4H20H

Crystal structure and computational modeling of the fab fragment from the protective anti-ricin monoclonal antibody rac18
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
220
structure length
220
Chain Sequence
EVQLQQSGPVLVKPGASVKMSCKASGYTFTDYYVNWVKQSRGKSLEWLGLIIPSNGGTTYNQKFRGKATLTVDKSSSTAYMELNSLTSEDSAVYYCARRGLTGALFAYWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPALLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIVPRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and computational modeling of the fab fragment from a protective anti-ricin monoclonal antibody.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Light chain of Fab Fragment from the anti-Ricin Monoclonal
total genus 44
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2012-09-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4h20H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4h20H02
2G75A 1FZJA 3AM8C 3BJ91 1IEBA 2QSQA 3DMMA 3O3AA 3TH3T 3DUHA 5CEZE 1CF8H 1HXYA 3HNSL 1U3HA 5D6DA 4HWNA 2DLFH 2DTMH 4PPTA 4JFYB 1YYMH 4G6AD 3BPNB 3S98A 1KIQB 5DD6B 4ISVB 4I3GA 2PW2B 3UEZA 4JE4B 4XMPH 2APXA 2G75B 4JANA 5K9QG 1HWGB 1UGNA 1HEZA 1NGWA 3IFPB 2CMRH 2FEEI 1INEH 3VFOA 4KGJA 3BSZH 4R8WH 4S1DC 1Q9LB 4JM2B 4M8VA 1BFVL 3PABB 5GJTL 3CFCH 3FT2B 1P4IL 4PJXA 4ZS6C 4M43H 4GRLD 4YHIA 2VDRH 3RU8H 5B4MC 5HVHB 3RL2B 1AO7E 4KUCF 2Y7QA 2AJUL 2P24A 4GRLB 2I27N 5CBAA 5C0CD 1G6RA 4WO4B 1BJ8A 3ZE1F 1WC7A 2H32H 2UVEA 5FO8A 3F7RA 4PJGA 5JIIA 4YDLB 5KVDL 4WY7L 2DBLL 3HRZA 2BY3A 3HC4H 3WLBB 2EXWD 3B2VH 4PLOB 3MLTA 5I75B 1EEYA 1UKSA 4P5TC 3SKJL 3EBAA 3MV9D 5DEGA 4JFXB 2W92A 1OAZH 2D0FA 3FB7A 3LKOB 5IMKB 1F58H 3DRTA 1CXIA 2DDQH 1KJ2A 5EZLB 1P4BL 2F53E 1XT5A 2Y9RT 1IAIM 3N1FC 1H5BA 4X8XA 2UWEB 1UYWL 1SM3L 1PKOA 3Q3GA 3TIEA 1QFWI 1BQLL 1OAXL 3A0OA 5TE4H 3NFNB 4YHPB 5DEGB 3MBEA 2RR3A 5I71C 4IHOB 5F1IB 1RK0B 1W0WB 1XGRB 5FHAH 5I76A 2JJTC 2DQDL 1VFAA 2ADIA 3QNZA 1EJ6A 3HA0A 5H2BA 2WUCL 2DTSA 4PRID 1JV5B 3KHOA 3MJ9L 2NY1C 3MV9B 2AJSH 2CH8A 3Q5TA 2FSEA 4RA0C 5F9WC 2YKLL 1GGBL 1LK3L 4PJFF 4LKXA 3HI1A 3MA7A 1PSKL 4DAGH 4Z9KB 1CTOA 1T2XA 1B9ZA 4X8JB 2QV2A 1GSMA 2OS7A 1FV1A 1TFHA 2C1PA 1YC7A 4HKBA 3JUZA 2JIXD 1RJYA 5B38A 3RVXD 4KRPB 5I18L 4D0CA 3QZWG 3D39A 4L3EB 1M4KA 3O45B 3NCEB 3QDGB 2JCCE 1B0WA 3PGFL 1CICC 4NC1C 1ZLUH 3MRNA 3C8DA 3W2DL 2P8LA 5JPNA 4G6JH 3SO3B 5KSAC 3CLFL 2FBJH 1KIPB 3GDBA 5FECA 4HUWA 5GIRB 4JKMA 5GZNC 5KS9A 4JQVA 3PGDB 4NQUA 1RIVH 4M9OA 4C59B 2YOCA 3MUJA 4LQFH 4I3SH 2DQUH 4FQXB 4P59L 4QKXB 4TUJB 1T04B 4I8DA 2X1XR 3FO9A 2H26B 3SE3A 3VGGA 4D0CB 4FFYL 5HGDB 4B41A 3ZE0F 1MQKH 3N9GH 3ULVD 3BE1L 5F7YC 1UEMA 4YR6B 3F7QA 6CGTA 1L7IH 4OGAC 2BSRA 4GAGL 4ORGA 2XT1B 4RNRA 2DF3A 2EDWA 5HGBB 1BEYL 5FDWA 2SEBB 3UBXI 1SYSB 4PP1D 4APQC 5BQ7A 3FO9B 1MQ8A 5MHSE 4I48B 1JHKH 3BIAX 3HUJA 4F7CA 2W07A 25C8L 2GTWB 5EBWB 1XF5A 3INUH 2FECI 3DX6B 1W72B 3EYVB 4YXLL 4HKXB 3BUTA 3KPPA 4ZTPH 1IGFL 5ICYA 4PRPA 4OZHA 2C4FT 3JWDC 3MPCA 4F7TA 4P5MB 2AERT 4WI4A 3NZHL 3RUGE 4BH7A 3LD8C 4LGPB 4ZAKB 3ARFA 4YC2C 3IJYA 4NKIH 1QSFD 5F7WC 1YPZE 1K4DB 4NZUL 1QO3A 3B5GA 4B53A 4X4YB 2NLJA 3P40A 4U1NA 5E8DL 5F9JA 4U6YB 4Y5VB 5LBSL 1GZQB 5LKNA 5DJAA 3UTTD 1VESA 2ORBH 1F6AB 3ULUC 3GBMH 3W9EA 2R2CA 3QQNA 5FYKU 5IW3A 2ESVD 2YD8A 1FVDA 1RIUL 4ZAKA 5D9SA 4JZNA 4Z7VE 4QNPF 2NY4B 4KKNA 3WLWC 5CSBA 2VZ1A 1QO3B 4ZOCA 4HK3N 3IVKB 2VLJB 4PJDF 1EBPA 4MB3A 4JQIH 1FVEA 1N5YL 1NBQA 5SV4A 2ATPA 1YEFH 5I17A 5IFJB 1F6LL 1NSNH 4F57H 3IU3B 3IDYC 2H6PB 1R5IA 4NOFA 2YXMA 3CD4A 4Y1AA 5GS0C 5M94B 3HI5H 5LXGL 1OT1A 4RBPH 3MRBA 1KJVA 1JMXA 2BY0A 5AYQA 3P4OB 1T1ZA 3RZCC 1MCHA 4PJHF 1FVEB 5EZJA 2OZ4H 1D3CA 1TJIH 1KCRH 4JHBA 3WS3B 3S6CA 4GG6F 3M17A 4I77H 4CVXB 1IKNC 5FOJA 5D1XD 3TBSA 1RZ7L 5I0DA 3QQ4B 4H25B 4ELKA 5MEQB 3QEUB 1MVUB 2JB6A 1T20B 3I75B 4FQIH 1WV7T 3D18A 4LSVL 3UBXB 4YE4L 5F6HJ 3SE9H 2ICES 1RMFH 2HVKA 3RPIB 3QIWA 3MLVL 3NCFB 5C0EB 5DVNA 4EVNA 2DWEA 1BJ1J 1AH1A 1ZHKA 1DN0A 3RTQC 2A0LC 4OIAA 3D25B 5MEQA 1ACYL 4L3CB 2AJVL 3RWEA 2NX5B 2H2PC 3I75A 4JFQA 4X7TA 4MQSB 2YA2A 4KY1L 2C3HA 3TA3A 3OB8A 1AC0A 3KVQA 3FRUA 3FONB 4X98B 5C0EA 2DIBA 1D5BB 2H1PL 1QACA 1MFDL 2CKBL 5CJQL 2VC2H 1KLUB 4OV6F 2Z31A 5DI8A 2Y6SC 1HHGB 4X80H 1ZT4A 3FCTA 2E6PA 4U1JA 1W8OA 3B9AA 5T1KB 4QRTB 2KH2B 2H9GB 1FVCA 5CSGA 5KVDH 5BCAA 3U1SH 2CLVA 3LMJH 3FONA 4NQXA 4QYOA 2YD4A 4JGJA 5E03A 2GKIA 3HPLB 4X0KB 2VABB 1I3RA 4G9FD 4LSDA 4PRIB 4MXWL 3DVIA 2H2SC 3VXSE 4WFEE 5E6YA 3PWNB 1F58L 2O5ZL 3SE8H 3VE0B 4YX2H 3P9MB 1P2CA 1Y18A 3QFJA 1NC4D 1G9NL 1NKOA 5FGCE 2MNUA 4BZ1L 1GYAA 1R3HA 4Y4KA 3I6KB 3SGKA 3LKNA 3LN4B 3P77B 3QPXL 4KROC 1ZLWH 2LFGA 4NYLA 2VDNH 4X4ZA 5JHDE 5FK9B 2C3VB 3MJ8B 4AH2A 4XZUA 3GSNL 3VE0A 1G9MC 4OLEA 2J6EA 2XQYK 3VGDA 2I9LA 3FO0H 2JLLA 1KJ3H 1KACB 1I1FB 2BDNH 3FO2B 2VNCA 3AS0A 1EO8H 4J3XA 3RI5F 4M1DH 5D5MA 3C6SB 2Q7YB 1MRCL 4Z7UE 3ARUA 2J1KA 4HIIB 2IWGA 3VXMD 1CE1H 5FGBA 2WM0A 3KNBB 1FP5A 1RV6X 1N6QH 2CQVA 3FO1A 1ZAGA 4MJIA 2VN4A 3LRGA 5MP6L 3G5YA 3TBWA 4DKEH 5IJKA 3ELAT 2EE3A 2EYRB 3LY6A 1LO3L 2DJSA 4HIXL 4OCWH 5KBNC 1J0JA 2CIIB 1HCVA 2R0ZH 3AMKA 5CGYC 2PCPB 3MBXL 3C5SA 2WLZA 3UTPD 1PQZB 