4H20H

Crystal structure and computational modeling of the fab fragment from the protective anti-ricin monoclonal antibody rac18
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
220
structure length
220
Chain Sequence
EVQLQQSGPVLVKPGASVKMSCKASGYTFTDYYVNWVKQSRGKSLEWLGLIIPSNGGTTYNQKFRGKATLTVDKSSSTAYMELNSLTSEDSAVYYCARRGLTGALFAYWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPALLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIVPRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Light chain of Fab Fragment from the anti-Ricin Monoclonal
publication title Crystal structure and computational modeling of the fab fragment from a protective anti-ricin monoclonal antibody.
pubmed doi rcsb
molecule tags Immune system
total genus 44
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2012-09-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4h20H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4h20H02
2FYYA 2UZXB 1IGTB 3VH8A 1A1MB 4XTRD 4P46D 3PQYE 1UB5B 1A6UL 4WNQB 3TA3C 2Y36L 3NIDF 3MGOB 3RY5A 2IG2H 1H3PL 3KYOB 1HHGB 3O4OB 3TBSA 5FF6B 1PZUB 2EIZB 3GK8L 4FQLL 1NLBL 3OJDB 5DRWB 5K59F 3KDMA 1OTTD 1MVUA 2HVJB 1JNNH 2GUOA 4RNRB 3CFCL 3R0MA 2J8OA 3K8KA 4XMLH 5C0CD 3V4UL 3QNYB 3D3VA 1LO0L 5BVJA 1LP9A 2B4CC 1T7ZA 4NQCD 1M6OB 1YPZE 3MUJA 1RJZB 3UTQB 3HNSH 1FBIL 4NC1E 5FGBC 3SE3C 4UV4L 4NKOB 1UACL 2YXFA 3D69A 1IL1B 2VDPH 3QUKA 5E8OA 5I66B 1SY6A 1KPUB 2EIBA 2YZ8A 3V4PH 4KROC 4IHOB 3G6DH 3OV6A 4S1RH 4MNGA 5FK9A 1J0YA 4DFIA 1I9IL 3H7BB 5MEPB 3MRHB 5DTFA 4DEPC 2GJ6D 4YBQD 1A0QH 1UJ3A 1CDYA 4U3XA 5TE4L 3F12A 2BOBA 3T1WA 1E6JH 3B2VL 2VLRA 2I07B 5EORL 5IB5B 1UH4A 5KBNC 2MCPH 2H3NB 4L5FH 1JHLH 4FG6D 3MXVH 3MODL 3CFJB 4J6RH 1PW3A 2COQA 4OT1H 2R29H 3C5ZA 4XNUH 1NCWH 3LKOA 5JHDA 5I71B 1J8HE 1MCIA 1WCBA 4LAQH 4KJPD 4PJGB 1D9KD 2P42B 1MCHA 3DO3A 2XN9E 2UY7A 5IV2A 4RDQG 1PD6A 3HR6A 2VWEE 3MRNB 4PRPA 1P1ZA 3MLPA 3O2VL 3VD5A 1UM5H 4WW2F 5DS8A 4ZAKA 1T03L 5ANMA 5DJYB 3GRWH 1TPXC 1ZLUH 3QUYD 1QA9B 1TLKA 3EOAB 4J3OC 1DFBH 4M3KB 5K59E 3UYPA 4G6AC 4TPRH 2YN3A 4GOSA 4Y88A 3C5ZD 4HUVA 4I0PC 5JHDD 1UEYA 3I84A 1JWUB 4UT7H 4OZIB 5KAQG 5IMKA 2IG2L 3WUWG 3DXAA 3STLB 3PUCA 3V7AE 1PFCA 3HC0A 1I9RH 2Z31A 4X80H 1KCKA 2WZPD 1LDSA 4PGEA 1N59A 4JREC 3VCLB 1T0PB 3N0PB 4PD4K 1P9MA 4KK5D 3NCYS 4ZAKD 1JNNL 1QSFE 4KTDH 4PY8J 3STZB 5GRYA 1L6XA 1JZ8A 3ET9F 2WM0A 4XMLL 3KHQA 3NCYP 4Y89A 3WIHH 3CDGB 1LO3H 1MFCH 3T3MF 2ZPKH 5AYQA 2BFVH 1J0ZA 1DANT 4RDQF 1AKJA 4JM2F 2ZSWA 3VFVB 4HCRA 5GGSA 3VFUB 3HNSL 2BMKB 3U46B 1ND0A 4PREB 4CMMA 3C60B 3MXWH 3OKOA 2YD2A 2EDRA 2VDPL 3FB7B 5E5UB 3V4PL 1NAMA 1QQDA 3UCRA 3W9DA 4GFTB 3W0WD 1S9KC 2A83B 5DD3H 5JW4Q 1TJGH 4APQD 3E6HA 2JE8A 2ESVB 2VABA 4G6JH 1X44A 1XGUB 3JTTB 1J05A 4OCSH 3ZKXB 2FIRT 4G8GE 1A0QL 3D5OF 4R6UA 1AKJD 3PGFH 4JFHD 2YPLB 4NRZA 1MCJA 3BUYA 2CPCA 3BE1H 3VWKC 4XVJH 1E6JL 3FQRA 1IKNA 4IOFD 3EYVA 4X6BB 3T4YB 2NNAB 3RDTD 1U8MA 3BEVB 3JSSA 2MCPL 3LKRA 4L5FL 1JHLL 3PWUA 4U7SA 3BI9X 5TDPA 1I7RB 3MXVL 2YRZA 4J6RL 4GRLB 4I48A 4U1HA 4OT1L 2R29L 4XNUL 4MCYA 1HDMB 5GGRB 3QPQC 2DRUA 1JMXA 4LAQL 1KF9B 4PLJD 4PJGE 1DQMH 5EOTB 4M93C 4LCWB 4WY7H 1T04A 1AQDA 5EC1A 1UB6B 1WTGT 3OXSA 1J86A 2E9JA 5AUMB 3C5JB 1S5HA 3QZWB 4LEXH 2XWBA 4IIQC 2VB5A 4F58H 1UM5L 5E8DH 4F57H 1EMTH 1YQVH 3RY4A 3VA6A 3GRWL 4GAFB 4IRJC 4K7PY 1H3UA 1CFSB 3O3EB 4XNZC 1KCVH 1XCTA 1DFBL 1ZA3A 5F7HA 3I6GB 3WEXA 4ZFOL 2EYSB 3INUH 5JLZB 2JB5H 1HHIB 4POUB 2NMSA 4TPRL 3WBDA 4NKDA 3CFBB 4YR6B 2VOTA 4UT7L 1T1XA 3G5XB 3DMMC 5FOBA 2NX5B 3MR9B 2OK0H 2PXYA 5JZ7D 4BZYA 3VGGA 1I9RL 4X80L 1A4JA 4OGZA 3BYYA 4AM0A 1RD6A 4K7FB 3S35H 3WNKA 3VFNA 4HX1A 1F8TH 3QDGA 3OX8A 4TVPD 5JDJA 4U6XB 4JFFD 3HPJA 1HI6A 4EI5C 4ELMA 3ZDZE 3TYFB 3WIHL 1LO3L 1MFCL 3DX9A 2BFVL 4KHXH 5A43C 4LVHC 3RHWK 1FFRA 1MRCH 2CO7B 3DUHA 4ZOBA 4ODVH 2AI0H 1CLYH 3QWRA 4QCIB 3SDCA 3MRRA 2EDJA 2VYRE 3MXWL 3MUHL 3RTQB 3CFKA 3NN8A 4JFXA 4BYHA 3HCVB 4L3EB 3WFZA 3MQIA 4P57A 4N1CA 3GMLA 5DD3L 4NBZB 4Y16B 1TJGL 3QDGD 3BGAA 4WENB 4ZOCA 2ESVE 4OZHA 4OFVA 3MYZA 2V9TA 4PJBB 1I7ZA 1YNKH 3BRFA 3VRLE 1WWAX 3KJ6H 4HC1A 3KAAA 4J3XA 4P4KA 3V7MA 2XKNB 1U3HC 3PGFL 1ZSDB 3MLTB 2YPLE 2HRPH 3BHBA 3BE1L 2X4NB 4XVJL 1NDGB 3HZMB 5GRVK 3RWDB 3MOAH 1OD9A 4JR9H 4G3YH 3KPSD 2JJTA 2ENYA 3HE6A 1SMAA 2HFFB 5D4QA 3Q6FB 5F8QC 2VLKB 3U4AA 4I1NB 3H7LA 4ZUTB 4YHOH 4X7SH 2ITCA 3ARFA 3VFWA 1DQML 2CDGB 2UYLB 3FOMA 4P48A 4LCWE 1IVLA 4WY7L 4R4BB 5HTSA 4HKXA 4ERSH 4HKJB 5B4MD 3RBSA 3ZKND 3TYGH 4ZG1A 3D39A 1G9NH 1R3HB 4LEXL 3AAZB 5KS9F 4F57L 5E8DL 5H94B 4F58L 1EMTL 1E4XI 1YQVL 2JB6A 4M4PA 2P24B 1J1OH 4N0UB 1F11A 5L6YH 1EX0A 1KCVL 2OI9C 3VD7A 4KJWC 3V0VA 3QXWA 1NBZB 5T1DH 3HE6D 2E7LC 1LEIA 3WKMH 3INUL 3QQ3B 1ADQA 2JB5L 5C8JA 2XKUA 2DWEB 4HS6A 1NC4B 2X4SA 1XCQA 2HFGH 3HC3H 1U8HA 3S3JA 3GSQA 3DROA 3QPXL 4PJ9D 2OK0L 2PN5A 3M07A 2E9BA 5E56A 5SWSE 1KEGH 3BH8A 4ODTH 5D5MF 4Q2ZA 3S35L 1H3WM 4BFEA 2EKSB 5F21B 4DVBA 1F8TL 5GRZA 4YNYA 2FCBA 2BZDA 1QLEH 4XHQA 4OLUL 4Z76A 4OF3A 4MQ7B 3OHXA 2IPTH 5ICXB 3U0PA 4YGVB 4KHXL 4P23A 1MRCL 1D5MA 4XCEB 2GSGA 1G6RH 4ODVL 1CLYL 4XP1H 1S8DB 2QKIB 5C07E 4CADB 3M17B 3V79C 4ZO7A 1HQRA 1G6VK 