 1CD1A 3QUML 4I3RL 5C0DB 3P4MB 2CK0L 2XWTA 4WI7A 1G7HB 3WLWC 5D2LE 1YNLL 3ZMRA 5EZJA 4Z78A 1F58H 3MX0A 2XKUA 3LS4L 3L95A 3WSQL 3G6DH 2HFFB 4CDGC 1RIHL 3WNNA 1KTDA 5KVFL 2EZ0C 3HZVA 1H3WM 1YY9D 3PGCA 1A7PH 3KPSB 4FFZL 5CBAB 2GJ6A 2K9UA 4M8VA 5EZIL 4TNWK 5I8OH 1KIPB 1UCBH 5DD0H 2NY7H 4I8DA 4OF7A 4Y4FB 4KJQC 4DFHA 2OK0H 3DMMA 4U3HA 3QUKA 5DD1H 4OZHB 4WO4A 4XI5C 5FF6A 1H3PH 4Y2DD 4TVPE 2HFEB 2VC2H 3O6FB 3RVUD 4D94A 1AY1H 1KXTB 3FB8B 4L3EE 3MO1A 3WJJA 4PRHA 4P5TA 4QRPB 4XMLL 1FG2B 1WZLA 3IKCA 4L1DA 1Q9LB 4LAQL 5DTFA 3CX2A 1HNGA 5FM5O 4P5KA 2VDNL 2F74A 5B3JE 3MUHL 4W81A 4PY7A 1JGDA 1ULVA 1RK0B 1EAPA 4WHDA 4QHUB 4GLRH 5F1KC 1JZ5A 2WNGA 1BFSA 5D70H 4J1UA 2IANA 4O00A 5I0DA 1IKFL 1ND0B 4POZC 4ZFOB 1SJHB 4JCMA 4P23D 4UINH 3VXQB 5C0RL 3BX7C 1PDKA 3BE1L 5HDQL 1EHNA 4IRSB 2YHGA 2R8SL 2P8MA 2V7HA 2CDEB 1A8JH 4HMCA 4UOW1 1DANT 1AE6H 3P77A 3PWJB 3HE7A 1MUJA 4X5XA 4JKLA 3LIZL 5EO0A 1OAZH 4F7TA 3LS5L 3MRDB 2HJFB 3L7FB 3BAEL 5J13B 1FGVH 4QHNA 5EU7E 3QQ9D 1OGTA 1XGPB 2ZCKL 4HIJA 5FKPB 3RY5A 4Q97A 3TM6A 3WIHH 3BKCH 1K4CB 5C6PB 3EGSA 3TJEH 4HGWB 4HULB 3VXOA 4LRNH 4YQXH 2JLLA 3QQ9C 3QDJE 4PJ8C 2OR9L 3KXFB 4LCWB 5IW3A 4G3YH 3JVGC 4HIHB 4KJYA 4F7PA 3W81A 4WI4A 1EHAA 3MV7D 4GRMB 2NY4C 3C2AL 1DLHA 3WFBL 3GGWA 3GMMA 3UJTL 1D9KA 4OZIE 5IF0A 1Q72H 1ZT7A 4OM0L 3VFGL 2UZIH 1WBXA 4B0MM 4UQ2A 4HIEA 3OXSA 3HI6H 4PJ5A 5KG9B 5IV2B 4JFQB 1XGTA 4XBGA 1MFAH 4EJ1C 3ZYZA 1JWMA 2CKNA 4HEME 4O5LL 4OCLC 3ZE0E 2DQFB 1MHCA 3I6GB 1MCDA 4UUJB 3RWIA 3VH8B 1K6QH 2PYEA 4X98B 1KLGB 4IHOB 1KJ2L 1BFTA 1DANU 3LVEA 5DMIL 3ARQA 1MCPH 1IGYB 4DKEH 3KPTA 2XQYK 1G9ML 2NW2A 3HUJF 4HQQH 4DKAA 5F1OB 2K1MA 2VLJE 4Q0XH 1YMMD 1ZGLP 2GAZA 4O4YH 1T1XB 1CG9A 4OJFL 4QNPE 2VABB 4Z7WF 3MRBA 1LE9B 1MJ7H 3D9AH 4ONHB 2XKNA 4PJ7E 3BDYL 1SJHA 4MAYA 2DIBA 4FQQA 4XAWL 2BNRA 1AJ7L 1RK0A 3DI3B 1HQRA 4BFEA 2ZOKA 1FZJA 5FO7B 5F1SA 1K3IA 4NM4L 1MWAA 4PLKC 3QNYB 1ZA3A 1U8JB 2WQ8A 4QLRA 4JFZL 5TH2A 2Q8BL 4K3DH 2PW1A 5GISH 1UWEL 2PO6A 1QQDA 1IC7L 2PYFA 3PGFL 3U9UB 1CF8L 4O5LH 2I5YL 2FX7L 1OGAD 2H6PB 4HUWB 4JAMB 2Q86B 4XPGH 5T1KD 4BFBD 1UH3A 4HGKC 1FNSL 2ATKA 1V7NL 1R5IA 5CJ8A 1R5VB 3QIWB 3MLXH 2VLRE 5CS7A 5DGRA 3BE1H 1KJMA 3VI3E 4P5TC 1A6WH 2DI8A 4AL8L 2GY5A 5T5FH 4QYOA 4NRZB 4JRYB 4YAQA 5I2IA 1E27B 1D5MA 1IAMA 1UWGL 4OLYL 3V5KA 4JPKL 1EO7A 4ODWB 5IG7A 1R5IB 2AP2A 5KVFH 2HYMA 4KJWC 1JNLH 3B5TA 3K1KC 4P57B 5E7BA 3VI4F 3MRIA 1FAIL 1NFIB 2YMXL 3NZ8B 3ULVE 1YY8A 3DOSA 1FZOB 1BREA 3D2UD 1JN6A 3TP4A 1HIML 4HS8L 1A6UH 4M7ZB 1F4YL 3R06A 2HT4C 5EOCL 3HCVA 2G5BB 2V2XA 4LVEA 1UENA 1G7IA 3MUGB 4AENA 3NCFB 5EORL 2WP3O 1NBZA 1N2RB 3TEUA 3F62A 1WAAE 4M7LL 5GRZA 4ODSH 5KOVC 5BCAA 4Z8FH 3V4UH 3TT3L 4YFLI 1Y6NR 3OKKA 4OBRA 1GGIL 4U1MB 3RWJA 3KWWA 1A6VL 3VXUB 3SPVA 1CK0L 1KNOA 1LO4L 4O58L 3FKUS 4HKBB 4OAWB 4Y5XA 3UTQB 1S7XB 3EW3B 1RHHA 3C8DA 3HE7D 4XPHL 1DLFH 5E5MB 1JYXA 1D6EB 1T1XA 4P9HL 1CE6B 1AI1L 3RIAF 2O93L 1YDPB 1MCOH 5D1XA 4L4VD 3SE8L 3JVGA 3EYVB 5E2VL 4PJ5D 2IG2H 4KRPB 2YPKA 5FUOL 4POYA 2E9IA 