4KY1H

Humanized hp1/2 fab
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
220
structure length
220
Chain Sequence
VQLVQSGAEVKKPGATVKISCKSSGYNIKDVYMHWVQQAPGKGLEWMGRIDPASGDTKYDPKFQVRVTITADTSTDTAYMELSSLRSEDTAVYYCATGMWVSTGYALDFWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN IGG1 FAB, LIGHT CHAIN
publication title Antibody humanization by redesign of complementarity-determining region residues proximate to the acceptor framework.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 37
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2013-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ky1H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ky1H01
2UWEA 5MEND 2J7LA 5IF0A 5D7SL 3VRIB 3QEUB 5TE7H 4LDOB 5B8CA 3WN5B 5FO8B 1FZJA 3QUXD 5GGUB 3GSVA 1JHTB 3QCVH 4RGND 5LG1A 4Y7MA 5GSVB 4BH7B 3BXNA 4KUZL 2BOBA 2NCMA 1CGXA 5DJ6A 5ILTH 4IDJL 3Q1SH 3CFIC 3HZKA 2KKQA 1U58A 3BRGC 2K7QA 5E8OB 3Q2CA 1BD2E 5EFIB 2FD6L 2EDLA 1OAKH 5T5FL 1CXEA 1I9JH 2BY0A 4HV8B 2J4WL 3MREB 3HC4L 5FB8A 2CRMA 3MRPA 3W82A 2ICCA 4MNGA 4DGIL 4LCUA 3C6SB 1RIVL 5H2BA 1K6QL 3KPSB 5MEQB 1KEGH 1A6VH 5ID0B 1WAAA 4P5KA 3DHMA 1OAQH 5EIVA 3SKNB 3TO4B 3B5GA 4K8RH 3QAZC 4F3FB 1CE1L 4MXWL 3NACH 4QXUL 1SVZA 1G7LB 5E8DH 1NMCC 1ZWIA 1IGCH 4PRHE 4DVBA 5KS9F 2FIKA 3O8XC 1HHHA 4ZFZA 4PLNC 1T21A 3J8F7 1DUYA 2UWEE 4MA1B 5HGBA 2JELL 4CN1A 2CGRL 1AC6A 2OI9C 3F12B 3H2WA 4JO3L 1LE9B 3VFVB 1RZFL 2P5EB 2Z92B 1U9KA 4IOFC 4WRLA 5C7XH 3BEVA 1RUMH 4W6WB 1S7WB 3DVGB 5E00A 3ZE1F 2NY3C 1D6VL 4MHHI 3BD5A 3RTQD 1M7XA 1FVDA 2CR3A 1G9MH 3L5JA 4GUPB 3UJTH 2J5LB 5FUOH 1CGYA 4D3CL 1HI6A 4UQ2A 2UYLA 4JPIA 1YPZF 1FLRH 1MI5D 4OI8A 5HHVL 2BSSB 3P4OA 4JJ5B 1P5UA 2NNAA 4UTBH 1HZHH 4NO2A 5EBWA 3VDAA 5C0NC 1KEML 4KAQH 4IIQB 5I1AB 1XR9A 1V7ML 4Z78A 2XXCB 2X4NA 1UC6A 5I19H 5CHNA 5BS0A 3KXFB 4J6RL 3VXQB 3KLSA 5DRXB 1D7FA 4H8WH 1S5IH 1LO4H 4Z7QE 3OF6D 4MJ2A 2ICWA 3MX0A 4FTVE 2W0PA 2PNDA 3ILQC 3J7HA 3KPQB 2CUMA 2NY7L 1TVBB 3I6GB 2Z91B 4KKCD 3WLBA 4QHKI 1JPTH 4N5UA 1KENH 2IANB 2YD3A 3EFDH 4WI3A 4G7YH 4NJ9L 4HWNA 4BFGA 2QR0B 2OL3L 4MD5B 5ICZB 1RZJC 1J0JA 4P4KA 1MCFA 3H3KA 2VISB 5D96B 4X4MA 1IAKB 3T0ED 4DGVH 4X6EA 4NOFA 3LHPH 1AIFB 5FYLH 3MR9A 1JGDB 3D0LB 4DFHA 4FABH 3WXWL 2J6EH 5ADPL 4QRSA 4HIIA 3ROOB 4D9LH 4QRUA 4XXCC 5D4QA 1RI8A 5HDQH 2Z9TA 3FQXB 4ZPTB 1OW0A 1MPAH 2DTML 4B53A 1I9IH 3DVNA 2BVOA 4JHAH 1Y0LA 3QFDA 1I8MB 2HT2D 1KIUA 4M9PA 3STLB 3C08L 4CNIB 2DD8H 3MGTA 4YHML 1V05A 5BS0E 3IDMA 3TA3A 1IKFH 3RY6C 3K4AA 4MA8L 4PRDB 4OZFG 4PJDF 3MV9A 1HHGB 5TJWK 4FZ8L 1KELL 3VFWA 1JNHA 4MZ3A 3QDGA 1INEL 2BNQB 1XF3B 1NGXA 3NCMA 4G6KL 4HIEB 4N9GB 4PY8I 2W07A 4O9HH 3JTSA 2HFFA 4GW5A 5IB3A 4JZNA 5MERA 43C9B 5IKCA 3GHEL 3OAYH 4H0GA 4NT6A 3ULUH 3UDWA 3BZFA 4FQCH 4XI5C 3BOVA 5HYSA 1GC1H 1UZ6E 2B1AL 2WIIA 5J89A 4QY8B 1J12A 3C5SB 4GRWF 1SHMA 5MP6H 4R97B 2XWTB 4HGKC 1DANT 3O8XA 1YEFH 4JFOA 3PDGA 4YHIA 4R6UA 1EA9C 4HKZB 5C0FA 4PY7A 5JOFA 4X6DA 5I6XB 2VKWA 2R0ZH 4Q2ZB 1SY6L 1T1WA 3MCG1 3ARWA 2VR4A 4P2YA 3H42H 4FQQA 1A6AB 3QG7L 4XT1C 3HAEA 1UM5H 4RQQA 4LCCC 3T2NH 3TFKC 2XTLA 2A6IB 1ZLSH 4AEEA 3KYOB 4JPWL 1NFIB 5C0BD 1NANI 1RJLB 1RIUL 2BNRA 3QIUC 1JPGB 4PLJC 4PRHB 1EIBA 3TNNB 2PXYD 4NNPH 2R1XB 1SM3L 2UZIH 5M7QA 5L0QC 4NWTL 2W0KA 4F7TA 5D6DA 3H3PH 3S35L 1OAXH 1TFHA 3OXSB 4KI1A 2DWDB 2VJXA 3OKMA 4BUHA 1FORH 1I75A 3QNZB 5FM8A 1NGPH 5IW1A 1MWAL 1L0XA 3LKPA 1A14L 1ORQA 2DLFH 4EN3D 3ELAT 4G9FA 1A4JB 1U8KB 1U8QA 4JO1H 3NGBC 2LE9A 4GH7B 4TOYL 2WNGA 4OD3H 2GW5A 3NIDF 5DFTA 3WDIA 1DJSA 1BWMA 1FVCB 4QXTB 4WO4B 1FBIL 4IS6B 2F9BT 5DJ2A 4KQ3L 4QHKJ 3A6BH 1T1YA 5B39B 3T2OA 1DZBA 5DVLA 1U6AL 5FCUL 4G80A 4PG9B 5F6IB 3WXVH 1PAMA 3IKKA 2P8PA 4YHLH 4G5ZL 2KQNA 4GMSL 3MUY1 4L29A 4PJ7A 4GAYA 2RFXB 1ES0A 5IMOA 5IIEA 2BNRE 3BP7B 5EZOH 3O6LH 4M7ZC 1XGPB 3FQWA 5FKPA 4N5EC 1BFVH 1RIHH 2DM2A 4XXCA 2EYSA 4U6YB 4FTVB 4OGZA 4RFNC 1JGVH 2FCBA 4RNRA 5CJBA 1N5YL 3P3YA 5D7KE 3UC0H 3R1GH 4O2EB 4P2OA 1BJ1J 4TSCH 2JCCE 5KSAC 4PFEA 3P40A 3STZB 4Z8FH 4LHUG 4LHQB 1UQSA 3BEVB 4KH2A 4TPRH 2BSRA 2H26A 4J3TA 3OAUH 5T3XL 4G9FE 2ATKA 2YMXL 5EUKA 4TQEL 1E4WL 3WNNA 3BUYB 3B4NA 1CU4H 5JR1H 1KXVC 4P9MH 2EDQA 5EC1A 3VJ6A 1G7QB 4QHMA 1T5WB 2PCPB 3MOAL 4Q6YA 4JFDA 5E2WL 4NM8H 4XNZB 1G1YA 1IE5A 2PO6C 2YK1H 1K2DA 3IDXH 2IJ0C 3BZEA 2ATPA 5EORH 2CUHA 2PTVA 4LAQL 5E94A 1JUFA 3TJHC 1CG9A 4JQXA 5LWYH 1ZAGA 2FO4A 4NHCL 2VL5A 3PL6C 3GMRB 3N85L 4K7PL 3V6BR 1OARH 3T0EB 1N64L 2VWEC 3IU4H 4PJ7E 1A3QA 1FPTL 4I18C 1P7QA 2JE8A 4NM4H 4G8IA 4ZYKA 2Q76A 3MOQA 1GHFL 1PGRB 3U4EA 2B4CL 4UMGA 4YNYB 3LOWA 2OR7A 4OGYL 3SCMD 2EKSA 2EH7H 4GJTB 3UJJH 2JIXA 3WLWD 3U0PA 3SDXF 4MHHG 5EU3B 1P1ZB 3MXVL 1KCRL 4HMCA 5F9OL 3MC0A 4XCEA 4OIIH 1UWEH 1OT1A 2ADGB 4LCCA 2YD8A 