1MJ8L

High resolution crystal structure of the fab fragment of the esterolytic antibody ms6-126
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
219
structure length
214
Chain Sequence
EIVMTQAAPSVPVTPGESVSISCRSSKSLLHSNGNTYLYWFLQRPGQSPQLLIYRMSNLASGVPDRFSGSGSGTAFTLRISRVEAEDVGVYYCLQHLEYPFTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution crystal structure of the Fab-fragments of a family of mouse catalytic antibodies with esterase activity
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords IMMUNOGLOBULIN MS6-126
total genus 46
structure length 214
sequence length 219
ec nomenclature
pdb deposition date 2002-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mj8L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mj8L01
1KYOK 5D8JL 3VGAB 2D7TH 4F7MA 4XCFH 5B8CC 1URLA 1RIUL 3C08L 3O6LH 3BJ91 2X2YA 4DUVA 3BHBB 4E0RB 1LO3L 3U82B 4NPYB 3UTOA 3BZ4B 4XXDA 3DXAA 3MMEB 4CW1B 1A6AA 3CZJA 4HS3A 4NT6B 1XZ0A 3NZHL 4K23H 3G5XA 1K6QH 3C87A 4H1LB 4NN6B 1GYAA 4ZNEA 2YD5A 1ERNA 3WIHL 3WXWH 5F3HB 4OD1H 1PDKA 1JPTH 3U9UB 3ZTNH 1AKJB 5K9KA 3GSNH 3F6IA 1XGTB 1EJOH 2VXTH 4QXWA 4XVUC 4K2UL 5B38G 5IM7A 4YHYC 5IMOB 3BKCH 3O4LA 4U0RC 4NNXA 4KTYA 1VFBA 3HG1B 3FT4A 4CU8A 3MNZB 1TJIL 4P3WA 2B0SH 2CDFA 3H9SA 2HMIC 3U79A 1KTRL 2A1WH 4U7KA 1IBGH 3SGDI 3DBXB 3PQYE 2H2PD 3UEZA 2FHCA 1SEQH 2AJYH 4XRCA 4RWYL 5IBLD 1HYSD 1F97A 3QWRA 3VH8B 2GJ6B 2WIMA 1S7UB 5I66B 3WXVL 3S3PA 4GW1A 4AQ1B 3LQAL 2NXZD 3LEVL 2OL3A 3PGFH 2QL1A 1U8KB 4XH2B 3I6LE 3QEUB 3ZDYF 2D9CA 2FR4B 3P73A 2COQA 3P4OA 1TJGL 4O58H 2DIAA 4H5SB 3HE6C 2IH3A 5C0AE 3UBXG 1KEML 1QSEE 2BVUA 4MDJB 3RDTC 1NQBA 3LEXB 4MD0A 3QXUA 3M8OH 5C0FB 1QOKA 3MV7D 3FT2B 2IANA 3A6OA 5DVMA 4ALAL 3EOTL 5SV3A 1IGFH 4CADA 2VZ1A 4CDHA 3SGDH 1MQKH 3MYJB 1FNSH 3MA9H 2OR9L 1FLRL 4FP8L 3TO4A 2NXYD 2X5PA 4U7MA 4HC1H 5TQ2L 4XAKE 5B38B 3ZT7A 4KFZC 2W9EH 1IC5L 1CGTA 2YC1A 2PUQT 3ZHDA 2AXGB 5HGHB 3QHFH 1OPGH 3QDAA 3QIWB 2OMNA 3MV8A 5C8JA 1JNNH 5IESL 5I8CA 2UYLA 3VW3H 2ZSWA 4RGNC 1UJTA 3O9WC 5IP4A 1MFAH 2AJVL 4BFBD 4LCYB 4WW1A 2P5ED 1FJ1B 4PJ8B 1RK0A 4K94C 3PWPA 4OSUL 3IS0X 5DHYA 3WEXB 2XZZA 5J1AB 1U8MB 2AXHA 4YBHA 4PY8I 3SE4A 1R6VA 3ZTJG 3GSNB 4ODHL 4GRLC 4GW4A 4PB0L 5LAXB 5HPMA 4PJHA 4WVRA 2RGSA 3TJHC 1TQBB 2C3GA 4PLNC 1U3HB 3P0YL 3EYSH 3BH8A 4H1LH 4YXHH 4HMDA 3AS1A 5F3HA 3VGFA 5M7QA 2ICWJ 2YMXH 4LCCA 4LHUG 4BA8A 4DCQA 3UDWC 1UEMA 5T5NG 2OM5A 3Q6GL 4PR5B 5IV2A 1QKZH 3HI5L 3F7YA 4JG1H 1HXYB 2EICA 3RWCB 3SHSA 4G7VL 2NW3A 3U2SB 4NHUB 3SBWC 1LVEA 2CMRL 4QWWC 4LAQH 1A7OL 1I8KA 3MRKB 4MS8C 4NQDE 1P4IL 3O6FD 4BSWA 5HHOD 4NQSA 2VLRA 5HHNA 4NZUL 4M5YH 1A7PL 4PJIE 1GAFH 2GAZB 4N0FB 4QT5A 3BX7C 4EI6B 3B9KA 4X7EC 4UBDC 4ZUSB 3BO8A 1KSRA 4MD5B 1KJ2H 3QIUC 9CGTA 2OI9B 3QIBA 4MA8H 3BWAB 3BPLB 3GHBH 5DJYB 3MA7A 3UYRL 4QXTA 1BM3L 5H35A 1L6ZA 2EYRA 3HE6B 4G9FE 5F1IA 4FHBD 3MO1B 1I1CA 2IBZX 2JJTC 3U30B 3NN8A 4PGCA 5DSCA 4Y8DC 1IC4L 2DB8A 4WI9A 2VXTL 1WICA 3RGVA 4WHTB 3TZVA 5ABDE 2PYEE 1AFVH 4PRPA 1FL3A 4D0CA 4M48L 2J4WL 5E8PA 2BVYA 4YHMH 5IGXL 3GMQA 4P5KA 3HNSH 1E4WH 1QFWL 1SYVB 2EEAA 2PXYB 3C60A 3EOBA 4JHAL 1P1ZA 3AM8A 1QVOA 1WC7A 4R7NA 4U1LB 1OVZA 3ECBA 5DD5H 3GI9H 3MODL 4YIQB 3P11H 3MGAA 5F97E 1MWAB 3DMMD 4XNZB 1IEHA 3IJYB 2VC2H 4U7SA 4LEXH 5KSAC 2NY5L 5AG9A 3DVIA 5KVGH 1WFUA 4RGNB 4KXZH 2APWA 3SJVA 1B0WA 5JQ6L 3NVQA 2CDEB 2EDJA 4UT6H 1A6VL 1H0DA 4P3CL 5HI3D 5BMFL 4P5TA 1TDQA 4Y5YB 5DJ8B 2Z8VC 4LSQH 5JIPA 1QA9B 2NX5D 1D5XA 2AP2A 2VXVL 4ZO8A 2D0GA 4KAQH 1GOHA 1RZGA 2IQAB 3KG5A 4NKIL 4PJ5B 3IDXH 3PHQB 4TYUA 5IBUB 1FQ9C 2EYSA 3KPPA 5D7IF 1LO2H 3KXFA 4YLQT 4E0RA 1R5IA 3P0YH 4OIAA 1PLGH 1HSBB 4X8JA 5I19H 2R0ZH 3BPOB 3P2TA 4Z7QF 5GGSB 1P7QB 2OK0H 1NL0L 5L8LB 3TFKD 5C92A 3LKOA 3HUJE 4Y1AA 1M6OA 3RY5A 3QHZH 2Q1EA 4E42B 3GUTA 2GSGA 1E6JL 4N8VG 3X12B 4Z95H 2C3WA 3H8NA 5DRNA 1D5MA 4UT9H 4RGND 3MXWH 3BN9C 1LK3H 3NACL 5EBLB 3QXDB 3ILPB 4MYWB 3KDMB 5T3XL 4S1QH 4KKLC 4LIQL 3QPQC 2EO9A 4Y4FB 1D9KC 3BN3B 4GMSH 1NCAH 3PP4H 1N8ZB 1UFUA 2A6DB 5C0AB 1K8DB 4DVRL 2F9BT 3PWNA 1CQYA 5JORB 1H8SA 1ACYH 5HYSA 4MVBC 4ZFFA 2XNAA 3TO2B 3RWFA 4YXKL 3KPSE 1QRNE 4FMFA 3RJQB 4H88L 4JPIB 4PRAB 5IFHL 3OKLA 4U6HA 4NNPH 1F2QA 3KPTA 5DD0H 5SWZB 2IH1B 3QXWA 5D1ZA 4S10A 3QI9D 5KBNC 4FFYH 4XGZB 2UUDH 3UDWA 1L0XA 1NGXB 4JM2B 3OQ3B 1MCPL 5FYJH 4IMKA 5EDXA 4ZAKC 1T03L 2WWKO 4LLWB 4TUOB 1NUDA 1NKOA 3GRWL 4PRID 1FO0B 2DLIA 1Q94B 2H8PA 1UWXH 4I3RL 2L0DA 5GHWL 5E7BA 2VLRE 5DEZA 2UVFA 1HILA 32C2A 3VD4A 3X3GH 4KK5D 5T1KD 2LU7A 1F3DH 2LFGA 2WUCL 4YQXH 2LU4A 4WWID 4F9LA 5CUSL 1BFOB 3VI4F 1F11A 5D2LF 1JPFA 5T3ZL 1W8OA 4HLJA 1B4RA 4U6TA 1HZHL 1FIEA 3UZEA 1V8HA 3UPRB 3DMMA 4U2ZA 4MNHA 1BJ8A 1TVBA 4Y16B 3VG0H 5KSBE 3MREA 4HX1A 3RNKA 3DWTA 5CINL 5E5UB 4MAYC 4YDKL 2AEIT 3QO0A 4NZUH 1DDHB 3F5WA 3O6LL 4JFZL 4WHCA 2C4FU 4P49A 4IRJC 2P7TB 1KLFA 1A6VH 3RUGB 4MNQB 4RGOL 4AIOA 1A3RH 1MHPL 1KB9K 3GNMH 4GQPH 5F72S 1Z3GL 3TO4C 2X4OA 1AR1D 1JZ4A 3H9SD 1RJLB 1MFDH 1ZWIA 2A6DA 4OZGF 4UOJA 4MNGA 4J4PC 3QUXD 3RZWA 2V5MA 3JZ7A 3OXSB 1EGJL 1JP5A 2AV1A 4I9WD 1TENA 4KJWC 4NQDB 4AEEA 1YY9D 5D7JC 4OV5A 1W2KT 5CJBA 5FO7A 2WBKA 4UTBL 3KLAA 