5EUKB 1RJLA 3AMKA 3FB6A 4L3EE 4PJFA 1A7NH 2R0LH 2X2YA 4KKCC 1MCQA 2SEBB 1TMCB 1JHTA 2X7LB 2ARJB 5CP7A 3CFIC 2VISA 5K9KB 2J8UF 3BPOC 5I8EA 2ZSVA 2DM2A 3QNZB 2VITA 4PJBE 1JZ6A 5ITFB 1YNKL 5IKCA 1FLRH 3KJ6L 4JFDA 4JEGB 4NO0D 3DJ9A 4X4XB 1T89A 5FM5O 2HRPL 2YUWA 4HK3N 3MOAL 4RIRB 5KS9E 4JR9L 4G3YL 3L5JA 4Y19B 4EXPX 1U93B 2R2BB 4Y4HA 5GRUH 2Q3ZA 2VLKE 5KSUA 3ILPB 2GYSA 5E6YA 3U7WH 3QAZB 4YHOL 4ZOEA 4X7SL 4XNQB 1BVKA 2NZ9D 4RX4A 4ERSL 1H3XA 2HT2D 4LL9A 3MRMA 1WZLA 3O9WB 3O8XB 3FAWA 1G9NL 4P0DA 4JFDD 1CZ8H 2C3WA 2Y4SA 3SGEI 2UVEA 1DBJH 1NAKH 4H1LA 1J1OL 3EO9H 5L6YL 4N0UE 5JOPD 4P4RA 1A7PH 4JVUA 4OF8A 5IW3A 2AV7B 5DJ0A 5T1DL 2F8OA 4YDVB 3WKML 1FFNA 2CD0A 1RJYA 3IJYA 4PJXA 4NT6A 3OPZH 4XCNB 4XMKH 2VC2H 3MFFB 2HFGL 1CG9A 3OKKA 1X9QA 2YRPA 5A2LH 1CDIA 4RX4D 1FVDA 2Y9RT 4LLMB 1XIWA 1KEGL 2MSPA 3O4LA 4PBVC 3MV8A 4ODTL 5IWLA 1OPGH 4ZSOA 3BEWB 5GS3A 2WBJD 3ARGB 4EEEA 3U2SA 3JV4A 2NPLX 1CD1B 1QLEL 3Q5OA 4WEBH 1QG3A 2GCYA 1A4KB 2IPTL 4LRNH 4PJEF 3K80A 5D7IA 5ESAA 3MRPA 2Q7NA 2FATH 1UVQA 4DFHA 1MCOH 5HYFA 1F6FB 4XP1L 1W72B 3L3DA 4HLZG 1KGCD 3C6SA 4JZOA 2Z92A 4KUCF 3SCMD 4G8FA 1A6PA 2UZYB 1C7SA 1AD0B 1GGYA 1GRWA 3F65A 4MX7A 4L8CB 4LBEA 3O4LD 3CK0H 3H2WA 1A7NL 1Y0LB 4KJPC 2ERJB 5IMOB 1OTUC 5DUMH 3RWIB 3FQTA 2BRQA 5HD8C 1IGIH 5CGTA 4Q9BA 1FLRL 3DX8B 5IFJA 3IS0X 4BSVB 5I16B 5GRWA 1UJ3C 3QCUH 1D6EA 5EUOA 2X5PA 4YHYB 3DGGB 2RAMA 1AGFB 1IEBA 3WS6A 5I1GH 3C2SA 2F8VA 1T21A 3UTSB 3AY4A 1R0AH 1S7QA 2E7BA 1WEJH 2NXYB 4MD0B 1A6TA 3BZ4A 4Y19E 5DVNA 4GT7A 2PTVA 4JJ5A 3TBYA 5GRUL 1CXKA 2FH6A 3C5ZC 1BAFH 3U7WL 3LDBB 4HMCA 5DMGC 5FECA 1BM3H 1ONQA 2CSPA 4LDLB 1NJ9A 1JWSB 3ARED 5IW6A 4F15C 4PJDF 1WWCA 3C6LB 3CH1B 5IP4A 2GK2A 1G9MC 1CZ8L 3CLEH 1AO7A 4ZAKC 2H6PB 4BSWA 1DBJL 1NAKL 3EO9L 2Q76B 1A7PL 3RVWC 3ZKSD 3VFGH 1BPVA 4JFOA 3H9SA 1RIUH 1E28A 3OGOE 3VW3H 1T66D 1TZIA 2XRAH 3OPZL 2VC2L 1FYTB 1MUJA 4PJIB 2I5YH 4HKZB 5IQ9A 2Z31C 3GMNB 3LSOA 5CMAA 3FN0H 3IDGA 5IVZB 5KVFH 1OPGL 1R5VB 5DMIH 1ZAGA 3ZE1F 4M02A 2Y06H 4HH9B 2P45B 1EBAA 5AYUH 4Q9RH 2CIIA 1UG9A 4PJCF 4WEBL 4LRNL 5DZOA 1LE9B 2B8OT 4JDVA 4O2FA 3H9SD 1D7FA 1VFMA 3MRLA 3LMJH 4NQEA 2FATL 3KJ4B 3ZDXF 5I8OH 2R23A 4OCRH 2FR4A 1QSVA 3BPLB 2HJLA 1MCOL 4M8QA 2X1QA 1N6UA 4R90H 3QRGH 1QSEB 3MRDA 4EXKA 4L29B 3NZ8B 4NJ9H 3GDBA 3KXFE 3UTPD 3CK0L 5C0BD 2IBBA 3GSNH 2FX7H 3ESUF 5DUML 4C56A 1FNHA 2PR4H 1UXWB 5T3XH 3FO1B 1UM4H 5LGKA 2ZWLT 4M7ZC 1IGIL 5KTEH 5FFLA 1JIBA 4MAUH 1J0HA 1UZ6E 3PJSB 1I1AA 3TZVA 1IEAA 4RCAA 2P5EA 4NQED 4PJDE 4U1MB 4FMFA 3QCUL 3QUXD 1XF5B 1IKNC 1EK3A 3B8SA 3UTSE 1R0AL 2PYEB 1WEJL 4Z7VA 3FRPA 3HMWH 1NCTA 1H3TA 1NGPH 3REWB 4K8RH 3IU3A 1TQBC 3MJ7B 1N5AB 1BAFL 5MENA 2B5IB 4DCQA 1BFOA 1W0WA 1YY9C 1QOKA 1BM3L 4NM4H 1KJ2B 4HIEB 2H8PA 1MI5A 3NTCH 1PSKH 1Q9OB 3IXTA 4N0YH 4I2XE 4WO4C 3OKDB 5LGHH 2DKMA 3OR7A 2P5ED 3CLEL 4EDXA 1I8LA 3MRQB 4KJYA 1N2RA 3F7YB 3WDHA 3LHPH 2WK2A 2R1XA 4YGAB 3MBEA 1U42A 3PP3K 3WCYA 2QHLA 4U3CA 3VFGL 3AMLA 1DEDA 2Z0BA 1RIUL 4HULB 3ZE1E 3QIWB 2EDHA 4OZFB 3X11A 5F9WB 3MV7B 3VW3L 3QI9B 2XRAL 1IQDB 2IALB 4C59B 1FYTE 3D85A 2BNRB 4QWWD 2PXYC 2I5YL 4MNQD 4PJIE 4QRQB 2Q8BH 1FCGA 2DL2A 5BRZA 4UAOC 3RPKA 5FYJD 4HHAA 4RMWA 3PWPA 4KVCH 4WGWB 1RUPH 1WC7A 1UC6A 3TJHC 2OTUB 4ODUA 3ZKMC 2CLRB 3FN0L 4J1UB 5KVFL 3Q0HA 4C54A 1P6FA 1LK2B 3NIFF 3I3BA 4HH8A 2EE3A 4KJQD 1CFVH 2UY6A 5DMIL 5LG1A 2Y06L 2D9QB 2YEZB 5AYUL 4POZD 4Q9RL 2AP2A 2VZ3A 5DC0A 4X98A 2J8HA 2XV6B 4MA1B 3LMJL 3NA9H 5I8OL 4OCRL 2P7TA 3T0EB 2VLLB 5GJSH 3OKNA 3SDCC 3S8WA 3KG5A 3QRGL 4R90L 3UYOD 4D9LH 1QSEE 8CGTA 5D72H 3D85D 4W70A 3VMPA 1G1CA 4X83A 5BRZD 2NY7H 4NJ9L 4OGXH 2BNQA 4WWKA 4XNMA 5DD6A 3SE4A 3NZHH 1T6WA 3MA7A 3QA3A 4ZO9A 1HWHB 3TPUA 3WLWD 3GSNL 2FX7L 5FO9B 3QDAA 2ICEB 1MHHB 2PR4L 1FNLA 1MFAH 3B9KD 3QHZH 1UM4L 3QXTA 4FRWA 5T3XL 5GGTA 1VDGA 4QT5A 4LGPB 5KTEL 4MAUL 2LU7A 2Z91B 5IB2B 2E3VA 5BV7H 5L7XH 5EBLA 1CDUA 4P4KC 2XOTA 1SJEA 3WD5H 1S7XA 3U82B 3IDXH 3RRQA 4G9FB 35C8H 5HHNA 2OZ4A 3SO3C 2PYEE 3BO8A 2D03L 3HMWL 2JJTC 3HE6C 2HN7B 1NGPL 5CIPB 5DEGB 2J6EH 4K8RL 3FN9A 4WFGE 4OGAD 12E8H 4GBXA 1C16A 2BNQD 4NN7C 1A6VH 1FZJA 4JRYB 3KPLB 2EE6A 4KKNA 4NM4L 1MWAB 1WBXB 3ARFC 4Y4KA 2YD9A 3S3SA 5K9OA 5EOCH 3NTCL 1PSKL 1K2DA 5DDHA 1B90A 4N0YL 1ZMYA 5GZND 4QHLB 5LGHL 4HWZA 4FQIL 4DZBB 5JUEH 3LHPL 5HSFA 3ZT7A 4CMHC 1OT1A 5H2BA 3V5HB 3WS3A 5DFWH 4NZJA 4E0RB 2DF3A 4AY0A 1I1FB 5IF0B 4GBXD 2IH3B 4H20L 1A6ZA 1B2WH 5DD1H 4CBPA 4ACPA 2Q8BL 5DJ8B 2OXHA 3D2UA 2Y7QB 4KVCL 2ZZUT 1RUPL 1P4IH 2ADIB 2HT3D 1JGEA 3QXUA 5JIKA 1CIDA 3M8OH 4XMPH 1CFVL 2E7HA 3MO1A 2VIRB 3LZFH 1UADC 1Z5LB 1U8OA 3GMQB 5ACLA 5C0JB 1EEUA 4P23C 3NA9L 4AT6B 5AEAA 1ITCA 2HJKB 5GJSL 1OAYH 2AJZA 3FQNA 1VADB 2W0FA 5GSRB 1D5BA 4D9LL 3JWOC 1YN7A 5D72L 4KXZH 5BS0D 3OJMB 3SDAB 4O51A 4OGXL 1QFPA 4D9RE 3L7FB 3NZHL 2Y1VA 4UIKH 5HYJA 1WSST 4UIMA 1H8SA 1MFAL 3QHZL 1HZHH 3C08L 1MCLA 5B38G 3A67H 1UWXH 5BV7L 2C1OB 5L7XL 3H8NA 4PPTA 6CGTA 5CJOH 3WD5L 5GS0D 2EDNA 4XNXH 2R1WB 1T89C 3IDXL 3AB0C 35C8L 4G9FE 4WUUA 1GZPB 3I2CL 3TVMB 2V7HB 1BZ7A 2E9IA 5FDYA 2ILLA 1HILB 3OB0H 3O3BB 2XTLA 5CBEB 3OMZA 2J6EL 4Y4HC 2H32A 5C0EA 1NGWA 4LKCA 1ZHLA 1T1WA 12E8L 5DRXB 1O5DT 1A6VL 3FFDB 