3OAZH

A non-self sugar mimic of the hiv glycan shield shows enhanced antigenicity
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
223
structure length
223
Chain Sequence
EVQLVESGGGLVKAGGSLILSCGVSNFRISAHTMNWVRRVPGGGLEWVASISTSSTYRDYADAVKGRFTVSRDDLEDFVYLQMHKMRVEDTAIYYCARKGSDRLSDNDPFDAWGPGTVVTVSPASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab 2G12, heavy chain
publication title A nonself sugar mimic of the HIV glycan shield shows enhanced antigenicity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 46
structure length 223
sequence length 223
chains with identical sequence M
ec nomenclature
pdb deposition date 2010-08-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3oazH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3oazH01
5BMFH 1QFWM 1P2CB 3MV8B 3OKEB 4A6YL 5IROA 3BKML 1NGPH 1CFSA 1IKFH 3O8XB 4ZFZB 4FQQB 1JN6B 1YMMB 2HN7B 1LD9B 2F53E 4OGAD 5F7LB 2DWEA 1N4XH 4XBGB 7FABL 4MZ3A 1F90H 5D2LB 3A6CH 5DK3A 5TFSL 3QZWB 2BDNH 3BIKA 5I16B 1INDH 2EH8H 1I8KA 1A5FL 4YPGB 3W82A 4FZ8L 3S4SB 2QV2A 4PJAF 3QUZB 3U30C 4XVSH 5C6PB 2OP4L 4P0DA 1V3JA 3TBVA 3OXSA 3S8WA 4LVOB 3CNKA 1X6NA 2AJSH 5E2VH 4CU7A 1EJOH 2NY6B 2WZPD 4S0TD 3TJHD 5JTWA 3SDDA 1A6PA 1RJZA 1FGNL 1UACH 3KLDA 3M8OL 3QEUB 1IM9B 5C08B 4DK3A 3QQNA 4HWEL 4K71B 2X4QB 4RGNB 5FFLA 4MJIB 5E8NB 4FQLL 3EYFB 4PGBB 1F8TL 4YNYB 4EEEA 1SM3L 3VW3L 3B5GA 4P2RB 1HQRA 3U36B 1HDMB 2D7OA 3MRGB 4MA3A 4BSWA 2V9RA 3U2SB 3RWFB 1TQCC 2D03H 2BHYA 4QRSB 1KPVB 3HB3C 3SKNB 3H9SE 5DUBA 1Q38A 1NC4A 2EIEA 2PTVA 3RGVD 3DV6B 3NGBC 5IQ7H 2QHRH 5DJ8B 5AWNH 2F8OA 2J6EL 4F2MA 4HMEA 4YFEA 3BGMA 4XNQA 4YHNB 1SVCP 4IRJA 4NRXA 5F7DB 1MCRA 1SJEB 1A64A 5D2NE 4KAQL 2JB6B 5ISZD 1CU4H 4ONGH 4GBXD 5GRVK 3TVMA 3RWJB 5DMIL 1HKLH 4UTAH 1XIWB 1ZGLP 3W39B 4LHQB 5EOQL 3QJFB 4KJQC 1HWHB 2XV6B 5EB9A 4ZUTA 1KCRL 3NABL 4O5LL 2AV1A 3DSNA 3PG2A 1RZJH 2VR9A 3LKQA 4KGJA 4MVBC 1I8KB 3MNZA 4UI2A 1J18A 1VFAA 4XCEA 3QHZL 4QXWA 3MROA 3MR9A 5TQ2L 5CD5C 1A6VL 3T08A 3HAEG 4XVTL 3T4AA 1SVZA 4NQSA 1H3PH 3VXUA 5J9PA 4OZIB 1RJZB 1RJCA 2ED8A 4JRXA 3EW3B 2A9ML 5DR5H 2GUOB 3OMZA 3BH9B 5EG6C 4MWFB 1EJOL 2OJZH 2EIDA 5LAXA 2C4FT 3QDGE 3IDMA 3IFNH 3FONA 1YEKL 3ISWA 3WNNA 2W65B 1QEWA 3MODL 3QCTH 4XXCA 3U79A 5GJSH 4YHPA 3BGAA 2YRPA 1ADQH 5ESVA 4HKJA 1CDIA 2EDFA 3LRGA 2OTPA 3HNTL 1E4XI 1I85A 1MJJA 2HFTA 2EC8A 4UAOC 2WSKA 4ZO9A 2E8YA 4HGMA 1JPTH 4KK5C 1EHLL 3CX5J 1FLRH 1I8LA 2VIRB 4F2MB 3CDFA 1H8OA 4Z8FL 5FA4A 4IRJB 1A3LH 4ZO7A 2OI9C 1BBDL 5C2UB 3ULUE 1R3HA 4L9LA 4NQED 4P23D 3NIGF 4KY1H 3J7HA 2R2BA 4M6ML 3TVMB 3MXVL 5D8JH 4UQ3B 1LQSR 3X13A 1VGEH 1E6OH 3RUGA 5IKCA 4CN1A 3S88L 2H8PA 5EN2B 5GRWA 1CL7H 1H15A 4RZCB 4NCC1 1WBZB 5IMMA 3CFDB 2DQDH 2GY7B 3SDCD 2IF7A 1QZ1A 4EKXA 1NAMA 5C0DA 1T22A 3RWEA 1QLRA 3IDGA 3NCFB 3LKQB 1WTLA 1YY9D 1G6RL 1S7SA 3WHE0 2K3TA 3L6FB 3ULVC 4XCEB 5CILL 1T0NA 4WFGE 4D9RE 3GSQA 2GI7A 3MR9B 4YDKH 1WUNT 5DD1L 2UUDK 4N0YH 1FG9C 4JPIA 4ODSL 3QISA 4LPYA 1UB5B 1NEZA 4Z7UF 1KLFA 4J4PC 3WXWL 5J9PB 5KSBF 3JV0A 3WLWD 5IGXL 1HQ4B 2QSTA 4YFLI 3BSZL 2YBRA 3O3AB 5ETUB 5A43C 3ARRA 3RVVC 1JGEB 3KXFE 5HD8C 3TC9A 5L8JB 3CVIL 1G9MH 1VSCA 4HV8B 2BCKB 3T0EC 4P49A 4WO4D 2PO6C 2PKDA 4Z0BL 1QEWB 2OTWA 1NMCC 5HYQA 5KVDH 4Z7NF 3OKKB 4YHPB 2DMCA 5ESVB 2F53A 2R4SL 2NZIA 4HKJB 3QEQA 1MVFA 3TFKC 3ZHDA 4IDJH 1YPZE 2XTLA 4OZHE 4NZJA 5I2IA 5DLMH 1MJJB 3O2DL 2EXYC 4Y5XA 4OV5A 3UXFA 1T5WB 2C9AA 1YMMD 4XNZC 5T1DL 3L1OH 4YXLL 1S5HA 2Z9TA 4Y4KB 3MO1A 5FA4B 4C4KO 1NKOA 4Q0XL 1YN7B 1F42A 2E9IA 3F62A 3HI6L 4L9LB 5FKPB 4WW2F 1LHZA 3VI4F 3X13B 4DGYH 1HKFA 4XPBH 5IKCB 1WZLA 1MWAL 2W1NA 3P2TA 4HUWA 1FNSL 4G5ZL 1H15B 2X1QA 3QUZD 5BVPL 1UCBL 2A9NH 5IMMB 3CFCL 3CVHH 5E7BA 4AENB 3EFDH 4IIQA 3V4UH 5I0ZA 4Y8DC 4S0SD 3RWEB 4W6XB 3IDGB 1YYMH 5ITBH 5GIRB 1JZ5A 5IV2A 3G9AB 3VDCA 3S9DB 3W11D 1IM9D 5C08D 1MIEH 5D6CA 1A2YB 4MJID 4X6FA 4L1DA 3GSQB 4LCYB 3UAJD 1MFBL 4GKZB 3H9SA 3E3QE 2PYEE 4NUGH 4JPIB 4R26L 4P2RD 1UFUA 3BDXA 4HKZB 4ISVA 2LU7A 2VLRE 2WBWB 1NEZB 5CWSB 4LOUD 5TPWH 3B2VL 4NZUH 1BBJB 5D2NA 5D6DA 3GRWH 3W0WE 2QTEA 3ETBF 1Z9MA 2H32H 2ZCHH 1R0AL 5J11C 3E6FA 4LDLB 4KFZC 2Z35B 3GKWL 1KIRA 3V4VL 1Q72L 4W4OA 1UXSB 4X6BA 3GBML 4PLOB 1TZIA 1IJ9A 1KTDB 1QLEL 2FX9L 4YIQB 2F53B 1BJ8A 3QEQB 2X09A 4OCWL 1OGAE 2MWCA 1JFQL 3CD4A 5E2WL 3FFCE 5F7WC 5I2IB 2BVUA 1UWGL 3BQUB 7CGTA 4Y5XB 1VFOA 1MCIA 3SGDH 4KUCD 5AZEL 1WIOA 4KI5F 4ZSOA 4YBQC 5MEPA 4DTGL 3I02B 1CDUA 1AR1C 3EDDA 3MRPA 2V9QA 2JJSA 3MCLH 4IRZL 2EE6A 1I8MA 2BHUA 5CMAB 1WWCA 5EZJB 3S34H 5D96C 5IBUG 1MCJA 5FCUL 4K94L 4PY8I 5AUMB 5D1ZC 3R8QA 3WUWA 3WEXA 2XYCA 3WFDH 5J1AA 3CIQA 1MCLA 3AREA 4KJYA 4EIGB 4JY6B 4IIQB 4N1HB 4UILL 5FIEA 4PJ7E 3SDDD 2NZ9C 3WFCH 2AEPH 2QQNL 2ZOLA 1I1RA 2ICWA 4XNXL 5FOJA 4UIKH 1J9CT 2P7TA 3B2UD 3QZWG 1KB5L 3HMWL 2QSQA 3AS1A 1PG7L 1F6FB 1TMCB 1UB6A 1UM6H 4QF1B 1DBMH 3H9SB 3LKNB 3NFPA 5FUOL 3S4SG 2FIKB 2AK4A 4JFYA 4ISVB 5IB4A 3MBEC 3MBEA 1XR8A 4QRRE 5FM8A 2YA2A 3TO4C 1OTUD 4XAKD 5CIPB 5SWZE 2AXGB 4L4TA 4WENB 5C0BE 5HDBE 4BK4A 3EO0A 5D2NB 3ZTNH 3RNKB 5JZ7C 3EFFA 5FGCE 1NC4D 3F7YA 1AGDA 2BFVH 4NC1C 5GPRA 3ZT7A 4HDIB 4X80L 4XCFH 1A22B 