1MJ8L

High resolution crystal structure of the fab fragment of the esterolytic antibody ms6-126
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
219
structure length
214
Chain Sequence
EIVMTQAAPSVPVTPGESVSISCRSSKSLLHSNGNTYLYWFLQRPGQSPQLLIYRMSNLASGVPDRFSGSGSGTAFTLRISRVEAEDVGVYYCLQHLEYPFTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords IMMUNOGLOBULIN MS6-126
publication title High-resolution crystal structure of the Fab-fragments of a family of mouse catalytic antibodies with esterase activity
pubmed doi rcsb
source organism Mus musculus
total genus 46
structure length 214
sequence length 219
ec nomenclature
pdb deposition date 2002-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mj8L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mj8L01
4WEUD 2B7DT 3VFMB 2BOCA 5D1QB 3CSYB 1RK0A 2MFNA 3KPNA 1ZHLB 4LLWA 2CR3A 4JDVA 5FYLH 1T5XB 2X4NA 3W0WE 5DD5H 4ETQB 5KZCB 2BRQA 4QOKA 3ULUE 3GKZA 3OR7B 2D2OA 1HXMA 4PLKD 3MOAH 2ZUTA 3FB7A 1HN1A 5C6PB 3HUJE 5LAXA 1ZGLB 1OGAE 4Y4FD 4PJ5A 1N64H 1U93A 4AL8L 3LRHA 4M1DH 2PTTA 4OIBA 3OWEA 3QZWB 3U36B 5DTFA 5FA3B 5KSBE 4Y4KB 2QTEA 1EVUA 4WV1C 5EBGA 2OJZH 4NZJA 3VD9A 5IJKA 2L0DA 3KR3L 5JOFA 1FAKT 3FQUB 4PRPE 3BKCL 2RFXB 3WFHA 3E1F1 1VEPA 5HHVH 4IOIB 3WBDA 5EC2A 5CIPH 1CGSH 1T20B 1UH4A 3VFOA 1ZWIA 1XR9B 4HWEH 2YPKB 4JZJC 3RX5A 4GKNA 5MI0C 4LLYA 1PSKH 3I6GB 4JFDD 1YJDC 3L3OB 3JV0A 3WLWD 4XAWH 5A40E 1OP3H 4YNYB 1S7XA 4NUGL 3UTZB 4JFFB 2H2PC 1BD2A 1FQ9C 4UB0L 1DBMH 1A6WH 3SDAA 1GGCH 32C2B 2BCKA 4E41D 1U8JA 4X4ZA 1C08B 4NQDB 1A1OB 3FO0H 2FO1A 4J23A 4XP5H 3D3VA 3LOWA 4HG4K 3CLEL 1H5BC 3MA7A 3QG7L 3GEWB 3JV4B 3BGMB 3OJMB 5D1ZD 1P69B 2VSDA 3WO3B 1P7QB 5B38G 3O8XD 4WWKD 4HJ0D 1B6UA 2IAMD 4Z7UE 3U1SH 3NFSH 1KTLA 4M7LT 1KCVL 2P42B 3PWNB 4PR5B 3SDDB 5E9DA 5JW5B 4CMHC 3Q2CA 1HHJA 3RFZC 3QXDA 5JPNB 1BEYH 5E1AB 4LVNB 3CFBA 4I3RL 5B21A 3EFFA 3IKCA 5F1OB 5IFHL 3ULVD 3LSOB 2VAJA 1HXYA 3TIDA 2QQNL 5JHLL 3GSUA 2BHYA 3O8XC 3SDXE 4WWKC 2VDPL 3HAEG 3WXVH 4R2GC 1KENL 5GGSB 5ACZB 3FN3A 1Q0YH 4JZNB 1I8MA 5L2JA 5C0ND 4YDLB 1YEFH 3BW9A 1RZJH 3VXTA 3FQRB 2KPNA 2NQCA 3PWVA 4PJXF 2QLVB 4XNXH 3SE3A 3DMMC 3WYRA 3S9DB 4MCZA 4ZYKB 4BKLB 5TDPB 1RUQL 3K2MC 1CXHA 3GSVB 4OCSL 4X4YA 4ONHB 4TUJB 4MJ5B 1CGVA 3A67L 5LG1A 3TBWA 5IFAL 1NFIB 4I77H 3PDOA 4ZNEA 4N8VG 3V0VA 1XR8B 4DFHA 1NBYB 2AVGA 4GAGH 1M7XA 5JA9A 4M4RA 4M1CC 1FZOA 3ARBD 5IVXE 3QPQD 1QBML 4MJ6B 4M5ZH 5IHUL 2A38A 4OUOA 4Q6IA 1JWSA 1MQKL 3ZE2E 4HXBL 1S7SA 2PUQT 5CP3A 4ZS6C 3RUGF 3TN0D 1A6PA 2HG5B 3LEXA 4GBXA 4GG6F 5GSVA 1M71B 3O6FA 1U8KB 3MBXL 3C6LA 2AJSL 4QXGH 4ZFGL 1IAMA 4O2CA 1U8HB 1SY6L 1U8LA 3CFJA 4G8GD 2YRPA 3BIKB 5D5ME 2V2XB 4D0CB 5I8EB 3IDNB 2YRLA 4OLUL 2YZ1A 4NQCD 4V1DA 1JRHL 2DYPA 3IDYB 5JW4N 3IDIA 4PYGA 3LMJL 5AWNH 4XMPL 2A6DA 4BM7A 3PJSB 2B1AH 5HHNA 5L7XL 3TN0C 4I9WE 3I02B 3MXVH 1MCCA 1CFTA 2R0WH 3FFDB 3GSOB 1CD9B 4KH2A 1FE8L 1KB9K 4TNWF 1OAKH 1D6VL 4FFVC 3T0ED 4TOYH 2FL5B 2OCFD 5DR5H 5GGRY 4ZNCD 2QBWA 2R0ZL 3FO9B 1LVEA 4DKFH 3O2DH 3U7WL 4NO3A 3VWKC 5DQ9B 5DFWH 3MSPA 3SCMD 3NCCB 4GW5B 2V7HA 1Z0NA 3PWJB 3NFNA 2AW2A 1YEKL 5DUMH 2EXYD 3GMRA 4U05A 3HZVA 2Y72A 3KS0J 3T0AA 2XV6B 1D5BB 3OB0H 1IEAA 4PY7A 1F2XK 4TTDC 3T0EC 5DRNA 3BAEH 3P4MB 4PJGA 2QQKL 3SBWA 4NZUL 1NEZG 3FB6A 1NAMB 4G9DA 3F8UB 2Z9TA 5INCB 3FRPG 3UTQA 4K8RD 5E2TL 3OG6B 2EXYC 5FGBC 5JLZB 3SGKC 3VE0A 3K74B 5AZEH 4KZDH 4JZJB 5ICXB 5FB8B 5MI0B 3KYKL 2FEEL 4FOMA 4N0UB 4OSUH 5DA4A 1ZAGA 2AJVL 2X89A 3T2PA 2P48B 3ZT7A 4EBQH 2R29L 1N2RA 5CAYB 4GQ9H 3NH7L 5IF0A 1MWAL 3DTXB 2XWTB 5DQJB 2X9YA 5E5MA 1J8HD 1CLOL 1G7IA 2E3VA 2GY7B 4WRLA 5CJBA 5SWSB 4PRID 3ARDB 5C0DA 3C8KB 1A6TB 2BP3A 3HI5H 3HG1D 3X11A 1RHHB 1NCTA 4E5XA 1NDMB 3D69A 2CLZB 1MCIA 1C5DB 2AEPL 4DK6A 1JPFB 3SO3C 1P4LB 4AK1A 1JHTA 1D5ZA 1VGEL 4B7LA 4R4BB 4R8WL 4MA7L 2R23B 1XGRB 2D4FA 3MGTB 4DN3H 2CK0L 1DANT 4HJGA 2XN9D 4J8RA 3WIIH 2QV2A 4HKBB 2CLVA 1RFDL 3BEWB 3S88H 5HHOB 3KJ6H 1IC5H 1JZ6A 4D9RD 1MVUA 3EYQD 4WHYG 2DOCA 3L3JA 3K4AA 2O5ZH 3HPJB 1MFAL 5FM8A 2Y5TB 2FO4B 3O8XB 2BERA 5FUZH 4R2GB 1XGUA 5T33H 4EKXA 3D2UD 4FQ1L 4KVCL 1Q9OA 2ITDB 3DMMB 1MWAA 3LKNB 3RU8H 4LKXA 4GXVH 1I85C 3REVA 3PL6B 3JTSB 3RHWF 3GZKA 3VXME 4OZHE 1FVCA 5T5NG 5IW1A 1A6AB 5DEFA 5IIEB 4JN1H 3MLSL 2VISB 3VXRA 3ZDYE 1ACYL 2NXYD 3TT1L 2XG4A 2AJUL 5DK3A 5LGHL 2EH8H 5KVGL 4GRWF 1SEBB 4YQXL 1LP9A 2FHCA 2Y5EA 3X3FH 4KFZC 5LJYH 3RY6C 2OR7A 4JDTL 5FHAH 1UXSA 1B0RA 4PIRF 3MV7A 3EOYG 1ZLUH 4TQEL 2ED8A 5FIEA 5SWQB 4G8EA 1SJHB 1JZ7A 4U1JA 3S35X 1P7KB 3CPLA 3RBGA 5C07E 4H8WC 5CMAA 2FB4H 1BBJA 3L5IA 5F1IA 2CRYA 1RVFL 4N5UA 3WLBA 3VGGA 4IMKA 2GITB 1G7PB 4LQFH 2ZZUT 2EIZA 3KPOA 3FTGA 1R5IA 2HYMA 3HMXH 1MUJB 4Y4HD 5B8CC 1NCNA 1ZVSB 2FHBA 3I50H 3ESVF 3BD3A 4U1LA 4NNYA 4PJFB 2W65B 4KMQA 2QQLH 5HJ3A 4UILH 1IBGH 4Z6AT 5T1LD 2FDBP 3VCLA 3Q5TA 2Z8SA 4K9EL 2OYPA 5D71L 1K4CB 5E8OB 4DKDC 4QHUA 2BVOA 1FZJA 4Y4HC 3P0VL 3BKMH 1BHGA 5EU4A 2VLLB 5HYJB 4OV5B 1GAFH 3PNWA 4XWOD 3P73B 3MUGB 2GSGA 3MCLH 1LEIA 4D2NA 1N3NA 4RFOH 3UJTL 4P59H 5C6TL 5L8LB 1TVHB 3NIDE 4RFNC 3TO2B 3RWIB 1GGIH 5DMIH 3VWKB 5JTWA 1LO5B 2CIIA 4UV7H 3SQBA 2OQJA 4XWGL 4LBEA 