4LEOA 1A64A 4JRYE 4NOBA 5HGAA 4LLQA 2KL6A 2ICWI 3G5VB 5EOCL 1WCQA 2OSLA 4X5LA 4H25A 1U3JA 1J88A 1KXVC 2BY0A 2ED9A 3M1BB 5A40E 1KCRH 2VXQH 5IM7B 1GYAA 4PP2A 1K8DB 3RUGF 5JUEL 3EYOB 1LO5A 4ELKA 4X6DB 4DGIH 1FL6A 3CFEB 1MFBH 4KKLC 4WUUD 4EVNB 2A6DB 4Z78B 4ZS7H 3MJ9A 1CD9B 4BQ8A 5CCKH 1B2WL 4A2MA 4YPGA 5DD1L 1I1YA 1XGPB 4IJ3C 2VAAB 1N3NB 3K4DA 2J5LB 3JV6A 4F7TB 1XIWC 3X14A 5I1DB 1P4IL 2OTPA 2EIEA 5IWLC 1DQJB 2XKSA 3BZFB 3M8OL 3X12B 4XMPL 1F4AA 4QHKJ 1DN0B 3LZFL 1T5XB 4U1NA 4HG4J 5LGJB 4U6YB 5C0IB 3SKJH 1KELH 4LP4A 3GSOB 1OAYL 5DVKA 4XWOD 2VLME 3C5SB 3TNMA 3MUGB 3LRGA 3PNWA 2ENSA 1YY8B 3KS0J 3T0WA 5CEYA 1S9WB 4JO2H 2R0ZL 4K3GA 2VXVH 5JO5A 1WWWX 1DR9A 3MX0A 4UIKL 1Y6KR 2IAMB 3BP5B 1DLFH 5F6IC 4LQFH 1HZHL 1JZ4A 4U1GC 2ATPB 2X4OB 2IMMA 3A67L 5T5FH 4MD5A 1A2YA 1MLBA 4A6YB 1OP9A 2HG5A 3IJHB 5CJOL 1X5ZA 2HA1A 4XNXL 1HH6B 1ORSA 4P2QA 1Q38A 3WS6C 1L6ZA 4Q74A 4L8DB 1U8KA 3QEHA 3AY4C 4NUGH 1DUZA 5DHVA 3RUGE 2EDEA 2CRYA 2NY1D 2ORBH 5FAAA 4H26A 2IANA 5B39G 4M9OA 3T04D 4PJHA 1A9BA 1H8OA 3TBTB 4QRPB 3MPCA 4X8JB 1Y18B 5FYLH 2GKIA 4JY4B 3ARDA 3CXHJ 3P0YH 1DJSA 3S37X 3E2HC 3HB3C 1QD0A 4TULH 1C08A 5D7JB 5D71H 1KCRL 1FV1A 1QACA 2VXQL 1F4XH 5EWIL 3SO5A 4P2CG 4DGIL 4QNPF 4X6DE 3LAFA 1MFBL 1MJJB 2XFXB 5DURB 4ZS7L 2EDKA 1R5IB 4KC3B 3TM6A 1QLFA 4TRPH 3AXLB 1CGYA 3SDXF 4JFQB 1BIIA 4N8VA 3I85A 5CCKL 1SJHA 1REIA 2Y5TA 3FO0H 3W2DH 2V2XB 1FL3B 4ZNEA 1UYWH 3ARDD 3WIIL 3QQ4B 1NKRA 4HIJB 43CAB 4GQPH 1KT2B 3HI1A 4BQBA 2I9TB 4PLNC 2RFXA 5L8LB 4XXDB 2EH7H 3ME0A 1EJOH 1CT8B 4MXVE 2CRIA 2VDQH 5J12C 5CZKA 1AR1C 1X5YA 4IOIA 2EDLA 2CQVA 3L3JA 3PQYA 4BQ9A 3SKJL 4WHTB 1KELL 3QP3A 3T3PE 5JOFA 1G7IB 1M05A 1G7LB 1TVBA 3FQUB 4X99B 1ZEAH 5BQ7B 2DS4A 5DRNB 5ID0B 5HHQA 1EO7A 2MOVA 4P2OA 3PHOA 2VXVL 3WFHA 1MSPA 3GSUB 5F7EH 2GTZA 2FJFB 3ZO0A 3MROB 1JNJA 4WI3A 1DLFL 1MRDH 1BD2B 3G9AB 4LQFL 5E8PB 2ZOLA 2ICWB 4ETQA 3ZHLA 3I50H 1Q9LB 5FA4A 4BH8B 1B0RA 1I1AC 4W6XB 5T5FL 3TZVC 1CN4A 1XR9B 3TV3H 3PQYD 3VD9A 5FA3B 3I3DA 5L8KB 1J1XH 3KPTA 4NUGL 4R7NA 4LHQB 1WLHA 2ORBL 1KPRA 4PGDB 1ZLVH 4F7EB 2IGFH 4DVRH 1ZVYA 3QXDA 2KZWA 4AMKH 3RVXC 4KI5F 2APTA 1Z6JT 4P2OD 3IU4H 3VMOA 4E41B 4QKXB 4GKOA 4LPWA 1D5ZB 4FQ1H 3I6KB 4QRPE 5FYLL 5F89A 2A0LD 3RWEA 4ALAH 5J11B 1WFTA 3P0YL 1KB9J 3FQWA 1HOCB 3U4BH 4CGTA 3WUWB 1JBJA 1HKLH 3P4LA 1TVHA 5FB8B 4TULL 3MFGB 5CINH 3I6LE 3RZCB 5D71L 4KJQC 1I8LC 4MA8H 3BGMB 1S7UA 4I4WA 4ODWA 3OAUH 5D2NA 4POZC 1TXKA 4G80A 5EZLA 3IDYB 2F74A 3MBEC 3VFPA 3W11C 4J12A 5J6GB 3QCTH 5HHVH 3C2AH 4OQTA 4TRPL 1J8HA 1CXIA 3BPCA 4GKZB 5FO8A 5I75C 1PDKA 2XN9A 3WO4C 4QXTB 1WZ1H 3U7YH 4ZXBD 3K1DA 4NCC2 1CFNB 3FO0L 3W2DL 5A3ID 4QHUA 5IG7B 1L0QA 3B3IB 5ELIA 1WBYB 4RAUA 4YDLC 4LNRA 5ACMA 2V7NB 2FGZA 1YDPB 1DLHA 1GC1C 1IC1A 1RZ7H 4R97C 4U2ZA 2EH7L 1EJOL 25C8H 4FOMA 2VDQL 2Z35A 4PP1D 4ZPVB 5HHMB 4OKVB 5ISZA 5B3JF 1IGTA 4XX1G 1U6AH 5C6PB 4QY8B 1J8HD 1LDPH 1UB5A 4WNQA 3MGOA 2X09A 3NOIA 4Z9KB 2XN9D 5AG8A 1BOGA 1ZHNB 1ZEAL 3L95A 1GXEA 5FGCB 5F71A 4BFBD 2WLZA 4OGAC 5ABDE 4WWKC 4XP5H 5IR1B 5F1IB 3SE4C 2VL4A 1QSFA 1EAPB 1G9MH 3V6BR 4CW1A 4Z5RA 5F7EL 1T3FB 2VDRH 3QXAA 4KI5E 4OF7A 2ZNXA 3EO0A 3QFJA 3UYRH 3FB5A 3QUMB 1MRDL 1BD2E 3RL1B 43C9B 3S5LG 4EIZC 3I50L 1MCBA 2VERN 5HI5C 2DYPB 4N0FA 4NNYB 1PYWB 4DGVH 3TV3L 3LRSB 2DKUA 3AS3A 3GHEH 4MMZC 4X9IA 4Q6IA 1DANU 1J1XL 4QXGH 1IL1A 1V5JA 3T8XA 5I66A 5J56B 5LAXB 2IGFL 4DVRL 3T0DA 4S1DD 2JJVA 3OZ9H 4GBXC 1QO3B 3IU4L 3RVTD 2XG4A 3BAEH 4E41E 4RMQA 3ULSA 4FQ1L 3H7BA 4Y4KC 3LKPB 1G7JB 4ALAL 1R3JB 3U4BL 1LEGA 2C3VB 4G8GA 1HKLL 1P69B 1RFDH 1TCMA 2HT3C 5CINL 5HGHB 1HH9B 1Q94A 5EC2A 1F42A 2I07A 4MA8L 4WW2A 3IAGC 2K1MA 2H3NA 3OAUL 2BSRA 4I13B 4UUJB 3ULVE 3QCTL 1JJUA 5HHVL 3C2AL 5HGDB 3KPPA 4LPUA 4LFHG 4LSPH 4PJGA 1NAMH 2IF7A 1RURH 1WZKA 3CC5B 1WZ1L 3U7YL 1T6VN 3FAXA 5TDNB 4IMKC 3VFTB 3EOYG 2X6MA 5F7DB 1B3JA 3VH8G 2A1WH 4TNWF 5EZJA 5FDWB 5IESH 1RZ7L 5KSBF 5JPNB 3EOAA 3T2PA 1BZ9B 1J0IA 1EEYB 25C8L 3QUZA 2FECL 5LCVH 3RWJB 1UZ8B 3PP4H 1NKOA 1WV7T 1D5IH 2VXUH 2VAJA 5CP3A 5HHME 3RWGA 4ORGB 5KZCB 1U6AL 1A22B 2FSEB 1JWUA 1LDPL 1KG0B 1MY5A 4JM2A 4WU7B 4WIQA 2KBGA 2D0FA 3CFDB 3STBA 5C7XH 3S7GA 1NBVH 1IAKB 1KUMA 3ZT5A 1JTPA 5FGCE 2XICA 4YHMH 4WU5A 3MNVA 5GJTH 3VCLA 3L3KB 4XP5L 1QEWB 1G9ML 5C9KA 2BVUA 4TVPH 1KTLA 2VDRL 1TTGA 4YXKH 3UYRL 3CDGA 2ZOKB 3QO0B 4RWHA 4XI5D 2F54A 1YUHA 3VFVA 4FQ2H 5J1TC 3MREB 1FPTH 1NCAH 2DBLH 4CDGC 1MFDH 3NCFB 4MQSB 4PREA 4DGVL 2BSSB 4J2XA 4PV8B 2WBWB 3GHEL 1AI1H 1TNMA 4OZGB 3GUTA 3FT2B 4QXGL 3FB7A 3VXMB 4IM8A 4OFPA 3EDKA 3CXHK 3MLRH 2A83A 5E70A 2F8XC 5HHOA 4DKEH 5GGVY 1ORQB 3BAEL 1OD7A 4PRDB 4XXCA 4YX2H 4PRHB 3JTTA 3RL2B 1CTOA 1LP9F 1TDQA 5IBUG 1RFDL 5CJBA 2YPLA 5D2LB 4XNYH 2N1KA 4KH2A 4EN3B 5J06A 2GK0A 2W1NA 4X6BA 2NNAA 5EN2A 1A7RH 3C60D 4NC0B 4MZ2A 3EBAA 4KRPC 1MVFA 3ABZA 1I7RA 2E7CA 3C09B 4GRLA 2A9MH 3FN3A 4P3DB 2BVOB 1HDMA 3G5YA 5EBWB 4PJ8A 4LSPL 1NAML 3DYMA 1RURL 2IPKB 2ESVD 4LOUD 1UB6A 5GGQH 5EBMB 5KG9A 2VKXA 4V2BA 5E4EC 3MUZ1 3ILQC 2A1WL 2NY6B 2YPLD 4R96A 5IESL 3N1FC 4BZ2H 1QP1A 3LEXB 4L9LA 5DK3A 5MEOA 1MF2L 4D0BB 4GW5A 5IFHH 1YN6B 5LCVL 3TBVA 3G6JB 3I6GA 3VA2C 2FO4B 2EYSA 4L3AA 2VXUL 1VERA 4GRLD 1H15A 