4H20H

Crystal structure and computational modeling of the fab fragment from the protective anti-ricin monoclonal antibody rac18
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
220
structure length
220
Chain Sequence
b'EVQLQQSGPVLVKPGASVKMSCKASGYTFTDYYVNWVKQSRGKSLEWLGLIIPSNGGTTYNQKFRGKATLTVDKSSSTAYMELNSLTSEDSAVYYCARRGLTGALFAYWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPALLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIVPRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Light chain of Fab Fragment from the anti-Ricin Monoclonal
publication title Crystal structure and computational modeling of the fab fragment from a protective anti-ricin monoclonal antibody.
pubmed doi rcsb
molecule tags Immune system
total genus 44
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2012-09-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4h20H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4h20H02
1AFVH 5F6HI 4G6KL 4N0CD 2DKMA 2NY6C 5CP3A 1KG0B 3BD3A 1L7TH 1L6XA 4NNXB 5F9JA 5ISZD 2UVEA 3RUGB 3BEWA 3V6OA 1NCCL 1SYVA 2G75B 2PW1B 3RWGA 1CI5A 3L3DA 4HS6A 3P4NB 5I2IB 5L8LB 4X9BA 4PGZA 3KXFE 1MJ8L 3RY5A 2HKHL 3FFCA 4YXLH 5INCA 1KTDA 1SY6H 2F54B 4OM0L 1NGPL 3CZJA 4HWBH 5HHOD 1IGJB 1S7VA 3MLWL 3SE4A 2AJUL 3ARDA 4I18B 3QO0B 5GRJL 1HCVA 2P24B 4RZCA 1KBGL 2VL5A 3CFJA 4HBQA 1EZVX 2HRPH 3H3BC 4UQ3A 5DI8A 1LWRA 5GS0L 4JY5H 5D1QC 5BZDA 1P7QD 3S98A 2X9WA 5E7FA 3QG7L 1BFSA 1KELH 5C1MB 5T3ZH 4WU5A 4G5ZL 1S9VB 3T1WA 1OSZB 3UX9B 2R1XA 4NBZB 3P0VL 4WV1B 4NO0D 3HZKA 1G9NC 4R2GB 4YE4L 4OZIE 1NDGB 1T5WB 1BECA 3QUZA 5HGGS 3IT8D 3JWOH 4Z76B 1RULL 2YWYA 5F9WB 4ZUVA 5TDOA 4PJIF 1QQDB 3ROOB 2VB5A 4DJMA 4JREC 1WAAE 2HFGH 1NLDL 5FHBL 4GG8B 1BD2B 1NC4B 2F53A 4Q2ZB 2QSQA 3QNYA 4JFEA 5HHXH 5F6IB 1H15B 5GGVY 5DURD 2D03L 4LOUD 2PTUA 2ESVA 4W6WB 4HUWB 4ZUWA 4AMKH 5H94A 2H41A 5DXWA 3NZHH 2R69H 5JZ7D 4JN1L 3MMEA 3ZKQD 5D1ZB 5D7JA 2F74B 1NFDB 4Z7VB 5ADPL 1DQMH 2Q6WA 3GSXA 3DO7A 2XT1B 1X4ZA 3ZKND 1C16A 4PJGB 2X4RB 4R97B 1B9ZA 3JV4B 2YRPA 3GSUA 3LS4L 3RBGA 5IB5A 3U0WL 3EJYC 5EBLB 3PXJA 3V5KA 3LKSA 3LKQA 3LN5A 1WZ1L 3CUPA 4QRQB 3Q6GL 2CDEA 1PY4A 2BK8A 3VG9C 1CICD 4UAOC 2V6HA 1TPXB 3D6GA 3AGVA 4F7CB 3ARRA 5I1AB 4K23L 5CP7A 5DR5H 2EXYC 4R96A 4JG0L 1O5DT 4HD9A 3MRKA 4LLVA 3WL9B 5GGVL 7FABH 4ZS7L 2ENSA 3WHE1 4UV7L 2MHAA 4O58L 4ZDHB 4P4RA 4KUCD 1QR4A 1PLGL 4HKJB 4RRPA 5T33H 3GI8H 2EYTA 1MJUH 3PWVB 1VFAB 4E41E 5SWZB 5DHVA 2QQKL 2AEPL 1T7XA 4ZAKB 2HJKB 4R4BB 4FQLH 2IBGA 2VO5A 5JQHC 1F02I 1NCNA 1OL0A 2R0WL 3OR6A 1VESA 1KTRL 3G6DL 1RZJL 2ZCHH 2ZSVB 5MENE 3MLXL 1JCKA 5KSVA 3KPRE 2AI0L 4MJ5A 5I9QB 1H8OA 2J2ZA 5DT1H 3PP3H 4PGCB 4OV5B 4TOYH 4HDIA 3ARGA 5DMKB 4MAYD 4O2FA 4DGVL 2RQ8A 3WN5A 4G8FA 2KDGA 4Y2DD 4Y16C 4F57H 4XZUA 4ODVH 1VGEL 1D6VH 5C0DA 3STBA 1KIRA 4HAFA 1EAJA 4JFZH 3R1GL 4XCEA 1FG2A 4I48A 1FZOA 2FIKA 3CFKA 5E2VL 4HG4K 3B6SA 4OZ4B 2G60H 1AGBA 2R9HD 1I7RB 5JMRA 4DW2H 2DAVA 3BT2H 4TTDD 2JJTA 3L3KB 1GPOH 5T1KA 5FKAA 2ARWA 1EHNA 4Q0XH 3FN3A 4UV4L 3LN4B 3Q6FA 1P5VA 1VEMA 2HG5A 5DQJB 5CINH 2KPNA 1ZE3C 3KPTA 1IM9A 3PIQB 4NN7C 4NQED 5C0EB 1FJ1B 5BOPA 2C3XA 5KW9L 4A6YB 1MCPL 3TN0B 5IJVB 5EORH 3PGDB 2BSRB 1BBJA 1C1EH 1A7NH 2APXA 5D9SB 3TA3A 5L2KD 3MRIA 5EZJB 1XGUB 2PYEE 2VXSL 3VXMD 2P8PA 3VDCA 5DFTA 3C60C 5TDNB 3T0EA 3I6KB 2ZNWA 1AO7E 4K7FB 2AXFA 2EIEA 5C0AA 5J06A 1SEQH 1BGXL 1DQLH 1XGPA 3DSNA 2G9HA 3LMJH 1HQRB 2MTPA 1JF6A 4U1HB 4K8RL 4NKMA 2PYEA 4ODSL 3WUWA 2ED8A 1KULA 5JMOC 4BZYA 1DE4A 4I0CC 4TRPH 4NUJB 4LIQL 4NUGH 4FQQB 3SDDA 4XMKH 4NP4H 3SBWA 1HILB 4MCYB 3S34L 2EECA 4MQ7B 3RVUC 4J4PC 5CS7A 2CH8A 3C09C 5FK9B 3QCTL 3WE6B 3RVTC 1NKRA 4JGJA 2VDRL 4RDQF 1FO0L 5DYOA 3VXTA 1UH4A 3O4LD 4K94H 4PYGA 1AE6L 5JW3H 4JG1L 4P23A 1K9TA 3I2CH 3UPRB 5EDXA 4WHTB 5ISZE 3CXHJ 1DCLA 1ZT4B 4IS6A 3RZCA 3WUZA 4QRTA 2OX5A 1CU4L 5K9JH 5D5MF 4KZDH 3QUYD 2JJUA 1CLYL 2UZYB 4OBRA 3OXRB 4MMZC 4U1MA 2NCMA 4X4XA 2DJ4A 5HYQA 5BV7C 43CAA 5C0NC 5HHOE 4QOKB 3PDGA 4H88L 5JUEH 4Z7WF 2FEEL 2AEQL 2GT9B 3DX6A 4XP1H 4P2QD 4TUOA 6FABH 4Y5YB 3AVEA 2NY0D 4MNGE 1PFCA 1Q9LA 4KHXH 2ZZUT 2Q20A 1X5AA 4F37K 1KTLA 2VKXA 4N8VB 1BM3L 1EVTC 5DJZB 1JN6A 3KXFB 5CEZD 2QHRL 3MO1A 3KYAA 1CZ8L 2FO4A 1L7TL 4PP1D 2R2HB 5JHLH 1ERNA 3HB3D 5CZXD 2AEIT 5GHWL 1Q0YL 3AFLA 1FC1A 1P7QA 1U58B 4HIHB 3IGAB 1T7WA 4I2XA 3MBXH 1EAPA 1JP5A 2VDKL 1JYVA 4M7ZC 4X7DC 5C0RL 2J4WH 3T2NL 5B39A 4JFPA 4JY4B 4NHUA 3VXOB 5EO9B 3GJFB 2EDJA 5E1HB 4M62H 3OJDA 5EC2A 2Y5EA 3ULUE 4OZFB 2FEEI 3QEHA 4OFDA 2FJGB 3MRQB 4XVJH 2EH7L 3QHFH 3BEVA 3T2OA 4B41A 1INQA 3E3QC 4FZEL 3LEXB 4U6XB 3T4AB 2JJWA 3KLAA 1J5OH 2WLYA 2ZUTA 1OAUL 4S0SD 1ZHKB 3GGWA 3BH9A 3AS1A 1JNLL 1WT5C 4OZIB 1R5IB 5EU5B 3LCYA 4YPGB 4AG4L 3VFPB 1XF4B 4WFGD 3UDWC 2LABA 4GAJL 5D70L 1WITA 1EUTA 1UB6B 1GXEA 2VH5L 4I0PA 1Z9LA 5ACLA 1A1MB 2YMXH 5DUPL 1PZ5A 3LSOB 2F15A 2AAVA 3VXPA 2DQIL 3ETBF 1A6VL 5KG9B 3CK0H 2HLFD 3NPSB 5EIIA 1ZHLA 3KG5A 5GGUB 4EXKA 2B0SL 4BH8B 3EYQC 3EGSA 4OUUA 3VFMB 3O3EB 5TFSL 4K3DH 1QFUH 5DRXA 3S5LG 1EJOL 4U1SB 2ADFL 4P3CH 1CICA 3U1SH 4JFFE 1QVOB 2BXYA 5HGAA 2D0HA 3JV0A 5LKNA 4QXUH 3NZHL 2GITA 3NIDF 3QUMB 2CUHA 1XF5A 4M7LT 2JCCB 