4H8WL 3GSNA 2R56L 4IRJD 4M3JA 2PNDA 3UYRL 5DHVB 5EIIB 3MRFA 1QVOA 4RAHA 3VA6A 1SMAA 1LO3H 4G8FA 4FQXA 3TVMD 5GRUL 3MCKB 3C60C 1DUZA 5D9SA 4XHJC 3AB0B 3CX2A 3IDXH 4HBCH 1IEBA 4XNMA 3HNVH 1NGYA 2BNRE 2HG5A 2F74B 2OL3H 4PJ5E 5MEPB 2X4NA 4WNQB 5HHNA 4XAWL 3UZEA 1MRCL 1FORH 3ZHLA 1AO7A 3SGKC 2R29H 3DGGA 2AERT 1YEIH 4V1DE 5JIKA 3V4PL 4F9LA 1PY4A 5IEHB 1EO7A 5CS7A 1BEYH 4JKWA 3LKRA 2NYYD 4U3XA 3TNNA 2V7NA 3WUWB 2ERJB 4RA0C 4YLQT 3DBXA 5DURB 3MV11 5GGTL 2YEZA 3EZ8A 1H3XA 3QDGB 1FO0A 4G80A 3VXUD 3KJ4B 5ENWA 5DMKA 1FVEB 2CIKB 2BOBB 5CJBA 3RAJH 5IOPB 4PJAA 2ZOLB 1OARL 2E27L 2ICWB 1KJMA 4BZ1H 4MD5A 1FE8L 4NYLA 3HC0A 1UWXH 5I17A 2VDKH 1ROWA 4X6CE 1T3FA 1UB6B 3L3JA 1BVLB 3NFPB 5EC2A 1ZT7A 4D8PA 1SMOA 3SEPA 1XR8B 1G7HB 3D18A 5DA0B 2Q3ZA 2FB4H 3INUL 4QT5A 1A14L 3GJFA 4L4TB 1G1CA 3CSGA 2MHAA 3EO0B 5F6IB 4KVCH 5M95B 2PTUA 2GTZA 3FQUB 1AGDB 4MS8D 1AD9A 3REVA 5F21B 1ULVA 1QBLH 2B0SL 4D0BA 1YN6A 4Y4KD 3GSNB 1DTUA 1QVOB 2CMRL 2VDML 4G8FB 4OQ1A 1INQA 2OMBA 5L8KB 2R0ZL 1HNFA 1DUZB 3D39A 2JTDA 4U2YA 5D9SB 3RTQC 4Z95H 1KYOK 2J12B 2VE6A 4JG0L 5I1CH 4Q6YA 5L2JA 3VXMA 2ZUXA 4D3CH 1IEBB 1NGYB 3QG7L 1LO3L 3BGFC 4UMGA 1BHGA 3ARYA 4HS3A 4MXWL 3W9EA 1GAFH 2HG5B 4FMKA 5JQHC 5MHSE 4DJMA 2X4NB 3U4BH 3MLSH 3IDXL 5B8CC 5I1DB 3R0NA 2PYEA 1KN4L 2VLRA 5K9JL 3MFFB 3GM8A 5HXMA 3O9WC 4FQJL 3VXRE 2HVKB 1DVFA 3LKRB 3VRIA 5IW1B 3O11B 4I18B 2V7NB 1KENL 3IB4A 2DBLL 4U1LA 3KXFB 4JN1H 4EOWH 3RIFF 4HZLB 1K8DA 2BVOA 5F97E 5J56B 1FO0B 3OKLA 4PG9A 4ZO8A 2QLVB 1RMFH 2P24A 5BRZA 5DMKB 1MCFA 4HIIA 2EYTA 3LQAH 2J7LA 1XR9A 1X5YA 3MNWA 3GNMH 5EUKA 4UT6H 5DTFA 2VLKE 1YPZB 3HC0B 1P5VA 4LMQE 5LGHL 1IEHA 3FFCA 1T3FB 3GI9H 3RAJL 4P3WA 4R6UA 3V0AC 5DJ2B 1EZVY 1T21B 4G3YH 1ZT7B 5D7KE 4JPWL 1OGTA 2VLLB 4LSQH 2EIBA 3D18B 3N50A 4HX1B 4X4YB 1HXYB 2F53D 3F6LA 4QT5B 2HTKD 3GJFB 3QEQD 2HTLC 5HVGB 4KKBC 2MHAB 5IHLB 2W59A 1RY7B 3GJEA 3FB7A 2XRAL 5ALBH 1JWMB 3RNQB 3BQUD 2Q8AL 5A3IC 3V6OE 2D0GA 4OM0L 2F8XC 4YHZH 3X11A 2IFFL 5GS0H 2XZCL 1IL1B 2RAMA 1YN6B 2DM3A 5E6IC 4OSUL 1IGFL 1HHIA 2XTJC 1O7VA 1NBYA 4OTXH 5T3ZL 2YPVL 1INQB 3O6LL 3VXSE 2AKRB 2QSCL 4PJ7A 4GSDH 4JY4B 3BW9A 3M07A 5L2JB 3NZHL 1ZAGA 3CFJB 5F7EL 1WVZA 3VD9A 4OJFH 4M3KB 4PD4K 3W9EB 1YYLH 4HUUB 3WD5L 3NCJL 5C9JA 4ZD3H 4Y4FC 4Y4FA 4N5UA 3MNVA 5HHVH 1FFOA 4TRPH 2SEBB 3FMGH 2ZUYA 2PYEB 4LCWE 4BJLA 1KGCE 3STZB 2VLRB 4KK6D 4KRPB 5C2BL 2VXVH 3DPBA 5JW4N 2P5WA 1DVFB 3VRIB 2VXTH 5C0BA 3NCMA 4UT9L 3MLZL 3F58L 3W0WB 1A7RH 2YN3A 4HIXH 3H9SD 4NPYA 1F3DJ 3HPJA 2FD6L 4PG9B 4Q74A 4UOW0 1FC2D 3C08H 3QEGL 3EO1B 4HIIB 2EYTB 4NQDE 5KJRL 1FZKB 1XR9B 1OPGH 2Y07H 2A6JA 3CMGA 3RJDA 1WEJH 3WN5C 2YPLE 2XZAH 1OGAB 1UA6H 3QIWC 3FFCB 1EXUB 4Z7UA 2VXSL 3RL2A 3WL9A 4DWHA 4XCYA 5T1KA 5KSBA 3H3BC 1VENA 1ZHBA 2APXA 1CDYA 5DFVC 1FFRA 2XZQH 3E6HA 3ZYJA 5CCKH 1NCBL 4UT6L 1WFTA 1OGTB 2ARJA 5I9QB 4ZUWB 2RFXA 1KEML 4DVRH 1ZHLB 3BMVA 1S5IH 2NW2A 4JRWA 1D6VL 3GJEB 4XPFL 4F80A 3FB7B 1NEZG 1BLNA 3ECBA 3QNZA 1F00I 2CUMA 3ET9F 3T09A 4YC2B 3WE6B 5F9OL 3GHEL 1RK0A 3X11B 4PTUB 5IMOB 4NHCH 1RIUL 4O4YL 2LU3A 3RPIA 4FNLL 4MAYB 1KIPB 2Q7YB 5C0FA 5IF0B 4YE4H 1LO0L 4O02H 3TA3A 3K2UL 4NN7B 1RUAH 4YUEH 4M7LH 3WFBL 1IAIM 4PJ7B 1RVFH 5DQJA 4PGZA 3REWB 4L5FH 2I24N 1A4KA 2CLVA 2ZCKL 4OTXL 3HHRB 2HLAA 1I3RB 1K4DB 5DURD 5FUCC 5MP6L 4WW2A 4WW2C 4NSKA 5C0AE 3W9DA 3QDGD 1FV1A 5D1XA 5HYSA 1FFOB 5IESH 1QKZH 3BPNC 4KKLD 2WIIB 3OAYH 1WC7A 4K2UL 1L7IL 3QULA 4XP5H 3Q48A 5JXAH 4QRRB 4TPRH 2P5WB 5SWZB 4TSBH 1KIQA 1NC2B 4YHYB 3F12A 5C0BB 2AJUH 2VOTA 4C55A 4M7KL 5T5FH 3PDDA 4PLKC 5FGCB 3QIBC 2AK4D 1P1ZB 4FFZL 3VXNB 1J1PH 3ZE0E 4GG6E 3SKMA 4L4TD 1P4LB 1NDGA 1RZFL 3SOBH 4AL8H 3ULUD 5EIQA 1T03L 3D9AH 4OUOA 4X5LA 3FZUD 1MCQA 1CGUA 1ES0B 3KG5A 5J6HB 5TJWK 3RL2B 4P5KA 5I74B 1T6WA 4E41E 5D7IE 1ZHBB 4P57A 3MV7E 3QRFM 1T7VA 4Y2DC 2BNRB 2XXMB 3GMMA 4PJ5B 1UWEL 5GRJH 4NHUA 4FQXD 2NW2B 1PX4A 3PHQB 3ECBB 4H0HB 3DX8A 1D6EB 3QNZB 3U7YL 4YZFF 2Q6WA 4JRYA 2EDNA 1YEFL 4N8PA 4HT1L 5E8PA 2X4SA 3O0RL 5CZXD 3RPIB 4D9RD 2BSTB 1YQ2A 2FX7L 1GJIA 3P11L 5C0FB 1AO7D 5GZOD 2GW5A 4XPHH 4OCLC 3UPRA 4JFQA 2X7LB 1W8NA 2ZJSH 2A0LC 1BF8A 1A4KB 4QOKA 2CLVB 1MFDH 3DVNB 5JUEL 1X5ZA 1ZSDA 1FZJA 2VLKA 1HHKA 1FV1B 3UJTL 5HYSB 1GSMA 4RRPA 2P43B 3P3YA 3QULB 4LPCA 5GJTL 5FV2A 5FO9B 3TBTA 5FYKH 2EDWA 3PGFL 3KNBA 4Y5YA 4JFXB 3D3VA 1QKZL 5IP4A 4JO2H 2DYPA 5K9KB 1EGJH 2X4OB 3K2MC 5GGVL 3TZVA 1OL0A 1C5CL 5GGSB 2FR4A 3RL1A 4XVUD 1QBBA 4DVBA 3OG4B 3WUWG 4XTRD 4X99A 4D9QE 4WEMB 4P4KC 3OL2A 4L8DA 3BP5A 5FGSA 3E2HB 4K3GA 1DANT 3SE9H 1FNFA 2UWEE 5I6XC 4IS6A 4OT1H 5LCVL 2H1PH 4TNWK 4P57B 3D9AL 5E9DE 3M17B 4NN6B 4H5SB 5I1KL 4CRPA 2X10A 3SKJL 4K8RC 5GSVA 5H8DA 5I1IL 4EDXB 5INCA 4WIQA 3DX8B 3V0WL 1IC7L 4BH7A 4JRYB 3IU3A 5E8PB 5D7LE 4XP1H 3HPLA 3KPQA 3VXRB 3O6KH 2YC1A 1A9EA 2VDQL 5JDSA 4QRUB 2FDBP 3NACL 1J1XL 5CEYB 2WINB 1RD6A 4IRSC 5EWIL 3A67L 1EAJA 3RX8A 3T65B 3I6LE 1CTOA 3SDXE 2PYED 3R06A 1IGJA 2VLRD 3VJ6A 4KRPD 1KXTB 4ZTPL 2DQUH 4G6JH 1DVFD 4JY5L 1JZ4A 5EUOF 4NQDA 1RV6X 1B4JL 1MUJB 5JXEA 2WM0A 4YR6A 5KVGL 1X5FA 1W0VA 4XC3H 3VGHA 4DKFH 1YEDA 1ZSDB 4RMSA 5DD3L 2DMKA 1FZJB 2YPLA 2VLKB 1HHKB 5IQ9A 