4H20H

Crystal structure and computational modeling of the fab fragment from the protective anti-ricin monoclonal antibody rac18
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
220
structure length
220
Chain Sequence
EVQLQQSGPVLVKPGASVKMSCKASGYTFTDYYVNWVKQSRGKSLEWLGLIIPSNGGTTYNQKFRGKATLTVDKSSSTAYMELNSLTSEDSAVYYCARRGLTGALFAYWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPALLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIVPRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Light chain of Fab Fragment from the anti-Ricin Monoclonal
publication title Crystal structure and computational modeling of the fab fragment from a protective anti-ricin monoclonal antibody.
pubmed doi rcsb
total genus 44
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2012-09-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4h20H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4h20H02
3L95A 4NNPH 1PG7L 3KYOA 1MREL 4XAKE 3UBXA 5KN5B 1PKQE 1LP9F 3BQUB 1H15B 1S7RA 1AO7A 2GCYA 3P0YH 1IM3A 1JGLL 4XPBL 1L7TL 2HKFH 4G8GA 3D1MC 1CQYA 5SWSA 3RPKA 2J2ZA 1AD0B 4H5SA 2JIXA 1OM3H 2NY1C 4KMLB 4X6DE 3DV4B 1PVHA 1NANH 2GAZB 1MRDL 3C2AL 4LDLB 2AJVL 1KJ2B 2DQEH 5JXEA 1A02N 1KN2H 2W9EH 4P2RE 2XZCL 3MFGB 5C0AD 1ZT1B 3S35H 5C0NC 1ZANH 4RAUA 5DC9B 1B6DA 5HYQA 1WBXB 1FN4B 3G5VB 2NXYB 4FQQA 1E4KC 2P44B 5EIQA 1D5BA 1XR9A 4JM2A 3T0XA 3NIDE 1HXYA 5E1AB 3PL6A 1FZMA 1OTSC 4JO2L 4ETQB 1JP5A 3QI9D 3B4NA 4R7DB 1R5IB 3LKQA 1ROWA 2VLRD 5BOPA 1AHWA 2ICWJ 1JHLH 2XRAL 1PYWB 4KK6C 2YBRA 5F97E 2EO9A 1OP3K 2WBKA 2DLHA 1ZGLP 3QRGL 1KB5A 3IDJB 2GSIA 3GSNB 4QXGH 4FABH 4Y4HD 3QIWD 5CSZA 1QSEA 3NAAL 1YUHB 1G7MB 5EU3B 3TYGH 3K46A 3B9DA 1IKNA 3O6LH 4ODXB 3RWGA 2ENYA 3CXHK 4S1SH 5ABDE 3CFKB 3KR3H 4WUKH 1I3GH 4MD4A 3EW3B 3BYYA 4NDMB 1D5ZA 5HDOA 1RSFA 4DN3L 5GGTL 5EU4A 4HK0B 4Y4KA 2Y36H 3QO1B 1CIDA 3QIUA 4G80B 1P6AB 4AEFA 4XCFH 5BXFB 1WC7B 3H6JA 1XF1A 3ZKMD 1EEZA 4L9LA 5GRXG 2A9ML 3S6CA 4N0FB 3VFPA 5D7JD 1ZTXH 1GGIH 4X5WB 3VXUA 4XNMA 4OLZH 1MWAA 3ARYA 3MOBL 3MO1B 3QEUA 4OZIB 1VDGA 3B9KA 1S7TB 2D0GA 1ED3B 4K7PX 4MNHA 3SQOL 5EG6C 1IC4H 1VPOL 4WV1C 1RK0B 3QUYB 4LRNL 1CR9L 3QZWA 3PP3K 1R5VA 3LKOB 1X6NA 1GGYA 5IWLC 4YJZL 3HG1E 1IJ9A 2J7LA 2CDGA 4KQ4L 5TFSL 3HC0A 2EIDA 3D5OF 3SCMD 4NYLB 3V7MA 4A2MA 4XVJH 5JHDB 1VFAA 2WBJB 1F4XH 2W07A 3LQMA 2VTFA 2Q76B 2R1WB 3G6JB 4NO3B 5D7LB 2HH0H 3BKMH 3L95B 4RA3A 4Y5YC 2ATKA 3K4DA 1D5XA 1JI1A 3PUCA 4G42A 2IPKA 4GW4A 4IRSA 1XF5A 2GCYB 2F5BL 2Q8AH 1KXTB 1G9NL 1IM3B 3GI8H 4YDIL 4K23H 1NCAH 4S2SA 4Q9QL 2W60A 5BW7C 4U1LA 4ENED 3JUYA 5DHVA 3BH9A 5E24E 1FNHA 4RAVA 4QEGA 5SWSB 1CE1L 3DMMA 4H5SB 1MCNA 5FHAH 4W68A 3H8NA 5IUSA 1CFQA 5EC1B 4I4WA 4OKVB 4O00A 3HZKA 4XPTH 5CEXA 4LCCC 1S9YA 3DX7B 4I3SH 4LFHD 4RAUB 5HJ3A 5C6WH 4WHCA 5ICZA 5HYQB 3RU8H 5IB3A 2OJEA 5CFHA 1G7HA 4GG6A 3TIDA 4H88H 1D5BB 4OLYH 1AXTH 1EGJL 1XR9B 2IJ0C 5GRUL 5CJXA 4JM2B 3DIFA 1HXYB 2VQTA 3PL6B 3S96A 1FZMB 2BRQA 1S9KC 1HI6B 2I07A 3E6HA 5FGCE 3VH8G 3GSWA 3LKQB 5EUOF 2AEQL 2IQ9H 1CWVA 5IJVA 4P49A 2BNRD 1AHWB 2OK0H 3MLYL 5A16A 2GUOA 4YX2H 1WQVT 5JHLL 2G60H 5FGSA 1ZGLA 3GMLA 1KB5B 4K3DH 5B22A 3E8UH 2GSIB 5A2LH 4OF7A 3U4AA 2BVYA 2BOCA 2VXTH 1VSCA 5CSZB 3PDOB 1QSEB 5DMGC 3ISWA 4S1QH 5F93C 4M7JL 3F62A 4XNXL 4JFHE 2VDQL 2CIIA 3RWGB 4JRWA 5JUEH 4IOFD 1KB9J 4KI5E 43CAB 4CN6A 3JVGA 1KTRL 4MD4B 2HP4A 4M48H 1D5ZB 4JDZA 5DRWA 4Y8AA 2QSTA 3BXNA 2DQUH 4PJIE 5EU4B 4Y4KB 1UKSA 4U0RC 5IF0A 1P2CA 4S1RH 5A3IC 2VR9A 4F57H 1FORL 4QRPA 5LJYH 3MLTB 1K8IA 3O6KH 3C5ZC 4ZFFA 1EEZB 1ZOXA 1BBDH 3VFPB 4R7NB 4JN1L 2CPCA 1GRWA 4XP5L 3HZYA 3WKML 2RB8A 3GIVA 5KJRH 3SE9L 2BVPA 4M03A 3VXUB 1NLBH 4TSBL 3VXTA 15C8H 1JV5A 2E6PA 3FOMA 3F7YA 4JN2A 1S3KH 1NUDA 3QEUB 2NY1D 4UINL 1A22B 2I5YH 1X5GA 3H2WA 5D2LF 1ACZA 3MOAH 4LVNC 4MNHB 1IM9D 3LVEA 2APVA 4PG9A 1XT5A 4H26A 4R0LA 1RJLA 3QZWB 4PGBA 5JOFA 5C0ND 1R5VB 2H41A 2ZNXA 5JLZA 3CLEH 2D4FA 4QXWA 3U2SA 1JTOA 4PRPE 4HEPG 5LCVL 4I2XE 2CDGB 4M6OL 4KTEL 4MGXA 3HC0B 3UYPA 4Y1AA 4XXCC 4B41A 4JDVA 2B1HH 4EN3C 1I1AA 4PB9H 1YEDB 2HKHH 2JJUA 1OTSD 2W9LA 3FT4A 1SYSA 4JFPA 1DFBH 5D6CA 2AQ3A 4PRHE 2ATKB 3U0WL 4NUJA 1D5XB 4G42B 5BV7H 2IPKB 4GW4B 4KK6D 4EQ2A 5K93A 1CL7L 3C6LA 3DPBA 1XF5B 2F9BT 5CZVH 2YEZA 4IJ3C 5EU6A 1KLGA 4Z7OF 4S2SB 2W60B 4LMQE 2X05A 3WMSA 3RWIB 4U1LB 3THMH 5DHVB 3QHTC 4FQ2H 3P9LA 4RAVB 4QHLA 4M5YL 3IFNL 3DMMB 5JORA 3W9DB 1QFPA 3LKRB 5ELIA 1JF6A 4X6FA 3U9PH 4HWEH 1KIRA 5EZOH 1WAAF 5BRZE 4I4WB 1DLFL 2YMXH 3HZKB 4OGXL 1MFDH 1X5JA 1JTTA 2V7NA 5CEXB 1R3JA 1BD2E 2VXSL 1S9YB 4HWBA 1JNLH 2AVGA 2D7OA 4DAGH 4LASH 3MUHL 5ICZB 5IB3B 3CSBA 2OJEB 2EEDA 1E4XH 1G7HB 5I74B 1D5MA 3TIDB 1ONQA 4HS3A 4U4BA 4N8CH 4WHYH 4R6UA 5I1EH 4R26L 4AEIL 5CILL 3S96B 4OZHB 2E9IA 1NFDE 4ONGH 4UILL 3E6HB 4HIXH 1MJJA 5LGHL 4LVOB 5ACMA 5IESL 5IJVB 3NCJL 5A16B 2GUOB 1Q0YH 3L3OB 3NFNA 2HWZL 4KQ3H 1BPVA 1FJ1B 4JCMA 4LSUL 1ZGLB 3GMLB 2ZCHH 3CVHH 1T21A 2UVFA 5HHNA 2YC1A 2A0LC 2YRPA 2BOCB 3ARGA 1KCRH 3TF7C 3UMTA 1YNKL 4PS4H 3VXQA 5JW3L 1G6RH 4M9PA 1A1OA 4Q9RH 3MLZL 4CMHC 3AFLA 3IDGA 1MPAL 4JDZB 5DRWB 4Q7DA 2C4FT 4J8RB 5I16A 3U83A 1NL0H 1T7WA 2ESVA 4N5UA 5IF0B 3TN0C 