1YA5A 3VMOA 4W68A 2A73B 2YD4A 3QA3A 1AO7A 1U42A 3ETBF 1YEJL 3GIZH 3MFFB 5C0CD 4HUVA 1DDHB 5ESQB 4UU9A 5ERWB 4ZAKA 1Q9LB 3QJFB 3D39B 2FJGA 1PY9A 2VKXA 4NM8L 1OM3H 4HHAA 4YXKH 1I1YB 3PP4L 3RZCA 3EYVB 3MGOA 1NKRA 4K3GA 2DMBA 2Y1VA 3D9AH 1H15A 3KPRD 2UZYB 5DD3L 5E95B 3MRCA 3CUPB 4ZMAT 2Z93A 1JBJA 1QKZH 5IEKB 2EDYA 1EO7A 2H32A 1HEZA 1MI5A 2VDMH 1NBVH 1BREA 1ES0A 2ZSWB 1FH5H 2R2HA 5CEZH 1VDGA 4GRLA 4WI9A 4RWYH 5FKPA 2BSSB 2DTSA 3NZHH 4GLRH 4X7CC 1BPVA 4PB0L 1A7QH 1FLRH 2HP4A 4FQLH 4HFUL 1A1MA 5KS9B 1NLBH 4Y19B 3D5OF 5F88A 5ITBH 4NZTL 3PIQA 1YEGH 2ESVB 1FO0L 2F5BL 2AK4A 4XPFH 2WQ8A 2IWGA 5FYLE 5LGKA 1INQB 2AJ3B 2R8SL 3TBSB 5DDHA 2NZ9C 3B3IA 3FOMB 1JPTH 2YD5A 9CGTA 1J18A 1GOFA 1OTUC 3P4OB 3MPCA 3W0WD 3SO3B 1KPRA 1QD0A 3SGDH 4POZD 1J1PL 5EFIB 5C3LD 3H3KA 2IC2A 2VKWA 3ULUD 2P8PA 1TQBC 3WO4C 1NGXA 2PO6D 4YC2C 5E2JA 1BP3B 3HC0A 1Q9WB 1KIRA 1OP9A 1OGAD 1KB5H 4JQIL 2XZQH 4Z0XB 1LD9A 1JPGB 1YY9D 5F1NA 3AU1B 3VXSE 2Y7QA 4PJAA 4S1RL 3KWWB 4P23A 5DQDL 4IDJH 2NNAB 3RDTA 3ZSSA 3FAXA 1MCWW 1PG7W 4PRDA 4PRPD 3GGWB 4POZC 4Z8FH 3L3GA 3BKYH 3RWEA 3ULUC 4RRPA 4WFFE 4HPOH 4WFGE 5D7IE 3EOTH 4UT6L 1JHKL 1I7UB 1T0MB 4TULL 2XKUA 1OPGL 3CFIC 4X9IA 2JJSC 2K7QA 3CVHL 1YEEL 1YY9C 5TH2A 4U1SB 1NGZA 1L7TL 3GO1L 1FO0A 4M6OH 3VXUA 5E94A 4KRPB 2BHZA 1B4JH 4HCRH 4DK3A 1MVFA 4JG1L 4QNPE 1HHIA 1KEML 1DR9A 2EDNA 2BY1A 2A74B 3HZMA 1FFNB 4QGTA 3TESA 3O4LE 1M05A 1IC7L 1WBZA 1UM4H 4LHUG 4NBZB 1T7YA 4ODXB 3SOBL 1LK2A 2PYFB 4PGEB 3K46A 3I3EA 4S1QL 1J1XH 5MEPB 1G1CA 1G7QA 3FQXA 2VZVA 4HBQA 2ADJB 1FDLL 3RVXD 1EFXA 3JZ7A 1EK3A 1VCAA 1IEBA 3PWUB 1J87A 3K4DA 3JWDL 2J1KA 1FGVH 3X14A 4QRTA 2BDNL 4ZUUA 4NC1E 5GIRA 4NT6A 2OR9H 4XVTL 3RTQD 4UUJA 1EIBA 3CVHA 3O3DA 1I3RA 1MEXL 3BWAA 4XCEA 5FGSA 5HDQL 3UZQA 3KLAA 1G7LA 3BXNA 4I0PA 4ZTOL 1ZANH 3DO3A 2ZOLB 5KSAD 3VI4E 4OD1H 1CLZH 5CJOL 1ERNA 3TH3T 5BS0E 3BP4A 4LLUB 2HT4C 4XP6L 1WIOA 1RIHH 2IAND 2YRZA 2ZUYA 3MRDA 4IRJA 5BV7L 4OV6F 4PY8J 2GW5A 5EU6E 2A1WH 2WBWB 5DD6A 5IBUG 2APTA 4Y16C 3IDMA 3BMVA 2DQJH 3MRRB 1GCFA 3GI8H 5EORH 3EGSA 1WWBX 4WO4A 5KSAC 2DQHH 4G8IB 3OXRA 3T0DA 1A9BB 2GK0A 3C08H 3U9UA 2ICES 3MCKA 3O3AA 1UJ3A 2VSCA 1F02I 4N1HB 1OTTD 3JWNC 4KTDH 2E7LC 1RUMH 5IESH 4HUWB 2AV1B 3BEVB 4M1GH 3ARGC 1KPUB 3E3QE 3RNQA 3A6OA 4U2ZA 5C0AA 5DT1H 1JYVA 4APQB 5MERA 3C87A 3UTSB 1QQDA 2VDRL 3KHQA 2JJTA 4LFHD 1TJGH 5CZXD 4X0KA 1QLEH 4HIJA 3LQMA 3PABA 4HWNA 1A1NA 3BT2H 1NFKA 4P2QA 2VJXA 5KS9F 1I7ZA 5MENE 4I9WD 3B9KB 4OZ4B 3QQ3B 1OTTC 2BMKA 2P5EA 2A77H 1A7NL 2A0LC 2NPLX 1F3DH 4FTVB 3OR6B 1XCQB 1E27B 3H7LA 1J5OL 4TSBL 2EE2A 2F54E 5J8OA 1DSFH 5JDJA 1YNLL 2GJ6E 3L3IA 1HH6A 2VH5H 1ZA6B 4LMQI 4WHTB 1JE6A 1TQBB 3V4VH 4NZDA 4YC2B 5IJVA 1NC2D 3IJYB 5I17A 1NMBH 4KKCD 1MLBA 3BZFA 1BGXL 3ZHKA 4KHTH 2G5BA 4KROC 4LAJH 1MHHA 2E5EA 3V0WH 5BQ7B 2HRPH 3NCYS 4Z7QF 5HD8C 4K3JH 2OTUB 4MS8C 3GMNA 1IC1A 3UJIH 4HQQH 1UC6A 4PGCB 1YECH 35C8H 4YUEL 3DVNB 1JGVH 3QDMB 4WHYH 2FZ3B 3QQNA 4YHPA 2WUCL 4UDTB 1P2CB 2WP3O 1NMAH 4P2OD 2F58L 1A47A 4WDIB 3S96A 4NKDB 3K4ZA 4OIIH 3UPAA 2IALB 1WBXB 5F3HB 3FZUD 1A7RH 4LCWE 1KACB 1G9NL 5J6HA 3L3DB 2JK5B 3MRFB 1CDJA 2HRLA 1J7VR 2OJEA 3T77B 1IZKA 1K2DA 1UWXH 3CDFA 4MLSA 4FFYH 3M1BB 2YXMA 2IPUG 5AG8A 4OTXH 2BFVL 4H25A 3QWRD 1R3KA 2F53A 3DROA 4XP9H 1KFAH 2X4TB 2QADC 2CXGA 3GMQB 4QT5A 3H0TB 4KZEH 4HH8A 1RZIB 1CT8A 1KYOK 4PGBB 2R2EA 2XWBA 4H26B 3FZUC 3IVKA 1UB5B 1OGTB 5A16A 2BVQA 5MEQA 4ZPVA 1DQLL 1VEOA 4ZFFB 1WC7A 8FABA 3MV9A 1K8IA 3LKQB 4UQ2B 2HKFH 4NRYB 4JHWH 1P7HL 4I2XA 4KVNH 5E0QA 5EO9B 4E42B 4LCIH 5BV7B 2CKBH 3N1MC 1Q9KA 1XGPA 4L4VA 4U6XB 1KIQB 1DFBL 2XKSA 3Q1SH 3QG6A 4OZGE 5DEGB 2X4PB 4HS3A 5A43C 4ELME 2D0FA 5BOZG 2R1WB 1G7JA 5IMLA 1L0XA 2XA8H 1PAMA 3C5ZD 3Q6GL 4ODHL 2A6KB 5D72L 3U0PA 3KYOA 3UZEA 5GS2D 4PJ7E 5DK0A 2OZ4L 1TPXC 2R2BB 5ID0B 4XBPB 1F4WH 4ZTPH 2Q1EA 2FJHB 5IGXH 2OBGA 3SJVE 1IGTB 3C5SA 1FC1A 3QIBB 4BH7A 2M1KA 4NDMA 3VXMD 1FIGH 3O3EB 2FATL 3V52H 1R0AL 1HQ4B 2NTFA 1T1YA 5DHYA 1AJ7L 1FL6A 1YY8A 3RVTC 1C16A 1IGMH 5CZVL 1S7WB 5F9AC 1P53A 4Y16B 4FQCH 5EO0B 4ZUTB 4OLYL 3PDDA 4X6BB 1NGYA 5HHXL 1LILA 2FH6A 4I5BB 5IW3A 1KIPA 3C9NB 5C07D 3IETA 3FT2B 1HI6B 3V2AR 3P77A 5KSAB 3KPMA 3EO1B 5LKNA 1FFOA 1A7PL 1CBVH 3WS3B 3IU3B 5DVKA 4AIZA 5CD3A 3TO4A 1D5IH 1GRWA 2R69L 3RUGA 3SKMA 4YO0B 4GG6A 3ARGB 4KGJA 1X5KA 3ARFD 1KYOJ 3C2AH 1IKFH 3SGJA 5F7DB 3RQ3A 1X5IA 4Z7WB 5F9JA 4XCYB 2ZCHH 1UQSA 2OZ4A 3CMOH 4KPHL 3TH2T 4GJTB 4OD3H 5E4IA 4GMSH 1J05A 1H8NA 1T1ZB 5HGBA 2D03H 4JR9L 1JZ8A 3TZVA 1HZHL 2KQMA 3TV3H 2H45A 2J2ZA 1MCWM 4D9LH 5IQ7H 3S7GA 1T66D 2E6QA 4EN3C 1J0IA 1CF8H 2VAAA 4IJ3C 4U0RC 1WAAA 1ZSDA 1RQ5A 1QSEE 3UTTA 4LLMB 2G9HA 1MFBL 1U36A 2P8MB 1UWGH 2AABL 2M26A 4P3DA 4F8QA 1CCZA 1A7OH 3N0PB 43CAB 2YUWA 1JUFA 3ROLB 3RIAF 4NWTL 3G5XA 4LQ1A 2BNUA 3RGHA 5DJCB 5EUOF 3OZ9H 4LSSH 4WI6A 3O2VL 4NKOB 1INEL 3OAZK 4NRXA 1S7UA 1S7TB 1RZGB 1CS6A 3MRNA 4X5XB 1LNUB 2IH1A 1BJ1J 5JO5B 1VPOH 1CIDA 5C08B 4DCQB 4KROB 5ICZA 2W60A 4XZUB 3W9DA 1UEYA 2YUXA 1OWWA 3B9DA 2YD3A 3L5XL 3ULUF 3FCTB 1KJ3H 4XC1L 1TZHA 1AGCA 4ZUVB 3CX5K 1XGYL 2EZ0D 2YA1A 2HJKB 5DA0B 4PJHE 3TFKD 5K59E 1L7IH 1EJOH 2N7AA 5TFSH 5CEZE 