3HC4L 3W81A 4G6FD 2EDOA 4XMPL 2VAJA 3TBTB 3DHJA 4JREC 3P73B 2ED9A 1S3KL 3WIHL 1OY3B 3KNBB 3DIFA 1HHHA 1F58H 2Y6SD 3H42H 4AIZB 3FFCD 5IB2A 2CRZA 1IC4H 1FRGH 1CR9H 4HS8H 5EU7C 3VFUA 1LK3H 3BVNA 3L3KB 1DUYA 4TOYH 4X99B 1EHAA 1DDHB 4L8DB 4LEXH 1F3RB 1T89A 2VLJE 1W72A 2O5XH 2BC4A 2AW2A 2YOCA 2FZ3A 3IXTB 4TULH 3P9LA 1FFPA 4X5XB 3VXSB 3NCBB 3C5ZA 3T04D 3EYSH 5J13B 4AEHL 1TZHA 1FH5L 1NLBH 2J88H 5KN5B 3U4EB 2NW3A 4MAYD 3VWJC 5GSVB 1U8KB 4R90L 2ZKHL 3VE0B 4V2CB 5INCB 4LCWB 4XPAH 2D7PA 1F5WA 3T8XA 1IQWL 4WEBL 5CEZL 3HPLB 4CVXA 2YC1B 5JDSB 1B4RA 5IIEA 1WT5A 4CN4A 1C08A 3S96A 3RKDD 5E8EB 4O51B 3DO3A 4JCMA 3D2UA 3MREA 5T1LB 4JDTL 1CDBA 1RJLB 3F7QA 1LDPL 3N85H 1GGBH 1MPAH 1IGJB 3R06B 3VXOA 4PB9L 4QRRD 2CJUL 3SJVE 2P5WD 1GHFL 5SWZD 1IKNA 5HHOE 3FQTA 1NC2D 4JFEE 2ATPA 4NQDB 5C0BD 1JUFA 3DNKA 5JHLL 4NKQB 1W0VB 2B1HH 1YEDB 3OAZK 3QPXL 1OSPH 2YPLB 5HI3C 1FL6A 5I1EH 4EQ3A 1DFBL 3V7AE 1A6UH 4JHWL 1B6UA 4UBDC 5E5UB 5MI0B 1I1YB 3GMOA 3T0EE 4RWYL 3WO4C 1ODAA 4MNGE 2M26A 3T2NL 4GMSH 1HHHB 5T1KD 5IB2B 1A02N 5GGSY 2FECL 1KYOJ 1J10A 4UTBH 1WBXB 1NFDF 1AGBA 3DXAE 3BVNB 2HFEA 4Q2ZA 5B4MD 1DUYB 3QIUA 3QIUC 3A6OA 2YN5A 2BNRD 1LEIA 1D5XB 1MEXL 3PV6A 4PGEA 4Z76A 2KQMA 4QHUB 4WI5A 1W72B 2CK0L 1JNJA 2BC4B 2R0LH 4Q9QH 2FZ3B 4DQOH 4DN4H 1FFPB 2DQHH 4X8XA 3C5ZB 3QFJE 1UZ6E 3OPZH 4LPWA 4XC1H 5K9QG 2X4PA 3NFSH 2JIXA 3VFVA 5BV7C 4BQ8A 1LNUA 2NW3B 3MJ8A 3OX8A 3TNMB 3WNMA 4XBPA 3IJHB 2FATL 5C0AB 3WLBB 5E1AA 3PWJB 1WWAX 4Q9CA 1K6QH 4A6YA 2KQNA 4Y5VA 4Y5VC 5LJYH 2CKBL 2GEEA 4S1DD 5FUZH 3MRJB 4D9LH 5SWQB 4CVXB 3FAWA 2IH3A 4H26B 4AYFA 5IIEB 1WAAE 2FJHB 5D1XD 1IM3B 3HAEH 3BZ4A 4KHTL 3S96B 4PJIE 5EBWA 2ZPKL 1JNHA 1N7ML 5B38A 1J86A 4E42A 3VXOB 1HZHH 2EKSB 3QUXB 1ZVSB 4GG6B 3JTTA 1KCSH 1RZ8A 6FABL 1ZA6B 4NO0A 2ATPB 4CW1B 2A6KB 1FGVH 1JUFB 4U7SA 1C5DA 1N2RA 4N8CL 4LCCC 43CAB 3LRSA 3NIDE 3S37L 2UWEA 1FL6B 1MFEL 1CF8H 3CSYA 4LMQI 3FT4A 4E41B 5D7IB 4NJ9H 1IEAA 4JFFE 5ABDE 2D4FA 4KTDH 3MV7B 5E9DA 2CPCA 3CFBA 4HCRL 4APQA 5KZCD 3GMOB 1FYTA 2OK0H 1JRHH 5EFIA 1OB1B 3QUMB 3FQRB 3O6FC 4LBEB 5JQ6L 1MHPH 4AG4H 1CFVH 2A38A 4OD1L 2BMKA 5DD5L 1AGBB 1G7IB 3EGSB 1D5ZA 3WJLC 3FOMB 4LIQH 2K7QA 4HPYL 2DLIA 3ZDYE 4YDIL 1JGVL 5MHSD 1YEEL 2VERN 3OKOA 3O2WL 4Z76B 5BQ7B 4M9PA 4RCAA 4WUUA 1B0RA 1FFQA 4CJ0A 5EBMA 4ZFOA 5E0QA 3SDXA 3QJHA 4HIEB 4PJFE 4LSVH 4JRYD 4R4BA 5HYJE 4YHKL 4ODUA 1MCOL 3OAUH 3VXRD 4HKBA 4EI5C 4K9EL 2X4PB 3VFVB 5JR1L 4N9OB 4UV4H 3HFMH 1ZT1A 1PKQE 4Y4HC 4FQIH 3B83A 4OLVH 2V5SA 1FBIH 4X7TA 3VD7A 4N8VB 1OM3L 4KI5D 4N9GA 1I7RB 1D3CA 1R3IL 4QOKD 3DX9A 3WJJA 5KS9E 2VLKD 2EDTA 4MXVF 1DL7H 3BZ4B 1CGTA 4S1QL 2DQGL 5EBWB 2EO1A 1DBKH 1IGIL 1JNHB 4NZTH 5D7KD 1IBGL 1OCWH 2IPTH 5B38B 2Y25A 2XA8L 4E42B 1XF5B 1P7QB 1U8LB 5DHXB 5SX5K 4I13B 2DWDA 4HC1L 5BS0A 1RURL 1C5DB 3UJJL 4LLWB 5E94A 2VLJA 1OAUH 4JFZL 3TZVD 2AJVH 2UWEB 4POYA 3LN4A 2R0WL 4KROC 1LMKA 4ZUUA 4L9DA 1A6ZB 5FHBL 5E9DB 5GGRA 4R96B 3JWDL 2ENYA 4P3DB 4NC2B 3BMWA 3CC5A 1PSKH 5HYSG 2ZUQC 4PTTB 4G8GA 2A6DB 4RAVB 1AXTL 2DQTH 4YQXL 3VXSD 2DD8L 1B88A 2DL9A 1U8JA 3QNXA 3BKYL 4MQXC 4BELD 5HI5D 5D7LB 4U1MA 3QT2A 5TGBA 5HGAA 3GSOA 4I3RL 1DR9A 3VWKA 4DZ8B 1LWRA 4EVNA 1B0RB 4ERSL 4I77H 3WDJA 1N59A 4JJHA 3SDXB 3ZE2E 1KGCD 4P5TA 4JFPA 2FO4B 5IBTH 5F1NB 1K2DB 1QHPA 4HKBB 2XPGA 2JJUA 2AI0H 1A4JA 5SX5H 3OBAA 1CXKA 1U8HA 1JF6A 5T1LD 3ZYZA 3JWDC 2MPAL 1GOHA 3O6MH 3BJ91 5IMKA 5C7XH 1A7PH 1E0OB 4GOSA 4OLYL 1OVZA 2VXUL 4N9GB 1QSZA 2WWMC 5KSAA 2DQIH 4NQDD 3PNWA 3IVKA 3RY4A 3DJ9A 4P4RA 5JXED 5CGMA 3LB6C 4N1CA 3MGOA 3WHE1 3QRGH 2YPLD 3L3HB 4K3JL 5JMRA 3CU7A 3EYOA 1U36A 1JHLH 1XGUB 2HFGH 4CNIA 1ZT4B 4CADA 1FFNA 2H9GA 1U91A 4PY7A 1NBVH 2BX5A 1CT8B 2E6PA 3UC0H 1G6RA 2AS5M 3N9GH 5ACLA 2DWDB 4Y2OA 5BS0B 4O2FA 3BWAA 4RDQF 1AXSB 5E94B 2VLJB 4ZFGH 1RZJC 1F4HA 1ZXQA 35C8L 4HXBL 2O61B 1MFAL 1V5JA 1EO5A 5E5MA 4F7MB 3TCLA 4WJ5A 1SY6H 3HR5B 1QPXA 4ZUUB 4HIHA 3B5TA 3QFJA 5GGQH 3UBXA 4M61A 5GGRB 1F4AA 5K33A 4XCNA 5C0ND 1MRDL 2DTSA 2J1KA 2YPKB 3ESVF 4GT7A 4RRPG 2GKIA 3BXNA 4X7EC 2E7HA 2V17L 4FTVA 3C5ZD 4ZS6C 1KJVB 3IRZA 3WUZA 1QFHA 3QNXB 1O7SA 4L8SC 4U1HA 4PJHE 4R97C 3CH8A 4U1MB 4F37K 4NQVA 5B22A 5TGBB 3GSOB 1WAAA 5C0AD 5IT2L 1FPTH 3QPQC 3VFWA 2IQAA 5E4EB 3O2DA 5DVNA 4P5TB 1HHGA 3FB5A 4JFPB 5KTEH 1ADQA 4G9FE 4L3EE 3SJVB 4X6DE 4S1SH 2IJ0C 3MXWL 3EYQD 4JFEB 1A4JB 2VZ3A 4C83A 4WI9A 3ZDXE 1X7QA 2NXZB 4W6YB 5IBTL 3MRCA 3IU4H 3VFGH 3BZEA 1KELH 4FG6C 2QSVA 4IM8A 5I71C 4WRLA 3VRLE 2ZUWA 1RIVL 4JHAL 5KSAB 3PNWB 3L5WB 4PUBL 4FQ1H 3SCMA 4GW4A 4MNGB 3MGOB 1KCUH 2QKIA 5TH2A 2PO6B 4IJ3C 4OB5H 4E41D 1NPUA 4CADB 1PGRB 3X3GL 3MV7D 5EUOA 1LK2A 1FFNB 1VA9A 2H9GB 3NA4A 4LCIH 1BFSA 1G6RB 3L7FA 2H2PC 4BZ2H 3LS4L 1SHMA 3LD8B 3AXLA 1DEEB 2XWTB 3JSSA 3BWAB 5IFAH 4J8RA 4N5EC 3L9RB 2WIMA 3B6SB 5ACZA 2HFFA 3P4LA 4CAGA 4WJ5B 1R5IA 1E28B 3V2AR 3QFJB 4YBLB 3ZKXC 2JB5L 2Q87A 2W0FA 3RDTC 3VGBA 2YMXL 5CFHA 4WI8A 4XCNB 1MQKH 3WNKA 1NDMB 4OLZH 2AV7A 5F96H 3BXNB 3ZMRA 1P9MC 1P9MA 2X1WL 4WU7A 5IG7B 3EYVB 3CPLB 3RVTD 3P4MB 2JIXD 3GMLA 4JPVH 2A73A 1G9MC 4U1HB 1J8HE 4Z7WE 5KS9A 3ARBC 3SHSA 1MCKA 3KPPA 1E4XL 3GIZL 1TPXC 2X9YA 2VTFA 4PJIB 5DJCB 1AGEB 