1KT2A 3W9EA 1I9IL 1OVZA 3QNYA 4NGHH 4X7CC 3O3UN 5CGYC 4QRPB 3WEXA 1FDLH 3G6AA 3OG6B 2VDRL 4ZFFB 3RUGB 2P5EE 2FX9L 4PV8A 3BJLA 3T1FA 2OI9C 3U0TA 3HZYB 5F9WB 2DL9A 3GIVB 2DTSA 3L5JA 2BVPB 3ZDZE 3VXTB 1F5WA 1B2WH 3SDYH 1JV5B 3FOMB 3F7YB 5DSCA 4JN2B 4PREB 5ANME 5CD5C 3C09C 4R9HA 4FQCL 4U6YA 3CFCH 1MAJA 5J11B 4NN6C 4PG9B 5C0DA 1NBVH 3NA9L 4H26B 3DVIA 35C8L 1RJLB 4F15B 4LSQH 4PGBB 5JOFB 3MNWA 2R0LH 3GK8L 2UUDK 5JLZB 4HXAH 2HRPH 3U2SB 4P3DA 2QQLH 4O9HL 1FIEA 1YZZA 5AZEL 4M1GH 4O51A 4WI6A 3IB4A 4XRCA 4JDVB 4OFIA 3FO2B 3BMWA 3RP1A 1I1AB 3OQ3B 1I8LC 1CZ8H 3FT4B 1SYSB 3IKCA 4JFPB 1BBJA 2BX5A 4XCCL 1DUZA 4OBSA 5D6CB 4XVTL 3TO2B 1QBLL 5ESQA 1HKLH 2YEZB 5EU6B 2YZ1A 1KLGB 3RTQA 4KI1A 3NIGF 5IFAL 3JV5A 3MCLH 4TVPL 4A6YL 3WIHL 1R0AH 2IBGA 4MJ4A 5DMGD 3IU4H 1N7MH 1G0YR 3P9LB 4QHLB 1UENA 5CBAA 3BWUC 5H35A 2CUHA 5HI3C 4R4FL 1UJ3C 4X6FB 4XWOD 3ALWA 1KIRB 1SM3L 3OSKA 2BSSA 3VW3L 1CF8H 4O02H 3S7GA 5D4QA 3LDBB 5EU7C 4S10A 4ZOBA 5I1CH 5A3ID 4TNVK 3FB5B 1A3LH 2X09A 1JHKH 1YECL 5DFTA 3RQ3A 1M05B 3C5ZD 3QQ3B 1NGXA 1LE9A 3FCTA 3S37X 1KIQA 1BQUA 3TCXA 1JPTL 3GMNB 4ISVB 1N26A 3SDXA 2HVKA 4RBPH 5D8JL 2WM0A 4G3YL 1QBMH 1MJJB 3T0BA 3SE3A 1HINL 1CU4L 2F54A 3NFNB 4UQ2A 4I18C 4X6EA 5B3NA 3FB7A 5LGJA 4OLVH 3AGVA 1J8KA 2ILLA 1RUPH 2IQAA 4BJLA 3CFJB 3UPRB 2I60L 1T21B 4UNVA 5HHNB 2VLJA 2YC1B 3HFML 3I75A 1J0ZA 1IFHH 5ICXA 1FNLA 4XVSH 3WIIL 4NQCA 3U48A 3AC0A 4K7FA 2BVOA 4C55A 4LL9A 4QOKA 4LCWB 4WTXA 1A1OB 4EN3D 3ULSB 4WDIB 3CC5A 4NCC2 4OIIL 4Z95H 3IDGB 3RY6C 4YHNA 2NY2C 3D48R 43C9B 5I16B 2OYPA 2ESVB 3AS2A 3W9EB 3ZHKA 1VACA 2B4CH 3OG4B 3QNYB 1ZEAH 1AQDA 3WEXB 3G6AB 3BAEH 2IPUG 4OIAA 3T3ME 2M8XA 3MV01 5KW9H 4PV8B 5T1KA 2HLFC 2JF1A 1CDGA 5CHNB 4JQXC 1F42A 4OZIE 1H5BA 1KJ3L 5DSCB 4IIQB 8FABA 1NCBH 1V05A 4U6YB 3LS5H 4RGOH 3O4OB 3T2PA 3L5XL 4GKZB 2ZKHH 1F8TH 5EUKB 5J06A 4XWGL 2VZUA 3CFDA 3MC0A 4NBZB 2GK2A 1EO8L 5IVZA 3MNWB 5CJBA 5DD1L 2YUXA 1IC5L 5CZKA 2HFFA 3RHWF 5F7EH 4R2GB 2Q8BL 4P3DB 2WAHA 3RVVC 1I8KA 3EOTH 3S3PA 5JHDE 2WINB 4O51B 1J1PL 4XRCB 1UKQA 3G6JE 1KJMA 3GMMB 5D7LE 4NHUB 1DN0A 3IKCB 3VD4A 2DBLH 3D0VA 2YN5A 1C5CH 1DUZB 1BWWA 3ZT6A 4GXVL 3MUY1 4HJJL 7CGTA 3KYMB 3VFUA 5ESQB 1AO7E 2CRMA 1KN4L 5I66A 4OV6F 3OV6A 2H1PH 4JO1H 5AUMA 3RTQB 1JK8A 4OFPA 4AZ8A 1J88A 1TCRA 2JCCA 3MCG1 2A0LD 2Z8RA 5I6XB 3R0MA 4KAQL 1KELL 5SWSE 5LAXB 5DZOA 2MFNA 3HR5A 4BZ2L 4L3EB 5CBAB 5H35B 5I19H 5JW4R 1HOCA 5F9OL 4YE4L 5C0AA 1UG9A 3I84A 2ITCB 1JFQH 2XWTB 2BSSB 2EDKA 1P4LB 5D7KD 1B90A 3S8WA 3TEUA 3DOSA 3M17A 5I1KL 2OZ4L 3TN0D 2GJJA 5JQ6L 1ADQA 2C3WA 2P8PB 3GI9L 5CGYD 3MRRA 4UDTB 2LQRA 1NMCC 1N6QH 1OAKH 4Q0XH 4JFOA 2FL5A 4XP6L 1NGXB 1MCEA 3QEHA 3FCTB 4CW1A 1KIQB 3SDXF 5ALBH 4N0RA 5INCA 5C2BH 3VE0B 2HVKB 3HC4H 3O2WL 2DLTA 4OZGB 5AZ2L 4X9HA 5HI4C 5CD5D 2DM7A 3TBTB 3WXWH 5HYIA 2HRLA 2CXKA 3KPQA 2F54B 4UQ2B 3MJ7B 1FFOA 3QIWA 3BN3B 4NNPL 4X6EB 3FB7B 5LGJB 2IQAB 5HGAA 3JWOC 4C83B 4MAUH 2FJFA 2XT1B 1QBAA 1MCDA 5MENB 2VLJB 5HGGS 1QSEE 3I75B 1NLDH 2RAMA 5ICXB 1INDH 2HJLA 2AAVA 4LKCA 2IEPA 3H7BA 3MPCA 3P0YL 4K7FB 2BVOB 4PY8J 1HHHB 4QOKB 2HKFL 1GJIA 1DN2A 3CC5B 2RIKA 1UYWH 4WI2A 4YHNB 3CDGA 1HIMH 1OM3L 5FUZH 4EQ3A 2FLBT 1VACB 1AQDB 2AKRA 4YHIA 5ISZB 1DLHA 4ZTOH 3CD4A 2GTWA 2DQEL 1KN2L 2W9EL 5FUOH 4PJEA 1A7QH 5T1KB 3S35L 3OB8A 4MB4A 1L0XA 1ETZA 1ZANL 1UM5H 3VXUE 4YDLB 1AIFA 3MLWH 1H5BB 5IVXA 4ZDHA 4M7LT 5HI3D 8FABB 5MEOA 1U8OA 4GMTH 4Y88A 1JNHA 8CGTA 1FYTA 4Z8FH 2GT9B 2X42A 1BMGA 3TZVA 4KK9C 4EI6A 3CFDB 3ECBA 3SOBH 5IVZB 1JHLL 5JR1H 1DQJA 2L4OA 2HFFB 3W0WD 5F6HI 1I8KB 4QXGL 4ZO7A 4FABL 4MMZC 1KJMB 1XCQA 4U05A 5E4EC 1DN0B 2JLLA 4HAGA 1N5YH 4HKBA 2C4XA 3D0VB 3TYGL 3WBDA 4QO1A 4U6VH 3O6LL 1CFTA 4X8JA 4OM0H 4S1SL 1U58A 4Y5VA 1T89C 3VFUB 2J6EA 4F80A 5I66B 3BHBA 3D85D 1H9VA 1I3GL 3KR3L 4WUKL 3QXWA 5AUMB 1TVHB 2JCCB 2Y36L 1FYHB 1JN6A 1JZ7A 1QLRA 2NXZC 2Y72A 3EYVB 1QR1A 4XCFL 4P57A 5A2JH 2ZPKH 4UTAH 4ELMA 5C0AB 3RWFA 1VFMA 4RGMB 2WZPD 4J3UA 1I3UA 1ZTXL 1GGIL 3P73A 4OLZL 4BELD 2O26U 2NY2D 1ITCA 1WF5A 3M17B 5D7IB 4C54A 2XV6B 2G5RA 1FNEA 5IW6A 1DVFC 4ZSOA 4GAFB 4RX4D 4JPWH 5JXAH 4GG6E 2WWKO 1IC4L 4UUJB 5FDWB 4L3CA 1DEEB 1BQSA 4JFOB 2FL5B 3RA7L 4FXGA 4HD9A 3QI9B 1EVUA 2HLFD 4JZNA 3RBSA 3EBAA 3KJ4B 2VLRB 1CXLA 4OZHE 5INCB 4WFFE 3IDUA 1A9BA 4TRPH 4H8WH 1MWAH 4NWUH 5TF0A 2I25N 4XVJL 3MX0A 3H42H 1F4XL 1PAMA 1H3WM 1A5FH 3KPQB 1CBVH 2N4IA 3EYOB 4Y4HB 4AK1A 1FFOB 3QIWB 2HH0L 3BKML 3IETA 5HGAB 1CD8A 2FJFB 4G6JH 4NKDB 2BY1A 1NUFA 4KRNA 4AIXA 3MOQA 1RZJH 2HJLB 2Q8AL 3RVVD 3H7BB 1JIBA 4PPTA 2O5XL 3GI8L 2Z31A 4K23L 4P2QD 4QRQA 2YD1A 5SX4I 5JW4Q 3V8OA 3S5LG 1UZ6E 3QULA 1QKZH 4NKMA 3U7WH 4G8IA 2LABA 4ZS7H 5FCSH 5JIHA 3ULUC 3ULUF 1J8HD 3LKPA 2LTQB 4RIRA 5FHAL 4Z7QE 5HVHB 1WLHA 4N0CC 5L0QC 3QUZC 4LIQL 2DD8H 4QRPE 5D7JB 3E2HC 3PJSA 3UPCA 4YHIB 1DLHB 2H3NA 4U1KA 3RUGE 3BKYH 2GTWB 1CXFA 5K59F 4XPTL 3S4SA 4UIMB 3PGDA 4PJEB 3N1QC 1P53A 4I3SL 4ZUTB 4KJWC 4MJIA 4EDXA 4POUB 1U41A 5JNYA 3MRLA 1IM9A 1HHKA 1AIFB 3DETC 1MIMH 3VGDA 5IVXB 1WFUA 3GIZH 4H88L 4OLYL 1AXTL 2ARWA 1RJZA 1JNHB 1FYTB 3MV7A 2MHAA 5ITFA 2QEJA 1C1EH 2AGJH 4QY8A 2OTPA 3TZVB 3S34L 5FA3A 1E4KA 3UZEA 2IQ9L 2PW1B 4EI6B 3ECBB 