4HT1L 4JANB 1RZ8A 5D7JD 2PUQT 1KBGH 2XQYG 4HIJA 3LKRA 1A1NA 3CJJA 5F72S 1UZ8B 2JB5H 1VHPA 2YPLD 4LKCA 1DN0A 4R8WL 1NLDH 2GTZB 4ZTPL 4JFDE 1VESA 3DX8B 3C60D 2DM4A 3N9GL 2EDNA 4UV4L 3V4UL 1FZMB 3PHOB 3FN9A 5F9DC 1R3KB 3ZDXF 2ZOLA 3D2UA 1QPPA 3GJFH 4KXZH 4G7VL 4QYOA 1UYWH 4HS3B 1WZ1H 5IV2B 4QXWA 2QSCH 4RGOL 3IDMB 4POZC 1F00I 2ZCLH 1O7SA 3CXHK 2RR3A 5GGVH 1KJMA 4IRSC 5C0IB 2X70B 1E4XL 5HXMA 4KY1H 3QRGL 6CGTA 2VLRE 4PTTA 3SBWA 2V9QA 4GKZA 3SE8H 5J13C 1UM6H 3MLSH 3ARDC 1QRND 1QBML 1XF2B 2DQTL 3VWKD 1LK2A 3JTSB 5IB4A 2KDGA 5MERB 4S2SB 1OCWH 3RY5A 3RVUD 5GSRB 1OAUL 4HMEA 2BSTA 4I0CC 2O5XH 2C5DC 4ESKA 1TVHA 4ONFH 4CADA 3QAZB 5HYSB 5JW4M 4PJHF 1U8HB 4YHOH 3RWDA 2YA0A 5C0BB 1NMCB 4J23A 3VH8A 3L5IA 5KJRL 1J1OL 1KT2B 2PXYB 3O8XB 4HF5L 5H37H 4JFOB 1BPVA 4NRXA 1WFOA 4LLWB 1XR8A 3F6LA 4PR5A 2ZNXA 3GKWH 5I1LB 4HH9B 4YBQC 5CZXD 4AT6A 5CAYB 3MTRA 3QNXB 2QBWA 1RJCA 1B2WH 4P46C 1N0LA 5FYJD 4RBPK 3MBED 1C1EL 4FG6C 3ZHDA 1QO3A 2A0LD 2BNRB 2VE6B 3G5XB 1K8IB 2LQRA 1EH9A 3GMOA 1ZS8A 4ZAKD 3OKKB 5HVWA 3HN3A 4XBEL 4HC1H 2I26N 1TQBC 3PWVA 4Z7OF 3EYSL 4WWID 4PJFB 1UKQA 4F7TB 1JYXA 1DP0A 2PO6A 5F1NB 2HFGL 2WBWB 3D87B 4DVRL 2JCCB 3IDNA 1HQ4A 2I9TA 4QWWD 1S7SA 2XWBA 1PJ9A 5D2LB 3PL6A 5F8QC 3BIKB 3TM6A 4LCWD 1BQHG 1OTSC 3E3QC 1AGBA 1NJ9A 3BW9B 1A9EB 4HKXB 2JKXA 3TJEH 1H3UA 4V2CB 3U9PH 1AKJA 1WCQA 3DYMA 5JPNA 2WBJD 2VDOH 4JN1L 1ZVHA 2ADIB 3G5VA 2X10A 5DI8B 2MTPA 3MJ7B 1MSPA 5I8KH 4RFEB 2FR4A 1AD0A 2YSSB 5F1IA 3F5WB 5I0ZA 1V3LA 3V52L 1R3JA 5DS8A 1DQJA 4GAYB 4F33A 3EDEA 5TFSH 1AXTH 4DEPC 5DJ8A 4OFKA 2PW2B 4KHXH 4UINH 1BLNA 5HY9B 1W72B 1CFBA 1U8LA 3FFCE 1CDJA 1FQ9C 4H1LB 5TE7L 3NOIA 4A6YB 2B4CC 2VXSH 4ZPVB 3O4LA 3LB6C 2Z31A 4PJBF 5ECJE 2GEEA 4XCNB 1UQSB 5TQ0L 3QEGH 3QCVL 1IGJA 1FFNB 4LLDA 3WUZA 5HYQB 3BFOA 4U1SA 2ENSA 2VWEE 3OG6B 3Q1SL 5EUKB 2D7OA 4JFPA 4BKLB 1HXYB 3G08A 4IRSA 3QUMA 4WFFE 1OAKL 5D5MF 2AXJA 3RKDD 4JKWA 5FGBC 3WFHB 3VJ6B 1XCTA 2I9LB 5DEZA 2R1YB 3ARDA 1KEGL 3SCMB 5DR5H 1A6VL 3VFNB 1K2DB 2FEDD 1OAQL 3SJVA 2ATPB 3KYMB 1IAOA 4ORGB 2IBBA 2YRLA 4L4JA 3JVGC 5IB5A 3UTTD 3QPQC 3MRNB 5DHYB 3EDJA 3NACL 5FEBA 5E8DL 3QQ9C 1IGCL 1NUDA 4HQQL 3HE7D 3IETB 5E2VH 5GZOC 3RNQB 1LD9A 4G8IB 5C09E 5D7JB 2F5AH 3DPBA 2VLRB 4U1KA 4TULH 5DFVD 4LPWA 4TUKH 3X13B 3WO3B 1U93B 1J0YA 1QOKA 2PW1A 5I1HH 2K7PA 4B5EA 5C7XL 4OV6F 1RUML 4F80A 2HTLD 2FBOJ 1P4LB 2A38A 5ABDE 4K2UH 2XFXA 5DYOA 4UUJB 5C0RH 2DLTA 1G9ML 3UJTL 1UB5A 1TNNA 4MYWB 5E8PA 5E6YA 3FN3A 5FUOL 2P46B 3T3PE 1FLRL 1A02N 4LCCB 1WIPA 5I30H 4P46A 2EC9U 1OWRM 3LKRB 1A1NB 3GSOA 4UTBL 2H1PH 3QIUB 2F5BH 2OXGA 1FV1A 1T0MA 4KAQL 2ZNWA 3SJVE 1GGCH 1RZIB 4FQ1H 5ICYB 5I19L 1YNTB 3LRHA 1L6ZA 5TGBB 4QNPE 2OM5A 3DBXA 1FIGH 3GBNH 4H8WL 1S5IL 1LO4L 2ZUXA 4ONOA 1NCTA 5I1CH 1OL0A 4TRPL 3HC3H 3MLPA 5EG6C 4KJPD 3EGSA 1NEUA 1I8IB 2D31B 3NGBB 2VDMH 2W91A 3VFPA 1JPTL 4GKZB 1KENL 3EFDL 2YD9A 4LSTH 3UTOA 1YN7B 4G7YL 2YPVH 3HUJE 2VMFA 1MLBB 5KOVC 1GPOH 3DARA 1EEQA 1NMBH 1LHZA 1TNMA 4DGVL 4HKBB 4HDIB 4EUPH 1IL1A 3BKYL 1XCQB 3LHPL 4LVNC 4JM2D 4FABL 2J6EL 4N8CH 2JJUA 4KK9D 5GGSY 3IDUA 3L3GA 3N0PB 2A83A 5HDQL 4GBXC 3IDYC 5DMGC 4NQDA 4PRBA 3ME0A 4OCYH 2VABB 3LN4A 3MO1B 1A64A 3DX6B 1I9IL 3AMLA 3OBAA 3T0WA 1JWMA 4M7ZB 2VKXA 3SKOB 4MXQC 4AQOA 1NC2A 4UAOB 1RHHA 2NY2C 2DQUL 2N7AA 3MLTA 2X4SA 4Q7DA 2K9UA 1XR8B 1JYWA 1CIDA 1HHIB 1IKFL 1NGYA 4PJEA 5BXFA 5KSAB 1SMOA 3D3VE 3CXDL 4QRTA 4HUWA 3U6RA 1KB5H 2MNUA 4GT7A 1J0IA 4LCWB 5CEZD 4U33A 1OGTA 2A74B 1RFDH 5DQ9A 4TVSa 3E3QE 5CJ5A 5JPMA 2JJTC 2OL3B 5D1ZD 5T3XE 3FRUA 4O9HL 2GUOB 1ZS8B 3RL1A 5FGBA 3PWVB 4N0FB 4RISH 4AG4H 1FL5B 1G6RB 3FFCB 1HILB 2CLVA 4GLRI 3AU1A 4AIZA 2YHGA 3S88H 2NW2A 3MODH 4FQCL 1EBPA 1GC1L 5IR1A 2L7UA 3ARSA 1CDBA 3ARUA 5TDPB 1C16B 1O7VA 5BVJA 1J1XH 3D0VB 4ELKA 4P4RA 4XBGB 3IFLL 1VEOA 4NQDE 1C12B 3PDDA 1R3IH 2EC9T 2QL1A 1YEFL 4I18B 4WTXA 4KZEH 2WIMA 2D4FA 3QSKB 1N3NA 4YDVA 5FDWB 4HXBH 3RI5K 3TBYB 2R0ZL 3JTTB 4L9LA 3V6FA 3C6LD 4PBWD 4L4TE 3DXAA 4YBHA 5IMLB 5KANI 5A16B 1ITBB 1UM5L 2EE2A 4I4WA 4DUXA 4I0PC 3T2NL 1F3DJ 5C8JA 2LVCA 1ZHLB 1ZLSL 2FR4B 4OKVB 1AD0B 1KJVA 3E1F1 4G6MH 5A2LH 5JLZB 3HE6A 5DWUH 3CDGA 1ZT7A 5D71H 4GRLC 1I8LC 1YQ2A 4NNPL 1YECH 1FFOB 2UZIL 1Q9KA 2IWGA 5C09B 2ZSVB 2FHCA 5JIIA 5JO5A 2I5YL 3TH3T 1OAXL 2X4PB 5A2JH 3GSXB 1FORL 3GSWA 1P6FA 1FL6A 1QSED 3S5LG 1NGPL 2B0SH 1B4JH 3KPNB 5DJYB 2DLFL 3D39D 4RDQF 4GQPH 5CKGA 1A6TA 3HR6A 4JO1L 5A43C 1CZ8H 1AQDB 5BW7C 5C08D 5IG7A 2C1PB 3HE7B 4YK4B 4ZO7A 3N1MC 1G9MC 1N4XH 1CT8A 3IAPA 4JFPB 3T0DA 3CXHJ 3CNKA 4X98B 3A6BL 4IJ3C 1MFDH 2C3VB 4C54A 2X1QA 1NEZA 3O9WD 3HS0A 5I73C 3DWTA 4XVSH 1MFBH 1UM4L 3WXVL 2OYPA 2NLJB 4YHLL 2I60H 4XPFL 1EPFA 3W39A 5CBEB 4ZS6C 2HG5B 3I50H 5GRWA 5EZOL 3O6LL 1E27A 3H9SD 3LQZB 3KPTA 