1MCHA 4XNYH 3QNZA 1X5JA 1VA9A 3QR2A 4XCCL 4Q9RL 1GGBH 3O6LL 4BK4A 5GGTH 3SDAA 2EIDA 1R3HA 4JFOA 4XP5H 3C6LC 4KQ4H 2HN7A 3IFPB 4MS8D 1NDMA 4HKZB 3IDYB 4M1DH 4GUPB 3W39A 2NXYD 3BP5B 2ERJB 4KV5F 4EI5B 5ENWA 3O3UN 5AYUH 4FA8A 2VN7A 2XQBH 3RWCB 3VCLB 4D9RD 2DD8L 3FONA 4WI9A 5CD3A 3MJ9A 5JORA 4NC2B 3IDJA 2XV6B 3GSNA 2VZSA 2PUQT 3P11L 4PJBB 1T1YB 1VFUA 4H0GA 2OM5A 5ID1A 4JZNA 4YHMH 1VKXA 1VPOH 4JJ5B 4PRBA 5DD6A 1TENA 4RBPK 2D7PA 2Z9TA 5DFVC 1FBIL 1ZT1A 5DMIH 3HZYB 4MAYA 3KPLB 3UJTH 2ZG3A 4EDWH 1JWMA 2BNUB 3BN9C 4GBXD 3NAAL 4QHLA 4Y2DA 4CMMA 5F97E 3RVXD 2KQNA 2GK0A 5DD3H 5IR1A 1A4JB 3LEYH 2K9UA 1LP9E 3C8DA 3RIFF 4TUKL 1LHZA 4ZSOA 4PLNC 4PJHB 3CIQA 4PJCE 4XP4L 1T0PB 3IDIB 4QHKI 5HJ3A 4JVPA 1WISA 4PP2B 5SWSB 4OCYL 5CJQH 4LPYA 4UB0L 3TBTA 3TH3T 1WIUA 2MWCA 1ZVYA 3D39A 5KVEH 4TOYL 4DQOH 3PDDA 5IHZB 2IFGA 1F58L 1U0QA 1NEZB 1U8QB 2DLGA 5D7IA 1INDH 1QR1A 3DROA 3GSOA 3LN9A 1SJXA 4YEEA 3IJYB 3KPPA 5L2KE 2XTJE 3DVFA 4IEFB 2BNRE 4NFBA 5HI3D 4F15C 3VXME 4NQEA 3SKOB 5IIEB 4NGHL 5HDBF 1DBKH 1YEGH 1A6UH 2H2PC 3SCMC 4M03A 4NZTH 5FUOH 1AI1H 4KK9C 1DBJL 4BZ2L 1G84A 3VXMA 2CPCA 4HLZG 1GPOL 2VLME 5IMOB 3H0TB 1F4XL 3QNXB 5TQ2H 4FTVD 5EUOE 3F7VA 4PRAB 4WW2F 3IU3B 1IEBA 2YD7A 1LEKB 3VMPA 3TBWA 1RUKL 3EJJX 4GXVL 2YD6A 2XXMB 3VWKB 3REWA 4L4TB 4OZGE 5CINL 1U9KA 5FGRA 1MREH 2I5YH 4DK6A 1HKLH 1RZ8A 1AO7B 4OF3A 2FLRT 3QXAB 4MNHA 4OZGA 5FECA 4GKSA 2A6IA 3VGEA 5TE7H 5FYKU 3RA7L 3O8XC 5C08D 3VRLE 4JFQA 4GG6B 5I30H 4A6YH 3WXVH 1ORQB 3RHWK 3LDBC 3O4LA 4PTTB 3GUTB 1ZSDB 2OK0H 4WW2C 3CFDB 5IK3A 3K8KA 4WIQA 1K5NA 2HFTA 3BPOC 1B0GA 2W65B 2A6KB 2AGJH 5SWQA 1OAKL 3JWOC 1C08A 3HE6B 4CVWA 1YC8A 4JPKH 4N5ED 3QUYA 4P2QE 1D5BB 3NZ8A 5TE4L 1CE1L 1UH2A 2F8VA 4PFEA 3QDHA 2WZPD 1DEEB 4RDQG 1CR9H 4MSWA 4N9GA 3BISA 3VGAB 4Z7QF 2FIRT 3MCLL 1JZ4A 2XKSA 1UJ3A 2FHFA 4ENEC 4EDXB 4U05A 1KJ3H 3G5XB 4YO0A 4Y8AA 1HXMA 3V9FA 4OLVL 4AM0A 1A5FL 1XGTA 5JW3L 1HEZB 3MXVH 5I19H 5I76B 2V2XB 5EIQA 2DQHH 4EZMA 5DC0A 4WWID 5I74B 3HMWH 4FQXB 3U4EA 4QHNB 3EYSH 3AU1A 2W0LA 3U36A 4KZDL 4OLWH 3A67L 3U9PH 5J56B 3PL6B 2R4RH 3IF1A 3ULSA 3EO0A 1A6AA 1VEOA 2AV7B 3B9KC 3PWUA 4CAGA 2DICA 1L9NA 3QYCA 4HXBH 1SJHA 1UVQB 2H1PH 4M6AA 4PRHD 4KC3B 1IAOA 3T77A 1A1NA 2V5YA 4H5SA 1T89A 1MHHA 1OHQA 3PXHA 2H2SC 2VTFA 4MCZA 5DRNB 2DQDH 5HPOA 2ZCLH 1ZEAL 1C5BH 1CFQB 4MNQD 3MTRA 4ODBD 3RWIA 2IC2A 3MLRL 1A64A 4X6BB 5DJ2B 1YY8A 5B4MD 2RCSH 4PLKD 3B9DA 5CJBA 4O2CB 4NQSB 4UTAH 5D2NA 5E1AB 5DEGA 5ERWA 1UYWL 2EE3A 5JHLL 2VLKD 1ONQB 2AXGB 1OAXH 1NPUA 4PJ5D 3QXTA 5I73B 3BXNB 3ESVF 4UOW0 4MJIA 1IEAB 2QSTA 5T1MB 1LE9A 4OBSA 5IB3A 5DJ0A 2Q76B 4MYWB 1G6RL 4HUKB 1F4WH 2IG2H 1TZIB 4H1LA 4Z0XA 3P4LA 4MX7A 3V7AG 3UO1H 5JPMB 2EYRB 3AB0B 3RGVD 3EDDA 3P4OA 4M62L 4TNVF 1FIGL 5DC9B 3IFOB 2DMKA 3O6FB 2XRAL 3GMMB 4LLUB 5A2FA 3QO1A 2ZJSH 1EO5A 2IAMC 4LL9A 4DZ8B 1DLHB 1JRHH 5DD5L 1K3IA 4E9LA 4H8WH 3Q0HA 1M05B 3HAEB 4RSVA 3BW9B 5FM5O 4KZEH 4NQDD 2YHGA 2OXGA 4XPTL 2HFFB 3TYFB 2OR9H 4MB5A 1CTNA 4HIEB 2WBJA 5IG7B 3ZYJA 4URTB 4JO1L 1OPGH 3FFDA 1QSFA 5D7LA 5CKAA 2VDNH 1V3MA 5E6ZA 5L9DL 3L6FA 3NFNA 3M07A 3AC0A 1IM3A 2BMKB 3GMNA 4LSPL 3TP4A 1FAKT 1I8IA 2HMID 1SVCP 5E00B 4JFFB 3CK0L 2YPKA 2FH6A 2NY2D 3CMOH 4LVHB 4N1CA 5A3ID 1BIIB 4J23A 1AP2B 2WQRA 5J12C 4F8QA 3RNKA 5EU7E 4JLRA 2HYMA 5JHDD 1AH1A 2A6DB 1FL6A 1FFPB 2EEDA 5FDWB 3VFNB 5CIPB 4F7TA 3IVKA 4HGMA 5JA9A 3D5OF 1BFVH 3TT3L 3BSZH 1N6QL 4HX1B 4W70A 3TC9A 2EXWC 4G8GD 2ZSWA 2A1WH 3ISWA 3L5XH 1JPSH 3QPQC 2O5YL 3ZT5A 4JPVL 5C9KA 3FQTA 4GBXA 4M1DL 1JNHA 3U2SA 2YEZB 4L8DB 2QEJA 4M6MH 2R0ZH 4XBEH 3RBSA 1N4XH 2YD5A 4GRLC 4QHUA 1NBYB 5GPRA 4XP6L 5GJTL 5EO1A 2ATPB 3MRRB 4JM4H 3SDXE 1NANI 5BS0A 2UWEA 1ADQA 3EDJA 4EI6B 5I18H 3DSFL 2DWDA 2W0FA 4GLRH 3D69A 4PY8J 1FZKB 4YHML 4QY8B 3BP7B 3VXSB 4PJXA 3Q3GA 5J1SC 5DMIL 3B9AA 3R8BB 5EZIH 3MRLA 3D0VB 3OQ3B 4EDWL 4K94C 2BNQD 4HHAA 4QXTB 3WKNA 5L2JA 1B0RB 5E7BA 3LEYL 4BA8A 2AV1B 4B53A 5IJKA 1AGCB 4PV8B 1MI5E 3GSQA 3X3FH 4G6AC 4MA3B 4ZNEE 4FTVE 3N50A 3DX9A 1N5YH 5CJQL 1KNOB 3HUJE 3KNBA 2X89D 3DVIA 4G9DA 1A7QH 1IGFL 2XTJB 2BNRB 3E8UL 1WC7A 4KVCH 3LAFA 5IESL 3HS0B 5LGHH 1AXSB 4FTVA 1KLFA 2DQFB 3IDNB 3ZDZF 4XBPA 1I8MB 2EIZA 4OLYL 1YEDA 3QA3A 1F97A 5KOVC 3MJGX 4JFHD 4DVBA 1LO0H 5GJSL 5E5RB 3T0BA 4LVNC 4IOFC 4LHUB 4UT6L 5FO8A 3GMPA 5FV1L 4P57B 5C08E 4PJ7F 1OW0A 1PGRB 1S9KC 1LO4H 1N5AB 2IQAB 4IRJC 1RVFL 1D5XB 5EUOB 3ALWA 1K8DB 1WGOA 2XA8L 4X5WA 5DK0B 4IIQB 3UTQB 4HBCL 4ONFL 3SN6N 5FUOL 4WI8A 1REIA 5MI0B 5C08A 1N7MH 3SGDI 1G0XA 3SDYL 1SMOA 4X4MA 1R6VA 3P30L 4KK8D 1EBAA 5HI4D 1BZ9B 1GGCL 4RNRB 4JDTL 5MHSD 2FRGP 4N1EA 4H26B 3KWWA 1KGCE 1JPFB 3SQOL 4YHKH 3LS5H 4PBWD 2GY5A 5M94B 5CJ8A 2EZ0C 1U3JA 5D1XB 1O0VA 1AD0A 2XZQL 5ID0A 3HPLA 2AJSH 1HCFX 1AD9B 4D8PB 1B4RA 2X7LB 4I18C 3WXVL 3T08A 5BVJA 3S36H 1IZKA 3EOBA 3IFLH 3QAZC 1U8PA 4LSTL 4S0TD 3ARVA 4RQQA 5KVDH 2I26N 4J1UB 2Q86B 5HHPA 3IXAA 4XMPH 2M1KA 1A8JH 1I7TA 3GMRA 1D6EA 2R1YA 1P84J 3N85H 2DLTA 2DDQH 2XPGA 4WV1C 1UWGH 5GSRB 1ZT7B 4PRHA 3FB8A 1MWAH 3RAJH 1HDMA 3V6FA 1OSPL 3I9GH 5IEKA 1U8LB 5C09A 2MQ3A 3P73A 3G5VB 3L3OB 2D4FA 3QQ9D 4MNQA 2AJVH 1U8HB 3MV9E 4Z7NE 2DQHL 2VLKE 2D7MA 4BH7B 2A38A 