3HZVB 2OK0L 2HFEA 3LHPH 5IHBA 1U6AH 1DQJB 2DM2A 4YX2L 1RU9L 2G60L 1N3NB 4PJCB 4JY4B 4Y1AE 4D9RE 4K3EH 4K3DL 3E8UL 5CD3A 3V95A 4ZMAT 5GGVH 3CDYA 1ZKAA 4S1QL 2FWOA 5HI4D 5IM7A 4HKBB 4UV4H 1DBMH 1CFTB 2BSTA 2H45A 3P0VH 5JUEL 1U58B 4WFED 1FNSH 3N50A 5EU6E 3BHBB 3GSRB 1Z5LB 2E5EA 4M48L 2DQUL 2ZJSH 3VRLF 4QHKI 4H1LB 5DGRA 4S1RL 3VI3E 3RI5K 3U30B 4F57L 1QLRB 1RQ5A 1GYAA 1QR1B 3BGFC 2XPGA 3O6KL 2D3VA 4ELMF 1AXIB 4YXKL 1BBDL 3CSGA 5AAWA 3RWFB 3CX2A 5CJ8A 4BFBD 3QXUA 5KJRL 1N5AB 3P73B 1NLBL 5C9JA 1EEQA 15C8L 4GS7B 5I17A 3MRKA 1EAJA 3V8CA 2D7QA 3MBEC 1S3KL 4K2UH 1MAMH 3ZSSA 2I5YL 5DJXB 2BSED 1FNEB 5IW6B 1F58H 3MOAL 5T5NG 1U3YA 4ZSOB 2D31B 3TBYB 2VLKD 3BGAA 4M3KB 1RIVH 5GRJH 4L3CB 2APBA 5DT1H 3ULVE 4FXGB 1MFCH 2YUVA 2EDNA 4JZNB 2J8HA 2LE9A 4ZNEA 3PP4H 3WN5C 3PV6B 4HHAA 3QDMA 4NKOB 1A9BB 4M7ZB 3TT1H 3TBWA 2YPVH 1DE4A 2CKBA 4PJFA 2B1HL 4P46A 4PB9L 1OD7A 2HKHL 4NC1E 5TDPA 3JWDL 3EGSA 5GRVL 3IETB 3CCHA 1DFBL 1IQWH 1WVZA 4KK9D 4WW2A 3D25A 5BV7L 2R56H 5F44A 1FVCA 2SEBB 3HPJB 2X44D 1BJ1J 2Z31B 2AS5M 4YGVA 5J8OA 4QRQB 1TXKA 1DP0A 4OCXH 32C2B 3THML 4CVZB 4NKMB 4R4BA 2EKSA 4G8IB 1JWMA 4FQ2L 1L9NA 1ZLWK 4ONHA 2ESVE 3LKPB 3P40A 2FHCA 3U9PL 4APQA 4HWEL 3PJSB 5EZOL 2XN9D 5GS2D 1FZKA 1VESA 2YMXL 4U1KB 1CD0A 3S4SB 3PGDB 3SGKA 1JNLL 2NY1B 4U2YA 4HH8A 4WI9A 4DAGL 1NGWA 3MZGB 3WLBA 4MJIB 2NXZD 1RV6X 4EDXB 4LASL 3MRLB 1IM9B 3O2DA 1E4XL 1JE6A 3BDXA 5FOBA 3WCYA 1J0JA 1ND0B 4DW2H 3R06A 5KVFH 4N8CL 3EDJA 3MV7B 5ITFB 2MHAB 5I1EL 1CL7I 5JMRA 3IDNA 4ONGL 2I26N 3IU3A 3OGCA 4HIXL 1MSPA 5FA3B 2IALA 3BZFA 1DVFD 3VGGA 2F58H 2HFEB 3PDDA 3SKMA 1Q0YL 4KQ3L 5DVOA 2N56A 4QKXB 2UVEA 5IP4A 4MVBC 5FV2A 3CVHL 3KYKH 2EIBA 2EYRA 2D7PA 4M6NH 4I9WD 4ODBD 4X9GA 5CD3B 4LLVA 1KCRL 2RR3A 4XPHH 4GAJH 2FWOB 1CICC 5IM7B 4GSDH 1SEBA 1BFSA 4PS4L 1G6RL 2BSTB 2VERN 2WK2A 2EE3A 2LU3A 1EO7A 4Q9RL 3HB3C 2OP4H 4ZXBA 1FPTH 1IT9H 1NL0L 3RZCC 4NGHL 1NSNH 1KG0B 1FDLL 5TQ2H 1P7QD 2XPGB 5DS8A 5CP7A 5EBWA 2X89A 5IBUG 3EJJX 2E6JA 1CK0H 2FHBA 4PRID 4UOJA 5E99H 1T80A 3T04D 2VDPH 3ULUD 3BPLB 1B2WL 3MRKB 3SDYL 5I17B 2HTKC 4N0CD 3QUZD 5E2WH 1BJ1H 1LO2L 3CFCL 3OKLA 3QXAA 3TYFB 2AW2A 2QQQA 1NBVL 2AI0H 4OCMC 3FN0L 4HWNA 1XCTA 4PLJC 4YQXH 4GRLC 2J8UA 4LSQL 2DI9A 5FYKH 2R0LL 4P9ML 1KEGH 1FAKT 4KJWD 2P48B 5L2KA 4HXAL 4J3XA 4OZGE 4HHAB 5IMMA 3DV6B 3QDMB 2QQLL 3DETD 4WFGE 3TBWB 4N90D 1DE4B 4M1GL 2CKBB 4CDGC 5JDJA 2F54E 5D1XA 4P46B 1RUKH 5EU5A 3ZL4H 1QD0A 5C07D 4PIRF 1V8HA 3RKPA 1CZ8L 3EGSB 5HPOA 2NPLX 1X44A 3CCHB 2ID5A 4WW2B 5MENE 2VLJE 3D25B 3HMWH 4WWKA 1PX3A 3DXAD 4NQCE 1HKLL 2VDLH 3LEXB 1GZPA 1FBIH 2GIYA 4QOKE 4ERSH 2CUMA 5HHOD 4BQ9A 1XGTB 3MCLL 4YGVB 2YD2A 4AEHH 3MLRH 1R0AL 3ARUA 3IU4L 1N7ML 2EKSB 4R4BB 5DJ6A 5KSAA 1JWMB 3OMZA 4L29A 4MNGA 1FE8H 1EH9A 3B5GA 5DI8A 1QLEH 5EOQH 5ISZE 1IGCH 3K4ZA 4OF6A 4RMVA 1ZHNA 2I9LA 1CF8L 3SDAA 1VB9A 5C8JA 1U8PB 4LHUA 4O02L 3CXHJ 3D3VD 2WQRA 2Y5TB 5I1CL 3U79A 5C7XL 1A3LL 5HPMB 1JGVH 4Z7VA 1JHKL 3WLBB 3DX8B 1MI5D 3GGWB 1MIEH 2X1QA 5J6HA 2ARJB 5FOBB 3R06B 4NRXA 1Z9LA 3MRFA 1W72H 2DQJH 3NCMA 4MQSB 3PXHA 3NN8A 3IDNB 5TE7H 2ZUWA 3IU3B 3KLAA 3OGCB 5E8NA 1YEGH 3MBED 4KJQC 3MRBA 1QBML 3RFZC 2DF3A 1CDYA 3BZFB 4N0YH 3MA7A 3SKMB 5E2TH 4OLVL 4Z0BH 3TPUA 1RUPL 1I1FA 1VEMA 2NCMA 2X10A 1TPXC 4GAYA 4L8CA 2VDKH 3FAWA 3TA3C 4NM4H 5B3JF 1IFHL 4RAHA 4LLVB 4XVSL 2FBJL 3TBSB 2CDEA 1SEBB 2ED9A 2WSKA 2AK4A 4LVEA 5EO9A 3T65B 3BMVA 5EA0H 2JCCE 3WJJC 3KDMA 1CFSA 2JJSA 3OXSA 5D1ZA 4IRZH 2YD8A 1SVZA 5MP6H 2B4CL 4HFWA 5SV3A 1T6VN 1QPPA 4HK3J 1ZEAL 3PV7A 5D70H 2YHGA 1ES0A 4H0IA 3BAEL 3BEVA 2X9XA 3LAFA 4HFUH 5DS8B 5A2IH 1BM3H 5EBWB 2D9QB 5C0AE 3V2AR 4XVUC 2X6MA 5GGVY 5GSVA 1SMOA 5GHWH 5JTWA 1WFTA 4PJ7A 1DL7H 1KEMH 3C5ZB 4JREC 3CU7A 1HKFA 1NCBL 4HULB 3LS5L 3OKLB 3QXAB 4RGOL 4GLRI 1J87A 2X4SA 1NCUA 1U0QA 3LD8C 3UTZA 1DBKH 3CNKA 2ZKHL 2F53D 1XCTB 3HA0A 1F8TL 2CQVA 2J8UB 1T1YA 1WCQA 3ZE0F 4MXWH 5L2KB 4KJYA 4XBPA 4LVNB 5F7EL 2QBWA 3KPMA 3JV0A 5IMMB 1SBSH 3EOTL 3TGXA 4QWWC 4I0KA 2OLDA 5J1TC 5D1XB 2V2WA 5FYLD 4XAWH 4QF1A 3HRZA 2DBLL 5JIKA 1C5CL 3WIFA 1H8NA 4J3VA 1ZAGA 5E8EA 5JIIA 4WWKB 4EN3B 3GRWA 3ZKSD 5FF6A 3SDCC 3BRFA 2H1PL 4JO1L 3UDWA 5HYEA 1B0RA 2XI9A 1BOGA 1ZHLA 3ZHLA 4X6BA 4G5ZL 4JRYA 1ACYH 1C8PA 3F6LA 3LQAC 4CU8A 4R97C 4PJXA 3V5KA 3OBAA 5KSAB 5DJ6B 4XCYA 3O3BA 1CICD 1TCMA 4P23C 4IJ3B 3QXDA 1HSBA 1KCVH 2BDNH 1NAMB 5I19L 5DI8B 2YD3A 1AY1L 3ZDXE 1JFQL 1QRND 1ZHNB 3HB3D 4EBQH 5C8JB 1IGFH 4PJEE 1CQKA 4LHUB 3RIFK 5C0CA 3RZCD 3UC0H 3JV6A 2DQIL 3QH3B 3R8BB 4Z7VB 2E9BA 3PGFL 2FLRT 4Z7NE 5IVXE 2AV7A 5J6HB 4Q0XL 3I6LD 1FCCA 2V2TA 4JZJC 4Z76A 3EIFA 1FYTE 3EFFB 3MRFB 4PRDA 5ALBL 4C4KO 1BGXH 4NFBA 3NIFE 4M43H 5C2BL 3HC4L 3RNQA 4PD4K 2EE6A 3BE1H 25C8H 3KLAB 5E8NB 2HTKD 1MCLA 3MRBB 3PWPD 4HWZA 3WXWL 5C0JA 3MA7B 5C70A 4OB5H 1ADQH 1F6LL 1PEWA 4PLJD 1LHZA 1I1FB 1S7QA 4GRLD 3C60A 5CJ5A 4GAYB 3Q48A 4MAUL 4DEPC 3AAZA 4B7LA 1MLBA 4LCIH 1UA6H 1NLDL 1INDL 4GUPA 4XC1H 4YAQA 2CDEB 4JFED 5CS7A 4YHYB 1QA9A 4JAMA 5FYJD 3UTSD 1CDJA 4EVNA 1UYWL 2H8PA 4GRWF 4QRUA 2FD6H 2MSPA 1BEYH 1HIML 3KDMB 1CFSB 5FUZL 3OXSB 5D1ZB 5C1MB 4KMTH 1R24A 3HI5L 1JNJA 4U1IA 3MBXH 4HFWB 3L6FA 1GOGA 4YPJA 2HA1A 