3AUVA 1M05B 2J88H 3DV4A 3VFTB 2JCCA 2UZIL 4HZAA 1G7LA 1HKFA 2NYYC 2D03H 1T22A 2NY6B 4P2OB 3IRPX 1MLBA 3O6KL 2FR4A 5HHXL 1F42A 4WDIB 1HKLL 4OLWL 2XZQH 4L9DA 4KKCC 4LPUA 3CAFA 3MFFA 1ZVYA 2XRAL 5E5MA 1UB6B 4OF8A 3FRPG 2HVKA 3KPSA 2VH5H 4XVJH 1OWRM 4U1GB 1PG7W 4X6EA 3NCMA 4JKWA 2YXMA 1YNLH 3ZKND 5IB5A 3IJHA 3JWOC 4JAMB 5AZEL 4MZ2A 3TBVB 2VQ1B 3QHFL 2NW3B 4NKMA 2IAND 2DDQH 3IDMB 5AAMA 1BEYH 1IC7L 5EUOE 4RMRA 3ARPA 3CH1A 3L3HB 4UOW0 4NQVA 4PJEA 3SDDB 4RMWA 4NRYB 4OD2B 5F7DA 1GHFH 3TYGH 5D7KE 2DQFB 1KPUB 3LD8B 2AS5M 2XWTB 3MV9D 2F74A 2ZCHH 5DFVD 1T03H 1OW0C 2E27L 2XOTA 3D9AH 3QJFA 1FDLL 1CFVL 3FMGH 1A1NB 1JBJA 4QHUB 2VLJD 3OR7B 1FL6A 5TDNA 1U3YA 1N6VA 1U8PB 5T1KA 3JWNC 3HMWH 1LILA 3TVMC 2VLLA 1RUML 4GJTB 4ODXB 5GRJL 1EGJA 4ZS7L 3MXWL 4G8GD 1JGDA 2PYFA 3VFNA 4PJ7A 4AIZA 4KY1H 5HGAA 5JIKA 4WU7A 1UCBL 2RFXB 3CLFH 2W9DH 4S11A 1IM3A 5F21B 3MBXL 4G5ZL 1FNAA 5EO9A 4IOIA 1F11B 2YUVA 1KCUL 1T80A 1KPVA 4LVHB 4N0UB 3CDFA 2NY1C 4RX4D 3C60B 1YUHB 3EOBB 1QVOB 4TUKL 1S3KL 1I7TB 2NXYC 3NAAL 3IS1X 4OGXH 3CPLB 1HHKB 4MJ4A 5CJOL 5GS0D 1WZ1L 3VRLE 3WFCH 4AM0A 2Z31D 3VXMB 2HLFC 2ATKB 4FFWC 1JRHL 3RDTD 1IAKA 3WJJC 3QUYB 4Z0BH 3GMMB 2IGFH 5DSCB 3BGMB 3RGHA 2Y36L 1HK6A 5CEZH 2K3TA 1HHJA 3MR9B 4TN9A 3C2AH 4WFHE 4FRWA 1C16A 3O4OB 3QUMA 2Q6WB 1XF3B 2PN5A 3J7HA 3MA7B 3VFWB 1G7PB 4NUJB 1HE7A 3ARWA 5AZ2L 4NZRH 3PF2A 3V6OC 4J2XA 1ZA6A 4KTEL 4MJ6B 2NZIA 1T2JA 4FNLL 2YZ1A 4UNVA 3QA3A 2M1KA 2NNAA 3S96A 3DHMA 3EJYC 3O6FB 4G6KL 5T1DL 1RK1A 5SWSB 3MV7E 3GIVA 4NBYB 2Z31B 1M71A 2ENSA 2FZ3A 5L9DL 4G43A 2QKIB 5DUPL 4NHUA 2VLLB 2ZWLT 3FQUB 3U7WH 2O5ZL 1I85A 5DJAA 3RGVD 2O61A 3QDGE 3RAJH 2D2OA 4WO4C 3O4LD 3GIZH 5FUZL 2BCKB 1KCKA 4IHOB 1FAIH 2AJZB 1CFSA 2E8ZA 4X80H 5F96L 4GKOA 4JZNA 3KXFE 1WAAF 4V1DD 5HTSA 3DURB 4GT7A 1Q1JH 3HE6D 2NY3B 2DM7A 3VFSB 4MCZA 2CJUL 1KT2A 1AXSA 1N64H 4HKZB 1T1YA 1KUMA 2FIRT 2ZCKH 5CLTA 3BZEA 1UH2A 3VJ6B 1YN7B 1GZPA 5E6IB 5EZJB 4F33A 4K3EL 1QBLH 1DLHB 1Z9OA 4A6YL 4Z7NF 4PJ7E 3HMWL 4ZOBA 5DJXA 3LPFA 1R24A 3WKNA 1U8MA 3ULVD 5B38A 1DFBL 4Z7UF 2BDNH 3DSNA 5FUOL 5IVXE 1MVUA 1B9ZA 1YECL 1U3HD 2IH3B 3RGVB 4G6FB 1FNFA 2HYMA 5IJVB 3HE7C 3O0RL 1N5YH 5DMKA 2XWBA 1L4IA 4KY1L 4RAVB 5DQJB 3TF7C 1NH6A 1ORQB 2AK4B 5GS2D 5A3IC 5C8JB 1A1MA 3MV8B 1MCOH 3FT2A 2AI0H 3MRMB 3D3VB 3OHXB 4PJEE 4XAWH 4NPYA 1C16B 5EC1B 3FB8B 4ZUUB 1T2XA 3ROLA 5JQHC 5AAWA 5FYLH 2BVOB 4U6VH 1JZ3A 2IPKA 3QO1A 1QKZL 5FO8A 4GMSL 4UNUA 1HEZB 4HXAL 5FM8A 1JNLL 4TOYH 2B1HH 4LLUA 3DVGB 4LVOB 1ZEAL 3OR6B 3PQYA 4ODUB 4M9PA 1N7MH 1G6VK 1OTUC 4HXBH 5JDJA 3ZZ1A 3LHPL 4HIIA 3C8HA 5EU6D 4JREC 4PJ5D 3KGRA 3RVTD 3GSXB 4R9HA 3PWNB 4L4VE 5BS0E 3GI8L 1SQ2N 3P77A 1Z6JT 3MUHL 4FQLH 1PLGL 5I19L 3QH3A 35C8H 1Q1JL 3OG4B 3D9AL 4ZOEA 3D25A 4BZ2H 1IL1B 1YDPB 1OAUL 2E7BA 2Z93B 4XH2A 4JFEA 5TE6H 3DBXA 5DVKA 1MAKA 4LGRB 5KJRH 1A0QL 3IFOA 4O2CA 5INDB 1HHJB 5CD3B 5GSRB 2HTLD 4OCWL 4TQEH 3DYOA 1XCQA 2BHZA 4KRLB 4DAGL 3MRKA 3EBAA 3ULVF 2BVEA 3I50L 5FHAH 2YD6A 4NN6C 1JMXA 1RJYA 2X70B 1LO5B 2H26B 2I5YL 4JDVA 3MBED 3LRSA 4PS4L 3G5ZA 3I85A 5EB9A 2WK2A 1UVQB 5CMAB 1QRND 1RMFL 4HS6B 1KCRH 4C54A 1J1OL 4BFGA 1YY9C 5D7JD 2FIKB 4NO0B 1OM3L 4LAJH 3SGKC 4XCCL 1XF5B 4CRPA 43C9A 3OKKB 3JV5A 5JW3L 2I60H 2X4RA 2BCKA 2QR0A 2EIDA 2C9AA 2LABA 4BZYA 2X44D 1X5HA 1EEYA 2IWGA 1EBPA 4MJ5A 1PSKH 3ZDYE 4HJGB 4PTTB 3FOMA 4FXKA 3BYTA 3NCJL 4RSVA 1ONQA 3QCUL 4LQFH 15C8L 1Z9MA 2AGJL 4FFVC 3T4AA 1II4E 2PW2B 4Q9RH 5D7SH 1FVCB 1RAMA 3QJFB 3JWDL 1MELA 3QG7L 4PRHB 2HKFL 3OKYA 1MJ8H 3O11A 1XGUB 5L2JB 1XIWC 1J88A 1QNZL 1WIUA 4JY4A 1DTUA 4F7MB 5I6XB 2VDPL 1OGTB 1MCJA 4XCYB 1JV5A 3DVFA 3IDYC 4HXAH 5JXED 2B4CL 5F88B 3VFOB 4ELME 1PG7X 3L5WA 1NGYB 5D70L 4M7LH 4MNQD 3O41A 3E8UH 2OR7A 3T8XB 3RNQB 3WD5L 3T1WA 2WQRA 4LASH 4LBEA 3WKMH 4E41B 4JREB 3JUZA 4D8PA 3ULUL 4YFLF 4M5ZH 5GS1C 3BE1H 3DETC 3LKSB 2YPVL 2Y7QA 5EO1A 2P8PB 3GSVA 2V5YA 1BLNB 3OG6B 3H7LA 4L29B 4X7SL 4H25B 5I74C 3S5LB 3EO0A 4GUPB 3TYGL 2CLVA 5C6PB 3WNMA 1CK0H 5I1IH 4KRPC 3U9PL 3HN3A 2C1PB 2HKHL 1FFOB 4JM2D 4ZSOA 2E7MA 3TIEA 5A16B 5EIVA 5ACZA 4OZIF 3FB7B 1DEEB 1UJ3C 3KXFB 3DV4B 1HQ4A 3SOBH 5F7EH 5BVJB 3BEWA 5D7IA 4LKCA 1S9VB 2GITA 2B0SL 4OAWB 5JLZA 3O2WH 3QUKB 1OD7A 1H3XA 3QPXL 4DZBA 4KHTL 4JZOB 2AERT 1ZMYA 3CVHB 4P4KA 5BS0A 4KJPD 1H8NA 1Q94A 2ZUYA 3LAFA 2IANE 3OAYH 4QXUL 2VDPH 4KROD 3PIQA 3VWJB 4NO3A 2BOCB 3L5JA 2NR6C 1H5BA 2DQTL 3BUTA 5FO9B 5DC4B 3VD7A 5CJ8A 1NFKA 4J3XA 1BFOA 1K3ZA 4FQ1H 5C0NC 1UWEL 4NNPL 3DO7A 3SO5A 4TUKH 3D0LB 1HN1A 4OF6A 4AH2B 4MDIB 5GXBB 1A14H 4MCYA 3UPRA 3IDMA 4YEEA 5I15L 2EDEA 3ME0A 2IMNA 5I8OL 3OKLB 5HHQA 2VLJE 3QFJA 1QPXA 5F88A 4QTIL 4EDWH 5FA3A 2F15A 2DQDL 3OGCA 4AIXA 4KI5E 1K8IB 5CZXC 1RU9L 2QQQA 4XBEH 4HBCH 5CEZL 1H3VA 1MCLA 4AM0B 4GOSA 3U9PH 3MRLA 5D1QB 4NQEE 2FD6H 5KW9H 4IS6B 2WINB 4Y2DC 1TNNA 2E7HA 4F9PA 5KSUB 3EO0B 2EYTA 3HCVB 5IW1B 5F1NA 3BI9X 4DAGH 4O51A 2YWYA 4YDIL 1DBJH 4E42A 5E95B 2ICES 4UI2A 2OTUA 4R2GD 4HHAB 5CFHA 2GAZA 3FO9A 5SWZA 2DQEH 2OL3B 5D70H 3D69A 2B1AL 2ADIB 3QNYB 2B5IB 1XEDA 4LNRA 4JG0H 5KVMC 3QRGH 3BKJL 2BJMH 5E94A 3QUKA 4RAUA 1R0AL 1DL7L 5I1CH 2ZPKL 1INQA 2IMMA 4FXGA 3LPWA 3RVWD 1KELH 