5GS2D 4OGZA 4XHQA 4OLUH 1ZGLA 4HIXH 1QSZA 4LSRL 4RGND 2WBKA 1MRDL 3U79A 4JDVA 3S97C 4LSSL 3V79C 4PGEB 3VFGL 5TJWK 1VERA 5F6IC 3NFPB 2HJLB 3U9PL 1S7WB 3V2AR 5MEOA 2VDML 4PJ8D 1KIPA 3VFVB 5J7CC 2AKRA 3WIHL 1R3KB 3IJSA 2R1WA 4PJ5A 2H1PL 1CXKA 2NZIA 3KYKH 2C7UB 5EC1B 3Q5YA 5D1ZC 2HA1A 3DXAD 5CD5D 5IBTL 1HHIB 4BSVB 4HEME 4R97C 3MRFA 4D9LH 4OLEA 4EBQH 1AJ7L 2XZCH 4W81A 4JRXE 4NRXA 4FQIL 5C0FB 1QHOA 2BVOB 3I50L 3RGVA 2WNGA 4IRSB 5GRXG 3LQZA 2M8XA 1A3LH 1LK2A 1VCAA 1W72H 4NQDE 4P3WA 3HRZB 3UEZA 4YGAB 4YXKH 3WFHB 1E27B 3GSVB 4G8IB 4HMDA 5ANME 1RZGB 3ILPA 2NTSP 3QZWA 3VE0A 1EO7A 3U7AA 3WEXA 1FORL 2Z93A 3FO0H 4BQCA 4ZO8A 4XB7A 2VDPH 3FO1B 4NRZA 4J3XA 3GB7A 3KR3L 4PS4L 4FS0A 3R4DA 5I1DB 2VOTA 1P69B 3NPZB 3QUXB 4R90H 4F33A 1SYSA 1Q94B 2YD4A 4NQCD 5J4MA 3SKJH 1TNNA 3PGCB 1BAFL 2JF1A 3HG1A 5IHUL 1RZIB 3VFRA 1T22A 4UOJA 4ZQKB 4P2OD 1IGCH 4R3SA 4L3EE 4M6NH 2VDLL 5AUMA 4XNXH 4KZEL 1KCUH 3MFFA 4P4KC 4PUBL 3GO1H 1HYSD 3ARTA 5I9QC 5JHDA 1F2QA 3PWJA 1IC7H 1YA5A 1SVZA 5B21A 2KZ1B 4K3JH 4CU7A 3RPIB 1CF8H 3RNQB 3ULVD 1FNSH 1VGKB 4M7KL 4X8XA 2CLZB 3HAEH 5BQ7A 3ROLB 3MXWH 3IS0X 4RMRA 5JLZA 4G8GA 5C6TH 3MJ7B 4WUKH 3WSQH 3NGBB 3VWJC 1RURL 4PRIE 5D7KE 3NABH 4V1DD 1F00I 1JGDB 4BYHA 1MAML 4KFZC 3VFTA 1QNZH 5IW1B 1YEIH 3QCVH 3BGMB 3QP3A 4YBLB 2HH0L 1CG9B 1FP5A 2F19H 4Y0GA 2XA3A 5EWIH 5FGBA 2J8UE 3MZGB 4PRDA 2XNAA 1RU9H 1I1YB 2VQ1A 2V5MA 4OLXL 3MODH 4HK3N 5ESAA 1G9EA 5JO5B 2M26A 2FBOJ 1ZLUH 5J13B 5D6CB 1U93A 4ZOCA 2EO1A 4CW1A 1FFRA 1WK0A 5E8EB 1CCZA 5F88B 2A1WL 2DKSA 1QO3A 2YRZA 4LHQB 5I8EB 3CPLA 2VAAB 3TN0C 2LV4A 4GW1A 4DTGH 3NCFB 4RFOH 4AEEA 3QUML 3WNKA 3AY4C 3T4YB 1EXUB 1XCTA 4EN3C 3QJHB 2BNQA 2R0ZL 4RMWA 5IW6A 1GVIA 3QIUD 3SQBA 5SX4H 1CVSC 1FYTB 2OLDA 1I1RA 4K2UL 2HFEB 3WJJC 2RFXA 2XY1A 4PREA 1G7HA 3ZKXB 4NDMB 2GJ6D 3MLZH 1XFPA 3LKPA 1VDGA 1KSRA 3HR6A 4GFTB 4UT7H 3ZZ1A 4N68A 3ALPA 1FNEA 2XN9D 3D85D 2MFNA 4UDUB 4AYFA 4M48L 4NQUA 5D1QD 5EO0B 3TIDA 3PABA 4K7PH 3RI5F 1MI5B 4L9LB 4IOIA 1T03H 1EHXA 5K9KB 1F11B 1I9IH 1TJGL 4QRPD 3HUJB 1I85C 4X83A 3Q5TA 1XZ0A 4LU5L 4L4JA 4OGYH 3FOLA 3X3FL 2VE6B 2B8OT 2C3HA 3WNOA 1XR9A 1BHGA 2VWEE 1CLOL 1N5YL 1F4AA 5M7QA 4L5FL 4AH2B 1CBVH 4ZTPL 4M43H 4LPTA 3VRIA 1OTSC 1NBZA 1LO3H 4KMTL 2APTA 3U9UB 3TO2A 1MIEH 5DZNA 3DX8B 3LQAL 4PJEA 4P48A 4GLRI 1LO0L 1A1OA 4WENB 3GMQB 3V6ZB 1TZGH 5J57B 1MHEA 4PY8I 3LEVL 5IQ9B 3X17A 3O45B 4GOSA 3HCVB 4J3SA 2Z31B 4MDIB 3TJHC 3UZQA 1WTGT 1LO4L 2O61B 1WBXB 1XGQA 2MKLC 4IHOA 3TBVB 1KCVH 5DWUH 4NNYB 3X12A 5T1LB 4DVRH 3KYNB 4MXWH 1NGWA 5EB9A 1J8HD 1N7ML 4BFIA 1J0IA 1QLEH 4NBXB 3S4SA 2XOTA 4TQEH 4ODHH 4W4OC 3LKOA 4QRUB 1YDPA 1CXEA 5BXFA 4BSWB 2P7TA 1KXTB 5ADOL 4R26L 4WO4B 1MQKH 4P9HH 4PJAB 4YHKL 2VZOA 5I1EL 2IADB 4PBVC 5A2LH 1S7UB 2I24N 1ETZB 2W9EL 5I15H 5H2BB 5E9DD 5E6IC 1TXKA 5L7XL 1U8KB 4WI7A 1YNKH 2NX5D 3NIFF 4JPWH 3WNNA 5I8KH 3LRGA 1PEZA 3F5WB 3V5HB 2WWMC 4MXVF 3ARSA 2AJSL 1S7SB 4H8WC 4HCRL 3KGRA 1KB9K 4RGNE 2Y9RT 3ARBB 1QRKA 5ACMA 3T3PF 1KPRA 2VUYA 3AXLB 4CJ0A 2B2XH 1CGXA 3BZDA 3W2DH 5J0BA 1A6TA 1KJVA 4LRNH 3QDAA 5GGQH 5GGRY 1FN4B 1T1ZA 3S36L 4GSDL 2ID5A 1FV1A 1L0XA 1KN4L 1I1FB 5B8CA 4Q97A 2DQCH 2FX9H 1J9CT 2QHLA 5ESVA 1UCBH 1WZMA 1FLRH 2ZUUA 1PQZB 2WSKA 3PWPB 4PB9H 2FO1A 3MV9B 3N85L 1K2DB 5EBMA 4ONOA 1NGXA 2ADGB 2IF7A 2CKBB 3OR7A 4AQOA 1F90H 2JK5A 4PJ9B 3I3EA 1FNHA 3R06A 5CHNA 3DXAA 3MLTA 3UBXA 1G7PA 3BQUD 3I9GL 5EOCL 3ORJA 3NN8B 1RJZA 5C0JB 2DQEH 1WBYA 1LK3H 2IJ0C 1M7DB 2H9GB 5ALCL 1EZVY 3NPSC 2GSIA 4DKEH 4WEBL 1PG7W 3QIWC 3HLAB 5C0CD 1AC0A 4X6CF 3FOMA 4L8SA 3GI9L 3TNMA 1T3FA 3TCLB 1IMHC 4MA7H 2NY1C 4QHMA 5JXAL 1HHHB 4JRXB 5KS9B 4KKAD 2XICA 3BVNA 2BRRL 4NRYA 4OJFL 2VLJB 5DJ6A 4OCXH 2PXYD 4BQ6A 2CMRL 3D18B 4S1DC 3MQIA 3CVHH 1FFNB 1H3WM 4Z77A 4EBQL 1OWRM 1NCBL 4BFGA 1YECL 4UBDD 5ANMB 2NZ9C 4LBEA 1U92A 3EZ8A 3IDYC 5HGHB 1C12A 4NQCA 2R0KL 3L3DB 4U1GC 4HFWA 3VJ6A 1Q38A 2ERJC 2CJUH 2XWTA 4EI5C 4YXKL 4K3HA 3FFCB 5INCB 3LHPL 2XZAH 1EO8H 1KTDB 4RFNC 4P2OA 2UY6A 3FTGA 3BIKA 2NY2B 4GAYA 3W0WD 3ULVE 4JDZA 4XX1G 2Q8BH 3ARZA 3ZL4H 4OGXH 5IQ7H 2P48B 1CQYA 1CT8A 2VL5B 1OD9A 3ABZA 4QRRE 4RX4A 2AK4D 3ILQD 3RFZC 3QQ3B 1IAIH 4L3EB 4M8QA 3CFBB 3ZE2F 5BZDB 1CD8A 3ULUL 3DTXA 3BZEA 4X7TB 3SKJL 3PUCA 2HT2C 3MRCA 2OQJA 4ELME 3RTQA 5DGRA 1QKZL 3N1FC 1BEYL 1RUQL 2EKJA 4J4PD 4P5TC 4RWHA 4X99A 2EDYA 4PR5A 4YHLL 2B4CH 4V1DA 1Q0XH 4FQJL 4OCRL 3MYZA 4OD1H 5I1GH 5BRZD 2P5EA 1KCUL 5HVGB 3CDYA 4L1HA 5DZLA 2NY5H 4OFYA 4ZUVB 5T3XD 2QR0A 1GAFH 5FM5M 4D3CL 2L7UA 4PRIB 3PF2A 3MACH 5LCVL 5BO1L 3VGHA 4NPYA 3SKNA 1OB1B 4X9HA 5D72H 1PYWA 3ZKMC 2XWBB 5C6TL 2J8UB 4LARL 4O4YH 3WSQL 2FZ3A 1T4KA 2ESVB 2HWZH 1VFBA 4JQIL 3HC4H 5C0ND 4YHIA 3TFKC 5I8CA 4EKXA 1K4DA 2NY3B 1KPVA 1YEIL 3EDEA 3GRWL 2Z92A 3VGFA 3C5ZB 4K07A 1OP5H 3MMEB 5JIPA 3OKNA 1M6OB 3QIUA 5EWIL 1T2XA 2Q6WB 1S78C 2XN9E 2ITDA 1KFAH 5A2IH 1H0DA 2G5BB 1ZLSL 3GMOA 1N3NA 4FG6C 3V5KB 3X3GL 5K9OA 5C3LD 3LKQB 4DUXA 2NTFB 1K8IB 2P44B 3HMXH 4HEPG 1SEBB 2GJ6A 3VWKC 2AQ2A 3AREB 3P77A 3LV3B 4QRPE 3VU2A 2F5AL 2XN9A 3D85A 3TJEH 1ZGLP 1PVHA 3K1KC 4MB3A 5C6PB 1I9EA 2EDEA 1I8LA 1ULVA 5F96H 3TO4C 4RFOL 5GSVA 5IGXH 4NT6B 2NXZB 3VFOA 4AEFA 3BESR 1AQKH 4HUUA 