2X89A 1HNGA 4MVBC 4Y4FD 2EEAA 3KNBA 3BAEL 4NRZB 2EXWC 3HC3H 4ODTH 2FATH 1CGVA 1MFEH 3WFEH 5I1LB 3RGVD 2QSCL 3IS1X 2VB5A 3DX7B 2CK0H 4HS8L 1FO0B 1WFNA 2EECA 4CU8A 2HVJB 1YZZA 4I5BB 2QTEA 5F44A 3HRPA 5FEBA 2OZ4L 4MHHI 3WFDH 3O3BA 3QCTL 4LCUA 1EXUB 5CSZB 3OKEB 4JY6A 1CL7I 3MJGX 2HWZL 4PP2A 5HGAB 1GC1H 3CSYB 1TJGH 3MLXL 5DJ6A 3ZDZF 2ILLA 5HPMA 1P7KB 4J1UA 3FN3A 3C2SA 3ARFC 3T0DA 3L5JA 1S9XA 5DMKB 4RMVA 3NH7H 3WXVL 4YE4H 2MFNA 4LLWB 3IAQA 2GFBA 3MLVH 3WEXB 2ZWLT 2E6JA 4GG8B 5AD0A 4EOWL 5IGXL 1YPZA 4J8RB 1MPAL 1A3RL 3BIBX 4GQ9H 1TCRA 1QFWM 2V2XB 1NUGA 1SJHB 5DR5L 3WKMH 4MZ2A 3BKYH 2ITCA 5L9DH 5DMKA 3T0EE 1HK6A 4NC1E 1NGZB 3GRWL 4OQTL 1FIGH 3QCVL 5LBSH 3BO8A 3IGAA 3MRRB 3JXAA 5HGHA 1QR4A 1HSAB 2EYSA 5HI5C 4ZUUA 3BJLA 4OLWH 1HI6B 5FA4B 2VH5H 2YMXL 4NM4L 2ITCB 4LVOB 1EERB 1NC2D 5FCUH 3RJDA 3KLSA 4J7RA 4YJZL 4ZUTA 5TGBB 2DLGA 4E0RB 3OKMB 3NFSL 4PJHB 1AHWC 4N8CH 2YHGA 1J8HD 1G9MH 1QSVA 2FO1A 1LE9B 4IRSD 3FRPG 1T3FA 2A1WH 1NGXB 1U92B 3G6AA 1IT9H 2GJZA 3VWJB 5C09A 1YEHH 1DQTA 3ALXA 1I8KA 4JJ5B 1EH9A 1CGTA 2JJUA 1DSFL 4DVRH 2MQCA 3GBNH 2P44B 1AKJB 5CJ5A 4G8GD 4AM0A 3ARGB 4M8QA 4K3EH 3ZYOA 5D96C 4F15B 1GCFA 3G6AB 2YZ1A 4NQSA 4NNYB 4TNVF 3UTZA 2YEZA 3SN6N 2BOCA 1BD2A 3QFJE 4Q6IA 3HR5A 4HKZA 3B3IA 5DRXA 5J89A 1HHIB 2AKRB 4ZS7L 4U1SB 3BN9C 2P5ED 1IEBB 3DMMB 3O3AB 5IK3A 5I8OL 2V9TA 4PRBA 4WTWA 2RBLA 5IKCA 5C07A 3LPWA 3ZDYE 3IDIB 4HIHB 4KK5C 3W5MA 2Y36H 4PJGF 1CFBA 2HFFB 4KKCD 1J05B 1IEHA 4C56E 1BIIA 5I75C 3QWRA 4OLVL 1MI5A 4NQVA 5ITFB 1JTOA 5L88L 3CVHH 4HIXH 5INCA 1R3JA 2AK4D 4YAQA 2XWBA 2NR6D 5IKCB 4M43L 1IARB 3W39A 3GHBL 4H1LH 1K85A 1NH6A 1KGCE 1I8LC 1T83C 5JIHA 2A6JA 3S36X 3EFDH 3ZKND 1J8KA 2HTKC 3P0VL 4FQ1L 1SYVA 1C08B 3RNKB 2DYPD 3HZMB 1QBBA 3LZFL 3QIBB 4RMTA 4HS8H 2XWBB 3TVMA 2ARJB 2YN5A 1X5IA 5SWZB 5B38G 1B4JH 3W0WD 4E42B 3MCLH 4S0SD 5EOQL 3L3OB 1A9BB 2QL1A 4BQBA 5DZOA 2H3NB 4IMLA 1QBLH 3TT1H 2C3GA 3PNWA 4HIJB 3EO9H 1BZQK 1U2CA 4I4WA 2P5WB 3DX8A 4S10A 3AUVA 5ICXB 3TNMA 4TNWF 1TVDA 2ED7A 1G9NH 3U7YL 1LEGB 2KQMA 1XIWC 4XVJH 2L7JA 4HWBH 4KK5D 5I0ZA 3DRTB 1FORL 2AEQL 3DVGB 1HSBB 2Q8AL 4IMLB 4P46D 1HZHH 5HYEA 4JFDB 4TVPE 4AY0A 5JOFA 1V7ML 1UB6A 5SWSE 3LQZA 1I9IH 4MS8D 2R2BA 3TIDA 1RULL 2FNBA 1F02I 1I9RL 1IGML 3V6FB 4WHTA 1TJHH 2VZSA 4Z0XA 4HPYH 3QUKB 4WW2C 4XNZC 4LSQH 1EO8L 5BOZG 4ODVL 3SCMA 4ALAL 4ZSOB 1NC4B 2IPUG 4JFOA 4POUB 1NBYB 3TC9A 4N9GA 3OBAA 5HSFA 1Q9KA 2F74B 3TJHC 3VGFA 2FWOA 4YBLC 1EEZB 4PBXA 3FQXB 4TTGA 2VDQL 2IPTL 5ITBH 3ZE1E 4Z0XB 3DUUB 3GSOA 1DBAL 3N50A 4NN7B 4X4ME 4M6OL 3VXQA 4WHCA 1IAOB 1KCKA 4N8VG 4PJ8C 1XCQB 4HKBB 3NN8B 2EYTB 3QO1A 1UJTA 3KXFD 5B38B 3MLUL 1AJ7L 3G5XB 4X7SL 4YHPA 4XC3H 4PJCF 2BERA 3U9PL 3MZGB 3QIWC 4U7SA 2EDEA 2FL5A 3ARDC 2DQIH 4HPOL 1BOYA 3EJYD 4OD2A 4XX1G 3VXQB 1FHGA 5GRUL 3O8XC 1YNTB 5FECB 2P5EA 2O5YH 3KPNB 3QSKB 1HN1A 4PJBB 4RAHA 1NCBH 3MV9A 1H0DA 4OCLC 4DKFL 4KI1A 3BPLC 4YXKL 5H94A 4HF5H 3O3UN 4OLYL 5GS2H 4X8JA 3NH7L 3QDJE 2C1PB 3I6LD 4Q9BA 1X7QB 2YPKB 1OP3K 4F9LC 2PO6C 1MJ7L 5IV2B 5EUOE 1AGCA 5FDWB 1CFSA 4PJBA 2N4IA 4AZ8A 4G8GA 3MROA 4J3SA 2FHBA 3SHSA 4OZIF 5I73B 4F9LA 4Z7OF 1FFPA 2BVOB 1HYSD 5F7EH 4HXAH 5GGQH 2IMNA 4LRNH 3IKCB 2GTWA 4QLRA 3D3VB 1MCPL 2IF7A 3RVVC 1QLRA 5JPNB 1HDMA 4F80A 4YHNA 3CXHK 2VL4A 4R7NB 3VFRB 2PUQT 3QXAA 4MCZB 3RAJH 1X5HA 3SGEH 4FQXA 1CFSB 2MPAH 1OGAD 2E27L 4N8PA 3MROB 1FL3B 4U1LB 2FO4B 2WLYA 4P3DA 4MHHG 1U8KB 2E7LC 3FMGL 5F93C 4UU9A 2YC1B 5F9DC 3LKPA 2F54B 4D3CL 2W59A 3ARRA 2BSRB 1BREA 7CGTA 4JFPA 2AXHA 3RPKA 5DJZA 3GMPB 4XCYB 2ZNWA 4MCZA 2BVPA 4UOJA 2SEBA 1QBAA 3RKDC 1EO5A 3EDDA 2J8UE 1D7FA 5BQ7B 2NMSA 1S7XA 2IBZY 3C60D 2HT2C 4PY8I 1TZGH 5H8DA 3MLSL 3CSBA 1OAQL 3ZKMD 2QKIA 4ZNCD 5IWLC 4HT1H 4JVWA 4WDIB 4AG4H 5CLWA 4NQEB 4K2UH 4D0BB 1JFQH 3H9HA 5I1JH 4JFDD 3RVWC 5IFAL 1U8IB 1DE4B 3VFNB 5ICYB 1BWWA 4KVCH 1YYLL 4NPYB 4KJYB 5B8CB 1S7XB 2Z93B 3LV3B 4JDVB 3IJYB 5CCKH 1IILE 3UC0H 5F3BB 4XXDB 4D0BA 3OKLB 4L1HA 4CRPA 3VFNA 1DQDH 3GO1L 5KN5A 3IS0X 3QUZD 5FM5O 4WIQA 3AC0A 4DGIH 2A9NH 2BP3A 4Y7MA 4OIBA 2BK8A 4MA1B 1KTDB 2ADGA 2LQRA 1Q0XL 3W11C 4MQ7B 2N7BA 3FQNB 3VWJD 3BZEB 5ADOH 1TLKA 3ABZA 3S88H 4UQ3B 5F88A 4OF0A 1CS6A 2M2DA 2OXGA 1T2QH 5B3JE 4P2RA 3SOBL 4GAJH 4MA1C 2GCYA 2JB6B 3JWNC 2PW1A 3O41A 3T09A 2FX8L 4HS6B 1DEEA 2ZUQC 4JFFE 5E4EC 4U4BA 3O4LD 4P0DA 3SKOB 5CGMA 1H3XA 4GW5A 4DGVH 2H6PA 3FQWA 5GS3A 1DLFL 4LP4A 2DQEH 1DN0B 2EC9U 1C5DA 5J12B 2YK1L 5DQJB 5HHNA 3RWFB 1KJVB 5E4EB 1A47A 1N59A 1MCKA 3P4OA 3KPRB 2VITB 4JFQB 5EO1A 4JO1L 4HFWA 3BOVA 1YY9C 1T0MA 2MCPL 3K46A 4L1DA 2V9RA 2BFVL 1QPXA 3QO0B 2Q76B 5EU7C 4UV7H 3HCVB 1WSST 1A64A 1FNGA 3DETC 5GS0H 1AQDB 5F8QC 4J3VA 4UT6L 4DZBA 4KROD 5DWUL 4L8BA 5CEZL 4LHJB 3PWVB 1ZHNA 3SDCC 3BSZL 4R8WL 3OJ2C 4U1JB 5C0FB 3D9AL 1FYTA 4GH7B 5CBEB 1MCWW 1MCBA 2Q76A 3FB5A 3QIWB 4OQTH 3GMMA 4OLXL 4L3ED 1P4LA 2DS4A 4N0UA 4HS3A 1DVFB 5T3XE 1AQDA 4H5SB 3IJHB 1K8DB 4MAYB 2NX5A 5HI4C 1PFCA 3G9VA 5GGVH 3DYMA 3SCMC 3PWNA 4PLKC 1MCIA 5E8OB 1FORH 2AEQH 3VXSD 2JB5L 4MJ4A 4LASL 5CBEA 3P9MA 1JPTH 2K3TA 3N1MC 5T3ZE 3L7EB 1LO2H 4YWGL 1FLRH 3EYUL 3S3JA 1MCPH 1XGYL 3LB6D 2A9ML 1K8DA 3X11A 3T77A 1KXVC 1Z5LB 5D7LE 5L2KD 