1A7QL 1FO0H 5ESVA 1MHCB 4X7SL 3W5NA 1N5YL 4QRUB 1YEGL 4U6YA 4MWFA 3VWKD 3DX7A 4LPUA 5HYQA 3QUZD 1EHLL 3CNKA 4QRPE 4UTBL 1DZBA 4ZOCA 2X4PA 2CIIA 3MFFA 2JB5H 2OSLB 5IV2A 2OJZL 5C2BH 3IDIA 1TZGH 4I2XB 4XHJC 1QACA 5E8EA 1LK3H 1QHOA 4QTHB 4KI1A 1JNJA 1DN0B 3EO1B 3QHFH 1NBVH 4N9GB 4QRPD 2NY1B 4N90D 2LU3A 1LNUA 3N1GC 4I0PC 3AVEA 1Q9KB 4HK3J 5F3HA 3T77B 3SJVA 3WD5H 2BP3A 3NIGF 4I1NB 3QDGE 4GS7C 2Y6SD 3NOIA 3B6SA 1KLFA 3UXFA 1MJ8H 5EBWB 3FMGL 4X5LA 5I8EB 3C6SA 1DQLL 3CVIH 4CW1A 2DQHH 3NZHH 2DLTA 2E8YA 3EGSB 4E42B 3EDKA 1KCRH 1OAKH 4LLDA 5I1LB 4PJFB 3DXAD 2HAZA 3F7RA 1D9KC 4NKMA 3BP4B 1I3RB 5BO1L 5A2JH 3QNZA 1A9EB 3EOBB 3FT3A 3EYOB 3IDNB 2HFGL 1WFOA 2CUHA 3SDXE 5C0IA 2APTA 5IHZA 2CDEA 1FLTX 1SEQL 2V5SA 1A6WL 3RIAK 1KEGL 1KLUB 3K4ZA 1P4BH 5IFAH 3L1OH 3QQNA 1M7XA 3FT4A 4JCLA 1KJ2H 2WSKA 4LSQL 2BNRD 5KSAD 5AD0B 4LHUD 5ICXA 4KI5E 2JELL 4UV4H 2W65A 4QHUA 3FQRA 4QRRD 4WFFD 5C86A 3DWTA 2R23B 1CIDA 3W9EB 2DKUA 5EUOE 3RPKA 3U82B 3RDTC 4P5KB 4YHNB 3EJZC 1SJXA 2ORBL 4KROB 4PP2B 1JPTL 4P4KD 1IAKB 4JDZB 4RFOL 1MCLA 3LRGA 3T65A 5DTFB 5ITBH 1T6VN 2MTPA 4E41B 2DKMA 1MY7A 5FYLD 5BJTA 4HJ0D 1T1WA 1AJ7H 1JPFA 5D8JL 2C3GA 3QFJD 3LKPB 4KZDH 3T8XA 1MREH 1I8LA 1JPSL 2XI9A 5EO9A 4TSCH 1KIRB 5K9KA 4M7JL 1LWRA 4CKVX 4JDTH 4YDJA 3CH1A 1C16B 2XZCL 4Y4HA 2GUOA 2BERA 4KH2A 4YHNA 5DEZA 2Y06L 5GS2H 1M05B 5ACMA 1QZ1A 3SDCB 2NY2B 5CBAA 1JF1A 3FB7B 4KQ3L 4WHTB 3RI5K 1R0AL 4DEPB 3T3PF 4KY1H 4ZO8A 2VIRB 3SDDD 4IRJD 1YEKL 2ZPKH 1I1YB 5D96C 4NFBA 1MFAL 5DT1H 3WXWH 1S7QA 3DRTA 3N06B 1ZTXH 1YYLL 4N68A 4UIMB 2VXUL 3MPCA 1WK0A 5EZJB 5ACLA 2RQ8A 3WN5C 5E94A 3ZKSD 1CD1B 3KJ6L 5BVPH 4N0RA 4NNYA 5TDOA 4NRYB 4IRJC 4N1HB 1IGFH 5DEGA 4GMTH 3VG0H 2CDFB 2JB6B 4OSUL 2EE2A 4FXLA 4NKMB 4PJEB 1A7OH 1X4YA 1CGYA 4DN4L 2VSCA 5IROC 4K7FB 2OTWA 4HPYL 2BVPA 2BOCA 5MI0C 2JTDA 4YIQB 4BSJA 1DBBH 2CXGA 4PG2C 5I1KH 2X4SB 4NP4H 4WHYG 4G6FB 4MZ2A 2VLLB 5TE4H 3RY6C 2X4QA 2Y72A 3NCYS 1DQQA 3EZJB 5IIEA 3BGFB 3TVMC 2FYYA 1J8HA 2IPTL 4ELMF 1JF6A 1NDGB 2L4OA 1MFNA 1XGRB 4EVNA 1C08B 4ELKB 4WRLA 4BA8A 5C0EA 5C0NC 2AQ1A 5D1QB 5CKAA 3VFRB 2OQJA 1FSKC 2DQUL 4G9DA 1A6VH 3D87B 5MHSD 4NGHH 4JN2B 3SDYH 1BWWA 4KKNA 2EDOA 2FX7H 1CVRA 1G9MC 2UY6A 1MAMH 5IM7B 3EOAB 2OSLA 1WWWX 3HUJA 3VFUA 1D3CA 4FQLH 5HYQB 5ETUA 3AY4A 4G6KH 5L6YL 3BUTA 2XZAH 3PP4H 4XP1L 3O11A 2CIKA 3NIFE 1GC1C 1M7DA 1NH6A 5CJQL 4WFHD 4PGEB 5E4EC 3ISWA 1XF4A 2VN4A 1BD2A 1QLRB 4M6MH 4YHLL 3RVWD 1ZHLB 2FJGB 5DI8A 4HWUA 1F3JB 2VXQH 5DR5H 4HV8B 2WUBH 1GIGH 1YN7B 1YUHA 3LN5A 2RBLA 4RDQG 4NKDA 4PJDE 1R3LA 2FJHA 1QP1A 5D7LB 1I1FB 3MLRH 4KZDL 2IF7A 3KDMB 3ARED 4ZXBB 3EJZD 4K7PH 4XP5L 5FGCE 5JHDB 1NMCC 2WQRA 3IAGC 1R5WA 4Z95L 3RVTD 5L88L 1L0XA 4CMHB 3MNZB 5E2UH 3T0XA 3VMPA 3HMWH 4N0UA 5F72S 3BOVA 3C8HA 4XNZB 1I7TB 4DGYH 2ICEB 3E2HB 4YBLB 1K8DB 4G80B 2BY2A 3QIWD 3O4LA 2HRPL 5DT1L 3WXWL 1M6OA 2PCPB 4NQDA 4U0RB 4JO1H 2XZCH 3STBA 4JM4H 3CFJA 2K7QA 3PV6A 4JFXA 1TVBB 4MHHI 5FHBL 4NQDD 2F5AL 4DK6A 3DETD 5IW6A 1G84A 3QDMA 2KPNA 3RDTA 2VXSL 