3GUTA 1SBBA 5JZ7C 2DQGH 2C26A 4N0CD 1LD9B 4GBXA 1IBGH 4H8WC 1MWAB 1WWAX 3UC0L 4U1KB 4ETYA 3R1GL 1JFQL 5KSUA 5A2FA 4TSCL 1G7PA 5FGCE 4OFDA 4UI2A 3EJJX 3G5YA 4LCYA 4Z8FL 1FIEA 2WINB 3HUJB 2XTJD 5E1AA 4TPRL 1R5IA 3FONB 3OAUL 2MCPH 2QQLH 4NKOA 1KLUB 2APVA 4RIRB 1A1MA 1CU4L 5JR1L 4P9ML 2W0LA 1JGEA 3FCTB 3I2CH 1ZANL 3QUYD 5FOBA 2C7UB 4NM8L 4JKKA 3IDXL 2JJTA 2V5SA 5EORL 1BQUA 4D8PA 4PYHA 5LWYL 5KAQG 1TQBB 5F93C 5B38G 1E28B 1TZHB 2AV7B 3B9DA 4WU5A 1OARL 4GKNA 2OTWA 3T4AB 3DO7A 1BVZA 4JM2B 4L1DA 1F13A 1PG7X 4PJAA 4NM4L 3D3VB 2BX5A 4ONHB 2MFNA 3F7RA 1MVUB 3IAQA 5C1MB 1YY8B 3LRSA 1XGYH 4N8PA 3CX5K 3SDAD 2OBGA 5DJXA 5J1AA 1YN6A 1CXLA 3L7FB 1WWWX 2EDJA 3ILPA 1GAFH 1QNZH 2VXQH 3MGOA 3QFJA 5F6HJ 2EH7L 3QH3B 2BP3A 1ONQB 4P3WA 3UJJL 4LF3A 1K8DA 2XKNA 3VXRE 2DL9A 2NXYD 1UXWB 3KNBA 2I07B 4X7TA 1H3VA 1A6ZA 1VADB 3CCHA 5SWSE 1QFWH 1KN2H 3KJ6H 1OQXA 4OIIL 1UWEL 1WF5A 3F65A 5KOMC 12E8H 1HQRA 1KBGL 3ZKMC 4JO4H 3MFGB 1IGYA 2R1WA 5I8CB 1GC1C 2F19H 15C8L 5BO1H 4GRLA 4M7LH 4OZGE 1I8LA 3LN4B 1X44A 3DIFB 1YY9C 4N8VA 4G8FA 1F8TH 4DEPB 2VXUH 1QD0A 1MHHA 1INQB 2D0GA 1NDGA 3T0AA 3MJ8A 4Z7UA 1WCBA 4NFCA 5CD3A 2X4SB 1UYWL 4L4TB 1WZ1L 4XXDB 4YIQB 2QSCL 1AFVH 2ZCLL 1IARB 4PGDA 1CDUA 5GGVL 1QQDA 4KY1L 3L5WA 2HJLB 4PTUA 1A5FH 4E0RB 1RSFA 3SE8L 5JHDE 1UM6L 2DB8A 3MLSL 4N90E 4WHDA 4XCCL 2B7DT 4X5XB 3LEYL 3MLRH 1QSFD 2AKRB 5E95B 4UV7H 1OCWL 2VH5H 3HNSH 4HUUB 4KDVA 4XP9H 4EDXA 4LSSL 4GRWH 2CH8A 5D1XA 3PQYD 3RY4A 5EOTB 2O5XL 5IHZA 3EW3B 4YHPA 4I48B 5INDA 4ONFL 1J5OH 3QWQB 1A4KA 1XF4A 5F9AC 3LIZL 4YHOL 4P23C 2XT1B 4RAUA 4WDIB 2GJZB 3BO8B 2FJGA 5F7EL 3WFEH 4KTDH 4OZFH 5JXEA 4ZOAA 1MEXH 1ROWA 4EZMA 2HN7A 1KIQB 3D5OF 4P2RA 4XP6H 4YHZH 3UTSD 2V6HA 3S6CA 4OQ1A 3GK8H 3O2DL 2YXMA 4O2CB 1F6LL 4MA7H 4M7JH 1UJ3C 4D9RE 5LAXB 3D39B 1FCCA 4HHAA 1B2WL 5C8JB 4PP1C 3ZZ1A 4JRYA 4M43H 4LKXA 3WIFA 2LU3A 5C08B 1ZT7B 2W60A 3HC0B 4JDZA 3CFBB 1V3MA 3QCUL 5FXCH 5SX4H 4XB8A 2E8YA 1ZLWK 4A2MA 2ZCHL 4YGAB 1MCNA 3VW3H 4X9IA 5JW5A 4DCQB 2HKFH 1LEIA 1XIWD 3QQNA 2OTPA 1R3LB 3EYQC 3O9WB 3WMSA 4NFBA 3WHXB 3IDIB 5AD0A 2PYEB 3MNZA 1T5XA 4R4FL 4LLUB 1DUZA 4BQ9A 1UZ6F 4ZUWB 1XGQB 1NCBH 1ZHNA 4LGSB 4XPHH 5IHUL 5IBUB 1C7TA 3U9PL 3EOAB 2R8SH 3OB0H 1NBZA 5C9JB 2V5MA 4XAKD 3DGCR 2QHRH 4YLQT 3OXRA 3R8BB 4P2RE 3WNMA 2VDOL 5I74B 4Y5YC 5J6HA 3ECBB 3NMEA 3AMKA 1P9MC 2HT4D 3CC5B 4IDLA 3OR7A 1KFAL 5KANG 3WKMH 2DTSA 1FN4A 5BZWA 4ODHH 5I8KL 1SJHA 2XTJB 1WV7T 1R5VB 4J3VA 3FQRA 4OKDA 3AS2A 3QI9C 2LAAA 5H35B 4LOUD 5DT1L 5TFSL 1AXTL 4LVNB 4FZEL 3KLDA 3KPMA 2EDOA 4LNRB 3RRQA 3ZTNH 4MD0A 3P9MB 4KHXL 1DVFC 4UINL 3T8XA 2EKJA 4NHUA 5CD5D 1J10A 1NGZB 3QUYB 1JV5A 1X3DA 2VUYA 3IDYB 3WHE1 1BHGA 4YFLF 3RWFA 5B4MC 3KYAA 1BFOA 2HFTA 1XH3A 2VXSL 4OLYH 5DJ0B 2J8UA 2CK2A 2WP3T 3AM8C 2X9YA 5C86A 3QEGL 3VXRB 1DBBL 3MV8E 2HA1A 1HSBA 4F7PA 5SWSB 5F96H 5FHAL 2YZ1A 4LLVA 2Z8SA 4APQC 3QXAB 4MXVE 1F4WH 4ZXBC 5E8NB 2GI7A 1U91B 4OZGB 5DR5L 4S1QH 4AYFA 1RJZB 1UKTA 3ULVH 2B1HH 2MWCA 4Y4KD 3DETC 2IH1A 3AFLA 2CUIA 1CE6A 3BPLC 2QJDA 3PE9A 4LVHC 2YC1B 2EIZB 5E2VL 4UIMB 1C5DA 4CL7A 1JGUH 4IHOA 1LP9A 2F5AL 4M93C 3MGAA 1E4KA 1F4XH 1JPSH 1DQTA 1NCWH 3DROB 3L3JA 4FQJL 4TULL 2JJSA 1MFCH 4HJJH 4PUBH 4TUKL 5EPMB 4Z7WA 4ERSH 5JHDB 5I1HL 5IEHB 1I85A 4PJFF 3RU8H 4LSUH 5JORA 3MGOB 3S96A 3VXPA 3VFUA 2J8UE 3NA9H 2JCCF 3ZYZA 2JB6A 1NDMB 3P77A 4K2UL 3KNBB 4MWFB 5C0RL 5D2LF 3LPWA 2Q6WA 4XC3H 3P9LB 1S9VA 5IQ9B 2OTUB 1U95A 5I30L 4I0PB 1OY3B 3TCLB 1HQRB 3QXWA 5ADOH 1IGYB 3TPUB 2H1PL 3C5ZD 3MRQB 3TZVC 4QRRD 3QWOA 4ZUVB 4N8VB 1GGCL 3QR2A 4OF7A 4KKNA 4FQ1L 1QSFB 1ORSB 1BAFL 4U2YA 3VFRB 3UBXA 2X1PA 5CD3B 1FIGL 4KKAC 3GBNL 2G5BB 4PRIA 3VRJB 2ZOKA 1I1AD 5I1CL 3HC3L 3DMMC 1QFUH 2GITB 1LP9E 5CLTA 1CD9B 2V2XA 4HLJA 3FO2A 1Z5LB 1D5ZA 1FZOA 3PWPA 3IVKA 3TA3D 1XAUA 4LSTL 2YPVL 2VIRA 3MV9D 3WE6A 1Z2KA 3RIAF 2HMID 3BMVA 1AH1A 4Y5YA 1GPOL 5DVMA 3QDGD 4KJWC 1NMBL 4UBDC 1T66D 1P9MA 3DV6A 1RK0A 1PD6A 3ZYOA 3Q5YA 4MAUH 4JB9L 5FKAA 5FO9B 4N8CL 5I73B 3RWGA 1I7UB 1YC8A 4LFHD 3QI9A 2YN5A 1ZE3C 4XMKL 2NY4D 2VQTA 4HEME 5JDJA 1MHPL 4RAUB 1G0YR 3EJZD 1U3HA 4YXKH 4DQOH 3QUKA 5CBAA 1X5YA 2PR4H 5HI5D 1DVFA 1T2QL 3F7VA 3ARED 2HN7B 1M7DA 2F74A 3HG1A 4NYLA 3ZKXC 5EU6A 1XIWB 4PLOB 3ULSA 3DVIA 3AM8A 4JKMA 4PRIE 3C9NA 4U6VH 4K9EL 5LGJA 1JK8A 1KB5L 2DKUA 5HHME 5FOJA 5J9PB 1RVFH 4TNVK 1RFDL 5DMKA 4JVWA 1UACH 4BSVB 3B9AA 1P5VA 4NQVA 2AJSH 2VLKA 3FQTA 4MSWA 43CAB 5D1QA 4APQA 5CP7A 4H5SA 2EDRA 5F8RC 5HJ3A 4AG4L 4ZXBA 4JFFE 4PJ9D 5CZKA 5T3ZD 5KSBE 3B5HA 3GGWA 3MODL 2GHWB 3GRWH 2PF6A 3MFFA 1MIEH 4GQ9H 1ACYH 1NBVH 3OAZH 3LAFA 5CS7A 1XMWA 1J1XL 3MV8B 5GRUH 4K7FB 1UVQB 1DUZB 3L1OH 3V0AC 3OG4B 4NOBA 1GGIH 2EDKA 4KZEL 3GJFA 8FABA 2GJ6D 4NQSA 5FIEA 1WC7B 4HXBL 3BP6B 3WD5H 3SE9H 