4U1KA 5F3BA 2FBJH 2H26B 3I6LD 4TSAH 3O9WC 5GS3A 2HLAA 1EGJL 1PD6A 2MHAB 3TBSB 4NZRH 3C87A 2EYTB 3VFUA 4DUVA 4YDIH 1G0YR 5HVHB 4PB0H 1TCMA 4G7YL 4BJLA 3Q2CA 4O00A 4UT7L 4DOHB 1QPPA 2XFXA 3HE7A 1HIMH 1SBSH 3DPBA 3BPLB 3HE6C 5I17A 3TIEA 5I1IH 4XCNA 4LP4A 4JM2B 4I3GA 2OI9C 2CO7B 3TVMA 3WHXA 3HZMA 4MJ5B 4WFFD 3RX8A 3AMKA 4C58B 2EDHA 1J8HE 3MBEC 3G04A 3LPFA 4PJIE 5AD0B 1FVDB 1ORSB 5ITFA 2X4NA 2K1MA 3WN5B 4G8FB 2PO6C 1ZLVH 2YZ8A 5SX4I 3BZFB 4I3RH 4WTZG 3TV3H 4YXHH 4OIBA 2YC1A 5I71B 4PGDB 5DJAB 5JIKA 4FQXC 1IAIM 3JUZA 2FIKB 1LO3L 1IC4L 3BHBA 1AGBB 2DMCA 4KMLB 1E4JA 3DUSA 1KJ2L 1P7HL 4XHJD 5C07E 1QBML 4XVUD 2F5BH 1A7OH 2OJZL 4C54A 3FRUA 4DK3A 5E9DA 1JHLH 4LLMA 4V2BA 1KCSH 4X6DF 2NX5A 2HG5B 3OKDA 1E4KA 5DEFB 1GOHA 3NH7L 1U3HA 4ODXA 4H25A 5AZ2L 5TH2B 1F6AB 4JB9H 4U1LB 1JTTA 1QLEL 1IM9B 1MNUL 4NZUH 4M7JH 1KPUA 3DUUB 4K8RD 2ORBH 3T0WA 3PHOB 2YA2A 3CLEL 4OQTA 4KGJA 5IVZA 2I9LA 3MA9L 1KCLA 4P9HL 2HT3C 2DL9A 1E28A 5I73C 3SPVA 4F3FB 2DM4A 2DI7A 5DEZA 2ZG1A 3FB6B 1IQDA 2DTSA 4D0DB 4JPWL 5DLML 3B3IA 3OZ9L 1YPZF 1HHKB 1XGPB 1J1OL 35C8H 2G9HB 4OT1L 1RK0B 4NC0B 1FLTX 5DVOA 3RL2A 3IAQA 1DJSA 5IM7A 1DN0A 2J5LB 1NUGA 3AB0C 3WS6A 1GRWA 1OAYH 3S37X 1G7LA 4APQD 3BQUA 4XXCA 2B2XL 1A6ZB 3W2DL 5JOFB 1E6JH 3PP4H 4ZFOB 4BKLA 4ODUA 2FATL 4HV8B 3ZHDA 3BE1H 3VXUD 1BBDL 5CUSH 1MEXH 4A2LA 2DOCA 2DQCL 3H9YA 4X6FA 5DO2C 5C0CA 1KC5H 1QBAA 1ZAGA 1AKJB 3MGOA 1FLRL 4LKXB 4TSBH 5J6GA 2A83B 5KZCB 3D3VE 1JPTL 4ONGL 3SKUD 1ZXQA 3O2DL 3RWDA 5BVPL 1UB5A 4KKLD 4HULB 4Y5XA 1Z5LB 1IZJA 2OZ4H 1DQJB 3DBXB 2YXFA 3MGTA 4IS6B 1Q9OA 4NC1C 1HHJB 2PXYA 4U49A 4ZXBA 1U8OA 2I9TA 3U83A 2CDGB 1M7IB 4L4VD 4U1MB 1T6WA 4LVHC 4QF1A 4HMCA 1EDQA 2CKBH 4NKOA 2H2PD 4NHCL 1PKQE 3OKKA 3W0WE 4LSQL 2VUOA 4NKIL 5KN5A 3U6RB 3DX6B 4UQ2A 5D93B 5F7EL 4TUOB 2B1AL 1YQVH 2X6MA 4WGWB 3TNNA 1YNLH 4JO3L 3C9NB 2AABH 2V9QA 3DETC 1CGVA 1DQQB 4G80A 5E4IA 2AK4E 4XAWH 1KTLB 4PTUA 1NSNL 4LEOB 3DV6A 4IMKA 1NJ9A 4NOFA 2JELH 3RP1A 12E8L 2NY4C 2C4XA 3QRFM 3C8HA 2VQUA 1I3UA 2EYSA 4L3CB 4LPUA 1S7TA 2Y5TB 2AK4A 3NVQA 4P9MH 2VC2H 2E7HA 1Q1JH 1FIEA 2XG4A 3C5JA 2BFVL 3PNWB 2CJUL 1IGTB 3QG6B 4LCIH 5CP3H 4CDGC 4AJ0A 2FYYA 1TQBB 4KXZI 2V7NA 5I16B 3S96A 5T3XE 2XZAL 2FWOA 5L88L 4F2MB 4QRRB 1QYGH 3P4MA 4JFPB 5HHNA 5HHVH 4JFYA 4QXGH 5EU6D 4YDVB 2APWA 5BRZA 5B38G 4HW6A 5T3ZD 3RU8L 4HK0B 5EC2B 5HYFA 2W0PA 4FFZL 3WD5L 5I1CH 2Q8BL 4XC1L 5L0QC 4U1JA 3ZL4L 3KPNB 4YC2B 4ELMB 2C3WA 3KPQA 4Y4HD 1INQB 3MROB 1YJDL 5DJCA 5IHLB 3ARPA 4ONHB 5J6HB 3TT1L 1IAIL 1HN1A 3A6CH 1GHFH 1A6WL 1ODAA 3DX7B 3GGWB 2NY6B 3BH9B 1I3GH 5IMMA 3EYVA 3N1GC 2HVKA 4GXUN 4X7CC 4X4YA 1AGFB 4PJFF 4KROC 3MV8D 5GS1C 3CDFA 1ZHBA 3CFCH 2OP4H 4I0PB 4W4NA 4FXGA 5D5ME 3G6JA 3QWOA 3CH1A 4XC3H 4LDEB 1CQKA 1FCGA 4JFDE 1ZHLB 1HWHB 5FYKH 1BOYA 1T2JA 3EGSB 3DURB 1F13A 3T3MF 4Z7WE 3W9EA 2BVPA 4J3OC 4HF5H 3SHSA 4JE4B 1RMFH 2AK1L 2HWZL 3SKMB 1IAII 5HGAB 1NBVL 4M8VA 3L1OL 3E3QE 3QPXL 5MI0C 4P9HC 3SDAB 4O5LL 1R3HB 1HYRC 4JFOB 4Y4KC 5IT2H 4OFIA 3FMGH 2ZNXA 4MZ3A 4KDTA 3K74B 2WAHA 1LO2L 2HN7B 4K71C 1QFHA 3QDMD 2X09A 2ICWB 2ZCKH 1X9QA 4WFFE 3TJEL 5JNYB 1DVFD 3BKCH 5ENWB 3ZO0A 4JREB 5JOPD 4Q6YA 3QIBD 3RJDA 3EJZD 4HPOH 5JORB 1S7QB 1CL7L 1ND0A 3L95A 5C70A 5IUSA 1UZ8B 2KH2B 4I1NB 3D87B 2WUBH 1WTLA 2FBJL 1TVHB 5ID1B 4KRPB 3T0XA 1NAMB 2GIYA 3MV7A 2AQ3A 1BQHA 4NQXA 5IB4A 4GQ9L 4YDIL 5D2LF 4KVNH 1EMTL 4CMMB 3KPSD 2HKFH 4L8BA 3WO4C 5EBWB 4LCYA 4ZSOB 2YA0A 1QLRB 4I3SH 4PJIB 4FFVC 2Y06L 5T1DH 5CCKL 3V0AC 4Z78A 4ZUUA 4FQ1H 5DHVH 5E5UB 1LDPH 3VG9B 2BX5A 1MCLA 1JGLH 4NWTH 3BP4B 3RKDC 5FFLA 1CFSA 5DUBA 2BC4B 3BRGC 1I1AB 4YUEH 2YRLA 4LNRA 3ZTNH 3C08L 3BGFB 4PG2C 3S5LB 1BWMA 4NJ9L 3WHE0 4OF6A 4NSKA 1BLNA 3UCRA 3DROB 3GSOB 3N9GL 5C07B 3KPPB 3FHAA 5D4QA 1DFBH 5KVFL 1MUJB 4HAGA 1MLBA 4LGSB 1T6VN 4X80H 2MCG1 3HC3L 1JZ2A 5K33A 1YY9D 2WINA 4M3JA 1RZ7H 1IC5L 2JB5H 3LKNA 3QXDB 4LSUL 2ZPKH 1MPAH 4Y5VC 1UQSB 4N0UA 4WI6A 3WV0A 3F7VB 3HNTL 2QSCH 3UJJH 3TBWB 3NIGE 1J87A 4OCSH 4KV5E 4H20L 3VXUE 1FO0A 3QPQD 4WHYH 4IRSC 5DJDB 4F9LC 5DC4B 5I1HL 3S35L 2IWGA 4L29B 5I75B 4NZUL 4M7JL 4APQA 1BJ8A 3HAEG 2A2QT 1YYMH 4FP8H 4U6VL 4K9EH 2H8PA 5IVXF 4Y16B 5JW4N 3QI9D 5ITBH 1WVZA 2RHEA 4G7VH 2Z91A 3MJ8A 3OXSA 4GO6B 3G5YA 1T2QH 2IH3B 3NA4A 5FO9A 3HI5H 2VXVH 3P9LB 1TJIL 3PWLB 1J1PL 1U91A 5AZEL 1UKSA 1RV6X 3O0RL 5F3HB 2GUOB 3BZ4A 4LSDA 1YEJH 4I9WE 4ZFZA 2B4CC 2LQRA 3RL1A 1I8KB 4L4VE 4WWKB 3EO9H 2OTUA 1MRFL 1B0GB 5CWSA 2GY7B 1INEH 1C5CH 5B3JE 1D3CA 3KPMA 3V8OA 4R4FL 4UU9A 3W9DB 1C08B 5E94A 2NY5C 3D3VB 3O6KL 3NZ8B 5E70A 1ZVHA 3QSKB 4AIZA 2X70B 1TTUA 4L4VA 1ES0B 1MEXL 1P6AB 4NN7B 2ZG2A 2X1PA 3FQRA 4OV6F 4X5XB 3KDMA 1NGZB 1UJ3B 4TSBL 2B7DT 1J7VR 2JJSC 4OD3H 1HXMB 4E42A 3RZWA 2W07A 4JKWA 5CZVL 1EPFA 1IT9L 1UKQA 1K6QL 3MRMB 3C60B 5HI5D 3U30B 1U41A 5KTEH 2IQ9H 3GBML 5HDBE 1F8TH 1PKQB 2DBLL 2BZDA 4POUB 1AIFA 5KOMC 2YPVH 1IBGH 4IOFD 4AT6A 2X4SA 4ODTH 4UZGA 4YR6B 3H7BA 3PQYD 3UYRL 1W0YT 2FHBA 3PG2A 5HVWA 1A6AB 3PWUB 2D7TH 3AAZA 1JGUL 4DGYH 2CKBL 2ZUVA 5CBAA 4YBLC 4IRJD 1OAZL 5T3ZE 4U1IA 3T77B 3DUHA 3MFGB 2BJML 3MNZB 1MHHB 4H5SB 4YH6A 15C8H 4MD0B 3GK8L 3E1F1 2FX7H 3V4PH 4WI5A 1UM4H 2AABL 4EUPA 4HUXA 3RWIB 