3L3JA 1M6OB 1FO0L 2EDHA 3VXTB 3M1BB 2WWMD 4HIEB 2QHRL 2C7UA 5HGGS 5ACZB 2B4CC 1IMHC 1FPTH 5DI8B 2E9IA 4ZNCD 2PTTA 3DJ9A 4MX7B 1OAXH 4J4PD 2PW1A 1K4CA 4Z8FH 4L8CA 4PJ8C 2GJZA 1I1FA 4X4MA 5DMJB 2HT4C 2XFXB 3FFCD 3L3HA 5I1JH 2E27H 3OKOB 1PY9A 4TSAH 2JJSA 4P5KB 4HBCL 1I9RL 1MFNA 4X7FC 4KHXH 2EH7H 2O26U 4BSVB 5FF6B 3SDAD 3G5XB 4LP4A 4ENEC 4ONGH 4UU9A 1QNZH 4XBPA 2DMKA 2VXSL 1P84K 1UM5L 4NFCA 1TJHL 2VH5L 3EZJB 2KPNA 3H3PL 4NZTL 1CGXA 2L7UA 3FQNA 5FECB 2XYCA 4XAWL 3JWDC 3F12B 4WUUA 3CDGB 3PL6A 5F7YC 5L2KA 4XP9H 3NPZB 1V7MH 4GBXC 4Q0XH 5ACMA 4JZJB 3IETB 1GGIL 4PJFF 2CQVA 1KCSH 4KMTL 1IGCH 3EFFA 5IB1A 2ESVA 1IQDA 3UTTD 1ZT1A 2XTLA 5DUML 5FGBC 2QQNL 5DHXB 3IJHB 1MCHA 2G9HB 3VFRB 2W0KA 5JW5A 3ISWA 4LDOB 4GKZB 4LLUB 1CLOL 1WCQA 4NN5B 2Q8AL 4GRWE 4Z7WF 3QNYA 2ADIA 5D93B 3MV7B 3TJEL 3WMSA 1JWSB 4KVCL 4F8QA 3VFGL 3OXRA 3QDJE 3ARYA 3LS4H 1IC4H 2QV2A 3B6SB 4HIIB 3CFDB 3BPLC 2H6PB 1C5CL 5D6CB 5CEZD 1MFBH 1KFAH 1S7UA 5I66A 4HIHB 1ZXQA 2X4QA 4XI5C 1G1YA 3VA2C 5GGTL 2XQYG 2FX7L 1OHQA 2IPUG 5FKPA 1OT1A 4YXLL 4NCC2 4P0DA 4AL8H 4J8RB 2X4UA 4X83A 4GAJH 5FA4A 3DVNA 2R9HC 1FFNA 4HKBA 1CXIA 1YEHL 4JN2B 4K3GA 4JKMA 3UTTB 1FHGA 4X7TA 5A43C 1OB1B 5AYQA 3MBXH 3QUZC 4P9HC 3JV4B 1WITA 3AY4C 3CGTA 1HHIA 5KVGL 4PTUA 4PJ8D 3ET9F 2X4NA 2PXYC 3L95A 5SX5H 4JPVH 1NLDH 2FX9H 2ICWA 2Y1VA 4NZTH 3CSBA 2C1OB 1C5BL 4ETQA 1UADC 2DAVA 3EOAB 4JLRB 2A9NH 4YXKH 4G8GA 4LCWA 4WI6A 4IDJH 1NFIB 1RUAL 1SEBB 1Q72H 1KCSL 2NX5A 1RHHA 3IDIB 3GJFH 2DM2A 5CIPH 1NGWB 5DFWH 3O4LE 4LRIA 4M7JL 2V2WB 3FQUA 3UZVB 3BD5A 4EI5A 5JHLH 1QRNA 4Y16C 3WCYA 3VXRE 5CILL 2CGRL 1SJEB 4Y5YC 5D1XD 2A6KA 2AKRA 4PG2A 3WIHH 3PE9A 3QH3B 2YBRB 4OGZA 4MA1C 5GZND 2EDBA 3CFEB 1RUPH 1TZHA 4LQFL 2AGJH 2DQUL 3OKMA 1UJ3A 1VACA 4OFYA 2W60B 5I71C 3HC4L 1T6VN 1FSKC 1YQ2A 3X13B 5AG8A 2F19L 2Z31A 4PLJD 4HFWA 1NBYA 2ARJA 3FQWA 4APQC 2N1KA 1JN6B 4UIKL 1D5ZB 1DVFA 1UZ6F 2P47B 4YJZL 1KB5B 5D7JB 2P49B 4PJXA 3IDGB 3LH2H 5T3ZH 5KG9B 3VDCA 1A6WL 5L2KD 1CXFA 3REWA 3LDBB 4OZFH 3CXDH 4PRNA 1GSMA 1RZKL 1YY8B 1CFBA 3T0EA 2VDNH 2X4UB 5E4EB 1JHTA 4G8IA 1F90H 4JG0L 4N0UE 4CVZA 2AK4A 3KYAA 3LKSA 4U1IB 4ZXBB 4XTRC 3VFMB 3JTSA 1A6ZA 2AV7A 2NY2B 3TN0A 1NC4B 3F7VB 1N0LA 4K55A 4L3EB 3ABZA 1FN4A 1E27B 4DQOL 2X7LA 4J1UA 1IAIL 1LQSR 5AWNH 3VRJA 2FSEB 3UTSB 3VU2A 1TQCC 2VKXA 5GS0L 4NYLA 4P23A 4D0DA 1K9TA 4R8WL 2VN4A 4I8DA 5GGTH 5JHDE 4PRHD 5L2KB 5ISZB 4FQXA 5IKCB 1AH1A 1U6AL 3WHXB 3NFNA 5IFAL 3QZWG 4PUBH 3QDMA 4XNYH 3BQUA 4WWKC 4O2FB 3SDYH 3EIFA 4YBQD 3ES6B 4QHLB 4TTGA 2YPKA 2OR9H 3DX6A 1CR9H 2NY2D 4X9BA 5KS9E 5D1XC 3VXUB 1LO4H 3BPNC 4L8SB 4CBPA 5SWSE 3GSNA 4X7TB 4HV8B 1QBML 4HUWB 3RU8H 3U0PA 3D0LA 3O6FA 1CDJA 3RVVD 3D85B 3EUUA 5I75B 3CX5J 5KVDL 7CGTA 3WIFB 3RFZC 1XF2A 2PO6C 5EU5B 3D39E 2QQNH 4LLWA 2Y07H 4ISVA 5FAAA 5F89B 4GW5A 4F58H 2AJVH 1IL1A 1NC2D 1FFOA 4OCNC 3NCEB 2WWKT 2F8VA 4NRXA 3EYVA 3KYNA 3Q5YA 3ARBD 4ZUWA 1B88A 1Z9SA 3PABA 5JW3H 3CSYB 3ZL4L 2EDQA 4HKJA 4NCC1 3UJJH 4ZFOL 2LV4A 3OBAA 4HKXB 2E9BA 1OTSC 2ITDA 2ATPB 2ZG2A 3C6LC 3ELAT 3P3YA 4ONHB 2E7LA 1JWMB 4LF3B 4R7DA 2QKIA 3ILQC 5F9OH 3SKMB 5A16A 4M43H 1YPZA 4N9GB 3SE8L 5E0QA 5SWZE 5KANG 3L3KB 3T2QA 3OL2A 4AEHH 2OQJA 4LCWE 4PJBF 4BKLA 4QRSA 4N0UA 3ARXA 3B5TA 1NC2B 4LCIL 4X6BA 2QSCH 5HJ3A 5L88H 4XPAH 5BRZE 1IGYA 1IFHH 2ZZUT 5MEOB 4LAQL 4JO2L 1BEYL 3BOVA 1KIPA 1YQVH 1MLCB 2FATH 5GRVK 5LGKA 3FQRA 3VGBA 2F54B 2ZKHL 4XNXL 5DFVC 4BM7A 2ERJC 2VDOH 3TYFA 3QRGL 2NY2C 4M62H 2BJML 3F12A 2BNQA 5DT1H 3P30L 4JQIH 1KOAA 4RMSA 4G8IB 1C8PA 3PQYB 1EHLL 3QDJA 3QAZC 1D5IL 5F44A 5JHDA 3CX5K 2GJZB 1ZGLB 1EO7A 2AQ2A 4LVEA 3DX9B 3RY4A 5KG9A 3QCTH 1HHHB 2VKWA 3CPLA 5DLML 1ZLSH 1KJMB 4PRHA 3NCJH 4JCLA 5IEKA 1MRDH 3MRGB 1YYML 5EU7E 2VZTA 3S5LG 1XR9B 4KZEH 4HWZA 1ONQB 1CIUA 2ZUXA 3C09C 1YEDB 5IVXF 1XH3B 4JN1H 3RJDA 2XIDA 4WTXA 3U46A 1FC1A 3T0BA 4N0YL 3ZYJA 1PW3A 4ZUTA 5HHOE 3D3VE 5CKGA 3PG2A 3P9LA 1FVEB 4OLUH 1AC0A 1ZT4B 5E2TH 3BPNB 5FGSA 1I7ZA 1CDYA 1I7UA 5GGUB 3CUPB 2APBA 5E6ZA 4PJ9C 4LKXA 2UZXB 1F3JA 5I75C 1OAYH 1EO5A 3NAAH 3E1F1 4NWTH 2A74B 1IC5H 1OAZL 4AEIH 1P4BL 3GK8H 1I3RA 5EU3B 1VEOA 1BAFL 4WO4A 2HT2D 3Q1SH 2FIKA 1QSVA 1I85C 1RULL 4NNYA 3MJ9H 5EA0L 5BMFH 1N3NB 1HIML 4I2XB 4B5EA 3E0GA 5DK2B 4XMLH 4FXGB 3L3JB 2R69L 3QJHA 4NKDA 4X4XA 1JF6A 4JRYE 3C2AL 4JHWH 1A1OA 4OD3H 2PYED 4NKIH 3TGXA 4QYOA 3RIAF 4P4RB 3T0WA 2XKNB 2DYPD 3QB7C 1TMCB 4Z7WA 3G6JE 4FTVD 3I6KB 3RX7A 2ADGA 3V6OA 3QUYC 3MXVL 1KFAL 4U6XB 3FJTA 4OLXL 4ZFFB 5FGBA 1MRDL 5DJZA 2NY7H 3MOBL 1JI2A 3MLRL 2VISA 5EZLA 4XPHH 4G6KH 1DSFH 4LPWA 1NCWL 3ULVE 3A6BL 1EFXA 1NCBH 1BQUA 4K9EL 4ZOCA 5H8DA 4LCIH 2FEDC 3PABB 1TXKA 1TTUA 1I3VA 1CG9B 2BNQE 4KROC 4NZJA 5J89A 1QZ1A 2YRZA 5IVXA 1A4KB 3WIIL 1IEAB 4JGUA 1I1YA 1DBKL 1KGCE 4ACPA 5GZOD 1VB9A 4PJHE 5HHVH 2BOCA 2DYPB 3ARED 4PJHB 5DEFA 5MI0C 1AI1L 4FTVB 2VLJB 3V8OA 2Y6SC 2Z35A 3P9WB 1HILB 3SDCB 3BKJH 1FRGL 4KV5E 1Q72L 5ETUB 5T33L 1SJEA 1YNKH 3U6RA 3UBXA 4F57L 5E08H 5F7UA 1J0JA 4YHOH 3QWQB 2A74A 3ZL4H 2DN7A 4L4VD 3MC0A 2XWBB 4RAVA 1BM3H 2W65B 1ZLSL 4BSJA 4X9GA 1S8DA 5BVJA 1GOFA 5C9KA 3HG1A 3T08A 1BBJA 2ENYA 5GGSY 1AP2B 5F71A 2CIIB 5TF1H 3HZVB 