5IB1A 5ECJE 5EUKA 2VZUA 4KK9D 1A4KB 1M7IB 4DFIA 3VFNB 4IRSD 2GQHA 1LDSA 5E00A 2AEPH 4Z77B 1A6AA 4FFVC 1EO8L 2X1WL 3IJYA 1DQDL 1P2CA 4WNQA 1JZ8A 3QUXD 4GT7A 1A7OL 2NY0C 2VWEE 1YYML 2V17L 4P46A 4QYOB 4X99A 4PGJA 2H32H 5LGHL 4TOYL 5F6HI 3SCMC 1F6AB 1UGNA 1C5BH 1MRFH 4Y1AD 3MRQB 1J8HE 1VDGA 5BW7C 5JUEH 1J0KA 2OBGA 1NFKA 3FONA 3IDXH 3KYNB 4KK6C 4LVOC 1MWAH 2ARJB 5HI3C 5IWLC 3O8XA 5L8JB 4BQ6A 4LPWA 3U48A 4YQXL 2XZQL 4OGZA 3QEGH 3U36A 4OQTA 1FZKA 3RNQA 4DGYL 4U1IA 1MVFA 1WVZA 3L3JA 3TVMD 4N8PA 1X5GA 1PKQB 4WU5B 1U8JA 4S1DC 4Y4FD 1NL0L 1YN6B 1T03H 2CGRL 4EQ3A 1IILE 4ZTOH 4ZUSA 1H15A 1OWWA 1RFDL 4H8WL 5F7KC 3TBVA 1YJDH 3GBNL 4NT6B 3IDMB 3FO1A 3TT1L 3SDXB 2GTZA 4P46B 3CFEA 1H8OA 3GNML 3FMGH 3MLZH 4NRXB 3DO7A 2HLFD 4ZUVA 2OJEA 5TJWK 5CP7A 1A4KA 1MHPH 5I9QB 1BWMA 1SBBA 4GXUN 1XCQB 3Q6GL 3FCTB 3AREB 5KVDL 3JXAA 5CSGA 4W6XB 5CEXA 4QRSB 4LVNB 4OT1L 1TVBA 1PLGL 3HE6C 2LQRA 3IFPB 2QSVA 5M7QA 1RPQA 4LCWD 4Q2ZB 4E9LA 2BRRL 4ZUWA 4X0KB 5IFAL 3O3DA 4JRXE 2P4AB 3LEXB 1QNZL 4N0FB 4UQ3B 1VEOA 4H88H 3KPLB 1PEZA 4YNYB 1IT9L 2P47B 2YPVH 1HN1A 3I75A 3JWDL 4XAWH 1N3NB 4N1CA 4JO4H 3GMQB 1P7QB 4GG6A 1YJDC 4HFUH 3W0WB 1HDMA 5DJ2B 1UC6A 4WWKD 5AG8A 3IGAA 3VA6A 1U3YA 4K23L 1VGEL 1AKJB 4GXVL 4JG1L 3RX8A 5D93C 5DVNA 4P3CH 1F3JA 4K3JL 1R3HA 4WU7A 1QLRA 3HLAA 3U0PA 4NQCA 4KK5D 4XRCA 4ZNEE 1N8ZA 4R3SB 1KELL 4KI5C 3OJVC 1MCHA 4HGWA 4OQTL 3L9RB 4O2FB 3BKMH 4JR9L 1X5ZA 4I0PD 1HHKA 2GITB 1INQA 1AQKH 3QQ4A 5IB4A 1CDYA 4JQVC 3AXLB 4N90E 1MFEL 4MD5B 1QOKA 4ZFZA 4D2NA 5HVWA 1NGWA 2MNUA 1U92A 3PABA 1KC5L 4XXCA 5AAWA 5I1IH 3ARTA 1G0XA 1PGRB 4YBQC 4F7TB 3B5GA 4MA3B 2XZZA 3CU1A 2WBWB 1C5CH 1UJ3B 1QYGL 2ATPA 4CMMB 3V0WL 1EDQA 3P77B 1PG7W 3DX8A 4KK8C 1A1MA 2P7TB 3PP4L 4XP1H 4YGAB 4JG0H 3K8LA 5SWZA 3L3DA 1ZVSA 3MA7A 1ZLSH 4MCYB 1YPZE 3MV9D 3UBXI 1CXFA 2ZOLA 4EOWL 1OAQH 4JPVH 3MGOA 3MJ9A 3SOBH 1IC1A 2F53B 5FV2A 3CFCL 1CGSL 4QRQB 3EHBC 5GRXG 5F7EH 2FLBT 3QCUL 2PTTA 2OTWB 1RIUH 5DJZB 2D03L 5GGUA 4AH2B 2XOTA 3S37L 3U46B 2LVCA 3Q2CA 3T3PE 1A9BB 5D6CA 5KSVA 4KRPD 1BOGA 4PJHB 5EN2B 3PDOB 1TVHB 3HNVH 4IJ3B 3RI5F 3BZFA 3AFLA 4L4VB 4NQXB 1T03L 4Z7NF 3EHBD 3I3EA 2EE3A 5E0QA 32C2A 1IEBB 1SJVA 2HVKB 4W4NA 5F44A 2A74B 2A83B 4AIOA 5B3JF 2HLFC 2VLRB 2F53E 4APQC 2IH1A 4S1RH 3SGDH 4CGTA 4ZUUB 2DICA 3HAEA 4RGNB 3K80A 1C5CL 1NBQA 1LHZA 3IU4H 1QHPA 4HKZB 1NAKH 3V0WH 3CSYA 5CZVL 3G6JF 1R3KB 3KPQA 2C26A 2AJUH 4KUZH 2X6MA 4F33A 1SM3H 1N0LA 1PY9A 2ADFL 4GKOA 4PG9B 4UNUA 2CPCA 4PRPB 1OTSD 5AUMA 5C0DA 2IFFL 3LQAL 2P42B 3RTQA 5GGTA 1ZHKB 3QCVH 1YYMH 2V17H 4U3CA 4YHZH 3GSNA 1B0WA 5GS0L 5T3XH 4LBEA 5F7FA 3RU8H 4PP2A 5I18H 3PL6D 5ENWA 1O7VA 2Z8RA 5GGSA 3MCKA 4LHUA 3C60B 3D39E 1G0YR 3Q6FA 4L4JA 1C1EH 3NA9L 4HWNA 4LSSH 4U1KA 2A73A 1CDHA 4XWGH 4BH8B 3AUVA 1BAFH 2Q7NA 2PYEE 4NQEB 2VDKL 3CDFA 3QJHA 3W11D 1JV5B 1GOHA 3SQOH 4YGVB 2FJFA 5T1DL 1TTUA 1AGDA 3P30L 2ICWB 3RAJL 5C0IB 1WIOA 1J1PL 2HLAA 2C5DC 1QSED 1FO0B 3INUH 4J23A 4HT1L 2J1KA 4GAYA 2GT9B 4D0BB 2D7NA 4KKBD 4PB9H 2CLZB 4ZSOE 4YUEH 