1YEIL 2X4SA 1S9XA 3RJQB 3QFJB 4TVSa 1MRCL 4F9LC 5D2LB 1EMTH 2HT2D 2XTJC 3EUUA 3O3UN 3RWCB 2O5XL 3D0VB 2VDQH 5BZDB 1OQOA 5F6HJ 3D87B 3DGGA 4M93C 4NYLB 4DVRH 3O9WB 4DFIA 1U8PA 2J8UB 1UM6L 1LDSA 4KY1L 1G6RH 3IAQA 1IL1A 3TFKC 1I3VA 2QADB 3F5WB 1GIGL 1H3VA 4FQHB 3U0WL 5FYLD 3GSNL 4Z77A 2GFBB 3QNZB 3V6OC 4HGWB 4MXVF 3AM8C 1MNUL 4OFYA 2AXFB 4L29B 4LF3B 2Q87A 4D0DA 1JWUA 4MB4A 1OCWL 4P4KD 5GQBA 4OCYL 1CFVL 3QDAA 4M62H 1H3WM 4OLVH 2WWKT 3B2UD 2VL5B 3QNYB 4X6DA 4DGYH 2X4RA 3ZL4H 4YE4H 5FYKU 3MACH 1ZT7A 3JUZA 4JQXA 3VXSD 5E6ID 1KT2B 1MREH 3VFVB 4CDHA 1TTUA 4Z7UF 5C2BL 1NFDA 1UWEH 8CGTA 4HT1L 3DXAA 1J8KA 5HDLA 5L88H 1PEZA 1QFHA 1H3PL 5DVOA 3WFZA 3P9MB 1MFDL 4JY5H 4N8CL 5JMOC 2HLFD 3QIUD 1RUAH 2B2XL 1U58A 3VJ6B 4WFFD 4TUOA 1BVZA 4XXCA 4WFGD 5EWIL 3RGVA 4MQ7B 1TPXB 3B2UC 3HE7D 1MF2H 1C7SA 4Z7OE 4AEFA 2BVPB 4L8SA 3STZA 2FIKB 4WEMB 3WS6A 4OUUA 5E6IC 1NFIA 3GSNA 3SDXF 5DD0L 1IGJB 1QLFB 3BDXA 4NQSB 5KOMC 2WINB 4ODUB 3CX5J 2VLRB 2AXGA 2BSED 2NX5A 4JFEE 1FHGA 5BVPL 5J9PB 4YFLI 2ZOKA 3UPRA 4K94H 3QIUC 4LEXH 3WFBH 3RA7H 4MWFB 4RQQA 3TP4A 3RWFB 2AXHA 5GGSY 1S78D 4MXQC 3O4LD 5TQ0H 2BOBA 4DTGH 4Q9QL 3O45B 3G5ZA 2Q7YB 1CXIA 1EDQA 1OAUL 5B39B 4HIHA 5HVFB 3GMPA 4KC3B 1N0XL 4R0LB 3KPSB 5DC4B 2VNCA 5I0ZA 4LLQB 5C0EA 1G9EA 2FX7H 1KJ2L 1KTRL 3WUWA 1ZLVK 2CO6B 4ISVB 4JPIA 5DHVB 5DURD 3OKOB 4Z7WF 3W9EA 2ICWI 3QEUB 2BC4B 3AC0A 1CXFA 4X4XB 1A2YA 5FCUH 4PV8A 4YDKH 2JB5L 4KTEL 1RZKH 4NO2A 1S78C 2AAVA 3MA9L 3MRLB 2Q8AH 3HNTH 3ZE2F 3PGCB 4QWWD 5F89B 2CDEB 3LIZL 3D25B 4AM0B 2H1PL 3IDJB 2D7TH 3QCVL 2C9AA 3MUHL 1NUNB 5F8RC 4R26H 4MDIB 1TNMA 3CCHB 4PFEA 1F6AB 1GVIA 4JM4H 3FT4A 5DRXB 3N9GL 4EN3B 1VFAA 1Y0LB 2J12B 4U7MA 2VQ1A 4IJ3B 5CHNA 4JM2A 2H9GA 3VG0H 4G42A 4EQ3A 5BS0D 2EIEA 5D7KE 7CGTA 4M5YH 2NW2A 2AK1H 3FHAA 4XBEH 3BMWA 1S5IL 4NC1C 4GG8A 2GJZA 1BVLB 2I07B 2F19H 1RZJC 2FWOB 2HTLD 1KJ2A 3QIWA 1U8NB 3REWB 2GTZB 1ZHKB 1WICA 4HJJH 1QSZA 4NQVA 5BZWB 2H8PB 5GISH 1UM5L 1CZ8H 3RRQA 3D6GA 4U6HB 3EOAB 3TIEB 3UAJD 2V5TA 5EN2A 4WV1A 2VXQH 1FN4B 1ETZB 3EDJA 3OJDB 3OMZA 1YMMB 4K71C 5I1JL 1L6ZA 2DWDA 4X6FB 3MOBL 4IRZH 2NZIA 3FOLA 2X5PA 4DJMA 3UBXA 1KXQE 2FHFA 5HSFA 4ZFZB 1E4WH 5CINH 3LD8C 3TPKA 1MAML 4Y4FA 5D2LF 3TJHC 1QR1A 3QEGH 3D1MC 4OZFH 4ZSOE 5JZ7D 5T3ZH 3PF2A 3VFGL 2P43B 5D6CA 4N0YH 5BMFL 4Y1AB 3UAJC 4BQCA 2XTJB 4OLWH 3IS1X 4K3HA 2YD6A 5FA4B 1R3LA 4IHOA 4X8JA 5MEND 2J8UF 3QWOB 4S0TD 3S34L 1CVSC 4XPGH 4C56E 4YH6A 3MBED 3O6ML 1NDGB 5DJDA 5IWLA 4WW1A 3KPQA 1Q1JH 4PG9A 4JO4L 2R9HD 3LPWA 3E3QC 2WUBH 2Q3AA 3ULVL 1H5BA 4LARH 2HWZL 4JRWA 2F54D 3MRKB 3CC5A 4HUMB 5EZJA 5H35B 5KW9L 2BY3A 1WIUA 4HWZA 5IB1B 5JZ7C 1CR9H 2IFGA 2GJ6D 5KAQG 1EHNA 1E28A 3QUKA 4JFDA 1RJZB 4KUZL 5DK2B 1IEHA 3VFSA 3EJJX 4MZ2A 3MLZH 3G04B 5K9OB 2Y07H 5I19L 1S9WB 4RX4D 1P84J 4U1MB 4A6YB 2MOVA 4RZCA 5AAMA 4DZBA 4E41A 3LAFA 1JGLL 4K7FB 3EDEA 2DM4A 4H0IA 4UOW1 1C12B 4PV9A 4XNUH 3EYUL 5F72S 4CJ0A 4LSVH 5D1ZA 5FXCH 2CXKA 3U7YH 1DANU 3HMWL 3O8XA 1BQHA 4WWKA 5EO1B 2IAMA 3QI9D 1I1FA 3L7EB 2HTKC 2OL3B 1KOAA 1NSNL 2VITA 2GUOB 4QYOB 5E70A 3LKNA 3GSWB 4G5ZH 3UXFA 3F12B 2H41A 5I8CA 1RIVH 5ALBH 2NY5C 2JELL 1AKJD 1K5NA 4LCWD 5EUKB 4ODSL 5T1MB 1RIUH 3FHQA 4K2UH 1IM3A 4PTTA 5FKAA 4EUPB 1B4RA 1QEWB 4EI5C 4DVBA 3V5KA 1FYTB 2DDQH 2KDGA 4M03A 3IJHA 4HX1A 4JFXB 4I0CC 1FG2A 1HQRB 5DXWA 3FO1B 5A1AA 4DGVH 5ICYA 1IE5A 2PXYC 3VW3H 1HHHB 3RWJB 3DX6A 3P30H 1ZXQA 2OR8A 4ZOAA 5J1SC 4L1DA 3MV8B 3BPCB 3CK0L 1NH6A 4OT1H 1MLCB 5JR1L 1DEEA 4NQEB 4YHLH 3OPZH 4OIAA 4M6AA 1J0JA 2JIXD 1BF8A 3MNVA 4OD2B 3DUUB 3VFUB 3EYFB 2WWMD 3ARBA 3PHQA 3IAGC 1LE5B 1RUPL 3OKKB 3WL9B 4AH2A 3P3YA 2XYCA 1J0YA 1VGKB 4YHIA 1EEYA 1QRNE 3TN0A 1A5FH 5F21B 2A2QT 4R4ND 5FF6B 3DHJA 3RI5F 3MRPA 5AAWA 5BRZE 4WTWA 3MCG1 4QXTA 5CILL 3SJVD 4D0BA 1LO2L 4G8GA 4LNRA 5EPMA 4QRQB 2WWMC 4G43A 3MUGA 1U8OB 2NLJB 4NQCA 3FO2A 3G6JB 4U3CA 3U6RB 1RAMA 1FAIH 1ZEAL 4JJ5B 4J1UB 4DW2H 3DBXB 4EI6B 1JYXA 2Y06L 1LK3H 1NGPL 3INUH 3L3KB 1T3FA 4R4NC 4K8RL 5FK9B 3TCLA 3E6HA 4QTHB 1P1ZA 3WHXB 3T1FA 4NJAL 5FM5O 4CU7A 4KXZI 1MPAL 1PYWA 4AIXA 5CJQL 5JIKA 3F58H 1QO3B 3T0EA 3BRDA 1SJEA 3EO0A 2OM5A 2XIDA 4ERSH 2VERN 5EU6B 3HI1B 1OAYH 4AEHH 43C9A 5KVEL 1NCDH 4H0GA 3SCMA 3EYSL 3GSRA 3O0RH 2XZCH 4L3EB 3LD8B 4TUKH 5DVLA 5DMYA 2I9TA 5TE7H 2Y6SD 4P9HL 5HYFA 3MLPA 1XIWC 1T6VN 2ADFL 1FJ1B 1Q0XL 3I75A 2J88L 4HBCH 4Z7VE 1XF4B 4L3CA 1MJJB 5I8OH 4CBPA 4D8PA 2W91A 3R0NA 3QHFH 4ALAH 4OI8A 4LPTA 5IVZB 4YHOL 2DLIA 5TQ2H 1T1XA 2DQFB 5M94B 5JXEC 4PRAB 2YHGA 2EYTB 4XC3L 2ZUUA 1DBAL 1QSED 4Q9RL 4GO6B 3TGXA 4JHAL 3QEHA 4BH8B 1OVZA 4OBRA 2BSRB 3ZTNH 5C0BB 5DZNA 4YXHL 2RR3A 2NY7H 2SEBB 4KQ3L 3HI6L 2ZG1A 3BO8B 2BRRH 4XP1H 4JG0L 3H9SE 3W5MA 1FNSH 3BN3B 4BQBA 4XAKE 2AJYL 4J3XA 1DLHA 2XNAA 1MCOL 1JYWA 1AY1H 1MFCH 5EOCL 5J89A 1TENA 3BISA 4IBLT 2DWEB 5HGGS 1J8HA 4P4RA 2CLRA 4PRIA 2CDGB 3V5DA 1G7MA 4JVWA 3HG1A 4X6CE 5I76A 1B3JA 1DQDH 3O11A 1C1EH 2DICA 1LEGA 2HMID 5CZKA 5B4MD 4JFHE 1B2WL 4NO5B 2IQAB 2V2WB 5FDWA 5IB2A 2XN9A 4FQQB 5CEZD 1KELH 3KJ4B 4WUUE 1T2QH 3EDDA 4Z7NE 3CVIH 5TDNB 2F8OA 5K9QG 5GRUH 5FYJU 3MLRL 1E0OB 4EI5B 2HMIC 1XF2B 2ZJSL 3MXWL 3QUXD 4HZLA 5B4MC 4PJBA 