3MLSH 3LV3B 3LN4B 4WFFE 5J06A 1RUPL 3EJZD 4RWHA 5K93A 1LP9B 3FFCB 4Q2ZB 3T8XA 3GMLA 3LQZB 4S1QL 5KN5A 1TPXB 2O61B 1IJ9A 4R7NB 3AXLB 2MMXA 3O3UN 3NIFF 4UUJA 3O3BA 4HSQA 4P2QE 1MHHA 1NEUA 4QF1B 5DK0B 3OZ9H 1V7NH 4O2CB 3MRPA 1NKRA 1J1PL 3SJVB 2CIKA 3V7MA 4X0KA 4HIEA 5DJYA 4WI2A 1WFTA 2I07A 1QLRB 5J13C 1NLBH 3T77A 2GSIB 3B3IB 4ZPVB 2D7OA 3LN5B 3D25B 3V0VB 1HSAB 5EIQA 4XCCH 2HJFA 1BIIB 3FB6B 3LEVH 2L7JA 2Z93A 3MLYH 2E6QA 4N0FA 3MLXL 4MZ3A 1DQMH 4RFEB 3SCMA 5EU6A 4I77L 1GHFL 2PYEA 1R3JB 3V6OE 1PKQA 2EECA 5E2VH 4EDXA 4D0CB 5CJQH 4JDZA 4KAQL 4L3CA 3W39B 2R56L 1TTFA 3EFDL 1A6ZB 3HMXH 1DVFB 1MFEL 1N6QL 2PW2A 4LHUD 4DN4L 1AFVL 1KEMH 1HCVA 1A1OB 1YPZE 2PR4L 4POZC 1CGUA 4CMHB 3GB7A 3TA3B 3TNNA 5DYOA 4X5XA 1I9RH 2IPKB 3SJVD 4E41E 1BQHA 1R5VB 4LFHD 2EH8H 3BD3A 3CMOH 4PP1D 4FZ8L 2DM4A 4GAGL 1HEZA 4WEUD 3F58L 2XA8L 1OAQH 3B9AA 5EUOB 3GMMA 4H0IA 2MCPL 1HSBA 1XGPB 4KDWA 4RRPG 4FFYL 2WLZA 3TVMD 1OF2A 4N1HB 2WSKA 3U4BH 4P4KC 2NW2A 1DQTA 1QO3A 5C07E 2Z8RA 2DQCH 5CSBA 1X4XA 4K71B 1KCUH 2NY3D 3VFNB 4AIZB 3BN9D 3MLTA 1OAYL 2LVEA 2D3VA 4J3VA 3CFBB 1C5DB 1LP9A 3FFCA 4N1EA 5DUMH 3B5HA 2H2SD 2J6EL 3FHQA 1L7TH 3ZO0A 3C6SB 2MHAB 1DE4A 3MJ8B 4K94H 3BRGC 1AO7A 1EFQA 2WBJB 1P7KB 3W5MA 1AP2A 2B39A 3D87B 1LK2B 1UB5B 2FO4A 5EFIB 5BZWB 2A9NL 1KULA 3OJDA 3ULVL 3DMMC 1X4ZA 1LWRA 2DI9A 3U4EA 1YA5A 2FHFA 3BQUB 3PWUA 1OP5H 5IG7A 4JO1L 4LCYA 4WW1B 4XNUH 4S1RL 3M1BA 2P8LB 2R23B 2J5LB 4IHOA 1FFNB 1CFVH 3FMGL 2ESVD 2VB5A 3MLWH 3SEPA 2FWOB 2QHLA 3W9DB 4TUJA 1ZGLA 4NM4H 2D0FA 4P2QA 5HGHA 2BK8A 4WGVB 4XB8A 4S1DD 3EAKA 4UINH 4I3SL 4YDLC 4CUCA 4IIQB 1HHIB 1K8DA 3GSUA 3SE8H 3QDMB 5A2FA 3RNQA 3UTZA 3V52H 3NCCB 4D9QD 2HP4A 1G9NL 4M8QB 3AY4A 5C2BL 3BP7A 3CLFL 5DJCB 2WBJD 1EXUA 1XIWB 5ESAA 3GM0A 2XTJD 5JUEL 3WD5H 2DDQL 3SKUD 3MJ7B 3DUUA 4H88H 3HB3C 1LHZA 1S7XA 3HZYA 4ZPTA 1VADB 1RJZA 3HG1E 4P2RD 4TTDD 4LPYA 5FB8A 3BMWA 1CDBA 2C4FT 2YEZB 4MNGE 2CIKB 1NAKH 1NGQL 1KG0A 2CRYA 3S6CA 3SKNA 4BZ1H 3OHXA 5EC1A 3ROLB 1A14L 1FZJB 2J6EH 4V1DA 4ZFGH 4F33B 5TH2B 1KCLA 5E2VL 4G8EA 4PJBB 1Q0YL 4Y4KD 2MQCA 4DEPC 1JGLL 4HWEL 2G9HA 5F1OB 1U8JB 3G6JA 5JW5B 5TDOA 1MVUB 3DVGA 4R97C 1H3TA 3TNMB 2LAAA 3QUMH 1Q9LA 2YD1A 1PKQB 2X4OB 4R4ND 4O02H 3MRJB 1N4XL 1IRAY 4M4PA 3D3VA 2FRGP 3BZEB 3SGKA 5EC2B 5B8CB 2AJZA 4HMCA 4A6YB 1REIA 2AJSL 3U2SA 4PRNB 4U1JA 5C9JB 1UJ3B 4OM0L 5D96B 3I02B 4N0YH 1R5WA 3DURA 1F45A 4HH9B 3FO2A 1GIGH 1WFOA 3QEQE 1NAMB 4P57A 3GI9L 3MODH 1HHGB 4L1DA 3NGBB 4O2EB 5FHBH 1ZA3B 3B2UC 5BOZG 4K8RD 3Q0HA 1ZHLA 2B1HL 3PGDA 1RZJH 1A6PA 1TNMA 3VJ6A 4QHLA 1WZ1H 2RR3A 3JV4A 5M95B 1AO7D 1BOGB 2EEDA 3PQYD 1XF4A 4X5WA 2YWZA 3HPJB 2WBJC 2ZSWB 3INUH 3F7QA 2R23A 2C1PA 4JRYA 3K74B 3D85D 1S9YB 3TYFB 1J05B 2ZPKH 1NCTA 1H9VA 5DJ0B 1DUYB 3STBA 3MROA 4GRWF 4LCUA 4Z7WE 3RZCB 3GJEA 4G5ZH 4JDTH 4NWUL 1INEH 1P7KA 4OLEA 3KPRA 4XNQB 3G04A 1MCRA 2IAMD 4PGBB 4NC0B 3QXTA 3CH1B 3RY6C 5IB4B 5TE6L 3RIAK 2FX8L 3QSKB 5JO5B 4PREA 3BP7B 2AK1H 1FZJA 2VXUH 2VIRB 4YDLB 1E6JH 4EN3B 2BDNL 5CHNB 1FG2B 5C0IA 1ZHKB 5KVEH 2V5SA 1U8JA 1Q0XH 1GGUA 3VH8A 3K1DA 1RZIA 1IBGL 2EDDA 3IDNB 3CVIL 3F7YB 1T5WA 1KB5L 3O3EB 3PDOB 1JPST 4LLQB 1IQDB 5JA9A 3QIUA 1NGPL 3IFPA 1PG7L 2P8LA 4PY7B 3L3KA 2CD0A 1HCFX 4TOYL 4LLDB 1MHHB 4LPCA 2IADA 3WFBH 4FQHB 5EWIL 4Y2DA 3T0AA 3TV3H 3T0EE 4WY7H 1J9CT 1TZHB 3ZDZE 4OT1L 5DS8A 2JK5A 3MLVL 1R5IB 2HRLA 3NCYS 1JZ5A 4O2EA 4LK4A 1MRCL 2VTFA 6CGTA 1JTPA 2ADFL 4RBPH 4XC1H 2E6PA 3K4ZA 1T83A 3KYNB 4WUKH 5DRNB 5JXEC 2XQYK 4GBXD 5LCVL 1ORSB 2JF1A 4LCCC 4DGVH 2A83B 4QY8B 3HPLA 5HYIA 3HS0B 4QHUA 2NLJA 2CO7B 2A6IB 1FVDB 1S9WA 3DROB 3GMNA 4GG6E 2VZVA 5D96C 5JIIA 3KAAA 1BF8A 3O3AB 4Q6IB 1J11A 3OKDA 4GRLA 1U3ZA 1G7QB 4FQJL 3VE0B 5IUSA 1GIGL 2R1YA 1VGKA 4G43B 3SE4C 4LSVH 2CXGA 1FIGL 3STLB 1OQOA 4CL7A 5EU6E 1KIQA 2XG4A 3UTTA 5E8NA 5I71B 5K9KB 3U7WL 2X89D 3O2VL 1CTNA 1MF2H 5DDHB 1W72B 2VL5B 1FZOA 2FH6A 4EIGB 5ISZA 4HPOL 4GBXB 1FC2D 1BHGA 1OQXA 1WWWX 4X6DF 1P5VA 2IPTL 3MLYL 3IGAB 1F8TH 5E2WL 2HN7B 3LN5A 4M6AA 3BUYB 4M6OH 5D9SA 4U6VL 2HWZH 5TF1L 4EUPG 1MHEA 2PCPA 2HG5A 4XVTL 4AG4H 3V2AR 3QA3B 2YXFA 3GMOB 4IJ3C 1U93B 3M17A 3T09A 1TFHA 2PYEB 3FZUD 3WN5B 3N9GL 1P4LB 3U36A 5J56B 2VERN 1UZ8A 2XNAB 5HHQB 1G7PA 4DGVL 2EKSA 3QG7H 4JZJA 3MZGB 2OI9C 1YEFL 4XPTL 4YGVB 4ODVL 4LEOA 2ITCA 1G0YR 1FLTX 3SDXE 1V5JA 2NXZB 4XVSH 1NCCL 4GFTB 1JYWA 5KS9F 5I30L 5GRXG 2YSSA 5C6TL 4AMKL 4OCYH 1N0XL 5DHVH 5FCUL 1Y6NR 1JN6A 3ALPA 1OSPH 4XP1L 3AGVA 3MJ8A 1CYGA 1R3IL 4WWKB 1KXVC 3QEHA 4PRDB 1AXTL 4WFED 2I07B 2HT3D 2DICA 1X6LA 1DBBH 5MEQB 4PJXE 5T3ZD 12E8H 1GZPB 5I16B 5J9PB 4BUGA 3LRGA 1U3HA 4M5ZL 3DPBA 3EDFA 3SN6N 2BMKA 5HD8D 5D7IE 3AREB 1ZV5A 2FYYA 2VSCA 4L8SC 5D1XA 3RUGA 4RNRB 1ZVHA 2MTPA 3TBTA 2OTWA 3QWOB 4JFEE 1H3UA 1S7TB 3BSZH 3LIZL 3SJVE 5IROA 3VXMD 1I7RA 4HJJH 2XWTA 2R9HD 3K4AA 1XR8A 4OF3A 1GC1C 5FOJA 4OLXH 3MNZA 4QRQA 3FAWA 4UQ3B 2AEWA 5KW9L 3MRRA 5BV7L 4D94A 1C7TA 1ETZA 3GB7B 1J87A 4OFKA 4OFYD 4DN3H 5IFAH 4FQXC 2HLFD 4NYLB 4XHQA 2VXQH 1MFCH 4M3JA 3K46A 5E8OB 4QCIB 3MRJA 4Z7UA 4HUXB 5LGJB 4NP4H 3EDKA 5E24E 1C12A 3UAJD 3VXOB 4QTHA 5HDLA 4ZFOB 4RGNE 1ZGLM 5HHOA 1FIGH 1NC4A 2VC2L 2FLRT 