2MQ0A 4X5WA 2F9BT 4YZFE 2D7MA 1EEQA 3ZTNL 1J87A 1FDLL 1MFBL 1IFHL 3QIUA 1KB9J 3PP3H 4JE4B 2VC2L 1OLLA 5DK2A 1IAII 1WC7A 3NTCH 1MHPL 2EKSB 2D9QB 5E8NA 1U95A 4JFFB 4H1LG 5E70A 2DB8A 4HDIB 1OB1B 3VD5A 3SKMA 1XR8A 2QL1A 5ESAB 1YMME 3GSOA 1ES0B 5EIIB 5EC2B 4UILH 4Y19A 1KTLB 2NXZD 2R1WA 1WZKA 5J11B 2DMKA 5T3ZE 4XGZA 4TNVK 2D4DA 3UTSE 3R4DA 1S7UB 2ZCHL 3MXWH 1AR2A 1HHHA 3P40A 3PJSA 3UO1L 3N1MC 4RAHA 4XCNA 4OLWH 5IEHA 4WWKB 5I8KH 3S34H 5T3ZD 1K3ZA 3RGVD 3V52L 1IAOA 1AGCA 2B4CL 5E8PB 4P59H 4JFDB 3OKLB 1ACZA 1DL7H 3ARBD 3B43A 1UZ8B 4X6DB 5J8OA 4GH7B 4NWUH 4PJIF 1X5JA 2X4OB 2NYYD 3WLBA 5HPMA 3V6FA 5IJVB 2KDGA 4XC1L 1C7TA 3FQWA 2O5XH 1CFVL 2X7LB 2ZKHL 3GSXB 4DKDC 4HUNB 2GJZB 4L9LA 4MDIA 1DEEB 1MFBH 4Q9CA 2ESVE 1KPRB 2L0DA 3IS0X 4OQ1A 2X05A 2R2EB 2Z9TA 3QFJE 3SGDI 4PJ8B 3GSNH 5CP3A 4F2MA 1HYRC 1AD0A 2D7OA 3TCLA 5E5MA 4C58B 2NPLX 5E56A 4B50A 4NO5B 3VXSA 3BKYH 1SJEA 3BISA 4NZTL 2B0SL 4NQTA 4PP1D 3CPLA 4RAUA 5HYIA 1E6OL 2C3WA 4QOKA 1WEJL 1JTPA 4JJHA 1U91A 5IB3A 4OAWA 2W9DL 2MQCA 2YA2A 3S98A 1Y6KR 5J57B 4YJZL 3GDBA 3KWWB 3TA3B 1H3PL 1KCUL 2EC9T 3HPJA 5D7JA 1JZ4A 1K5NA 2WBJC 4LIQL 2EC8A 2DQDH 4P46D 2HN7A 3QCTL 4GRWB 3PGDA 3SKJH 5HYFA 5TPWL 4WI8A 2BRRH 5I1EH 3H7BA 2MHAB 1UB6A 4P2OC 1BF8A 1KJ3L 1OAYH 1EJOH 5CD3B 1NJ9A 2XNAB 1FYHB 2COQA 4Y16B 2PTUA 5HGGS 2A6KA 2X9XA 4DVRH 1Q0XH 4KJPD 5DA0B 1U8LA 2ZNXA 1OGAB 4FMFA 1S9XB 4ZYKB 5KSUA 2VDOH 3QXTA 2ESVD 3H9ZA 3G04B 1KFAL 2XN9A 3DTXB 5MERA 3BGMB 3ZE2F 4UT9H 3VWJA 2QQLL 3L3GB 3UROR 4M9PA 3U4BL 4P23B 3GSNL 1RMFL 4NRZA 4YAQB 3VH8G 4XPFH 1G7JB 3IDJB 5HGDA 2NTSP 1KJMB 2AV1A 1II4E 3QUYD 3FQXA 1ES0A 1NAKL 1DFBH 2VLKB 4LASL 3B8YA 3EO9L 1NMBH 2JIXB 1I3GH 3ZKNC 4AYFA 1L0QA 1BVKA 1HSBA 2VB5A 4Y19E 4YDLC 4PJDF 2VNCA 4K8RC 1OB1A 4OZGF 5C0BD 2AJUL 3SO3B 3H7LA 1T5XB 3KXFE 3SDXF 2A2QT 2Y5TA 4XBPA 4OZ4A 2CRMA 3PXHA 3C6LB 3OJMB 4YK4B 3GUTA 3C09C 1F90L 1VADA 3ALWA 5I1HL 5ID0A 1P5VA 3WCYA 5L7XL 3OKEA 3QEQB 5I8OL 1S5IH 1Q0YH 1H0DA 2HLAB 4NN7C 4DCQB 5T3XL 3A6OA 4HCRA 3PWPB 1S8DA 5I30H 4K7PL 3MJ6A 2X9WA 3F6IA 1U2CA 2VE6A 2P1YA 2LAAA 3C09B 1TJGH 2AEQL 4MB5A 1JUFA 2VL5A 1WBZA 4YHZL 3QP3A 4MAYB 1GXEA 3QIUC 3HTLX 4TN9A 4BH8A 1T3FB 3MRJA 2V2WB 2A1WH 1TZHB 3PP3K 2EIBA 4FQ2H 1ACYL 4AG4L 1SVCP 3Q6FB 1A6TA 3LEVL 1S7WA 4HEPG 4UTAH 3V5DA 3TZVC 2CSPA 4JM2C 5MENB 1V3JA 4KK5C 4X8XA 1P4IL 4K07A 4G43A 5FO9B 1LO2H 4PTTA 4U2ZA 1A0QL 1YMHB 1ZOXA 1FVCB 2CDGB 1MIEH 2BSRB 1GAFH 3C87A 4MXVF 4K8RH 4PRPA 4U1JB 3O2DA 4ODXA 3D39D 4JHAH 3FN3A 1I7RB 1AE6L 3JWOC 5C8JB 3IJSB 3ECBB 5FM8A 3QXAA 2R0ZL 1WUNT 4PRHD 2EDFA 3ZYOA 2ADIB 3B3IB 4L5FL 1WBXB 2ZUVA 5ID1A 5C0AB 1U8KA 4QT5B 1Z5LB 1I7UA 3LKNB 2BSSA 3O9WB 1QLEL 2DBLL 1JRHL 5TF1H 4EI5D 3MNWA 4RMQA 3U7AA 5EBLB 3X12A 1A6ZB 5DSCB 4Z7UF 4WW2F 2WBJB 4R96A 4G6AD 1OAYL 4R90L 2XACC 3REWB 4K7PY 4FABL 4JKWA 3IYLW 2F8OA 3OL2A 4XCFL 5DYOB 1CQYA 3WFEH 4J8RA 1MFCL 3EDDA 5FKPA 3MCG1 5L9DL 2WIIA 3RWGB 2AXHA 4Y1AA 4X9GA 3TN0B 4JKKA 1FNAA 1RU9H 1K85A 4HK0B 4X4XA 2NR6C 3CH8A 3F65A 2Z91B 1W0VA 