3B6SA 2Y4SA 1C08A 1ES0B 2E8YA 4CMHB 2FSEA 1JPGA 5FUOL 2NW2A 3MRDB 1BIIA 5A1AA 1OAUH 1TZGH 4JJ5A 1UM5L 3TN0B 4I3RH 4PJBA 5E2UH 4PJ7F 3MLWL 2XY1A 2K7PA 4GMTL 4YDVA 4ZUWA 3WFEH 4ZSOE 3SO3C 2GY7B 2OI9B 4Z8FL 1ZLUK 2X4SB 3UTZB 5IQ7H 5DUPH 4WIQA 3SOBL 5I8EA 1II4E 5JR1L 2NY7H 4KJYB 4XBPB 4NN6B 4YFLF 2P5WD 4DKAA 2R0ZH 1PW3A 1AGFA 1A7NH 3G9AB 5FGBC 1RZFH 2V2WB 5CEYA 1NANI 4QF1B 3VXMA 3HRZB 2E9JA 1N5YL 4KJQD 5EZIH 2JJWA 4U6VL 3WIFB 4RFEB 4MCZA 4OM0L 5E8EB 2DTMH 5DJZA 3P77A 1BREA 3VD7A 4Q2ZB 1ZSDA 5C2UB 2W65A 5FF6B 1CDIA 4K3HA 1SQ2N 1BOGB 1ZHLB 4OD1H 1BIHA 4X6BB 4JRYB 4X4XA 3TA3D 4QCIA 1J9CT 4PJXB 3V5KB 5FECB 3K2UH 4X83A 4XCYB 3O3BB 3MXVH 3QXDB 1HSBB 1L9MA 4AM0A 5FKPA 2ZPKL 2NY3B 4UTAL 4M6AA 5KVDH 3AY4C 1JWUA 2MCPH 5K9QG 5KSBF 2JB6A 2GI7A 1L7IH 3FQNA 1XGRB 2FZ3A 2J6EH 2VL4A 4N0UA 5IBTL 2HJFA 5C0CB 1V3JA 1A6ZA 4MJIE 3JV6B 4BUHA 4JPWL 1RZ7H 5J13C 2V2TB 3LV3A 4Z76B 4XVUD 3MV7E 4PRDB 1S7VA 1KC5H 3ROLA 3RNQB 4OM1H 1IARB 1MJUH 3O3AA 2AXHA 1MWAL 4H8WL 5T5FH 2ZSVA 3GMPB 2BXZA 4HWZB 4OZ4A 5C0JB 3H42L 2Y23A 1A5FL 1CBVL 2HMIC 4FTVA 4DTGH 1AXSA 3HE7A 1S7QB 4HC1H 4XPGH 5T5NF 3C60B 2YUZA 1MLBB 4G6JL 4ZFOL 1I75A 4WI4A 1RZJL 4GUPB 2XWJB 4YAQB 4NO0D 2VQUA 1YEFH 4QWWD 1QA9B 4JAMB 3GHEL 3FT2A 1KJVB 1YPZF 1QKZL 3U7WL 4ZS7L 1OGTA 1JCKA 4DVBA 3GNMH 4QRUB 2NX5D 4TN9A 1FL5A 2APTA 5J0BA 2EZ0C 2DD8L 3P3YA 3N1MC 4ODUA 4U1IB 3UTPD 4MD0A 3MROA 3SDCD 3U1SH 3B6SB 3B9VA 3BKYL 5E8PA 2FSEB 1JPGB 3KJ6H 3U7AA 1DR9A 1WT5A 2NW2B 1RUAH 2NY2B 5DHXB 1OCWH 4IHOB 1BIIB 5F70A 4PJBF 4KKNA 5I9QC 4F7CB 2X4QA 4K55A 3DO7A 2R4SH 1TVBA 2Z91A 1UB6A 5E6YA 4HCRA 4P23D 3ESUF 1MIML 3CXDL 5IBLC 3GIZL 4ZUWB 4YDVB 2PO6C 3DURB 5EIIA 4CKVX 2IAND 5KSUA 3CAFA 1C1EL 5FM5M 2AGJL 7FABH 5C0RH 3WXVH 4ZNEE 2LU4A 5TDOA 5I8EB 5JO5A 1WBZA 5TDNA 3LHPL 1U6AL 3QDME 3I3BA 3P2TA 2DKUA 1KPVA 3SEPA 4K3EL 4XCNA 4PJFE 3MJ8A 4QTHA 1CS6A 4MCYB 4Y2DC 3RX7A 2DI7A 3S98A 5GGVL 5J57B 4N1HB 3MV9D 3UXFA 3VXMB 1S5IH 3IDIA 3ZE2E 2HG5A 4UV4L 1DBML 5I1LA 5FYLH 4P2QB 4MCZB 1LVEA 3P0VL 2WP3O 2Q86A 3DTXA 3P77B 1I7UB 3B5HA 3UZVB 1FNSL 2W65B 5D1QC 1C12A 2E7CA 1J8HB 1YC8A 2ZJSL 5L7XH 4W81A 4X4XB 1X5KA 1XIWD 2X41A 3BW9A 4QCIB 1MNUH 1IEAA 5E00B 4JFDD 3FRUA 1T89A 4XH2B 3U46B 5ILTH 5IR1A 2VDMH 2XN9A 3KLDA 4ZO6A 2PW2A 2CRIA 5GXBB 5FKPB 1W0VA 1V3MA 1JWUB 5D5MA 4RISH 3ARBC 2DM4A 2WANA 2JB6B 3T0WA 4PP1C 4CN1A 4PJGA 2FZ3B 1EK3A 1JGEA 4N0UB 3PHOA 1NBZA 1MAML 4R3SA 2W0FA 1GHFH 1A6ZB 3RGVA 1F58L 1PGRB 1RIVL 5IMOA 1YQ2A 3NPZB 4HPOH 5GS1A 2B5IC 5GRJL 5DT1L 3HAEA 1MFCL 3LV3B 3I02A 1DQTA 4N1CA 3PP4L 4EXPX 1PKOA 1S7VB 4Q9CA 1KV3A 3TT1L 2ZOKB 3FO1A 2MQ0A 3O3AB 2YPVL 2ZSVB 3ZO0A 4HAFA 2HVJB 2A6KA 4OZ4B 1BVLA 1BFTA 4FTVB 3FHQA 1IQWL 2AJUH 1DQMH 3CDFA 1UJTA 2AJ3B 2R56L 4JM4H 4PJHA 5KZCB 1MCBA 4KTDH 2HYMA 1FH5H 3BIAX 2OQJA 5FIEA 1WFNA 2G5BA 3FT2B 4QXUH 4OCXL 5DC0A 4MMXC 3MSPA 5FEBA 4DVBB 1TETH 5ETUA 2PR4H 1FL5B 3HPLA 2YR3A 4WEUD 2ZG2A 3ARVA 2R29H 4I13B 4ODUB 1DBJH 1ZLVH 4MD0B 3MROB 4PRIA 1T7XA 5GISH 1RZGA 4YHMH 1A7OH 5E8PB 1MJ7H 1Y18A 2EDJA 4OCWH 1YY9C 1ZVSA 2X4QB 2K9UA 4ZAKC 3DO7B 1TLKA 2Z91B 1MELA 2VWEC 1UB6B 4O2CA 2GJZA 4RFOH 1O7SA 4DW2L 3KPPA 1KGCD 5KVFL 4MB3A 3V5DA 3KGRA 4CBPA 5EIIB 5DTFA 5KSUB 5C92A 3UTQB 3KPSA 1EA9C 2J8UE 4WI8A 2G75A 3O81A 4NQUA 5TE4H 1EERB 1OT1A 3QDGD 5JO5B 5L2KE 1WBZB 2F58L 5ID1A 3MCKA 5BS0A 1CGTA 1QSFD 4PR5B 1KPVB 2Q20A 3KYKL 4QTHB 3MJ8B 5E9DD 4M6NL 5MHSD 3QEQD 5J4MA 3V4VH 4XPHL 4GAJL 4K7PH 3IDIB 2C1OA 2HG5B 3O41B 4GSDL 5I1LB 5IW1A 1A4JA 1S78C 3DTXB 3F5WA 1T04B 2HMID 2UY7A 1C12B 1E4XI 2OP4L 3MYJA 3HUJA 1FPTL 1IT9L 1CIUA 1UWXK 1I8MA 2HFGH 2Q7YA 3BW9B 3STZA 3MODH 5D93C 1IEAB 1NSNL 4MNGE 4JFZH 3KS0J 5IR1B 2XN9B 5TQ2L 2P42B 1AKJD 5FB8B 2XTJC 2PW2B 1FC1A 3OKMA 1W0VB 1CK0L 4JY6A 4F2MA 5D5MB 5E99L 2Z4QA 2VDPL 2NXZB 4PJGB 2F74A 5E95B 3PHOB 1NBZB 2CUIA 1LMKA 2W0FB 4Z7VE 2EZ0D 1UC6A 2W59A 1TFHA 2PTVA 4XBEH 1FVDA 1VFOA 2AI0L 4LRIC 5IMOB 1RULH 1TJIH 3AREA 2YPKA 4YQXL 3HAEB 1KBGH 3I02B 3H0TA 3V52H 2EDDA 2G2RB 5FYKL 3NZ8A 4NUGH 3OKKB 2YWYA 3FO1B 4N8VA 2XZQH 5GGSA 2BERA 5IBLD 2X4TA 4TULH 4WI7A 2NW3B 4YHOH 1RUKL 3ZL4L 2AEIT 1BVLB 4FQXC 4MYWB 2PETA 4NZUH 1V3LA 3HKFA 3HMWL 1JYNA 2QJDA 3GUTA 5C09D 2VDLL 4PJHB 4JKLA 1R3KA 3DLQR 1LE5B 1FBIL 4MDIA 2VAAA 4P2CG 3L5IA 4ERSL 1YDPA 1AC0A 4Y2DD 4AEHL 3MLRL 2AK4E 2GEEA 3REWA 1FE8L 4LLWA 5ETUB 2FGWH 5HYJA 2W0LA 2QHRH 5BQ7B 3FT3A 1QLEL 3QEGH 1NEZG 2V5RA 5EOQL 1IGCL 2D7TH 5D1QD 1T0NA 4PRIB 3FQRA 2EDYA 4QHNA 1HILA 1CI5A 2DL2A 4JGUA 5GQBA 3MREA 5AWNH 2L7JA 4YH6A 1ZVSB 3QUZB 4HUVA 4P99A 3ZMRA 3STBA 1MIEL 4O2CB 3X17A 2XICA 5JZ7C 2GJZB 3LQAH 4MDJA 4PJAA 1WV7T 2EECA 2Z8VC 3KPPB 2OTWA 3V5DB 1W72L 5KS9F 2DQJL 3ARBD 3OKEA 4PP1D 5DTFB 4WFHD 2ADJA 5TE7L 1CGXA 5DURD 2J3SA 1YEGL 4GXUN 3KS0H 4E5XB 4PGDA 4N0YL 1NDMA 4G6AC 5EIVA 5DMIH 3MCKB 3RGHA 2IBZY 5E2TL 5EDXA 4RMRA 4Z0BL 2F8XC 4JFFA 4FFZH 2P1YA 2VDKL 4QRTB 1QHOA 5JA9A 3D39D 4WNQA 4WHTA 4NM4L 5C71A 1B0WA 2A2QT 3B43A 4P4KA 3DI2B 3LSOB 4HZLA 1IRAY 3Q3GA 2B20A 2C1OB 4U1GB 3AB0B 2EKJA 1A4JB 5HHOB 2DICA 2VH5H 4JKPH 3L3DB 3F5WB 3T4AA 3DX6A 3OAUH 3HUJF 4X4YA 1FCGA 5EA0L 4G7YH 3ETBF 4JFYA 3MYJB 4JRYE 2KQMA 5F3HA 2X4PB 4IBLT 4PJXE 