3DUSB 3KHOA 4U6VH 3RY6A 1CU4H 1EXUB 5CBEB 3ZHDA 1OW0C 2P5WB 4EOWL 2PF6A 3QSKB 2MTPA 3D2UA 4FXGB 2YD2A 1QYGH 2PXYB 4MNGA 4AIOA 4P2CG 4G8FB 4YHKH 3GRWA 2MCPH 3TBTB 1E4XL 4OJFL 1JFQL 3TBYB 2LABA 2E27H 3LRSB 4QNPF 1G0XA 1F00I 4RBPK 1BIIB 4DKAA 4RIRA 1AI1H 3OB8A 4KHXH 1V3JA 4HF5L 3RL1A 5MHSE 1S9VB 2AJXH 2NY1D 2ORBH 5B8CA 1JNLH 1KLGB 1IGCL 2FBOJ 2ZPKH 3EO9L 5CWSB 1HINL 3F7VB 3DI2B 1RU9H 2H2SC 3AXLB 4MCYB 2H6PB 3U2SB 1ORQA 3QXAA 3QCUH 4EDXA 4YZFF 3DYOA 5I1KH 5I0DA 2QSCL 3MJ6A 4MD0B 4QRUA 4Y4HA 1W0YT 4ZOEA 3G6JF 1DLFH 4KWUA 3TYFA 3TVMC 5EBMA 1I7TB 3KXFB 1SM3L 3QBTB 4RNRB 1FNEA 4GKOA 2P7TB 3TBVA 4JFED 3LQZA 4C83B 4WTZA 5T1LA 5C2UB 4OCRL 1ZT4B 3RWGB 2W92A 2BNQE 3QO1B 4L8DB 4F58L 1A02N 1TITA 2XWJB 4JANA 4B50A 5CBAA 4FQIH 4PJ7B 1PG7H 1GSMA 5H2BA 1TZGL 3SE4C 1U9KA 3HNVH 3G5VA 4UOW0 5GGUA 4IS6B 3VXOA 2IPTL 2Q86A 3BD5A 2EXWD 1AHWC 5IM7B 3MV01 3WFEL 1KUMA 1KPUA 2CMRL 4MJIE 3P40A 3QUZB 3IFOA 5EBLA 1UA6L 3MJ7A 5MP6L 4XCNA 4E9LA 4ORGA 3V4UL 3W2DH 3TA3B 1J86A 3Q5YA 4FZ8L 1WT5A 3BKCH 1XIWB 2PR4L 4LCCA 4MD5A 5C0CA 1D5MA 1I7RA 2Z92A 1O7SA 1IM9B 4GKZB 1LEKB 4GRMA 3UJJH 4MAYB 2EDKA 3ZDXF 3IJSB 1YN6A 3GBNH 3GIVB 3PP3H 1W8NA 4G7VL 2CH8A 4RRPG 1AGFB 1NUFA 3EYOB 1E27A 3R06B 3KPRA 4WI7A 4NUGH 1CG9A 3U46A 4QHKI 4C54A 4UB0H 5D7KD 1PKQB 3BGAA 5ETUB 3MLUL 5E5UB 1CICD 1JRHI 3UYPA 1RD6A 4GKSA 1TVDA 4M7JL 1F4XL 3QCTL 3ZE1F 2C1OB 4NHCL 3SDYL 3LY6A 1NAMH 2YBRB 1KN4H 2X1QA 1DUZB 2Z35B 5EUOA 3PWLB 1T83C 4M00A 1XF5A 1NPUA 2W9LA 4EDWH 4Q7DA 1YNTB 3WD5L 2C3XA 3WHE1 4PGCA 4YDVA 3PWPE 2CGRL 5F7YC 3NABH 5L2KA 2DTML 3CXHK 4XPAH 3TYGH 3W0WA 5IFHH 5CJXC 4QY8B 5TE4L 2IADB 2BNRB 2VE6B 3IXAB 2NY4B 2PO6A 1CLCA 4K7PH 4X99B 1R5WB 4DZ8B 5T3ZE 1MCLA 3HUJA 1I8IB 1YPZE 2FGWL 1OGAA 1N6VA 3UC0H 2JJSA 4ZPTB 1T4KB 1KENH 2ERJC 4I18A 1AXIB 1DQML 2X7LA 3BQUB 4G6JL 5KSBA 5IK3B 4UTAL 1MH5B 3E6FA 1JNHB 1FGNH 3W82A 4C56D 3WSQL 1NCCH 2C1PB 2F74A 5C9KA 4PRPA 3GMMA 3TC9A 1ZT1A 1CDUA 2A83B 3VD3A 1U41A 2JCCE 3C09C 1FV1B 5KBNC 3QUYC 4H1LA 1II4E 5BVJB 3AB0C 4H26A 4NGHH 2VZTA 2MMXA 1G7HB 1DQQB 5ESVA 4M7ZC 1X5FA 2FEEI 4WUKL 1QBMH 3FB5A 1PY4A 2NW3B 4N5EC 2FBJH 4JCLA 5IHUH 4QHNB 5HHME 4CADB 1MQKH 5CSZA 4HXBH 4HKXA 2YC1A 5FO9B 1ADQH 4D94A 1OF2B 2DI9A 1M7IA 2DJ4A 3BIBX 1UADC 4QCIA 3L9RB 2KL6A 2AJSH 1KTDB 1J12A 3VRIA 1E6OL 5B38B 1SY6H 3GJFK 4Z7UA 5IFJB 5EZOL 4OGZA 4CNIB 2DRUA 2GAZA 4OLUH 1D5XB 1T04B 1AXSB 1H8SA 1XF1A 4DAGL 2I60L 5T1DL 3ZKMD 5BW7A 1HH9B 3OXSB 4KMTL 4PS4H 3LMJH 4XMPH 3FL7A 5DRWA 2X05A 1SBBA 4BSVA 4JEGB 1X5XA 3HC3H 3VXPB 3TVMB 1EGJH 1BX2A 1A4KB 3RTQA 4AEEA 4KJYA 1FE8H 3SDXA 4QXWA 3SGEI 3HAEB 3IF1A 2K3TA 3NZ8B 3PQYB 4O02H 4PJ7F 5D1XB 4F57L 3RVUD 3I84A 1OLLA 3NCJH 4PRHB 1IAIH 3PDGA 3MNZA 4U1KB 1GGUA 1REIA 2R0ZH 3FT2A 3L5WB 4HKJA 1Z3GH 3EO1A 3BPNC 3FMGH 3U7WH 3NA9H 4PJ9D 2LFGA 1MCHA 1DE4A 2VZ1A 5C0GA 1YEKH 3Q3GA 1HHGA 2IANA 4PJEE 2IH3B 2E7LA 5DJAB 4N8VB 5F7NC 4N90E 1ROWA 4P57A 2PW1A 4PJXE 3RX8A 3CIQA 2ZG2A 3RVUC 1OP3K 3IFPB 4AENB 2MSPA 3VD7A 1DVFD 4QRPB 5IVXA 1NANI 2NMSA 1ZV5A 1ORSB 1I4FB 2VLKE 2QQKH 4NC2B 5I1GH 1A14L 2B5IB 4FA8A 4B0MM 2HJLA 2GSIA 3SPVA 5GZOC 5ISZE 3DURB 4YEFA 4PJ9C 3ZO0A 5M7QA 5FDYA 1QRND 3QDJB 4JRXB 1HKLL 5GS1A 4MSWA 1QVOB 2XRAL 4Y5YC 1VADB 5H8DA 5BRZD 1F90L 2GY5A 4N9OB 3OQ3B 1XF3B 3L95B 2AJVH 5EU5A 5D5MA 1JGEB 5C0RL 5ILTL 1DVFC 2HFEA 5TF0A 1J9CT 2P24B 1FPTH 4WJ5A 5E8NA 4ZFOB 4RGNC 3QXWA 1S9YA 1MWAH 4HPYH 2FX8L 1MHCA 5HYQA 2C5DC 2X40A 4O2FA 1YQVH 5FUOL 1ZHBA 3AAZB 4XCCH 1M7DB 3H9ZA 1T89C 1FNFA 5DGRA 5DJ8A 5I1IL 4PLJC 4BJLA 3C60D 5GGTL 4JVPA 5IR1B 3V7AE 3QRGL 1R3IL 4QRSB 2WLZA 3S35L 2HKHH 4NPYA 1QP1A 1RFDH 1RUKH 4F7MB 3HS0B 5F7MC 4H20L 2YK1L 4QEGA 5I74C 1BZ7B 4WIQA 5K9JH 1MFAH 3VG9C 1NC2A 4WWID 5T1KD 3LHPH 25C8H 1I3GH 1ND0B 5EU7C 2X4OA 2A6JB 5C09A 1DQJB 3C60C 2ERJB 3EKCA 4U0QB 4JVUA 1EAPA 2E7MA 5GRXG 4P5TC 2VZOA 1YC7A 5AUMB 4FQ1H 3IDXL 4PGJA 3V79C 2MNUA 4PP1D 4TPRH 2YPVH 4HV8A 2B4CL 2Z91A 1XGTB 5C6WH 3FQWA 2E6PA 4KRMB 3QJHA 2YD9A 3FFCB 2K9UA 4XPTL 1YYLH 4TRPL 1HHKA 1NEZB 3MLSH 4JY6B 3S4SA 4OLZL 2CUIA 2X4UB 3LEVL 2EKSB 4P2OA 4BZ2L 3MGAA 2AJUH 3C09B 12E8L 1AFVH 2QQQA 3QUYB 3ES6A 4PJ8C 4YQXH 4YX2L 4HIXL 4BZYA 4ZXBD 4YHML 5GGTA 3MJ8B 3H9SD 4TQEH 5D7JD 1FL5A 4XAKD 5KVDH 2DLFH 4KAQL 5D7LB 4KK8C 4PJDB 3QB7C 7FABH 4FQXD 3NAAL 2J8HA 3BESR 1RVFH 3KPLB 1T1WB 3T0BA 3PV6A 4R7DA 3QWRA 4ORZC 5IB3B 1BFOA 3E0GA 4N0FB 4PLNC 2W9EL 4JFFE 4QRRB 3C6SA 3HE6C 1W72B 1Z9LA 4NJ9H 4G6MH 2YKLL 3VFNA 4E0RA 2GEEA 1T7WA 1OL0A 1KCSL 2OP4H 3BKJL 2CDFA 3VMPA 5DC0A 3NN8A 1P6FA 5C0FB 3WIHA 1OB1A 1TIUA 2NXZD 3OKLB 1HOCB 4EXKA 1QHPA 5GHWH 3SKJH 3IT8D 5TF1L 4LU5L 5L9DL 4WUUD 4R9HA 2AQ2A 3BH9A 2CKNA 1CIUA 4OAWA 2NTSP 2F5AH 3RNKA 2KBGA 3P4NA 2UV3A 5EC1A 3HKFA 5JHDB 3W81A 4M6NH 5DI8A 5IHBA 2C3VB 1D9KD 1FORL 5DJ0A 3P0VH 1A21A 3IXTB 3C5ZA 4QF1B 4X9BA 4L8BB 3MMEA 3I6KA 4X7SL 1A3LL 2NXZC 1X5ZA 3PGFL 1CD1A 1U0QA 3FQNB 4HFWB 5HHPB 4OGAD 1K3ZA 5F7FA 2ZCLL 3RBSA 5A3IC 3BPNB 1KBGL 2A6IB 4NZRL 4ONFL 1QA9B 3VXMA 4I48B 4OZHA 1EVTC 1U6AH 4OFPA 1NC4D 4JPKH 3OX8A 4HGKC 5I75C 2BC4A 4HUUA 4NO0B 1YUHA 2O5YL 4R7NA 5MHSD 5IB5A 3BRFA 5JPMB 3T2NH 4BSWA 5D2NC 1S8DA 4QXUL 3QEQB 