3HTLX 4DGIL 5EU6A 1LQSR 1S7XB 1MH5A 3OAYK 2JELL 3QDGE 3JUYA 5DEGB 5ERWB 5DQDH 1A9EB 1YPZA 1V3JA 4Y4HA 4ERSL 5CZKA 3OKLB 3GJFK 1YYLH 1UWXH 4MD5B 2J88H 4KTDL 1RUPL 3RRQA 4MJIB 2P1YA 4XWOC 3MV8E 5MP6H 5F7YC 4GMTL 3EBAA 1LE9B 2C4FT 1XF3B 5FO7A 5DD0L 1BPVA 2F54D 3NCEB 2B5IB 4OSUH 3PJSB 4H1LB 5SX5H 1FGNH 3H8NA 5LQBH 1RUMH 5HHVL 2UUDK 2OXHA 4OIIL 4DWHA 5TF1H 5DGQA 3H6JA 3IAGC 2V2TA 2W91A 2ARJB 1N0XH 3BX7C 1U8IB 4KPHH 5KSBA 5CBEA 3QO1B 4AZ8A 4LHUG 4N8CH 4L9LC 4Z7QE 3A6CL 3BO8A 1S9YA 1ZA6B 3DWTA 1IAMA 1I3GL 1FNAA 1PG7L 5D5MB 8FABA 1OF2B 2VL4A 5ICXB 5E8NB 3TH2T 1YMME 4G42A 4ZOAA 2OSLB 3L3IB 4R2GD 5L8JB 2WBJB 4YX2H 4JFDB 3NFSH 5D7LB 3FFDB 1QSFB 4LLWB 1CDGA 3I75B 1FPTL 5EPMB 1YEKL 4EIGB 4M7ZB 2OP4L 4R0LA 5IWLC 3L6FB 5D7SL 1L7IH 1IM3B 4Z7WB 1X5FA 1IFHL 2QQNH 5C8JA 1BD2D 1NC4D 4PJDF 4ALAH 4KI5C 2I60L 3DMMB 4CBPA 3BIBX 3QDMA 5FAAA 2I07B 1I4FA 4G6JL 4XXDA 1KIUA 3RNKB 1KB5B 4LKCB 5DRWA 4JLRB 1WV7T 1DVFA 1RMFL 1YMHA 2MSPA 2Z31C 1RZKH 5EOQH 1H3PL 1X5IA 3U46A 3QIBA 5D1ZD 4NCC1 4ELKA 3IVKB 3PDOA 5HPMA 2FSEA 1OAQL 1IL1A 2YKLL 4OZHA 3REVA 4Z0BL 4XWGH 3OX8A 1TETH 4CMHC 4WDIB 1DL7L 3U0PA 2FJFB 3FO9A 4YQXH 4U4BA 2R2EA 3JWDL 4CVXA 4FQCL 1ZHNA 3ZKSD 5IB1A 1V3KA 1YN7A 3FQTB 1JNHB 1H5BA 2V7HA 1X3DA 3KPSA 4LSVL 3CH8A 2G2RA 1A7PH 5DHYA 3BKCL 5C0GA 1HSBA 5IBLC 2Y36H 1NMCC 4UINH 3I85A 4M5ZH 4YBHA 3NA9H 3MCKA 3FB5A 1SJEB 5F9OH 3LIZH 2EC9U 1FZJA 5BS0B 3VI3F 4P46C 2DWDB 2W0FB 1QRNA 3EYFB 1LEIA 3D69B 3NBNA 3B8YA 2L0DA 4O2EA 5KAQF 3ARBC 5SWZD 4P59H 1LILA 5CEYA 5C71A 4ZAKD 3UTPD 4XAKD 3MJ9H 2XWJB 3CSGA 3MRLB 3GSNH 4XPGH 2ADIA 2HKFL 3CX5K 4RMSA 4X4ZA 1CGUA 4TPRH 2GCYB 2AS5M 2VJXA 4YJZL 4KDWA 1ZKAA 4S1SH 3C6LB 1QSEE 1FVEA 3FCTA 4YIQB 3GSQB 1ZANH 5T1DL 1DUYB 1U8MA 4LRIC 5GXBB 3BH8B 5E5MA 5J9PA 4YHZH 5EFIA 3BPCB 1FH5L 3KNBB 1RIUH 5BJTA 3WKMH 3BYTA 2YD3A 2IGFL 1WC7B 4FQ2H 2YXMA 3QJFA 5BW7A 1DUZA 3OKYA 4JQVA 3ZTNL 1UACH 2LFGA 4XNUL 5GRZA 1RPQA 4PRPE 3FZUC 2DLIA 2ZWLT 4XRCA 1NC2B 1YEDB 5F9AC 1EVUA 4RGMB 3K7UA 2A9MH 2JLLA 4DVBB 4NO2A 3VWJD 2J6EL 4M1CD 4RISL 3SGJC 4WU7B 3L5JA 5FO8B 3DRTA 2DTMH 1TITA 5J3HD 4LCCA 3QI9A 4X5WB 1HHGA 3FB7A 4XCYB 3PWNB 3X11B 3N06B 4OLZH 1ZVSA 4C4KT 4XNMB 3IB4A 2FB4H 3ARFA 1RK1A 5KJRL 2R0LL 2VR5A 1RZ7L 3IDUA 2EDKA 4BZ1H 3KJ6L 4MWFB 5GIRB 2WWKT 3HA0A 2ICEA 3ZT6A 4BQ8A 1MCQA 4YFLF 4ESKA 3CXDH 4XBGB 4OI9A 3NACH 4JO4L 4X0KA 3AUVA 4R9HA 2A6JA 3V6OC 5JW4Q 3KWWB 3MZTA 2P4AB 3TN0D 1A7RL 3BJ91 3FO2A 5TE6H 2XACC 3F8UB 2VISB 2YBRA 4YEFA 3UTTB 2NY7H 25C8H 4I5BB 4K9EL 4XVSL 4S2SA 5ITBL 2J3SA 2OYPA 3OBAA 4Q6IA 1MVUA 2DJSA 3TZVA 1BQLH 9CGTA 1KXVC 1QLFA 2GK2A 3OG4B 4E0RA 2PF6A 4UNVA 3SCMB 5GISL 3SE4C 3QBTB 1Y6NR 5GGSY 1RHHB 3MRBB 3K2UL 4M3KB 5BVJB 2A73B 3FQXB 5E95B 4AY0A 1IVLA 2GFBB 3RIAF 1U8PB 2FGZA 4KH2A 3GJEB 4ZPVB 1V7NH 5IW3A 4JHAL 3D9AH 3MRPB 3LVEA 2C1PA 2FD6H 1I7TB 1T0NB 1WAAF 3PQYA 3ECBA 1MFAH 3HZVA 4IJ3B 5GRUH 4WTWA 1KENL 2OL3B 3GMRB 2XPGB 3WNPA 4IRJA 5E2TH 3HNSH 2ATKB 3QUZC 1MCOH 2MOVA 3V6FB 1L4IA 1U6AH 5D8JH 2AJYL 4ZFOL 5IEKB 3GKWL 5C09B 1CDHA 3OGOE 2IPKB 3CFEB 3O8XB 4ZD3L 3T1FA 3LOWA 2H6PA 5K93A 3OKMB 1KG0A 1F8TL 4PJ7E 4PRNA 1G6RA 3LDBB 4NNXA 32C2A 2BCKA 3RUGA 2NYYD 2YPVL 2PW1A 4GS7C 4WW2B 4ODTL 4J3TA 3MOAL 5MEOB 3BKML 4QOKD 3P4NA 1ZK9A 2IPUG 3UJIL 3TJHD 3IJSB 5HHMD 2R1WB 3PV7A 4WJ5A 3C5ZC 3IU4H 4K3EL 4IDJL 2VZUA 5D7JC 1DANT 4LQFH 1E4XL 3QDGB 4Z9KB 3MLYH 2F54A 1WBZB 5CEZH 2R29L 1QBLL 1MCEA 3CNKA 2FX7L 1IJ9A 1CXHA 4NRXB 4Z95H 5LG1A 5C0IB 5JQ6L 1K4CB 3F58H 3KXFD 2P24A 1DSFH 1O7SA 4ZOEA 4HS8L 3Q5OA 2J12B 5DQDL 4QT5A 3FRPA 4JN2B 2MPAL 3IJHB 1VACB 1MFBH 3SE8H 1CK0H 3ILPB 1G7QB 3QZWB 4DFHA 5KVGH 1RZFL 3VE0B 4PYHA 1S9VA 2WWMD 3VMNA 1OSZA 3U82B 3WEXB 2DKUA 1G9MH 3B9KB 1OGTA 3IFNH 3GB7B 1RUML 1T5WA 4Z76A 4D0BA 2P8LB 3ULVL 1QFWL 1E4XI 1SYSB 4C83B 1HZHL 5CJOH 3ROOA 5JA8B 3HG1B 2XQYK 2A9NH 4FOMA 3MRGB 1T22B 4H1LH 4OKVB 1YMMB 1N64L 1BD2A 5F93C 5B22A 1NC4A 4Q2ZA 1FNGA 1ACYH 4Z7VE 4LAQL 5F7WC 1H15A 1R3JB 5AUMB 3FT3A 1MJJA 1CN4A 1CFVH 4R8WL 4HUWA 3U4BH 2OJEA 4HWZB 2FJHA 4NO3B 3S3PA 5C2UB 2F58H 3VH8A 3ARGC 1NFDA 3NFSL 1GSMA 1E4WL 2EDFA 3WN5C 5LXGL 1ED3A 4PJGA 4U0QB 1OARL 2X4RA 5FF6B 3IAPA 3JV4A 5EBLA 1MCJA 4JZJA 4MXQC 1H3VA 4HPYH 3QIWD 2CDFB 4QRQA 5K59F 4PV9A 4HQQL 3IKCB 3OAUL 4KJYB 3VFTB 3IDXL 1SHMA 3G5ZA 5DTFA 3QEUA 1R24B 3ZDXF 5FB8A 3BWUC 5E08L 3B43A 1QA9A 2X4PA 2IAMB 2Y7QB 2XNAB 4WRLA 3QQ4B 5EOQL 2IBZY 3O2WL 1KEGL 2VQ1B 3MUJA 1NCWH 5SWZE 3I84A 3WLWC 4K9EC 3UTPE 4QYOB 3WL9A 2NLJB 2BOCA 4S1DD 1G7MB 2RJMA 1U93B 4CW1B 2Z8VC 4HKJA 3V0VA 2IEPA 3SOBH 4WCYL 4JO2L 4ZYKB 1QO3B 3HHRB 4KTYA 5IBUG 4ZAKA 2HJKA 4GW1B 5FYLH 4KWUA 4EI5D 2CK0H 1XCTB 3B2UC 4U1NB 5I1JL 1A7PL 4XGZB 4OGAC 1EHLH 1T66C 4KHTH 4PLJC 1J88A 2ZSVA 3T0EC 1G9NL 4YGVB 4GRMB 1Q9KA 3NA9L 4GRWH 3WFCH 1GGUA 5J12B 1XF2B 3MLVL 5KAQG 3WMSA 1MHPH 2HT4D 4PGCA 5F1NB 3QHTC 3G6AA 1GIGH 4V2CB 4OV5A 2GSGB 3H42L 2W9DH 2Z4QB 3K1DA 1QSEB 5AAWA 3TIDB 1TQCC 4YDJB 3MLSH 2RBLA 4AEIH 3MJ9L 1A4KA 3SDDC 4IOIB 2VDQH 3SBWC 1A14L 1NCTA 1T21A 4XPGL 1ADQH 4NKDA 5HSFA 4PG9A 1F3RB 1PBYA 5D71L 2D9QB 3PV6B 1XZ0B 1F4YL 1NAML 1JFQH 2VXQL 3QUKB 4PJDA 3FOLB 5SWSD 4IBLT 4F80A 3W11D 3P0YL 4RIRB 4LQ1A 