4IRZL 1I8MB 4GW1A 2Q7YB 4LAQH 3B8SA 3STZB 5MP6L 4GFTB 4O2FA 3JWOL 3NPSB 5MERA 2FECL 1SEQH 5GS0H 2FIKA 5D70L 2P4AB 3QUKA 1F3RB 1S9WA 3ARQA 4HFUL 1BM3L 4NOFA 1YMMA 3OKMB 1HK6A 5DDHA 3O8XC 3P30H 2RJMA 1NGYA 1LO0H 2Z4QB 5CJOH 1FL6A 2IH3A 3RDTA 5GHWL 3WUWA 3BGFB 5C0CE 1DL7L 1KEML 5MEQA 2F74B 3O6MH 4NKIH 1RMFH 5AYUH 1SJEA 5DJ0A 3VD5A 1DBKL 1FVDB 1HQRA 4O58H 4LLMA 2YPKB 1UXSA 1YY9D 5IT2H 3H0TB 3QUMH 1CGWA 3NZ8B 5DA0B 4MXWL 4ZAKD 4XB8A 5D2NA 2OS7A 1SBSL 2A74A 5L9DH 4N8VB 3VGBA 1T4KA 2EC9U 2BC4A 4GRLA 2X4TB 1MCWW 3V6OC 4YXHH 3CLFH 3WN5B 4P2OC 3MRJA 4OD3H 2YPLA 1EFXD 3RIFF 5SX4H 4WRLA 1KTLA 5K33A 4HLZG 3GMRA 3JTTA 4OF5A 2Q1EA 5CINH 3T4YA 4MXVE 4JGJA 3EYUH 1R3KB 2PXYA 1S9XA 2ZWLT 4PGJA 3L7FA 2KQNA 5EO0A 1YDPB 3JUZA 1MCCA 1U8KB 3P9MB 1FLTX 1ACYL 4YBLB 3RAJH 3IFOA 3REWB 1MH5B 4P5MA 3KPRA 4F9PA 1RY7B 4HKJA 1KCVL 4LLWB 2BDNL 5HYJB 4PJ5A 1Z2KA 5EWIH 1S78D 3FT3B 1U8JA 3DSFH 5I73C 1S5HB 1T0NB 3FQRB 2YRZA 5EZLB 4DOHB 2O5ZH 1IGFL 4TVPD 1TJHH 2JTDA 4ODHH 3WS3A 4OFYD 4WGWB 1XZ0A 4HUVB 3P4OA 4L3AA 1HXMA 1UZ8A 4PJAB 2XTJD 4S11A 5EPMB 4D0CA 2F53B 1QQDA 4NBXB 4OZFB 4NOBA 1BGXL 3OKEB 4M43L 2WIIA 1OB1A 2ADJB 3VU2A 1B4JH 25C8L 3BE1L 3MR9A 5KOMC 4PGDB 1NDMB 3X14A 1CT8A 1WK0A 4F7MA 4OB5L 4KUZH 1ADQL 5FAAA 5IJKC 4KV5F 4JFFB 1T22A 5M95B 3UYRH 1MLCA 1M7DA 1JYXA 3LKSA 4LCIL 5DQDH 1UA6L 4WHTB 3VXME 2IAMC 1X4YA 1F11A 2F8VA 4P4KB 4XC1L 4P5TC 3BPCA 1RZ8A 3Q3GB 4ZFZA 5SWZA 4YHZL 4P2QE 2PF6A 2XXMB 1I7RA 4TSAH 4PJ9C 4QHMB 3T4AB 1JZ8A 3DX6B 4PRNA 5GZOC 2D7NA 4FQXD 4RCAA 1J8HE 4W70A 2E7LA 2FD6L 4NZJA 4GQ9H 4JFYB 5IHZB 2OR8A 3ZYIA 5F3HB 1BEYL 3M45A 5CGMA 1RVFH 5KW9L 4XPAH 4KMTL 4L4TD 1NC2A 1IVLA 3MBXL 4K07A 3VXRA 5MERB 2FIKB 3HE6C 1TZIA 2VISA 3QUKB 3RX5A 3IAGC 1S9WB 3OF6D 2ENSA 1MVUA 2EDWA 1AP2A 1X7QB 3PHQA 3WJJA 1YMMB 5DDHB 1OAUL 1TZGL 3RZCB 1NGYB 2P8LA 2YA1A 4I3RL 1NUGA 5E2UL 3QAZB 4K7PY 1FL6B 4W4OC 2UYLA 3OPZH 4N0UE 1AFVH 4G9FD 3WFEL 3ULUL 5AAMA 1UM4L 3KWWA 3MRQA 1MUJA 4X6DF 5DJ0B 1HQRB 4XHJC 1Q0XH 1R3LA 3F58H 4LLMB 5IQ7L 3Q6GH 3ABZA 1UXSB 4WY7H 5DUPL 4RGNB 1FGNH 1MCJA 2VZ1A 3PWPB 4NN5C 5ADOH 2NY7L 4MJ2A 4AYFA 4DCQA 5D2NB 2A74B 1T4KB 1YEJH 2BC4B 3ORJA 4GRLB 4YK4C 3WFCH 1A7NL 2W1NA 3UBXI 1RZFL 5ESAA 4FTVE 1Q9LB 3EO0A 3MRJB 2YPLB 4KKLC 5B4MC 3NIDF 1KTLB 5EZIL 3GMRB 3JTTB 3A6OA 3T4YB 5I75C 4G6AD 2DTML 1HH9A 4LF3A 4LSVH 4HLJA 3OWEA 2DDQH 4WFEE 3ARTA 3S37H 2PXYB 2A6DA 1S9XB 3DUSA 2IGFH 3L7FB 4U1JB 1VERA 3VMOA 4OD1L 2NX5A 4XCEA 3D0LA 4AH2A 3QG7H 1RIUH 2AXFA 1P9MC 2LU7A 3VA6A 2OR7A 4OV5A 4XI5C 3K2UL 3IFOB 3KPRB 2OR9H 3SE4C 2EC8A 3MXVL 4HKJB 2Q7NA 2CKNA 3NGBB 4PJ5B 1YY8A 1U8JB 2X1WL 2MCPL 3IJSB 4YR6A 1OP9A 2ARJQ 1L7IL 1WBYA 2J6EL 1UQSA 3H9SA 2V2XA 3W11C 4KRMB 4RFNC 2A77H 3QCUH 1FG2A 1PDKA 5DK2A 5SWQA 4NRYB 4EI5A 1XZ0B 2V9TA 1RZ7L 2YD9A 2DRUA 2DIJA 3OAZH 1HXMB 1UZ8B 4F9LC 4D0CB 1JF1A 3IFPA 2Z8SA 2P46B 4F37F 3TJHC 3O8XD 1QUNA 3LEVH 3R1GH 4J4PA 5I1DB 1KC5L 2BOBA 2WIIB 4OM1L 1OB1B 3FRPA 3VMPA 1MJUL 1EX0A 3MR9B 5T5FL 3T0EA 2P5WB 4U3HA 1UGNA 5KSVB 5HGHA 2IFFH 4F7MB 5F72S 1FO0B 4GBXC 3O4LD 4DTGL 4WO4C 2UY6A 2J4WH 5IV2A 4HC1L 4XPGL 3STLA 3FB8B 4G7VH 1T22B 2HAZA 4KVCH 5CIPB 1MLCB 3OKDA 1HDMB 3LKSB 1K85A 2DJUA 5F1IA 1F11B 4G8FA 4GG8A 5FO7B 1JZ3A 4AQ1B 3BPCB 1RZ8B 4NIKB 4ZFZB 5SWZB 2JK5A 3QFJA 3H3KA 1U36A 1TPXB 1YEFL 2VKWA 1I7RB 4KDWA 4PY8I 2E9WA 5FCUH 1XIWA 4P2OD 3QP3A 5T3ZD 4KKBC 4M9OA 3ZE1E 1FV1A 1F45A 1XEDA 3GNML 3GSXB 2W0PA 5EN2A 4B53A 2MCG1 5I2IA 1NC4A 1E27B 3VXRB 3GSUA 2XN9E 3ZDYE 3CK0H 2H32H 5GGTA 1TZIB 4D9LL 5C0BA 1MVUB 3KJ6L 1OW0C 1AP2B 4KH2A 3FQXA 1RUAL 1OCWL 2MMXA 1KPUA 1XMWA 5D5ME 1CYGA 2P8LB 4PJGE 2R4SL 5IB1A 2V17H 4G8EA 1A6TA 2XG4A 1E28B 2UYLB 2EXWC 2B0SH 1G0DA 3QPXH 4HV8A 5C08D 1AGBA 3KWWB 3VXPA 2E6QA 1UVQA 1MUJB 4MQ7B 2XKUA 3QHFH 3QZWG 1N64H 1RUQH 1EAPA 1R3LB 7FABL 3JZ7A 5C0RL 3WXVL 5EH1A 3UTTA 3BO8A 4YNYA 3GJEB 4NNYA 1IAMA 3GJFK 3LD8B 2BNQD 4W4NA 4TNWF 3FHAA 3G9VA 4LU5L 2M1KA 4I9WE 3TBVA 1IAII 1A1MA 1BFOA 1JYVA 3EO0B 1S5IL 1U2CA 4MNQD 5BV7C 4BZ1H 1NCTA 5FYLL 2XIDA 4K3GA 1RJCA 1HH9B 4PJHE 3FFCD 2MKWA 1G0XA 2A6DB 1ZHKB 3DUSB 1HNFA 3CZJA 4X7DC 2NX5B 4XCEB 3D0LB 4AH2B 5L7XL 1XF4A 2AXFB 4OV5B 3L5WA 2IAMD 1KCUH 5ILTL 2A6IB 4P5TD 2VDML 1ZHBB 3PWLA 3DUUA 2ATPA 3OGOE 3PWNA 1JZ2A 4PJ9D 4PRIE 5FM4A 3VA2C 5A2FA 4YR6B 4RISL 3BIKA 5GZOD 4KI5F 1MQ8A 1UQSB 3H9SB 2V2XB 4NQED 4EIGB 5I18H 4XAKD 1OD9A 3EJYC 1KNOA 1IAOA 1GHFL 1FG2B 5SWQB 4PJIF 4EI5B 5T3XE 1WTLA 4MA3A 3N9GH 4X7SH 1MCPH 3HE6D 2IANB 1JF1B 3IFPB 4PLNC 4EUPA 5F9DC 3L3KA 3TH4T 4M1CC 3QDGA 3VCLA 4Q74A 3KPSE 2BOBB 4B50A 1QBBA 3C6SA 1EGJA 3T0EB 4LVHC 1LEKA 3RWEA 4JZJB 1KYOK 5HGHB 4P59H 4Z7UA 1HWGB 2ERJC 5C3LD 4XHJD 3DO3A 1SY6H 5IV2B 3STLB 2AJUL 4U1HA 4P2RD 3OKDB 1DQML 1K4DA 1SVCP 4P9HH 1DANU 4JM4L 1GOHA 1O0VA 4KTDL 1FH5L 1OSZB 3F8UB 1BF8A 1U95A 5GRZA 2JK5B 1K9TA 3QFJB 3UTOA 4NM8L 1IL1A 5I30H 2NR6C 3FO9A 4QXUL 4M93C 1XIWB 4KKLD 5B4MD 1Z0MA 4U6XA 4KPHH 1FV1B 4JFDB 1TETL 3OX8A 2PR4L 2VE6A 1ODAA 5EN2B 3CGTA 1GGUA 2FB4H 3D2UD 3HR6A 2R29L 3V0AC 5KN5A 1CE6A 1DBJL 3GSUB 5T1DH 1JTPA 1QFWH 1W8NA 4XBGA 4GRWB 5GISL 4YHML 1H15A 1A7OL 1MJ7L 5C0BB 2UWEB 3FQXB 4OCWL 3VXOA 1KPUB 4XI5D 3I6KB 