1HHIA 5IB3B 4LSQH 1C5DA 4XP4H 3ZE2E 4MJ4A 1JZ2A 4GG6F 4LSSH 2HTKC 1FC1A 1JGUH 4LCWD 3D1MC 3JV5A 1FFOB 5KVEL 2OQJA 5SWSA 2NY1C 1NBVL 1T0MB 5ESVA 3QIUC 2Z4QB 4K7FA 3WIFA 4EKXA 2A2QT 5GJTL 4EI6A 2EEAA 3C8HA 1HYSD 2DMCA 3RVUD 2CDEA 4GLRI 1RSFA 4AEHH 4TVPL 1YEDB 3OAZH 3QDMB 2V2TB 5TDOB 4YXKL 4YDIH 3SJVA 5F9OH 4M03A 3OF6A 5JXAH 1NANH 3B2UD 3O6FA 4FQ2L 3F6LA 1FPTL 1NCAL 2DBLL 1MFDL 3CCHB 4Z77B 4L4TB 1ADQH 2GJ6E 4C55A 3O11B 5C07A 5FO7B 2NX5D 1AI1L 4ZNCD 4OZGE 1KFAH 5I0ZA 1MIMH 1JF6A 4MA3A 2C4XA 3HCVA 3NIGF 5F7YC 3VXME 5JMOC 4H88H 3U9UA 3MLRL 2CIKA 1KB9K 1NCBH 4M6MH 5DRZB 5L2JB 3U7AA 5A2JH 3UJIH 3DI3B 1K8IA 5FKPB 5HJ3A 4YX2L 1CU4H 1JRHI 3ARDC 2AQ3A 4PRHE 5INDB 1CR9H 1KOAA 4PJ7F 1IAOB 4Y1AB 2PO6B 5DJAB 1ZSDA 3BW9B 4XNYL 5D2LE 5C6WH 4HIHA 1NDGA 5D1ZB 3IAPA 4R2GB 5T3ZH 4OUOA 3RWDA 1GJIA 4AENB 1MAMH 1A7RL 5KS9A 5DJCB 4BKLB 2HFFA 1E4KA 4LIQH 4LRIA 4MAYB 3RTQD 4OIIH 4OI8A 2A9ML 4F7CB 3DRTA 1U8JA 2F53A 4JY6A 4L3ED 1U8IB 3SY0B 1T1ZB 3KYMB 1XF2B 3NFPA 4U1IA 4Y16D 3G5ZB 4JO1H 4B53A 4JDZB 3S96A 4WW1A 5BJTB 1A1NB 1KIQB 2R2HB 4ZPTB 1OF2B 4XVUD 1H0DB 5GGQL 1VFUA 3ZZ1A 2VE6A 4DN4H 1BBJB 3QDJB 4K71B 5EU5A 3LD8C 4EUPH 1R3HA 4JPKH 1U2HA 1TZHB 3N1MC 5IFAH 1A21A 4NKIH 2P24A 5D5MA 1F97A 2OM5A 4PFEA 3SDDA 4BZ2L 1DSFH 5FM4A 2FIKA 5F97E 2ZP0T 5IFHL 4RBPH 3CDFA 1FO0H 3IETB 2P8LB 4ODHH 5JIIA 3G6JE 4OD2B 4OLYH 3ECBB 2DBJA 3QQ3A 1CDBA 4MDJA 5BXFB 2VLKD 1U95B 4X9BA 4LSQL 5J6HB 4HKBB 3UJJH 1WGOA 4XP4L 3LPGA 2N7AA 4FZ8H 1Q1JL 1AHWA 1X7QB 4LSSL 5IW1B 1CFQB 4RAVB 1U8LB 3VJ6A 4YFLF 3QQ9D 1JGUL 1CE6B 4Z95H 4GAGH 5AWNH 1FVEB 5HHPB 3VRIB 2DAVA 2PETA 3W9EB 4CL7A 3EIFA 3R8BB 5JTWA 3BMWA 1J12A 4UTBH 4LHUA 4AEHL 1FP5A 1OWRM 3QDME 1DTUA 4YDIL 4LCUA 5ICXA 1FG9C 5F9OL 1EDQA 3VFOA 2X42A 2APXA 5JXAL 1BIHA 2A6IB 2D4DA 4QRSB 3VXUB 1NBQA 5BCAA 3V6FB 2V5SA 4CVZB 2JCCB 4ZUSA 3CZFB 3VGDA 4PJ7E 1NC4D 1ADQL 4L4TE 4JFHE 1V3LA 4NCC1 1IM3B 1KFAL 1MIML 3DX7B 1IGJB 5I1CH 4HUXB 4H88L 3FT3A 4QRTA 3QH3B 3WN5B 3OKYA 3MRJA 2X7LA 2DMKA 1NCBL 4M6ML 3DVGB 4I18A 4NRXB 3UJIL 1TVDA 3IKKA 3VD3A 5ITFA 4JRXB 1CU4L 1CR9L 4Y1AE 5IHLB 1IAII 5IGXH 3FOLB 5JDSB 5IVXB 3QRFM 2Z8RA 4HUUB 3EYSH 4KQ4H 1X4YA 5T3ZL 1ZT7B 1MAML 4JAMB 2ITDA 4RIRA 4Y19A 5D2NC 4UNTA 3W5NA 2AXGB 2A6KB 2HFTA 4LIQL 2R2BA 3ARVA 4OIIL 3LVEA 3L3OB 2HKFH 3ILPA 1A7QH 2EICA 4FQCH 2WMPA 1CDCA 4XNQA 1OARH 1TQCC 4JO1L 2PW1A 2A38A 2FZ3B 3CX2A 2ATKA 4LLDA 3U1SH 1HXYB 1AGEA 2IJ0C 3OXRB 3MV9B 4DN4L 4XBGB 3O8XA 1P7QA 3PF2A 4PLOB 5IMLA 2W59A 4JPKL 4JHZA 4PG9A 1FZOB 2E6QA 5CBAB 4R8WH 5IFAL 3TGXA 4NKIL 1CFTB 1NFIA 1DSFL 1CL7I 2AV7A 3RX7A 2ZUQB 1FO0L 4OJFH 4UT9H 4Y19D 4ODHL 3U48A 4OLYL 1T0NA 3MNWA 3DUUB 1QBAA 3TF7C 4PJEA 4XCNA 3UJJL 1CI5A 1HHJB 2X1PA 2CXGA 1X5XA 2EIDA 5HDOA 4EBQH 3O4OC 4WCYH 3X13B 3M45A 4HJJL 3S36X 4GAGL 4LLMA 5AWNL 3O9WD 4U1KB 3CMGA 3O8XD 1KXTB 1QBMH 1TNNA 2HH0H 4RGNC 3BEWA 4XHJD 1J18A 1NEUA 5F9DC 1CD1A 4UTBL 3BJLA 3WMSA 3U79A 3GMMB 3HZKA 2QQQA 2HFEA 2PYFB 3CXDH 2AAVA 5BZWB 5GPRA 4CAGA 2A74A 1SMOA 1KIPB 4YBHA 3VXUE 2R1YB 1YEKH 2JCCE 4LSVH 3MJ8B 4K9EC 5JA9A 1OB1B 1WT5A 1VFOA 4Q6IC 3KXFA 4GXVH 1EPFA 3AS1A 1CD0A 1O0VA 5E6IA 1L9MA 3MOBH 4HJ0D 5IMOA 1XGTA 1NUFA 2NTSP 3RI5F 1JYXA 5AD0B 4JN2B 3PL6B 3ARGD 4PTTB 3O2WH 4JRXE 1Q9KB 4MS8D 5IEHB 2ZUUA 2IADA 5DUBB 2XWTB 1A1OB 5IGXL 4QRRB 1S7WA 4PJDA 3UPAA 5IVXE 5IEKA 3GM0A 3EYSL 3E6FA 4KQ4L 2FNBA 2CH8A 2BY3A 4LCCB 4WW2C 5D7LB 1DBBH 4MD0A 2WWKT 4QHNA 1WJ3A 4PV9A 4YBLC 1B88A 3L5WA 3WLBB 5D1XB 2V5YA 2GFBB 2HKFL 1A7QL 3BWUC 3MMEA 4FQCL 1VFAA 4H1LG 4KI1A 3QG6A 4JHAH 5D96C 2UUDH 3KLHD 1OARL 1Q0YH 3U1SL 5ID1A 4P5KB 1JHKH 4R4NC 1EHAA 3KYAA 4I2XA 1QR1B 3N1GC 5K9JH 2XY2A 3CH1A 3OB8A 3MRBB 4FXGB 2JF1A 4R8WL 3DRQB 1BLNB 2DLFH 1LNUB 1GIGH 3GSWB 4MMXC 5IBTH 4L8SB 4PRNA 1NFDB 1IGYB 3UTSD 4FTVA 3QUZC 2NXYD 4JQXA 4QLRA 4UT9L 4OJFL 4OI7A 2AJYH 3SPVA 4PJCA 1J0JA 1LD9B 1FYTA 1G6RA 4JM2C 4NUJB 4KPHH 4PJIA 4KK6D 4EBQL 4HKZA 4WCYL 5D9SA 1HEZB 5FYJH 2QQKH 3C6LD 3EFFB 5IVZA 1QBML 1R5VA 2HH0L 4O2CA 5TQ2H 4YZFF 5FGSA 2X4TB 1MJ8L 2NY2C 1NEZA 4HLJA 3PWLB 1PEWA 1K4DA 3IKCB 3TN0B 3CXDL 2X89D 2EYTB 1OAXH 1A7BA 3ZKQD 4D0DB 2XG5A 5T33H 3KNBB 2Z9TA 4HGWB 3VFMB 1YEKL 1EZVY 4LSVL 3EHBD 1FYTD 4K2UH 1TCRB 2A6JB 3VWJB 5M94B 1U8NB 4XAWH 3IGAB 1L0XA 1H9VA 4GXVL 1BP3B 3P9LB 3VU2A 2XPGA 1SHMA 3MOBL 4LASH 1QYGH 2GI7A 3MZGB 4P5TB 3RKDC 2JIXA 1TJIH 3DV6B 2WP3T 3FO1A 2FEDD 3DOSA 3O2WL 4BFIB 4XXCC 3GEWB 5K9QI 2W92A 3PJSA 4MB4A 4DTGL 4QRRE 3U9PH 5IBLD 1M7DA 3HR5A 1CK0H 1XF5A 4PJ5B 3I3EA 3I75A 4PGCA 3TA3B 3DUSB 1QSED 3VFRA 1DBBL 4L4VB 4PLKD 3QWOB 5D7LE 2FHBA 1V7NH 3C8KB 4ZDHB 3REWA 4M61B 3BP4B 4GRLC 5JOPE 1XF4B 4ODSH 1BF2A 4FQJH 1RJCA 4I0CC 4P2YA 3D18A 4XBPB 2NW3A 3T1FA 3NGBC 4W4OA 4PJ8C 1JUFB 2NXZB 5C08B 3BD4A 3BWAB 3BQUB 1H5BB 3CDCA 1Q0YL 2BY1A 5DQDH 5EFIA 4GRWB 5K9JL 3CD4A 1MRFH 5TJWK 1QR4A 3CJJA 3DLQR 4WI4A 4HV8A 2DLFL 1GIGL 3F7YA 5IBTL 2YRLA 2Z8VC 1MHEB 4JKLA 4L9LC 4F3FA 1NFDE 2XTJC 2PYED 5I1LA 2AJYL 3B2UC 4OZFA 1U58A 2NW2A 5DK0B 4WFGD 4KROB 5T1LA 4DUVA 4OFIA 5B38B 1IQDA 2IALA 4E42A 3FHAA 2DM4A 4KPHL 3N1PC 3D25B 2MHAB 4M00A 3V6OE 1BBDH 1I8IB 1KGCE 5FYJL 2OTUA 2QQKL 1HNFA 5GZOD 5FGRA 2CLRA 4K55A 