1NBZB 1DSFL 2W92A 3WJLC 4CN6A 4Z5RB 2IALA 5HGAA 1JGLH 4J4PD 4B0MM 1DTUA 4CW1A 5J6HB 1JTPA 3CX5J 4TSBH 5EU6E 1BQSA 2Y6SC 1D5IH 4MB5A 2WANA 4YO0B 3MCLH 2NY0C 3TO2A 1KLGB 2Z4QA 1S3KL 3SOBH 4FXLA 3CLFL 4G6ML 4F2MA 5DWUL 1UADC 1IEBA 5EIIB 5LBSH 3X17A 3CGTA 3OHXB 1YEEH 4LEXH 5C0JA 1S7QA 5DRZB 5DVKA 5HD8C 1B0GA 3PP3K 3GSQB 3O11A 4MCYA 3RX7A 3TZVA 1DR9A 5HYJB 4AY0A 4NKIH 1WTGT 3HZVA 3SY0B 1IT9L 1B4JL 2Y7QA 1J9CT 1B88A 3OKOB 3IF1B 3NAAH 3B8YA 1DQLL 3FFDA 1AXIB 4I1NB 5IVXE 5CEXB 4RWYH 4OUUB 1PFCA 1EEYA 1CZ8L 4PLKD 2KQMA 2XZCH 5DD6B 3DX9B 2R0WL 4H0HB 1J86A 4XP1H 4P2OD 4LPVA 1T3FA 3DMMA 1N4XL 4M03A 3TEUA 1RU9L 1GRWA 2E7BA 1NANH 4FXKA 1MFDL 4Z18A 4HUXA 4H25A 5CEYB 3QCTL 5F89B 1QRKA 1YYMH 4XVSL 1MFBL 3VGBA 3NFPB 3M45A 4G6AD 4WUKH 3OL2A 3V8OA 3PG2A 4HC1A 2I60L 1KF9B 3BN9D 5INCA 1S7VA 3I50L 3BZDA 4WU7A 3RWEB 4FA8A 5I16B 5BQ7A 4EXKA 3M17B 1VCAA 1LP9B 1IBGL 4HIHA 4KROD 4P23B 2EZ0C 1QLRA 2G9HB 2APFA 5T1KB 3C5ZB 3PV7A 3RGVC 4XNQA 3DO3A 4FQLL 1AGFB 4NN7C 3F58H 3MLXH 5C92A 2F53A 1P7QD 3V0WL 5I76B 2Z8WC 5JORB 3RPKA 4G8GD 5HDOA 3V6OC 2DICA 4OLVH 2MCPL 4HFWA 3TYFA 5KSVA 1R24B 2QQLL 5CINL 4P5TD 1DQDL 3VFTA 1UJ3B 4XMLH 3BPNC 2CIKA 1IKNA 3I2CL 4O00A 4Y5VB 4M6NH 1AGCB 1AR2A 2O61B 2V17H 1EAJA 4CN4A 1BEYH 3ZYIA 2P8LB 2F54D 1ZT1A 2AK1H 5EBGA 1SVCP 3TFKD 3UTZB 3KLAA 1T1XA 1QEWA 4M6OH 4Y2DD 3FOMB 1W0YT 4UDTA 1TJIL 3BZ4A 3QQ3B 1EJ6A 2NZIA 4FFWD 4QHNB 4M61A 4X4YB 3F8UB 5ALCL 3MNVB 2NY4B 1A8JH 1XGYL 5HHMB 4XZUB 2HRLA 2W65B 4ODTH 3KWWB 4K9EC 5L9DH 3B2VH 2X42A 3FO2B 1GAFL 5DK0B 5C0AE 1QNZL 3F62A 4HG4K 3UPCA 1HH9B 1U8OA 3EHBC 4FFZH 2XXMB 3VWJC 2A77L 5DA0B 1QVOA 5E1HB 4JFFB 1GJIA 4Y5YB 3FO0H 1UXSB 2P7TA 3FO1A 3ZDYE 5KSBB 1KN2L 3C87A 1RK0B 3KJ6L 1IGFH 3DUSB 2MPAH 4MMXC 4O51A 1ZLUK 2ILLA 4AEHH 12E8L 2X4RA 2XYCA 4JO4L 4MCZB 4AJ0A 3T3PF 5DFWH 4J12A 4M4RA 3LQAH 2Y06H 3S36H 4C56D 4K3JH 4PV8B 5DUMH 1F8TL 1EHXA 2BCKB 4HPOH 2A6DB 5ENWA 1X6LA 1PLGH 2Y07L 4WHTA 3GIVA 4PJ9B 4ZDHA 1EAPB 3OQ3B 2V7HB 5K9QI 3BE1H 1MAKA 1AR1D 4JDVB 1I8KB 4ELMA 1AFVL 2CDEA 5TH2A 2FJFB 2DLHA 4ZUUA 1RZGA 3EYVB 5KVMC 3CVHB 3FAXA 3SKJH 3ARBA 2W59A 1HK6A 4YJZL 1LVEA 2V5TA 1PQZB 2EDEA 3OKEA 3U36A 1A1OA 1JZ2A 4O5LH 2GJ6B 3DGGB 3V5KB 4JN2B 3VFMA 4HX1B 2P42B 4OI7A 1GXEA 3MLRL 2XICA 4QRPD 4H5SB 5JNYB 1RJYB 4WTWA 4UV7L 3ZL4L 2VH5L 5HJ3B 3HUJF 1ZTXH 3WBDA 3ARTA 3C8HA 4L4VE 3I9GH 5J8OA 3EBAA 1N5AA 1J5OL 3VXMD 2XQBL 5IVXB 4XP5H 3D48R 3I84A 4KRMB 3BPLB 3CFDA 3LSOB 4LVHB 3RWHB 1W0WA 3KPPB 3HZYA 4KTDL 1DQQB 3SHSA 1MEXL 3GJFB 2ICEB 3LV3B 5HGDB 4NQSB 4JGUA 4R7DA 4XP6L 4M93B 4YHZL 3PL6D 1J05B 1MY7A 1PYWA 1U42A 3RGVA 3WDJA 3OJVC 3QPXH 3BP5B 5FO7A 4MA7L 5B3JE 2UVFA 4ELME 3V7AG 4XPBL 3HPJA 4JM2F 2F58H 4FQHA 2O5YL 4U1GB 4M43L 2AABH 2FGZA 3U4AA 4IRJC 3P4MB 1BIIB 4R90H 1FNGA 1FVEA 5E6ZA 4EUPA 1IEBB 3TWCL 4DZ8B 2Y5TB 3AS3A 1AI1H 2AXGA 1FE8H 4MAYC 2AW2A 4WUUA 1YMMD 3GBLA 4AL8H 3MRIA 1J0ZA 2GY5A 3HB3D 2WSKA 2VDLH 5KVDH 1J88A 1KXQE 2X9XA 1V8HA 3ARXA 2VYRE 5IP4A 1VACB 3P4NA 4OLZH 4XPHL 2NR6D 3PIQB 5K9OA 1NSNH 1XGUB 3I6LE 3IDGA 3O4LD 2R8SL 2Z31D 4F37F 4Z77A 1EMTH 4M5YH 1LQSR 1A0QH 4ZD3L 4G43A 1MCPL 4U31A 1KB5A 4P3DB 5A3ID 2JJWA 5DMJB 4GKSB 5GHWH 4HUXB 1Q9OA 4POZD 3WKML 3VWJA 4ODHL 1H0DA 1K5NB 3V6OE 1IC4H 5E03A 2WQRA 2D03L 3IXAB 1Z6JT 1MFEL 1CR9H 4NO3B 1XZ0B 1S7VB 2FRGP 3ZTNL 4OZ4B 1QFOA 5JOPE 3TIEA 4R2GC 1S9YA 3DURA 2AXFA 4BSWA 3K1KC 3PNWB 1N6UA 5TE6H 1ND0B 3HNTH 1QLRB 5C0AB 3SGEH 3SGJA 4OLYL 1YUHA 4M1CC 2BVYA 4DTGH 1V3KA 1PDKA 3W81A 4HS8H 1F3JA 2NYYC 3TIDB 1F90H 5I1KH 4HFWB 3C09C 4Y2DB 4QRQB 5D7LE 4ODWB 2B2XL 1PG7W 5F96L 1TPXB 2DYPA 3RPIA 1XFPA 4FP8L 1MCIA 1S8DB 3JUZA 1S7XB 1T20A 5TQ2H 4KVCH 2H6PA 5KVGH 1F4WL 3IU3A 1JF6A 1OQOA 3RA7L 5DUBA 3RJDA 4PRNB 4S1QL 5I1JH 2E7HA 3ULVL 2B1HL 2CMRH 3QZWG 4Y89A 5DRNA 3T0VA 1TCRB 4PP2B 1X5HA 3RZCA 2DQFA 1UB6A 2ICWI 4W4OC 1JGUL 2XZQH 5CIPB 1FP5A 1A9BA 4Q9RH 2C3XA 1F4XL 1NCWL 3G6JE 3MZGB 4ZOCA 1MFCL 4HJJL 4JDTH 4PUBL 4C56B 4TUJA 3VXSB 3F7PC 1WSST 4P2CG 3RU8L 4LSUL 2XZAH 4HULB 3NA9L 4K7PX 4U0RC 4I2XA 3AAZA 3GSUB 4L3AA 2MQ3A 3VI3E 4TYUA 4L4VB 3EO1B 2R23A 4XC3L 3FO1B 4UDUB 1RUKH 2ZCKL 4OGAC 2FX8H 3S97C 4Q74A 4AM0B 4HAFA 5ADOL 3GMMA 4JPKH 4DKAA 4I3RH 1DL7H 5KS9A 4Z76B 4IRJA 1TITA 4QCIB 1U0QA 4GAFB 2EDDA 2NY1C 4MJ4A 3RHWF 2E9BA 4HCRH 2UUDK 3TT3H 2Q7NA 5ENWB 5IFHH 2RCSH 5EU5A 2IH3A 4QRPB 4RAHA 1FRGH 4BZ1H 2BOCB 4JY6A 2H32B 4JRXA 4CVUA 4E42A 4OQTL 1F5WA 2XV6B 1ERNA 4XCYA 4AEFA 5A2IH 3VXMB 2QADC 3NFNA 3QIBB 1QFUL 1NC2D 1RZGB 3JV6A 3NPZB 5IROC 1F3DH 2WM0A 5AAMA 4HJGA 1N59A 1YPZA 5TDNA 4U05A 3F6IA 4X7SH 5K93A 1NPUA 1A1OB 4LBEB 1QPXA 4NN6C 5HI3C 1I3RA 5HYFA 4NIKB 3EYFA 4I2XE 5D6CB 3PV6B 1G7MB 4ZFOL 5DTFA 3ZKND 3EJYC 4BQ8A 4NQEA 1I7RB 3IFPA 4M62H 3VXTB 1JNNH 3PXHA 1Q38A 