1A1NB 1S9YA 5B39B 1DE4B 1J7VR 3SO3B 1HHGB 2AK1L 3T77A 1AP2A 5IFHL 3OR6A 3ZL4H 4PRHE 3B9KA 5IWLC 1PAMA 3G6JF 1FPTL 1DQLL 4J1UB 4WUKL 4LHUA 3UTZB 4LP4A 5EZOH 4W70A 5DJYA 3X17A 1P7KA 4WW1B 5F93C 3JV6B 3MRCB 3TPUA 4XNUH 2VQ1A 2BSSA 1P7QD 2Z4QA 4JFFB 5DEFA 4D9QD 4NIKB 1MWAB 3MLPA 3MBXL 3T3MF 4NO0D 3IS0X 3T4YA 4UIMB 4ZPTA 3SCMB 4GW4B 3JV4A 3UTTA 4MJ5B 2QKIB 4F58H 5T3ZE 1B3JA 5GZNC 4O00A 1RULH 2I9LA 3QB7C 4PP2A 4P2YA 5JA8B 4LNRB 1F4YL 3MGAA 4TVSa 5E9DD 3HUJF 5D1QA 1KACB 5DMJB 3B8YA 3S7GA 4N68A 3CVHA 5FXCH 5GGUA 5KVFH 1ZHNA 1KB5A 2J4WL 5L6YL 4CGTA 5ACZB 2HFFB 1QR4A 4GXVH 4PJFB 1S7WB 5HYJB 1G7QB 4PS4H 3H0TA 5GGRY 2W0FB 1MFCL 1EEYA 5FYJL 4M4PA 4Z78A 4PJDE 1NFIA 1PKQB 2LTQB 3RZCA 1I3UA 1YY8A 1FHGA 1NFDA 1A9BA 4ZDHA 5CBAA 4WU7B 1SYSB 4NKOB 1A0QL 3OB0K 2HVJA 5D1ZB 1CK0L 4U49A 2RIKA 1GGCL 1ED3A 5CSBA 3GMLB 2A73B 3BISA 1CXHA 4BSVB 5KS9B 3KPPB 1UADC 2F5AH 5IEKA 4X7SH 4XI5D 3TH4T 3IFPA 3T3PE 4YHLH 5FUCE 1NL0L 2PUQT 3VGGA 3T77B 5CJQL 1F4WL 4N0CD 4M1DH 4KZDH 3C8KA 3GSUA 1NCAH 4PB0L 1OTSD 1QFWI 2RQ8A 4U6XA 5I15H 3P4NB 1OW0C 3FT3A 4X4XA 1TZGH 2XKNA 4RFNB 3S98A 1HK6A 1P7KB 2HT4C 4G7YH 4U3HA 2H3NA 2FEDC 4U1KB 2Z4QB 3QWOB 2V9TA 1FNAA 4I5BA 5BS0D 3T4YB 5DO2C 4XGZA 4ZPTB 3FOLB 4F7TA 2VLJD 4N8VG 2XN9A 1GIGL 5GGTA 1X5JA 4GRLC 1FYHB 4PGDB 3P0YH 1FNEA 2ITDA 3OB0H 4HS6A 3E8UL 4ODTH 4R0LA 5TE7H 3TPKA 5C0GA 1HXMA 4ONOA 5JW4R 5TDPB 4PJHA 4NC0B 1BQHA 3C60B 3I75A 3N0PB 1LILA 4G8GD 3WSQH 1J05B 1MSPA 4QCIA 5B38G 1ZHNB 1MJ7L 1KB5B 1AI1L 1KPRA 2BJMH 5FB8B 3LPWA 5B21A 1TJIH 2PF6A 3BPLC 3U46B 5DC9B 4F9PA 2VH5H 2D2OA 5CP3A 3ABZA 4LVHB 4MB5A 4Z78B 3KYOA 1NFIB 3VWKD 3S36H 4M93C 1NFDB 5I1JH 3C8HA 5CBAB 4P5TD 3BO8A 4PRPE 3JTSA 1VERA 4UNUA 1SBSH 3SJVD 2Z93A 1ED3B 1IGYA 1KCKA 2F5BL 4JFED 4LLYB 5AZ2L 1NGWA 3LN9A 4DGVH 3C09B 1PVHA 1GGTA 4U0QB 1ND0A 3V52L 4JR9H 2NXZD 4J4PD 4PR5B 1MRFL 1TETL 4KMQA 2W91A 1QBMH 3GSVB 1OAYH 5DXWA 4I2XE 5HD8D 5KSAD 3K81A 3C2SA 3VXQA 2FYYA 1U3HC 3MOBH 1HH6A 1BQUA 5HDLA 1DQML 4KVNH 4YX2H 3C8KB 3GSUB 4OKDA 3BRDA 5EU3A 5GRZA 4U6XB 1DN2A 3U0PA 1GPOH 3SN6N 1JYWA 1I9IL 2EZ0D 2I9TB 4MHHG 2EE9A 3TFKD 4CBPA 3DRQB 4PLNC 5I15L 2X42A 5ERWB 1GZQA 3AGVA 1X5GA 1TZGL 4ZYKA 4XGZB 4F7TB 4LARL 3ZKMC 5L7XL 2X5PA 3DURB 1JWSA 4OLXH 4XBEH 2FL5A 1IFHH 1UZ8A 2X89A 1UXWA 3QFJD 4DEPB 3G6JE 4M5ZH 4HS6B 3TBSA 4TNWF 1TDQA 4R0LB 5K59E 4RMRA 1HXMB 2Q8BH 4Q6IC 4PJHB 1A7OH 4D2NA 1A6WL 3SGEH 1RQ5A 4QCIB 3KPNA 4JANB 1LEKB 3LPFA 1KPRB 4LPVA 4WI3A 1F11B 1L6XA 3BUYA 3LEYH 1MHEA 1CZ8H 4PGJA 4URTB 3BP4A 3U0WL 3GK8H 4G9FB 1WIUA 4KQ3H 1NMAL 3L3GA 4U1GC 3KYOB 1KLGA 1IAKA 2W0LA 3Q6FA 5EOCL 3QDMA 3O9WB 4O2CB 3BO8B 5CHNB 1MHCA 3M45A 3TN0A 3TN0C 3LKSA 1A1MA 4FP8H 1IGYB 3G5VA 4QRQA 4RSVA 2LVEA 3HS0A 2VJXA 3UTQB 4BQCA 1ND0B 3MUJA 1TVHA 5A2FA 5BW7A 2E5EA 4WDIA 2IQ9H 2EKJA 3LDBC 4JFFD 12E8H 5MERA 4MD4A 2QADC 2P8LA 3CLFH 3SCMD 1RZKL 3KPSA 2OMNA 4UT7H 5T3XL 4ORGB 2CRMA 5AG9A 5KG9A 5EU4B 1FAIL 3DUUB 1JWUA 3U0PB 2EXWC 4FQCL 4XH2B 2DF3A 2D4DA 5KVEH 5DUMH 4OZGE 3EYUL 4UOW1 4RA3A 4ZTOL 4FN0A 1U9KA 4HWBH 3CXDH 3MLYH 3FN0L 1GC1C 4FS0A 4O58H 4ZYKB 1UKTA 5EU7E 4L4VA 2HJFA 5JA9A 2ZOKA 3GMRA 3V7AG 5DD0H 1CFTB 1HH9A 3ZE1E 3GEWB 5HYJD 1HOCA 1UZ8B 5E6IB 3UYOD 3MRRB 4I9WD 5DSCA 1T6VN 1CVSC 3TBSB 1AY1L 1U95B 1J8HB 4Z7WB 4R2GC 5DJAB 3SPVB 1A6AA 4NNYA 1CDJA 4OFPA 1QSVA 5CIPH 3N1FC 3IYLW 5D1ZD 3LQAC 3KPLA 2AEQH 1X4ZA 4OZFB 5BVJB 1BX2A 4UV7L 1QSFA 4PRHB 4S10A 4ZODA 4GXUM 2MQCA 4JKKA 2EYSA 1TJHH 1KLGB 5L0QB 3S35L 4QRTA 2JELH 3I2CH 3Q6FB 3QDMB 5DHVH 4U6YA 1MHCB 2VC2H 3CFKA 2C26A 4U05A 1M6OB 3B9KD 1A1MB 2LQRA 3MRMB 4QRQB 4M5YL 5F88A 4JDZB 2VO5A 5KVMC 5FDWB 3GI8L 1AQDB 2V7HA 1LO5A 3WS6A 3FL7A 8FABA 1KN2L 4P9HL 5LBSL 4WDIB 4H0IA 5GS0C 4P99A 4AM0B 1ZVHA 1JV5A 4KKAC 1LE5A 3R1GH 5MERB 4LPTA 4NZRL 1U8IB 2VYRE 4KK8D 4R8WH 3UTTD 3UROR 1CD1A 2O5ZL 5B39G 5DYOA 5KG9B 2A1WL 5DQ9A 4MCYA 5F3BB 1IGTA 3ILQC 2MTPA 4PJEF 4RAUB 4LEOB 5EU6E 1TVBA 1HYSD 5T33L 1VPOH 4V2BA 2FGWH 3TT3L 3C60D 5DRZA 4HH9A 4XHJD 4PJDB 2ZSWB 3MRBB 3GB7A 2HJFB 5L88L 1I4FA 3BZDA 3GMRB 2XWBA 4FXKB 4PRPA 4OUUB 5ADPH 1HOCB 2NLJA 2CH8A 4P9HC 4O9HH 3ARUA 5SV3A 4G7VL 2NY5L 1C1EH 2F58L 5CZVL 3CJJA 1IGCL 4LVNC 3RZCD 1YEHL 3MLWL 3SDAC 1U8OA 4MA1C 4X9GA 4NNYB 4OIAA 1EJ6A 4BM7A 1A1OB 5IHUH 4J3XA 3GSWA 3ULUH 2Z8VC 2APTA 2IG2H 5H35A 1BX2B 2FJFA 1QSFB 2P48B 3TIEA 3BPNB 3MLTB 3OJ2C 2EYSB 3BPOB 1WCQA 1UT9A 4Y1AE 1OSZA 3GSNH 4QRTB 4P59L 5LGKA 3QI9A 4YFDB 5HVHB 4U6YB 1AIFA 2Y1VA 5AYUL 3THML 4OQTL 5ALCH 4KXZH 3ARGA 1QFUH 5C0IA 2ICEB 4LRNL 3MRLA 1LO5B 3GJFK 3NN8B 4JDVA 1UH2A 5A16A 3G6JA 3NZ8A 2PXYA 2X05A 2R9HC 4HJJH 3BN3B 4QRPA 3SE8L 4N0UE 1YNTA 4F7EA 1ZWIB 2W0KA 1Z6JT 1NLDL 5D7JB 2YA0A 2PCPA 2NY3C 1EH9A 1IGTB 4Y2DB 1J1OH 1N0XL 1OT1A 4P3CH 5GHWL 5GISL 2R8SH 3VD4A 3QO0A 5L9DL 1XF3B 3IETA 3QXAA 3G08A 3VMNA 1FO0H 1T04B 4HH9B 4OBSA 2XACC 4HF5L 3TCXA 5HHXH 4PJBF 2VDRH 1MCPH 3NH7H 4H88H 5KW9H 4KKCC 4AK1A 1OTTC 2XWBB 3VRJB 1JPSL 4ONHA 4AMKH 4JZNA 4PRPB 1XT5A 3HI5L 3NPSC 4TSAH 2Y36L 4MZ2A 5J06A 4NGHL 3OB8A 4ENED 4Y16A 3DRTA 1GGUA 3HE6A 1XGPA 2JJTA 4EUPA 2HRLA 1U8OB 2IADB 2W9DH 1EFQA 3GJFH 1VB9A 2B20A 3MC0A 3PWVA 3GSWB 4I2XB 