4Q7DA 4J1UA 3PDOA 1CVRA 1JWMB 5JA8B 3GSXB 2D3VA 5TQ2L 1CIUA 4JPVH 1UH2A 2YEZA 4B7LA 4IDLA 3T0AA 2W60B 2AK4B 5EZIH 3SGDH 5EPMA 2FBJL 2I9LA 1OAXL 3J7HA 1EVUA 4X7CC 3NCCB 1IRAY 5SWZA 2QADC 4NQDA 4OCMC 5E8EB 3O6FC 3QIWD 3QEQA 5T33L 3RIFF 3MV7D 1ZK9A 2H26B 4ZQKB 4GW4A 1EFXB 1LVEA 3QI9D 4G6FB 4OTXH 1NPUA 1INDH 2BNRD 5DVOA 4K2UL 1X6LA 4XAWL 4OF5A 4V1DB 2UWEB 5DGRA 5H35B 4HZLB 4LASL 1QYGL 4XT1C 3HZVB 5F9AC 1TPXB 2IC2A 2ICEA 1TJIL 3GJEB 5J1AB 3FRPG 1BWWA 4Z7WB 1PKOA 3IXAB 4NKQB 5IB2A 1AXIB 3AU1B 1AFVH 4IEFB 4NO2A 5E5MB 3RGVB 3OKMB 1S7SB 3U9PL 3HRZB 4I0PB 3P77A 2NLJB 1CK0L 4G9FA 3T0ED 5ENWB 3UPCA 5GS0H 5MERA 5LXGH 1VB9A 4JLRB 2CDFB 1RZFH 4L4VE 4X8XA 3TIEA 1V7NL 5CIPA 5DEGA 1E4KC 3UZVB 4HFWB 4LRIC 1Z0NA 5SX4H 1RULH 3GM8A 4ODSL 5DC4B 2C9AA 4FQJL 3BVNA 4LF3B 2X9WA 4D8PB 2WNGA 4JREB 5C0NC 4D9RD 3V2AR 2MJWA 2ICES 5C08E 1RK0A 5MEQA 1S5IH 5JMRA 3LEVL 5DQDL 2PKDA 3TO2B 4KDVA 4XB8A 4GRWE 1BQSA 1BOYA 3ARUA 2MQCA 4GKSB 4DZBA 4K07A 4RRPA 4KDWA 3PGDB 1XGYH 4NM8H 3SDDC 4G9FD 3RZWA 2QR0A 1YEIH 4BQ6A 1GH7A 2ID5A 4Z7VF 4WI8A 4D3CH 3WL9B 5ALCH 3LY6A 5IF0A 1LE5A 5EA0H 1JPFA 1YNTA 2QLVB 2H32H 2JK5B 4JRYD 5T5NG 5DK2B 2WQRA 1AHWC 3IDIB 1V3JA 4R7DA 4P9MH 1C12A 1BBDL 4OAWB 2Y7QA 1NMCB 5DC9B 4D9QE 2B1HH 1MJ7H 3GMOB 5BVPL 3HE7B 1FHGA 3EYFA 5B39B 5FV1L 5J1SC 4JPVL 3RBGA 3JTSA 2CR6A 5EZIL 3ZSSA 1MCCA 3GMQA 2E9WA 2ADJB 4KVNH 5HYQB 2LVCA 1T1YB 3NPZB 4OTXL 2OXGA 1INQB 3S9DB 1INDL 4M93B 1A14H 2FJHB 2C7UB 1AIFB 1LEKB 2YA2A 4HWBA 4V1DE 4XAKD 4UB0H 1A02N 1QFHA 1YMHB 2UWEE 1W8OA 3MRGA 4WFHE 5DQJA 3SDAA 1UXSA 4FQPA 4IIQB 4FFVC 5HY9B 4RWYH 2MQ0A 4I18C 4OF6A 4IRJB 4ZUUB 2EDTA 3HZYA 4FNLH 1QSZA 4RMUA 4QRUB 1J9CT 1AFVL 2GT9B 5DJ2A 1PQZA 4DQOH 2R1WA 4HBQA 1HYRC 4GSDH 5DLMH 5GS0L 5LXGL 2V7HA 1OP3K 4NQVB 2YC1B 3RUGA 2VLMD 1HILA 3GMPA 1RZFL 3ZYJA 4JGJA 1RULL 4LSUH 2DD8H 5E9DB 5DRXA 3SDAD 3QAZC 3CX5J 4NQXA 1I3VA 3KPRB 4XZUA 2QV2A 3VXSB 3G5VA 4MB5A 1S5IL 2NYYC 2WIIB 2VQ1B 3WUZA 3VE0B 4GAYB 4WI9A 2OLDA 1MJUH 1T7YA 4LVHB 3F8UB 3H9YA 3FRUA 1X5JA 4TQEH 1Q9WB 1XGYL 4NM8L 4NYLB 3ZE0F 4EVNA 1YEIL 3TVMD 1BGXH 2XZAH 1DDHB 5MI0C 3T0XA 4LKXA 1FZMB 4P3CH 2F9BT 4D3CL 5C0DB 3HHRB 3UTZB 5EA0L 2C3XA 1XH3A 1MCNA 1XGPA 1SM3H 2VAAA 4HUNB 2P4AB 3CMOH 4N0CD 3L3GA 4OCXH 1X6NA 4P9ML 4PY7A 3HTLX 3WHE0 2B1HL 4F7TA 2HLFD 3C9NB 1MJ7L 1CWVA 3LKNB 1A9EA 4HJ0C 4MZ3A 4YO0B 1U3HB 3P4MA 1DN0A 3BP7A 4NCDA 5DHYB 1S78D 3B5GA 1Z2KA 4MS8C 5I6XC 3PHQB 3CNKA 1OLLA 2O5YH 1ACZA 2GEEA 1T5XA 1NGZA 4KVNL 4ZODA 5C0IA 3LS5H 4WV1A 4JFEB 4HMDA 2H45A 1ZANH 3GSOA 1KLUA 5ETUB 3K2UH 4PJAB 3MUGA 2IBZY 1WT5C 1HSAB 2WAHA 3ARYA 5SV4A 2C3GA 4ZFZB 4JO3H 2AJVH 2IMNA 4NKMB 4UB0L 4JZNB 4MWFA 1OGTB 1R3KB 2HT4D 2J6EA 3BX7C 4BQCA 4P2RB 3CSBA 5E6IC 5I2IB 2VXTH 4NHCH 4RWYL 2O61B 3BISA 3LPFA 1QTYT 1V8HA 2YUXA 3Q5TA 1FNGB 4XH2B 3LB6C 4FNLL 4Y8DC 4A6YA 4CVXB 2GSIB 5FYJU 3OR6B 1ZLUK 3U36B 3IJHA 4DQOL 2Z93B 1BEYH 4YHYC 5HYIA 1FH5H 1IC4H 4H8WC 4GSDL 5DLML 1BJMA 4X7TA 4LLVA 1I8MB 3AVEA 1SBBA 3KYNB 4LLAA 1J11A 4HJGA 3IDJB 4YIQB 1FN4B 4LSUL 2DD8L 5I8KH 5EU6B 3E3QC 1ZHBA 5E9DE 2DICA 4NQUA 5TGBB 3LDBC 3L7EB 3BIKB 4QRPA 5KSAD 5E1AA 3KPRE 2P8PB 3VXSE 4JY4A 5EIIA 2IAMD 5HYSA 3LCYA 4GUPA 5KSVB 2BHUA 1MJUL 5D7JA 2Y07H 2C1PB 5DJDA 4TQEL 2CKBH 4MXQC 5EIVA 3SE9H 2BXZA 1MJJA 1KSRA 2VZOA 2APBA 1BGXL 2XZAL 1RUAH 1X5HA 4JQXC 5IB4B 3ES6A 1R5IA 1JPGA 3DSFH 2X4RB 3AXLA 4P3CL 1GOHA 3HC4H 4JFQA 1PEZA 2DLGA 2KQNA 2VUOA 4O2EA 5HGBB 4BH7A 3PABB 2Q86B 1SM3L 4QRPD 3KPQB 3CMOL 3EYQC 4F2MB 2EDFA 4OCXL 1XF3B 3T4AA 1BJ8A 1JTTA 2CMRH 4FQXA 4HIJA 2X1WL 1H3VA 4C4KT 5FCUH 1KT2A 1PY4A 3L5XH 3I6LD 4JG1H 3GJFH 4P5MB 5D7JD 1UM6H 2R0WH 3DYOA 1NBYB 4XXDA 1F6AB 3BN3B 1CT8A 3PXJA 2DM3A 3O81A 2FBOJ 4MQTB 4L3CB 1RZGB 5DURD 2O5YL 4TUOA 3KJ4C 4AJ0A 5BW7A 1WFNA 1FJ1A 3LS5L 5F3BB 4JFEE 4OQTH 1ZANL 1S9VA 1LILA 1Z9LA 1J10A 5D6CB 3K2UL 2BVYA 3EZJB 3PWVB 1R3LA 4X99A 4NDMA 4UINH 3ARZA 2XY1A 4JO3L 2AJVL 4LHJB 3PWNB 5CSBA 4UOW1 3DURB 4XVTH 1IAIM 2VXTL 5CZXD 2Q7YB 4NHCL 5I15H 2X4PA 4LCYA 4HS3A 5EO1A 5E8PA 2AXHA 1G0YR 4X6FB 2ICWA 4JCLA 4BH8A 2FYYB 4M8VA 3RY6A 1AR2A 3REVA 5HYEA 1BEYL 5FA3A 1FH5L 4IS6B 1IC4L 4F80A 1UH3A 3MRFA 1O7SA 3ZT6A 4PGDA 1CFBA 5E6ZA 4M1DH 2IBZX 1I4FA 2DN7A 3QT2A 5I8KL 5E08H 5EU6E 4O4YH 1SYSA 4M5ZH 2B5IC 2G5BA 4W4OC 2BP3A 3KDMB 3I6KA 2GW5A 1MVUB 4XX1E 4M1CD 2GUOB 5CSZB 1HOCA 3TWCH 1BD2D 4J8RA 5T1MA 3D3VB 1V7MH 5BVJB 2W0KA 2Y07L 3MGTB 3K8MA 4N8VG 4RAHA 3KLAB 4LPTA 2CKBL 3SE9L 2GITA 2HLAA 1AE6H 1FORH 1H3GA 1RUAL 2F15A 3QWQB 4NGHH 1FQ9C 4RFNB 1K3IA 2OYPA 2BOCB 1XR8B 3QUKB 5E8OB 3DSFL 4HQQH 3FTGA 4GKZA 3FONB 5F9WC 3HC4L 1PG7X 4QXTA 3P11H 4PJHF 1MHCA 4E41D 3UPRB 1W8NA 1CFNA 4MNGB 2APVA 5FK9B 4XPGH 5IG7A 3B3IA 2CMRL 1MCKA 3FQXB 5FCUL 2V7NA 5DTFB 3L5XL 5KN5B 4JG1L 4ZS6D 1OSZA 1UJ3B 3RZCD 1UM6L 2R0WL 1B6DA 3F12B 3KLDA 3JUZA 2BOBB 1ZTXH 4K23H 2VLRB 1MCRA 4OLWH 2WWMD 3DV4A 1OAZH 4OKVA 3ULVD 5F8RC 4QY8A 1WBZA 5DYOA 4OQTL 2PCPB 5IBUB 1X3DA 4L8BB 4QXWA 5IQ7H 3R06A 3VXQA 1ZHNA 3EDJA 4UINL 5IV2B 2DQCH 4PRPB 1P1ZB 3O41A 4WHYG 4XVTL 5F1IA 3H42H 3S4SA 5I15L 3PGCB 1IAMA 1JF1A 1NCDH 1BX2A 3QUMA 3MCKB 3ZHDA 2X1OA 4FZEH 1ROWA 2A73B 5HHMD 2DYPA 1D6VH 3MCLH 5C0GB 