3C8HA 3O81A 4RDQF 4XPFL 2R2HA 1F13A 4XBGB 3OAZK 1W8NA 2OI9C 1CK0L 1FVCB 4LSQL 1EFXB 2FGZA 4JRYB 4ONGH 2CO6B 1F97A 3HE7A 3U0WL 5MERB 1EHNA 4G6FB 4Z7UF 4KJWC 5DHVA 4XCEA 4PJ9D 4Y5YA 2BNRB 1CE1L 1SM3H 5EUOF 2IH3B 1KCUL 1CR9H 3HMWL 3MLYH 4CUCA 3H9ZA 4HG4J 1L0QA 3B5HA 2WP3O 5F7KC 1KSRA 4KKAC 5DXWA 2PXYC 5GS2D 5CEYA 2DLIA 2JF1A 3QWOA 2YSSB 4U1HB 2FBOJ 2Z35A 3SQBA 1DBKH 1NFDB 2CKBB 4P46B 4TTDD 4LNVA 3VRIA 1MUJB 1HYSC 2A0LD 3LKNB 3LN4A 3P77A 3SDDD 5J1AB 5KSBA 4PJEF 5I1JL 4M61A 5DEFB 1NFDE 2PO6B 3RHWK 5TPWL 1YQVL 5FKPA 4XZUB 4W4OA 3CSPA 3QDME 2GJ6B 3UTPE 1U6AH 3S35H 1BVKA 1KNOA 4WGVB 5L6YH 1XFPA 4D8PB 2DLTA 5CZXD 1I1FA 2XQBH 2H2PD 3W81A 1U9KA 3ZLQC 1WT5C 3DRQA 5L88H 3ARED 1OHQA 4UTBL 3ULVH 2X4PB 4JZJB 3OPZL 5IF0B 3GGWA 1J11A 5D1QA 4I5BA 1WZ1L 4K94H 1LE5A 1P9MC 4KI5C 5D1XA 4ZXBC 3MACL 3C09C 5H35B 3WL9B 6FABL 1WICA 1BVKB 2PR4H 1KCLA 1MJ7H 1CU4L 5HYQB 3SY0B 5HGAA 4HK0B 4P4KC 3L5XL 1ACZA 2RIKA 2VAJA 1YEIH 1H5BC 4R4BB 4BUGA 5HHME 2UVFA 1BBDH 3LN5A 5IROA 5K9OB 4ZOBA 3S97C 5C2BH 5DRZA 4IOSD 5AG9A 4U1KA 4NRZA 3U9UB 2HH0H 4MJ5B 3HAEG 1R3LB 4LVHC 5EIIB 5JOPD 1EBAA 3PJSB 5GJTH 1IC4L 1OSZA 3K81A 3VXUE 3CVIL 1FIGL 3QCVH 2MCPH 1IQDB 1QLEH 5C70A 4NKMA 4GRWH 4R6UA 5D5MF 2K1MA 3L1OL 1UZ6F 3QYCA 2HKHH 3UAJC 1HSAA 1LO4H 3QNYB 3MRLA 1MRFL 1ORSA 3MODL 2DB8A 4M6NH 4NNXA 5IB4A 1C5BL 5AUMA 3AREC 5KVGL 2KZWA 3L5HA 4G8EA 4JO2L 3NFSH 3VRJA 3D2UB 4OTXL 2AGJH 3FN0H 5FYKH 2NX5E 1AXSB 4TYUA 4Z5RA 1RZKC 5AD0B 4A6YL 2PKDA 3IXAB 5DUML 1Q72L 1UACL 4X4XA 5I1DB 5JHDA 5BZWB 1XF4A 1N0XL 5LCVH 4CAGA 2J8HA 1EMTH 1NMBL 3GIVB 3KDMA 4HQQH 4PLNC 1V8HA 4ODBD 1JGVH 2W1NA 2VXTH 4Z76A 2F5BL 1AXSA 3C2AH 1BIHA 5IMMA 4XVUC 2NY6C 4YWGH 1UZ6E 2IH1B 3KYKH 4NJAH 3TZVC 2UZYB 4TRPL 5DK2A 4H20H 2C4FU 1S9VB 2QHLA 3DETD 5FF6B 4EXPX 5HYJA 5FA4A 4H0IA 4NNYA 1NC2B 3GIVA 3KDMB 1WIOA 3HI5L 2DBLH 4LNRA 4OQ1A 3RBGA 4UDTA 5LXGH 2EC9T 4NGHL 4GOSA 1CXFA 1TETH 3DV6B 1E4XH 4WWKB 5JZ7D 2AKRA 3GSQB 1GRWA 4MCYB 3FQUB 3HZVA 5FCSH 3WN5B 4BQ6A 1CFTB 1UKQA 5HYJD 1D6VH 5C09B 5KSAD 3CAFA 1U8QB 4JJ5A 3LSOB 5IT2H 1P4BH 3B4NA 4MSWB 2YK1H 2G60L 2DAVA 1AKJA 4NCC1 3K7UA 4K7PY 3MRCA 4ZOAA 3HNSH 3T2PA 4NQED 2D7PA 5ILTH 4M02A 12E8H 2NY3D 3WIHL 1L0XA 5BJTB 4F7MA 3QNXB 3ARBD 1OTUC 2WWMC 1FGNH 2ZCHL 2BOCB 1F3JB 4MSWA 1I1AC 5ESVB 4HKZB 2IG2H 3MMEA 4C57C 4P9ML 5CEZH 1JWSB 1UXSB 1GOFA 4PLJD 5DRWB 2DOCA 3ET9F 1RZFL 3RUGB 2AQ1A 1QYGH 5IBUG 1MAJA 3QNXA 2QQLH 4YLQT 4E42A 3SGEI 1HH6B 3MBED 5BO1L 4KKAD 5DMIL 2BNUB 4JFDE 2JJVA 3ORJA 1U93A 3GJEA 1HKLH 3AY4A 2LAGB 2VDKH 3PNWB 1NFKA 3OXSA 1LNUB 2ZUYA 3RX8A 1MI5B 2X42A 4NQVB 5ITFA 1I4FB 1GXEA 2GI7A 2X4QB 1VFBB 3WHXA 2QJDA 3H0TB 2DIAA 2VLKA 3KYNA 4KAQH 4XAKE 5GRXG 1GGIL 1T83A 1UH3A 5FO8B 1J10A 3P0YL 4WUUD 3B2VL 5CP7A 3F6IA 1GH7A 3O0RL 3SE4A 3WLBA 1G6VK 3FJTA 5DUPL 4JANB 1OAZL 1N4XH 5B22A 2ZUXA 5IHLB 5TJWK 3VI4E 2D7NA 1O0VA 2YD2A 5DC0A 1UXWA 4MNGE 2IANA 3ZSTA 3V6FA 4TVSa 4XWGL 1AXTH 5IFHL 2EDTA 5C86A 3RZCD 3UC0L 4YHIB 2RFXA 1S7SA 2IPTH 3WJLC 5ITBL 3OL2A 2WMPA 4D9RD 4QRRA 4NO0B 3TIEB 5DHVH 2DJUA 2EZ0C 1OW0C 1J12A 1YN6B 3ULVE 5DVMA 1RUAL 4IHOA 2H32A 5D6CB 4YXHH 3OAUH 3GMLA 2HRPL 4KKCC 2NZIA 2EDOA 3BKCH 2CK2A 4LSPL 2LABA 4WWID 3QNZB 5C0AA 2YPLE 5A2LH 4ZNEE 4HIEB 5LCVL 3DOSA 1FAIH 1S7UB 2A73B 5JHLH 1MFAL 2AJZB 4JFXA 3QRFM 2O26U 2VXTL 1W72H 2D9CA 3W0WB 2VDLL 3C2AL 5HPOA 1UJ3A 4A2LA 4G8IB 1U3HD 5F7DA 3CXDL 1FV1B 3OXRB 4D9RE 1I7TB 2VO5A 1WBXB 3H7LA 3KPMB 4Z7WE 1X5FA 4O4YH 1EEZA 1HHJB 3S4SG 3W2DH 4ODTL 2AJZA 3RI5K 1SVCP 3QUMB 5KSVB 3QQ9D 2VDMH 2H2SD 2WZPD 1J0ZA 4OF3A 2A2QT 4OFPA 2LU3A 1X7QA 1A3LH 5T1LA 3VI3F 3PGDA 4YHZH 4QRQB 4UV4H 4TUJA 4ZMAT 1JV5A 1P5VA 3K4ZA 5CEXA 4MD4A 4MLSA 5HGDA 4K3DH 3HE6C 4MX7A 5E2UH 2XA3A 2A6KB 5D7LD 4LU5H 3PHSA 3ZE0E 4RWHA 5IQ9B 3CGTA 1CE6B 2V5YA 2P5EB 1Z6JT 1F3DH 5CJXA 1AD0B 1XF3B 2WBJD 5IVNA 1KJMB 4CBPA 1EHLH 4H8WC 3VFSB 5HYIA 4I48A 3IFNH 1MJ8H 3QIBD 4OZIE 3QDGA 5BS0E 2GTZB 5EBWA 5IW1A 4KMLB 1OSPL 3BW9B 3HS0A 5CINH 5IB2B 4WW1A 5JPMA 1ZEAL 5DFTA 4OZHB 2BVPB 3TYFA 1FPTH 3T0EB 2B0SL 2EIZB 1QSFE 4F7TB 3V7MA 3RDTB 5FYLH 2W60B 5KVEH 3VFSA 1CGXA 5JIKA 2AV1B 4P49A 4ZDHB 1K6QH 4WDIA 1CIDA 1IGCH 2AJ3B 4G8FB 4NHUA 4U6YA 1FCCA 5ISZB 1U8IA 4XVSL 4RMSA 3S4SB 1EV2E 3TYFB 4UIKL 3QPXH 1SYSA 1MEXH 4MWFB 4URTB 3D48R 4U1LA 1AR1D 2Q3ZA 3OR7B 4ZYKB 2I9TA 1FSKB 5D9SB 3HUJB 1Q9WB 2AV1A 4R96A 2OMBA 1KIRA 3LKPB 4QOKD 4LSRL 4XNYH 1A9EB 1A1OB 4JCMA 3UPRA 1BQSA 1MF2L 3VI4F 3O6MH 2CDGA 4Y5VC 2VLJA 1A7QH 1RURH 1KJ3L 3EYSH 4DVRL 1FFRA 4HKJA 3VGBA 2HMID 1YY8B 2X41A 3MJ7A 1RFDL 4BSWB 3CFEB 4LPWA 5FKAB 4QRSA 2BY2A 3OR7A 1F4AA 4QNPE 4KUCD 1QBMH 2FX8H 3T2QA 2E7CA 2BXZA 1WCBA 1DQML 1U8LA 5L2JA 3OMZA 3SDCD 4WENB 4Z7OE 1FL6B 2R56H 3TO4C 1GZQA 2N56A 1X6NA 1F6AA 8FABB 1QQDB 3KPQA 4BSWA 4G80A 3EOTH 3QI9C 3QEQD 1WUNT 1NFIB 4FQIL 4JDVA 3TT3L 5C1MB 4NNPL 2KBGA 2Y1VA 1T2JA 1N59B 1T20A 4OGAD 2NXZC 2DQFB 1C1EH 3WUZA 5K9JH 5GS0L 2BOBA 1OAKH 4XH2A 1LEKA 5J7CC 1JGDA 3S3PA 5DTFB 3WN5C 3EYFB 4MQ7A 4Z7UB 2R8SH 5IVXE 5H37H 3D39E 4LAJH 4M1DL 4TNVK 5GGTA 1OL0A 3C60A 4S1SL 4UOW0 1DVFD 4DZBB 5F88B 4I2XA 3BT2H 4GLRH 4L8BB 4HH8A 4PJDE 5I1HH 4H26B 4G8GE 1T1ZB 4PJAE 3CFKA 3ARWA 