4UINL 3ZKSD 1U41A 2FJFB 4KV5E 4M8VA 3TIEB 4ZMAT 1I7TA 2O5YL 5D70L 4HWZA 4Q9RL 5C1MB 5KSVA 4M6OL 2Y06H 3BP7A 4M1CC 4JM4H 1F45A 3QI9B 4CMHC 5I1AA 2IPKA 1D9KC 2F54E 5D93C 1Q1JH 4PY8J 1T5XA 2HKFH 1KTLB 2V6HA 2ARWA 4DFHA 3LMJH 3P0VL 4MQ7A 3GO1L 3FFDB 2HTLD 4XPTL 4OLWH 1V7NL 5A16B 3G6JB 3NZ8B 3HA0A 2PXYB 4HEPG 3MACL 5HHPA 5I6XB 3X3FH 3BZFA 3DO7A 5JO5A 1NBZA 4AQ1B 6CGTA 2EE3A 1J8KA 4OCYL 3CDGA 2AQ3A 4MXQD 2GJ6E 2LV4A 1CBVH 4QXUL 3FQWA 4D0DA 1YECH 1NSNL 3NAAL 4TTDD 1H9VA 5FO7B 5JW5B 1I1AC 4L29A 3QO0B 2IC2A 4QTHB 3T0AA 3IETB 5HHME 5H37G 3QHTC 3G08B 1MJUL 1YQVH 2ADFH 4IOFC 4PRIE 5CEXA 2WUBL 2BVQA 1Q8MA 4M62L 2LAAA 3D25A 1OQOA 1U3YA 2J5LB 5INDA 4WWKB 4PRHD 2AAVA 4IRSB 4PJCF 5HHXL 2F19H 3FO1A 4Y16B 5DJXA 3HE6B 1JL8A 1QHOA 3VH8A 2P8PB 2V5TA 4EUPB 3QDMD 4KTEH 1CDHA 1SEQH 1UJ3A 4DZBA 2Y7QA 1UM5H 3TM6A 1CLOH 3DYPA 3PWVB 4WI2A 3ARFA 3ARFC 5EO1B 3BRGC 2AJ3A 4LSRL 3NBNA 2NX5A 1TQBC 5T5NG 1X5LA 3PL6A 3AS3A 1KJ3H 1II4E 3QXUA 2B7DT 3F65A 5I8OL 5T3ZD 1DQJB 4HWZB 1NJ9A 3KLAA 5TE4L 1I9JL 5B3JF 5KSVB 1Q9LA 5D71H 4Z7OF 2NNAA 3K3QA 1JZ8A 4EN3A 4OZGB 2IPKB 2PYFA 3IFOB 2XXCB 3KPSD 3O4OB 2R1WA 4H25A 3N1GC 1P84K 1Z9LA 4POZC 5C0JB 4IMKA 4BFIA 4MQ7B 4YDLC 4BFGA 1X4YA 3FCTB 3VU2A 3WHXA 5DEGA 1N5AA 2DB8A 4YEEA 5D2LF 5SX4H 1MJ8H 5C0RH 5IMLA 4OM1L 4BH8A 4HUKB 4XP9L 4L4VD 4FZEL 4RIRB 2MKWA 4NWTH 1UYWL 5JO5B 1NBZB 4YAQA 3DO7B 3RPKA 3OG6B 4FFWC 5ADOH 3ARSA 4D0DB 4GJTB 4XZUA 1JYXA 5IR1A 3VWJB 1Z9SA 2DLEA 3KYKH 4OGXL 5DWUL 5E2UL 3HZYA 3V8OA 3FQNB 2I26N 3KYMA 4J23A 4QY8A 5EC1A 2O93L 1CLCA 1Q94B 4ONFH 4KPHL 1P5UA 1EEZA 4ELMF 1S7QA 3D25B 3K0WA 5INDB 1QSFD 3G04A 3L3IB 3FO1B 1WBYB 3WIIH 5DJXB 4E0RA 3G9VA 3VH8B 1AKJA 5IUSA 1DLFH 4KU1A 2CGRL 2NR6C 5TF1L 4P46C 4LLUB 2ZZUT 4O2EA 2HT2D 2AABL 3I84A 2AJ3B 5JW4Q 2YR3A 4Z7VF 4UU9B 4X7DC 3PL6B 4KTEL 4YHIA 1CICA 2W60A 3V95A 4OZFG 5LG1A 2HAZA 5DS8B 1NJ9B 1F3JB 1OLLA 1G9EA 1S78C 1Q9LB 1RUPL 2G60L 3MJGX 2NNAB 3DETC 1U6AL 2IPUK 2CKBA 5C0EA 4KHXL 2WK2A 4U31A 4I0PA 1KEGL 2NY1B 2VMFA 3N1MC 1CD0A 3VGEA 2DQEH 5CINL 2R1WB 4BQ6A 5D7JD 4AEIH 5ICYB 1WSST 4AJ0A 4IBLT 5FGBC 1G9NH 2PR4H 2B2XH 3WHXB 1BWMA 4X4ZA 1N5YL 2HRPL 1GGYA 2NY4C 5SWSA 5JOPE 4POUB 3NCYS 1JNLH 2R0KH 5MENA 1IVLA 3NTCH 3GGWA 4YAQB 4PRPD 3QDHA 2AP2A 4OD2A 4DKEL 4RMTA 2C3VA 3QHFH 5IR1B 1CIDA 4NKMA 3STLB 3FKUS 1RFDL 1V7MH 1ZTXL 2P5EA 3A0OA 3HZYB 4HCRA 5AAMA 1TXKA 4ELKA 3H3PL 4QY8B 3RWGB 1UM4H 2HWZL 5EC1B 4N1EA 4OZIF 2UV3A 4LF3B 3DWTA 5GRYA 1OP9A 4PP1C 4P2QA 3KYKL 2MCG1 4Y1AB 4U6VL 5GGVY 4KH2A 1N8ZA 1NMBH 4JQVC 2FX8L 5F1KC 1S7QB 4E5XA 5JHDA 3ARDA 3ARDC 5E00A 5CJ5A 3UZQA 2NY7L 3OHXB 1Q0XH 2B4CH 4GH7B 3DROA 5FECA 4LU5H 3AY4A 1AGFA 1NQBA 4MJ4A 3WS3A 4L3AA 1SYVA 4TUKL 2NY0B 5JOEA 1HILA 5F1SA 5D72H 3QQ4A 4EDWH 3QCUL 2YA1A 3JWOH 4G6KH 1AKJB 3QI9D 1JNNH 3P9WB 3N1PC 5FHAL 3RBSA 4M43H 1XGTB 2A77H 1EMTH 4O2EB 1WWBX 4JFDE 3ARGD 2I60H 1E27B 3RGHA 1BM3H 3I50H 4N0UB 4NNXA 4YHIB 1MREH 1CICB 4ZG1A 5CSGA 3DV4A 3UTOA 5D5MF 1DBAH 3BAEL 2OLDA 3LIZL 1MCBA 1HINH 1EZVX 2OZ4H 2PXYD 4F8TA 1SJHA 3IDIA 4U1JA 3EAKA 4Z5RB 1PEWA 2CKBB 3VG9C 4I3SH 4I0PB 1N64L 3M1BA 3MUY1 4HFWB 1PLGL 1YNLH 1IAII 1CLZL 4DW2L 1EVUA 1A7NL 3GSXB 2OR9L 1GVIA 3JUZA 4J3WA 5H94B 3UO1L 4C54A 2V2TB 1P69B 4HC1A 3HAEA 1IAOA 4NWUH 3MV9A 2LE9A 5H2BA 5LWYH 4OI9A 2QL1A 2VXQH 3GGWB 2BXYA 4OGAC 4QTIL 4NBYB 2E7MA 2NXYB 4OV6F 3NIFE 4WWKD 1MCCA 2C3VB 1FVCA 4HUXA 1NCDH 4IRSD 1EUTA 4JZJA 5TDNB 4NKMB 4Y4HB 2P5EB 3NA9L 4XMLL 1LO2L 4NO3B 1JK8B 1MLBA 3NFNA 4U1IA 4XNYH 4Y16D 2D0FA 2E7LC 4ELKB 3HE6D 4PJGF 3CX5K 3X12A 3AC0A 4XMKH 3V6ZA 1LEGA 3KPTA 4NO2A 2FSEA 4Y8AA 3CK0H 1RZ7H 4BZYA 4E5XB 3MRDB 3WNLA 3EOTL 3DROB 2AQ1A 2F54B 2QQLH 3C2AL 4Q9BA 5IHBA 1AGFB 5EO9B 3WS3B 2GHWB 3FO2B 5CGTA 1NMBL 1DLHA 3QQ4B 2MCPL 5IVNA 1OAXL 3V5KA 2IANE 3EOAB 1M7DA 5DVOA 4LQFL 4TVPL 3KS0J 5EORL 4YWGH 3MOAL 5TQ0L 3IJYA 2HKHH 2BY1A 5FYJE 1YJDL 4Z77A 1AC6A 1XGYL 4NNXB 1CFQA 4DN3H 4KROB 4KKNA 3Q6GH 5EIVA 3DV4B 1INEH 1PD6A 1WF5A 3FT2A 1OQXA 3CLEH 3IDIB 3C9NB 4M7ZC 1A6TA 2HMID 3RGVC 3RGVA 3ZO0A 3BOVA 1XZ0B 2D7TL 3A6BH 5GS1A 3TIDA 1SEBA 3IXAA 2IGFH 2ADGA 5DJ0A 4PRIB 5I75C 2X1PA 4Y0GA 1CD9B 4CUCA 4N0FA 3VWJD 5I1LA 4GBXC 4YDVB 5AD0A 4H0GA 3KPMA 1CXFA 4RX4D 1ZLWK 4YHOH 1MOEA 2KL6A 5DZOA 4GG8A 1WIPA 3Q5OA 1K9TA 3DYOA 43C9B 2RGSA 1QO3A 4XT1C 2RCSH 5J1SC 3LS5L 2DDQH 1RU9L 3TT1L 3NFNB 1P4IL 4JAMA 4NKDA 4PJBA 4XWGH 3HMXL 3MLUL 3D1MC 1EEUA 2CQVA 2VLME 1EBPA 2FSEB 1F4XL 3BN9D 3CDYA 5F89A 5F7UA 4KQ4H 2KPNA 3MUGA 4NKIH 4R4FL 1PYWA 1W72H 2WW8A 5DJ6A 4GW1A 3VXPA 3PL6D 2A83A 5IBLD 5F6HI 4ODHH 1AJ7H 3IF1A 1NAKL 1N6UA 1G7MA 1MLCA 3TESA 2CDEA 3BDYL 5E95B 4EN3D 2I07A 2NY1D 2YKLH 4WI7A 4C56A 4XP6L 5CEZD 4UNVA 3MJ7A 2DL2A 4EUPG 2ZCLH 2P1YA 3BEVB 1ZLWH 4Z77B 4M6NL 1ZS8B 5I8CB 3L3DA 5IM7B 1PZUB 1L4IA 1YMHB 3O3BA 4JO1H 4NP4H 5DRXA 3QDJE 4I4WA 2JK5B 1Q9KA 4KJPD 1CE1L 5D4QA 3ZSTA 5F7MC 5ID1B 1A7BA 1S9VA 5HDQL 3EIFA 5BOZG 3H6JA 4LSSH 3LH2H 4U0RB 2C1PA 1AXIB 1XGRA 4L8SB 3G5ZA 4LKCA 4Z0XB 4P23C 3CFEA 3O45A 4CVZA 3BD5A 3MLRL 4P9ML 3L5XL 4N90E 3JZ7A 1QSEE 2Z92A 3C6SB 3I6KA 1ACZA 4ETYA 2WUCL 4Y1AD 3RWHB 3TBYA 2ARJQ 1N3NB 4R3SA 2Y4SA 3SDCC 3PP4L 4G9DB 