3LRSA 4ENED 1N0XH 5GGUA 4X5WB 2W91A 3N06B 3DXAB 5DSCB 3HC0B 2OP4H 5F3HA 2Z31B 4M1DL 1UWGH 2APWA 5F9JA 1N59B 5E08L 4O4YL 4M5ZL 4XGZB 2W65A 5HI4D 5HVFB 1YQ2A 3LKPA 1G7JA 1R3JA 5F96H 4KK9C 1QRNA 1ZKAA 3TWCL 1YPZF 1V7ML 4ONHB 3KLSA 1HH9A 2DYPD 2ZSWB 4HK0A 4ZUWA 3ROLB 1ND0B 5DZLA 1AE6L 4UUJA 5KSBA 5ICYA 5JQHC 1FORL 4NGHL 3HPLA 1OGAA 1XMWA 3DTXA 4HQQL 4WEUD 3QIBB 4YAQA 4LPYA 3CC5A 1K9TA 3P11L 4RA3A 4AIOA 5TDNA 4P46A 1KB5A 2VABB 4MNGE 3VFTA 4XPGL 5F7DA 4N5UA 4L9DA 3O3UN 5BMFH 4NBYB 3DYPA 1NUGA 3LIZH 3GB7B 1KLGA 1TETH 4Y2DB 2DTMH 4HAFA 1BZ9A 1ZTXL 3FQRB 4K23L 2VLRE 1UZ8A 3EYVB 4M5YH 4OLWL 3JVGA 1WISA 3UZEA 1AD9A 1CQKA 1U8MB 3QHTC 4TN9A 1MAJA 3EJZC 4LVOC 3PWUB 1UQSA 5TDPB 4ORGA 5C0CA 5DA0B 3IT8D 3NFNA 4O00A 1TQBB 2MPAH 4NQCA 1KG0A 4MCYB 1Z0MA 5A16A 5CAYB 4CU6A 4P99A 3CFDA 5IQ7L 2NY0C 3WHE1 1T04B 3W39A 2BSTA 3Q5YA 2DQCL 2YKLH 4WO4B 4PRPE 4BFGA 1PG7W 3SDAC 2NY4B 4K8RC 2AJUH 1S5HB 3L3IB 2I60H 1NCDL 2EDXA 1P53A 1XF1A 4FZEL 5DO2C 1ZA3B 5EOCJ 1FL5A 1D6VL 5B8CC 3MCLL 4N0RA 4OBRA 5KZCD 2GJ6A 4O9HH 5F1OB 2AQ1A 2D31B 4NKDB 4UT6H 1N0XL 3GMRB 5JPMB 5E03A 5C6TH 5FOBB 2PXYB 2XXMB 3DXAE 3VXMA 2OP4L 1A4JB 1UWGL 1A7OH 4FXKB 4AM0B 2ZG2A 3SGJA 1OAQH 5TFSH 1ORQA 4HX1B 1ITBB 2CO6B 3B5HA 2V17H 1S7VA 4PRHA 1D9KA 3BN9C 5F96L 2Y6SC 5GXBB 4OM1H 1HI6B 1IE5A 1F3JA 5DVLA 4ELMB 3BPNC 2QSTA 3RVVD 3TFKC 3V8OA 4POYA 4JZJA 5EU7E 5FUCC 2EXWC 1C5BH 4Z7QE 3IVKA 4UTAH 4I3SH 3SDCB 4Q6YA 4Z0BH 3QUYA 1VEMA 1JYWA 4OV5A 1JMZA 1GZQA 2CK0L 2BVOA 3CFKB 3PXHA 3VXMD 4JFXB 4Q9CA 5J8OA 4UDUA 3WXVH 4TTGA 1GPOH 3GMLB 4QF1A 2O26U 5IK3A 4NPYB 2DQIH 3HAEB 3OGCB 3BRGC 1CTNA 1WICA 3L3HA 4OZHB 5EBMA 4GG6A 1IEHA 4PRHD 2V5TA 4OB5H 5GIRA 4CN4A 1SJXA 4FA8A 5BMFL 1EFQA 3RFZC 3LIZL 4P4KB 5DFVD 1TETL 4EN3D 1G7QA 3OG6B 4GW1A 3BHBB 2DTML 1P6AB 3CU7A 3X3GH 2BCKB 1GOFA 1FNEA 4M5YL 3G6JA 3SO3B 3FT4A 3K74B 1RZKH 2PW2A 4F8QA 5C0AB 2MPAL 1MQKH 5BV7C 1ZWIA 4WV1C 2EDBA 3FZUC 4NIKB 4NN7B 4PJGF 2ITCB 1EXUA 1FFOA 3VFWB 4KMTH 3FOMB 1EUTA 3O45B 4HKXB 1PY9A 2R8SH 2YKLL 5FHBH 3GKWH 3T77B 4ETYA 3RNKA 3D39B 1AGBA 2AJUL 2NY6D 4W6YB 3RWCB 2YD6A 3VI3E 3W0WA 2W0LA 2I60L 1AGDB 3S37H 2V2TA 4TSBH 1F11B 5TDOA 3V9FA 3RKPA 4APQA 1JGLH 4CMHB 1ULVA 3BD3A 3WV0A 3V0VB 4G5ZH 3GO1H 5IOPA 1CVSC 4PJ7A 4G8EB 4L4TA 4Z77A 4O9HL 4HS6B 3UZQA 3O11A 4OZIF 4UT6L 1XCQB 1U8HB 2CUMA 3GSQB 4U3HA 5C6TL 3F5WA 1T4KA 2M1KA 3RDTA 1ZVSA 1KTDA 5D8JH 1A7OL 4P9HH 3BH8B 4RFEB 4Q2ZB 1OAQL 4DVBB 4WWID 3BESR 5TFSL 4ZFFB 2EXYD 2XT1B 4DW2H 4D94A 4MXWH 4F33A 2V17L 3QDMD 3G6DL 4XVSH 4S1RL 3ZDZF 3HUJB 3AUVA 4Z76B 4OM1L 4LU5H 3OHXB 1RU9H 3U0PB 2WV3A 4QTIH 4P23B 5HDLA 6FABH 4AENA 4L4TD 1C5BL 1EO8H 1LMKA 5E2JA 4S2SA 5DJCA 4I3SL 4BKLA 4Z0BL 3Q48A 3BYTA 1FGNH 3BXNA 4AQOA 1HQRB 1U8IA 3QEUA 1RJLB 3SY0A 1T1ZA 3VXOA 4KMQA 3KYMA 3WXVL 4QHKI 4LSTH 4PJFB 1JHTB 1J1PH 1NCWL 2DQIL 1KIQA 1E6OH 2W9EH 4ZPTA 1OF2A 1H0DA 2ZSVB 3JZ7A 2VITB 4ISVB 3VRLF 4CVWA 1RK1A 4Y1AD 4OB5L 4FQXC 1CGXA 2PO6D 4FQQA 4G8IB 1KN2H 1TZHA 4MNHB 5C0FB 5IKCB 1UGNA 2FHCA 1GAFH 4MVBC 1AC0A 3VFSA 3THMH 4QHMA 1DQDH 5D1ZD 4R2GD 2EZ0D 3AB0B 3X3GL 3KS0H 2R2CA 5SWQA 3DIFA 2NY3C 3WHXB 4JFFA 3RQ3A 4MAYD 4HT1H 1RZKL 3P9MB 4TTDD 1U95A 5C0AE 5J6HA 2F5BH 4Y4HB 5BW7C 1MQKL 4AEFA 2AJ3B 1RUMH 1CFQA 1U8LA 3MLWH 2H2SC 4OM0H 2RR3A 3MRIA 1UKSA 4W68A 1BVKB 4KMTL 1FSKC 3ELAT 3QO1B 1FYHB 3BJ91 2R8SL 2I27N 5FHBL 4OZIE 3QDJD 4Z7UB 3GKWL 5DI8A 3LQAH 3W9EA 3D39E 4HS8H 5ADPH 1FVCA 3RJDA 4KI5C 2NTFA 4H1LB 3S37L 4TSBL 2CLVA 4P4RB 1SEBA 2EDDA 5I18H 2HMID 1JGLL 4DOHB 5DJ0B 2M2DA 4KTDL 4G5ZL 3GO1L 3V6FA 1KULA 2JCCA 1FCCA 3RY6C 1FFNB 2ZPKL 3IJYB 4PJXB 2LU4A 5JIHA 1X5IA 1IM3A 1P4LB 4X6CB 1CG9B 7CGTA 3OKKB 3DX7A 1IGJA 1P5UA 3BD5A 4U4BA 4YXHH 4NQSA 3S3PA 1FVDB 4LLUB 1KTRL 3L5HA 1XIWB 4HUXA 3KPSA 3WN5A 4P9HL 3MV8B 1FNSH 3D0VA 2HTLC 1IZJA 4DW2L 1OVZA 3U2SB 3JV4B 4JRXA 4MXWL 1AP2A 4XVSL 2DTSA 3HUJE 4LU5L 2GCYB 5D7IB 1RU9L 2DM7A 5JDSA 3B9AA 3VXUD 4QTIL 4X6CF 2GTWA 4G6JL 4NQTA 6FABL 1D3CA 1Y6NR 1VACB 4OCSL 3OAYH 1B6UA 2D7QA 4JAMA 1EO8L 3L3DB 1W72H 2BJMH 3C6SB 2CK2A 4JANA 3O3AB 2Z92B 1FGNL 3OKLB 4G8FB 3CUPA 3DWTA 3S88H 1QFWI 1GVIA 3K46A 32C2B 3RWHA 2DQFB 4MX7B 4LBEB 4LSTL 3P2TA 5J3HD 4PJFE 2GAZB 2VTFA 1J1PL 1ETZB 3ZYOA 1HXYA 2W9EL 1E6OL 3OXRA 5CEZE 4PJBF 4XBGA 5F6IB 4PJ9A 4JRXD 4Y0GA 1B0GB 1KV3A 4U1GB 1ES0A 5F88A 1FZOA 1I3GH 1PZ5B 1KN2L 2VZ1A 5IFJB 5CBAA 4ZOAA 5E7FA 1GAFL 2WP3O 3BKMH 3THML 5EUOB 3K1KC 3EGSB 4M7LT 4H8WH 4XRCA 1T21B 5CGYD 1E4XH 3QB7C 5HVHC 3BZ4B 4HT1L 3UBXA 4S1SH 1NSNH 4MYWB 2F5BL 3TBYB 3T09A 4ZYKA 2YBRB 4LHUG 1RUML 4ODXA 3MLWL 2XQYG 3IFPA 4EJ1C 4PRAB 4OM0L 5FECB 1ONQB 3X13A 4ESKA 1S7TA 1IBGH 1NJ9B 3MV9D 3KPMA 2H2PC 4U1KA 3L1OH 2NX5E 4Z7UE 3LQAL 3B83A 3E2HB 4V2CB 4HS8L 5ADPL 3JUYA 1AO7B 4BSWB 3MGAA 4YHZH 4R3SA 5I18L 4YHIA 5GS1A 3WKNA 1DN2A 4DOHE 1TTFA 1KIPA 4JFOB 2R1YA 4K7PX 1B0WA 2JKXA 1E28B 3F7PC 4NO3A 2AEPH 1OB1A 3QFDA 1TZIB 4NO0A 4XWGH 1OCWH 4X6CE 1MUJB 1U92B 2AI0L 4YXHL 1P7KA 5IQ9B 3LSOB 2YHGA 5KANG 5CMAB 5E94A 3MV8E 4OCWH 4JN2A 3PL6A 1FNSL 1C7TA 2VZSA 1OP5H 3FO9A 5IEHA 2GQHA 3ESVF 5J12B 2CIIB 5DUBA 1T5WA 2XWTA 2G9HB 5D7IE 1FE8H 4JDVB 4O2FB 4EUPA 4HW6A 2R23B 4XC3H 3UC0H 4LCCA 5D7LA 