4PRPB 3H9SE 2Q1EA 1MSPA 2X41A 1S7RB 3L3KA 4P23C 4GRLB 5LWYH 1HK6A 2FGWL 3CCHA 3QQNA 3LN4A 1RFDL 4LLDB 4FQ2L 3RZCC 3VRIB 3GBNL 1T7YA 1UACL 2QQLL 5DQJA 3THML 4NYLB 4KGLA 3PIQA 2ICWI 5JIIA 5C0EA 1FJ1A 3GSRB 1KEMH 3OGCA 1QUNA 4HG4J 1A0QL 1MHEB 3TN0A 4YBQD 2Z35B 3PGDA 2RAMA 1MAKA 3LD8B 3D2UB 3HFML 1II4E 4F58H 5TQ0H 4RAHA 3UYPA 3O6MH 5D9SA 3JZ7A 5D93C 4KQ3L 1XGUA 1U8NB 2V9RA 1LNUB 3OF6A 4TN9A 3T04D 1LD9A 4LLYB 2YD9A 1D9KA 2W9LA 1TNMA 2IANB 1KXQE 1UG9A 4PY7B 1HQRA 3VMOA 3VWKD 1XIWA 4NM4L 2LVCA 4L4TD 4GW4B 1Z9SA 3WXWH 5CFHA 2X4OB 3U7YL 5BXFB 5IFHH 4WW1B 4XVTH 4HK3J 4JZOB 4NUJA 1AO7D 4FQQA 1WCQA 3STLB 2IFFH 2F8XC 1A3RH 3S37H 4YPJA 25C8L 1J0KA 1EEUA 4MQ7A 1G1CA 5EA0H 2DQGH 5C92A 3WLBB 1TQBC 3R0MA 1MCDA 1WSST 5FOBB 5FK9A 3E6HA 3EOTL 3O9WD 2EDRA 4QGYA 2CLVB 4YDLC 1NKOA 4IRZL 5A16A 2GAZB 2PCPB 1NCAH 4WHTA 3WIHA 1A6TB 2WIIB 4XPAL 4KUZH 3KJ4C 2DB8A 4NNPH 3WIIH 2BVQA 4M7LH 3VD3A 1NMBL 4QOKE 1CIDA 1G7JB 3LPWA 3HE6D 5HHME 1CLZH 5B8CB 2HAZA 3WFDL 3BAEH 4IMLB 1T1XB 4DN3L 4MGXA 3KLSA 4Z7UA 5ESVB 3OXRA 4HKBB 1A02N 2SEBA 2GHWB 2GJZB 3ZTJH 4GMSL 2CRIA 2X2YA 2Z0BA 5EBMB 5TDPB 1NGXB 4CNIA 1QACA 2JK5B 2O5ZL 3BKYH 1UFUA 4I0PC 1AXIB 3R06B 4PJ7B 5CHNB 2R4SH 4Y5YA 4ZNCD 4OTXL 4XPBL 3ZKNC 1OQOA 4KUCF 2WUCH 4X6EA 4OUOA 1RZKC 4N8VA 2Y07H 4WFHE 1U95B 2OL3H 4FQXD 5DJZA 1HI6A 4W4OA 2VABB 3KXFA 4LVOC 1IQWL 3M1BB 3PL6D 2R2HA 5CILH 3INUL 2E7LA 1T0MA 3U4AA 2YS4A 2EICA 1GH7A 3HNVH 1CICC 3QAZB 3G08B 4HIHA 1U58A 3IGAA 5L8KB 1FRGL 1CVRA 3IXTB 2O5XL 3B9EA 2DQTH 4HS3B 4RRPG 4NRYB 3JXAA 1CDCA 2QTEA 4LQFL 2BDNH 1P5UA 1WIPA 5HGBA 1S3KH 4RFEB 3VXOA 3SDAC 3GJFA 5ICZB 2BHUA 4OZFA 4HJGB 5FKPB 3MRQA 4O9HL 3F58L 2H32B 4LBEB 5EU3A 1DSFL 3O2VH 1HQ4B 3VJ6B 1BX2B 4HFWB 3LEXA 1T80A 3J7HA 3S6CA 3T4AA 3NIFE 4AEHH 1P4BH 1UM6H 3FQUB 4M02A 4YFEA 2CGRL 2HT3D 2BY3A 1ZHKA 4G6FB 4Z8FL 3ULUD 1JPGA 4OZIA 1R5IA 1UH3A 4KKCC 1G6VK 4Y4FA 3FTGB 3E2HC 3LH2H 4GAYB 5EU5A 5BMFH 4YPGA 2ICES 4JDZB 3VFPA 1CFNB 2X05A 1LP9F 3T3PE 4CUCA 4XNQA 4EQ2A 5JR1L 4PJCF 3ELAT 4KRPC 5FA4B 1WAAA 4B7LA 1SM3L 2FEDC 5T3XL 1JGVH 1UB6A 2B1HL 1HOCB 3VW3H 1J05B 3H9HA 3HI6H 4KRMB 4OKDA 5D7IF 3O6FD 5E2UL 5E4EC 5KSAB 1H8NA 4Y2DC 3BZEB 4C56E 5LBSL 1LEGB 5KG9A 4KY1H 3RTQB 3ET9F 1S9WA 3QRGL 4BH8A 5BV7L 4WHYG 5DO2D 3O3EA 3V4VH 1JHKL 1NLBL 2JCCE 1OP5K 4EOWH 1Q72L 4PLOB 1QVOA 4HXAH 1KLUB 3OKEB 4ZTOH 5FYJU 3U4BL 4TTDC 3C5SB 3RWFA 2CLRB 3QUMA 3CAFA 1I1AC 2YSSA 1ZWIB 5DVKA 1IGIL 5I1LA 3BGFC 5I0DA 2NQCA 1DBML 4NPYB 2WP3T 4CN4A 3QH3A 3QHZH 2DQJL 4X6CE 4JFFD 3RDTB 3UMTA 3MREB 4GAGH 1R0AH 1RJLB 1V7ML 3O81A 1WEJL 2FZ3B 5DDHB 4HKZA 1DBBL 4XP9L 5GZNC 2PR4H 5DQ9A 4PJBE 3BP5A 4OZGF 2Z92B 3N1PC 4F7PB 1E6OH 2XKUA 5ESQA 3RWCA 4OM1H 3VCLA 1RIHL 5T5NG 2BSSB 4N5UA 4HWUA 3WUWG 1JV5B 1TZHB 4E41A 1NCWL 1P7KA 1TTFA 2R8SH 1T1YA 5K9OB 1FFOA 3SE9H 3K8LA 5HDQH 4R7DA 3JVGA 4P4KB 3VRLF 3QEGH 4JJ5A 3EAKA 1KB5L 4PJHE 2X4QA 4K7PX 3HZYA 3R8QA 5I75C 2BNUA 5BZWB 1OCWH 5MENA 1OM3H 4LCWE 5SWSE 3KPRA 2C5DC 3EZJB 1J1XH 1A4JA 3F12B 4PJHA 2R23A 3VWJB 3HC0A 3DVGB 3K46A 5F7HA 1ZGLM 6CGTA 1CGTA 5SWSA 1RIVH 3U7WL 4KK6D 3FN0H 3NOIA 4JJHA 3VFUB 4RAVA 1ZLVK 1AY1H 5F1IA 4LDLB 4W6YB 3VXSD 1IGMH 4WWKC 5IHZA 1T04B 3KYOB 5DSCA 5CGTA 2XFXB 2Q87A 3HE7B 4RBPH 1NEZA 1MAJA 4YHNB 4AEIL 4DKFH 2X1QA 3TIEB 3IJYA 3QUYC 5HD8D 1KYOK 3H9SB 5IIEA 3SKOA 5HXMA 1YEFL 3TVMB 4NM8L 3WHXB 2BVEA 4UTBH 1FAIH 1UJ3C 3MRJB 1LGVA 1MRCH 1MCFA 4EN3B 3HPJB 1EFXB 4L4TE 2XTJD 2BNRD 1CGSH 3N1MC 1P4LA 2NY0C 3H0TA 4PGBA 3C2AL 3U30C 1MIMH 2V17L 2YC1B 5HGDA 3UZEA 4PRAA 4OQ1A 1LEKA 5C2BH 2HTLD 3LY6A 5D6DC 3VWKA 3BHBB 4QTHB 2ICCA 4LASL 4LHUD 4ZS6C 3STZB 3WO3B 4N0YH 4HCRA 4KAQL 3T65B 2VLMD 4GG6E 2YA1A 4U6YB 5CLTA 1AO7A 5B39G 4YZFF 3QXAA 4MAUL 1OD7A 1VB9A 4F58L 5F1OB 2JJVA 5EZOL 4R4NC 1TJHL 3OKDB 4N1HB 1U3HB 4OF0A 1Z3GH 5FEBA 3GUTA 1QP1A 1UM5L 1J0YA 5D2NC 3DI3B 1KPUB 2VYRE 2VDOH 1G9MC 4KU1A 1MCSA 2N1KA 2EH8L 1JMXA 1CD1B 2A6KA 2W65A 2ADJB 3IDGB 4LK4A 2Y6SC 1MQ8A 4WUUE 3SPVB 4ISVB 5D1XD 1T20A 2IFFL 1D5BA 2QBWA 3DNKA 1K85A 5I66B 1IQDB 1DEEA 2A77L 5DMGC 1X4XA 3IRZA 4J8RB 4LP5A 5ISZA 2B5IC 4NFDA 4PBXA 1AGEB 3MRNB 1MCKA 4X7SH 4P0DA 3RL2B 1J18A 4QTIL 3BUTA 3G5XA 5GGRA 5HHMB 3OTTA 5K9QI 1HEZA 2LVEA 3V6BR 3GHBH 5FHAL 5I76A 1ZA3A 4HUVB 1G7LB 3T2QA 4JHWH 1B4JL 4KMQA 1DN2A 1FE8L 4NZJA 5HHOA 2J8HA 4QHNA 4JVWA 1MF2H 1AFVL 1WWCA 4HFUH 2DI8A 3BAEL 4X6FB 3PL6A 4POYA 1W2KT 3T8XA 3MGOB 2AV7A 1JZ8A 4MNGA 3RWEB 3RKDD 2WBJC 3VXNB 4Y5XB 1T83A 3OHXA 3MGTB 5DRNA 4ZUSA 5E6IB 1Q9OB 5HYSA 3BKJH 1CFQA 4YXLL 3DRQA 4ZXBB 1U8OB 3QXVA 4GJTB 1SY6L 2MCPH 3O3AB 2I9TB 4HWBL 1GZPB 4GRWF 4NO0A 4ZFGH 3TWCH 4TNWK 5DA0B 2OL3L 1ZS8A 4NQSA 4O2CA 4QF1B 3DMMC 4NKOB 3F7YA 2UY7A 5ALBH 3LB6D 4M5YH 1ONQA 4X6DE 2AXGA 3I02B 5IFAH 4UQ2B 2HRPL 3BXNA 1IEAA 4JY5L 4JANB 2OR7A 5T1MA 5L6YH 2UWEF 5DVNA 4TTGA 3SJVE 5EUKB 1KELL 5T3ZL 4M00A 2BDNL 2COQA 5JPMA 2EYRA 1J0JA 2AP2A 4PJXF 5DA4A 4C55A 4IRSD 4R7NB 3IFOA 1S7TB 3SDXF 3O6FA 3GM0A 3A6BH 4LLQB 3JWOL 3C5JB 4LLUA 4GBXC 4DCQB 3RVXC 1TDQA 4O51B 1HH6B 3V4UH 5HYIA 4DZ8A 1DLHA 3HI1B 1JNNH 3O3BA 3BFOA 4I77H 1GGIH 2HFGL 1OT2A 1XAUA 3QIWB 4M9OA 3P4MB 3MNVB 5HHNB 4JFYB 2H32H 4NC1E 3LH2L 5BMFL 5HHXL 