3QUMH 1ZA3A 1PBYA 1T1YA 1QG3A 4PREA 3ROOA 1WFNA 2EEDA 4OF8A 1FDLL 2NY0D 4MGXA 1I75A 1Y6KR 1YY9C 2VABA 3KPRA 1BAFH 1AKJD 2YK1H 4GUPA 3GBNH 1WZ1L 4G8EA 5F89B 4PJCA 1NCTA 3MUGB 1KCVH 2X4RA 2BRRL 1PYWB 4AT6A 4MDJA 1OAKL 5E99L 5DJ6B 3VXPB 3O3EB 4K07A 2A83B 1CICD 3QXDA 3DLQR 5E4IA 3WLWC 2VKWA 3UJIL 5J1TC 3MA9H 2UZYB 4PJ8A 4NKIL 3IF1B 2ZUSA 1G7MB 4FABH 1IT9H 2VWEC 4WO4C 5J6GB 4I0PD 4HXAH 2I07B 1JVKA 1S7TB 4EBQH 4GAJH 2BRQA 3VH8G 3FHQA 1H5BC 3MJ6A 4HLJA 3QSKB 2EECA 3PJSA 3BKMH 3WV0A 4RNRA 5I76B 4RFOL 3RDTB 3QEHA 5ILTL 1OLZA 1P2CA 3MV8A 3OKEA 7FABH 5DRXB 5IVZA 1U2CA 1C12B 2ADIB 1Q9KB 3QQ3A 4I4WB 4JQXA 4P5MB 5DFWH 5SWSD 1ZEAL 3R8BB 3BDBA 5I19L 3O8XA 5DUPL 4FQQA 1JN6A 2R15A 1S9VB 2HN7A 5TFSH 3RQ3A 5HGGS 5K9OA 4UZGA 3BT2L 4PJXE 4RBPK 3KLHD 1A5FH 4FFYL 1NUGA 3DSFL 2NXYD 4XBGA 4FZ8H 4J3VA 1AFVL 3KPOB 4RGOL 3CFEB 2P5ED 4ZAKC 3ARBB 4CVZB 2OP4H 4IEFB 3LHPL 5I16A 4HFUL 4YPGA 1WQVT 3S4SA 5T3XE 1UEMA 3I6KB 4P2QD 1VFMA 5EH1A 3BHBA 3QUZA 3QUZC 1FNHA 1AHWA 1FGNH 3IGAA 3DHMA 5JHDD 1QOKA 3M8OH 4LVOC 1MAML 4HWEH 3PWNB 1T1YB 3ROOB 3CH1B 4JFDB 4FQLH 5FDYA 1F8TH 3F5WB 1GXEA 2BVPA 4OFKA 4K7FB 1SM3H 2VABB 3QEUA 3VW3H 4ELMA 5C08A 1PX3A 4GUPB 4K71C 4G8EB 5DMGC 4PGBA 3ULUF 5M7QA 3UAJC 1RJYB 3RVWD 4MDJB 4ESKA 1HDMA 3MRGA 1BQLL 4H20L 4NQUA 3QXDB 3KR3L 4JO3L 3U2SA 1NEUA 1KJ2L 4LOUC 2J6EH 3VDAA 4RBPH 2DKMA 4TUOA 4X9HA 4OCNC 4FFVD 4KAQH 4Z7VA 4TQEL 2C3GA 1EK3A 1T7YA 2ZSVA 1ZLSL 1LP9F 4YHNA 5DMIH 4PRID 2P45B 9CGTA 3IAGC 5F7DA 1SJEA 3PJSB 2LABA 4RNRB 2JB6A 1JPST 3AS2A 1FVDA 3QP3A 5CKGA 4LK4A 4QXTB 4J3TA 3SKOB 3QEHB 1OF2B 4L3CB 3RWJA 1Z5LB 5EOQH 1UKSA 5IROC 5IVZB 3QQ3B 4G43A 4XP4L 1KCRH 3UEZA 3WXVL 3NABH 1E4JA 1XIWA 1IZKA 3MV9D 4O5LH 3W39A 2YUZA 2CRIA 3E0GA 5K9OB 4LGRB 1BFVL 1QRNA 1ZMYA 2HLFD 3QJFA 1X5HA 4LSDA 1FC1A 2E9BA 4OIBA 3QHZH 2EIZA 1I9RL 1AR2A 5TQ2H 1A6VH 1PFCA 4XVTH 3KHOA 1FP5A 3C6LA 2CUHA 1WITA 3UDWA 5I0DA 3O2VL 4Q97A 3BHBB 2IANB 1AHWB 3IGAB 1XH3B 4MQTB 2A9MH 4OIIL 3JXAA 1BECA 1YPZF 4OZHF 1V8HA 4OZIA 2XY1A 3SDDC 4FRWA 3V79C 1U8PA 2BVPB 1YEKH 4HJ0C 3VFRB 4MB4A 1BZ9B 4DAGL 4ELMB 3MODH 2GUOA 3BH9A 3B2UC 4MWFA 1NGZA 3ARQA 1JHKH 4QXGL 2OQJB 2J8UE 4LSTL 3HNTH 2EDRA 2W65A 3C5JB 1EAPA 2XKSA 2ZUTA 1E4WL 3P9MA 1OTUC 3VGFA 5BZWB 3ZDZE 1T20A 1EHLH 1BD2E 1CL7I 4K23L 1GRWA 3LEVL 3VD3A 4NJAL 1P53A 4Z8FH 4TUOB 2EYRB 1BBDH 2VR5A 4LNVA 4UQ2B 1G7LB 5AG8A 4Z7VB 3MRHB 1NH6A 2ZSVB 4M6MH 3OJDB 3MXVH 2VIRA 4GRWE 4OCXL 4FQ2L 2VDPL 5D5MA 4IRJC 3S88H 5C09E 1BIIB 1X9QA 1FVDB 3TVMC 5DT1L 2APFA 3RJQB 4UQ3A 4J7RA 4G43B 5EN2A 3FHAA 5EBLA 2MMXA 4ZUSA 4RZCA 3HE7A 1WBZA 5I8EB 1CVRA 4OD3L 1TFHA 1QRNB 3CFDA 2Q7NA 4GKSA 1G6RH 1P4BL 1IC5L 2MSPA 5CILH 3GMPB 2G9HB 4G42B 2DM7A 2EIZB 3B4NA 5DD1H 4JB9L 2NY2B 5HI4D 4ODSH 3C6LB 3L6FA 1LO4L 2NYYC 3WXWH 1RHFA 1CQKA 1QRKA 5IGXH 1KG0A 3BSZH 4HKXA 4HUVA 4U3CA 3GMQB 1YUHB 3AAZB 3S3SA 3CVIH 3WMSA 2YHGA 4PJGA 1UB5A 2DQCL 5HY9A 1HQ4A 1U8PB 3O3AA 1S7VA 5ETUA 5F9JB 1JZ6A 3RFZC 3L5HA 3QUYA 1JGEA 4Z0BH 2OL3B 4BQBA 2R1XB 4XRCA 3CUPA 2H2SC 4HV8A 2BCKA 1NGZB 3S6CA 2R4SH 1JCKA 2R1YB 4YJZL 4C56D 5JOPD 5JW4M 5GRXG 1H3VA 4TSCL 1EAPB 3D0VB 4XXCC 3O2DH 3OZ9L 4F3FB 3OKKA 1JHKL 4M8QB 3P9MB 2WBJA 4WV1B 1NAML 1T20B 5DGQA 3RDTD 5T1DH 4X7FC 4YXLH 1I85C 3H9ZA 4Q0XH 4Q6IB 5EU5B 3HI6H 1QNZL 2Z31B 1T5WA 3ULVL 4MS8C 1C7SA 1I8LC 1QSEB 5IB3A 4PJ7F 1QFWL 5D5MB 2BY0A 4Y4KA 3VGAB 1MWAH 1YN7A 2X1OA 4L9LC 1FNSH 3DOSA 4G5ZH 5FKPA 5BVPH 2G5BB 4U1GB 1UCBH 1TJGL 3CFCH 1HIML 1Z3GL 5EBLB 4ZUSB 1QYGL 3P0GB 4GMTL 1RUQL 4MCZB 2FH8A 2N7BA 3HE7B 4CN6A 2EH7L 4GKSB 5HDBF 4AENA 2DI9A 1PG7W 4JFDD 4W4NA 1LP9E 3LZFL 5GIRA 5JLZA 1MFBH 1RHHB 3P40A 4R26H 3KPRD 4KZEL 3KHQA 3CCHA 4HG4J 1KFAL 3ROLB 1A2YA 4AZ8A 1KG0B 3ULSB 4HKXB 4RGMB 4K7PL 4LCYA 4XHQA 4HUVB 3B2VH 4GKZA 4UUJB 4HKZA 1MH5B 4PJGB 1O0VA 4RMUA 1F3DH 1B2WL 5I18L 5HY9B 1R0AH 5CWSA 3GKWH 1KBGL 1S7VB 5FYKU 3V4VH 1BBJA 4PJ8D 3K8KA 1Q72H 3SDYL 3SGDI 3QUYB 4IOSD 3GBMH 4XRCB 3CUPB 2FX9H 1QLEH 1IQDB 5CUSL 1WV7T 2GCYB 2Z35A 4OCWH 1JFQH 5E2WH 3PQYE 1X6LA 1UXSA 5FYLL 1UWGH 1KTDA 2A6IB 4YIQA 3CGTA 2HTKC 2WBJB 5JPMB 3EJZD 5CLTA 2E6QA 5AZEH 1GL4B 1ETZB 3MV8D 4DTGH 3WFEL 1H3UA 3BQUA 4Y5XC 3O8XD 4IRZH 1T1XA 3BP6B 3FB6B 1WJ3A 3IDNA 5IB3B 3EO9L 3O41B 3I02A 3ME0A 1DEDA 5FCUH 1U8NB 3K4DA 3HKFA 4K94H 4Z6AT 2ENSA 1TNNA 2YD1A 5L2KE 2R69L 4F33B 5CMAA 5EZJA 4X6CF 5CJOL 3RWCB 1BFOB 4J6RL 2VNCA 3FO9A 2Q20A 4ZNCD 5AUMA 4QWWD 4UILH 4LASL 4C59B 5BJTA 4F15B 5CGYD 2FWOB 3OKNB 5KBNC 2IAND 2QQNH 3MYZA 4XNXH 4HWBA 2DQFB 2NY6D 4FQPA 4IIQC 4JY6A 1YNKL 1KB5H 3HMWH 5FYJD 1PG7H 2NCMA 3MRIB 2DIBA 5JLZB 1N0LA 5JORB 3RHWK 4KK6C 5FUOH 4L8CB 3PHOA 4K3DL 3CCHB 1A7QL 4BYHA 4CDGC 4RGND 1TLKA 1VESA 1Y18B 2AXFA 3B9AA 1BF2A 3AMLA 4QF1A 3LKNA 2FIKA 2DTML 3DVGA 3LEXA 2WP3T 4HMCA 4WFFE 3PHSA 1MCNA 5CIPA 4YXHL 3WNOA 2R2CA 1KCLA 2AXGA 5ESQA 2ADJA 5I1HL 4K3HA 4M03A 5D2NC 4X80H 2DICA 5D6DC 4H8WH 5C07E 3QA3B 2R56H 3RNKA 1J5OL 3UYRH 4MQSB 3BX7C 4JFHD 3S5LB 1CS6A 1Q9OA 2XT1B 5FA3A 5GRUH 4LLMB 4HDIA 2V5MA 4JVUA 4W4OC 1L7TL 3G5XB 4OF0A 3VGDA 1UEYA 5DHVA 5EIIA 1WK0A 2FIRT 1M7IB 1P7HL 3PWPE 4OLUL 2IMNA 2NTSP 3BRFA 3MCKA 4MJ2A 4XAWH 3TWCL 