1QZ1A 2F19H 3RX5A 4M8QB 1W72L 2BJML 1WFOA 3WLBA 5DD0H 4Y5YA 3MRDB 2ADFH 1FO0A 2FEEI 3S88L 2N4IA 3EOBA 5EO0A 3DSNA 3WFCH 3PL6D 1O7VA 3VXPB 4C56B 4XTRC 4P46C 1JPTH 4WI6A 1CICB 5L88H 3IJSB 1I3GL 4YDJB 1NMBH 5BOPA 4QRRD 1I1AB 3TZVB 1EO5A 1LNUA 4RFOH 4NFDA 3TYGL 2YD7A 4L8SA 4MDIA 3BKML 4UQ3B 4GAJH 5E2WH 1CGUA 1BVLA 1P7HL 2WBJA 4H8WL 1OTTC 5D7LD 3WNLA 1YJDC 1UWXK 1E4XL 3SGEH 1CQYA 4HK3J 5CD5D 5D1XD 4YXLH 4S1SL 4J4PD 1NSNL 5EU3A 3IU3B 4UILH 5MENB 2Y25A 3RPIB 4BK5A 2E6PA 1W0WB 3V6OA 5MHSE 3OB0K 5M7QA 3D0LA 4H5SA 2H8PB 1MI5B 4OCYH 1IBGL 4HUKB 3HC3L 3EFFA 3SCMA 3L1OL 3BP6B 4J3WA 4IRZH 1Q72H 5CJXA 5I8CB 1FG2B 1AO7E 4EDXB 1RUQH 1DVFB 2QHRH 1N2RB 2VDLH 4U1SA 5GGSY 4YHZL 3IKCA 2R1XB 4I9WD 4X9FA 3MBEB 4M1GH 3IFOA 5J13C 4Z6AT 4D0DA 1KJVA 1NDMA 3KNBA 4HGWA 1NCNA 3VFMA 3ULUE 2DWDB 3X11B 4OZFH 4YBQC 2AEPL 3WO4B 4XWGL 1D5XA 4MD4B 4DJMA 4B41A 3C8DA 1OCWL 1TCRA 1U8NA 1G6RL 3IGAA 2GJJA 1CGWA 5AAMA 9CGTA 4HHAB 3MLVH 3PWPB 4JO4H 3LOWA 3P9LA 4KAQH 4YDLB 4FG6C 4ODUB 1AGCB 4P5TA 3SGJC 4OCWL 5B22A 3UAJD 2R0LL 4BFIA 4IMLB 1D9KC 3TN0D 1F4HA 4X98B 3AREA 2HVKB 1FE8L 2B7DT 5DFVC 3BDBA 4JZJC 4OBSA 1ZLWH 3HNVH 2P7TB 4XC3L 3UC0L 3DUSA 3DECA 2QJDA 2F19L 4L4VA 3OKNB 2X44D 4WI2A 4JJHA 2J12B 5I1IH 4FQHA 4M61A 3QUYC 5DD0L 4F9LA 3VWJD 2ADFL 4MSWA 3HLAA 4PGBB 4AH2B 1JUFA 5DD6B 4WWKB 4XNMB 5C08A 3QA3B 4P5TD 3BQUA 1H5BA 3WFCL 4U6TA 4C56E 1JPTL 1KIUA 4JG0H 1UZ6F 4X9GA 5L88L 4GKNB 1NMBL 3NVQA 5EBLB 4UV7H 4RFOL 2AKRA 4KDTA 4I3RH 1MHEA 2UZIH 4PJ5D 5E2WL 1MCPH 1GGBH 3TA3D 2C4FT 3IS1X 5HHNB 4KK5C 4L4VD 4Y5XB 3BO8B 3ZLQC 5IIEA 4YXLL 1QKZH 5CIPH 2OJZH 3RA7H 3TIDA 4UILL 4NN5C 4WUKH 1NEZG 3CU1A 1C16B 5GSVB 3R1GH 2NXZD 5C08D 5MENE 1FZJB 3BQUD 1MWAH 4Y4KB 5K9OB 2HJFA 4XMKL 3T2OA 4OCYL 1VHPA 3L9RB 1I1RA 1RQ5A 4PTUB 3ZL4H 3GSXA 4IRZL 1Q72L 3A6BH 4XPFH 5FYKD 2EXYC 4HWZB 1DZBA 2EE2A 3FFCB 4JM4H 5C0BA 1RUQL 4FFWD 2QHRL 2VDLL 2N56A 4APQC 1P9MC 3EJYD 4M1GL 4MLIA 1MEXH 5E8EA 2BRRH 5E99H 5A1AA 3WS3B 2WQ8A 4KROD 4ZQKA 4HGKC 1CXFA 1EFXA 3BDXA 1RAMA 3A6OA 2XQBH 1GGIH 4JCMA 1WAAF 3AROA 1A6ZB 4WFFE 4OIBA 4PJIF 2DMBA 3QUXA 4D9QD 4V1DA 4NZTH 4IOFC 2UWEA 1CGSH 3D2UB 4JO4L 4MJ5A 3RDTC 1BFVH 1X5FA 2BSED 4NNXB 4HZLA 1N26A 5CLWA 5GGVH 1JGEB 2DQGH 3I02A 1FNAA 3IFLH 3IAQA 4PLJC 2AK4D 4Z7OE 1VGEH 5E5MA 3RGVA 4TNWK 1U8OB 5I9QB 5TF0A 1ZLSH 4EDWH 5C2UB 2D7NA 4XCFH 1IFHH 1EFXD 3HNVL 4G6FD 1S7RB 5GHWH 3P0GB 1EUUA 1I8KB 3FQNB 2EYRB 2CDFA 3P4OA 1XGQA 3GSVA 3UDWA 5MP6H 3GKZA 1YN7B 4V1DD 5I1GL 4MCZA 1HSBA 4LF3A 4WFHD 2Q87A 1N8ZA 3GIZH 4Y4FB 4HWBH 4M62H 4U0RB 4G9DA 3FB8A 4WI5A 2QBWA 1YEJH 5HYJB 2KZ1B 1MLCA 4N8CH 4YDKH 4UIMB 2WINA 4LVEA 1VKXB 4JG0L 1IZKA 4MNQA 5JZ7C 4GKSA 2A9NH 4G6AD 1OM3H 3CPLA 4WEMB 1RZ8A 3RGVD 4UV7L 15C8H 4I0PD 3KPNB 4I3RL 4NHUB 2UZIL 5DJXB 1MCPL 1GGBL 1X5LA 1BZ7B 1IARB 3SKOB 4DGYH 3N85H 1E27A 2VLJB 3KPOB 2CRZA 1S9YA 3WNNA 2OJZL 3RA7L 1FIGH 5C0EB 4NO5A 4LKCB 4WUKL 1E4JA 5DK2A 3R1GL 5KVMC 5I1AB 4OAWA 1ZLVK 5HGAB 5EIQA 1S3KH 3GMOA 1WAAE 1KNOA 1A3LH 2OSLB 5DEFB 3HE7A 1BQLH 3S6CA 5BOZG 3ZL4L 3A6BL 4WJ5A 4XPFL 4BUHA 3VXTA 4PP2B 5CFHA 2LTQC 1MY7A 4TNVF 4JM4L 3FFCE 1LO5B 4XPBH 5EO9A 3RP1A 1KJMA 1FL6B 3BDYH 4KRPB 1GGUA 2IQAA 3B9KA 2ADJA 1G9EA 1MEXL 5HYQA 1QLRB 2BRRL 4UU9B 5E99L 1PAMA 4E5XB 1AJ7H 2XQBL 3QJFA 1GGIL 2C7UA 1AIFA 5CJ5A 5DMKB 5LBSH 5L0QC 1X5KA 1I1YB 4NZTL 2YSSA 1YMHA 3ALPA 5CEXB 5I73C 4S1QH 1BFVL 3X14B 1HIMH 4HXBH 3HE7D 5GGVL 3T65A 1EHLH 2AABH 2DQGL 4ZUUA 4TOYH 3WFDH 1KN4H 4YQXH 3IFLL 4RGMB 3OSKA 1OSPH 3V5DA 1VGEL 3ZKNC 5B4MC 1RHFA 2AV1B 1ZLSL 4EDWL 4XCFL 3QPQD 1IFHL 1OWWA 3SQOH 5GHWL 2YC1A 3C87A 2KQMA 5MP6L 1IGMH 3TNMB 4B0MM 3QIUB 1I75A 2DQEH 3GIZL 4M6OH 4JFZH 4HWBL 4M62L 4RRPG 1Q8MA 3S36H 3CH8A 2KH2B 4HEME 1YEJL 1KYOK 4IRJD 2L7UA 5HYJE 3HRPA 4GS7C 4GAYA 3TT3H 3E0GA 4YDKL 3N50A 3SKNA 1U3ZA 4PJ9C 3B43A 3QBTB 3DBXA 2VRAA 2A9NL 1RZIA 4KV5E 1JN6B 1OM3L 1Q9WA 4MD5B 1MLBB 4A6YH 1X4ZA 15C8L 2HG5B 1ORSB 4P2QB 1DDHA 4YEFA 1U8KB 3W81A 2GIYA 3QEHB 2ZUYA 1FNFA 4DGYL 1DUZB 3N85L 5DHVB 2VLJE 4H26B 4OFYA 2IANB 3MRKB 5E9DD 1FIGL 4J23A 5LJYH 3KPRD 3VXSD 1A9BB 3HI6H 3MV7E 4ZUVB 1T22A 1FIEA 1S3KL 3H3BC 3LKNA 2QSQA 1A3LL 2BNRE 3F7QA 5BS0A 1BQLL 2BVQB 4I5BB 5DHYA 3ARRA 4XPBL 3IF1A 5A2IH 4YHKH 3BDYL 3HFMH 5GS1C 4GJTB 4CVUA 3PV7A 2BVPB 3CSGA 4OFYD 4U31A 2P5WB 5DD5H 1AJ7L 1NGYB 5ETUA 3NCBB 3VG9C 1BIIB 5DJ6B 1U91A 1WQVT 1SJHB 4DKFH 5LBSL 4TSAH 3T0EE 4RQQB 3VMNA 2BY2A 3LD8B 4S1QL 1J0KA 1HIML 4HXBL 1UCTA 5I2IA 3TO4B 2OX5A 4D0CA 1U3HD 3HI1B 4X4ME 2O61A 2FX9H 1EHLL 2NY7L 3PWJB 2AABL 3CVHB 4TOYL 3WFDL 5IJVA 1KN4L 4YQXL 4AIXA 4WFEE 1FNGA 2NZ9C 2E7LA 2XWJA 1OSPL 2W9DH 4M6NH 4IOIB 1UCBH 4RSVA 5AAWA 2HT2C 2Z93A 5C71A 4JFED 5JNYA 5ESQA 3L3JB 4HIIA 4HUWA 4LCCC 1I8MA 5JOFB 5IB1B 1M05B 1TVBB 4W4NA 1IGML 4Y5YC 4YIQA 1YEGH 2DQEL 4M6OL 3L6FA 5HHQB 2FWOB 4P2RD 3BIKA 3WFHB 3S36L 1CXHA 3TT3L 2GTZB 4X0KB 1EEZB 1LO0H 4Y5VA 2GY5A 2ZOLB 1ZS8B 2C1PA 5FA4B 3UX9B 1B0RB 5TPWH 4PRIB 4A6YL 1DUYB 2RHEA 4L8SC 5E0QA 4I8DA 4LLYB 3CSYA 5E2UH 5F7LB 5KOVC 2WBJC 1BREA 2YOCA 1OOAA 4R7NB 1SBSH 3NMEA 3QXDB 1BJ1H 1F90H 2IANE 2OR9H 5EU6D 4DKAA 5HGBA 4NSKA 2Q86A 3KPQA 3V6OC 1XF3A 3LKSA 3HI6L 5F89B 4X6EA 3RWEB 