3QDJB 1KTLB 1MPAH 5GSRA 3I6GA 3UPAA 3GSXA 3RAJL 1A9BA 4KDTA 4DW2L 3HZMA 4P2QD 3NIDF 2CUIA 4UT6L 1VESA 3MRGA 4GG8B 2I26N 4U1KA 3GI8H 3QIBD 3F8UB 1UYWL 2ITCB 3RHWF 4XT1C 4KJQD 1TZGH 2HJLB 4OIIH 5GGSA 3T0EC 2DLHA 1QR1A 3W2DH 3RPKA 3TBSB 3JVGA 2W59A 3DUUB 2G75B 4OQTH 3HTLX 4YHOL 3G6DL 3S35X 1UM6H 4F15B 1Y6KR 4NN7B 2BSRB 4J4PA 2ARJB 2Y36H 1F3RB 2ZOKB 5GRWA 2ICCA 4HWEH 1WBXA 3V5KA 4A2MA 3CK0H 2P45B 4H20L 2XXMB 4MB5A 4NC2B 3BSZL 3LIZH 3PJSB 1U8OA 2GUOB 2Z31C 5IK3A 3QDMD 1SM3H 5D2LE 1DUZB 1ZVSB 3O11B 3BKML 3OPZL 1OARL 5KANI 3RUGF 3P4OB 3LN4A 1G9NH 4P2QB 3UC0L 3X3GL 4N68A 1RFDH 2ITDB 4ZOAA 4XCEA 2ZUQC 4FS0A 5EU5A 4DUWA 1XIWD 1AGFA 4M61A 4ODVH 4WFGE 1G7MA 2XTJB 1KPVB 3GRWA 5FYLL 4XZUB 1CK0L 8FABB 4G6FD 1ZLVH 1CICC 3V6ZA 1INDH 4M8QA 3BP4B 1FYTE 4OCYL 5KAQG 4P2RB 3QT2A 4YHKH 4DTGL 1ZGLP 1EVTC 4BQCA 4BFEA 4XX1G 1JYVA 4JR9H 3HPJA 2HH0H 2Q20A 5D6DA 3SDCA 4QF1A 1XCTA 1N2RB 4XHJC 4OUOA 2C5DC 5D1XB 3TBTB 2R0KL 3MUZ1 4PJAA 3KPRE 5L0QC 3B2VL 4Z78A 5I2IA 5EORL 4UT7L 2ARWA 5DJAB 3S7GA 1HHGA 3FOMB 1A4KA 1HI6A 4FXKB 5MEPA 4BQ6A 2WUBL 3MZTA 4LSSL 3V79C 4ZAKA 4XBEL 1KJVB 4I0PD 1CF8L 1V3JA 1N64L 3FQRB 4NQED 4PB9H 4MAUL 5F8RC 3QUZA 3ALXA 3ARGC 3EGSB 2QQLH 4G6MH 1CD9B 1JPFB 1I3GL 1ZA6B 4YIQA 1UKTA 4UAOB 1FG9C 1XGPA 4X6BB 5HJ3B 3MJGX 2E9JA 4ZODA 3MUGB 1DBML 2XZCL 4X98B 3RWHB 5DHVB 3AAZB 4LSTL 4YHPB 4NQSB 1I8LA 4TNVF 3NZHH 1VKXA 1YEFH 1NUGA 4XPTH 1JUFB 1ZSDB 3NIGE 2HA1A 3ZKNC 1Y0LB 2BERA 4CVXB 3VDAA 5ITFB 4EQ2A 3UTSE 3B9KB 5FYJU 1RIHL 2V2XA 1QR1B 4Q74A 3W81A 3MROB 2BC4B 5EUOF 2J12B 5BO1L 2BVOA 4PBWD 2UUDK 5ISZE 4ORZC 2DQIH 1QSFA 3P73B 1HH9A 3QO1B 3OKNB 1I7TA 3X3FL 3WFBL 2ICEB 4FQ1L 2DTMH 3V5HB 1MFDL 4CVWA 1JZ6A 2EDWA 5F3BB 4JO3H 2B8OT 5MEND 5E4IA 1CFTB 1RULH 3B3IA 4KV5F 4ZPVA 2N7AA 4OCRH 4LF3A 3LEYL 5ILTH 1S7WA 4U1MA 3NZ8B 5I15H 5DDHA 5DMGC 1QSED 4DOHE 3IXAA 1J10A 4UTBH 4YBLB 4C55A 4ZFGL 2R1WA 4UV4H 5FGCE 4U3XA 3VXOA 2YHGA 4GO6B 4F7TB 4U1GC 4PLJC 5CEYB 4UB0H 4Y4KB 4DFIA 4Y19D 4DZBB 1MNUH 1SMOA 4P2YA 3L1OL 4GG6A 4XHJD 1OTTD 1T1WB 3TWCH 5IHLB 1A5FH 4LL9A 3MRQA 1RUQH 2HRPH 4TUJB 2WP3T 4KHTH 1H5BB 5FO9A 2UVEA 4NO0A 5DJXB 5EU3A 4MD4A 4JZNB 2FL5A 3DYMA 3HPLB 4LOUC 3UTTE 2R2BB 3MRCA 2V2WA 1NBYB 3FQWB 4YAQB 5SV4A 1T66D 3UXFA 1FNEA 1U8QA 5DQJA 1KN4H 5C0JB 5C0CE 2HH0L 4I0KA 1G7MB 4N0CD 4U1NB 3QFJE 2FZ3B 3FCTA 4MQXD 1UH4A 4UNTA 1SYVA 3G5ZB 5HPMB 1Q9OA 5B39B 3SQOL 1RIHH 4WO4D 3UX9B 1JF1B 4P48A 2ZJSL 2AAVA 1J7VR 3QUXC 3CXHJ 1LE5B 2X9WA 4K7FA 1WT5C 3KJ4C 4PJDB 3VWKC 5EO0B 4X7SH 2DLGA 4JM2F 2Z8WC 5E03A 4YHZH 1JHLH 4XC1L 1I1RA 5CEZE 4GRMA 1S8DB 3RKPA 1FRGH 3U1SL 3X14A 1DQJA 1W0WB 3RL2B 4S1SL 4MAUH 4HWBH 5I1HH 3D18B 4F57H 5EUOA 3KPLA 3BPCB 2BRRL 4QO1A 3RVXD 4HFUL 3QIBC 1S5HA 4LU5L 5D71H 1EZVX 2AJ3A 4OFDA 3IVKB 3KPOA 1EJOL 1UM4L 1SBSL 4YNYA 2QQKH 3O8XD 1OY3B 1JNNL 2NY1B 3WFEL 4F9PC 3TNMA 3EW3B 4XXCA 3Q6GH 4PYHA 4PRPD 1JL8A 4WFHD 5ITFA 1RZ8B 3BKYL 4WUUE 4K9EH 5AEAA 2VLKB 2K7QA 1CE6A 2IF7A 3TEUA 2F54D 3MNWB 1KV3A 1LEIB 4AY0A 4MVBD 1Q9KA 1FL5B 4WI5A 3S36X 5KVEL 2AQ3A 3FB8A 2QBWA 4ZUUA 2YEZA 4AYFA 5JPNA 1TETH 3H9SB 4KDVA 1M7IB 3QCVL 4KKNA 3BZFB 4P9HL 5EPMB 2CRMA 4HUXA 5CD5D 1CLYH 3ILPA 4NO2B 1U36A 3WUWB 1PKOA 3K2MC 2PF6A 2IFFL 4KROB 1QG3A 3GIZL 2LTQB 5TQ2H 4S2SB 4F58L 4Q58C 3K2UH 2Z4QA 4BQ9A 4P3CH 1QSEA 2NY4B 3ZT6A 3MLXH 4QTIH 2HFGH 5ANMB 8CGTA 1YNTA 3ARBA 1OPGL 2X6MA 3CU7A 1A7BA 2VLKD 4V1DE 2Q7YA 3R0MA 2R8SH 4PJ7F 4ENED 4IRZH 4RAHA 4LKCB 4JY6B 4UB0L 1NLDL 4Z7UE 2ADFH 2EO1A 5GGQL 4O4YH 5ENWB 1JGUL 1FFPB 3KLSA 3BESR 4MJIA 4XCNA 3K1KC 3L7FB 1ADQH 4Y4HB 1KENH 4HGWA 1HWHB 2CPCA 5L2KE 1G7JA 5J11B 5BV7H 1AKJD 4H0HB 2MSPA 3IYLW 4MAYA 1RSFA 4KC3B 5DD3L 4POYA 4PV8B 5HYFA 1MRFH 4QGYA 1NAMH 3KWWA 4QHKJ 1RZFH 3CFCH 3QR2A 2P8PA 4H1LG 1GPOH 3SGEH 4XNMA 2F53B 3F6LA 4QRUA 5H2BB 3L5XH 1QUNA 4N9OB 4XP1H 3UYOD 1KXTB 4E41A 2JJUA 5TDPA 4D0BA 4YBQC 5IESH 1PAMA 1EMTH 4WNQB 3G6JB 2KUTA 4OUUA 3MRNB 2DQUH 3MV7A 2NX5E 3KR3H 2EDFA 4OF7A 3MNWA 2HFTA 4P9HH 5KZCD 5IB2B 4LLVA 3R1GH 2J4WH 1G6RB 3HRPA 3CFIC 5E70A 5H94B 5CZVH 1UYWH 2KL6A 3QUMB 1MLCA 4TVPE 2GT9A 3LKRB 3WFHA 1CXEA 1YEEH 4Z8FL 4ODWB 1RURH 1WCBA 2RBLA 3MRFB 4X99B 2UWEA 3G6AB 1BBDH 1G7HA 3QXDA 3CXDL 2MNUA 1B0RB 2VSDA 1EEUA 2OMBA 1JWSA 1WF5A 3K4DA 1VSCA 2WM0A 1WIPA 4OZHF 3OAZH 1SYSA 1F4AA 3CFJB 1LDPH 2AV1B 2VR4A 2X4QB 2F5AL 5E99H 4FQQA 4NQCA 2NTFB 5KTEL 4PBVC 5CZXD 3MV11 3MRDB 1MWAL 1T22B 1IAIH 2R1XA 4XMPH 4GG8A 5F9JA 3V52L 3CC5A 5IV2B 1HH6A 3GSWA 2DQEL 2H32B 4YE4H 4EJ1C 1DN2A 1QSFE 1ITCA 1EO8L 1GPOL 1NBZA 4K8RH 2DBLL 1QRKA 1CFQB 2JELH 1MJUH 4P3DA 5DI8A 1K4DA 1G7LB 2F5BL 5C0GB 1GGBH 1QD0A 5HYJD 2W91A 3S37H 3VWKA 4RGMC 3JV6A 3BDBA 1NANH 1X5IA 4JRXB 1GVIA 1XCTB 4KVCH 4M6OL 2HWZL 4F7PB 2A38A 4MCYB 1XCQB 3T4YA 1TLKA 5ALBL 3ULVC 5AWNL 2CDEA 4MJID 3L5HA 4OD2A 2PTTB 5F7DB 2R4SL 1IGFL 2A77H 4ELKA 2P4AB 4HG4J 2F74B 2R2CA 4MQTB 3ES6A 4R90H 2EXWC 2YPLD 2BVTA 2G60L 2YD7A 1I1FB 1BFSA 1QTYT 4ERSH 5GJSL 2Q86A 5D7SL 1DUZA 1ZVSA 4MQ7B 1MAML 4KMQA 3DSFH 3S34L 5KS9A 4JGMA 2AK4E 2ORBH 4GG6B 5FYKD 3LSOB 1F58H 4ZD3L 4YDJA 4IS6A 3QUZD 2M8XA 2BXYA 3SKOB 2GK0A 5FK9B 4YR6B 1JRHI 3VGDA 2DRUA 2VDOL 4QRPA 