2HFFA 3TYFA 4HC1A 4UUJB 4MLIA 1OVZA 4C56B 4HIEA 2NY1B 3VI4F 4DN4H 5IG7A 3ZMRA 4AMKL 1A9BB 5IVOA 3KPQB 3GRWA 1JGVL 3QUXD 1AHWA 2R69L 4RGOH 1HINH 2HJFB 2M2DA 2BMKA 1Y18B 4P3DB 3GHEH 1DQML 1IGYB 1MELA 5E00A 5IMMB 4JFFA 1JGEB 3AS3A 1LO5A 1IAKB 5IJKC 1BIIA 1FGVH 4LMQI 1D5MA 3JBG7 1AP2A 4JY6A 5I8OH 3QDJE 1A2YB 1GCFA 1U2CA 1IEHA 4FMKA 5FUCC 4U1GB 2UYLA 4ZODA 3MA7A 1ZHBB 1S8DB 2A6DA 4X6CB 5A43C 3G6JB 5FDWA 1GC1H 1GGYA 3CH1B 4RFNB 5CIPA 1G1YA 3RGHA 4YDKH 3WNMA 1J11A 4N8PA 5DR5L 2BVTA 3EYUH 5E2WH 5CJXA 3MUHL 4RGMC 3ARQA 5DJXB 7FABL 3L5IA 4NOBA 5TGBA 1M71B 3W9EB 1R0AL 1R5WB 1EGJA 2C1OA 4GAGL 1JK8A 5T33L 3F62A 4JAMB 2ENYA 3GI8L 2PR4L 3VXQA 1MJUL 2YEZA 4L8DA 2X4UA 2OMBA 1CDIA 2CR3A 1R5VB 1B2WH 2FHCA 5FUZH 1NBYA 4FQLL 3LRSA 4LAJH 4FFYH 4P5TB 1KTKE 3VXSE 2X9XA 4LVEA 2ZCHL 1RD6A 3CC5A 1U2HA 4LCWB 3TF7C 1OTTD 3O4OC 1LP9A 3BP7A 4QY8A 1MFEH 3VXSA 5DT1L 1FZMB 4PJCA 1O7VA 2KL6A 5B38B 5E99H 3D0VA 5IV2A 1I9RH 4QXWA 1JZ5A 4WI3A 1R3IH 1U8JB 4QXTA 4F57L 1B0RA 3N1QC 4ODVL 1D6VL 3L3HB 4WY7H 1N2RA 1FYTD 3UPAA 1AGCA 4MJ6B 4PV8A 4JFZL 1M4KA 1Q9WA 4YLQT 5EG6C 2G60L 1KJ2A 3WIFB 3ARWA 3MV7B 3FN0L 4CGTA 5F89B 4NQXB 4U7SA 3S88H 4DW2L 3EFDH 5L2KA 3JTSB 2W60A 3BT2L 2BNRA 2BY0A 3ZHLA 1PAMA 3HS0A 3QEQE 2BSED 1AXSA 1MI5D 4Q0XL 2DQFA 4LEXH 1JI1A 1L0QA 4S1QH 1I8MA 3JV6A 2AJZB 4ORGA 4PJFE 4Z7NF 4F37F 2BSTB 4IJ3C 3V95A 4P57A 2ZOKB 3V0WH 2IQAA 4D94A 2APBA 1B6DA 1CXLA 1NGQH 4UTBL 2Q3AA 1D5XA 5EUOA 5IOPB 1CFSB 5EORL 1AXTH 3TO4B 5DK0A 4FZ8H 4IIQA 4Y1AE 4XMLH 1C1EL 1B88A 1A7NL 4NSKB 2P46B 1MJ7H 4JRYE 1CXFA 3AM8A 3O9WB 1BZ9A 2EDBA 3MRHB 2NNAB 4Q9QH 4KI5D 4RNRA 4PLKC 4YWGH 3R0NA 4U0RC 1JWUA 1SEQL 1DQLL 4QWWC 3LMJL 4XT1C 1JBJA 1VENA 2JB6B 4H26A 1JPFA 3BI9X 3FKUS 4NN5B 1RSFA 2Z31D 2D31B 4H1LG 4AIXA 5F21B 1MWAB 4NN6C 5D1XA 4TRPL 4NUGL 4TSCH 2XYCA 4XMKL 4NP4L 4N0UB 4Z6AT 4TVPH 5T1LD 2EKSB 2OI9B 1P2CA 4EVNA 1KGCD 1MCIA 1AD9A 1F2XK 4U2YA 1KIQB 4RMVA 3MBEB 4WUUB 3RGVC 2IPTH 5E8PB 5CEXB 3CJJA 3VD9A 4HKXB 3OB0K 4P2QA 3O2DA 4K94L 3RWJB 1ZOXA 5E8DH 4WO4D 2PO6B 2HRLA 3I2CL 2MQ0A 2R56H 3IETA 4J1UA 1HXYA 5F6HJ 3JWNC 5K9JL 3G5YB 5HYJE 1UEMA 1U91B 4G6MH 5D2LE 1XMWA 4QEGA 4OQTH 5T5FH 1CIUA 1P9MA 1JYWA 5JPNA 4ZFZB 3ARBD 1PSKH 4FMFA 1H8SA 5JUEL 5CWSB 1W0VB 1W72B 3G5VA 4XP1L 3L3OA 2JE8A 2LTQC 1XF1A 2AJXH 3KPMB 4U2ZA 1XGRB 1U8HA 5CAYB 6FABL 4BH7A 5E94B 3PGFH 2VITB 3BMVA 2HMIC 2FR4B 2W0KA 2HVJB 4KHXL 1KUMA 4PGEA 1GOFA 1WCBB 3GNMH 1NMAH 3NFPA 2HJLA 4FXLA 3MYJA 5JXED 5DVLA 3PWPD 1BFTA 3MV9D 1R3KA 2ZOLA 3SE3A 3UC0H 4PJ9D 5EC1A 1TLKA 4FXKB 4Z7OE 4YK4B 5DF0A 4G6KH 3MBXL 1HHIA 4BSVA 1J8KA 5AG8A 1KJMB 4RMUA 3FZUD 5EH1A 3WNLA 4X6DB 2J4WL 3RWHB 1AIFB 1NCCH 2BVOA 4AT6B 3TWCL 3H7BB 3UTZB 2WK2A 4MMXC 3S9DB 5LGKA 3MJ6A 5CBAB 3HRZA 1MJ8H 4XVJL 3SJVB 3WFHA 2HKHH 3QULA 3QHFL 3B83A 1N6UA 1V05A 3GSVA 4M5YL 4U6HA 4OAWB 4Y19E 4JRXD 5FGBC 4OM0H 1NGPH 1OY3B 1J5OL 3BIAX 3MLWH 2VLJD 2AJUH 4EUPB 4HUXB 4YHYC 1XCQB 3VXRE 5GRJH 1KBGH 4FQHB 1MH5B 4P5KA 4P5MB 3SDCB 3WDHA 4OFKA 1YPZB 4HIIA 5GS0H 2PYFA 2ITCB 2AJ3A 3QUXA 5DVMA 1N59B 3PGCA 1BIHA 5J1AA 3QG7H 5DK2B 2YMXL 3TCXA 3ESUF 3FFCD 3FAWA 5FO7B 4G5ZH 2YD1A 4ZQKA 4X98A 2NW2A 1FNFA 3P0VH 5KANI 3I6GB 1GGIL 4I77L 4YE4H 1BVLB 5IF0B 1RULH 4K3DL 3X13B 1QFUL 5K9QG 5IMLB 3ZLQC 4P3CL 3U1SL 3RPIA 5F7DB 3RNQA 1JMZA 2VKWA 1VGKA 4L3ED 4U7MA 1NLDH 2CLZA 4QXUL 3NCYS 3ZE1F 4RGOL 4HZAA 3T09A 3QDJB 4PJEF 4EIZC 5E8OB 1JHTA 4XNYL 4P2RE 2RIKA 2D03H 1GGBL 2NY4B 3EHBC 5GGTL 2BRQA 1EERB 3NCMA 1CE6A 4XP5L 1JGDA 3WFBH 4JKLA 3NCYP 4QRSB 3RY6A 4KQ4L 2JIXB 5FYKD 3QFJE 2LU3A 2IALB 4JN1H 1CG9A 5EZLA 5ADPH 3O11A 1I1YA 4N0FA 4F7MB 1HNGA 5AYUL 3LS4H 3HN3A 1CFTB 2XQBL 3BOVA 4PRID 5D7KD 3U0WH 1GC1L 1ZMYA 2Y25A 1BF8A 4KK8C 1WZ1H 3Q6GH 5HI4C 1NH6A 1Y6KR 3EO1B 5C3TA 2UVFA 5L0QB 5E8EA 5F88A 2ESVD 1FYTE 1TVBA 3DYOA 1VPOL 2VAAA 3RHWF 5DRWB 2NY3D 2YPLE 3LD8C 3MC0A 3UJTL 3C5ZD 3K4DA 3QJHA 3SDXA 4K23H 3U46B 3TBYB 1B2WL 2H3NA 1JWSB 5GGVH 2YD8A 5DD3L 5C0BE 5HPMB 1BQUA 4MJ2A 4KJPC 5HBBA 4FFYL 4ZS7H 4UV7H 1KLGA 4O58H 3OX8B 1PLGH 2HFEA 3WS3B 3ZTJG 4I8DA 1F3DJ 3FQNA 3U0PB 5EOTA 2N7AA 4NDMA 5DMYA 5H8DA 1RHFA 2YOCA 5DK3A 5JIHA 2QQKH 2AEPH 3ARED 4KROB 1J0ZA 5GS1B 3MPCA 1QOKA 2O93L 1YN7B 4UDUA 2DM7A 1MFEL 5EO0A 2R0WH 3G6DH 1RZJH 2G2RB 1MI5A 3P0GB 5KVEL 4W6XB 5C0GB 4DQOL 1HSBB 4ZNEA 3MR9B 3TGXA 5K9KA 1F11A 2NXZD 3MLXH 1R3IL 1OGAE 1INDL 3LKRA 2FH8A 1ITCA 3MCKB 3HUJA 5GQBA 4DKAA 1EUUA 3RVVC 5JTWA 1FZJB 2MNUA 3QEQB 1DBKL 1QRNB 1YEGL 1RJYB 5F72S 1A6UL 4O2EB 4DGVH 1SQ2N 4KI5E 4Q74A 5CEYB 1TIUA 3L3GB 4NZTL 4PJFB 1MFNA 1VGEH 1AI1L 3EFDL 4QNPF 2Q7YB 4AH2A 1CWVA 4E5XA 2ADIB 4EXPX 4RAUB 2XXCB 1I3RB 3K2MC 4K3GA 3OB8A 3U9UA 4Y4KB 5B8CC 3M45A 5TQ2L 3CU1A 3QB7C 4WHDA 4JM2D 1FVEB 3DX8A 3FCTB 1MFDH 2CIIA 1TMCB 4K71B 1UA6H 4Y1AB 3V6ZA 3GMQA 2BOBB 2YUXA 2V2WB 3NCCB 1U8MB 1D5ZB 2P45B 3O45A 1MREL 5J9PB 2I5YL 4MDIA 3F7QA 4JRYB 1G0DA 4F8TA 4UV4H 1HKLL 5BJTB 3N0PB 1C7SA 5ACZB 5C9JB 1AXTL 2LU4A 1MHCA 3T0VA 3EUUA 5FM4A 4NNYA 5E6YA 1EBPA 5T1LA 1EX0A 1X7QA 1S9XB 5TE7L 4PJAE 1MJ7L 1OWWA 3M17A 4XPFH 2GQHA 1Z0NA 5KW9H 4QRUA 1MCPH 5I30L 2DM3A 4A6YL 3DRTB 1LE5B 1T1WA 5EN2A 2EDXA 4BSWA 3QZWG 1JF1B 2OK0L 4WO4A 1BJMA 