3QXUA 5T3XD 1FYTB 1Q0YH 2IJ0C 5DTFA 1JK8A 3M17B 5EN2A 3GSXA 4W70A 4M48H 1QEWA 1GAFL 4OCWL 1CQYA 3C60B 4X5LA 1KTRL 2BMKA 4ORZC 5D7LB 3ARTA 1FGVH 4M03A 1S3KL 4ENED 3A67H 1M7DB 2YD9A 3MOAH 4JO3H 2R4SL 3TWCH 2PXYD 4MD5A 3E6FB 3MCLL 2H9GA 4GKSA 4J2XA 3WO3B 3NA9L 2AEIT 2EH8L 3RNQA 4JVUA 1PX3A 1OD9A 5F9WB 3HCVA 3QI9D 4TTDC 2QEJA 4KI5F 4X9BA 4LAQL 2HLFD 4HEPG 3UTSE 3WUWB 1JVKA 2BRQA 4ONGL 3X11B 3PGCA 5K93A 1NCNA 4X7TB 2VXSL 3F62A 5C0FA 4GKSB 1EFXA 5IFHH 4DUVA 2Q8AH 3HE7B 3GMQB 3FB5B 4N0UB 5K59F 1R3HB 4UTAH 2VERN 3GNML 4HWEH 2DM3A 1II4E 1OSPH 5F97E 3MRKA 3BMVA 1IGJB 4JZOB 4PRAB 2E5EA 4QRTA 4M1CD 4B0MM 3QIUB 4NGHH 2IBGA 4EUPA 4ZQKB 3QWOB 4FP8L 1MPAH 4PR5B 3SO3C 3BKCL 2ZCLH 1DDHB 2VXVL 5GGRY 3VGEA 5KVFL 1IVLA 5E8PA 3HPLA 3EAKA 1YQVH 4QHLB 4ZO9A 4NQDB 2CDEB 1SJVA 1IGJA 3FT4B 2CGRH 4Q2ZA 4XVSH 1MIMH 3CVHA 4I0CC 4ODSH 4PJBF 2MSPA 4I3RH 1Z9LA 5CJXC 5IB5B 4AT6A 2Y06H 3GIZL 3WIFA 4WFGE 4R26L 1QG3A 1NL0H 1RVFH 4XPBH 4FNLL 4Y5YB 3L3IA 4GW4B 2BNRA 4GKZA 1BGXL 3L3DB 2BVEA 1KB5B 3T3MF 4XC3L 2F8VA 3WIIL 3CVHB 5TDOA 1F11A 5LG1A 4P2OA 4XNQB 3WL9A 2Z35B 1WAAF 2I60H 5DJXA 1OGAE 1SQ2N 1HCFX 2BHYA 1YEIL 2HLAA 5I1LA 4DTGH 2A6DA 1DBML 1JRHI 4RMWA 5CZVH 3QRGL 3BP5A 1A6ZB 3DHMA 4U31A 4Z7WA 4R4BA 3N1QC 3G04A 1UYWH 1GC1L 1UC6A 3I2CL 3LHPH 1UH2A 2ZOKA 4MJ5A 1NAMH 1W2KT 5AYUL 1LQSR 4O02H 1GJIA 4UI2A 4D8PA 3F58L 4PP2B 2DD8H 2NY1B 5BVJA 2DQCH 1DJSA 4AYFA 4L5FL 3GGWB 2UY6A 1AY1L 1GGIH 4QOKB 4ZS7H 5GGQL 1JF5A 4HMCA 4NKMB 4I18C 3MODH 4PJIF 3UTTE 3WD5H 2ZUWA 3DGCR 1NDGA 1U3YA 5IEHA 2ZOKB 2ZOLA 3EDFA 4ZUVB 2LTQB 3RY6A 5ID0A 1DUYB 4PJ9B 4PGDA 3NAAH 3B6SA 2OJEA 1X6LA 1H8SA 1UM4L 3JTSA 1S7QA 4A6YH 1T03H 3V5KB 1E27B 3WJLA 4DGYL 3ILPA 1ZS8B 2YWYA 3GSRA 3LN5B 1FBIL 1NGZA 4Z5RB 1KPVB 4U1KB 1TNNA 4PTUB 5CSZA 4PG9A 3MRRA 5HGHB 3UJTL 4HWZA 4OZGF 3QXVA 2OMNA 1IC1A 5SWZD 3CFDA 3K8LA 5HPMB 1OSZB 1CVSC 3ESVF 2X10A 1MI5D 3QH3A 2LVEA 1DCLA 1U95A 3HI6L 1ZGLA 2HFEB 1OAYL 1CBVH 5F1OB 1ZS8A 3GSRB 3RL1B 3KYKL 1MHEA 4YUEL 4S1RH 1I9IL 5T1LD 3TJHD 2Q8BL 2HRPH 4XNYL 4XMPL 4GAYB 5IMMB 1NGPH 5EULV 2NY2B 3V8CA 4HLZH 3IDNA 1NFDF 1OGTB 3VXTB 1T3FB 1FAIL 5IB4B 1U3JA 1SJHA 2DMCA 4DN4L 4XNUH 1CICD 1FNSL 4KUZH 1W72L 1RUPL 3CDGA 1NDMA 3BO8B 3IGAB 1ADQH 2DLHA 3H9SD 4OZIA 1XF4B 4N8VB 4F7PB 1ZSDA 2ZPKL 1NBVL 3TP4A 4M6OH 3VXRE 3E3QC 4LDLB 3MLPA 3HC4L 4K7PH 1Z0MA 3FAXA 3ZDZE 3RKPA 12E8L 3GKZA 3T4YA 3RVXC 5F96L 5KS9F 4HUNB 2PN5A 4EXKA 3VXPB 5E6ID 4HEME 1WWAX 2LVCA 4PRBB 1KEGH 4OSUH 4Z7QF 5F7MC 1LK2B 1NANI 4HIHA 5EC1A 1RZJC 1YDPA 2A74B 4BFIA 5TE6L 3X17A 4D9QE 2CLZB 3TNNA 4GXVH 1JPST 1MIEH 4L8SB 2F15A 1ZVHA 4AEEA 5DRWA 1OTTC 3KPOB 1ES0A 4JRXA 4K3JL 5FYJE 1J7VR 3ARDA 4P4KA 3HNTH 1Q0YL 4LHUG 3O9WC 4XCFH 3LDBB 2ZG1A 3NTCH 2Z91B 1T4KA 5INDA 3Q48A 1MCCA 3HR5B 2VLJD 2DM7A 1S3KH 1T5XB 2DQGH 5IOPA 4AENB 2R2EA 5DSCA 5C0JB 3HZMA 1ZEAH 2MKWA 2V2WA 4I0PB 1AGBB 3P4NA 1GGBH 1LK3H 3X13B 3O0RH 3BYTA 3TT1L 4HZLA 5DMGD 5JW4N 1T7VA 5ESVA 1AGFB 4NFCA 4V1DA 3TBTA 4NOBA 3JVGA 4UNTA 3RTQA 4HZAA 1UXSA 4FQCL 3MXWH 2QHRL 4DK6A 2AK4E 4IRZL 4XVJL 4QRRD 2YS4A 2DQTL 4PJIA 2DQCL 5IMOA 3P4NB 2ZUQB 3TNMB 1N8ZB 4KU1A 2NYYC 1DL7H 4LVNC 3O9WB 1AIFA 1K8IA 2IANB 3LQAH 2XACC 3WLWD 4HFUL 2Y5TB 1TDQA 2O5XH 2VR5A 4DFIA 1OCWH 5EC2B 1G7HA 1A6UH 4JGUA 4HJ0D 2ADFH 3TBTB 4L9LA 4I3SL 4XC1H 3HUJE 2A6IA 2JCCF 5CEZD 1AGEB 3BDXA 3QDGD 4J4PC 3RX7A 4ZNEA 1NCCL 1N8ZA 2FCBA 1HEZB 4HXAL 5IVXB 3ZHDA 3IAGC 5TFSH 1OF2A 4KTEL 5HD8C 2XZZA 2NY2C 5ESQB 2FX9L 3FOMA 1BEYH 1CFVL 5ABDE 3GMOA 1NC4A 1NLBL 2EKSA 4JFOB 4LHUB 3T65A 5MENE 5A2FA 5ICZA 4R26H 5ICXA 2BJML 1YQ2A 5I6XC 4MGXA 2XI9A 3B8YA 5CJQH 4NIKB 4XPBL 2GSIA 3ARBC 4S1RL 3O6KH 1H3GA 3DUUA 3RIAF 5C9JB 3ES6B 5E4IA 1UJ3B 2PTTA 4YXLH 3UROR 4K07A 4G8IA 3MLUH 2HJFA 5EFIA 4FFZH 2GQHA 5TE7L 3TF7C 1VPOL 5FM5M 3T2OA 3JWDL 4JFEE 4ONHA 5ID1A 4HX1A 3KPMA 1TZGL 2D7OA 1HHKA 4HPOH 4EI6A 2VDML 2FZ3A 1O7SA 5DK0A 5IESL 1OT2A 4N0UE 2L4OA 5IB3B 2YD1A 3U2SA 4DTGL 2VLRA 4IOFC 2PTTB 4OD2B 3T0ED 3SE8L 4I77L 1SJEA 1KJ2B 5EZLA 1K3ZA 5C0GB 2OQJA 3AVEA 4W6XB 1TQBC 5HBBA 1NGQL 4R4ND 3GJFB 4NO5B 2Q86B 4ONHB 5ID1B 3B9DA 1NBVH 2FWOB 4UUJA 4ZUWA 4PFEA 4OLYH 1NCTA 3BRGC 2Z4QA 4Y4KD 3LKQB 3FB6A 4OZHF 1XCTA 4MX7B 3H7BB 1UCBH 4O2FA 3VD7A 5JHDD 3F7PC 2C5DC 5EU6B 2DD8L 3TJEL 4KJPD 2VXUL 3MRIA 1E28B 1QPPA 1R5WA 3C5ZC 4X6FA 2NW3A 4AMKL 1I7TA 2Q86A 1XF2A 5IV2A 1AD0A 1KJMA 4KKLC 4BJLA 1R0AH 2IAMC 1KG0A 2X4OA 3G5XA 4PJ9C 5HHPA 3VU2A 4L9DA 1O5DT 1WGOA 2BSSA 3QG6A 4DKAA 4M9PA 3H7BA 4O2FB 5ERWA 5IW1B 4NWTH 5T33H 1JGLH 2VZTA 1GOGA 5IB2A 2DMBA 5J6HA 3RZCA 3OF6A 3DYOA 4M3JA 1JGUH 1U2HA 3QXAB 4DKEL 4U6XB 1RJYB 2CLRB 4G9FB 3K74B 5DQDH 3NTCL 2B39A 5CWSA 5CEXB 4P3DB 5MENA 3PHOB 3UJTH 5EOCH 3D39B 5DZLA 1HILB 4UU9B 1EVTC 5D2NC 4ZDHA 4HWEL 2A6KA 2GEEA 5EH1A 4P9HH 3QEHB 4LSVH 4DWHA 2VLMD 2AJ3A 4G8FA 4NHUB 1F45A 3RA7L 4HG4K 3UDWA 5ISZA 1KIPA 2EZ0D 5JOPE 2AGJL 5FA3A 4FABL 3WFEL 2ZZUT 3CMOH 4MWFA 1QFUL 1S7WB 4O2EA 4F37K 4LSUH 4LEOB 2AJVH 3QR2A 1U8NA 5E8NB 4KTDL 4NJ9L 1HDMB 3DSNA 2CDGB 5EB9A 2DKSA 4YHNB 2G2RA 3VFRA 3AM8A 3P30L 3EO1B 1CCZA 2W60A 1S7WA 3O9WD 4JFZH 4O2EB 5E2JA 3S5LG 3HUJF 4NJAL 1U3ZA 3GK8L 3MLZH 1WCBB 1U8NB 3FTGA 4WFED 