1RUML 1MRCH 3AB0C 4HK0B 5H37H 1U92B 1XIWD 1IILE 1KNOA 4EZMA 1T1XB 4ZNEE 3IDNB 1OP5K 2AQ2A 2F74A 2YS4A 4KRNA 3V4PH 1QRND 3RA7L 4WNQA 1FSKB 4D0CA 1J11A 2BNQE 1ZANL 1R5WB 2JJSC 3HR6A 4QO1A 3TYFB 1CGSL 5GGTH 5JDJA 2NY2D 4YHML 5IEHA 3PABA 4MDIA 3C6LD 3FO9B 3FRPA 5BJTB 2ERJC 4F57L 5ANME 5LQBL 3MRKB 1OARH 2E27H 3AREC 3QDGA 5F1IB 2ATKB 1FE8H 2J8UB 4KKLC 3GHBL 3VFPB 3RRQA 2OS7A 1FVEA 2CIKA 2BOBA 3BH8A 5IOPA 4MMZC 3HZKA 3PHOB 5IVXE 2DM4A 4WHTB 1BD2B 2R23A 5CP3H 4X4ME 3INUH 1A14H 2DM2A 2AXFB 4JZOB 3PDGA 3WCYA 1E6JL 3ZKND 1BVLA 3LOWA 3HN3A 3RX5A 1Y0LA 3DVGB 3LEXB 5DVLA 1G7HA 2NY3B 4GRWB 3DMMA 3IRPX 4P2OA 5ESQB 5CSZB 2B0SH 2ADJB 3ULUC 1OP5H 2X6MA 5EULV 5C09B 3FZUC 3OJMB 1G1YA 2CMRH 3FQUA 2VDMH 2Z31D 1T1ZB 4N90D 4JHZA 3WFHA 1Q9OB 1QSED 5FA3B 4FXGA 2V2WA 2R0ZH 1ZGLA 4UDUB 4JG0H 5E2TL 2XQYK 1UWXK 4J3OC 4OLEA 3QG7H 2WBKA 4HGWA 4MXWH 4FQXC 1RUKL 1LP9A 3TJEL 4OCRL 3QG6A 5FM5M 3HG1E 1KN4H 1KNOB 1S9WA 3HE7D 4ZOEA 5K9JH 5CZXC 2AVGA 4FQJH 2GK0B 4D0CB 5I1DA 1NKRA 2AJXL 3G6DL 4DGIL 2R4RL 1KENH 4KI1A 2DBLH 5GZOC 25C8L 4LLQA 4F9LC 3MFFA 3TH2T 3PABB 4MDIB 5HYEA 1MQ8A 4ZXBB 2HVKA 4X0KA 5IW1A 1Z0NA 3O11A 5IJVB 4I18A 2KKQA 4JCLA 3KXFA 1AH1A 3S3PA 4CMHB 5EA0L 2VDOL 1D9KB 4HZLA 5D93B 1K5NB 5KAQG 4UDTB 2XA3A 5LGHH 1K4CB 4WCYL 3BH8B 4HQQL 1OAZL 1MHHB 3QUYD 3HZKB 4JPWH 3U9PL 4YXKL 2R23B 4LRIC 4LRIA 5DZNA 1YPZA 3GIVB 1PZ5B 3T2QA 4OZHA 1NANH 5B3NA 5IK3B 3BEWA 2ILLA 4A2MA 5DJ2A 2PW2A 8CGTA 1T21A 4M1GL 2XRAH 5HPMA 4XVUC 2VLLA 1Y0LB 2Q8AH 4XTRC 1GH7A 5A40E 4Y88A 4HX1A 3RWIB 4X4YA 1IAMA 1HXYA 3DMMB 4OM0H 3KDMB 4P2OB 2WBJD 3MLXL 4OGZA 2IFFH 4MJ6B 1I1AB 2XZCH 3TH3T 2YWZA 4OSUH 5C6WH 1IGFH 2Y72A 1JWMA 2ZP0T 3RNQA 5T3ZH 1LDSA 2YPVH 3WFHB 5JOFA 3O6LH 4Y19E 1RIHH 2V2WB 4FXGB 5T3XD 1IL1A 5ISZE 2QSCH 1ZGLB 1Q0YL 1KC5L 3NZHH 3E1F1 5F7EH 4U4BA 4HGWB 1K3IA 4PJ9A 3WD5H 3NCJH 4TVPE 3ARTA 2AKRA 3K1DA 2ICCA 1LP9B 4JY4A 4KJWD 5IHZB 1NGXB 3CFJA 4HLZG 3QG6B 1S9XA 1S9WB 4HUUA 3ZE0F 4GG6F 2D0HA 2XI9A 5C2BH 1JI1A 4HZAA 1AD0B 1VEPA 2SEBA 2P44B 4UT9H 3FO0L 3MLZH 1T83A 4LLQB 3F58H 3STZA 4F8QA 2D7QA 1YEGL 5D7IF 2FD6H 4X0KB 1DVFC 3V6FA 3UMTA 4WTWA 4NQCE 3QEGH 1B0GA 2X4UB 3VCLA 3W0WA 5KJRH 5ICZB 2XQBL 1CLYL 3DUSA 1I3GL 3PQYB 2VXSH 4JHBA 4QYOB 4WY7L 3EO1A 2EC9T 5C92A 2P49B 1FZKA 4MMXC 3DTXA 1NCBH 3WFZA 3PWPA 3RKPA 1IC1A 1OGAA 2PW1B 2Y6SC 1EXUA 1KEMH 2G75B 4OZHB 3SE4A 2YSSB 1A3QA 3BEWB 1D6VH 2PW2B 4PLJD 4XPFH 4K3EL 5HPMB 5A2JH 4MX7B 2AGJL 5I9QC 4ZUWA 2DQJL 3GHEH 5F9OH 1ZHLA 2QBWA 1SJXA 3FQXB 5HHQB 1RIUH 4O4YH 2FNBA 2QEJA 5L2KB 4FNLH 4DCQB 4YC2C 5HJ3A 3WE6A 4PTUA 5IMOA 1LO0H 2K7PA 4MA8H 5JOFB 3K2UH 3WFBH 3BESR 4NQEE 4B7LA 1F6LL 1ORQB 2B1AL 3VI3E 4MAYA 4MAYC 1KIPA 2Q7YA 1TCRB 5ACMA 5IF0A 2ZCKH 4WTZG 4PJ9B 2EICA 5MP6H 1RIHL 4NN7C 2AJYL 5CJXC 4ACPA 1G0DA 5CJXA 3L5JA 1DBBL 3REWA 4K2UH 4DUVA 1L7IH 4P46B 1S9XB 1I3RA 1K4DA 2JLLA 1VADA 1FL3B 4X4MA 4UNTA 5IJKA 4NNPH 1C8PA 3RKDC 3HC3L 1J0KA 2Q76A 2WIIA 4JO4L 4M7KH 2YXMA 2UWEF 4QRRA 5TDOA 5JNYA 2BSRB 1KTRL 4FFZH 5SWZA 3V6FB 1NC2A 1B0GB 2FH6A 5E6YA 1C5BH 3VCLB 1RZFH 1KOAA 5ID0A 3V5DB 5AAWA 1T03H 3QAZC 1P1ZA 3DUSB 4KGLA 3VXNA 4MAUL 1G7JA 1URLA 1P4LA 4G6ML 4KUZL 2VWEE 1T66C 4GAFB 3DTXB 5C09D 5C9KA 2F15A 5DVMA 5EZIL 3LRHA 3PWPB 3OAYK 1ES0A 5J6HA 1T2QL 1UWEH 1W0WA 2AJZB 3SDXF 4ZQKB 4R4ND 3ZTJG 3U7YH 4QHKI 2BNRA 1E4KA 4PJ5A 1YEFH 4ZPVB 4HT1H 2BNQB 2VZTA 4L1HA 3O0RH 3PHQA 1D6EA 4OGYL 2FX7H 3P11H 4V1DA 5HJ3B 1O5DT 1BP3B 4PGCB 1S8DA 4XVJL 3O4LE 2BSTA 3Q1SL 3S5LG 3BKJL 4S2SB 3GFUA 5JUEH 3TA3C 2UZIL 4MA8L 1X5IA 2KBGA 4NO5B 4LHJB 2X7LA 4KK9D 1PY9A 4HUNB 4ZXBD 3UJTH 4KMTL 4XCCL 3BIAX 4S1DC 1G9NC 4K8RH 3DVNA 3QXTA 5IVXB 5GJTH 1VADB 3PGFH 3BKCL 5D1XC 4X6CA 1BZQK 2Q76B 3P77A 2ORBL 3ZSSA 5GGVH 3IDYC 1T4KA 1C5CH 4LLDB 5FO9A 2IALA 4MJIE 4NNPL 5TDOB 5JNYB 4MA7L 4JFXA 1EA9C 3C8DA 1AQKL 5K9KA 3BE1L 5MEOA 2X4OA 5ID0B 3AUVA 3EBAA 5GGSA 3JWNC 4EUPH 4Y19A 1NCCL 2W9EH 3DMMD 1JYVA 4P2OD 1G7JB 1C5BL 5LCVH 4S1RL 1FIGH 3LSOB 3E2HC 3SO5A 3J8F7 5I1KH 3SKJH 1XF4B 3HRZB 2QQKL 5I1IH 1JGUL 2FLBT 1W0WB 5I8KL 3F8UB 1C16A 3HG1B 3M17A 3JWOC 3U7WL 4NN6C 3V0WH 1IC7H 4H5SA 4JPKL 1JPFA 3VFSB 3EJYD 1JZ7A 1PG7X 3C5SB 4EDXA 2VDQH 3NACH 1J1XH 2M1KA 1M7XA 4HHAA 5EWIH 1FL5B 3A67H 4V1DB 2NTFA 5F3HA 1KF9B 2VAAA 1FZOB 3I6GB 4KDTA 3VXRA 1S7XA 4G6AD 5IFJB 4QRUA 1R5VA 4ZTPH 2OZ4A 5CEYA 1S8DB 2WINA 3HNSL 4JY5H 4WFGD 2X40A 2V5YA 4EI6A 1B4JH 1U93A 3T65A 1FN4B 5KVGH 5DD3H 3T1WA 3OWEA 4KI5C 4OBRA 3HC4H 1MUJA 3KXFD 4KDVA 1DSFL 5I30L 4XMPH 5IW6A 3MA7A 4NM4L 3Q5TA 3TYGL 1S3KH 3WIHH 4X6CB 4MLIA 4YBHA 4CVUA 3PQYD 3P77B 4K8RL 4YO0B 2B39A 1T4KB 5HGBA 4JG1L 2IALB 4GLRH 3P73A 1MF2L 1UZ6F 2GFBB 1DBJL 4JM2A 4Y5YC 4YK4B 4AIZA 4ETQB 4JKPL 4JQIL 5MEOB 3TZVC 5JIPA 5I1GL 3V6OA 4AH2A 2BVTA 3FRPG 3L3KA 1A21A 4Y19B 4ODWB 1JHTA 3MZGB 1DDHA 3K8MA 4AEHH 1AE6L 2NPLX 1FH5H 3H7LA 3F6IA 1PKOA 2GYSA 3IXTA 5GS2D 3I9GL 1WAAF 2W9EL 2DMBA 4X5XA 3VXSA 3PWUB 3FRUB 4R90H 5J13C 2ZKHH 4PJIF 1FIGL 2WV3A 4LSPL 5KN5A 1C16B 3U4EA 4X83A 5E1HB 2E6JA 1A8JH 5HI5C 1JPFB 4RWHA 2LVCA 1IQWH 5GSRA 4WEBH 5CEZH 2Z8RA 1U8KA 4PJ9D 2VDLL 3QQ9D 3VE0A 4M48L 2XOTA 2MQ3A 3TBWB 4HHAB 4LCWA 1CCZA 3NIDF 