4HS3B 3S96A 3G6JA 4KUCF 3GBMH 1BBDH 3O45B 1EBAA 1MCQA 4UTBH 3ECBA 5KSAC 3KR3H 4PRIB 3IFNH 3F7YA 5KBNC 5JW5A 1FO0L 1QO3B 3MRPB 5JXEC 5EULV 1CL7I 4ZFOA 1NGPH 4TSAL 1GJIA 1MCCA 1W0VB 1MOEA 1UFUA 4PYGA 1CBVL 5D71H 2DBLH 5FDYA 5T3ZH 4GBXB 4H5SB 4L8BB 4PY7B 3PABB 4ODBD 4UT6H 2YD8A 4X6CA 3ZT5A 1ZEAL 2OYPA 4M6NH 4HH9A 2J4WH 4LARL 4JY6B 3LDBB 2JF1A 5I1EL 5DDHB 3L3OB 4FNLH 1KPUB 1IT9H 5C0CE 4TTDD 2OI9C 4PJCA 3GJFH 2MQ3A 2H2PD 2ERJB 3MRKA 5F9WC 3U0WH 3FB8A 3U4EA 1S9YA 3F5WA 3Q1SL 3STLA 2Y7QB 4WO4B 3TO4C 3V6OC 3BGAA 5D6DC 1NUFA 2ZP0T 3HAEG 2EIZA 5EU6D 5IMLB 5SWQB 3MNWB 5F7NC 1DQJA 4LKCB 4P4KB 3GI8H 3LRSA 5EU6A 2Q8BH 3KYMA 5C0BE 4ZTPH 4TTDC 3V4PH 3QUXA 4YZFF 3WV0A 4UT9L 1RZ7H 3BI9X 4RMSA 4YXLL 5ID0B 3T2QA 2R1XB 4U6VH 1SEQH 3QQ3A 4NZRH 3C6LA 4MJIB 3ULVD 5E9DE 5D4QA 1OOAA 3N0PB 2UYLA 3BSZH 3P4MA 3O3DB 5H94B 1T22A 5IBTL 3MLXL 4MZ3A 4ZUWB 3OF6A 2OP4L 4PJDA 4JQIH 4YR6B 3WFDH 1J1OH 4MD0A 3DVGB 5CSZA 1NEZG 5I76A 3GKWL 1T21B 3O6KL 4G6ML 3SBWA 4H25A 1LO0L 5H2BA 2EEDA 2W91A 4DK3A 4V1DA 3RUGE 3NH7L 3WS3A 5D2NE 3V5DB 4F37K 2ICCA 4AT6B 1I4FA 4C4KT 1NDMB 1XCQA 3RHWK 2QKIA 5HY9B 3HE6A 4ZOBA 1CFSB 1CFNB 2LTQC 1KENH 1OP9A 1UA6L 4FQJL 4NQVA 3QEHB 1IQDA 5E5RB 3BUYA 4D9LL 2GTZB 3DNKA 4JFHE 3O2DL 5L9DH 3WKMH 1WFTA 3TWCH 4KAQL 4MLIA 3HS0A 4F9PA 1FYTD 5CD3A 4LVHC 1JNNH 2R56H 2Z8WC 3RNKB 4P4KC 3H7BB 1U3JA 4M4RA 4FABH 1GGYA 1I8KB 4FZ8L 5DC0A 1FV1A 4GG6E 1HEZA 5GGRY 3H8NA 4NSKB 3GUTB 3CC5A 5D7JB 4DKFH 3BMWA 2E7LC 4PRBA 4XI5D 4PJXB 1VACB 4KKLD 3O8XB 1T5XA 3O41B 1YEHH 4RFEA 3VWKB 1QFOA 2NLJB 3TJEL 4G42B 2JIXA 2KKQA 4PJBE 3DX6B 4NO5A 3VXSB 3HI1A 3D48R 3IU4L 1SBSL 1G7MB 1W8OA 2VLJD 4YPGB 3RZCD 3VXRE 3RBSA 3GJFA 4B41A 1YEFH 3WHXB 2OMBA 1MNUH 3IDJA 1I9RH 5HVHC 1XF3A 4LASH 3TH3T 2ITCA 3TGXA 5EU4B 4L5FH 2PTVA 2BFVL 3LS4H 3QO0A 4WEUD 1QFWL 3V6FB 5HPMB 5BZDA 4WWID 4QWWD 1UEMA 3KPRE 4WTZA 4OLXH 1M7IA 3L3IB 5DJ8A 1RULL 3RIFK 2VTFA 3S4SB 1B90A 3UPRA 1CLYH 3GMOB 1IAOB 5GS0H 4GQ9H 2V5YA 1XCTA 4OB5L 1M6OB 3RVUC 1KB5A 1I7ZA 4CAGA 3MRCB 1FRGH 3DURA 1LEGA 3CLEL 1GL4B 1S7UA 2ICEA 1P4LB 1BBJB 3I50L 3TIDB 3MNVA 1AHWC 2BVOA 4GG8B 5I17B 3E0GA 1N6QL 4OM0H 3S5LG 1AGBB 4Z7OF 1VPOH 1OQXA 2EDLA 4G6KL 1CD8A 3VG9C 3DXAE 4DTGL 4GRWF 1QSFA 1BAFL 5C0GA 4N0CD 3D2UB 5HYSB 5I1GL 2P5ED 4LL9A 4UB0H 2X1PA 4Q0XL 3BEWB 4G42A 1LILA 2X4RA 4ZAKC 1U91B 5IB3B 4YDVA 3AM8A 1MCPL 2W0FB 3MR9B 2EKSA 3K2MC 4HJJH 5I15L 1DUZB 2CXKA 4GKNB 1ZMYA 1LP9A 3B9KB 1AD0B 1MHHB 4NDMB 4OCMC 2VYRE 1G9MH 4KDWA 5HYJB 3QG6A 1NCNA 4PJGF 3LQZA 3SKOB 2GJZA 4HPOL 4MDIB 1V7ML 4LSDA 4PGEA 4E0RA 1JYNA 1BJMA 1WZMA 2NY5C 3Q5YA 1FL5A 3QUXC 4PGDA 1GC1H 1C5DA 2Y36L 4G8GE 2AW2A 1OSZA 2R0KH 4I18C 4OGAC 4QRTB 1DBBL 5I1KL 4EN3D 1J88A 4UOJA 5DO2C 1CVSC 2Y4SA 2H26B 5CEZL 3MRHB 2Q6WA 5DVKA 1Z6JT 3TYFA 5JXED 1CIUA 2BVUA 3GHBH 1Q9WA 4O2EB 4XCYB 1CGWA 5F96L 4OM1H 1J86A 4NHUA 4IIQB 1EMTH 4OGAD 4YXHL 1XT5A 2YPLA 3RWFB 4HG4K 4UIKL 4AIXA 3NAAH 4ZNEA 2F19L 1ZVYA 1KCVH 2YUVA 4KFZC 5ITBL 1I8LC 2A38A 2C4FT 4G3YL 5D1QA 5ILTL 1SMOA 