1U92A 4U1JB 2FH8A 5DK2B 4H88H 4NNYB 1HH6A 2DQDH 2VR9A 3PGFH 5F3HA 1BVLB 5C9KA 3DRTB 1D5XA 5KVFH 3V4VH 5KS9E 1OHQA 5MHSD 4YXKL 1TJHH 1BZQK 3QHFH 1TVDA 4DN3H 2C4FU 3ISWA 4N9OB 1HHKB 4OZGF 1PKOA 5E7FA 2P44B 5I0DA 3GMQB 3FQNA 5K9QG 4XH2B 1IGTA 1YMMB 1RUPH 4JRXE 2CRYA 5IJVA 5I18H 4JQIH 3K81A 3ZE1E 3WIHH 3W5MA 4FOMA 1YEDA 5T5NG 2D3VA 1OM3L 5A1AA 2OSLB 3QT2A 3BI9X 1EERB 1RVFL 3U9UB 1CGVA 1SYVB 4K7PY 4MB3A 1UACL 5F1OB 1YPZE 2VQ1A 1D6EA 1XEDA 3DXAD 2AJSL 3BPNB 3MLWH 1EO8H 4JFZH 4LSRH 4WNQA 5IK3B 5TDOA 4EUPB 4S11A 3HCVB 4XBPA 2NY6D 2YEZA 2PTTA 1ZHBB 3ZE0F 1DEEB 4XGZA 4NQXB 4D0BA 2AXGB 3D85D 3HE6D 1RMFL 3RIFF 2XWJB 1MIEL 2YOCA 4GQ9L 1ACYL 1NBVL 2E8ZA 2HVKA 3ARGC 3MRIB 1Z9OA 5GGQH 3L5XH 4C4KO 5GRUL 5D7LB 1MUJA 4PJDA 2ICWJ 3L1OL 1F58H 3C5JA 1NGWA 3EDDA 4W4OA 2ARWA 5K9OB 4O02L 3HKFA 3WD5L 3SE9L 3FB5B 1T1ZA 2G2RA 2EC8A 5FYKD 2BNUA 5KVEL 5CJQH 2J3SA 1H3XA 1T89A 3Q0HA 4M48H 4U1LB 1KB5B 2ZKHH 4TSBL 3SDDB 4YHNA 3ZHLA 1D5IL 4RZCB 3BVNA 3MCLL 4HG4J 3S9DB 3VG9B 1T0NB 3CSBA 1H0DB 1LO0H 2HJKB 3D18A 5C0EB 3SOBL 3IXTB 2CD0A 3P4LA 3ULVC 5F44A 4NN5B 3C8DA 1JE6A 1M05A 4WENB 1I1YA 3WUWB 1FNEB 1KGCD 1QTYT 1YEEL 1KCLA 4LEXL 1PX3A 2DDQH 5JTWA 3NPSB 1Z0NA 3G6JB 3QDAA 2AXFB 1SJEB 2UY6A 2FWOB 3BHBA 1HDMA 4NKIL 1VKXA 4L8CA 1U8MB 3PHSA 1VA9A 3VA6A 2Q8BH 5ICXB 1UCBH 3NAAL 4OZFA 4L8DA 4RWYL 5BVPH 5L2KA 3HRZA 5IEKA 2XZCL 4XP1L 3CFKA 3QXDA 5F97E 1U8NB 3U0WH 2WAHA 1BF8A 4U6HA 4BFIB 5DJZB 5IROA 1T20B 5IMKA 5IMMB 4LLQB 4YDJA 3RVTD 1I9EA 2HVJA 3KDMB 3U30B 4KHTH 3N1QC 1N8ZA 1NFDA 5DEGA 4DAGL 1EHLH 1A2YB 4PJIA 4YHKH 4WUKL 4JKLA 5EBLA 4WW1A 4UILH 4S0TD 1YEIL 3A67H 4LCIH 4HFUL 5IOPA 5E99L 1MCDA 5SWZA 5I75B 5K9JH 2W1NA 2P43B 2D0HA 4GRWE 1R0AH 3GSNB 3NN8B 5C2BH 2LAGB 4M1GH 3TNMB 2DMKA 3W9EA 1DDHB 4TUJB 1WWBX 3MLXL 1S9XB 4YQXL 3TN0D 2OQJA 3DUUB 4HKJA 4OLVL 3BQUA 3CFCL 1IQDA 3O3BB 5L2KE 1AE6L 1WBYA 2AQ3A 4HWBL 1SQ2N 4XMLL 3W0WA 3QFJD 4QOKD 4KGJA 2Y36H 4LSVH 2V17L 3GMMB 3KG5A 4JEGB 4K71C 4Y8AA 4NO0A 2QSTA 3BH8B 1TJGH 4BQCA 4MXVF 1NFDE 1IEAA 2AK1L 1FFPB 1MH5A 4WFGE 3IKCA 4PJIE 5J12C 4M6OL 1WZLA 3VFGL 1DFBL 1YEKL 2H3NA 4K8RD 4MAYB 1A3RH 4GRLD 3CH1A 1FYTD 5GGTH 3RUGE 2NMSA 4FHBD 3WFBH 3O3DA 1W72H 5SWZE 4EI5B 3PJSB 4MA3A 4EDWL 4ODTL 1CDIA 2DM7A 2WWKT 2ORBH 4C55A 2G60H 1KJ2H 4FFZL 3O41B 1VENA 2DL2A 3IRZA 2V2TB 4PJ8A 1HCFX 3FO0L 2CK0H 1IGFL 2MPAL 2R2BA 4JREC 4AEHL 1YEHL 2DQJH 2Y4SA 2V2WA 3S36L 5D70H 4K3JL 3MCKA 3IDJA 2E7MA 1RPQA 5D1XD 1CTOA 3KAAA 5DUML 3QO1A 1ULVA 4IM8A 2WWMD 1JYVA 1HYSD 4KKLC 3P0GB 1FG2B 3CZJA 4R2GB 2RJMA 3FL7A 1OT2A 3BE1L 5D7SH 3VDCA 4LLMB 4PV9A 4G42A 3WNOA 5JXED 3QIWD 3UMTA 5ID1B 5JZ7D 3VFSA 1HEZB 1Q94A 4P2RD 4NZDA 1YEDB 5DD3H 3TBVB 4AQ1B 4DK3A 4WHYG 4YAQA 1LP9F 1JRHI 4O5LL 4LFHG 4S1DC 3N1GC 1KNOB 2DS4A 1GSMA 4XNUH 5FA4B 4I9WD 3BPCB 1MRFH 1MCRA 3BKJH 1ZTXL 3QUZC 4JRYD 4U1IA 2J4WH 1OD9A 3I02A 3O6FC 3HC4H 4HZLB 5EC2B 5DGQA 1IQWL 3L3KB 5EN2B 1OGAD 3I9GL 1RIVH 1K6QH 5CWSA 1ETZA 3PWJA 3AS0A 5FYLD 1F42A 3H9YA 4MXWH 5HHOE 3ULVE 3OR6A 2Q86B 3QP3A 1BJ8A 3OX8A 1ADQH 2AEIT 1N2RB 2ZUSA 3C5JB 4I5BB 1WFNA 3U2SB 2FB4L 5E9DD 1MY5A 2OLDA 4L3CB 4P2QA 1P7KA 2Z93A 5T1MA 4KKBC 3DX7A 3QPXL 1HWHB 3KR3H 1U8JA 2QEJA 1TZIA 5SX5H 3HAEG 3MRCA 1FSKC 1RZFH 1JI2A 1M6OA 4BK5A 2OS7A 3S98A 1I3UA 2R56H 3PWUB 2F58L 5GIRA 1F4HA 5L2JB 3MRJA 2X4OB 4Y4HA 4U1NA 2AABL 1D6VH 4BSJA 1BX2B 3DYOA 2DBLH 1DE4A 2CXKA 2XOTA 3GNMH 2EIDA 4R90L 4PJHA 4EVNA 2BY2A 2EDYA 4GXVL 4ZFOA 1T83C 3BP4A 1CWVA 3DSFH 5C07A 1AI1L 3FT3B 3CFJB 1FE8L 1A7OH 5DHVB 3B9KC 3ZTJH 1I7ZA 4AL8L 4MQ7A 3PGCB 4RMWA 2GSIB 2M1KA 2NY1B 5C70A 4HUVA 3ULUD 3FB6A 3CMGA 5FYJH 1WITA 5KSBF 2LU4A 4PD4K 1V7MH 4LP5A 3BRDA 3SE3C 4EEEA 2OJZH 4Y1AE 3HI5H 1CXFA 1MQKH 2VDLL 5KVDL 5IEKB 3OGCB 4OLZL 3TV3L 4BFBD 3O6MH 1NSNL 3I75A 4QTIH 2XZZA 1EMTL 4M5YL 1NBYB 1A0QL 4CU7A 4P2QE 2D2OA 5ETUB 5GGRB 1XF5A 4F7MA 5GHWL 1N8ZB 1NFDB 5M94B 4DZBB 3OJDA 4U1MB 1E4JA 1AHWA 3D6GA 4L3ED 4PJIB 3PDOA 1IC4L 4KK5D 4NJ9H 1CS6A 4WW1B 2OL3H 5DEFB 1IRAY 4NUJA 1KIPB 1CR9L 3NCFB 3RUGB 1OOAA 3MMEA 4NQCD 5FYJU 1CFQB 2EE9A 1Y6MR 2IADB 4QOKB 4PJHE 3QDJA 2VTFA 4MGXA 1S7RA 1G6RH 3LS4H 3GRWA 5TE6L 3D1MC 3HNTL 2QKIA 3ES6B 1B4RA 5F88B 3VFOB 2HLFC 5JUEH 4NJAL 3GFUA 3WN5C 3QULA 1T04A 3X14B 3TVMB 2GIYA 4HS8L 2OQJB 5I1KL 1F90L 3W11D 1HOCB 1Q9WB 1EZVX 5IVXF 3V0VB 5HVFB 1EXUA 1BFSA 3ARZA 1CD1A 3THMH 4N68A 5TQ2L 5HI4C 1NL0L 4KVCL 3MJ9L 4GW1B 1INEH 1NC4B 3B3IB 4OV5B 2R2CA 1QR1B 5I1JL 2D7MA 4CVXA 1X9QA 1BBJB 5FF6B 2CMRL 4P5MA 3AXLB 3LDBB 1MH5B 5H94A 1Y6NR 3QDMD 2KUTA 3LKSA 3QUZA 4YDIH 5KG9B 2EYRA 3O6FA 2BY3A 2XACC 2VLJE 3GHEH 1BQHA 4PJBA 3WCYA 4DKFH 2XZQL 3ARGB 4Q9RL 5IVZA 2CDFA 4OFPA 3RIFK 4JDTL 1X7QB 5D5MA 1SEBA 4KMLB 1IM9A 3B43A 3EIFA 5BMFH 5ITFB 2DOCA 2VITA 5C6WH 