3RPIA 4DFIA 2CLVA 2W91A 1XAUA 5IB1B 1NQBA 3FL7A 3E3QC 1A6TB 4G8EB 4DUVA 4RFOL 3VXPB 4UB0H 1EAPB 1YEKH 1BAFH 3W11D 5TE4L 3UTTB 1KJ2A 3BO8B 1F97A 4YNYB 4POYA 4KZEH 1F6FB 3GM0A 4UU9A 3BD3A 2NY4C 3G5VA 1EDQA 4N8PA 2DKMA 2EDFA 1VA9A 4JCLA 3TBVB 3TJHD 1A1MB 4LDEB 1BFOB 1JRHH 2BJMH 2MPAH 3D87B 3V4VL 4L8SC 5CMAA 5I15H 3QA3B 1RAMA 1NFDF 4U3XA 4PD4J 3HMXH 4OGYH 1QSVA 1LD9A 3QQNA 4GBXD 2R1YA 4WO4D 1FG9C 1CXEA 1XF4B 2DS4A 5LBSH 5C6PB 3L5WB 3MODL 3GSNA 2VXVH 4JFZL 4LPYA 3PWLB 5HYJE 4W6YB 3NABL 2ATPB 3BVNA 3PWNB 3NCCB 1UACH 1NMBH 2DB8A 1JWSA 2EEBA 2ZG1A 4DOHE 4KKBD 1TENA 3TPKA 4L9DA 1CLYH 2NY6C 4F33A 4PJDA 4NDMA 4U1SA 1KNOB 1IAOB 5E5RB 4LPCA 1WSST 2COQA 2LAAA 1G7QA 4FFWC 4XBEL 3SY0A 5HGBB 1WGOA 5EULV 4PJAE 1E6OH 2F53E 2AERT 5TPWH 1RULL 1TJIL 1JHTB 5BXFA 3BUTA 1KBGL 1ZT7A 1J18A 3V52L 1HSAB 4NWTH 3I50H 4JLRA 3QDGB 3R8QA 4NUGL 3VCLB 3Q0HA 2EXWD 4X5WA 3C6SB 3ZDZF 2XZQL 1I85C 4PJ8D 3RWEB 3KG5A 1WCBA 3MO1A 4HS8H 4HEME 5BCAA 4Z7UB 1MRCH 4YHOL 2X9WA 3LIZH 4HX1B 1T7ZA 4PGCB 4JFFE 1DQDH 4NZUL 4DZBB 3BKCH 4U1HB 4LOUC 1K4DB 1XF3A 4JPVH 4F7PA 4KXZI 5GPRA 3LKOA 5GS3A 1IZJA 1OPGH 4OKDA 1Q9WA 1U95B 2HT4C 3ZT7A 2FRGP 4Z77A 1U42A 3FO9B 1I7TA 4V1DA 1I9RL 1LO5A 4TOYL 4F7EB 4NO3A 4OCSH 3T09A 1QLFA 3QUXC 4C56D 5F7MC 2VE6B 4IM8A 2FGWL 3TFKC 6CGTA 2B4CC 1H8SA 1T1ZB 5T3ZH 2QHRL 3QEGL 3CJJA 2PYEA 2D7TL 3MNVA 1CE6B 3VFMA 4XBGB 1UFUA 1YMME 5KVEH 2DI8A 4ODWA 1QZ1A 3VGHA 3VXOB 5AWNL 4X7TA 3RPIB 3VGEA 2CLVB 3IDYB 4CVXA 1RJYA 4XMLH 3LQAL 3I6LE 5GSRB 3KYAA 3ARXA 2H9GB 5F88A 3QHZH 5I9QB 3MRGA 4M8VA 1CGYA 4F8QA 5EC1A 1CN4A 5KAQG 2BY0A 4OKVA 2PNDA 4RGNE 4CNIA 3EJYD 3BESR 1FNGB 5DK0A 4HUUA 3LRHA 5DMIL 3DX7A 1U8QA 5D2NE 3WFBH 5F9JA 2NXYC 1T83A 1WWWX 3KXFA 4UU9B 4JE4B 4JKKA 4FFZL 3UYOD 2YPLE 4M1CD 5SX5K 1MF2H 2GJ6A 1NJ9A 1RHHA 1T7VA 5CMAB 5C09B 2R0KH 4OFDA 5HHVL 1HI6A 4BM7A 6FABH 5FYJE 2VH5L 3EO9H 4ALAH 1LD9B 4JKPL 4Y2DB 1DBAH 4JHBA 2R1YB 3OAUL 4N68A 1RHFA 1V3KA 4G7YL 4YIQA 2X4RA 4BK5A 4LAQL 4LGPB 3KPRE 1SEQL 4PRPD 5GS0L 3PDOA 1UXWA 4PJ5E 2FEDC 3HZMA 4A6YA 3WIHA 3BVNB 1RZKC 2NR6D 3O3EA 4X7FC 3ARFC 4YHLH 1IQDA 2N7AA 4X5XA 1JWSB 3P30L 2ITDA 5CJOL 1D7FA 43CAA 4AIZB 4F33B 3F7QA 3MRMA 4PJDB 4U1SB 4ZYKA 3O6ML 4HH9A 4PRHD 4NKIL 1CCZA 1RMFL 5AYUL 4PYHA 1G7QB 3SY0B 1OARH 3K8MA 5ESVA 3ARBB 3RNKB 1QOKA 3MLTA 3BOVA 1ZT7B 3T3MF 1AGEA 5IT2L 1EO5A 3QUML 4R7NA 4JLRB 3KHQA 3FQUB 1HCVA 1M7IB 4OSUH 3B2UC 2P5WE 1L6ZA 4M00A 2B5IB 4HIIA 5DGQA 5L9DL 4OZIF 4UT7H 3UJTH 1WCBB 4OIBA 4DQOH 4YXHL 3D39B 3CLFL 4OD3L 2FECI 5BRZD 3BZDA 1J1XH 1B4RA 3QUYC 3HTLX 1QVOB 4GXUM 1ZE3C 4L4VA 5CINL 1A0QH 4U1MA 1XF3B 2Y25A 4F7PB 2GQHA 1D9KC 3Q5OA 5I8CB 4QLRA 3EYUL 5SWZE 2NY4D 3V0WH 5CEZE 1Q9WB 1OY3B 5AG9A 4U49A 2WBJC 4EIZC 2D4DA 4Z77B 3RAJL 4L4TA 1I7TB 4V1DB 2QHLA 1LO5B 3DX9A 3G6JF 1BZ9A 1YEDA 2IG2H 4CGTA 1QLFB 2X9YA 3WHE1 2CMRH 5EWIL 3VXRE 5JA8B 1MJ8H 3DSFL 5I1JH 1D5IH 3V6ZB 2PYEB 3MNVB 1AGDA 2DOCA 3LRGA 1JJUA 5HHXH 1RIHH 1WWAX 4G6MH 1F4AA 3MRPA 3VFMB 2O5ZL 2R2HB 2XNAA 5GJTH 4ODWB 1TJHL 1SJHB 3SJVA 4WJ5A 4ODHL 4NP4H 4HIJA 4X7TB 1JGDA 3RWIA 5E7FA 4CVXB 1RJYB 1BF2A 2DLFH 4MQTB 3JV4B 2VUYA 3W9DA 5DJ2A 3LKRA 1T20B 3TM6A 5F88B 5DRXB 4XP1H 3MRGB 4OLWH 4ZAKB 2NY6D 5JXEC 1B4JL 4ZO9A 4CNIB 1URLA 3A6BH 5DK0B 4HUUB 3EJZC 4FFWD 2VC2H 3BP4A 4HUWA 1U8QB 4KUZL 2APWA 5LVEA 5F9JB 3KXFB 1F4YH 4Q9BA 4FQIH 3FQTB 4ZOAA 2ED7A 2P5ED 3UYRL 3V7AE 5DQDL 2Z8WC 3PL6C 4JM2F 4PGZA 3CSYA 2GJ6B 1NJ9B 1RHHB 4LQFH 3PF2A 2W9DH 4OZHA 4YXLL 4YHKH 1AHWC 4TSAL 3L7EA 1EVTC 4CU6A 4HZAA 4FHBD 3RVWC 3RIAF 3L3OA 5KG9A 2NX5E 4YIQB 1FJ1A 2X4RB 3E1F1 4LOUD 5J12B 3DHMA 1RVFL 4I0CC 4R96A 4NJ9H 3GFUA 2C4FU 3UTPE 3GJFA 5CCKH 3WL9A 4PTUA 2ADIA 5I1GH 1K3ZA 4BQ8A 1YYML 4XNQB 1UXWB 1IKNC 2A83A 4LEXH 3HZMB 4A6YB 3TT3H 2HT4D 4HK3N 1WIUA 5IQ9A 3VFNB 3O3EB 4ZFGH 5BVPH 5E08H 1IQDB 4X5XB 2VIRA 1CGSH 2ITDB 3H9SE 1FQ9C 3OPZL 3K74B 3QUXD 1AFVL 3MRMB 4XX1E 4Q58C 3TFKD 4Y4KC 2QADC 4U0QB 4FG6C 4ZYKB 4HH9B 5FHBH 4J8RA 3QDJA 1X5YA 3QIUC 4LSSH 9CGTA 2ZUSA 3L3IA 5ESVB 1CGUA 1Q0XL 3FOLB 3VFSB 3F58L 3Q6GL 4L9LC 2OZ4A 2XA3A 1AGEB 4WY7L 1FGNL 1DUYA 3RUGA 3OJVC 2AXJA 5DZNA 5ADOL 1DQQA 4H8WC 3T0EE 4HIIB 3RVTC 5JOEA 2C5DC 3B9KC 1YEJL 1EFQA 2IADA 4KU1A 4M5ZH 4Z6AT 4PREA 4XNUH 3WFCL 1HE7A 3QIBC 1WICA 2WMPA 2R39A 3V4PL 4V2CB 4HBCH 5H2BA 4I48A 4L4VB 2ZUTA 4U1MB 4LSVL 1PFCA 2F8OA 1RZJC 2DDQL 4QNPE 3N85H 3V6OA 4P2OA 4I1NB 1VHPA 2NXYD 4P5KA 3S37L 3HHRB 2Z0BA 3QFJE 2IGFL 5HBBA 1AE6H 2C9AA 2XZAH 3QG7L 1RIUL 1U8MA 2JB5H 4L4TB 5IKCA 3A6CH 3FO2A 3N1PC 4QHUA 3DX9B 1BZ9B 1ZV5A 2OR9L 5E94B 4BUGA 1JMXA 4Y16C 3WO4C 3QISA 4OLXH 4ODTL 2AJXH 3TO2A 4IRSC 4ZG1A 4R90H 1QP1A 1AGDB 3T0VA 5M7QA 4RBPK 3MRPB 5C0BE 2XNAB 2UWEE 4KDTA 1U8NB 2VB5A 2DMKA 2A77L 3SJVB 3QCUL 4WJ5B 4I8DA 4HIJB 3BP7A 1T66C 4I3GA 1T1XA 1JGDB 1I1YA 1X5ZA 3F7VA 3DMMC 3UZQA 2P43B 4DKFH 4YC2B 2FEDD 1KIUA 5GGSY 3AM8C 5DJ2B 2ZUQC 3ARFD 1H0DA 3R1GL 1C5DA 1X5XA 4WTZA 4G9DB 4HKXA 2BNQA 4OCRH 4P0DA 3UTTE 3I3DA 1U3HA 4IMKA 3LN4A 2IFFL 1OSPH 1MFEH 5KS9B 3BP4B 4HUWB 3FB5A 4L8BB 1N6VA 4RDQG 5I74C 4GG6F 2J4WL 4G7VL 4KVCL 1M05A 2AP2A 3QQ3A 4WI5A 1KUMA 5IK3B 2D0FA 2UZXB 1QG3A 4UDUA 3CSYB 2HTLC 3OAYK 4OZHF 3B2UD 