2Z91A 2NTFB 5F3HB 4JDTH 2VAAB 1LDPH 5E8DL 1S7XB 3D69B 4PB9H 1R5VB 4NQCB 3WIFA 1IAIL 2CJUH 1GHFH 4QKXB 5E8EA 4EI6B 1U93B 4O51A 5TE6L 1REIA 5T1LA 1RJLA 5JHLH 5DRNB 5AYQA 1I1FA 3QPXH 1D5MA 3UTPE 5FOBB 2CDFA 4PG2A 1DFBH 2E8ZA 2BVEA 1JF1B 4JHWH 2N1KA 5JXEC 2QQQA 3ZDYF 3W0WD 5IW6B 3MA7B 3VXUE 4RWYH 2VISB 4HWUA 3UPCA 4LSUL 4A2LA 3T2NH 1FAKT 2G2RB 4JRXE 3PP3K 3WKML 1I1CA 5MI0C 1I1YA 4PJFF 1R3KA 5HGBB 1IGML 1U0QA 4RQQB 4UB0L 4JM2B 3PWPD 1OGAD 2APBA 1MEXH 1BGXL 1WBXA 4HPOL 5D7SL 1ACYL 1M71B 1IZJA 2CK0H 1WCBB 4AH2B 1WZMA 3G5YB 3EOYG 1JHTB 1HE7A 5FGRA 1D5XA 2FBJL 5C0NC 1T89C 3P30L 4QHUA 1EV2E 5KS9F 3X14B 2PTTB 2FATH 3MLVH 4HAGA 3C5ZC 3TF7C 2HJKA 1G7PB 3NMEA 2GAZB 1UJTA 1FZMB 4GRMB 4JLRA 3SDCB 2DLFL 2CKBH 2GIYA 4YPJA 3TNMA 1EO8H 5GSRB 3IJHA 4GAGL 4JVPA 3RUGE 5C0AA 3WLBA 3PWJA 1OWWA 3BD3A 2D7NA 4KHTH 2Z91B 1TIUA 5BO1L 4YGVA 2ZPKH 1N7MH 3PP3H 4MSWB 3MRJA 5SWQA 4H26A 1CE6B 3EYQC 3WIFB 1ZOXA 1WT5C 2FJHA 1IM3A 6FABH 2IAMA 1JRHI 1YEJL 3WNPA 1BMGA 5LXGL 2C3WA 1XCQB 4N8CH 1I1FB 1ERNA 4TNVF 1IARB 1D5MB 3ULVE 4MNQE 2EKSA 3S37H 3QUXA 2HH0L 1ZVSA 4GG6A 1U8MA 1XFPA 3UYPA 1MFEH 2CDFB 1I9EA 1IKNC 1ZA6A 4CW1A 2A6KA 1BFTA 2OR8A 4HCRH 4ALAL 43CAA 3ALWA 4RFEA 1MNUH 4JJ5B 2CKNA 1H5BB 4E41A 15C8L 5D7IA 5BV7L 5JQ6H 1UVQA 3MV7A 3ZE2F 2L4OA 3KJ6H 4OD1H 5DD5H 1R3KB 2XG5A 1CFBA 1HSAB 5MEQA 1OB1A 3QUMA 4HPYH 1RZIB 3FQRA 4LBEA 2R2EA 4YDIH 1JGVH 1YEEH 5SV4A 3O2WH 1MVUA 4DK6A 5DJDB 1AGCB 2CXGA 2FLRT 1G7IA 3EGSA 3HG1D 3QH3B 3FOMA 1MIML 2J8OA 3QEQE 5HPOA 2CO6B 1BIHA 1CGVA 4PJ5D 4YHKH 1KJ2A 2MJWA 4OCSL 5FKAB 1MCOH 4ZAKB 3O4LB 4K9EH 4GW5B 5BQ7A 2JE8A 5JR1H 4HIEA 4JGMA 2BP3A 4V1DD 4XPGL 5FM4A 3DX7B 3RVTC 1OM3H 4KRMB 2HJKB 2N4IA 1JIBA 1SBBA 4JLRB 4ODVL 1NCWL 1R3IH 2BNUB 3IFLL 3TLRA 3MLVL 4Z9KB 1OP3K 4F7CA 4N8VA 4ODXB 1N6QL 4QEGA 1I7RA 4NUJA 3UZVB 4S1QH 2DQGH 4M7JL 3PIQB 4YGVB 1IGIH 1EO8L 4HW6A 5FYLE 1IBGH 2PETA 3RHWF 2XA8H 4Z7QE 3MJ9L 5C6TL 4HC1H 2IAMB 1RURH 3MGTB 3UJJH 2CSPA 4B50A 4JFZH 1XF5A 1L9NA 4LGPB 1P7QA 1U8LA 1U8MB 2R0WH 3GM0A 3RU8L 4ZFOL 5FHBH 4NBXB 1KT2B 1LVEA 4LLWA 4LDEB 3JWDH 4PJHF 3WDIA 2BSED 2OBGA 4RFEB 4PYHA 2DBJA 5T5NF 1A6ZA 1KB9J 1AXTH 4LCUA 5E5RB 4Y19D 4YQXH 3SQOL 1UVQB 3I3DA 2ZNWA 2DD8H 4R96A 3KGRA 4APQC 4P3DA 3BKYH 3VFMA 1MNUL 2G5RA 5MEQB 4CDHA 1Y6NR 4PTTA 4X6DF 1A3RL 2A6DA 4LQ1A 4RAVA 2R2EB 1CFSB 4TVPD 3KJ6L 4PV8A 1MVUB 4RISL 3W2DL 5DK2A 3DX6A 4I3RH 1OP3H 2CUIA 1JGLL 5F1OB 3ZDXF 3JBG7 4ERSH 5FO8A 5BMFL 2DWEB 5EZLA 5D7LA 1NGPL 1IKFL 3VRLF 1KJ2B 1CQYA 4DZ8A 3BIKB 1G0YR 2XKUA 1N4XL 4ZSOE 5J3HD 1F90L 2MPAH 2FO4A 3A6CL 5F1NA 1K2DA 2J6EA 4OLYH 3U30B 5LGJA 2BDNL 4NQCD 2VXUH 2DS4A 1V05A 1INDL 2EH8L 2FHBA 3TBVB 3OXSB 2WNGA 3V6BR 1K8IA 4XWOD 3S3JA 3SDDB 2HT3C 4F7CB 4K3JH 4XVSL 4XI5C 4CVWA 4NUJB 2ZWLT 2FJGA 2VSCA 2JCCE 2BVYA 3I3EA 2AJSL 5E2VL 4N0CC 4QNPF 1BOGA 5DRWA 3WJJC 3L3HA 4JGJA 2APWA 1OTSC 1UACL 1MY7A 2VZSA 1IRAY 1XGUA 1HQRB 3UTSE 1X44A 1ZT4A 4MA3B 5FCSH 4BSWB 2XFXA 35C8H 3IDJA 4HXBH 1MFAH 1CT8A 3CFIC 1TQCB 1FLTX 4JM2D 3RIAK 1AXSA 5DUBB 2AK4E 1NC4B 4Z7WF 2O61A 1MRDH 3NGBB 2D03L 4F7MA 3OKDA 3HR5A 3BGMB 4L4TE 4XNQB 1W8OA 4NRXB 4LCUB 1H3GA 2V17H 5IQ7L 2QHRL 3RVXD 4WFEE 2W92A 5AWNL 3VFMB 4BQ9A 2YPKA 1CI5A 4JGUA 4NC1E 2P8MA 1CU4L 4ONGL 1KJVA 2QHLA 3DGCR 4PV8B 5DK2B 3DX6B 5IT2H 3OXRA 5FO8B 5C70A 5EZLB 1HKLL 4UTAL 4MNHA 4ZUTB 1OOAA 4IMLA 3JUYA 2AV1B 1J0HA 3VWKC 3MXWH 5E4EC 3MNZB 2EDBA 4LCWD 4P5TC 1QFOA 1VFAB 4MNQA 4OZ4A 2IWGA 3SJVA 3MROB 2VR4A 5HHOA 1RZJL 4JFEA 5LGJB 4WGWB 1AO7E 1RIVH 4JHAH 3T4AB 4NQSB 4PUBH 2DIJA 2NXZC 3GMNA 4J4PA 3VXUB 1K8IB 4AEFA 1ORSA 4W6WB 5CJ8A 3GKZA 4R7DA 4AIXA 4JRXB 5KSAC 1JZ2A 2FJGB 3L5WA 4GKOA 3T0EA 3X3GH 1H3PL 5LAXB 3ZYOA 1BOGB 3IDMB 5DRWB 4MNGA 3FONB 4B5EA 2PO6A 4PJDF 3LS4H 5DR5L 2EZ0C 4PJAE 2OJZL 3DXAA 2XFXB 3IDJB 3IFNL 5GRVL 5T1MA 3LD8C 2JB5H 1DEEA 2XWTA 3QCTL 4NM8H 4UAOB 2YMXH 5GJSL 1ADQL 3L9RA 1V3MA 1WTGT 3B6SA 2J8HA 3AFLA 3OKDB 4NRZA 3O81A 4R9HA 3QXWA 1E28A 4YBLC 2OI9B 4TN9A 4JN2A 1R3HB 3LN5A 2FGZA 3T3PF 1JPTL 4Y7MA 4JEGB 4NOBA 4ZAKD 2R2BB 3O4LD 1FLRL 4CKVX 1NDMA 2UUDH 2NQCA 3RUGB 1A3LL 2P8MB 4J3SA 2H8PB 5IG7A 3EYVA 3CPLA 5BCAA 3ESUF 1E4XH 3GIZH 3P4MA 4KY1L 3OXRB 5D8JL 2WWKT 3U48A 3K4ZA 1VGEL 1E6OL 1BJ1J 2AK1H 4MNHB 5IFHH 3D39E 4EXPX 1NAMB 4IMLB 5C0DB 1CL7L 1T22B 1QLRB 4U2ZA 3VXME 1DQLH 4PJIA 5DJCA 1AGEA 1A1NA 2DQDL 4WUKH 1EBAA 2OXHA 5B39A 3W5MA 1NFKA 1S7SB 1DE4A 3SO3C 4MNQB 4OZ4B 1T0NB 2W38A 4X5WA 4ZOCA 5DMGD 4RMVA 5HHOB 4J1UA 3MBXH 1JMZA 3UTZA 3QUKA 2IAMD 3GMNB 4WW1A 1T80A 1ORSB 1HCVA 3JV6A 4R7DB 2YBRB 3QUXD 4JFFA 4YDKL 1MWAA 4N0YL 4NBZB 4PBWD 3CXHK 4UIMA 1F4YH 3T0EB 2C4FU 3SCMC 4MJ5A 1WFOA 5BRZE 4J12A 2OTWB 1NMCB 5HYQB 4LNRA 1G9ML 2J4WH 3DXAB 5L6YH 3PUCA 3EHBD 4HWNA 3RVUD 3DUHA 5F6HJ 3WO3B 5T1MB 5DJZA 1MY5A 1MFCH 5KVDL 5FYJH 4OV5B 1UH3A 1QD0A 4XNZB 4IDJL 1VDGA 2VN7A 4PJFA 1S5HB 4NRZB 1S7WA 4QNPE 3PGDA 5HYJA 1G7QA 3MO1B 5DLML 1A0QH 4JN2B 4NM8L 3LN5B 1CK0H 3VA2C 1GGCH 1PKQA 2LTQC 3L1OL 4HEME 5DD6A 1JMXA 1ZKAA 1CGXA 1RPQA 1SYSA 4NKOA 4HUWB 1GYAA 1TTFA 5D1ZA 5F8QC 3MCG1 2XTJE 1EIBA 2JCCA 4DGYL 4XPBL 1NL0H 4BSVA 5CJQH 1F4WH 3Q5YA 4AQOA 1JTOA 2H26A 3UTSA 4PB0H