4G6MH 4CKVX 5IVZA 4KHXH 4HKXA 2VR9A 3RQ3A 1A14L 4TOYL 3R0MA 1PYWA 2HG5A 5ESAA 4FFVD 1LP9A 1MI5E 5F7NC 1J5OL 2I60L 4I0PD 4PUBL 4XVTL 2GK0A 3HE6D 1FJ1B 1CFVH 1D6VL 1CK0H 4X4YA 1A1OA 1OP9A 2GCYB 3GRWH 35C8L 5IVZB 3O11A 1JZ5A 5DJ8A 3QP3A 2XQBL 1H15B 2BOBB 3STZB 4G5ZH 2VLRE 3MJ7B 4CADA 2OK0L 2NPLX 1JGDB 2HG5B 1A7NL 4FS0A 3O2DA 4LHQB 5FKAA 2FIRT 5GHWH 1FVDB 2E8ZA 4F7EA 4O02L 4X6DF 2VDNL 4N90E 4JAMA 4LIQH 4NO0D 3BAEH 5E7FA 3RWFA 1U8LB 2W0FA 3QUZB 1T7ZA 3WFBL 1MJJB 3KPRA 3IVKA 2E3VA 4QF1A 5DDHB 4LGRB 1JPGB 8FABA 1AY1H 3STZA 4WFHE 1G9ML 5F70A 3ARGC 5D2LB 4LCYA 5E5RB 5GS1A 2B2XH 2BDNL 3DUSA 1KLFA 4APQD 5KW9H 3BZEA 4OZ4B 4UB0L 5HGGS 4TPRL 1XR8A 4OAWA 3FAWA 3GMNA 4WHYH 4NP4L 2CXGA 4FQJH 3WFHA 2PW1B 1I8MB 1I7UA 4C58B 1X44A 5EUOA 1HNFA 3U0PB 5AZ2H 3T0XA 5EZJB 3VA2C 1OWRM 4UILH 3EYFA 4MAUL 4Z7UA 3LIZL 4FQCH 1EEQA 3C60C 4FQQB 3QDJB 4DK3A 3VDBA 5B39B 1RUKH 5HHNB 1QSEB 3E6HA 3EDEA 3DMMD 3WFHB 2GHWB 4ZTOL 1UKTA 3U0PA 4G7VH 2D7QA 3OAZH 5E8OA 3BRFA 3GZKA 4MDJB 1EHXA 1JK8B 1T1YA 4AQOA 5D1ZC 2AP2A 4M6MH 2UUDK 1A0QH 4XAWL 4KI5E 3S37H 2APBA 3H3KA 1QA9A 3LH2H 5B39A 3DV4A 3KLHD 2AEPL 5JQHC 2B4CC 3U0WH 3ALPA 3VH8G 2RGSA 4PYHA 3RNQB 1KB9J 2HWZH 1MJUH 1S9WB 1E6OL 1T1WA 4OLZH 2QADD 4CVZA 1FSKC 2Y23A 1REIA 3V0VA 2F5BH 4ZFOL 2BJMH 2IH3A 32C2B 5DRNB 4MAYA 4IRSB 5E2VH 5E56A 4KZDL 3WNMA 4Y2DB 3Q6FA 2NNAB 5JQ6H 1CTNA 3X14A 4KK9D 1LO4L 1N6UA 4PGJA 4X6DB 4JVPA 1DQQA 4LSUL 5ALCL 3TCLA 1FZMA 5LVEA 5JW5A 2CKNA 2CKBA 2JK5A 1VB9A 1G1CA 2HTLD 4KQ3H 1OQXA 3VXME 1A1MA 4LCCB 2WWMD 4FZEL 1NPUA 1RPQA 4JZOA 1CLCA 2D9QB 3G6DL 1QBLL 1QKZL 1UQSA 3SBWC 2R2HB 2R29L 2NNAA 4XBGA 3RRQA 3G5VB 4NUJA 1YEDA 1JL8A 4M7KL 2WBWB 1JNJA 1N0XH 2ESVE 2R15A 2WIMA 3TCLB 5DHVB 1WBZB 5HYSB 5LGHL 1KCVH 1CDIA 2NYYD 4S2SA 4XBEL 3L95B 4JREB 4OZFH 2FJGB 4M4RA 5DMGC 1D9KD 3IXTB 5GPRA 4O58H 4HJJL 5IB5A 5C0CB 3EO0A 3NACH 5BVPH 3BKML 2VSDA 2O61A 1GGTA 3AS1A 3BZFA 4NSKA 2P45B 3CUPA 1VKXB 4FN0A 3VFVB 1NCDL 4QTIH 1MUJA 4ZODA 1A7PL 3HE6B 4YQXL 3TBYB 3RDTC 4OGYL 1BBDL 3UYPA 1DUZA 2R0LH 2A38A 1L6ZA 4XHJD 1F11B 1INDL 2QR0A 4NQEE 3JV4A 2O61B 4K8RC 1JHTA 2ZOLB 4WFFD 1BVLA 3AFLA 3SEPA 4LIQL 1JI2A 5FUCC 3R8QA 1DUYA 4PJ9A 1YJDC 3B6SB 4N0CC 2B20A 2XICA 3RGVB 3O2VL 1DUZB 1PZ5A 3MFGB 3U4EA 2WUBL 5CP3H 1MLBB 3AS2A 1NUFA 5BRZA 2R1YA 4NN6C 4JG1L 4YK4C 5H35A 3IETB 3NCYP 4PTUA 1ZLSH 2AJSL 4R97C 5CHNB 1S7TA 3LKRB 4YDKL 1BVLB 4MS8C 1VFUA 5HYQA 3CFDB 3JV6A 2B0SH 4NNXB 4C56B 4ESKA 1QFUH 3BP7B 2PTVA 3MO1B 3F8UB 1ZGLB 3VXSA 3OAYH 3WSQH 5KOVC 1WZKA 2DJ4A 3I84A 5BRZB 3ILQD 5DRZB 2VDOL 3PIQB 2MTPA 1NCBL 4QTHB 2J12B 4DN4H 2ZUUA 4P2YA 4XNUL 1NLBH 3VG9B 5I1DA 5C09E 5D7SL 5L8JB 3IDNB 1PG7L 1CFNB 1P7KA 2VR4A 4C56A 3ARVA 4L4TA 2GITB 3SDDC 1HH9A 1GOHA 5DMJB 4PGCA 1CLZH 4RQQA 4X6CB 4J4PA 3SGDH 3WEXA 5J57B 3HC0A 1UWGH 1H3UA 1YEKH 4IDJL 4WEMB 3OX8B 4NQCB 5D93C 5IJVB 3Q6GH 5F7EL 4N8VA 1NEZA 1LMKA 4CNIB 5FDYA 4LPCA 1EJOL 1I1CA 1A2YA 3PHQA 4LLQB 1G7QA 4JKLA 5DJ2A 1IC7L 2K9UA 2I5YL 3DGGB 4G43B 4WTXA 3T08A 5L0QB 3O4OC 1JHKL 4RMQA 3U7WH 1OGTA 5I1CL 3EJYC 1FZOB 1SHMA 4GRMA 1CIUA 4Z18A 3HNTL 1IE5A 4P3CH 1T5WB 3GI9L 4WV1B 3U9PH 5GZND 1HKFA 2J88H 4QXGH 4AEHL 3CK0H 1C1EL 1RULH 4WFHD 1J18A 4OZIB 1QNZL 3FFCB 4LSTH 5FV2A 3VJ6A 1TVBB 4TN9A 1PY4A 2YD7A 5BS0A 1B6DA 3DO7A 4LNRB 2FLRT 1B90A 4TVPL 1QRNE 1O7VA 4LSPH 4UV4L 3RWIA 1WJ3A 2NY0C 1BX2B 1QFWL 4HUMB 1T5WA 3VRLF 4OM1L 1GPOH 4U3CA 4HH9B 3VG9C 5E2UL 5C0RL 2D7TH 3KXFA 1I9JH 5IBUB 1I7ZA 4Y19A 1FZKA 4YHLL 4PJGE 1U8QA 2XZAH 3DO7B 4BFEA 1FQ9C 2Q87A 3V0WH 1E6JH 3A6CL 1FGVL 2A9NL 3GJEB 1U93B 3A67L 1HHIA 2P43B 4U0QB 4V1DB 4P9HL 4EDXA 4XVUD 4TQEL 2X4RA 5GJSL 5SWQA 3ZDXE 4OGYH 3TZVD 5IK3B 4R97B 2VOTA 5EBLB 3WHXB 5I16B 1ADQA 5C07B 3BUYB 1RAMA 3KYNB 1AIFB 1INQB 3R0NA 4LKCA 4NC2B 1ZLVH 1J05A 5GRUH 4PV9A 1Y6KR 1XZ0A 2E7LA 5IOPB 1VADB 1E4WL 3EYOB 5L8KB 3O3DA 3Q1SL 3RUGA 3CCHA 2DQEL 1HXMB 5KVMC 2M26A 5I16A 3C6LD 3ZYZA 2DM4A 1KEMH 5D7JC 1UXWB 4LFHG 3W39B 4B50A 1J1PH 1OF2B 4X7CC 3TO2A 3TCXA 1IBGH 2J6EL 3UJJH 3OSKA 1U8PB 2GJ6E 2EH7L 4WI2A 1HINL 3RZWA 3JWOL 4AEFA 1J0IA 1MCDA 3QDMA 5JQ6L 2XA8L 3NABL 5ICZB 4EI5B 5IMOB 4OD3L 2YBRA 4NO0A 4TOYH 3H0TA 5CKAA 4QRPE 1G6RL 2VLKB 3P73B 2R39A 2ZG2A 4DZ8A 1EIBA 5FOBA 2GSIB 2BC4B 3EYSL 1OTUD 2DKMA 3BWAB 4PJ5B 5TQ0L 3KG5A 4PJXF 1BM3L 5KTEH 1NAKL 1CDBA 4HV8B 1MIML 3E2HB 3VFGL 4OI8A 3G6DH 1I7RB 1LO5B 5SWSA 1JIBA 4XCCL 1CFQB 5BMFL 1WITA 5AEAA 4EI5A 1W0VA 1MFDH 2CKBH 4D2NA 5DQ9B 4TUOA 1CLZL 2ARWA 4DZ8B 1LEGA 1DQDL 2XN9A 2I26N 4NCC2 5AG8A 4PJ5A 3QUZC 2Z8SA 4XWOC 3AGVA 1ZT7B 4WNQA 3PG2A 4OB5H 4X6CE 3H2WA 3HRZB 3JVGC 1KXTB 3R1GL 3S88L 1M7IB 3GJFA 4NO5A 4P2QA 2PF6A 1CFQA 2EDHA 1KF9B 1AXIB 4Z7NE 4QRRB 5FM8A 3WHE1 1XGYH 2CPCA 3T04D 2A77H 2NCMA 5E9DB 2VXUH 5E5UB 2Z4QB 5BV7L 2HLFC 1CT8B 3QWRD 1LGVA 3WXWL 4Z8FH 1V7NL 3QUMA 5KSVA 5C9JA 1J8HA 3KLAA 4DVBA 1OGAB 3LAFA 1A6VL 1PGRB 1NBYA 4P2QB 4BZ1H 2FH8A 1H5BB 3O2WH 4XP9H 1F3DJ 1I1AA 4OGXL 3Q3GB 4ODHH 2A73A 1TZHB 1K9TA 3FQXA 1TENA 2FZ3B 5DK0B 2NXYD 1OD7A 3IYLW 2XWJB 3MRPA 3ZE2F 5FV1L 1W0WA 1XGRA 4EIZC 4PJCB 4L29A 5D71L 3CK0L 2ADIB 1EUTA 4WWKC 1XCQA 5ISZD 1S78C 3IFNL 3KAAA 2EDYA 5DWUH 1YYML 5CWSB 2XTJC 3W9DA 