3TBWB 2DIBA 1SY6H 1WGOA 1RUKL 3PWPD 2J5LC 4KJQD 5CGYD 3QIWB 5IB2A 1ZGLA 2FX8L 4XRCB 4O58H 4HLZG 3RBSA 4JPKL 1DBJL 4I3RL 2XKUA 5CSZA 3M1BB 1U3ZA 3ZT7A 5HHOB 1GL4B 4JPWH 1LEGB 3I6KA 1BOYA 1WBXB 2FYYB 3IDJB 1KB9K 3OKDA 4IIQC 1T83A 4L8BB 2HLAB 1IEHA 1QSZA 3V6ZA 3TT3L 5DGRA 4XNMA 5IFHL 3WIIH 1VFAB 1FRGL 4BZ1L 4LHUB 3SN6N 3S35H 1U3HD 5EU4B 3ARFC 1OGAB 4YEEA 3L3OA 1A7PH 2A6KB 4G42B 5C0DA 3EO0B 1MWAH 4U1HB 4Q6IB 2ESVA 5I71B 3JV0A 3D69A 3SE3A 3E6FB 2HJFA 1CLZH 2ZG1A 5B4MD 5F71A 3HG1D 5F1SA 2NW3B 4DUVA 2VLMD 4X7SL 4LMQI 5LJYH 1ZA6A 4NO5A 3RX5A 4WWKD 4R26H 5J11C 4DKEH 1EZVY 5E9DB 2GFBB 2YD2A 3S37H 3ZKSD 2X09A 3GHBL 3LKOB 2ERJB 1H15A 4M62L 1JNNL 4IOIA 3FZUD 5DC0A 1F11B 1L0YA 3FO9B 2VLKD 4H88L 2X2YA 1ETZB 3PGFL 5D1QD 3MYJA 4Y1AB 2AJ3A 4X7FC 3V4VL 2IG2H 3GJEB 1IZKA 1TJHL 3QHFL 5C0CA 2EE6A 2GT9B 5GS1C 1CN4A 5ELIA 1MHCB 4P2QB 3VRIA 2R9HD 3QEUA 3PGDB 4KUCD 1N5YH 1RUPL 2BVEA 5I18L 4JQIL 4LVOC 1U8JB 4JPVH 3WN5A 5FO8A 3MOBH 4LPTA 5MEOB 5GGUA 1J8HD 1JHTA 4BH7A 1BQLH 5GSVA 5BRZE 3PHQB 1B6UA 5T3XH 3X11A 2YMXH 3ZO0A 4C59B 4RAVB 4TQEH 3BWAB 1EO8L 1E4WH 4JFZL 4OLUH 4EVNB 4LSRL 5FDYA 5E8OA 5HDBE 5EFIA 3PWNB 4PGJA 4HV8A 3MREA 5HGGS 3MOAH 4K71B 5MEQA 3C6SA 1TENA 5HTSA 3KPSA 1QFPA 2X89A 5ID0A 4ZUTB 1MCBA 1T22B 3SKNA 3NH7H 5CEZH 1G0DA 4JHWH 4F3FA 3FB6B 1UJTA 4L3EB 4LAQH 1LK3H 5GGQL 3L5XL 3UTQB 4PGBB 1G7LA 1Z9MA 5HDLA 1F58L 2BDNH 4NQCB 4PJCA 3MRDB 1FPTH 1WIUA 3NABH 4PGZA 5EOCJ 3UJIH 1ZVYA 3ZSSA 4XVTH 5CJQL 2E27H 3MNWB 2ADFL 5I6XC 1LE9A 3F12A 4KKAD 2ZKHL 2VDQH 2P5EA 3B9EA 2Z92A 3DLQR 1XF5B 5HYIA 1MCQA 4GAGL 4UU9B 1T7YA 3OAYK 3OJDB 4R4ND 1LO0L 1CLYH 1S7WA 2EDFA 3QUXC 3DVGA 2YS4A 1KPVB 4RGNC 4OFIA 2VLJB 4YR6B 4GUPA 2DJ4A 3MXVH 4E9LA 1KCRH 1TTGA 1X5XA 4JREB 3BESR 3L95B 3ALPA 2FX9H 2BSSA 1U8PA 1P4BL 3IS0X 2EDWA 4JJ5A 4NDMB 4X5WB 4YXLH 3TF7C 3RDTD 4R8WH 5BZDB 2Q8BL 4IIQA 4NBXB 4Y19A 4X8JB 3KPSE 1UCBL 3N9GH 5IUSA 2GK2A 3LMJH 3QDMB 1L7TL 1NCDL 3KXFA 3VXQA 5ISZD 2EDBA 2OP4H 1CLCA 5DRXA 3H7BB 4MD4B 3U0WL 5GS0D 4PJCE 2F53D 1J11A 1G9EA 3KPQA 3T4YB 4KHTL 1TVBA 1IGIH 3I6GA 2Z91A 4L8SC 5ACMA 3UROR 2IANA 3OJMB 2P5EE 1EHLL 4YHKL 2DQTH 4P5MB 5HHNB 1M1SA 5F6IC 2QR0A 3T1WA 2YD6A 4MD5A 2VISA 3LKSB 2ZPKH 3RTQC 1IAKA 1AQKL 4PJGE 4UOW1 4CAGA 5JDSB 1AIFA 3LZFH 1JZ7A 1JGDA 3D0LA 4F15C 5K9JL 3KLHD 5I17B 2B5IC 3MV7D 4WIQA 3OV6A 3ROOA 5C2BL 2AJUL 3T1FB 4PREA 4M1GL 3FQXA 4ZPTA 1LNUB 1ZA3B 4ODXB 3RVVD 5T1LB 3P11H 3SPVA 4Y19E 1I8MA 2DN7A 3STLA 3H7LA 4CNIA 5J4MA 1JZ5A 4BZYA 2OZ4H 4PRDA 2XN9E 2IC2A 3ARQA 1HHGA 5FECB 1BVKB 2JK5B 2Y36L 2O26U 4LSVL 5I9QB 4MNQE 5CP3H 4OGXH 2BNQA 1XF3A 5JMRA 4U7MA 3LS5H 4HIEA 3NIGF 1JZ6A 1TJGL 1YJDH 4N9GA 4QHLB 4KKCC 3SE4A 4OAWB 1CXKA 4WWKB 1EO5A 4ZNEE 1D9KD 3QA3B 1CFSB 2OCFD 1OPGH 43C9A 4TNWK 5E08H 4F8QA 1ZK9A 1A3RL 3B9KB 3HMWH 5GGTL 3T0EC 2APBA 2YWYA 3WFBL 4HAGA 1MJJB 4ZQKB 3L3HB 3CMOH 4FQXD 3SDCB 4S0SD 4QY8A 5HD8D 5BRZB 4EI6B 3C5SA 1Y6KR 4PD4J 4WFHE 4X6CE 2GY7B 2XWTA 2ORBL 2G60L 3G6JF 1UG9A 1TQCB 1KJ2L 4HGMA 5BCAA 2C1OB 4HKZA 5ACLA 3ARBD 1CDYA 5HVHC 2IPTH 4Q2ZA 2RB8A 4C58B 4UT6H 3VI3F 1A6AA 2GTWB 4YBLC 2DQJL 3V4PH 1OTTD 5T33H 1E6OL 1J8HB 2A6IA 3KYOA 1NFIA 4UNUA 5D70L 2BNQE 1RJLA 2AJ3B 4OFYA 1JPGA 4PRHA 3TNNA 4I0KA 3TH4T 5DZLA 2Q3ZA 1JBJA 2R1XA 2WMPA 5KTEH 4YFEA 1CGTA 1UGNA 1OWWA 4WI6A 2CLZB 2EXWD 1B0RB 3OXSA 2DWDA 3LEVH 4KI5E 3QNZA 2KL6A 2NTFB 4WFED 2IQAB 3KPOB 3GM8A 2J1KA 2QSQA 5DD3L 1A4JA 2R4SH 2HFEB 1U8KA 1KULA 2DBJA 5TQ0H 3LD8B 5KZCD 1X5JA 4PB9L 3X11B 5TF1L 5ESAB 3UPRA 1FVCA 4QXTA 4WO4A 4XNUL 3PWLB 3N50A 1F4AA 4IS6A 1MRFL 5MENE 3BKJL 5J3HD 1EEZA 5B39A 1MIMH 3GJFK 4PG9A 1GYAA 2DIJA 3RTQA 1Q8MA 4HCRA 4RGNE 3MUZ1 5AZ2H 2RFXA 3TGXA 1ADQL 1PKQB 3BP7A 4LK4A 4WUUD 2YD1A 2DI9A 1XGPA 3HZMB 4HQQH 3CFEB 2PXYC 4PJCB 1KCVH 2Y23A 4JFED 4U6YA 3MROB 4FTVA 4QHUB 5L6YL 1KSRA 2NX5D 3HLAB 5EO9B 4O2EA 3KR3L 3STZA 2CKBH 3BT2L 3VI4E 2HYMA 2R56L 4EN3C 1LO5B 3QEHB 4HIXL 4L1HA 5ISZB 3MRBB 2DBLL 3FB8B 4NBYB 4PJGB 3GNML 4HWUA 3BUYA 3OF6A 3DSFL 1V7NH 4PRAA 3MRFB 1G7QA 1U8PB 1DANU 1T5WA 2PCPA 1A7OL 1H5BB 1AO7D 1GVIA 3FTGB 2E9IA 2ITDB 4Y19B 5FYJL 1I4FA 5T1DH 2Q3AA 4GMTH 2VZVA 1OSZB 1CQKA 3WO4C 2OJZL 2R69H 1MQKL 3GMRA 3HI5L 3QWRD 4J8RB 5TF0A 1ZT4B 3T0EA 3CUPB 3ARFB 3O6ML 3QO0B 1VFBB 2VLLB 2XN9B 2DWEB 3WNLA 4QTIL 2A6JB 3DV4B 3MV7B 4MNQB 1MI5E 4TRPH 3WIHA 4YNYA 2ED7A 1NEZG 1GH7A 3TYGH 4JZJC 3FJTA 3NCEB 2QHLA 5J11B 1QA9B 1IILE 3AUVA 1A3LH 5EU3A 1P1ZA 1SBSH 1O0VA 2X1OA 4JCLA 3BKYH 3L6FB 3MRHB 2CPCA 2ADGA 4YZFF 2H2SD 3LKNB 1G6RL 4JANA 4G9DA 3LS4L 1KG0B 1UZ8A 4HGWB 2GTZA 4PREB 4X6CB 1LE5A 1T03L 2D7QA 3RZCD 3DX8A 5JUEL 2YWZA 3MXWH 5GS1B 4ETQB 3SPVB 2FL5B 1FZMA 3PHOA 1D9KB 3B9VA 1R3KA 5F7DB 1AP2B 2DQUH 1MCLA 4CMMB 1HIML 2AERT 1KV3A 4HS3A 3T0EE 5IV2A 