1XGRA 4P23D 3JV0A 1V7ML 3EYQC 1ZLUK 3RX8A 1E27A 2OTUB 3OGCB 1A3RL 1MHPH 4FFZL 5DD1H 2DKMA 1FFRA 1QEWA 2MJWA 2OX5A 1NANI 4HCRH 1VGEL 4FG6C 2I60L 5FYKH 4OFVA 1WISA 3TZVC 4I9WE 3IETA 4CN6A 2DQJH 2X9XA 5A2JH 5AD0B 1DLFL 1HNFA 3TA3D 1HIMH 4HIXL 1MLBB 4XWOD 2YPVH 4RRPA 4LSDA 3D39B 1CBVL 5IB3A 1A7NL 1XGUA 2V17H 2VWEC 4JKKA 5L2JA 4F8TA 5I17A 4M03A 3QUZB 1IEBA 4YDKH 4BSVA 1PQZB 4EBQH 3D3VD 4LSPH 4X4YA 4LP5A 4WI8A 4OLUL 5C0CA 1RUMH 3QNXB 2XFXA 4GG6F 4HGKC 5BRZA 4ONFH 3QIWC 1A6WH 3TPUB 3I3BA 3QNZB 3WSQH 2XY1A 4JQVC 1MEXL 5EUKB 5EOQL 1K4DB 2KZ1B 3CVIH 4ELKB 1NMCB 1JE6A 1YJDL 3PWPB 2CH8A 3MBEC 1W0VB 2BHUA 4XNZC 2UWEE 3B9EA 3V5DB 2Q76A 4MWFA 5DD0L 1NMAH 4G6JL 1PJ9A 4R4NC 1EHAA 4FMKA 1S3KH 3SE9L 3U0TB 4Q6IC 2LVCA 4Q9BA 3FQTB 2AXGA 5LAXA 4GKSB 4ETQB 4X6DE 4PRDA 4B7IA 2K7PA 2XG5A 4FTVE 4NQCE 4WI3A 2P8MB 3KNBA 5HHPB 5CBAA 1CS6A 1KIPB 1Q9OB 4Y19E 5IK3B 5E2TL 5B39A 1S9XA 4H26B 3NABL 1RURL 3T0XA 2X70A 3MXVH 1NC4D 4KKCD 1F6LL 5IBLC 2R4RH 4HFUH 2W0FA 3RI5F 1FGNH 4I0PB 2NMSA 3V6FA 3VFSA 1A64A 4GMTL 5FUCC 5JR1L 4AEIL 4U1SA 3RTQD 4XCYA 1DSFL 5AD0A 1BD2E 1TITA 1MCWM 4Z95L 3O9WA 4CJ1A 2VDLH 2CDGA 3TT3H 1RVFH 3TH3T 3SKJH 1LEIA 5EA0H 1U41A 4KQ3H 1CFSB 2Y6SD 5JPMB 2EDOA 4M9OA 5T3XH 2GFBA 1CR9L 1FAKT 1DBMH 3MCLH 4EUPA 3MYJA 1ZOXA 5TGBA 3SDXF 4CMMB 2GCYA 3SPVB 1OTTC 3BT2H 4K9EC 3CZFA 3CFKB 3ROOA 1MCEA 2NTSP 1BWWA 4M7KH 5I1KL 1CE6B 4ZFOA 4GS7B 4AENA 3WFCL 3LKPA 3N85L 5J57B 2W0PA 3L3GA 5DK2A 1RY7B 4ZS7H 4NQUA 5C08D 3QQ4B 3HE6A 5EZIL 3TPKA 2ADJB 4C59B 5E8NB 2QSTA 4JM2C 4DCQB 3QP3A 3O8XB 3TIDA 5MENB 3QHTC 1YYMH 4HK3J 5IQ7H 3L3IB 3QEQB 5TE4L 5LCVH 4KDTC 4POUB 1BVKA 2Z91A 3GSUB 4QRRE 3OJDB 4Y0GA 5J3HC 4QRPB 5DK3A 2P48B 5EOTA 2DJ4A 2YPKB 1OL0A 5EIIB 1LO5A 2H26A 2AXFB 2C3HA 2G60H 3R0NA 2VLRB 3HR5B 1EJ6A 2IALB 4Y19B 3ULSA 2QSQA 3L7EA 4P4KD 3B43A 1J1XL 4NQEA 4ZAKD 5C2BH 4M8VA 3PWVA 1OW0A 2QTEA 2EDRA 3V9FA 4QHMB 3L5IA 5CSGA 4J6RL 3NCFB 1M7IA 3EDJA 4FTVA 1WC7B 2C1OA 3NIDE 2VN7A 4L8SA 5EG6C 3KPQA 3IXAB 2IAMB 5DT1L 2APTA 1A7QH 3G9AB 1MCPH 5TDOB 3QQNA 3NFSH 5F7MC 3WBDA 1CI5A 5CKAA 5ENWA 4DGIL 1NMBH 1EX0A 1P4LA 1HQRA 3Q6FA 4AG4L 2VDML 5T33H 3LEXA 4MD0B 3P4NB 4O58L 4K3EH 4Q7DA 1EH9A 1F13A 5H35B 3F7VA 4LSRL 3N9GH 3P9MB 4ZS6C 1DFBH 5C9JA 1BFTA 4XWOC 2NY6C 3F58H 3F65A 1N5YL 4LU5H 1CGVA 3MLUH 3VXPB 3EO1A 5ERWB 1T2QL 4KK9C 3T0EB 3QISA 5K9QG 5E5RB 2YOCA 3FONB 2NY1D 1FLRH 4ODUA 2ERJB 2MFNA 2DQCL 2VXQL 1KG0B 2XRAH 1NEZG 4NN7C 2NY6D 5IHZB 1AIFB 2YKLL 2AV7B 4MXQC 5D7JA 5HI5C 3OV6A 2I5YH 4GAYB 4J3WA 5FM5M 5AZ2H 1T89A 5IVOA 4Y88A 5T5FL 4PJGF 1IM3B 4KTEH 2HJFB 4OLYL 1PKQE 3NA4A 1DQJB 1W0WA 3RL2A 4ZUWB 2BRQA 1NCUA 1YJDC 3HI1B 2JLLA 1CLOH 3DRQA 5DA4A 3DX7A 1E0OB 2X4TB 4NGHH 2CRIA 3SDDC 3KPOB 1FGVH 5ITBH 4NC1C 3KLAB 3VFTA 3ZMRA 3OWEA 4V2BA 1BZ7A 4NSKA 1UKSA 4NQXB 1HDMA 1T7WA 5ESVB 1X5KA 3DECA 1FP5A 1X5XA 5FUZH 4BQBA 4QRTB 4X6CE 5DLMH 1XT5A 3DGGB 3TT1L 3MLSL 3B8YA 2CR3A 3AREC 4G80B 4UU9B 5ICXA 2DOCA 1B6DA 4DZ8A 4PJ9B 5IW3A 4ODTH 4FQ2H 2HJKA 1MCKA 4D9LH 5HYJA 1T5XA 1UZ6E 5EU7C 4Z18A 2JK5B 1CLZH 3PV6B 4L4JA 4IM8A 4QHMA 3L95B 2YA0A 4ZDHB 3RA7L 1NDMA 4Y5XB 5HDQL 5GJSH 4FZ8H 2XN9D 1CVSC 4Y4HD 1KCRL 4P3DB 1IGJB 5ID1A 2IADB 4JAMA 2WIIA 4IMKC 1JWUA 2Q8BH 3S3JA 5JHDB 3CFBA 1EAPA 1MJJB 1FL5A 3DX9A 2GY5A 1SY6H 1T83C 3SO3C 4XCEB 2FYYB 3NCBB 4OZFA 2BSRA 4OQTA 1G0XA 1C1EH 1A0QH 4M1CC 4L3CB 2VDQL 2WWMC 4WEBH 3UYRH 2H8PB 5A1AA 5IFJA 3MCG1 2F54A 1MIEH 4PJIA 4KRMB 4S2SA 3UCRA 1KB9J 3KYKH 4IDLA 3REVA 4JFQB 5IQ9A 3A67H 3EO1B 1CF8H 3KLHC 3FN9A 1VEMA 3SDAB 4ONOA 2GJ6E 5I1IL 1T5WB 2VISB 2ED8A 2EIZA 3MOAH 3S3SA 2RB8A 2CUHA 2NY7L 3ORJA 3TA3A 1CDUA 4PGJA 1RZKC 4ZYKB 3QIWD 3A6CH 4HK0A 4CVZB 5ALCH 3QUXA 2FWOA 5E1AB 5T1DH 4OUUB 1RZ8A 2IG2L 4Q97A 1AO7E 2HLAB 1U93A 3L9RA 3M17B 1B0GA 5BJTB 2Q76B 1KB5H 2ZUQB 2EKJA 1ZWIB 4MNHB 5FK9A 5T1MA 4HCRL 2XTJC 1I1AA 3QCUH 3RWHA 1M7DA 3GMRA 3QWRD 3LQMA 3I50H 5FHAL 1LE9B 1MF2L 4X6FB 3RPIB 5SWSD 2Y25A 1IE5A 2DQFA 1EA9C 3GJFA 3X3FH 3ARFC 4YZFE 4IOFD 1G9EA 5HVFB 3C08H 5KSAA 1WQVT 3KJ6L 1P7QA 3D39D 3O4LB 3CFEA 4KJYB 1GGCL 3O45A 3ARUA 5CP3H 4OCRL 1C7SA 1FFPA 4C56A 5HYJB 2VAJA 4QGTA 3STZB 3QI9C 3FQTA 3DTXB 4L8BA 3FL7A 4PV8A 4PJBE 3INUL 5CCKH 5D5MB 1DVFD 5EZOL 4Y5XC 3RA7H 3RGVC 3AB0C 4MJIE 2ZSVB 5IIEB 4LCWB 3AS2A 5BXFA 5ADOH 5E6ID 3C5JA 3OAZK 2OS7A 3AU1A 3QDGD 5L9DH 3DRQB 3VMPA 2GK2A 3HUJA 4Y1AE 4HPYL 3KHOA 5FV1L 2YPLE 4JHBA 4UIMA 3VCLA 3QIBB 5BRZB 1EDQA 4OLZH 4WENB 4PG9B 3OZ9L 4PJEB 5FDWA 1VFAA 1UQSB 5TFSH 3G08B 4E5XA 3SO3B 1F4YH 2AK4D 2HKHH 3BW9A 2HG5B 5IMMB 4M1DL 3UO1L 3B9KC 4YDJB 1KLUA 2E8YA 3SPVA 4EDXB 4M93B 5E00B 3TCXA 3S37L 4KI5D 1K5NA 2P5EA 4FFVD 5J7CC 3V4VL 1CL7H 3VFOA 1QBLL 2EIBA 4OCXL 5IW1A 3HNTL 3TESA 3SDAC 3DUHA 4G8FA 3IDGA 1QPPA 5LKNA 4BFIB 4M7ZC 2LU3A 2OQJB 5HGAB 2R2EA 1R3HB 1J05A 3FQNB 5DQDH 5FECA 1N59A 4NM4L 3VFUB 5IJKC 3BQUD 3SKJL 1SBSH 5A2IH 5JOPE 3RWFB 5DD6A 1JGVL 3BDYH 4CVXA 1ZHKA 4N90E 2BY2A 4WI7A 1ZHLB 4QOKB 1A9BB 3D85A 4AZ8A 4JKPL 1ITBB 5J9PA 4OCSH 4WUUD 4ZS6D 1ADQA 2JE8A 4U0RB 4HW6A 1AR2A 2R0WL 5KS9B 2F54E 2PO6D 4GSDL 5KVFL 2CKNA 2FATL 4QCIA 4Z7UB 5FFLA 4YDVA 2ZJSH 2NX5B 3UROR 2GY7B 3WUWG 1K4CB 