3GMNA 4ISVA 3NACH 2OTUA 4FXKA 3M07A 3K0WA 5FCUL 2GK0A 3L7EB 2IAMA 3TVMC 3QUYD 4H1LG 4G43A 5KG9B 5IFHL 2J8OA 3GO1H 2AABH 2X4OA 2OL3H 2X2YA 3CFJA 3UPRA 4R96B 1D9KD 4J3OC 4XPFH 3GJFB 4QGTA 3WL9B 4PTUB 3EKCA 2ADIB 3CK0L 5DO2C 4O5LH 4U1NB 3QRGH 2A83B 5JHDD 2V5YA 4NQEA 4OT1H 2WBJD 3WFDH 5IQ9B 5LQBH 3O6FA 4LCWA 2VIRB 3JVGC 3EYQC 4UNUA 3KYNA 2V17L 4JHWH 1UZ6F 3GBNH 3ULSA 4KZDH 4WDIA 3WDHA 3WNNA 1S9VA 2B0SL 3QPXL 5HHPA 4Y19D 4JKWA 5DWUH 43C9A 3QDJB 5HYSA 1AO7D 5EBGA 4PFEA 4MZ3A 3WNPA 3L3IB 2ED8A 2NTFB 3EOYG 5IMKA 1N64L 1EUTA 1RUQL 4W4OA 2ZCLH 5AG8A 4YZFE 3RUGF 1E4JA 1X5HA 4UQ3A 4E41A 1BOYA 3QDGE 1DUYB 4LDOB 4G8GD 5F9WC 5F1KC 2RBLA 1DQQB 5SWSD 5F3BA 2GW5A 5CHNA 1WZLA 2JIXD 1NCWH 1R6VA 2IF7A 5F7UA 1MFBH 5MHSE 2IADB 4Z7UE 4IIQA 3ARZA 3WKNA 1O7VA 1IE5A 5J11C 3RZWA 4U33A 3VRJA 4R0LC 1NPUA 5JXED 4LSTH 4M62H 4GKZA 4F15C 5H2BB 4I48B 3PABA 2VOTA 4BZ1L 4WUUA 5EUKA 5K9JH 3EJZD 4RQQA 4P2OB 3LOWA 4P5KB 4LARH 1AD9A 5IROA 4ORGB 3BD5A 2Y06L 2NNAA 2WINA 1U8MB 3D2UA 1I1AC 3PL6D 2VN7A 1KCUL 5IKCB 3GMMA 4QHUB 4NHUA 4Y4FA 1XH3B 2XXCB 2FYYB 3C5SA 1HH6B 5C0GA 1C5BH 1TQCB 3C6LC 3S4SG 1DJSA 3RVWD 4DKDC 3KYMA 2MQ3A 5L2JA 2C3XA 2B39A 5I18L 1X5IA 2XTLA 4AL8H 3BP7B 5I73B 1T1XB 3F7VB 1I1YB 1MCPL 3N9GL 4X7SL 3VI3F 5LAXA 1YEHH 1PLGH 5BO1H 4L3EA 1U91B 4FNLH 4MAYA 3T08A 1H0DB 3CFIC 5E2JA 4JB9L 1C5DB 2ITCA 4HG4K 4J3TA 4HKXB 2XWTA 2BNQB 4Y4KD 1P4LA 2QADD 4FG6D 1U3HB 1AR2A 1E4WH 4XMPH 4X9FA 3QIUD 3LN4B 3MUJA 3PXJA 4P59L 4KRPB 1JNNH 2P8PA 1SY6L 4UDTA 4LNRA 2QSCH 4GO6B 3ULVC 4MNQB 2K1MA 3ULVF 3SGEI 3WE6A 1IGIH 4EUPH 1B3JA 1YEEH 4FZEH 1BQLH 3B83A 4P9HL 5C09E 3HS0A 4UDUB 2OJZH 3VE0A 1DEDA 2I9TA 2OTUB 4FXKB 3RVTD 3B9KD 4OZGA 2X5PA 1CTOA 1EGJH 3MGOA 1W8OA 5I30L 3QIBD 5CGTA 3TBTA 1EPFA 1FIGH 1D6EB 2GK0B 1IAIM 3OB0K 4HT1H 3MJ9H 2JELH 2IAMB 4NC1C 2FX7H 4KPHL 1ZT4B 4G43B 3MJ7A 4ODVL 4P5TB 3WD5H 3I9GH 2FNBA 3MNZA 4X9IA 2X4OB 3FZUC 4C83A 2EIZB 2W0KA 2FB4L 3CX5K 3ARGC 4IOSD 1C7TA 3REVB 4PJ9B 5MENA 5T1DL 1QFWL 1G7JA 4TQEH 4TUJA 2DKSA 3SQBA 4NQEB 1I4FB 4LCYB 1MEXH 1HHHA 4OF3A 4KHTH 4DFHA 3O6FB 4PTTA 1EBPA 1Z9OA 3KYNB 4KY1H 4PJDE 4M7JH 1ZA3B 1S9VB 2VDQH 5BJTA 1X3DA 4Y16D 1OW0A 5HHPB 3QO0A 4HJGA 4K71C 3DECA 4IRSD 5HYSB 5I0DA 4EDWH 1TZHB 4KUCF 3VFRB 4UB0L 4WFHE 1J0YA 5IMKB 1BFVH 1YEKL 4HLZH 5ISZA 1IILE 1BAFL 1QFOA 3T77A 5ITBH 3X12B 4UQ3B 4E41B 1A6WL 4PJ8A 3INUH 1T66D 4KZEL 3KPLA 3E6FB 1R3HA 3VWKC 3DMMD 5F3BB 1MQKH 2Y5EA 1ZVYA 3RRQA 3O4OC 5ADPH 1FFPB 1BQHA 1JRHL 4NN5B 2BJML 2MPAL 4V2BA 3VRJB 2GT9A 2EDBA 3K8KA 3PABB 1F6AA 4WUUB 3HMXL 4OGYL 1ULVA 5KAQF 1KJ2H 3FJTA 4FQPA 4RQQB 5FXCH 5DRZA 3WDIA 1AD9B 3IDXH 1P1ZB 2DQCH 4C56A 1SYVA 4HDIA 2NNAB 2VITA 4V1DE 5LBSL 3D2UB 1BHGA 5I75B 1AJ7H 2VXVL 2HTLD 5ICYA 3QYCA 4WFFD 4Y4FB 2EC9T 2Y7QA 5FM5O 4X6CA 3HI1A 1A6AA 1UACL 1NMBL 2PYEE 3C5SB 5C0GB 4Q6IA 3PWJA 1CDHA 3TVMD 5L2JB 1CLYL 1OWWA 3RTQC 1M4KA 1CDCA 5HSFA 3BDYH 1TVHA 4ZPVA 4LHQB 3GSNH 5DO2D 1E6OL 3EYVA 2JJTA 3MLXH 1G9MH 4RFNB 1OAQH 4NWTL 4MAYB 5IMLB 4OFKA 3EYQD 4JKMA 1N0XH 1RZKH 1GPOH 5F7YC 3VRIA 1YJDH 4U6HA 1LO4H 1A3RH 4HS8L 2CJUH 2BMKB 5D7IA 1MRCL 4QRPD 3KXFE 3LIZL 2VNCA 3BKCL 4LNRB 4UUJA 4X4ZA 5FDWA 1DEEA 4JPVL 3QI9A 2GJ6E 3WE6B 3DYMA 1T2QH 3HS0B 2VLRA 1EHNA 3DJ9A 4GBXB 1OPGL 1ZK9A 3CVHA 1EMTH 4OZGF 3VFVA 1PQZA 1QHPA 2I9TB 4CUCA 4KHXH 4FFYH 1MCQA 1YNTB 3MGOB 1UM6H 1F4WH 3EDKA 1T5XB 4LLUA 3EDDA 3MRIA 3EYOA 4Y4HA 4OCSL 3MNZB 5MI0B 1A7RH 5T3ZL 3EAKA 1YQVH 4KC3B 4E42A 1JPST 5CLWA 4YUEH 4B0MM 4NKDA 1G7JB 4TVPE 4TUJB 4Y1AD 5FYJU 5KVEL 4D9RD 1DQLH 2ADGA 3X13A 1I1AD 2J5LB 1LNUA 1BZ7A 4PTTB 3IF1A 2ADFH 4XMLL 2OX5A 5BJTB 4D9QE 1HYRC 3GDBA 1OP5K 3DI3B 3QO0B 4HJGB 3QHZL 3W39A 1S7SA 3MA9H 3LPFA 3C6LD 3QDAA 3DBXA 5D7JA 5EU6D 2NTSP 5HHQA 3T77B 1SJXA 3Q5TA 2VZ3A 4PJ8B 4UIMA 4OI8A 1P5UA 3BD4A 3KPLB 5MEPA 1R3HB 3WFBL 4ZUTA 4JQVC 1H5BC 1BZQK 2ZZUT 2H6PA 3K80A 1BQHB 1MF2L 5BVJA 2YXFA 4ZUSA 4L4VE 2R0KL 4ONFH 4Z7WA 4CN4A 3EYFA 1SBBA 3U7YH 2J1KA 4RMWA 6FABL 1F6AB 1JPFB 3JTSA 1J0IA 4ALAL 2PW1A 1UT9A 4XMKH 1RUMH 3SCMA 1DBAL 3HZVA 3VD3A 5DRZB 4K94C 5J89A 1QPXA 4PV9A 1N3NA 4PJCA 3ULVD 4JY4A 5DQJA 1SYVB 4C56B 5BV7B 4HDIB 4L4TE 2VITB 1I9EA 5ICYB 2NQCA 4RRPA 5JPNA 3HNSH 4GAGH 2AXGB 2Y7QB 4U7SA 3V4UH 4W6WB 4X6CB 4N9GA 3HI1B 5C0FA 1A6AB 2QQNH 4YHLL 3MUZ1 4LHUG 4Q6IB 3PWJB 4D2NA 3GSRA 3SJVE 1Z5LA 2BFVH 3NCYS 2JCCF 4IEFB 3ARGD 5IOPA 4ZTPH 4ZPVB 3HNVH 4H1LA 1B6UA 1KB5H 5CLTA 3OTTA 4P48A 1OARL 5IW3A 1NMAH 4PG2A 2DJ4A 1U92A 5IFAH 4PJIB 4Z0XA 4I5BA 4OFVA 4M8QA 4QT5B 4OSUL 5B8CC 3LRSA 5HTSA 4BSVA 1N5AA 3VRIB 3EUUA 4MA8H 1M7XA 4LK4A 4U6HB 4R4FH 4UT7L 3UJTL 4HUMB 1DBBH 1VENA 4DQOL 3VGAC 1UH2A 3VDBA 2BY3A 5DJXA 4D94A 2FEEL 1J1XL 4MX7A 2D31A 4LPTA 3TBYA 5C9KA 5FYKD 4L5FH 1Z9SA 2F15A 4LVHB 1I85A 5IB2A 1A0QL 3KJ4C 2EYSA 2CRYA 3Q6FA 1AH1A 4ETYA 3VWKD 2BNRA 2ERJB 3PV6A 3IS0X 3CVHB 2FO4B 1YYLH 3V0WL 3VFVB 1PQZB 3ET9F 4NKOA 3OJDA 5D6DA 1QFUH 4MA1B 1T3FB 4MJ5A 4WGVB 2Q3AA 5FO9A 3CPLA 5T1MA 3TLRA 2CIKA 1UH3A 2CK2A 3OJMB 4LLUB 2IG2L 3MRIB 5DEGB 4I2XB 1G6RB 2OCFD 3C87A 2CMRL 3RWHA 2DQDH 2RGSA 3M8OH 1MJ8L 1NUNB 3GSQB 1OQOA 4E42B 5I1JL 1D5IL 1KCSH 3GMQB 5HHXL 1RIHL 4O4YH 1NBQA 2SEBA 4LGSB 3HPJA 1HN1A 