1IKNA 4UNUA 4PJAA 2VXSH 2IADA 4JCLA 1S7UA 3V5DB 1ZVSB 3WO4B 3DIFB 1XH3B 3IS1X 2AGJL 1U8KA 3ARFB 3WLWD 1CD0A 1CFBA 3X14B 4TSCL 1BGXH 4JPKL 5E0QA 3V5HA 3GFUA 3VGDA 4K8RH 2ICEB 1CR9L 1S7SA 4ODSH 2NR6D 3SY0B 1VADB 4LPWA 4X0KB 1IM9D 3ARBA 1FVCA 3O3DB 3AXLA 4M1GH 1KJ3L 2X5PA 4LIQH 1VSCA 1FN4A 5EU4A 5IFJB 3Q1SH 3S34H 3PWPE 1I7UB 5HYJB 3MXVL 5I19L 2VZ3A 5D2LB 2VLRB 4OGAD 4HZLB 3VI3E 1T66D 4PLJD 3QCTH 3TZVB 4P2OC 3HMWL 4POZC 5ICYA 3EYSL 4YNYA 4F9PA 3FT4B 4OLWL 5JXEA 1AE6H 3CVHB 3PWPA 2R4RL 3OV6A 3MNWB 3MV9A 1HYSC 2VLKA 2X4TA 3NTCH 2CKBA 4UILH 1KB9J 4HXBL 1KACB 4PJ9A 1NQBA 5CSGA 4GW5B 5GRYA 5MEPA 1CDUA 1FG9C 4FN0A 5KSAC 4Y5VB 5C0JA 1AGDB 2DQDL 5AEAA 3L7FB 3VFWA 4MQTB 3IDMB 1J86A 1CLYH 2ZCLL 1A7BA 1M7DA 2H9GA 2C1PB 1C5BL 3PGFL 3RTQC 5HY9B 1GC1C 5KS9E 3ECBB 3HLAA 1FNLA 2RB8A 1AKJD 2RCSL 5LGJA 2VLJE 4H88H 2J1KA 5KZCD 2AEQH 3CLFH 4UTAL 3TCLA 2E9IA 3C8KA 2H45A 1HHHA 4JRXA 2CUIA 1FL3B 1OAXL 3V6OE 1TTGA 3UC0L 3RVWD 1BM3H 3UAJD 4JHBA 2H6PB 4HJ0D 3WDJA 2DYPB 5CGMA 4NQDA 3D18A 4NKQB 2QHRH 1FFNA 1CZ8H 4GKZA 4PRNB 1G6RB 3FFCE 2VSCA 3RDTC 32C2B 1F4WL 2IG2L 2BCKB 2ILLA 2EDQA 1X5XA 5ANMA 5GHWH 5AYQA 4Y19B 1Q0YH 2D4DA 4KJWC 5HGHA 3UO1L 1CYGA 4G9FB 2E7MA 4PD4K 2WANA 3UTSB 4B5EA 1N26A 1C8PA 2VDKH 3BN3B 1VFMA 4WJ5B 3VXRB 5C0RH 4WGVB 4MD4A 4N0RA 2ZJSL 3QIUC 3T2NH 4Z5RB 5IVXB 5INDB 1KT2B 1JRHL 4X8JA 2P5WB 4H8WL 3K80A 2WM0A 1NUFA 2EH7H 4RWYH 4KTEH 4LHJB 2OR9L 1L9MA 3D1MC 4FZEH 1MCCA 1JYXA 3QQ3A 4L3EA 4QT5B 3CFBA 1OPGL 1HH9A 4LDOB 4MHHI 4ETQB 4KRNA 1OAUH 2VDNL 1I8LC 3ES6B 4KJQC 4X7TA 5FYKE 4EUPH 1JNLH 1IE5A 1MCRA 2N4IA 3VD7A 4AG4H 5F8QC 4ZPTB 4RCAA 1Z6JT 4QRRD 1ACZA 3CMOL 1OGTB 2MQCA 4GAJH 4YHPB 5D70H 1DDHB 1WUNT 2Q7NA 2VH5H 3KLHD 2F53E 4D0BB 5DUPH 5KSUA 1Y0LB 4JFEE 4W68A 4P2RB 1OTUC 2DQIH 5H35A 2ESVE 3OAZK 1A6VH 4PRIA 1TCRB 1JRHI 3HE7C 2B0SH 1OB1A 3QFJB 2NY6D 4NFCA 1OP3H 1BFVL 5TFSH 1ZLWH 1FNGB 3BSZL 1EJOH 2XWBA 3ZE0E 2ADFH 2J8UA 4AIOA 3FT3B 4JFXB 3ZSTA 3Q48A 1MJJB 3TVMC 4NJAH 3WFBL 2XY2A 3L5XL 1JPSL 2OJEB 2FJHB 1G7IA 3C5ZA 1YN6B 5ILTH 4I0PD 3S4SG 2RR3A 3VH8B 1M6OA 4D9QE 4OFPA 4M6ML 4XCCH 4XBEL 4Q9RH 3O6LH 1N4XL 1ED3B 1F3JB 4OIAA 2G5BA 2GTZB 3GM8A 3IYLW 4JZJB 4UI2A 4QHKJ 3U0TA 2NTFA 1K8IA 2PTTA 5IMKA 1SEBA 1AR1C 2YPLB 4JM4L 4PV9B 3AREA 3LV3A 1CLCA 5I18L 1NL0H 4S11A 1P1ZB 3G5ZB 5DTFB 2X89A 3QEUB 5C0BB 5FB8B 2VERN 4I4WB 2Q8AH 2DD8H 1QA9B 2X4PB 2YN5A 2NW3A 4NT6A 4HUNB 5EZIL 2BVYA 1V5JA 3P11H 1FL5B 5IROA 1Z9MA 2H26A 4DOHE 3MSPA 2BOCB 3SDAD 1E4KC 2DJUA 1U3HC 3CSYB 4KK5C 3TBSA 1I7ZA 3V0VB 3MUZ1 1FBIH 3NAAH 1HSAA 3L9RA 4G8EB 1OGAB 4HT1H 1UGNA 4ZO6A 1A7QL 3QT2A 4TUKH 4KVCL 5FCSH 5KANG 5LGHL 3GIVB 4XP4H 4NIKB 4KKCD 3MUGB 4JM2A 4BFEA 5MEQB 1PX3A 1L0YA 1T7ZA 1Q9KB 2DWEB 4OF7A 4OCYH 4UB0H 2J6EA 3OJVC 3UBXG 2D9CA 4KRPD 4YAQA 1WWBX 1Q8MA 4KDVA 5AD0A 2FEDD 1RAMA 2PETA 1FVDA 3G6AB 3WS6C 1ORSA 1F58H 5HDLA 4G43B 2P8MB 3BQUC 4XXCC 1RJCA 4CVZA 1A4KB 3BZFA 3P9MA 1T21B 1WZKA 4PGDA 3EJYD 5DJAA 4CMHB 3ME0A 4NKDB 4NGHH 4PG9B 2VNCA 1MFDL 3M8OH 1UA6L 4NCC2 2XIDA 4PJDB 3WJLA 1DBJH 5DZOA 4B0MM 4BZ2H 2J7LA 4C4KO 3D39D 4G3YH 4Y5XC 3LS5L 3F6IA 1I1AD 1F4XH 1NMCB 4KKAC 3CCHB 1DBAH 2EXYD 2CO6B 2WWKO 1RUKH 5K59E 3B5HA 4GXVH 5DEFA 2PXYC 1N8ZB 3GKZA 4ZXBC 1R3LB 5TH2A 1F6AA 5C07D 3CZFB 3ZDXE 4JPIA 4U1LA 4P46B 4TULH 5LAXB 2YZ1A 4UBDC 4XPFL 3HKFA 4HGWB 3OGCB 5GZND 3T0EE 1UWEH 4LF3B 3DUUA 2K3TA 3PHOA 4CDHA 5C0AE 2EC8A 2DF3A 2L4OA 5HVFB 2C3VB 2W92A 3IFLL 4OD2B 3GSWA 4KKBC 3RA7H 5CLWA 5GS0C 4F3FA 4HJJH 2E9JA 3KHQA 3FB6A 1LD9B 5IBUB 4L8CB 2VZTA 3KAAA 1W0WB 1X5KA 5KVDL 4D0DA 1D9KB 4XMPL 1YUHA 1HHKA 4IMKC 1RK0A 2C9AA 1XIWB 3MRDB 4PJ8A 1VEPA 2DDQL 1UWGL 3MUY1 3ILQC 1MWAL 3DGGB 3RAJL 1OAKH 4M1GL 5E24E 1A6ZA 3RIFK 2VLLB 4ZFOA 2I25N 2O26U 5JOFA 5FYJH 4Y16D 4HV8A 5IVNA 5TE4H 3Q1SL 1CE1H 2DBJA 2V9TA 3CDGB 2BERA 2AJVL 2QQQA 1KCKA 5E56A 4OLUL 3MCLH 3E6HB 4HIXL 1DQDH 1GZQB 4HUMB 4LKXA 1AKJA 4HH9B 4NO5B 5GGSA 2E8YA 2A83A 3GZKA 4UDTA 4OLVH 1A5FH 3G6JF 4WNQB 1JUFB 1Z5LA 1DLFH 5A16B 1WFTA 1DQJA 3NTCL 4WWKD 3DBXA 4UILL 5F7FA 4D0CA 3GEWB 2BVQB 3KYKL 1HHJA 3D3VD 3A67H 2CDGA 4Z7UB 1M7IA 3ZYOA 1IKFH 4D9LL 2XZCL 5F9JB 2SEBB 3BEWB 3KPOA 1SYVB 3SGKA 3RWGB 3U6RA 1A3LL 1WQVT 1NGYA 4HS6B 3CLFL 4CNIB 1W72L 2EE6A 1ZEAH 3C9NA 1MCBA 4BQ9A 1DQQA 3C60D 4X6EB 4LEOA 3MLRH 3VD4A 1X5HA 1S7VB 4I2XE 1HI6B 3ARDB 5F7KC 2R2CA 1UYWH 3FO0L 4L3CA 1F6FB 4ZS6D 4DZBA 4RZCB 3FQWA 2VDPL 3ZDYE 2Y5TA 1T0MB 3CFJB 4UQ3B 1UXWA 2KQMA 5DI8B 3RX5A 1EHAA 4R90L 3PNWA 1IGTA 3QG6A 5I16A 1A6PA 4R4ND 1G6RH 3RVUD 1H9VA 1RZJC 5F70A 5HGBB 4F2MA 4QRRA 4WU5B 3RVTD 1JZ7A 1IGCL 4YDVA 1UKTA 2R1XB 4HK0A 3HZKB 2D0FA 1FIGH 4M6NL 4KDTC 4LPVA 2MKWA 4XNXL 2A0LC 2XRAH 3KPNA 4OB5H 4ELMA 3T2PA 3QUZB 2E7BA 5EU3B 3GO1L 4RWYL 4KTEL 2EIBA 1IC7L 3MROA 2Y6SD 4ODWA 5TDOB 4ONHA 5J6HA 4K3JL 1CF8L 3BPNB 4Y2OA 5DD5H 4NBYB 2QADB 1FNSL 4MJID 3DX7A 3BWAA 1JPGB 4Y4FB 5DMGD 3RQ3A 2F53B 3MXWL 3QNYB 4JFEB 3QWRD 4XPTH 4XNQB 4GS7B 4WUKL 1MCWW 1P4IH 3ZT7A 1AGFA 5IEHA 3NABL 4JO1H 4ZUWB 4GKNA 5H94B 1QNZL 4U3HA 3QCVL 5L9DH 3H9HB 2YR3A 2F19L 1UADC 2WV3A 5D7JB 4LSPH 4BELD 3GSXB 3DO7B 1NFKA 1RU9L 1C16B 1UXSA 3TPUA 3GSUB 1S9WB 4K7PY 5IB5B 3MODL 1BVKA 3LKSB