2EICA 4X7DC 2J12B 4LVOB 2GAZB 3THML 1CD0A 3CXDH 5C0IA 2X70A 3WEXB 1H9VA 5I66B 4KK8D 1ITCA 3SCMC 4F58H 3O3EB 3ZHKA 1XF2A 4NQUA 1KOAA 3S5LB 2AEPL 5IVOA 5F9JA 4KK6D 2EE3A 3FQUB 4YDIL 4S2SA 3UBXI 1CYGA 4ZO6A 1RD6A 4Q97A 2R29H 3VXUD 1D5BB 4D0DB 1OLZA 5GSRA 4DKFL 3Q3GB 4B41A 2X4QB 2FLRT 1HKLH 5D7JC 2N1KA 4GS7C 1U8HA 3BKMH 5C0BA 3EUUA 2QTEA 4JRXD 1KT2A 3IFLH 2PXYA 3C60C 5GJSH 1MCKA 5EZLA 3MRRA 2QV2A 5BMFL 4LLWA 2H41A 5MENB 4BQ6A 1DBAH 3N1FC 1MRCH 4AMKL 1QG3A 5IBLD 3V7MA 5I1LA 4K55A 1G84A 4HH9A 2UVEA 4O58L 3TPKA 2HH0H 3QNXA 4EN3A 3QUXB 4XHJD 1JTTA 4BH8B 4RGNB 3VCLB 2VDPL 3G5XA 2VE6A 4NQED 1K8IA 2WK2A 1P53A 2XPGB 4JM4L 3OKKA 3RWJA 3VD7A 2GSGA 3VWKC 3WIIL 3VGHA 1NFDF 4PJFA 4WI5A 1DCLA 2I5YH 2VDRH 4MQXD 3JXAA 5F1NA 3U4BH 4PJIF 3RVUC 5E8EB 2ENYA 2JCCA 1Q0YH 1A7PL 1AGDB 3OTTA 1S7TB 5D2LA 3RUGF 5ERWB 1CLZL 1ED3B 3BIKA 4JGMA 3IRPX 4XVJH 3VD3A 4LAJH 3BW9A 2AJZA 3L5HA 1A9EA 5C0BE 1I1RA 1J0HA 4HKXA 3REVB 3HPLB 4JFYB 3OKNB 4R26L 3UPRB 4M8QB 4DKEL 2PYFB 4JFEB 3S37L 4R4BB 1A7NH 4PJ5D 2ADIA 2ADJB 4L8SB 5B38B 1EEZB 3FAWA 5GXBB 4YPGA 4X7CC 3MJ7A 5DI8A 4ODUB 4RFEA 5HHQB 4E41D 5CZXC 5D8JH 1UM4H 2YSSA 1XGRB 3F5WA 1N0XL 2IG2L 5FK9B 3RTQB 1QYGH 3MBEC 4XPFH 2X7LA 3AB0B 2A0LC 1Z0MA 4F15B 2AV1B 4OM1H 2PW2A 2B5IB 4ZAKC 1FJ1A 1MI5B 5HY9A 1W72A 4UAOC 4WHYH 2CLRB 4PJFE 2P24B 3G5ZA 4H1LA 3TBSB 1EVTC 1NUFA 4A6YA 1QP1A 1JFQH 4ZPVA 4LPYA 4X0KB 4OLXL 4JPVL 3MOBL 4QWWC 4NKMB 4RMSA 4XCNA 1BQLL 1FFNA 5D2LE 5D2NC 5HYQA 4WV1C 4XX1G 3H9HB 3RY6A 3BGFB 5HBBA 2Q7YB 4OLUL 5FAAA 4BKLA 1HXYA 4YXHH 3BDYH 4D9QD 3ZLQC 5I1EH 5F7YC 4ZTOH 2X6MA 3WFHA 4PRAB 1ZANH 2WBJC 1VFUA 2I9LA 3BH9B 4PY8J 1X4YA 3GM0A 2R1YA 4I3SH 4TVPD 3SCMA 5MI0B 2VSCA 1KTDB 4XWGH 3VFNA 4BYHA 3KYMA 3NH7L 5CEZL 4ORGA 3VGFA 3QG6B 4JHWL 1PX4A 3QBTB 1I4FB 1LK3L 1CK0H 5DHYA 3MRNA 4WW2B 2P8MB 4JJHA 2OMBA 2BDNL 2CIIB 4LPUA 2X40A 3IETA 1FC1A 3O3AB 4J7RA 3ULVF 2BZDA 2ARJB 3NABL 1UEYA 3RNQA 1L7IH 5D7JA 3UJIL 5T3ZH 4XVTL 5DSCA 2E27L 2VLRA 2PTUA 3X13A 4ISVB 1U93A 2VDQL 3CVHH 1J1PH 1FFQA 1QFWM 2BFVH 1CLYL 2V7NB 3EYUH 1P4LA 2DM3A 2VSDA 4JY5L 2YPKB 4NKDA 3CVIH 5CLWA 2YUZA 5HVHB 1VEPA 4UUJA 1JMXA 4PRPD 1N26A 2FEEL 3K3QA 3H6JA 2G75B 4YBLB 1A6WH 1YNKH 2FX9L 5J1SC 3T77B 4G9DB 3RKDC 4YXLL 1BJMA 3QIUA 1LE5B 15C8H 4XWOC 4J2XA 3GMNB 4MJID 2Z35B 2R2EB 2FEDC 1ADQA 5ITBH 3LMJL 1RZIA 4X7EC 5ICYA 2WWKO 3U0TB 4KRPD 1YNTA 3EOTL 3HR5B 5TGBA 3VXUB 2V5RA 2OP4L 4R3SB 4LARH 4QF1B 4XNYH 3HE7C 3BEWB 4YK4C 2IAMD 2NXZD 1HSAA 1EFXD 4AH2B 1PBYA 3T65B 5ESQB 3BQUD 4F9PC 5J7CC 5SV4A 4QGYA 1I8IA 2D31A 6FABH 1IGIL 5DC4B 2YPLE 5DFVC 3B6SB 3W0WD 3UTPD 4XCCH 1YNLH 1YN7A 2ZJSL 4NPYB 2AK4D 4RSVA 1MLBA 2HTLC 3LEYH 2K3TA 3LY6A 5AUMB 4Z7NF 2W38A 3WNPA 5F9JB 3AY4C 1FNLA 4M00A 2ZPKL 1MCCA 4KQ4H 5CMAB 4HKBA 4HXAH 1MAJA 1AY1H 4HDIA 4XMPL 2VDKH 3QRFM 4LSSH 1OTUD 1XCQA 4NO0D 3LZFL 4XAWH 2XNAB 4GRMB 5IJKC 4U6XB 32C2B 5IFJB 4AK1A 5FFLA 3UYPA 3LIZH 3MBEA 2VABA 3MO1A 1INDH 1D5MB 3DX6A 5F7EH 3SKOA 3P11L 1QRNE 5EZLB 3MRRB 5DA4A 1AC0A 1KLFA 3K2MC 2FNBA 2OJEB 3PP4L 1HHIA 3O2DH 2MHAB 2OZ4L 5KSAA 1ZGLP 3BPOB 3DOSA 4OGXL 4Y16D 5D2NA 4EN3B 4LCWA 4KJPC 4PJ8D 4NCC2 2A74A 3LS5L 3O4OC 2FECI 1YJDL 2OL3A 3QJFB 2Q87A 5DURD 4EOWL 5C0GB 3SGDH 2GUOA 1OAZH 3QCUH 1S7UB 3R8QA 3X12B 3RWJB 2GSGB 4N0FA 1OPGL 2WBJA 2ZCHH 5E08L 1FL5A 1G6RA 1MNUH 3C2SA 4PJ5B 3FFCA 3UBXG 4K3DL 4ALAH 1HILA 4F8TA 1OAYH 3RVWD 1MFNA 3VD4A 3HMWL 2F8XC 4MDJB 4JM2C 3V2AR 3CMOL 5I8EB 2LABA 4CJ1A 4E41B 4KK9C 3SKMB 3WO4B 5TDPA 1C16A 2BHUA 2DRUA 2OMNA 3D0VA 3IJSA 5FYJE 4XBGA 4R4FH 4UQ3B 1C12A 2AJZB 4I18A 5IHUH 4HLZH 3TLRA 5FDWA 4JAMB 2IPTL 3TBYA 3JTTA 1O5DT 1MRDH 1J0KA 4UT6L 4JZJB 5IMLA 5A16A 1YDPB 4ZFGL 2P5WD 1KFAH 4YPGB 3V4PL 4NZRL 1WJ3A 2WW8A 1CGWA 5T33L 1ZHLA 1Q9LA 4OKVA 2BVPB 5D2NE 3E6HB 4LCWE 5JLZA 4LHJB 2X7LB 1U3JA 5D1ZC 5DT1H 4LQ1A 1FFOA 1IC1A 4FZEH 5KTEL 5C09A 3TH2T 5AAWA 2ZSVA 4JE4B 1FJ1B 4RX4D 1KN4H 2MCG1 2X4PA 3LEVL 3GSXA 2R39A 3G5ZB 4OCSL 4OZIE 1KIRB 5CIPH 4UZGA 2W9LA 4HUNB 3KPNA 4LDLB 4MJ6A 5IHLB 5DJYA 3IJYB 3RNKB 1MHEA 3O0RH 1JZ8A 1PG7L 2R4SL 1NCUA 3IFOB 5EO1A 1KJ2B 1DBBH 5E6ID 4LLYB 1AQDA 2I27N 2NTSP 3NZHH 5D9SB 4H20H 2C1PA 3HE7A 5FHAH 1SY6A 3U46B 3Q6FB 5DO2D 2ZUQB 4X98A 1DEDA 3BGMB 4Y4HD 2FH6A 2C3VA 1MIML 1UH2A 2YKLL 1M71B 3BDXA 2QQKH 5FGSA 3L3IB 4UTAH 5C07D 2NLJA 3AY4A 4B7IA 5AZ2L 1I7TB 5CBEA 2HG5A 4PRPB 1LILA 1YA5A 3T04D 3LQZA 2CXGA 5IJKA 1KCVL 4NRYB 1J18A 4IMKC 2H32H 4DFIA 4GS7B 5A2KH 1KACB 1MWAA 4ZSOB 5DSCB 2YPLB 4FQJH 5KN5B 1L9NA 2BY1A 4N0UB 3R06B 4P9HH 3QYCA 1CICD 2A9NL 2CKBL 3C60B 4MJIB 2R0KL 2WINA 3HUJA 3U48A 4FFYH 4W4NA 5LVEA 3FONA 1IC7H 3MRMB 4NKDB 3UTTE 4KRPB 4LSPH 4V1DD 3V5HA 1KLUA 4K3GA 5DDHB 1LDPH 1KYOK 4RIRA 1VERA 2IAMB 3FCTA 5GRVL 1EFXB 1V7NL 1C5CH 1QFHA 