5GS0C 2V2TB 3U4AA 5I30L 1DZBA 4UIKH 2QSQA 4HDIB 1MCKA 2DF3A 2CDEA 5CSBA 1T03L 5C07A 5JIIA 1TTFA 1WCBB 3K8KA 4HGMA 4LEOA 4PJ9B 3GSQA 4KI1A 3VFWB 4V2BA 1N6QH 1MJ7H 2EICA 5KTEL 1LDPH 4UV4H 4PJIB 1W0WB 3NIGF 2O61A 2CKBB 4Y5YB 4Y5XC 2BVUA 3ARFA 4ODTL 4M9PA 5GGVY 2Z31D 5IVOA 1KN2L 1QRKA 1EH9A 4DGIL 4WFHE 1VKXA 4N9GA 1UKSA 1IGIL 4RGNB 5C8JB 1NUDA 2GJJA 3BP7A 5JNYA 5KN5A 4BK4A 4NZTH 4KUCD 1VACA 2F5BH 3C5JA 5EIIA 4ENEC 1HILB 2C7UB 4UQ3A 2R8SH 4KKAD 1PJ9A 1N5AA 3EFDH 1MCQA 2BNQD 4YFDB 5D6DC 3WJLC 1IAOA 1P9MC 4Z76A 1QTYT 5JIPA 3OHXB 1C5BL 4F37K 4NKMA 1BFVL 4NSKB 2HH0H 4JQIH 3GK8L 5DJ2A 1WZ1H 4K94C 4OM0L 4LL9A 3HZYA 4RA0C 4MJID 1KLUA 4MJ2A 4WW2B 1IGYA 4F7EB 1OY3B 2DN7A 2J5LB 3MRGB 5DQDH 1T80A 1WUNT 4KKAC 3T08A 5KSVB 5I74B 5IQ9B 3VG9B 5AZ2H 2VDNL 4RGOH 4DEPB 4KDWA 3KYNB 3V5HB 4EIZC 1BOGA 3MOAL 4HLZG 4HUXB 2HVKA 4P5TB 4UT6H 3GJEA 1OPGH 4QO1A 1JPSL 4NQXA 3CVHH 5DJYB 1YEEH 2ZSVA 3QDGB 3VFRB 4LHJB 1OLZA 2X1XR 4CMMA 4ODWB 3OKMA 4JG1H 1UB6B 3LKRB 3VFTA 2OK0L 2OJZL 5DJZB 3SY0B 5BJTA 1XAUA 5I1EH 4LSRH 3BVNA 5MEOB 1WTGT 3AM8A 4LPCA 5HHVL 4PJ8B 3CGTA 5D4QA 4PJDF 2VLJB 4PBWD 1AQKL 1BBDL 1H0DB 1ZS8A 3UO1H 4NWUH 1FL3B 4MMZC 3HZKB 2FX9L 4HWEL 5TDOB 1S9WA 1U8QA 3GJFA 4JZOB 3SOBH 2QHRH 5HYSA 1PSKL 2ED9A 4NN7C 4EVNA 3ARSA 5ALCH 4ZUSB 4N0UE 4K55A 4ETYA 4BFIA 3EDFA 1DBML 4OLXH 1FDLH 1PG7X 4O2EB 3S3PA 3HE6B 1F13A 5A2KH 3PWPD 2RIKA 3DX8B 3EJYD 2DQIH 4OF6A 2LU7A 3FO0L 3WUWG 5GGQL 4XP5L 4X9HA 5SWSE 3LKSA 4JO2L 4P4KA 3K1DA 3KDMB 4XVTH 4JQVA 1BF2A 3T4YA 5T3ZD 3F12A 5E1HB 1UVQB 3U1SL 4CU6A 3NFSL 5HDQH 2B1HH 2EO9A 4JPVH 2DLEA 3VXSA 4Q9BA 3K1KC 4XNYL 5E6IA 2FEDD 1I9EA 1QBAA 1U8IB 1YEHH 3U4EB 1BEYL 3IDGB 1BFSA 5H37G 1I9JH 5CIPA 3EJYC 4NHUA 5C7XL 5HHOE 3QIUA 4G9FB 4XP6H 3QFDB 4I13B 4LDLB 5BV7H 2A9NL 1T7VA 4XP4H 1AP2A 5D7IA 1DL7H 3I6LE 3WXVL 3HE7A 4F3FA 5T5NF 2UYLB 1PQZA 1FNAA 3DARA 1OARL 4H5SB 4NNPH 4P2RB 4PREA 3TT3L 4JAMA 1YEFL 1CQKA 4Y2DC 1MCNA 5IP4A 1A8JH 2XY2A 2JTDA 5GSRB 5I2IB 4RMVA 4M6ML 1NLDL 2YUZA 2R0KH 3X12B 3OKEB 5FOBB 5LWYL 3OKDA 5I75B 4PLOB 3JWOC 1LE5A 2OTWB 4I77L 5D2NB 3O4LA 4OGXL 1OSZA 5EG6C 3ARYA 2R4RL 2OSLA 5I1HH 4Z5RB 3HB3D 3MYJA 3MO1B 4LHUB 3BE1H 1N59B 2L7JA 3RWHA 3I3DA 1TJHH 4IOFC 4ELKB 4PJIF 1U8MA 2VDRH 4L9LB 4M5ZL 2R1YB 4XNQA 1FNHA 5KVFH 4P46D 1Z9SA 4P5KA 5FOJA 5IG7A 1N5YL 3KG5A 3UBXG 3GKWL 3LRGA 5HVGB 4NUJB 4Y5XB 1S7VB 3KPTA 4K7PX 4WNQA 4XRCB 4IRSC 2GTWB 3DV6B 4QXGL 1A7NH 3B6SB 3DBXA 5ID1B 1HWHB 1O0VA 2FYYA 1S7QB 2XOTA 2ZUSA 1V3LA 3G5YA 4P46C 1CN4A 1YNLH 4UTBH 5I66B 4QTHA 2VO5A 5J1AA 5AWNL 2PCPB 1JF1B 3BIAX 4PJFE 2LQRA 2B1AL 2XQBL 1WFTA 2KKQA 5BS0A 1RK1A 4QHLA 2WIIA 4HAFA 2R0WL 5GJTH 1J0ZA 5IV2B 5IKCA 3O81A 1I1AC 2ADIA 1JNNH 1BGXH 3CNKA 4HIEB 4N90D 3VRJB 4JRYB 3GMLA 2VOTA 1WWWX 1U3YA 1OAKL 2NY2D 5IBUB 2R56L 3PHOA 4TOYL 3JXAA 4YUEH 5DR5L 4XBGB 4YGVA 3H42H 4JDZA 5E2UL 1N8ZB 2VIRB 4XGZB 5HGHA 2BSTA 1N4XL 1KGCE 2YZ8A 3CDCA 2FSEA 1KG0B 2WUCH 3CFEA 5BXFB 3NMEA 5ISZD 1U3HC 2F58H 1BVKA 1BQHG 4U1NB 3WXWL 1BZ9A 1T21B 2PNDA 3C2SA 1ZKAA 3HLAA 2EEBA 1GGTA 5DMGD 3QISA 1JJUA 2R39A 2EECA 4X7DC 3D39E 4I4WA 5JMRA 3G6DH 1A3RH 3SO5A 3QNXA 1HKFA 1PX3A 4Z7VF 2EDBA 2CPCA 5ANME 3EOBB 4MQXD 2BFVH 3JVGA 5J7CC 4W70A 1FSKC 3BZDA 3ULSA 5E5RB 2EDHA 2EYRA 4XI5C 3NCMA 3MR9A 5MENA 1PZ5A 1KJMA 3GI9H 5AZEL 3I2CL 3MLTB 1FZKB 2NY6C 3MBEA 5FHBL 5INDB 3HR5B 2XFXA 1R3JB 4OSUL 3LN4A 3SDCD 1JCKA 4P48A 3MREA 2IGFH 3CZFA 4PJCB 1N26A 2F54A 3NFPA 2HN7B 3UMTA 4MQXC 4Y19E 1QLRB 1CK0H 2GJ6A 5FO7A 4AMKL 1I9RL 3FONA 4NN6C 1IC4H 1UYWL 3QXTA 2ESVE 1DFBH 3HI5L 3MZTA 5D1QD 5AYUH 4IEFB 3TNNA 4OZIA 3QQ4A 4U4BA 4R3SA 1VFBA 4RX4A 1S3KL 5TGBA 3T8XA 5IEHA 2YUVA 1TDQA 3LS4L 4JFQA 3Q6GH 4ODHH 3WIFA 3ZKSD 1ZVHA 5I1DB 5KZCD 3SDCC 2D7NA 2DBJA 2PYEB 5IMOA 3VXQB 4UT9L 1UCTA 2FR4A 5F9DC 3SKNB 4DN3L 2UZIH 1JN6B 3WIIL 3S37H 2VXTH 3QI9A 1AD0B 5GJSH 3KJ6L 4MYWB 3DRQA 2PKDA 3MROB 5DWUH 1R0AH 1VA9A 4Y4KD 5D1QC 4M48H 2O5ZL 5DRZA 1AJ7H 1I8LA 5K9KB 2JF1A 2Z4QB 1X44A 5FUZL 4KK6D 1IKNA 4FXKB 4Z7QE 1FCGA 1TNNA 5DUBB 2ZUQC 4Z7NF 5HPOA 1AKJA 1F3JB 4LCWA 4OLYH 3TM6A 1F4YL 3MRIA 3LV3B 4P99A 1MFEH 2QEJA 3GNML 4Y2DB 5L8JB 3O41A 5J06A 1ZVYA 3RU8L 4GXVL 3QHZH 3HCVA 1MFNA 4HC1L 1TVBA 1A7PH 3H7BB 1HSAB 4JN1L 3EIFA 5FO8A 2ICWB 1NGQH 3CFDB 3WNLA 4JFFD 2R69H 1A9EA 3L6FB 2EH8L 3ALPA 3X3FL 5H94B 4NOFA 3VI3E 1ZHNA 2P1YA 4K23L 4NQDD 1PX4A 4LK4A 2J6EH 3CH1B 4JREC 4PRNA 4KPHH 5J0BA 4UIMB 1ONQA 4DQOH 3ZZ1A 2FB4L 1P7QD 5HHMB 2UWEB 2JIXA 4HUNB 1R3HB 3AY4A 3FN9A 5CCKH 2W1NA 4KKBD 2WBJB 2ICEB 1MCSA 3SDDD 5CEYA 1FCCA 4IRSB 3HTLX 4F7CB 4LSTL 4OZGA 1T7ZA 1V7MH 3HMXL 3TPUA 4ELMA 2HA1A 4TVPL 1UCBL 4CDGC 1NBZA 2UVFA 3CU7A 2B8OT 5DHVH 2AABH 4C58B 4L8DA 2ATKA 1S5HB 5F7LB 2QR0A 4NWTH 5FGCB 4P46B 3DIFB 4I3SL 4NRZB 4P5MB 1A6ZB 4UILL 1IBGL 3SJVA 5KSUA 4KKBC 4X7TA 5F44A 1INEH 3GUTA 2CJUH 3LN9A 3DX7B 4JN2B 4YPGB 1T22B 1ITCA 1TJIH 4KUCF 2X4QA 3DVIA 1I1AB 2IPKA 1SEQL 3FQTB 2D0GA 2HLAB 3TNMA 5AD0A 2BJMH 1WWCA 3ECBA 5FUCE 2G2RB 4LOUC 5I15L 1H9VA 2LU4A 1CFQA 2DS4A 5L6YL 3UDWC 3A6BH 1JK8B 4OKVB 4Z78A 3M8OH 2CSPA 2Y36H 5E8PB 4RFOL 1R5VA 3QT2A 4P59L 4U1HB 2YPLB 4UDUB 1GGIL 1XGYH 3S5LA 4UV7L 1XGQA 