1T21A 1VEPA 4XWOD 3ARWA 2MMXA 3OR6A 3GMLB 2AV7A 1X6LA 3HC4L 1YEDA 5HVFB 5H94A 4NWUL 1XIWB 1U95B 4UT7H 4YIQA 3VDAA 4M7KL 1EZVY 5E8OB 4K7FA 4PRDA 4S2SA 1ZHBA 2DQGH 1V7MH 3M17B 4N5EC 4LSVL 1T4KB 2YD3A 4YXKL 3IDXL 3T0EE 1JMXA 1W72H 5SWSB 1QLFB 4GAYB 5BMFL 3QPXH 4M02A 3WFDL 5GSRB 3PHQA 1PZ5A 3BKJH 5EWIL 5KANG 4LKCA 4P4KA 4MJ5A 5IOPB 3FL7A 1KB5H 3SO3C 4N8CH 2FJFB 1OQOA 4NFDA 3NVQA 3UYRH 4I2XE 1S9YB 3D25B 4I9WD 2I26N 2AVGA 2E7LA 4LF3B 2ZJSH 4FQIL 5TGBB 5DGQA 3W2DL 4LSUL 3UTSB 1MHEB 4P2RB 4XZUB 2ZWLT 5DDHA 3MLVL 3MV9E 1TVHA 4W68A 4PJHA 5EN2A 1N6QH 4X7TA 5FKAB 2AXGB 3QJFB 1U3HC 3EO0B 1LEIB 1ZT4A 3TWCL 3LAFA 1GYAA 4H5SA 2W07A 4KI5D 1CF8H 2O5ZL 4LBEB 5JR1L 3GSVA 3L5WB 1FLRH 2F53A 4FQJH 1GHFL 1U8MB 1GOGA 2NY0B 3LKPA 2ZOLB 4MA1B 5BJTB 2Q8AH 1PX3A 1EH9A 4LQ1A 2ZUWA 3QXVA 2B1AL 4Y16C 5AUMB 4MDJB 3LD8C 2VAAB 1DDHA 1AI1H 1D6VH 1FL3B 3FQNA 4TSBH 2MPAL 5DLML 1RMFH 1KJVB 2AGJL 3I02A 2BRQA 3G5YB 2ATPB 2IAMC 3KS0J 1BIIA 3X14A 4Y19D 5E2VH 2W65B 3ULUH 3P4OA 4G6AC 3E1F1 4OF3A 1LDPL 5SX5K 4GKZA 3OKNB 1N6VA 1XF5B 1AD9B 4LLMB 4Y89A 4JLRB 3WMSA 2XYCA 4G8EA 2VQUA 4YWGL 5DURB 2P48B 4MMZC 1XEDA 4L8DA 4U6HB 3QEGL 1OTTC 3D39A 5D1XD 3VFMB 1A6UL 4NUJA 4JFYA 5FDWB 1G7PA 1T0NA 2IH3B 2NTFA 3KNBA 1JIBA 4UDTA 3X3FL 1ZANL 3QHFL 3FFCB 4ZXBC 3ULUE 2EICA 2G60H 25C8L 5FCSH 4M6OL 1GGTA 4LGRB 1PG7L 4PJHF 4G9FA 3IFLH 2WZPD 5I1LA 5DQDL 5KAQF 4L29B 2BSSB 4CBPA 3QDJA 8CGTA 4PGBB 1OT2A 2YSSA 2W92A 2O5YH 1IM9D 3W0WA 5BVJA 1KENL 1RK1B 3GHEL 3N9GL 4L3AA 3UPAA 1ERNA 1I1CA 5B22A 5EORH 2QSCL 4TQEH 2BVTA 3H42L 3B6SB 4N0YH 3F7VB 3NAAL 1IBGH 4U1LB 2IPKB 5IJKA 2X10A 4XNUL 2LE9A 3HNSL 3MLZL 3IJSA 1A5FL 1KELH 3DMMD 3KLDA 3MA7B 3SJVB 4BUGA 2AGJH 4ZSOA 1RURL 5IQ9A 4WJ5A 1XGUA 1FVCA 3GM0A 4I0CC 4ODVL 4DGVH 3LKOB 4JVPA 3MUZ1 1IM3A 3P4LA 4A2LA 4I2XA 3MJ8B 4N8CL 3FQUA 4QXTB 2GTWB 3OAYK 4XVTL 4U1GB 2CIIB 3MFFB 2X4PB 4ODTH 1A7QH 1N0XH 4GRLD 4P2QD 3AREA 4HC1H 5LCVH 3AXLA 3CCHB 2BNRE 4AJ0A 2NY6B 5EIQA 2XWBA 5HD8D 1JPTH 1TZHA 5EIVA 2IAND 3S36X 4GKSB 3ABZA 3HMXL 3VDBA 1N8ZB 3BGFC 1A02N 1CD9B 1WBZB 2Y1VA 3CFEB 2JELH 4TOYH 1BZQK 1C12A 4ODUA 5DJYA 3SGJC 3VFWB 3TBVB 4X80L 1OAUL 2DJUA 5AZ2H 4FMKA 1H15B 2JB5L 2FSEA 4HWZB 3QFDB 5FHAL 3F12A 1A3QA 1H5BC 1HIMH 4HS8H 3ULSA 5CBEB 2CRZA 4JFEA 2R0WH 3NCJH 5EDXA 3H6JA 3C5SA 2ARWA 2WBKA 1EMTL 4GAJH 4K94C 1X5XA 4QHLA 1JPGA 5HHOE 3U36B 4ORGA 5DS8B 1CFQB 1Q1JL 1ZAGA 5CJXA 3OKKB 4Q9RH 3ARVA 1BLNB 3L5XL 3P73A 4RMWA 2F8XC 4XCFH 2BC4B 1V3LA 2P5EE 4RWHA 4FXGB 1BVKB 1HSBB 1N2RA 3C9NB 1QEWA 4OZFB 1HCFX 4CJ0A 3HCVB 3RX7A 3Q3GB 3GM8A 5C3TA 4LLWB 4K9EH 1JK8A 2DQGL 4DW2L 4HF5H 1U3HA 4L3CA 2VXUH 2EC9U 3QRGH 3X11B 3R8QA 1I9JL 4RMRA 3WDHA 3UCRA 4M43H 4WFGD 4KMTL 3FO0L 3WLWD 4M3JA 4UDUA 2MWCA 3CMOL 3WHE1 1OWRM 4XPAL 5FYKE 1S5HA 4Y16A 1S3KL 4NT6A 1EV2E 3MODL 2O61A 3TPUB 5E1AA 1U8HB 4M62H 3CVHH 2X70A 2PYED 2DQTH 3O4LB 2I27N 4QHMA 4TRPL 3KLHD 1UB6B 3HN3A 3KG5A 5MEOB 1JZ6A 1K8DA 2ARJQ 4UV7L 5DUPL 3WYRA 4OCWL 1MI5A 1Q94B 2PW2B 3CSBA 3QWQB 3P73B 3KPMA 4MNHA 