2VSCA 5JNYA 2ICCA 4KKBC 1HILA 4N0FA 5EU6A 2V5RA 4NQCD 1G1YA 1CICB 4L29B 5B4MD 3SDYH 5A3ID 3QHTC 5K9JL 4OM1H 5C2UB 2NY6B 1U6AL 2NW3B 5EORL 3KPNA 1CGYA 4QRQA 3GHEH 5CILH 2C3XA 3D0VA 4KJWD 4M5YL 2BY1A 4QGYA 5FO9A 3B9KC 4NN5C 5HHPB 2VXSH 1AI1L 4YDLC 2P8PB 1OTSD 1MREL 2LE9A 1A7OL 3SDCA 3MRQA 2PYED 1J1OL 3MRNB 3FQRA 4J23A 1TXKA 5J6HB 1YMHB 4JG0H 4UBDD 1RK1B 3BHBA 1DFBH 1PX4A 2CR6A 1QSED 2G2RB 5F89B 3DURB 2EE9A 1CU4H 1N64H 4JFFD 3GK8H 1OY3B 3MLZL 3OKNA 4P4RB 4GO6B 3ZT5A 1ZE3C 1WF5A 3QXTA 1T0PB 5CZXC 1ZOXA 5IIEA 2WBKA 4E5XB 3U36A 5CIPB 4ORGB 1RK1A 3BHBB 3PV6A 4RNRB 4N5EC 4H88L 4OLXH 5HGBA 3TN0A 3PDOB 3F12A 3T0EA 4LGSB 3OKNB 5E9DE 3NBNA 1D5IH 1JNNL 3S34H 4ZG1A 4YHYC 1PJ9A 2IAMD 3QAZB 2RQ8A 2FO4A 3ARYA 3VFMA 3CVIH 4OFYA 1RIHL 3CH1B 1P7QD 4LCWD 5JORA 3O6LL 3O3EA 2BX5A 4KJPC 1FL6A 4WI8A 4K9EC 4YFDB 2XA8H 3NABH 3ME0A 4XCYA 1G0XA 1D6EA 4K7PL 2NY1D 4PRPB 4KRNA 2VYRE 1G6RH 4G80B 1CGSL 3QQ9C 3PP4L 1C5BH 3WFBH 4P5KA 1TQBB 3KYAA 2DQDH 1Q9WA 1EAJA 1OTSC 1NAKH 3GKWL 2P5WD 5JXEC 3DYPA 4N90D 2X4SB 4YNYB 3VGAC 4PJ5E 2AW2A 3C09B 4M6AA 1RY7B 1OW0A 4HKJB 4P99A 2GK2A 1LEKB 1FNFA 4LLMB 1WWWX 4KTYA 4UTBH 3ULVL 1JPSH 1ZV5A 3QCUL 4LCYB 5B8CA 3B9KB 5EU5B 3VXUB 2Z93A 5C0NC 4CVUA 1NCAH 3KLDA 4NDMA 5FCUL 1XR8B 3O8XD 6FABH 4XXDA 3RVVD 1G7LB 3MRGB 5ACZA 1KFAL 2X4SA 4Y5XA 4YNYA 1I7UB 3O11B 1NMAL 5IWLA 5T1MA 3CFKB 5FYLE 4TRPH 2UYLB 3WV0A 2ADGB 1FNEB 4HWUA 2XTJB 3FQNA 5F7HA 4OUUB 4WJ5A 2HKFH 1NFIA 4RGMC 5FGCB 1J87A 1H3PH 3RWCA 4OKVB 5FUOH 3X3GL 4JAMB 3MCG1 5T3XL 8CGTA 4LOUC 3G6JB 3RBSA 4JDZB 4LQFL 4RCAA 3FT3A 4P2OC 4UMGA 4HMDA 4KPHH 4PTTA 4LAQH 1RZKH 1A0QL 4XAWH 4Y4HC 4OCXL 3LH2L 2VTFA 3FQWB 3ARQA 1DBMH 4O5LL 2IAMA 4DGYH 5KZCD 2QHRH 3R06A 4GAGH 3B9VA 1H3VA 2OX5A 1G84A 3VXOB 3H8NA 3VWKD 1K4CB 3H9YA 1SEQL 3PQYD 4ZO8A 3F6LA 2YRLA 3RIFF 1EX0A 2LAAA 4PTTB 5GZOD 1AR1C 2KPNA 4X4MA 4KFZC 4M1GH 4HXBH 3GSXB 4QRPB 3KR3L 1ZHKB 4CVZB 5C08E 4R7DA 1WAAA 5GGSA 4E41D 1A6TA 2A83A 3TV3H 4PRAA 1ZHNB 5C0AE 3E6FA 2D7MA 5I1AA 2BXYA 2HH0L 3PWJB 2X44D 2HN7A 4I0PC 5LJYH 3C5JA 4WFFE 4FZEH 2Z8RA 5JW5B 1D5BA 5CJ8A 3SKUD 4JRXE 5E2WH 1JGVL 2F5AH 4HS3B 1FIEA 3WUWA 1IL1A 4X99A 4H5SA 1DVFC 3LS5H 5DMIH 4Q2ZB 1HHGA 4ZSOE 2IAND 3UPCA 1KCVL 4POZC 2QLVB 5HHOB 2LV4A 2X40A 3MNZB 4D0DA 1CL7H 4XAKD 3L7EA 4KAQL 4EI5C 2OR7A 4L8SC 1MCOL 3Q5OA 5D5ME 3NACL 3P9LB 3V52H 2F53D 2Y5EA 2YD3A 1KB5A 4P2RE 5BV7H 2XRAH 4HDIA 5FYKL 5HY9A 2Q8BH 4KHTH 1KBGH 1KEGL 3MNZA 4UT9L 3TLRA 4D0DB 3PL6C 1DDHA 4CN1A 3PWUA 3THMH 1RIHH 3F65A 4RZCB 2WW8A 2IQAA 3I6KA 4NO3A 2I25N 4YBQD 2EIEA 1I9JL 1KELH 2ESVA 4L9LC 4HUVA 2G9HA 3NGBC 1NAML 3S37X 2C3VA 5CGTA 4XP5L 5GQBA 1E6JL 3KS0J 4BKLB 2ZPKH 3CPLB 1QSFA 5DEZA 4RAVB 3T0BA 1LD9A 4RBPK 2N7AA 4HPYL 1HOCA 5BVJB 3L95A 3UO1H 3SE9L 1L0YA 4IRJA 4PLJC 2PO6A 4I9WD 1IC5H 3LKSA 5I9QB 2ICWA 2AEWA 1I1RA 4P2OB 1TITA 4Z7VF 5JR1H 3NAAL 3E3QE 3FO1B 1IAIL 1Z3GL 2Z8WC 3VFVA 4FQHB 3WIHA 3ZYJA 3V6OA 3LB6C 4GMTH 3RIFK 4XXCA 5HHOD 3DECA 3KWWB 3MXWL 2FRGP 3ULUL 2WBJB 5CUSL 2W9DL 1CXHA 1WWCA 2FEEL 4K55A 4PGEA 1HINH 5HHMB 1Y0LB 3P0YH 1FG9C 1UWEL 4LPTA 4HK0A 4M5ZL 3MNWB 3NOIA 2R0WL 3IKKA 3TBVB 2YUXA 3U6RA 5J13B 2R1YB 4U6VL 1AGDB 4QRUA 4K23L 4OFYD 5EU4B 2Z31D 3MREA 3OX8A 4NQCA 5EIIA 3LKRA 5ID0B 4MXWH 1RD6A 3H42H 5T1DL 3JV6B 1NCWL 3VXTA 2EE6A 4I18B 1F4HA 1XF1A 3EHBD 4YGAB 3ZKSD 1ED3B 1VEOA 1S9XB 1S7QB 2OCFD 3EKCA 3VXSB 1ADQL 5DLMH 5DMYA 3RVUD 4YO0B 1G7MA 5EZOH 2IADB 1V5JA 4XP1H 1BQLH 1OAXH 3KPLA 4NN7C 3RUGF 2YPVH 1NEUA 3LOWA 3P11L 3QNYA 2GAZB 5D70L 2HFTA 3LQAL 1CGSH 3ZL4H 5E0QA 3TV3L 2FJHB 5I73C 4PGCB 1TPXB 3BP4A 4OF7A 5FYJL 1C16A 3D2UA 4R90L 4NBYB 2YRZA 1G7MB 4WV1A 5IESH 1U36A 5C6TL 4G5ZL 2OK0H 3V5HB 4G9FE 5E6IB 3I3BA 1HHHB 1LK2A 1NGQH 4A2MA 3D5OF 2KL6A 1BZ7A 2BHZA 2D0HA 2D7TL 4BQCA 5K9KA 1EGJH 4BK5A 3D39D 4ZFZA 3QHZL 3ZTNH 2GYSA 4G3YH 4L8SA 1FC1A 1PAMA 5EO9A 1MCOH 2IH1A 3K3QA 1ES0B 2GY7B 5DHYB 4WCYH 3KXFB 3TJEH 3MGTB 3V0WL 1FO0L 3WFCL 1HHHA 3DROB 4LSRH 1T4KB 5DHXB 1BZ7B 4C83B 1N3NB 2AV7B 4LSSL 5K9KB 1EFXD 5EBMA 2R2EB 1CDGA 5DSCB 1BQHG 4WU5B 3EJJX 1R5VB 1X5GA 4C54A 3SO5A 5DHYA 4OV5A 3WDHA 4LU5L 2R1WB 5GGRB 3WHE0 4UILL 3HMXL 2JCCA 1BD2B 3LSOA 4TUKL 4XP5H 1JCKA 1KB9K 2C9AA 3AB0C 2CLZA 3QDMD 4OIIL 4RRPA 2DL2A 3EYOA 3LPGA 5LGKA 4GLRI 2YA1A 4U3XA 1PY9A 3RWGB 4MB4A 3T0WA 5GGRA 5BJTA 4Y19B 4GG6A 1G7PB 5FHBL 3IDIA 4LLVA 4ZXBA 4XC1L 1BMGA 3WFZA 3S96B 1XGQB 4JR9H 5K9QI 4G7YH 1G7HB 3VDAA 2DMKA 5GRVK 1BIIB 1JWSA 5ALBH 5C0JA 2X4RB 4L4TD 1FL5B 2V6HA 4K3DL 1B0RA 4ZFFA 5INCB 5D2LE 1HXYB 1XGUB 3BUYA 4YHOH 5C0ND 5E8DH 5FOBB 5HXMA 4HLZG 3BWAA 1XGQA 1PW3A 2CRMA 3NIDE 1U91A 2VKWA 3HR6A 2APTA 1SYVB 4EBQH 3NIGE 1C08A 3RNKA 1UFUA 2P4AB 4G6KH 4QCIA 5DQDL 1U8MB 5DYOA 2R0KH 3CCHB 1M05B 5EIQA 4YIQB 3B2UC 1OARH 3TVMB 3IF1B 1NGWB 3IFPA 4TUOB 4Y19D 4YEEA 1YEEL 5J11C 1JYXA 5HI3C 5DD5H 1MCQA 3B9EA 3TO2B 3V7AE 2K7QA 3PABA 1ZT7A 5MEPA 1U8PA 1LVEA 5SX4H 3GUTA 4PJXB 3GKWH 4BZYA 1IAII 3E2HC 1F4YL 4IRSC 2A6IB 4PUBH 4E9LA 2A1WL 5DYOB 1IZKA 2B1HH 4Y4HD 4HIJA 4Z8FL 2G5BB 2Y7QB 1KBGL 4ACPA 3FB8B 1KV3A 3V5DB 3VFWA 4XCNB 1RHFA 2BC4A 1NJ9A 4NKOB 5IB3A 4JKPL 1KB5H 4FFWC 5J06A 1TQCC 4TSCH 4HV8A 2OQJB 3SDAD 5E1AA 