1U3HB 1L0QA 4R96A 1A4JB 3TJEL 3TF7C 1N0LA 3GIZL 3HMXA 4JFYB 4F7TA 1YEIH 3C8HA 3F6LA 3RWDB 4LPVA 4PJEB 2H3NA 4QLRA 3OV6A 4Y5VA 1SVCP 3GB7A 4YHNB 1MRCH 1JV5B 2BVTA 4OI7A 1QZ1A 2FECI 5IOPB 4AT6A 4ZQKB 2M2DA 4NCC2 1OM3L 1F3DJ 2XKNB 5IMMB 1HYRC 4YXKL 4WFHD 1XCTB 3F7QA 4KK5D 3D9AL 5JW3H 1CTOA 2MHAB 4HMDA 2VLKB 2P8LA 5DYOA 5CEXA 3AS0A 2ZG3A 4YR6B 4KY1H 2YSSA 2ARJB 3E8UL 1GIGH 1QKZL 3UTSE 1IFHL 2D7PA 3GSNH 5IJKC 3MRMB 3DSNA 3UBXI 2GT9B 4LLAA 4WY7H 3DVGB 4DUWA 4XHJC 2NY6B 3C8DA 4PJCF 2RJMA 4HIIB 1K4DB 5CEZL 4LP4A 4PGDB 5DS8A 4GW4A 1QSEA 4CN4A 1CE1L 3MQIA 4M7KH 4Y8AA 1FLRL 4DUXA 5A2JH 4FQLL 4N0CC 2G5RA 4IIQA 5D8JL 4LCUA 1CFNB 5JW4R 4FTVE 4RFEB 5ITBL 4OCXL 1YEGL 1M6OB 3VXNA 3WJJA 4XPFL 5SX4H 1WFNA 3ROOB 5I16B 4KQ4L 4HT1H 3BOVA 1JPTL 4F7PB 4L5FH 1MHEA 4PP2B 5DZLA 2W9DH 3QULA 4N8CH 2B2XH 3WKMH 3R1GH 2VXUL 1TCMA 3B8SA 4NCDA 5EZLB 3GSXB 3ALXA 5IUSA 1BAFH 1QSFB 4WU7B 5FGRA 3Q6FB 1B0GA 4XXDB 5E6ZA 1GZQB 2HT3C 3BZEA 1ZLSH 2CIKA 2V5YA 5SV4A 5A2IH 4S2SA 3L3HA 4A6YH 5H37H 2EO1A 3B5TA 1EHAA 2H26A 4GAYB 4IDJL 4YWGH 4PJHA 4WFEE 2HFFA 3H9HB 1D6EB 5BVPH 5DD1H 3QDME 1KNOA 5I18H 1W2KT 4Z8FL 1IQWL 1SHMA 3BKYL 4KDTC 2ZUQB 4MA3B 1IT9H 3ISWA 4Q9QH 5E99L 2OL3H 3OGCA 1T5WA 1F97A 1RJLA 5ESAA 3MLYL 4WTZG 1DCLA 1N0XH 1NGWB 1CE6B 3QUXA 5HY9B 4ZUWB 1JGDB 2JCCF 1AIFA 3OKNB 3D85B 3SE3C 4TTGA 1JHLL 3DHMA 3VDBA 2H2PD 5EU3B 5DO2D 1GZPB 4MD4A 4RAHA 2V17H 2G60L 2HVJB 4KTEH 4EUPH 1IILE 1D5XA 2UWEF 5SWSD 1CFSB 3ARDD 3DWTA 3OAYK 2R1XB 1KB5A 1DN0A 4JREB 3LIZH 1TCRA 2H1PH 4RISH 4YIQA 5LBSH 2XZZA 5F6HI 3ARRA 4G6AD 1WBYA 4MXVE 2EEDA 2IMMA 4RAUB 3QUMB 5I1AA 3N9GH 3VWJA 3EAKA 3KLDA 5DO2C 1A0QH 2HJFB 2EDOA 5FEBA 2VABB 1EHXA 4MVBD 3T0VA 5HI3D 4GBXC 3O6FC 1HSBA 5HHOD 1IAII 3ARDC 1QFUL 2F15A 2OR9L 3NACH 1RZFH 1S5IH 2Q6WA 3SE8H 1TZIB 4BFEA 4HS6A 4K3DH 1L0YA 4FHBD 4ZDHA 3I6LD 3LKPB 4HCRA 3SE4A 4AQOA 4R2GD 4G6AC 2DQEL 3WN5A 5C92A 3HRZA 3LKOB 5EBWB 1ZANL 4L4TB 1XFPA 3BDYH 5T5FH 5IB4B 1EHLL 4UNVA 5JA8B 2HFTA 1AHWA 3DMMD 4OD1L 1CLZL 4X6EA 3WCYA 4MVBC 3PL6D 4JFEA 4RAVB 5HI3C 4OCLC 1BQLL 3NVQA 1RIHL 4ACPA 1V7NH 5DSCA 4XVJH 4FRWA 4OQTH 1KTKE 2IBZY 4NNXB 1JGUH 1UXWB 3BP5A 2NY3C 2DBLL 5D93C 2BOCB 4RMWA 4PJEF 1RK0B 3QH3A 5E8EA 4FP8H 3GI8L 3KPNB 4M1CD 5EORL 4DN4L 2FJFA 4LLWB 4DOHB 4JDVB 5F1KC 2X4NB 3ZTJH 4QOKB 1UENA 3PL6C 1CD8A 1SBSH 1E4KC 3C08L 2VYRE 4LSUL 5FAAA 1HXMB 4JKPL 1UFUA 1VB9A 3FB7B 5GRZA 3RIFF 4I8DA 1XZ0A 3IFLH 5LAXB 5HGAA 4PTUA 1FNGA 1AGEA 4ZS6D 4PJ5B 3S34H 1U93B 3NIFF 1RUML 4JFOA 2PTTB 4M1GL 1WJ3A 3O6MH 5HBBA 3DVFA 1R24A 4JO4H 1CGTA 1KLFA 4FQ2H 5M95B 4HMCA 3ULVH 2BVYA 4Z7WE 3DRTA 3KPPA 2HWZH 3IGAA 5KW9H 4LASH 5JOFB 4J12A 1IVLA 3VGBA 3D0LA 3WFHB 4BUHA 5IW6A 1QLEL 5I1LA 5EC2B 4ONGL 3BT2L 2V7NA 3ILPA 1CGYA 3VFOB 2WV3A 4H1LG 1I1RA 1ZWIB 1I8KA 4OF7A 3S98A 4ZO8A 1DEDA 2MPAL 4GKNB 1CICA 2IBBA 5CLTA 5JXAH 4LLYB 2V5MA 1JGLH 5CJXA 1JPST 1S7XB 3G08A 1YEDA 5HYJD 1BD2B 1DSFL 5DFVC 2X70A 3P4LA 4I2XE 2YR3A 5LGJB 5GGRA 3SDAB 2BCKB 2VH5L 4FFVD 1U8JB 3HC4H 4YDIH 4L4VE 1XH3A 1KGCD 1RURH 3D3VB 4LCYA 1NSNH 3RPIA 3MA7B 3T4AA 4B41A 1OAXL 3V4VL 3VWKD 3T0WA 3WE6A 1E6JH 2NCMA 1NMBL 4Y8DC 2FGZA 1KTLB 2CUHA 2JELH 4KHTL 3V0WL 5C08E 4JPWL 5E9DB 4K3JL 1ZOXA 3DOSA 3UJIL 1BWMA 1HHJB 3QXDB 3D39D 35C8L 1FVDA 5CGYD 2Z0BA 1N7MH 3CFBB 3DGCR 3LEYL 4TTDD 4XVSH 3EFFB 3IKCB 4WI4A 4JO1L 1Z9MA 4ZSOA 1QNZL 1HXYB 3TIDB 4N0RA 2IFFL 3GSUB 5DJXB 2EDTA 5TJWK 5EZIL 1WITA 1WF5A 1A7RL 1X7QA 3H8NA 3M07A 3QFJE 4YDJA 4C56A 1I8MB 5L2JB 1QPXA 5D2LE 2Q76A 3BW9B 2GHWB 5JR1H 3VXTB 3PWVB 2GCYA 4FFYL 1QFWI 2NY5H 4MCZB 4WGVB 4FQJL 5CGYC 5B22A 4X4YB 2X41A 1CLYH 3MRJA 4MXWL 4MAUL 4K3EH 4Y19D 2J8UE 4XP9L 1KFAL 3PDOB 1RUPH 2ESVD 3V0VB 2VDLH 3BYTA 2ADGA 4LIQH 4S1SL 1EFQA 2R4SH 4CVWA 1FZOB 3QDHA 2EC9T 2HKFL 2I24N 4JHWL 4Q6IB 4NQUA 1JWSB 4KVNL 1F11A 5CILH 5HI4D 1S7SB 3BPLC 1LO2H 4LCIL 5F7WC 5F7UA 4IMKC 3LEXB 4Q6YA 4M8QB 4GUPA 3TWCL 4GBXB 5GSVB 3O6FB 4KI5C 3C6LB 1WAAE 3ZDZF 3KYAA 5DLMH 4O2CB 1U8LB 3CFJB 5J6GA 4JY4A 3MODL 4LFHG 1YDPA 4A2MA 4YAQA 4V1DB 4X4ME 5HHQA 2DYPB 3DSFH 3IDIB 1F4WL 1WIPA 4LNVA 2DQTH 1T2XA 2A6DB 5HI4C 3JV6A 5HHNB 5DMKA 2W0LA 1MPAH 1KPVA 1G0DA 3IU4L 3V52L 5CJQH 4KRPD 2D31A 4Y7MA 1CFTB 1GXEA 1L9NA 3VFPA 3ARZA 3SHSA 2VLRE 1IGML 3HRPA 1E4XI 3QP3A 2NY3B 5D93B 5KVEH 1IZJA 4PJ9A 4U1IA 2I9LB 1I3UA 4P9HH 3STLA 3V95A 5B3JF 2QKIA 3WNKA 2GIYA 2ADFH 2JB6A 2A9MH 3B5HA 5C70A 2J88H 4NO3B 3KPSE 3M17A 2V7HB 4KRPC 3NFNB 3VRLF 1K8DA 15C8H 3GMRB 1DVFA 3HZVB 4RWHA 3T3ME 2DI7A 1AGBA 2E9WA 3PHSA 3MRQA 4FFZL 4ZAKC 5BO1H 4XC3H 4ODVH 1HDMA 1DBAH 4Q9RH 1IKFL 3P9LA 1IEAB 4PY7B 3HFMH 4MDJA 2C26A 4JHAH 1QRNA 5HGDA 4LSQH 4XT1C 1P5VA 3RZCC 5DRNB 3S37X 3MNWA 4OD3L 2XG5A 4GMSL 5HYIA 3HI6H 1JF5A 1LMKA 3S4SG 3FB6B 2ZKHH 2PW2A 3ABZA 2P44B 5BRZA 2D03L 2APVA 3QO0A 1ZLVH 3UTQB 3UP1A 1MCOH 4HK0A 3A6CL 3VE0B 3EZJB 3V6ZA 5EOCH 4JLRB 5K93A 1CF8L 1DP0A 3H6JA 3EW3B 3ZT6A 5DJ6A 2J4WH 4PRBA 4GRLC 5JORA 1PGRB 4Z0BL 4D3CL 5C9JA 4FNLH 1UWGL 4HKZA 1Q72L 1A7OL 1P4BH 4XCFL 1CL7H 1N2RB 3RY4A 5IF0B 4LLDA 5E6YA 5CP7A 5E5MB 3DJ9A 1G7IB 3OZ9L 4LSSL 4YHYB 5C0DB 1NFDE 1B2WH 3C60A 4J3VA 4P23D 2Q7NA 4NOBA 2VTFA 3X11B 4E5XB 