4NQCD 1JWSB 1BLNA 4N5UA 4ZUTA 5GZOC 2BDNL 5I0ZA 3MV8B 4L4TA 3KJ4B 4NOFA 1J1PH 2F5AH 3QAZC 1ZXQA 1CL7H 3PIQB 1RJYB 4ODVH 1QA9B 4K23H 3SQOL 5GGVH 3KYNA 3OKOB 1I1FA 2XZAL 1RVFL 3P30H 3FRUA 3MYZA 4U1HB 4DWHA 1OY3B 1DCLA 3X3GL 2CRYA 4LCYA 3LN5B 4GJTB 3MCLL 4WUKL 1TJHL 2QLVB 1B0GA 4X99B 1JGVL 2QQKH 2VUOA 4XNMA 1OP5K 5C07B 1G1YA 4WTZG 1NCBL 1FCGA 1NBYA 4L9DA 4ISVB 1ZLWH 2E6JA 1HOCA 2XQBL 1QKZH 4QTIL 2XXCB 4C56B 5IB1B 5JIPA 5INDA 4JFDA 5E8PA 4XP5H 4R7NB 1CG9B 2YRZA 5IM7A 2AABL 3G6JE 4XVJL 2IAMA 3FB6B 3MJ8A 5DR5L 5KSAA 2P46B 2QQNH 1FNGB 5D9SA 4J3OC 4OGXH 3ES6A 2EIDA 5DFWH 3QI9D 4M8QA 5I8KL 4HPYH 5AAMA 3F58L 3RWIB 1IEHA 5IQ9B 3HZMA 4ZS7H 2G60L 4ELKA 1I1RA 1I3VA 2VZOA 2D0HA 4OD3L 4A6YH 3T0ED 5IBUB 1D5ZA 3SDDC 5EPMA 3AU1A 2KL6A 5FHBH 3JUYA 4WEBL 3JTTA 4UQ2B 2FATL 4F57L 2H8PA 3FFCE 5J1TC 3OF6D 4QEGA 5J56B 1NKOA 1GOFA 2V9RA 3IKKA 4ZXBA 1NCCH 1PD6A 5IF0B 2N7BA 3GIVB 2BVPB 4LDEB 3DBXB 1X6NA 1J11A 1L7IH 1RUMH 2QQKL 2JE8A 4R26H 1S9WA 1UT9A 1ZHLA 5DI8B 5EOCJ 3TC9A 5CJOL 4JPWH 1FO0A 4BQCA 4NRYA 4OZHF 4BZYA 4GRLA 5JA8B 4LP4A 5F6IB 3GRWL 3QBTB 3DYPA 4URTB 5E94B 5GJSL 2CR3A 2FDBP 1RZKC 4MYWB 1TCMA 3FN0L 4JLRA 4OZIB 3CVHL 1SBSH 2OXHA 2J6EH 4MXQC 1E4XH 3KJ4C 3NFPA 4ZG1A 4MQ7A 5HDBF 4EI6A 4PPTA 3NIGE 2VITA 2OTUB 3L7FA 4DVBA 5LGHH 4AY0A 4XNQB 2VQ1B 2Y07H 3FO0H 1CS6A 4O2CB 4LSPL 3AREC 1F42A 3P0VH 4PV9A 3MACH 1NLDL 4GSDL 4Y4HB 1DQMH 4IRSA 4YX2L 3SE9L 1IE5A 1DDHB 1RFDH 4H8WH 1FIEA 4OFPA 4FQ1L 4WW2B 1AO7E 1ND0A 2R0WL 2WBJD 1T1WB 3T09A 1NC2D 1R24A 1WT5A 5EUOB 3REVA 2FIKB 4YDIH 4PJEE 1MJJB 4Y1AE 3BH8A 5AZ2L 3T65B 3ZYJA 1JGDB 3O81A 4OV5B 2WWMD 1LEIA 2ADJB 4AZ8A 1FORL 3STZA 1C1EL 4CU7A 3L5XH 3B4NA 4X7TB 4POZD 5F9OL 1IGIH 5IMMB 1LE5A 2A6IB 5FV1L 5TF0A 4OUUB 3L5JA 5BV7L 1MCEA 1RUQL 4OKDA 4NGHL 5C9KA 4NNYB 4O51A 3D25A 3FZUC 1RURH 1QFWM 4OZHA 5FF6B 1KLUA 4HGMA 1T2QL 1ETZB 4NN6B 4WENB 2HVKA 4U7KA 4PUBH 3MMEA 3DETC 5CIPB 1IGCL 3DRTB 1MQKH 4GLRI 2Y07L 2YPVL 4K7PX 1BQUA 4X6CE 3SCMB 3W39B 5SWSA 3HFML 2XQBH 5I66A 5CJQH 4ZS7L 1HI6B 4OD1L 3RA7L 3VRLF 4PJCE 5TDPA 3NABL 4OV6F 4WY7L 4Y5VC 3T0VA 1KG0B 3DUUA 2NY6D 5CP3H 1G9NC 1T83A 3VXRA 3BP6B 3C8KB 5E2WL 3BH8B 1HK6A 2VO5A 3ZKMD 3HC3L 3BHBB 3VFVA 4KHXH 1ZS8B 1JWUB 3HG1A 5J7CC 4I0KA 1MCJA 3ARGC 3KLSA 3U7YH 3D3VE 1LQSR 4U0RC 3T77A 4CNIB 5HGAA 4JR9H 1T7YA 1X5LA 3DX8B 3IXTA 3PDGA 3HUJE 4KVNL 4MA3A 1QRND 3WSQH 4UAOC 1I3UA 4ZTOL 3NFPB 4PJGB 1YNLH 1CT8A 4P2OB 3ZE2E 2DTMH 1XF2B 2F5BH 1S7RB 5IB4B 4FZEL 3NN8B 5F97E 3V79C 3ARFC 4TULH 1C5DB 5IFHH 4TPRH 2O5XL 2BX5A 2ZKHH 4JHAL 1PQZA 4PRNB 4WFFE 3C08H 3OTTA 5IGXL 3ARDC 2X1QA 2AJZA 2R0ZH 3FT3B 1UWXK 3GSRB 5JW3H 4JFPB 4OGYL 5D1XB 2YR3A 2XFXB 1GZQA 1KF9B 1WQVT 3OJDA 3JWOL 1AFVH 4GKNA 2A9NL 3A67L 1RHHB 3D85B 4PD4K 2PXYD 2GK2A 3BQUD 5TF1L 3UYRL 1J8KA 1M71B 2H8PB 4KMLB 4U4BA 4LSUH 4PJIB 3HA0A 4GG6F 4FN0A 2F15A 3KPLA 5LKNA 2I9LB 3BIKA 5FIEA 2YK1H 3JV4A 1UXSA 1BVLA 3LKQA 1Q9KA 3LN9A 3QCUH 3VGGA 4BSWB 1X4XA 5CD5D 1AO7D 4GG8A 4X0KA 3RGHA 3RP1A 4O02L 1VFBB 3V8OA 1X5HA 2W59A 