5GZOC 3QDJD 3GSVA 1X9QA 5JOFB 2RFXB 4WI3A 1P84J 3TT3H 4JFZL 1UB6B 4U6HA 3EYUH 3JUYA 2X4NA 1I8LA 4OM0L 3TIDB 3U0TA 3ZT6A 4F3FA 3SQOL 3FB6B 5IHZB 1U58A 1XCTB 5GSVB 1MF2H 3O6ML 4QO1A 1MCRA 4PREB 3UXFA 3UYRH 2VE6B 3KPTA 3DTXA 4RISH 1BZ9A 4XMLL 5KVFH 2NR6C 4KC3B 4S0TD 1XF2B 1MH5A 5E94A 2RAMA 1Q9KB 1MCLA 2F74A 3MC0A 2FD6L 5D1ZD 5J3HD 3O4LB 5E9DA 5C08D 4YFEA 4DUXA 2VLLA 2FLBT 1A02N 3ULSB 4GXUM 2YUWA 2VQTA 4ODSL 5ACMA 2VLRB 35C8H 4JCLA 1X5ZA 4PREA 3QHZH 5I8CA 4FXGA 1IAOA 3BP6B 4KDTC 4OCNC 2H1PH 3OXRA 4WU7B 3M8OL 4PRHB 4J4PD 3QEQB 3GHBH 3CX2A 3O4LA 1PD6A 1HHJA 2ZCKH 3LKQA 4X80L 4QHKI 3NCMA 2ID5A 2FL5B 3CJJA 2BNRE 4OJFH 2FBJL 3MR9B 4LKXB 1QR1B 5DURB 3FQRB 4W68A 1OAKL 2R0WH 3UJIL 1PG7W 2WNGA 3BP6A 4OUOA 4JRYE 4MLIA 3SE3C 3N9GL 4NUGH 2J4WH 3HHRB 1IKFH 4UB0H 1IAKB 4MD4B 1YUHA 1U8JB 3CFCL 5IJKC 1F3RB 1KC5L 3O45A 5H94B 4N0FB 1OLZA 3HG1D 3O2DL 2F19L 2JJWA 5IHUL 4XWOD 5E8NA 3U36B 3OHXA 5CIPA 3EO9L 3D85A 5EU6E 1CE6A 1X3DA 3MFFA 3PV6B 4XPGH 1FE8H 3F58H 3PDOA 5IBTL 2EDDA 3HNVL 1A7BA 2XNAA 5E5MB 3VD9A 3PHOA 2CUMA 1IGIL 1T22B 4WY7H 3MOAL 4JO3L 5HHMD 3IDGA 4L8DA 3D3VA 1TTGA 1AFVH 1YNKL 2CUIA 3MRJB 2X05A 4D94A 1D6EB 4NQDE 4R90H 1IC7H 4LLYA 3SKMA 3AMLA 3ARZA 1HE7A 1A1NA 4M93B 4HGWA 1MAMH 3CZJA 1ZVSB 1CLYH 3NMEA 1UM4H 4P5KB 5M7QA 4PJ8A 3FQTB 1BAFH 3WUWG 4QHNA 2Y06L 2CRZA 2HYMA 2F54A 4XBPB 2VJXA 4PG2C 1FJ1A 4F58H 3MRJA 5C9KA 3GEWB 3KPPB 4ZXBD 4N0YL 3GNMH 3IT8D 4FQXD 4JM4H 4Q0XL 1PKQB 3U4BL 1EZVY 5ELIA 5BVPL 4YFLF 2XXMB 3O3EB 1OOAA 3BD3A 1EDQA 2NLJB 2P49B 4FTVD 4U1NB 5A3IC 2FEDC 2WUCH 3UPRB 1MJJA 2B2XL 1NGPL 2GT9A 4JRYD 4W4NA 3K0WA 4JPVH 2BZDA 3QXWA 5ADPL 1JRHH 5IM7B 4C4KO 4DN3H 4NPYA 5CZVL 1FNEA 4QRSB 4PJDA 3LRSB 2NW2B 1YECL 5JIPA 2YA0A 1FNSH 4WW2F 4IJ3C 3D0LB 5L2JB 1WFOA 4JDZA 3FT3B 4KWUA 2XKUA 4YK4B 5AZEH 3NCJH 4NN6B 4OFIA 3ECBB 2V5MA 3OJMB 2Z0BA 5ENWA 2V2TB 3LRSA 2IAMB 4F7EB 4FQQA 4JHWH 4N9OB 4WHYG 1TETL 3L3JB 3REVB 4BK4A 1LO0H 2VKXA 5DVOA 5ACZB 4JR9L 5JDSA 4HUUB 1A3RH 5D4QA 1S7RB 3B43A 3X12B 1BFSA 3SKOA 5GS1B 1GHFL 4YQXH 4OUUA 4WJ5B 3Q1SH 2GJJA 3V4VL 1Q9OB 4I2XB 4KY1H 2AXFB 5I1GL 2G60H 4F37F 2AJYH 4KDTA 1NCWH 2VDPL 4XP4L 1LP9F 4IS6B 2N1KA 1J1PL 2MPAL 3LHPL 5FUZH 5D7SH 4LARL 1Z0NA 4KZEL 5AYUH 4CMHB 1MOEA 1IAMA 1Z9MA 3RPIA 4ONFL 1OAYH 1CBVL 1FNGB 3INUL 4ELMA 2J8OA 4YUEH 3QDJA 4OI9A 5GSRB 3SDAA 2C26A 1OARL 2IG2L 2DQGL 4F9PC 1M7DA 1KENL 4Y5XC 3Q6FB 5ALCH 4MXQC 4AK1A 4NUGL 1IKFL 3O6FA 4MDJA 3T8XB 3BGFC 4X6DA 2HAZA 3MLSH 1R3KA 2JK5B 3S36L 5C0IA 4RGNC 2WANA 3O2DH 2F8XC 5GGSB 3WSQL 1ITBB 1ZLUK 1A6TB 3EOAB 3QFDB 5EPMA 4HDIB 3PGCB 1MRDL 2NY0D 4L4TE 3V8OA 4OB5L 1HQRA 4FA8A 4V1DE 3PWUB 1T1WB 4WTZG 3R1GH 5HYSG 4YHML 3SKNA 1UM5H 4P3CL 2ESVB 1EVUA 2GIYA 3SQOH 3IXTA 1BECA 1Z5LA 1JWUA 1JE6A 3EDJA 2Z8VC 1XGPB 4Y8DC 3WDJA 3W11D 4UDUA 4BZ2H 4QTIL 4R4FH 5HHOA 4JKKA 1A22B 3P4MA 5I8OH 1P2CB 1U8OB 1Y18B 1FZMB 1JUFB 5CLTA 3CPLA 4TVPH 4KJQC 1QSFB 3HE6A 1LD9B 4NQDA 4XWGH 4JPKL 1FH5H 5IW6A 4Y16D 5EUKB 3U48A 4PBVC 2R23B 3FL7A 5C0RH 1G7IB 3K8MA 4UDUB 4MXQD 1U41A 4KH2A 2MKLC 3V4PL 3P4MB 1JPFB 5EA0L 4HUKB 3U4BH 1RZ7H 4BA8A 3L9RB 4PGBA 2XOTA 4FQHA 4MJIE 1CWVA 5C0BD 4NO3B 3WYRA 3FO2A 3OAUL 5ACLA 3NIFF 3L3DA 4LCWE 2Q7YA 4M61B 1G6RB 4WO4A 5F96H 1G7IA 4FZ8L 5FKPB 4YPGB 1XIWA 4QXGL 3WDIA 4AEHH 1YMMB 4GUPB 5DF0A 3VG0L 3T3ME 3QB7C 2CK0L 2NZ9D 1MQKL 2XZCH 3BZFB 1IM9A 1INEL 3WMSA 1MLCB 1X4ZA 2EYRA 2HT4C 3GHEL 2A6DB 4KK8C 5CILL 4AQ1B 4QHMA 3DRQB 3UTTB 4HJ0C 5HDOA 3WFDL 4YHOL 1NEZG 3NCJL 1QFWH 1LE5B 1MIEL 1KPUB 3G04B 2WSKA 5JW3L 2H8PB 1J1OH 4PP1C 2XG4A 1JZ6A 1ZHLA 3CFIC 2EDNA 2W38A 5I19H 5LQBL 1A6WL 4S1QL 4O4YL 4NM8L 3V79C 2FGWH 1CXEA 2X5PA 1MLCA 5HYFA 2ED8A 4IRJD 4U33A 1GIGH 1FO0A 3GFUA 2HVJA 3QXDB 3KWWA 1MWAB 1YEEH 1MLBA 2XPGB 4GAFB 5K9OA 2VUYA 4CW1A 1LO2L 4W81A 4GQ9L 3N1PC 2APFA 4NHCL 3WKML 3V4UL 5B39G 3HB3D 4ZUVA 3QHFH 1AQKH 1R24B 4ZO6A 3CSYA 5DJ6B 2YRPA 3GJFK 2FX9H 1T21A 4LPVA 5IBLC 1OWWA 1KT2B 2O5ZH 3C8KA 4OLUH 2XY2A 3BP4B 3TBVA 4DJMA 1G7QB 3OR6B 1JGUL 4ONFH 5F3HA 4IRZH 4L3AA 4Y4FB 4LLUB 3A6OA 3BDBA 4QTHA 1YPZB 2VDQH 4JN1H 4HWZB 1FZOA 3HPJB 4HFUH 4WO4C 4FFZL 5TE7H 1ED3A 2KDGA 3U4AA 3HMXA 1U95B 1VFMA 2J88L 3WNLA 2NY5L 3OKDB 4N8CL 5MEOA 1QLFA 4P23C 3VWKA 1JYWA 3C5ZD 5F3HB 5LGJA 4ZFZB 3BZDA 4X7SH 4OD3H 1CDYA 4XI5C 5JHDB 2RHEA 3ARDD 1NEZB 3HPJA 4P5TB 3NPZB 3DROA 2AABL 1KYOK 4V2BA 4WWKD 1BM3H 4KRPC 5KTEL 1YECH 3RWIB 3OZ9H 5MEOB 1IZJA 2AV7A 1SJXA 2ARJQ 4JQVC 1MEXL 3GB7B 1KLGA 4HH9A 5DK2B 2R0ZL 1AE6H 3OPZH 3V5HA 3QUXB 4B7IA 5E6IA 1GGYA 4KI5D 1FN4B 3H3BC 4Z95H 4Y4FC 5F72S 2ZCKL 1JTPA 4FQLL 2ZJSH 3I6LE 4KVNL 1RIVL 5TDNA 1YEJH 4HAFA 4AM0B 3MSPA 1PLGL 2EDJA 4JM2C 4XGZA 1DANU 3UJIH 1OLLA 3L5XH 5SWQB 4Q6IC 3MNVA 1W72A 1K5NB 3MGTA 1QD0A 5EBLA 1IFHH 1JZ7A 5D2NE 4XPHL 3GSWA 1I85C 5DVLA 4FTVE 4YPJA 1H8OA 3QEGH 2YEZB 5E6ZA 3VXMB 3U46B 4P3WA 2PO6D 5I8EB 4M7LH 4PV9B 3TNNB 1BX2A 4YHYB 1XZ0B 2X4UB 5EBMB 5J56B 5ANMA 3PQYE 1P1ZB 2E7BA 4U1SA 4LCWB 1A7RL 5KG9B 2IFFL 2C7UA 1FL5A 5DJAB 3ESUF 4ZFFB 3WXVH 1LWRA 1UCBL 1I7ZB 2OYPA 4M1GL 3NPSC 5J9PA 3P0VH 4IIQA 3VXMA 3VG0H 4BUHA 4AENA 4L4JA 1ETZB 3BESR 4Y19E 4LCWA 1U8MA 1T7WA 2CMRL 3VD4A 3RWGA 3ZKMC 5TQ0H 4CVWA 1R3JB 