2WBKA 3D69B 2G75A 2EE3A 4NC0B 2NYYC 1JHTB 4B7IA 1D5ZB 1JMXA 1Y18A 2DQDH 5FUCC 5ADPH 5TPWH 3HNSH 3OKYA 4EJ1C 3DO7A 1WTLA 4HJGB 4YBQC 1WK0A 3MLRH 4J8RB 5T1KA 1YMME 3K80A 3JSSA 2ZJSH 3JTTA 1T0NA 2CLVB 1YMHA 4S0SD 4P23C 4Z7VA 1MVUB 4EOWH 3SQOH 3L3JB 4APQD 1L7IL 3RDTC 2NX5E 1EJOL 3K7UA 3ORJA 3UTSD 3B43A 5TFSL 1MRFH 4OJFH 1JFQH 4JHZA 4NKIL 4F2MA 3LQAL 1VESA 4BA8A 2CRMA 3W11C 2DD8H 1XGUB 1EMTL 4Y1AE 3NGBC 4LKCA 3MLXL 2XTJE 1LE9A 1Q9OB 1EJ6A 2IQ9H 1MWAB 3B9KD 4LKXB 2Y25A 3REVB 4HWBH 4DVRL 4HF5H 2BZDA 3RX7A 1PEWA 1O7VA 1FVCB 4ZXBA 5ANMB 4U6YA 4FTVD 5IW1B 5F3BA 1G6RL 5DEFB 3H9SA 3VXRB 5D7JA 4APQC 4HEME 2NR6D 3V6OE 4FQXA 1LP9B 2NZ9D 5JW4Q 1CDCA 1OTUD 1UXSB 4M3KB 1B0RB 3MV7B 4LLVB 1NCWL 4G8EB 4U1JB 3CPLB 4M62L 3B9KC 5ENWA 4PGZA 4X6CA 5CMAB 5D70H 4DGYL 4G80A 1MRDH 1BBJB 5F1IB 5IMKA 3WLBB 1NJ9A 3BPLB 4FZEH 1MREL 3VD4A 4GAJH 2EIZB 3KPOB 2EYSA 3FTGB 5JW4M 1SM3H 4FMFA 2NR6C 3L7FA 1R5IB 4WFED 5DUPH 2DQUH 3QDMD 4WUUA 1MHPL 1WVZA 4F58H 4U1LB 3MJ9H 1F2QA 3O6LL 4NNYB 1QPPA 3CLFH 2LTQC 1MF2L 4O9HH 2RBLA 2AQ3A 1D9KA 5HJ3B 1G6RA 1Y6MR 2IEPA 5FECA 3GM8A 4O4YL 3VCLB 4TNWK 4I0PC 2XZAH 4ZD3H 2Q20A 5HPMA 5C0JA 2RCSH 5CJ5A 4QHUB 3WFEH 2BVOB 1URLA 1FZJB 4OF3A 1UA6H 4K94L 2YMXH 1FYTE 4BELD 4GQPH 3RA7L 4BZ1H 1S9KC 3PNWB 2ENSA 5MP6H 2GSGB 3GMOA 3V4UH 1NCAL 3F7YA 4IRJC 3FT3A 3HAEH 3BD4A 1NC4A 1N3NB 4FZ8H 2IJ0C 4H88L 4KDVA 3W39A 3T65A 4X80L 1EEUA 5F9OH 1AQDA 3MV8E 1DBBH 2CIIB 2OQJB 3QAZB 2FX7L 3CDGA 4LBEB 3QA3B 1AO7B 1OHQA 3WKNA 4WO4C 4NQEE 1D7FA 4LVHB 2GKIA 4G7VH 4HUVB 1MJUH 4UU9B 4ZAKB 1RZKL 1UJ3C 2ED7A 5JQ6H 2FJGB 3FAWA 1DBJH 4R97C 3HNTL 4HH9A 4W6XB 3MLUH 4HHAB 3BPOC 3RZCB 3MGOB 2LVEA 4NFCA 5D6DA 4YBHA 4M7JH 3WJLA 1F4XH 1SQ2N 4FFWC 3R4DA 1H15B 3MRCB 4NHCH 3K8MA 3SDYH 2Z93B 2Z31A 1ED3A 3V9FA 3TCXA 3EBAA 4JM4L 4F33A 5IBLC 1B6DA 2DQCH 2H32B 2X1WL 4U6TA 1TQCB 1HEZB 1W0VB 1MI5B 5TE6L 1ES0B 2R2HB 3K2UL 4GRLB 5FKPB 1UGNA 3QIBD 4YZFE 5BV7C 4XBEL 5HYSG 2HT4D 1FZMB 3FN0L 4M43H 1OP5H 4PJFF 2BNQA 3G6JE 2CGRH 1LGVA 4ONOA 1A1MB 1EPFA 1ZLWK 5EA0L 2I25N 4WU5A 5F88B 3CSGA 2F19L 5TE4H 2UZXB 1FVEA 4F15B 1AXTL 2AK4B 3TEUA 4Y16D 2VB5A 4HJJL 4IM8A 5DDHB 5D9SA 1H3XA 3RVWD 3B3IB 3SKOA 5E00A 2AGJH 4KMLB 1AR1D 1KPRB 1CZ8L 3CFKA 3V6FA 2P8PB 4MJIA 1DQMH 1NGXB 2VZSA 3QIBC 4Z95L 1MSPA 4G6JH 4RDQG 3DV4A 3HC0B 4UTAH 2ICCA 1KIRB 2ARJQ 4GW1A 1AGDA 1LD9B 3NTCL 4UT7H 3WSQH 5F1NB 1BJMA 1IAKA 2Y7QB 4IRZL 4PJAB 2FIRT 3ARGD 3H3BC 4ZO9A 1E4WL 4P23B 1RJYA 1EO8L 3RVWC 4L3EE 3RDTB 2MJWA 3QEGL 1AR1C 4PRDB 1G9ML 1SYSA 3RHWK 3L3GB 4N0YL 3RWEB 4Q2ZA 3U79A 4WUKH 3NGBB 1BM3H 3LN5A 2X1OA 1DUYA 5TH2B 1FFPA 2OI9C 1NGZB 3ZHLA 3VXUB 5I73C 1FO0B 2EDRA 5E94B 2A0LD 3ZDXE 1LP9F 1HHIB 3WDHA 1IQDA 1RZ8A 1ODAA 5C0BE 1CYGA 4MNHA 1ZTXH 4GAFB 4QKXB 1U95A 3HZMB 4L4VD 3OBAA 1M05B 3PE9A 4X5WA 3O3BA 1GC1L 1WBZB 4CRPA 3QXUA 3MLZL 3DECA 2I60H 4KMTH 3ZE1E 1LK2B 3B8YA 5ITFA 3PWPA 4KI5F 3FRUA 4JGMA 1G7QB 5C08D 3FQXB 4XNUL 2RB8A 4K07A 4KROD 5IT2L 4LSVL 2ZWLT 5HD8D 3EDKA 4MS8D 4OZFA 1EFXB 4N1EA 4J3TA 1YPZA 1IEBB 4ZS7L 3MJGX 4JFPA 1W72H 2DKMA 1FRGL 1H3GA 2PN5A 4F57H 2XPGA 3X14B 4QRTB 2W0FA 3U0TA 4A2LA 1WEJL 4ZUUB 5GIRB 2RAMA 4NT6B 3WMSA 1QFOA 4UUJB 3CVHB 3O3DB 2C4FT 1CGXA 2VXVL 3BWAB 4XX1E 4XCEB 1G9NC 3WFDH 1UKQA 1RIVL 2LTQB 1BLNA 4P2YA 3KLAB 2AV7A 1EO5A 3QFJD 1G7LB 3AUVA 3BXNB 5DEZA 4P9MH 1RIUL 4O5LL 4J4PD 3CFDA 4I0PB 1J0KA 4K2UL 4J3OC 2JCCA 4ODBD 4YXLL 2EDJA 2DDQL 3BP4B 4G7YL 3O9WD 3KNBA 4KKLC 2CRZA 2XA3A 4DGVL 2P5WE 3CH1A 2DLGA 4LIQE 2M8XA 3GHBH 3WUZA 4YBLB 3MRDB 4IRJB 2QADD 2I5YL 1Q94A 3LDBC 1A14H 1JWMA 3ARXA 5DD6B 4OB5L 5EOTA 2VWEE 3DPBA 2AJZA 3IDMB 5F71A 3DX9A 4MNQA 4J4PC 4G3YH 5HDBF 3EGSB 1H8OA 3DLQR 2K7PA 4WO4B 4O51A 3VI3F 3EZ8A 3OXRB 1XEDA 1U92A 2GK0B 1F90H 3U9UB 3MCKB 3UYOD 3O9WC 3H3PL 1ITBB 3O3AB 1UJ3B 5ILTH 4R97B 4IMLA 1HIMH 5E4EC 4DWHA 2X42A 3BPOB 3HPLA 3RNQB 5C0AB 4OFDA 5JUEL 5MERB 5FUOH 3QWQB 1QQDB 3RKDC 1YN7A 4PG2C 4X0KB 2CK2A 5CKAA 4HIJB 3PABB 1RULL 3G6AA 1A1NB 4P2QB 3X13A 3KLHC 1I7ZB 5J3HC 4KJWC 3V7MA 3QRGH 2AXJA 2BMKB 3KXFE 2P5EB 3CXDL 4DW2L 2APWA 2Z8WC 4Q58C 2VLRD 3RVTD 2ITCA 2IF7A 1ZA3A 3INUL 1GHFL 4H20H 2YK1H 5C0IA 3D48R 2VL4A 3L3IB 1EEZA 1MIML 1HH6B 4MX7A 2D7MA 4G6FB 1UZ8A 3LB6C 4PJXA 3KPSD 5IJVB 3BP6A 3VH8A 3F58L 3N1QC 3PGDA 4TSCL 4WI8A 5I17B 2ATPA 1MLBB 3BZFB 2G5BB 1MHHB 4XPTH 4YR6A 1OAYL 4XH2A 1NCDL 4TRPH 4X9FA 3GMNB 3O0RL 5ISZA 4BZ2H 4BUGA 2XZCL 4TUKL 12E8H 2D4DA 2X9WA 4XMLH 5F1SA 4HIXH 5DF0A 1A6UH 4XNMA 1KJVA 4YHMH 4CVXA 5I8OL 4O58H 3FB8A 4R0LC 1AE6H 3QHFL 3KYMA 3S96B 3CSBA 3P2TA 5TQ2L 4OFYD 3NAAH 5F70A 3VDCA 4NN5C 5KANI 4EN3D 3L1OH 5J6HB 2OI9B 5I73B 2AERT 3MRBA 3BHBA 2VC2H 2OJEB 1K2DB 1F45A 1PKQE 2ZNWA 5JIHA 1PW3A 3A0OA 4F7PA 2NY7L 3BZ4A 2BRRL 4L8CA 2WSKA 2OMNA 4LGPB 4H25B 5IHZA 1R3KB 2F53B 3DROB 3BKJH 3LS5H 3H2WA 2QHLA 3SDCA 4QT5B 1LHZA 1CT8B 1VFUA 1MFCL 5KG9A 2J8OA 2R2EB 2WZPD 2XWBB 4X98A 1S7RA 4YK4C 4AG4H 3MRHB 5TF1H 3QRFM 3IVKB 1J11A 3FKUS 1NKOA 4L3AA 5A16B 2BVQB 5MEQB 2YEZA 1WC7B 8FABB 3MV9B 4GAYA 1K8IB 3VFMA 5D1QA 1DQDL 3CSYA 1C1EL 1FNLA 3B9EA 1ZHLA 4I2XB 2DJUA 3F62A 1YMMD 1T5XA 4ETQA 1Q9KB 1XGPB 4L4VB 2BNRE 1A3LH 3QG6B 4JO3L 3OR7A 