1Q0XH 3SCMC 1F13A 5H37H 4URTB 5CJXC 4XAKE 3WO3B 1F6AA 2O5ZH 4X6DF 5JW3H 4OLEA 4I4WB 4YHKL 1RZGA 5D2NB 3HFML 2NQCA 4G80B 5EZLB 3VFPB 2V9RA 3ULVH 1G7HB 1Y6MR 3ROOA 1TITA 1I3RA 2OJEB 2EC8A 4OUUB 5DD5L 2P5WE 4KKCD 3BPCB 1G7MA 4ZD3H 4PUBH 4OLVH 5D6CA 4Z8FH 1DQQB 1RHHA 1P2CA 3KWWB 4DKFL 4TSAL 1YEFH 3PWNA 3DURA 1U8QA 3NCMA 4LNRB 4YFEA 4P5TC 5E2TH 2FX9L 5ACZB 3LQZA 4EQ3A 5F44A 4MXVF 4X6FA 3HMXA 1M1SA 5KSAB 3BKJH 2X9YA 1BQHG 5K93A 2W9DL 3AREC 4M6NL 5ISZB 1UCBL 4XCCH 5TH2A 1G1YA 1QFWM 1ZVHA 3LV3B 3TP4A 1YNLH 3T3PF 4IS6A 2ZJSH 1OLZA 1U8PB 5HYSG 5DEZA 5CS7A 4F9LC 1BOGB 3EYUH 1JE6A 4R0LA 1I7UA 3L95B 1JNHA 1YEGL 1B4RA 3DO7A 5GRXG 5CLTA 4BA8A 4RGNB 2NXZC 1FRGH 3MSPA 4CU7A 4QEGA 4MJ6A 1QSFB 3BQUC 1H5BC 3DHJA 4LFHD 5CSZA 4CW1B 5CD3A 1T66C 4Z5RB 3QXAB 3EO0B 1KJ3H 1S9XA 3QFJB 2MTPA 3FB5B 3QUMH 2X4QB 2APFA 2LVEA 1VFBA 5FM8A 3MGTA 3NBNA 4M7LH 3KLAA 5TPWL 4N0FB 3MRCA 4PRIE 3OAZK 4KDTC 1M71A 2IQ9H 5IVOA 3ZDYE 2VDMH 4FFWC 3ARXA 5E2UL 1U3YA 3EJYC 4Q6IB 3T8XB 3NACH 1QVOB 1XR8A 2BOCA 3MCG1 1SBSL 3TBWA 2Y72A 3FONA 4W81A 1F90L 2OR9L 1ZXQA 3FHQA 3UPRA 1FGVH 5DR5H 3ULSB 2MWCA 3FQXA 1LEGB 1F3DJ 3D3VD 1Z9OA 5KN5A 4G8GB 1Q0XL 4GG8A 3LKQB 1RZJH 3RI5K 1HHHA 2OL3B 1Q94B 2O5ZL 4HIXH 5I76B 5EC2B 1NCUA 1F4YH 5JW3L 1EBPA 4Y2OA 3U6RA 1WFUA 4WW2B 3WE6A 4KRMB 2BSRB 5D2NE 3IRPX 4YBLB 5I30H 2MCG1 3ULVL 1IKFH 5E00A 2C5DC 5AZ2H 3KPPB 1M7IB 2PCPA 4L8BA 1ZGLB 1IM9B 1K4CA 4Z8FL 4ZD3L 4PUBL 4OLVL 5D96B 1OTUD 5DVMA 3PV6A 2G60H 1AXSA 3QUXC 3DETD 1YEFL 5HD8D 1KB5H 3F7VA 3NIDE 3HS0A 1MH5A 5CWSB 3V5KA 5EZJB 5DQ9A 4RISH 1ZHKA 3PGCA 5E2TL 4JO2L 1WUNT 1FZKB 3MCKA 2VLRD 3P40A 2YUZA 3QUZB 2AVGA 3BKJL 4GO6B 2A73A 2GJZB 1YJDH 1YMMB 4UDTB 3RGVC 4JKPH 4XCCL 2PF6A 5C0GA 3RWGB 5ISZE 4XCYB 1YPZA 4YJZL 1YNLL 1A8JH 4ONGH 2ZJSL 3U4EA 4RBPK 5DMGD 2CKBA 4X5WA 4JM2B 4NC2B 3U0TB 3ISWA 4FFYH 5H37G 5DSCA 3U0WH 3UDWC 2VZTA 3EYUL 2X05A 4PRPD 4QXUH 1ZA6B 2ADGA 1JK8A 3MLZH 4WU5B 3MNVB 4XGZA 3GIVA 4RGNE 1FRGL 3F7RA 1OAKH 3BZDA 5JW5A 4GMSH 2NY2B 4HFUH 3RVWD 1KTLB 3H9HA 3RWFA 1KJ3L 5I17A 3QFJE 1W0VA 2OMBA 4ZXBA 4QWWC 3QUML 4ONHA 2F54B 2AGJH 3QDHA 4M7LL 1YUHB 4UNVA 4QTHB 4EOWH 3Q3GA 4GRMA 1HQ4B 3GJFA 3ROLA 3K81A 2IQ9L 2VDML 5INCA 4JFYB 1INEH 2G2RA 1F4XL 3GUTB 2LAGB 3DXAD 5FKAB 5K33A 3NACL 2Z31D 1AY1H 5C3TA 3CSPA 5C2BH 3QIBA 3QR2A 2DLEA 1IILE 1JGDA 5HHOB 1FGVL 5DR5L 3QULB 2K3TA 1NMCC 5J7CC 5KAQF 5ECJE 4B5EA 2CKNA 3ZYZA 3GB7A 3QJHA 3HE7C 4Y2DA 1RZJL 3QNXB 1UYWL 1I85A 3S34H 1PGRB 4HIXL 2GK0B 4KQ3H 1K5NA 3BKCH 1F4YL 5EN2B 3WLWC 4W6WB 3ULVF 3B9KC 5I30L 1IKFL 5AZ2L 3S4SG 2R39A 3G5YB 3NGBB 3MJ6A 2D7MA 3QIBD 4PJ8B 1K85A 2XNAB 3MJGX 1A1MA 4AL8H 2G60L 4MJIB 4IRSB 1R5WB 4MGXA 3SKUD 4WO4A 2M26A 3D6GA 1KB5L 3KYOA 1HHGA 5KG9B 5FF6A 4LDEB 5KANI 3DVNB 2Y23A 1BZQK 2EIZA 3Q1SH 3L3IA 4RISL 4Y2DD 4R96B 4L9LB 3OJDA 4U49A 5DRWA 5MEOB 1VGKB 2HVJA 2XTJB 4GW5B 4YE4H 4RNRA 3TBVB 2CGRH 1B9ZA 1YJDL 3EFDH 1YMME 3QNYA 1H15B 4JKPL 2D31A 1M6OA 5GZNC 3GMRA 3T3ME 1C5DB 4MHHG 4ONGL 5JPMA 3O3DB 1JF5A 4CUCA 1YY9D 1RJZA 3QPXH 4N90E 3UTQA 4FFYL 2JJSA 3U0WL 3HN3A 4NKOA 1I1CA 2OQJB 5SWSB 4XC1H 2DDQH 4FXKA 4WO4D 5ESVB 2DQJH 3WIFB 5C09B 4QXUL 2NY4D 3MLZL 3O2DA 1KPUA 4U6HB 4WTZA 4X4YB 3H3PH 4EI6B 1OAKL 2YS4A 5CHNB 4IHOA 2CDEB 4GMSL 4AMKL 4OLUH 5C92A 4HFUL 4K94C 3RU8H 3SJVB 2AGJL 1CXLA 2F54E 2QADB 5MEPA 3MRHA 2X10A 3CAFA 3O6FB 4EOWL 4LPVA 1RVFH 1N6VA 5BO1H 3SGKA 2FJGB 3VGAC 1JI1A 2KUTA 1OQXA 1XZ0B 1SQ2N 1INEL 5C07B 3UTTB 2CXKA 2PXYD 5T1KB 3BH9B 5IB5A 4MA3B 3U30B 1MQ8A 5DJZB 3IDNB 1AY1L 1ZT1B 3TJHD 1ZE3C 3RIFK 5C2BL 3U9UB 3CFJA 1MCEA 3ZKMD 2CIKB 4NPYA 4F7MB 3HAEA 3OGCA 1F58H 5HHOE 1G0XA 5SX5H 4UQ2B 1K8IB 2D7TH 5HJ3B 4KFZC 1CCZA 3MRNA 3OJ2C 3S34L 4HIHB 3T0VA 3JBG7 3VXRB 1KTKE 2F5AH 3QWRD 4KQ3L 2BCKA 3BKCL 2HYMA 2XA8H 3SDCD 1JV5B 5DJYA 5KS9B 1GSMA 3X17A 1QA9A 5C0AA 4U7MA 4NP4H 4BUGA 3FMGH 1N5YH 3DRTB 1U8JB 2F53B 4JY6B 3K0WA 4ZFOB 2FB4H 3NFPB 4U1IB 1IGFH 5B21A 4AL8L 3S96B 5GS0C 3O45A 4OZIA 4WW1B 4MJIE 2L4OA 5HVWA 3T77A 4Z7NF 2VE6B 4HLZH 3STLA 3SHSA 3NPSC 2MKWA 5EU5B 2UUDK 3RWCA 4P4KD 5EB9A 5AZEH 3KR3H 4UI2A 3Q1SL 2HRLA 1MOEA 1AGDA 2FRGP 5D5MB 3SDDB 3ARTA 4YWGH 2D2OA 1JL8A 3H0TB 3P0VH 2FIKB 2XTJE 2VH5H 4YE4L 3STZA 4YHNB 2CGRL 3EFDL 5C0AD 4EIGB 4G8EA 4MDJB 3TH2T 2DJSA 3ZE2F 2RB8A 2OS7A 1AHWB 1V3MA 3VFUA 3ARFD 4LVNC 1NGQH 2BMKA 3U46A 1KC5H 3VJ6B 3TLRA 1TJHH 3C60A 4PRBB 1J87A 1X4XA 4XC1L 2DDQL 2DQJL 2E27H 4RFEA 4PS4H 5C09E 3D39D 3MA9H 2FGWH 4JQVA 4ZFFA 3H3PL 3QHFH 4BJLA 5F72S 1KBGH 2VR5A 3FKUS 4LHUB 3OZ9L 3HUJA 1G0DA 3EAKA 4JDTH 1T83A 3N1QC 2ESVA 1DQLH 5EU4B 4LCUB 3FCTB 4Y5VC 2J8UB 3RJQB 3RU8L 3SJVE 2PUQT 3VFOB 5I74C 1EGJH 4OLXH 1XGUA 5GS2D 3BFOA 1RVFL 5BO1L 4ZUSB 4NWTH 4NN6C 1J5OH 3MC0A 1U9KA 1TFHA 4OZGF 4U1LB 4AIZB 3UTTE 4HMEA 4S11A 1HCFX 3T4YA 5E8NB 1JP5A 5FUOH 4KY1H 1N0LA 3BEVA 1NL0H 1HE7A 3FT3B 4QRTB 2ED7A 3MRJB 2VSDA 1BVZA 3QSKB 4I18B 1F58L 5GGRA 4MJ2A 3K3QA 2G75B 4ISVA 2D7TL 5EOTA 4LCWA 2QQLH 4G8IA 5C0FA 4XWOC 4MNHA 2WUBH 5D2LF 2BC4B 4P23D 4A2LA 5AUMA 2IH1B 1JTOA 3C5JA 4Z7NE 5T3ZD 3QZWA 4P49A 3O6KH 4PB0H 2LABA 4F37K 2F5AL 3VXRE 3OKEB 3RAJH 2XA8L 2ITDB 3WHXA 2AK1H 1CFSA 3O3EA 3P9MA 3V6ZB 4NP4L 3FMGL 1N5YL