3P4LA 5GJTL 1W0WA 2ADGB 3EHBC 4AENA 1HYSC 3X13B 1NCAL 1LNUB 4OLUH 1BZ7B 3IF1B 2QV2A 3TWCH 32C2A 1P4IH 4CVZA 1LP9A 4C58B 2DLFL 4AIOA 1QRKA 1Q9KA 4GQPH 2G9HA 3QDJE 1GIGH 1BWMA 1CXHA 3W39B 1S7SB 5IHLB 1KFAH 3DBXB 1IAIH 3GZKA 4OLWL 1G6VK 3RTQD 3ZDXF 1PD6A 4FQHA 5HHQB 1S7UB 1AGCB 4PJEF 3FB6A 4YFLI 4ZQKA 3A6BL 3VFOA 4ACPA 2VC2L 5IVNA 5MEPB 4KKAC 5BRZB 4PBVC 4FQIL 3RU8L 1BX2B 4Z7NF 5IVXF 5DHVH 2LVCA 1ND0A 2H6PB 4H20H 4LQFL 2W9DL 4UTBH 5BVJB 3NIFF 4ZUSB 3TZVC 4Z7WB 3EYFB 1EHLH 4YHKL 4OQTA 1HHJB 3JTSB 3V6OE 5I8OH 4AT6A 3SCMB 4ZD3H 2GITA 3ZTNH 3DROB 5C6TH 1KYOJ 5KANG 4PV9B 5DQJB 3RWDA 4RDQF 3BZEA 4NJ9L 4NRZA 3GMOA 2B7DT 5CCKL 4O2EB 1KTKE 3WHXA 1MOEA 5I1GL 2BP3A 2VXTL 5JPNB 2QQKH 3S3SA 5I1AA 4LEXL 1GSMA 3TT3L 1FZJB 4N9GB 5C0FB 3DUHA 4ZFGL 4Y5VC 5BVPL 5E08L 4S0TD 3LZFH 5EOTB 1CGSL 3RL2B 3VDCA 4DN4H 1XR8A 3SE8H 2VLJD 3V0VA 3NCBB 1G7LA 5FHBL 3U30C 4LSSL 5IOPB 2DQHH 4NQCD 3GJFH 2ICEB 4LSPH 1KG0A 2NY6B 4QOKD 4D3CH 1U92B 3R0NA 4PRAB 5EBMB 4Z0XB 1OAYH 4I5BB 2D03H 2AEPH 1S8DA 1FZOB 4M8QB 2BNQE 3K4AA 3LRSB 5CZXC 2VRAA 1G1YA 3IXTA 4LAJH 4BSVB 3RHWK 2P47B 3DRTA 4JVUA 4M5ZL 4XNUL 2UZYB 5IVOA 3TYFA 2CH8A 5DLMH 1D3CA 4MX7B 2QLVB 4MNQE 4ZS6C 1IAKA 4HBCL 5T1KD 1AI1H 3BPOB 5IB2B 2VABA 2YD7A 3RX8A 2EYSB 3Q6FB 1MHPH 3N85L 3PQYD 4MWFB 1F2QA 4M7ZC 2BNRB 3CLEL 2KL6A 2D2OA 4XP6H 1WZ1H 3DV6A 3OJDB 1AE6L 1T6WA 4WV1A 5A43C 2JB5L 4MJ5B 4B5EA 5FO9B 2XZZA 3CPLB 3M1BA 5T1MB 2CIKB 3A6CL 3EO1A 2VLLA 5B39A 5IWLA 4X0KA 2CLZA 2PTTB 3RWHB 4OLXL 5DUBA 3VI4E 2AJXL 1Z3GH 4R90L 1EEUA 3AMKA 3LEXA 4NQEE 2Z31C 5CZVL 3IXAA 3QUXB 3OZ9H 1W0WB 4KK5C 5F6IC 4Y5YA 2NY0C 4L4JA 4AENB 1DANT 4Y19A 4LCWE 3VXSD 1XGTA 5I76A 1WJ3A 2ZOLA 1LP9B 4DKFL 3O11A 1Q9KB 3J8F7 1V7MH 1F3DJ 4HBQA 2G9HB 4KGJA 4NNXB 2HT2C 4FQ1H 4OD2A 5BW7A 1U8IA 4RNRA 3S36X 1G84A 4NQSB 4OCRL 4E41E 4FQHB 3T0AA 3RWCA 1U8LB 1U8PA 1MFDL 4R8WH 3FB6B 4ZQKB 2WV3A 4XZUA 3VFOB 4P4RA 1OSPL 2Y5TA 1MFEL 3H9YA 4RWHA 5HPMA 3IT8D 3DX8A 3GGWA 5GGUB 2ARJA 4LCCA 2V9QA 3QXTA 1S7XA 5D96C 1U9KA 3FAXA 3NACL 4YLQT 4WUUE 2CLRA 2NZ9C 3QJFA 3PGCB 4AT6B 4JVWA 2GITB 4HWBH 5K9OA 1F4HA 3GO1L 2AABL 2AQ1A 3UP1A 2OL3L 3IRZA 1I9JH 2ZCHL 3RWDB 4H25A 3BZEB 5EUOA 4NRZB 3GMOB 4XPFL 4HW6A 3MMEA 3WHXB 3ULVH 3VXNA 2QL1A 2VKXA 1Y6MR 4O5LL 3O3DA 1Z9MA 5I1AB 2NLJA 2E27H 3TBSA 1YN7A 4OT1L 3WFDL 2YA0A 2R8SH 5LQBL 4CJ1A 4GH7B 4YWGH 3UX9B 4JHWL 3GBNL 4KZDL 4LIQE 4DZ8A 1XR8B 3X3FH 3T65A 3V0VB 5I1HH 1G7LB 2BHYA 5DWUL 3W2DH 3ARFB 4XC3H 3NBNA 5F8RC 5FFLA 3WSQH 2ZCLL 4L3EE 4IMLA 3EHBD 3KPTA 1HYSD 2WNGA 4LGRB 3WNLA 3ALXA 3TH2T 1S8DB 3BPLC 4KXZH 4KKCC 3IXTB 3LCYA 1NCWL 2OSLA 1MFBL 1VGKB 3DRTB 4DGYH 4YO0A 3C5ZA 3U0PA 5I71C 4M1DH 4LSTL 1I3RB 2AK1H 1IAKB 4M62L 5DFVC 1JZ6A 3G6DH 1CFVH 2VABB 1I1CA 5K9JL 2B2XH 3QIBA 1F3DH 2HT3C 4KKAD 5D2LA 3CFBA 4G6KH 4LARL 3W5MA 2HRPL 3SKNA 3RA7H 2E3VA 4PLKC 4WV1B 4ZFOA 1FYTD 4PJFF 4P46C 4BH8A 2VUOA 1D9KB 3M1BB 2X4NB 2VLLB 3EO1B 5AYQA 3TZVD 5TH2A 5B39B 4WW2C 2VR5A 4WW2F 4QGYA 4RZCB 4X0KB 2CLZB 4TNVF 3ZE2F 4JPIA 2EDXA 5DUBB 4MSWB 1C5BL 4XNZC 4GKSA 4XXCA 5HD8C 1ZWIA 4EN3A 3KYOB 4CDHA 4J3SA 3IXAB 5E6IC 4Y5YB 3UBXB 4Y16A 4Y19B 4AL8L 3TH3T 5I76B 2ZOLB 5IFJA 1S7RB 2FH6A 1AO7B 3A0OA 2YRLA 3O11B 2O5XH 1YEHL 3AS3A 3OKYA 3SGJC 1PLGL 4NJAH 5BO1L 3ARRA 4APQC 4FNLL 1NAMA 2ZUXA 4G8GB 3LMJH 1PZ5A 1TVDA 4OD2B 4HGMA 1U8IB 4RNRB 2X1OA 2IWGA 1ZLSH 3SGKC 2JIXB 3RWCB 1E4WL 4XMPL 3WNMA 4LIQH 4XZUB 2PYFA 3E0GA 3AM8A 4P4RB 4X5LA 1MCSA 2IH1A 3QH3A 1JNNL 1WAAA 2DLEA 5DVKA 4P3CH 2YKLH 2QSCL 1OL0A 1A8JH 3N1FC 1G1CA 1IGIL 1YEEL 4LCCB 4FZEL 1BQLL 4YDKH 3EFFA 3VD9A 3FMGH 1S7XB 5CZXD 1EXUA 2OJZL 4FQQB 3L1OH 2CLRB 1J7VR 1A14H 1UB5A 3QJFB 1FIGL 4GRMA 3LKNA 1I7ZA 1GOFA 4HT1L 3BGMA 2JELL 3MJ9L 5DD0H 2FX7L 2XKSA 5K9OB 5J56B 3WD5L 4ZS6D 3I9GL 4C56E 5GZNC 3S34H 4H25B 5E8DH 5EUOB 1AQKH 3Q2CA 1NEUA 2YBRB 3MMEB 1PG7X 2BHZA 1RU9H 1XGYH 4TQEL 3VXNB 3TVMA 2KKQA 4X6CE 3FONA 3UPAA 3O3DB 3MZTA 1BVZA 2NLJB 1YN7B 1MEXL 4KHTL 5DEZA 2EXYC 1BP3B 4X8XA 4KY1L 2ICCA 1CD9B 4DZ8B 2QSVA 4ZXBC 5GRWA 4Z95L 1FNAA 3WDJA 2NY5H 3EFDH 4FXLA 4XWOC 4EDWL 5H8DA 3HAEG 1JGUH 3H3PH 4NQTA 3MJGX 3CIQA 1BFVL 2Z31D 5ITBL 4RMTA 4IMLB 4KK5D 3IJYA 2NY0D 2QADB 4E9LA 2V5SA 3MRDA 4OTXH 3INUL 5SX5H 5DR5H 3QIUB 4U0RB 3TN0A 1MQKL 1MCFA 4L9LB 4YXKH 4BK4A 2OSLB 5D7IE 4YO0B 5AEAA 5ADPL 1IMHC 3U0PB 2HT2D 1QFWI 4P3WA 4XNMB 1MWAB 1OP3H 2NZIA 4Q97A 2J8UF 2WUCH 3B9KB 3L9RA 5HDBE 2YN3A 5B21A 4MJID 1KJ2L 4AY0A 4FRWA 4X99A 2VLRE 1LDSA 3QIBB 5D2LB 3CFBB 2VLMD 4POZC 4XP4H 1A6UH 3WJLC 2EICA 3BP6A 3SKNB 4F58H 3IDXL 1QFHA 2DQCL 4ZFOB 2ZSWA 3AU1A 3MV7D 5D1XC 4BH8B 1AJ7L 2DQTH 4MQXC 1LEGA 1FGVH 4HXBH 3BRGC 5TH2B 4Y7MA 2NZ9D 4WWKC 1YNLH 1VFAB 4JPIB 4RFEA 4GKSB 5DD6A 5DVMA 4Q2ZA 5LWYH 1ZWIB 3JWDH 4FN0A 1H3GA 1I8LA 4MVBD 3BDYL 1BECA 4Y16B 3WO4B 4TVSa 1JRHI 4K94H 5ID0A 5KSAC 4IRSB 3BPNC 5GGRA 5IFJB 3GSNL 1A6VH 5FECA 2YOCA 1OGAD 3MLXL 3V79C 1G9ML 1OAQL 1E0OB 3WO3B 4XB7A 1PZ5B 3PG2A 3SDAC 3T1WA 3E3QE 3BH9B 1N0XL 1RZKL 1EZVX 1GPOL 5B38A 1YJDL 1XGRA 3TNNA 1WFOA 1LO4L 1A3RL 2PYFB 2CJUL 3PP3H 2ZUQB 1CFQB 1J1OH 4Z7VF 1UJ3A 2IH1B 1N6QL 1OAKL 1Z0NA 3GKZA 2APFA 5HJ3B 1KULA 1T2QL 4Z7WE 1EXUB 3KVQA 3MJ6A 2XKNA