3FTGB 4NQEB 1GZQB 5GGRY 1KBGL 3O0RH 4OGAC 3LMJL 1KJMA 5T1MB 2VDQH 5E2WH 1I1AB 2DL2A 3CD4A 5FV2A 3S35H 1A7QL 3BP6A 3BD4A 4ODBD 3T4YB 2M2DA 2NCMA 4C56D 4N8VA 1MIEL 4HEME 5CAYB 3B8SA 4X9HA 1E4XH 1F4XL 4P5MA 4QRPD 2MWCA 1F2XK 5D7IB 1T04B 2VLME 3HAEG 1AGCA 5CD3A 1BGXH 5JOEA 2KQMA 2G2RB 1MFBL 2CSPA 4OZHE 5F7EL 5HYQB 3QNZA 3AB0B 3H0TB 4F2MB 1NBZB 3TO4D 3OPZH 4U1HB 2EZ0D 2NY0B 1OWWA 2V7HA 2YMXL 2B2XH 5HDBF 5GPRA 1F8TL 4LLMB 4P46A 4UOW1 1BF2A 4OD1L 4NKMB 5I1LB 4WRLA 1FZKB 2IG2H 5CWSB 3SY0B 5E8DH 4FQJH 2EDXA 3BWAA 3D0VA 4RISL 5B4MD 4KKAD 1IGCL 3IDNA 5JUEH 3RVUC 4RDQG 1ND0A 4M6MH 4DEPB 2BY3A 3QJHB 4ELMB 3Q6FB 2O5YL 1WBXB 3SGEI 3V5KB 4KPHH 5I8EA 2FO1A 5IWLA 2A9MH 2CLRA 2B20A 1XGYL 4E5XB 4EUPB 5C0FA 1VGKB 1FORL 4JB9H 1EAPB 2MPAL 2IFGA 2VDMH 5I1DA 3N85H 4R96A 2ZSVA 4D0BB 1CZ8H 1KJ2L 2PCPB 1ZLWK 2DF3A 3O9WB 5I30H 3FN3A 4HLZG 1ZT7A 3BEVA 2W9EL 4KJPC 3QUML 5GGVH 4GMTH 2HKFH 5JR1H 3LQAH 3ULUE 5IROC 1G6RL 3RZCD 1G7IA 2H9GA 3MSPA 2JKXA 4PJGB 2VDLL 4Z6AT 3UTZB 1DANU 5L6YL 5I9QC 1WVZA 5EBMA 3NIFE 3VGGA 1AKJA 4RGMB 2VZSA 4KKBD 2P5WD 1C5DA 3U7YL 2OXGA 3ZKMD 4HLZH 5F9WB 1U3HC 2H3NA 4Z78B 5KTEH 4PRBB 3FQXB 4UTAH 4I18B 4QLRA 3WLWD 2P5EE 1XF2B 2CLZA 3HC3L 3DX7B 1MCBA 3IAGC 1R5WB 2P24B 4WW2B 1S9YA 3O9WD 2VYRE 3EYSL 4ZFZA 1ZS8B 4MSWA 1TVDA 4M1CD 4NRZB 4JRXA 3AMLA 5EBWB 3L3OA 2QHRH 4LLYB 4NFDA 1DE4B 3CCHA 4GQ9L 4WHTA 1CL7L 3BIAX 5KSBB 3HI5H 2P5WB 1OCWL 3N1GC 3GSQA 4FQQB 2ZUSA 4I5BA 4XC3L 4ZSOB 1RUKH 2MKWA 2GTWA 3CLEL 3I02A 4NCDA 3UAJC 1YPZF 3QBTB 4CU7A 3DX6B 2J3SA 2HVKB 1SM3L 1MI5B 3N0PB 1P4IH 3L1OH 4YEFA 4PGDB 3DV6A 3BH9B 2XN9B 4OSUH 2NY0C 3ZHLA 1EVUA 1HNGA 3IJSA 4Y8AA 5GSVB 1AJ7H 4HJ0D 4FQPA 4L5FL 4ZQKA 2P42B 1S7XB 3HZYB 3VXSD 5IWLC 1JWMA 5D1QD 4EN3A 4WGWB 3IU4L 4QXTB 3U7YH 3HAEA 2MCPH 2YRPA 25C8L 3NTCL 4PV9A 4RISH 2UY7A 1QEWB 4U6YA 3QUYA 5D2NE 5TH2A 3ZT5A 4NO5A 2X7LB 2D7NA 4HKJB 2UWEF 3QQ9D 5DGQA 4UQ2B 3KPRB 4G9FD 4GAJL 4XNQA 5ID0A 1JYXA 2P46B 1WCBB 2DLEA 2R2BA 4G7YH 4P46C 4R2GB 3PWLB 5JA8B 3BRFA 1IZJA 1J0HA 1RJZB 4HPOH 3TFKC 4HZLB 2DWEB 4LSQL 4OZHA 4KRPB 4KJYA 1P2CB 4U3HA 3S36H 3S4SB 1S5HB 2XKSA 3T4AB 4JQXC 1DQQA 5IGXH 3PHOB 3PGFL 4W4OA 3HFML 1MRCH 4UQ3A 1XF4B 3GZKA 4A6YA 4R0LB 2VUYA 4YHLH 5DQ9B 4L8BB 4PJDA 4PBXA 5EO0A 1TJGH 2X1OA 1J12A 4G8GB 4NHCH 5D72L 5JXEA 3P11L 1JTOA 2IALA 2EDKA 4HMEA 1LO0L 3TM6A 5LGJA 3EO9L 1ZHNA 3NPSC 4J23A 2HAZA 1OAKH 4ZUTB 3S96B 2R0KH 2F53D 4TSCH 3UTPE 3O45B 4H8WL 4DN3L 1B0GB 1VEPA 1MAMH 4Y89A 5JQ6H 5IMLA 5K9JH 4F80A 3V7AE 3SGJA 5KSAD 3QO0B 4FQCH 1BPVA 3LQAC 3BPOC 1N59B 3VFUA 4JY5L 5GRUL 4X6FA 3EZ8A 1DEEA 4R96B 4N5ED 1PQZA 1U42A 5FA4B 1L9MA 3EOAA 4HKBB 4DVRH 4PJAE 3OJMB 4P2CG 1T0MA 4WW2C 3DXAB 3MMEA 1GXEA 1LK2A 1TETL 1UB5A 2FO4B 1A4JA 5EFIA 3RKDD 5IBTH 3VDBA 4HUUA 1NGWA 2CLVB 3RWEA 1U95B 2Y9RT 3OF6A 1BVKB 2Z91B 4EUPH 1ZTXH 1IAOB 4Z77A 5FDYA 2E3VA 1F6AB 1UH3A 4IIQC 1L0YA 3MRLB 4GQ9H 4I4WB 3B2VH 5EORH 4ZUVB 1UM6L 3T0DA 1U8OB 3DHJA 5IJKA 4XC3H 1VPOH 3IFLL 4I3GA 2Q7NA 4QXGL 4FZEL 3MLWL 1N8ZA 5C09A 3H6JA 1B6UA 1N3NA 4I2XA 1W8NA 4QRSB 1LO3H 5FO8B 3BGFB 5D9SB 4KGLA 1KB5A 4LCWD 1BECA 3P4NA 1MHCB 1OARH 4M00A 2J88L 1I3GH 3MRMA 5H94A 2EDNA 4D9RD 1IKNC 3MTRA 5DJ2B 1Z5LA 3C9NB 4PJCF 1MY5A 1JPTL 5BRZD 3MJ7A 5E9DD 1U8HB 2XXCB 1U2HA 1ZK9A 5C0CD 4Q9CA 1FG2A 2MQ0A 5C0IB 2VE6B 5HHXH 4EZMA 3RBGA 1FL6B 3G9VA 1F4YL 1MAJA 1ZHNB 3EFFB 1RIVH 5IB1B 4IRSC 1QFUH 4HDIB 5FEBA 2CDGB 1BMGA 3FO1B 3VW3L 3QHZL 1SVCP 4R4FH 1X5AA 2X4RB 1MNUL 3KWWB 2NR6D 2R1YB 1RZJC 2HTKD 1NAKL 1NGQH 3IKCB 3JUYA 3KR3L 4JFDD 3MRBB 4HC1A 1DQDH 4XNMB 5DFTA 4PRIE 5BO1H 2EC9T 3I2CH 1TZGL 2JIXB 2VDKH 4RZCA 1D5IH 2HFFA 4MX7A 3N1FC 4PJDE 4Y4HA 4LHUB 3GSRB 5ECJE 3HFMH 1TJHH 1EGJH 4WHYH 3L3DA 4HUWA 2DYPA 2PO6A 4YHIB 1WZKA 5C08E 5MEPB 4WV1B 4NM8H 3OKOA 5D72H 1UWGH 1QA9A 1N4XH 3NPSB 1NPUA 1IAIM 4OLVL 4U2YA 3MV8D 3N1QC 5FF6A 1A1NA 1RJYB 2R2EB 3DNKA 2BSED 3TCLA 1NAMA 3FO9B 4NQTA 1OB1A 5I73C 5IB5B 3KS0H 5B3JF 3ZTJH 1BBJB 3WHXA 2E9WA 4KUZH 1G9ML 3HNSL 1AD0B 1SYSB 3QCVH 4HCRA 1DQQB 1DQLL 1T4KB 4NJ9H 2OLDA 1OAZH 1YN6A 4JJ5B 4DKDC 1MHCA 3RIFK 3PDDA 2YD2A 4D3CL 3IKKA 3E8UL 3G6AA 3W0WA 4FFWD 3EOTH 4NBZB 3HHRB 2BP3A 2HJLA 5E4EC 3BGMA 4G42A 3MPCA 4DK3A 4QYOB 5DRXA 1WEJL 4NN5C 3ZDZF 3B6SA 2BNRE 5LG1A 3EJYD 5GS0C 5DK0A 3IT8D 5CWSA 4O5LL 4YWGH 5JORA 2F5BH 1AGCB 4RAUB 1H3PL 5EWIH 1JI1A 3CFJA 4PG9A 1A3QA 3T3ME 5F9AC 3HZMB 1BQSA 5C09E 2JB6B 1EUTA 1JIBA 4OZFB 1ULVA 2GK0B 2ZCHL 1F4XH 5ANME 1DCLA 1CQKA 4YHZL 4K7PL 1WWCA 4OF0A 1HOCA 5D5MA 1EFXB 4NRXB 4GKNA 1CXLA 4M62L 4GH7B 2QSVA 5ESQB 2NY5C 3MLZL 4OM1H 1HXYA 5E56A 3RWCA 1LO0H 1D9KD 1RZIB 1W72L 2VXUL 3T2NH 5F6IB 1WFNA 2NY0D 5D71L 4M43L 3HUJB 2OTWB 2FB4H 1HQRB 3U30C 3HLAB 3O6ML 3THML 4YR6A 1ED3A 3TH4T 2GSIA 3CFCL 1XR8B 2DMBA 1NEZB 5JW4Q 4U4BA 4L4TD 1IT9L 3NFPB 1TTGA 1X7QA 4JRXE 1EMTL 3ZHKA 5D7KD 4N90D 1G9MH 1J0KA 2PETA 1X5JA 3MV9E 3P4LA 3UJTL 5HHVL 4EI5B 4NJ9L 1MREH 4NBXB 1YMMB 1JGUH 4LRNL 5DUPH 4P5TB 5DJ8A 2X4TA 1DBAL 4V2CB 3TIEB 2PO6B 5LWYL 3O8XA 5HD8C 1TVBB 1U8LB 4Y16A 3MREB 4HX1B 3V7AG 4QHNB 4YGAB 1JZ7A 2VNCA 5I1AA 1BJ1J 4BUHA 4BFIA 3HB3D 3LV3A 4MLIA 2DQJL 2I24N 4X5XB 3V4VH 3LCYA 1JNHB 