1NBZB 2EXWD 3LQAC 5FO8A 4N9GA 2NY3B 5DHYB 2G5BA 4OI9A 4HUVA 4TVPD 4WFEE 1JGEA 3OG4B 3B9KD 3ALPA 1FC2D 3IDIB 1JF5A 2DQCH 2NY0D 5H37G 4F58H 3O3EB 4Z7OE 3MROB 4R7NA 2P5WE 1PKQE 4R2GC 1H8SA 3JV0A 3MRIB 1W72B 1OPGH 1F8TH 3P0YH 4QRUA 4JPWL 4PLKD 2MPAH 3LD8B 2RIKA 4P5TD 1OAZL 3ZLQC 5IEKB 5IG7B 3UJIH 4AIZB 1F3DJ 4JDVA 1SYVA 3RL2A 5I6XC 1EO5A 4EIZC 4LCCA 3WXVH 2ZCLH 3QAZB 1HWHB 2L7JA 4MXVE 1INEH 3FRPG 1XH3B 3DGGB 1BEYL 1MPAL 4WW1B 3KPPA 3C5JB 3WN5B 1CFTB 3MUY1 2YD4A 5HDOA 1QYGH 5CSBA 1NMAH 4RFEB 5D7KE 2V9QA 1PJ9A 5FGBC 5B8CA 2J6EL 5I1AA 4F3FA 4KK8D 5HI5C 1BFVH 1VSCA 1NC2A 1TZIB 2B5IB 4Z7VE 5DHVA 4NCC2 3WKNA 3CC5B 4OGXL 4DEPC 5E24E 3G5ZB 1AQDB 3I9GL 2FECI 3LKRB 5TDNB 1EEZB 3PG2A 1DL7L 1NAML 1AC0A 1MI5B 3FN9A 1F4HA 4LK4A 1CICD 3QNYA 1A7NH 2CUIA 1TCRB 4MJIE 3M8OH 3FOLA 5E1AB 4NPYA 3OAYH 4J7RA 3GHEH 2AJVH 4WFHE 5FUCE 1S5HB 5D1ZC 2XA3A 2BSED 5BRZE 3UAJC 1CDUA 4GXVH 4LSTL 5KTEH 3NIFF 4GMSL 3IRZA 2X42A 2DOCA 2OP4H 5ALCL 1NC4A 3O6LL 5JW3L 2WW8A 3BN9D 2BJML 1WEJH 3RDTB 2VABA 1BMGA 1HKLH 3BXNA 3QI9A 2WWMC 2ZCLL 4I77H 1D5MB 4BJLA 1FFPA 1L9MA 3MV7A 2FRGP 5IB2A 4JFFE 1U8QA 3Q3GA 3CMGA 1P7HL 1OM3H 4WI2A 5J6HB 5HHNA 4J2XA 3LH2L 4G80A 2PYEB 4X98A 1P6AB 3GSWB 2AXFB 2JCCB 3CVHA 4P9HC 2HT2D 5EO1B 2G5RA 3VXRD 1MRDL 3RWCA 4LLQB 3ROOA 2WUBL 4OFVA 2EH7L 2HJLA 4L8CB 1XGTB 3RHWF 3KPNB 2YPLE 1XF1A 1FN4B 1JNNL 1UB5B 2H2PC 1RJZA 5JHDA 4XNXL 15C8L 4HLJA 4JRXA 5KAQG 1X5KA 4KHXL 4K3EH 3ARFA 1D9KB 1OAQL 4JPVL 1Z9LA 5JDSA 5FO8B 2Y9RT 4NQCE 4KMQA 4L3EB 3UO1H 3VFOB 4F8TA 4NNXB 3DV4B 4NYLA 3K8MA 5I71B 4ZAKD 4P99A 1WV7T 5I16B 4PJIA 3H9SB 2XPGB 3MRNB 1Q1JH 1NGXA 4XB8A 4PRPD 4Z5RB 2Z93B 4GUPA 3HRPA 2XWBB 3UC0H 5H8DA 2QQQA 3L6FB 4R2GD 4YDKL 4HH9B 1T5WB 1Q38A 1T1YA 1AXTH 2VL4A 5CILL 4X6CB 1ZWIA 2E27L 4KGJA 1CFVH 2B4CC 4RMUA 5SV3A 1FZMB 1G1CA 2ZZUT 5SWZE 5JQHC 4MAUL 1E6OH 5M95B 5KVEH 5INCB 4OCXH 1J0IA 2GSGA 4ODHH 5DD3L 1RHFA 1A14H 2V7HB 3DSFH 1UJ3C 4PJAB 4M43L 4QOKD 3L6FA 1B6DA 2V5RA 5E8DL 3WFCH 3K3QA 2FX9H 4OB5H 1OT1A 3QXDA 4YHIB 3AS1A 5DUMH 2J8UE 3PWUA 4RFNC 1A4JA 2PN5A 2R15A 3TJHD 4H1LH 1QPPA 1AXSB 5F9JA 1MH5A 4P2QB 1EXUB 1JFQL 3T4AB 3IXTB 4NO3B 4OF6A 1D9KD 4JFHD 4L3EA 1FFRA 2D2OA 5KTEL 4F7PB 3BP5B 4FNLL 3TO4A 3V6OA 5DYOA 2JK5A 3IKCB 3O8XD 1TJIH 3ZL4H 1K2DB 4OIIL 5F1NA 1PBYA 4APQA 1FAKT 5ITFB 1GZPA 2FHBA 4PR5A 1IQWH 5F21B 2J88L 2QQLH 4HJJL 5IT2L 4F15C 2UZIL 4UB0L 1F58L 3DMMB 3EO9H 1A6ZA 4L8CA 2A9ML 3VXRB 3OKMA 3QWOB 4CVXA 3DROB 4R4BB 4Y4FA 1RVFH 3B9AA 1MCOL 4FRWA 5FYJH 4YFLF 5FB8A 8FABB 5DD5H 4UIMA 2EDHA 5HHOA 3GSWA 3O9WA 4XMKH 5LWYL 4J4PC 1OTSC 4KVCL 3CX5J 1UEYA 5EBGA 1LMKA 1IKNC 1NCWH 1U8KB 3SE3A 1NUNB 3F6LA 3FB7A 4WHTA 4I77L 1M05A 1QFUH 5I73B 3VD4A 1IGJB 1EA9C 2R1YB 3DV6A 3EDFA 1ETZA 4HKJB 4AQOA 2FR4B 3VXMB 3C08L 4JJ5A 3MJ9H 4Q6IA 5JOFA 1RIVL 2ZUXA 3SY0B 1EBPA 4XPTH 1LK3L 2B5IC 5F7YC 2CQVA 4K2UH 4FFVD 2CDGA 4J1UB 3R1GL 4EUPH 5GZOD 1JHLH 4ZFGH 5ADOH 4JN1H 3BW9B 4IOIA 5DFTA 1UVQA 1YZZA 1ZT4B 4BK5A 5IB5A 4MQTB 3FZUD 3STZB 2F74B 3B9DA 3WIHA