4JO2H 1K2DA 4NZUH 4O00A 3IJSA 4OTXH 1SY6A 3P73A 4WGWB 1JGLL 4IIQB 1JN6B 5E2WL 3P9WB 1CLYL 4GRLC 4Y1AB 4XCCH 2VDRL 2B1HL 5MEPB 1HH6A 5BMFH 4YX2L 1QOKA 1ZA6B 2BNUA 1P69B 1Q72H 1UACH 4J3UA 4UT7H 3GBML 3GUTB 2R9HC 1S5HA 2OTUB 1RJZB 3HG1B 5J0BA 1LO5A 5SWSB 1OQOA 4M5YH 4RFEA 4S11A 3O6FC 3OXSB 3CU1A 1VA9A 4P2RD 2RCSL 1KB5L 1VFBA 1K2DB 4ETQA 4H8WL 3V5DA 1XGUA 3MXVL 4XCNA 4CVXA 4EUPG 4NKOA 2R4SH 3UTSA 4JQIL 1N5YH 1U91B 2LU7A 2CXKA 4NQCE 4P23B 5EC2A 2FR4A 5HHQA 1A9BA 3QQ4A 2H3NA 4ZOEA 2A77L 4MA8L 5B3NA 5E1AB 3NVQA 4QCIB 1MVUA 1AGEA 1I9RH 1IGMH 4CL7A 3S37L 5JOEA 3BPNC 4U05A 2WIIA 4DN3L 4OLUL 2XY1A 4MNGA 4JFEB 2DWEB 4P23A 3VWKC 2L7UA 4J3WA 4CDHA 4UAOC 1HSBA 3FOMB 5I1EL 4L3CA 1J0KA 4JFDA 3RWEB 3UTOA 5BRZE 2DQJL 4YH6A 1S7SB 5F9AC 1MH5B 5SX5H 2NY4D 1YN6A 4MD0A 4PY7B 1LILA 3ULSA 2CRYA 3SGJA 4P2OD 4X98A 4WHTB 3ES6A 4ZPVB 5K59E 1DZBA 1DQJB 1S7VB 2E7HA 1F4XH 5CD3B 2FATL 5B3JF 4PB0L 4JFFA 1MFEL 2IMMA 3MRFB 1DBJL 2W91A 2Z31B 1P9MA 5D1XC 4PRHA 5F71A 4P4KD 4UT6H 2BNRD 2JELH 4NP4H 1I1AD 1PSKH 5JXAL 3QUYC 3IDJB 4MD0B 5AWNH 2PYEA 4YHKL 3PXHA 5JTWA 1AP2B 2H45A 5EORH 1D5ZB 5A1AA 4ZPVA 1QR1A 1OGAA 1ZK9A 1F90H 2VABA 4X0KA 5C0GA 4YDIH 3ULUH 1NL0L 1RVFL 4XP4H 2AXGB 4OCSH 5F7FA 3RY5A 1RUKL 1BHGA 3JSSA 4NKDA 3VRLE 3D0VB 1TZHA 4NM8H 4ODXA 5J6GA 4ZTOH 5BO1H 3WIIH 1ZT1A 3JWOC 2ZSWB 4IOIB 4CU7A 3MRPB 3SDCB 1NGYB 4M3KB 5HHVH 1PLGH 4HXBL 4L4VB 4U1MA 1YMHA 4ETYA 1YNTA 3KR3H 1MY5A 5BW7C 5HHXH 4WU7A 1IGIH 5F89A 5T1LB 4KK9C 2XWTA 5DD0L 1NCDH 5C0CE 1MFCH 3DURA 5IB1B 5FK9A 1Q1JL 3MJ8A 2X1OA 3H9SA 4S1DD 5GS1C 5HI3D 1H0DB 3QI9B 4GBXB 1XR9B 4PG2A 3V4UH 4JEGB 2BSSB 3QG6B 2VXQL 1Z9SA 1QRNA 2JJSC 3H42L 3KS0H 1F4WH 4OCRH 1CICA 1X5YA 5DJYB 5C0BB 4CGTA 5ISZE 5AZ2L 5CJOH 3RHWF 4FRWA 5IR1B 3MUHL 3BEVA 2YPKA 4KK6D 4MAUH 5CMAA 2R4RL 1XIWD 2UY7A 3O6LH 4NM4H 3IDMB 1PZUB 3MRHA 5DFVC 3QI9A 1SEBB 3VFMB 5EBGA 1FRGL 1QRNB 4QHNB 4DUWA 4DQOL 1Q38A 3G5YB 4N0YH 1UM5L 1D9KC 3RX5A 1C5CL 4HLJA 5IR1A 1A4KA 1MHPH 3MFFB 5DGQA 3BEVB 4YEFA 4YDJA 3KYOA 5FYLD 4K8RD 4YBQC 1H3WM 1IT9L 2EIZA 4FQ2L 4P4RA 3CDYA 1PQZA 1BFOB 2KKQA 4LIQE 4NBXB 4H1LA 4PRHE 3SGKC 2EKJA 5C6TH 3BQUC 3KPRE 2ORBL 4R4NC 1H3TA 1JNHB 4KVCL 5GGTL 3PQYB 2MCG1 1FH5L 1A4KB 1KCSH 2GT9B 1MJUL 1F5WA 1EGJL 4X6BB 5B8CC 4JGMA 2YR3A 4DCQA 2NW2A 1KFAH 4PJ8B 2I9TB 3CXDH 3OKEA 1YJDH 4K9EL 3BPCA 4WUKH 3DX9B 4Y88A 3FZUC 4WW2A 4EUPH 3C6LB 4Y5XB 3MYZA 1DE4A 5GRVL 2FH6A 3L3KA 4KKBD 1E4XI 1CG9A 1IGTB 2UUDH 3CFEA 4KQ3L 5FUCE 1AD9B 3LV3A 3EHBC 1F2QA 4OF5A 2LTQC 4KHTL 2GSGA 2O5YL 2GUOA 4NC0B 4WW2B 4YHZL 3VA6A 3C6LA 2ZG3A 2ICEB 4DGVL 5KS9E 5L0QC 1GHFH 2E9IA 5DJ8B 4JM2F 5KN5B 1EGJA 4QY8A 2NTFB 4CADB 3V4VH 4MXVE 4ZFGL 2C3WA 4HF5L 4RFNB 4XRCA 4JPIB 5DD3L 1Q9OA 4NRYA 4OD1H 2W0FB 3KJ4C 1K4CA 3BKMH 1DBJH 2ICEA 3O41B 3BEWB 5D93B 4R2GB 1MRFH 4N5ED 3QAZC 1CD9B 5D2LA 3QUXD 3DIFB 3I85A 4QRPA 4RWYL 4OZ4A 4E0RA 3UO1L 3PWLA 2W9EL 4YBHA 3OJVC 4R7DB 1MSPA 3ZT7A 5CP3A 1LE9A 3VD3A 4GKNB 1X5LA 1CDCA 1MCNA 3PWJA 1PG7H 3UZEA 1I8KB 4XPAL 1DLHB 1HYRC 4LEXH 3QUML 2ENYA 5C0IB 5DLML 3PWLB 1IGCL 2RCSH 4M8QB 5MI0C 3O8XB 5BS0D 5HHVL 2OTWB 3EOAA 3MUY1 2GW5A 2JB5H 3EOYG 1ZVYA 1S9KC 3CU7A 3G6JE 4MNHB 1JPTL 2XN9D 1P84K 4P57B 3T4AB 5GGVY 4V2CB 1KJ2L 3T3PF 4YDKH 1P4LB 4ELMB 3QG7L 1DVFA 1I75A 3SDAB 1JFQL 3GBNL 3DV4B 4HW6A 1FFOA 4UT9H 3T2NH 1QVOB 1JWUB 5BXFA 1BD2E 1RZJL 5I1AB 5LAXB 5C92A 2R4RH 4HBCL 5EWIH 5GRJH 3MA9H 4M7ZC 3CLEL 1MWAH 4RZCA 4JHZA 5FHAL 4M93C 2OP4L 3DXAB 4IRSA 3T77B 5IW6B 1V3LA 2XFXA 4LP5A 3FRPA 5BV7B 5EZOL 1YMME 2R23A 3CH8A 4OZFG 2WV3A 4M00A 1HQRB 1AJ7H 4PR5A 1DQQB 4XMLH 4HC1L 5TF0A 4N1EA 5FGRA 3EIFA 5T5FL 1FGNL 2ZCHH 1WZLA 2DQIL 4MXVF 1KPRB 4JREC 1MELA 2CR3A 3FT4A 2ARJA 3MQIA 3BISA 4AT6B 1T66C 4GXUN 3OB0H 1FLTX 4KDWA 4YPGA 4Z77B 4PB9L 4MZ3A 2PETA 5JW4R 3AXLA 3RWJA 2NXYB 4GMSH 1JNLH 3TVMC 1IM9B 1WBZA 2QQLL 1AHWB 3SDXF 3MBXH 2IQAB 5JUEL 5F1NA 4PRNA 4RMRA 1F00I 1QUNA 3P4LA 4ODWB 5KSUA 3TYGL 1PG7X 4OJFL 4HULB 2PR4L 3RVTD 2G5RA 4XNQA 2C4XA 1N5AA 2F53B 4BKLA 2FJFB 1NMCC 2VZOA 5C0BE 3L9RA 1B4JL 3QIBC 1KNOB 3UX9B 4RAVA 2OL3B 3TBYA 1Q1JH 2V5TA 4U6VH 3LQZB 5EOTA 1EEYB 2R2BB 1A6ZA 1R3IH 5D1QB 1RZ8A 5A16B 2QR0B 4WVRA 5IHUH 3W5NA 2X4TB 4POZD 5D7JA 5J1SC 3MLWH 1P5UA 4QXUH 25C8H 2QADB 3SY0A 1WISA 2XZAL 1ERNA 3RGVA 3B5TA 3S5LA 4QOKA 4EOWH 2WBJA 5IGXH 5HDQL 5SWZE 4M7ZB 4PJAB 2X4TA 5D7JB 5F1IA 2X89D 4Y4FA 3V6OE 4Q9QL 3KPLB 1X5AA 3NFPA 4YZFF 2VLKD 5CHNA 1OAQH 4OFVA 4NKIL 5KVGH 4HUXA 4HT1L 4AG4L 3WJJA 4OCYL 2GAZA 5JW4M 4BH8B 4Z6AT 1KOAA 4M1CC 4ODVH 3MNWA 3SDAC 4ALAH 4IOFD 5CIPH 1TQCB 1JTTA 1C16B 4OZFB 5D1ZA 4HCRA 3MA7B 3QUMH 3SGJC 3ZHKA 1KCSL 1Z2KA 5JMOC 1DQLH 1V05A 2DQJH 4ZD3H 3VD5A 5E2TL 1T21B 2AQ2A 3NIGF 5MI0B 4CU6A 3GIZH 4BSVA 4G8EB 3NZ8B 4AJ0A 1NUDA 1T1XB 5IUSA 3RL1A 5JW4Q 3I50L 3WBDA 2IADA 2R0KL 3HC0B 4LLUA 3UP1A 3ARBA 5J11B 3RDTD 1RHHB 4KXZH 4X7FC 4KVNH 1T2QL 1XGTB 1A6PA 1U3HC 5D6DC 5TPWH 4X7DC 4BSVB 1AKJD 3IDXH 1N3NA 4RX4A 2YN3A 3IFLH 2VISA 4KKLD 1JI1A 5E95B 3EOBB 3IKCA 4KK6C 2AS5M 2LU4A 2PNDA 1F90L 5KSBE 2XTJE 1ZLWK 1UEYA 5CGYD 3MNVB 3HB3C 4YXKH 4R7NA 5E08L 2ZNXA 1TMCB 5D7IE 2JCCB 3K4DA 4LVEA 3SDXB 4OFDA 1FL3A 3M8OH 2CDFB 1YY9D 4RFNC