3S97C 5JZ7D 1HXMA 4PJAB 2WV3A 5KSVB 1JYNA 1YNLL 4PGZA 5TE7L 4F7EB 3DUSA 1F4WL 4LPTA 4YPGA 3ETBF 2ED7A 2NY5H 2PXYA 3NMEA 3OKEA 4C56E 1N6QH 3DOSA 1JTTA 1ZHBA 1QSEB 4KZEL 4NZRL 4XBGA 1J8KA 2YRLA 1NGYA 4Y7MA 5F7KC 4UBDD 4ZMAT 4JE4B 5IB3B 3FRUB 1ADQL 4JHWL 1LE9A 3MACH 3OR6A 4P5TD 4ORGB 3SCMC 5DD6B 5D2NA 3ZE0E 4NO2A 4PGCB 5DWUH 3REWB 5HDQH 3FHAA 4DKFL 5GS0H 1K2DB 2B2XL 1AR1C 3IU4H 3VD9A 1QSFB 4YUEH 3P77B 5KVFH 4GUPA 4U1SB 1AHWB 1X44A 2KBGA 3GGWB 1CD0A 1Q9KB 1TCRB 4JPIA 4PRAA 1D5ZA 3IGAA 4Y4FC 1OLLA 4PJXF 2ZKHH 1UXWB 1KBGH 4FFZH 2RJMA 5DD1L 1VFAB 1Y6MR 3DTXA 4KZDL 1NBQA 5FOBB 5J6GA 1UGNA 4QT5B 4K3DL 4RMVA 5HSFA 5H2BA 4G42B 3SDXA 4K94L 2APXA 3CLEH 3MQIA 4WO4B 4LLYA 4YO0B 3RKDC 5L7XL 2QEJA 5IIEA 4HS8H 1IAOA 4Z77B 3W9EA 5T3ZE 1J5OL 4NUGL 2VLRD 1WZLA 2AQ1A 3HI6L 4YK4C 4EVNB 5GS3A 4YE4L 1FZMA 1I8IA 4OGXL 4DVBB 4GXUN 2A73A 1CLCA 4PLKC 2Z0BA 4ZAKB 1MCCA 1W0VA 4H26A 3GKZA 4WU5B 1X6NA 1EEYB 5DVLA 4F7CA 4CGTA 3PHQA 3VXME 2YA1A 1D6VH 2EYSB 3C09B 3KPPB 4IMLA 3STLA 1V05A 1OGAE 3OR7A 5TQ0H 1OTUD 3UTQA 2HLAA 5BJTA 2F5AH 5E99L 4HD9A 2BSTB 4APQD 1T6WA 1RHFA 4ZG1A 2W9LA 3KJ4B 5FYLE 5ALCL 5MEQA 1Z5LB 3V6ZB 1MFEH 4U1JB 3U4EB 2RCSH 4I0CC 5CD5C 3OB0H 1FJ1A 3EOYG 5GHWH 1DBBL 1MWAA 4K3JL 2Q3ZA 3IJYA 3QQ3B 1ORSA 2R1XB 1LNUB 1JNJA 4JPKL 1AGEB 5LBSH 5C0EB 5CZVL 4AEHL 4K07A 3O2DL 1GL4B 4IRJB 2R2HB 1QP1A 3DSFL 2OL3H 4FQXB 1BD2A 4JANA 5CLWA 3O3DA 4KZDH 5LQBH 3ARTA 5IEKB 2ESVE 3U1SH 3OMZA 4CDGC 3ZKXC 2JTDA 4PREB 5EIIA 4HH8A 3HNVL 3RWDA 1R3LB 3KLDA 1NCDL 4NQCB 3DX8A 1OAKL 5TGBB 3G5VB 5CP7B 2UV3A 2ATKA 1S7WB 1MCQA 4U1MB 5E1AA 1U8NA 1UM4H 3RL1A 2XY2A 1LDPL 3RUGE 1VERA 1YZZA 1IQWL 4M93C 1K2DA 1VGEH 2EE6A 3S4SG 4FQIL 4KTDH 5MENA 4NJAH 3EYUL 3C8KB 4HKXA 3LB6C 4CN4A 3PGCA 1KLGB 4OCLC 5DD3H 4LLQA 1ROWA 1I8KB 4XP4L 3MX0A 5IB4A 4TULH 2XTJE 1J1XH 3WL9A 1U95A 5ADPL 2LTQC 1CXHA 1DZBA 1NCNA 2EC8A 3LB6D 5EOCJ 1LEKB 3SE3C 4GRMB 4U05A 3GK8L 4JPVL 4PP2A 2V17L 1DUYA 1TCMA 2FX9L 1U8KA 4WFGD 1IKFL 4GW4B 4K7FB 4ZUVA 2BNRA 4DOHB 5IF0A 4HV8A 3WS3A 5J1AA 4JRYD 5C6WH 3GSQB 5LWYH 4I5BB 4ALAH 3N06B 5HYSG 3KHQA 5MI0B 5KAQF 5IW6A 3D18A 2YPLA 3BXNB 3O81A 4G9FB 1T21A 1JPSL 4HF5H 3KPNB 1NSNL 3H0TA 4OZ4B 4F2MA 5J0BA 4N8PA 5E7FA 3O2DH 5I0DA 3L7EB 4YNYB 1BFVH 1EEZA 3CVHH 5BXFB 1S7QA 3QG6A 4JDTL 1CICB 3LD8C 5I76A 3GNML 5HY9A 1DANT 4OI7A 1A6UH 4L9LA 3HNVH 4ODXA 4WEMB 1AXIB 1U2CA 3Q1SL 3VXRA 5AYUL 5C0CB 4QRRB 5JMRA 1AY1H 1SHMA 3PP3K 4JY6A 4W68A 4YHIA 4TPRH 1F6FB 1WTGT 3S34H 3PGDB 4HQQH 3LS5L 1UWXK 1HQ4B 3NIGF 4FNLH 4KQ4L 4L8DA 4NDMA 3MLTB 1G7IB 1MWAH 2H9GB 35C8L 4PJGA 1JF1A 4YC2C 5L8KB 4OV6F 1JMZA 2NLJB 3HS0A 4ZQKB 4LSTH 3JWOL 2Z4QB 4HWZB 2BNUB 4WHYG 3VFMA 1ED3B 4JR9L 2OJEB 2SEBA 4LGPB 1RZKH 4S1DC 4NRYA 3MYZA 4JFDB 5T1LD 1XZ0B 3ARFD 3RI5K 4X6DA 3RQ3A 1S7RB 3CFDA 1YEIL 1CN4A 1PY4A 5DMIH 4UT7H 2APFA 3DXAD 4LVHC 5E08L 1WEJH 5IBTL 5K9OA 4LFHG 4DGYH 3VMOA 3IDJA 2AEQL 3IDYB 5DXWA 1CU4H 1FL3B 2H1PL 4O9HH 1QHOA 4WFFD 3ZKXB 1DJSA 1KEGL 4LLVB 3ULUC 1CBVH 1OM3H 1A7OH 3QEGL 2ZCKL 3QFJB 2FECL 4X98A 2E7LC 4KKBC 1LD9B 1VPOL 4Y4FD 3R8QA 1WGOA 2PR4H 3O3EA 2BOBA 5I74B 4ODTL 4PJXB 1T7YA 4MNQE 3SDYL 4JFHE 3WHE1 4LASL 3WKML 1XIWA 5ESAB 3REVB 2F58L 1MH5B 1YY8A 3GSOB 5IB2A 1NBVH 2OZ4H 1I3RB 3AROA 3CZFB 1BX2B 1WWAX 2BNRD 4LMQE 5TE4H 2DQTH 3MCLL 4JFOB 4RFNB 3VXRB 3IF1A 3O6FC 4BK5A 5I9QB 5FA3B 2V9RA 2W1NA 4L8CB 4P5MB 5FYKL 1MJ8L 3L6FB 2PTVA 5F9WC 3QG6B 2BVPB 3RWIB 1YMHB 4KXZI 4HH9A 2QADB 2XWJB 2Y5EA 1JGEA 1XAUA 4HIXH 3PL6B 5E8EA 4F3FA 2BY1A 4MHHG 2PTUA 3GBMH 5IT2H 3JXAA 1EFXD 1KPRB 5B21A 3ZE2E 4WWKA 1DEDA 4B41A 1FVDA 4B0MM 4JFDE 1V7NL 1FE8H 1I1AC 1B4JH 4RQQA 4IBLT 4XBPB 3QDGB 2WANA 4TSBL 5JXAH 5ETUA 1TPXC 2BMKB 2FGZA 1U0QA 4GKNB 1GH7A 2YUWA 4OB5L 3NFPA 4NM8L 3UBXB 2BNRB 1TVHB 2BFVH 5TPWH 1NJ9A 1TZIB 4KQ3L 5JMOC 1BZ9A 1CLZL 1GGTA 1Z0MA 3WE6A 2A0LC 5BVPH 1E4KC 1QO3B 3HLAA 5C07B 2UYLB 2ORBL 1I9JH 3WLBA 3QQ9C 4XXDB 1BIIA 3T3PE 2ZUUA 3S4SA 4W6YB 3VGHA 1FNGA 2V9QA 5GGVY 1MREL 5T1LA 3JTTB 5M94B 2XT1B 3QFDB 2XQBL 2ZCLH 4PJCA 4OTXH 5F7HA 3GFUA 3V4UL 1KTDB 4OFPA 1XF1A 4L3AA 5C2UB 1IAKB 2ADJA 4XNXH 1O7SA 3CDGA 3QEUA 3ROOB 4XP9L 4NGHL 3KPLB 3WJLA 2HFEA 3PWPD 4DGYL 4OV5B 1AXTH 3I6GB 1AHWA 3GGWA 1DVFC 3ARRA 3WN5A 3LKPB 4WJ5A 4JCMA 4BSWB 3NABH 1Y18B 2BRRH 4DGIH 4ODSL 4R7DB 3QYCA 3TCLB 4P2OA 2VIRA 3KYKL 5E8OA 3CSGA 2RAMA 3B9DA 1JVKA 3KDMA 4F7EA 3DV6B 4PFEA 1A7NH 2ZG1A 4UUJB 3D48R 1WK0A 1YMME 4G9DB 4LLMA 4P46B 4TSAL 3RZCA 2DD8H 2E7CA 1J0IA 3OSKA 2G75A 2N4IA 4TNWF 5IFHH 2ZUTA 5GGQH 3MACL 3EYFA 4UIMB 2I9LA 3VCLB 5JW4R 4TPRL 4LRIC 4X0KB 5CIPA 3ZKSD 4K7PY 3MLUL 4KUZL 4JVWA 4XVSL 3VXNB 4JO4H 4M7LT 1WV7T 1XGRB 3ALWA 5J3HD 3BEWB 4S1RH 3D2UD 5EBWA 2GYSA 1IGTB 2G5RA 1VACB 3QNXA 3VXSE 4PJAF 4F7CB 4XMKL 1HYSC 5I2IB 4C56B 5DJ6A 1R3IH 1NJ9B 1VENA 1RK0B 4LSUL 5DHYB 1T0NB 3MCKB 1RZJL 1T66C 3BKCL 1VFUA 5D7LD 4FQ2L 4TUOA 5K9QI 8FABA 4D9LL 1Z2KA 1QR4A 4HWBA 4EVNA 4G8FB 4RIRB 1MCNA 4GLRH 5C0GA 1DBAH 5FUCE 4DFHA 2A0LD 5ESQA 2C4XA 5EOCH 1HZHH 3IKCA 4WTZG 5EU4B 3SDXB 5HVHB 5CS7A 4OCMC 4KU1A 2OXHA 1A7RH 1T89C 5TF0A 1ZKAA 3H3PH 2KDGA 1OP3K 4HZLA 1EZVY 3GMQB 3D5OF 2VR5A 4PGEB 4QOKA 5C7XH 3FT3B