2DM7A 4HS3B 1KCUH 1OSPL 2NX5D 4W4NA 2XQYG 1ZGLA 1G7JB 5IMLB 3S3SA 2ZCLH 2BK8A 3QZWA 3U36A 1KBGH 3O6KH 5F9WC 1T2QL 5FA3A 4Y1AD 3CVIL 3U0PB 3KYOB 4Y4KA 4XXCC 3RGVC 5DK0B 2XTJD 3Q0HA 2CQVA 2Z8RA 1QHOA 4L8SC 4XPBH 3C5SB 4BH7B 4NDMB 3WS6C 2AI0L 3FQUA 2RFXA 4IOIA 5IBTL 6CGTA 2NTFB 1T20A 1T1YB 5DHYB 1FL6B 1QYGL 1YY8B 4HK3J 4OM1H 1XR9A 4M7LH 5F97E 1C16B 5FYKH 3LDBB 1CDHA 2YPKA 5I1CH 4F80A 3I6GA 4NCC1 3L3OA 1NGYB 2CR6A 4YNYA 1QOKA 5AEAA 3UROR 4OFIA 3UTZA 1KIPB 4JFFA 4ESKA 3IETB 4KHXL 3P77B 5KTEH 3S5LG 3KPMB 1DQTA 2ORBL 2AJXL 4HS8H 1FFOB 3ARVA 4ODTH 1JNLL 32C2A 3VGFA 1C08A 4NQDA 1A1OA 4AIZB 5CD3B 2ZPKL 3TO4B 3DI3B 4F9PA 3RUGB 5E4EB 3JV4A 3BGMA 3ZYZA 3SKMB 2DIAA 4GG6B 1GH7A 1P7QA 3N1GC 5GS0H 1OAQL 4OBSA 1B0WA 3PWNA 5F9JB 1UQSB 4PR5A 3ME0A 3QCUL 3SDDA 5JW5A 3UCRA 5I1KL 3WV0A 4AEIH 1J05B 5JPNA 4UAOC 5E1AA 5HGBB 1INDL 5BOPA 3TZVB 2QJDA 1DLFL 1C5BH 3X3GL 1BFVH 3LSOA 4NIKB 5CSGA 4X9GA 2VAAB 3GJFH 4JM2C 3UDWA 1ZSDB 3UTTB 2G9HB 1UH3A 4P3DB 3PQYE 1FG9C 1FYTD 5GGSA 5ACZA 4R4FH 1KF9B 1JUFB 1CD0A 5I8KL 4JZNA 2EDFA 4PRHE 5L2KE 3G5XB 4MXQD 2VDNH 2BNUB 1X6NA 3FQRA 4FQIL 3V4PL 1JIBA 1PG7L 5J12C 4BKLA 4ZYKA 5TDPA 3GSVA 3HNVL 4ONHA 3QIWC 4TUJA 4MJ5A 3CSPA 3MV8D 1EEQA 4NRXB 1RZ7L 1S7UB 3IRPX 1JPSH 3MRNB 3NPZB 4NQED 2IH1B 3MV11 1ZMYA 1XR8A 1NBYA 5ICZB 2LVCA 2W60B 2UY7A 1J10A 3W9DB 2OK0H 2MQCA 5IROA 5J13C 3V6BR 5F6IC 3W2DL 4QRPE 1UZ6F 3P11H 4MJ6A 2RGSA 5CD5D 2V9QA 1VFMA 1TZHB 1AGCB 1MCRA 4PLKC 1AQKH 3B9VA 1BBDH 2VDKL 5T3XL 5FFLA 3O2WH 4Y4FC 2FX9H 2HG5A 3QDJE 3UJJL 4JRXE 3GBNL 2AEQH 4N8PA 1M71A 2X4SB 3QQ9D 1U8KA 1S9XB 4OCNC 4NN5B 3I3BA 3K0WA 1U8HA 1F8TH 2FECL 3BIKA 2MKWA 2V2XA 4D0CA 5I8EA 1QG3A 3IDNA 3NIGE 5CD5C 5IWLC 5LGJA 3DGGB 3S36L 3MTRA 1U8PB 3U4BH 2JKXA 5GGQH 3RVVD 1IL1B 4J6RH 3PJSA 4JO2H 4Z77B 1NAML 1KN4L 3I02A 4LAQH 1WGOA 4BK5A 4F8TA 3QQ9C 2YD7A 5ADOH 4YK4B 3FFDA 3WLWC 3GSOA 4D0DB 1JWUB 4EDWL 2UUDH 4C4KO 4XNYH 1YJDL 1CTNA 1P84K 2CO7B 1K6QL 4XMKH 4X6DB 1MAKA 3NABL 2X4RB 2IBZX 2FL5A 4POUB 3TYGL 1BWWA 4XPAL 5C7XH 1ZT7B 4KDTA 3RVVC 3FO9A 4HEPG 1JYNA 5EU6D 1DBKH 4K7PL 5D1ZC 5DQ9A 1NFDB 3DXAB 1RMFH 4GW5A 5DJXA 2A9NH 3PWJA 4HJ0C 2IAMC 4L3ED 3UC0L 4Q0XH 2OMBA 3TJHD 4G6KH 4DKEH 3RAJL 2WP3T 1FFQA 1KCRH 1OARH 3TT3H 4P3CH 4JFZH 3AGVA 5F9WB 1U58B 5ACMA 4TUOB 1JI1A 1D5BA 4X7FC 4M6MH 3RGVB 1NLDH 5F96H 1FGNL 4FABL 1MCPL 1QSVA 1GGBL 4Z9KB 5LWYH 1NCCL 1JMZA 4L8SB 2MQ0A 3STZB 1EV2E 3P4MA 3ULVC 3FFCE 4OUUB 3BJ91 2IANE 3AMLA 3V8CA 4C57C 1NAMA 3GSNB 3KLSA 5INCA 4OGXH 2R4RH 4LDOB 4WI3A 3Q48A 2AXGB 2NX5B 5C0BD 4NGHL 5LCVL 5JLZA 2ZOKB 3UPRB 4JZJA 1PFCA 5ICXA 5FB8A 4RQQB 5C0NC 1VEMA 4KU1A 2BOBB 4GRWB 3OF6D 4N0UA 5HXMA 2FBJL 3G5ZB 5D7LE 3UTOA 4PJDE 4HIHB 1N5YH 3GMPB 1QBLL 3IB4A 3GKWH 4NP4L 3DTXA 2XWTA 5HVWA 5DQJA 4KJPD 4M8QA 1ADQL 1CQYA 5C0EB 2EC9U 3WUWB 5SWSA 4QRRE 3ARDA 3BJLA 3C8KA 1A6TA 2R0LL 4JPIB 5EULV 4HG4J 3W9EB 1RHHA 3JWOH 1NDMA 1PDKA 2CLZA 1A2YB 1C5DA 4JKLA 4PV8B 4TSAH 1JPFA 1L4IA 1P4LA 3ARBC 4R90H 3QPQC 4LPYA 4NO2B 4XNZB 5E2VL 4Q74A 2HTKD 4R4BA 2C4XA 2R23A 1XGRA 3ARED 5D7SH 3MGTA 4PS4L 3AS1A 5HVHC 2XQBH 3GHEH 1PZUB 4UAOB 4KJPC 1KC5H 4HKBA 2GI7A 1WAAF 3BEWA 5HHOA 3LPFA 3FT4B 3HC3L 1EGJL 4K7PY 4YGAB 1VFAB 2P49B 5JHDE 3OAUL 2VQ1B 3HPJA 3RIAK 5CHNB 4JM2B 2H9GB 1KEGL 2Y5TA 2FO4A 4LSPH 4L4JA 4EI5D 4G42B 4O02L 2NW2B 5GRJL 3IFNH 2R56H 2I9LA 3NCJL 1IAIL 5GRWA 1OT1A 2P5WD 3AREC 5E03A 2ITDA 5E2UH 4GG8B 3UYRL 2GJZB 2PXYD 1Z3GL 2VLME 3DMMA 1N4XH 2JJVA 3LPGA 5J12B 4CL7A 3FMGL 1WCQA 3PL6A 1ADQA 1ULVA 2K1MA 2YXFA 2ZCKH 1E4KA 3KJ4C 3JTSA 3NA9L 2NY0D 1KJ2B 1F3RB 3QIWB 3DUHA 5KJRL 1JZ5A 3WXWH 1A6AA 1YYMH 5IIEA 2VISA 4NQVB 1SY6A 5C09E 5AG9A 3ZLQC 5J1TC 2N1KA 1SEBA 5EN2B 5J56B 4GFTB 2P46B 2OS7A 4WV1B 5E7BA 4WCYH 5J13B 5F6IB 3QEQE 5SWQA 1SJHA 3IKKA 5I1GL 1P7KA 1MJ8H 4KK9D 1A6VH 1SJXA 2DWDB 4C59B 4BQ8A 2VN7A 2VWEC 3FOLB 3SCMC 2NY0C 3UBXB 4PUBH 1EGJA 3SE9L 3T3MF 4JE4B 4Y4FB 2GITA 1G7PA 1QR1B 4JLRA 3HN3A 3I2CH 5FHBH 3U7AA 1KULA 4PJIE 5D6CB 5J11C 1MUJA 1CL7I 1R3LB 4IHOB 4X8JB 1ZVSA 1FPTL 1YNKH 5DJDB 4HPYL 3KXFD 4WW1B 4KK9C 3KPQB 4RGNE 5JOPE 4PG9B 4AMKH 1I9RH 1B88A 1UYWH 1YQVL 2W65A 1F4AA 4PJFA 4K8RC 4YEEA 1H5BB 4OCMC 4XCCL 3CC5B 5EZJB 3GBML 1GOHA 1S3KH 4HWZB 4LMQE 3S8WA 1K4CA 3LS4H 4JFDB 1E28B 3QUKB 5E8OA 2V6HA 4X6DF 4J2XA 3VFSB 1TETH 2VLLA 1LO4H 4CMHB 1KB9J 5HYJA 4OV5A 4UT9H 3P73A 2HKHL 1GOGA 4RZCB 5C3TA 4DZBB 1NFDF 4LVEA 4E41B 1RUKL 4YHZL 3QUZD 3PG2A 3OSKA 4M02A 4PV9B 1TVHA 4P9HC 3TO2A 3RWIA 5K9JL 3VWKA 5D1ZB 1LO5A 3G9AB 1BQHB 2A73A 3LHPL 2IAMB 2YD1A 4WWKB 3TA3D 25C8L 1I1FB 1I3GL 1LWRA 3MFFA 1XIWD 4NM4H 4J3UA 1F4YH 5EU7E 2VITB 1DDHA 1YZZA 1IM9D 5ESQA 5ERWA 1JTPA 1Q9LA 3GNMH 4TPRL 1C5CH 3QJFA 2YPVL 4WEBH 3D39A 4UINH 4MAYD 5I8CB 3QDGE 1I1YA 1K5NB 3X17A 4HC1H 3EYVA 4EIGB 3DETD 5ANMA 2LU3A 5JXED 1YYLL 3QUZC 3EYQC 5E08H 2E7BA 5SWZE 3CUPA 2UY6A 1IM3B 4PTTB 5FKAB 3QR2A 1AFVL 3TA3C 4CN6A 5KVMC 4DVBB 5IEKA 5FGBA 3V5KB 3SGKA 3IJHB 4HX1B 5AYQA 1FG2B 2VLJE 5SX5H 4K23H 4LLVA 1F42A 1G1YA 2J3SA 5ICYB 2ZSWA 2DLFL 5KVDL 2ZUXA 2APBA 3N85L 3CFCH 4GLRI 2BSSA 2MWCA 4X8XA 7FABL 4MAYC 3DX6B 2KUTA 2DI8A 4KGLA 3DETC 5GRVK 5KS9A 1L6XA 4Y19A