4PB0H 3L7EA 5GZND 4K3EL 2C7UA 5BJTA 3QXUA 5HDBF 3BWUC 1QRNB 3O9WC 5JQHC 5T1DL 3QDJD 2AK4B 4X6BB 5H37G 4GMTL 3VWKB 3JV5A 1E28A 1TZHA 2AV7A 2R69L 4OBSA 1BAFH 3MPCA 3ROLA 3T4AA 4XPGH 2CJUH 2WQ8A 4JM2A 2APWA 3D3VA 4ONHA 5AWNH 1MVUA 3LN5B 2R2HB 1YY8A 1HSAB 3MLZH 1CGSH 4N0CC 4A2LA 5IW6A 2W9DL 5I74C 3G9AB 5AYQA 3TYGL 3L7FA 1GIGH 1CXIA 4P48A 3QH3A 2ARJQ 1ONQA 1N7MH 2XTJC 1YJDC 2NY5H 3ZE2F 1UXWA 2I07A 1A3LL 1SBSL 1RZ7H 1RURH 1VADA 3GMPB 5FA3B 2B39A 4GOSA 4E5XB 3GKZA 4JB9H 4AZ8A 3CX2A 4Y16B 3D25B 4XMKH 4ZS7L 3QUYC 5I8CA 3OB0K 1I3GL 4ODBD 1MHPH 3MBEB 3DIFA 3MXWL 4YHYC 4ZAKB 1ZVSB 1INQA 1S78C 1T2QH 3FB7B 1R5WB 1WK0A 1IAIH 5C6PB 2KPNA 4L4TA 4XXDA 4YIQA 3K4DA 1GZQB 3QEQD 4K9EH 2EDXA 5DRWB 5JIPA 4S1RH 3MZTA 2HJLA 2IBGA 4PJCF 5D2NB 3SDAC 4E0RA 3ARPA 1XGTB 4WV1B 4F58L 4X5XA 2VRAA 2ZZUT 3UAJD 5DVOA 4J1UB 1J7VR 1MELA 4Z0XB 2AKRA 2WBJB 2SEBB 2NXYC 1JZ3A 2R29L 4HUUA 4P57B 4GG6B 4JFQB 4F7CA 2JF1A 1RK1B 4OZIB 4OB5H 1FNHA 5EOTA 2P5WB 4I48A 4R96B 4PJGF 3JVGA 3UZQA 1HKLL 3O2WL 4WDIA 3BKML 2GJZA 3BO8A 5CEZE 3IJSB 3OJ2C 3SDYH 3RVXD 5GJSL 2CR6A 3F7QA 1KIQA 4CVZB 2ESVD 1PW3A 4BZ2H 3VXNB 3GI8L 2HWZH 3V7AE 5CKAA 1DSFH 2EEBA 1DBAL 2A73B 1MRCL 4NSKB 4O2CA 1DQMH 2M8XA 3IFNH 3SGKC 5LAXA 1QR4A 1G7JB 3D39A 2HH0L 4GW4B 2BVTA 1BREA 2H9GB 5F7LB 1Q9LB 1S3KH 3CLFH 5E6IB 3T0BA 1WVZA 5C08A 3HC0A 4JFHD 3CFBA 1EEUA 3BD4A 5EU7C 5GRYA 4BM7A 5EOCH 2EO1A 2VDRL 3B83A 4JZOB 4DCQA 2E7LC 3U4BL 5L8LB 3TBTB 1NLBH 4FNLH 1Q0YL 1R3LA 3O9WA 4LVEA 5C0CD 4GSDH 3GSNH 3KPRD 1IT9H 4ONGH 5KW9H 3WHXA 3IDIA 1AD9B 1X5IA 4MJ6B 2ID5A 3GEWB 1W0VB 1MHEB 4U2ZA 1DQLH 5FUCC 2PYEA 5C3TA 4XVJL 3UTTB 5HHPB 4LLUA 5EO1B 4ZUWA 4F7EB 1XGQA 2R0WH 1QFWI 3GBMH 3EOAA 1ZGLM 4X6CF 5C9JA 2OZ4A 1E0OB 1MF2H 4HWZB 1FL3B 1A7NL 1RU9H 4OM0L 3ECBA 2A1WH 1W8OA 3CC5A 3KPLB 3FRPA 2X4UB 3X3FH 1UWXH 1QSEE 3QCTH 1R5VA 5D8JL 3D39E 1F2QA 2J2ZA 4WTZG 3OKLB 5H35A 1QYGL 5GGSB 3BDBA 5C08E 4LNRA 4OM1L 4XHQA 3P9MA 2X4TB 3TO4D 3WS3B 1GGYA 5FCSH 5F70A 3C8KB 1NGZA 3QUYA 3RFZC 2XQYK 5EIQA 4WEBL 1EUTA 1XIWC 5DJ0A 4J3WA 4FQLH 4KI5F 5GISH 3V0WH 3VXRA 3WL9B 4RRPA 2PYEE 4CU6A 3LN9A 5CINH 2DF3A 5SWSA 2IF7A 3V5HB 3P30H 4Z9KB 1DQDH 3FOLB 3DTXB 3H9SE 3LEXA 3PXJA 5B8CC 4YXHL 3BDYL 5I1EL 4ZTOL 3AS1A 3SDAA 3QXAA 2DI8A 3VD9A 5E8NA 3L7EB 3O4OB 4I3SL 1OP3H 1QLEH 1QZ1A 1U91A 3BISA 4OZGA 1NCAL 5EOQH 5BJTB 2HT4C 4XWGL 3C2AH 1MOEA 3VMOA 1RJZA 4PJXB 5EWIH 4ACPA 3QXTA 3Q5TA 1MQ8A 1CK0L 2XTJE 5C71A 4RGMC 5JW4Q 4CJ0A 5FHBL 2O5ZH 1LO3H 2YC1A 4P59H 2EIZA 4X80L 4LOUC 3ROLB 1C08B 1WFUA 4UIMA 1TJIH 4MS8D 1L7IL 1VB9A 5T3ZL 3GDBA 1M7IB 3DROA 4MVBD 5ALCH 5CD5C 3VGGA 3KXFD 5EPMA 5IW6B 2RIKA 2AJVH 4OLEA 5JHDA 5IEHA 3CVHL 1J1PL 4MJ5B 3WKNA 2YBRB 4OBRA 25C8H 2BFVL 3EYUL 3RJQB 5SX4I 2A77H 3CVIL 5DMIH 1NDMA 4N1HB 4OCWH 3VI4F 5J0BA 4J3XA 4MWFA 2X9WA 3OAZK 3P9LA 1PZ5B 1KPRA 4GG8B 1FZKB 2IAND 5IQ9A 5FYKH 1WLHA 1A6WL 1YNKL 1L0QA 2OTUA 3QEQB 4G8EA 5J06A 4Y4FD 4I0PA 4RWHA 5I2IB 3B2UC 3TCLA 1IM3B 4KRNA 3NVQA 3TPUA 3MRQA 1A6UH 1OF2A 3NBNA 1HXMA 4ZUVA 2EEDA 4QT5B 1RULL 5D1ZB 4NFDA 2I25N 3V9FA 4OT1H 5ITBL 1WTLA 5KAQF 2D9QB 1U8IB 4Y4KC 5D7IB 4X6FA 1QSFA 1ORSA 2Y07H 2E7LA 3GMLB 4KMTH 2HT3D 3VFRA 4LARL 2G5BA 4YGVB 3VRJA 4XNYL 4J3OC 2HTKD 5JW4R 1KUMA 4QLRA 2R0LH 4ENED 2GITA 1J8KA 2CKBA 3LKQB 1CF8H 3BJLA 3BAEL 4XTRC 4R9HA 4M02A 6FABL 4MNHA 1Z5LA 1CL7H 5FYKU 5BW7A 2ZP0T 1BZ7B 3O6KL 1YNLL 5IM7B 3ZE0E 3MBXH 4XPTH 4M8VA 4KQ4L 2OR9L 1IJ9A 4HXAL 3ZL4H 1AY1L 4IRZH 2VDKL 4RA0C 4XAWL 3C6LB 1S9WB 4F7CB 5DJCB 1U36A 3P0VL 5FO9A 1I7UA 4Z6AT 1KXTB 5DHVH 2XQBH 4KFZC 5F7MC 2DQEL 1INDL 1CBVH 3C5ZC 2B20A 1GOGA 4ZUSB 5EU7E 2VDNL 1NCNA 1CDHA 2MQCA 1QSFE 1YYLH 3MRGB 2N4IA 5JIKA 2H8PB 4JRWA 1XIWA 4QGTA 4WW2F 1QSEB 3PQYE 1JWUA 3KPRB 4TTGA 3O45B 2ZG2A 5CJ8A 1BD2D 1I1AC 4Y5VC 4XPBH 5L8KB 5FUCE 4JLRB 5J9PA 2O5YH 4KTEL 4BSVA 1EDQA 1IMHC 4KVNH 2EYTB 5EUOE 3TA3C 3G6AB 3IJHB 1OAZL 43CAA 5JHLH 1ODAA 3TWCH 7CGTA 1KYOJ 2HMIC 3CPLB 1MNUL 2J6EA 3UTSE 4ALAL 4MX7B 4XVUD 1OAYL 1T66C 4O2FB 3MACH 4OFYD 3O81A 3ZMRA 4PRHD 4OJFH 4NC2B 1YMHA 4OCRH 5F7FA 1R3HB 4NQTA 4JHZA 3MQIA 2FO1A 1PSKH 2NY4C 3MV8A 4B7LA 4K7FA 5DUPL 1UVQA 5HPOA 3EJZC 4EBQL 3UDWC 4AIXA 5ANMB 1WC7A 3H9SB 5HI5C 2VERN 3BP6A 3AREC 3K8MA 4YFDB 4Z5RA 1RV6X 3QZWB 3SQOH 4K23H 3P73B 4ZD3H 1MCPH 1MRDL 3QJHB 1FLTX 1U3YA 3PF2A 4YO0A 1TZGH 4AEIH 3MRLB 1KLGA 4WO4D 1Q0XL 4N1EA 2D03H 2ZUVA 3FT4B 3JV4B 1MFEH 2MSPA 4FFVC 3MA9H 4JY4B 3FMGH 5EIIA 3OHXA 1CFNB 3K2UL 5GS2D 5DRZA 1KN4L 2W0FB 5JXAH 4XAKE 3W9DA 4PJ9C 3GSQA 4KWUA 5HYJA 2RBLA 3SY0A 1OP9A 5EZJB 1R6VA 3OKOA 1X5KA 3IF1A 4Y4KA 4YHYB 3O0RL 4H26B 4FTVD 5CEXA 3WFDH 2DQHL 4OUUA 1P69B 3QQ4B 1FHGA 4TUOB 5D6DC 3OB8A 4L5FH 5DD6A 3DX9A 3L9RB 3NZHL 5IBTH 4H20L 4NGHL 4ODVL 4MLSA 4MNGE 2B2XH 3WFCH 1WISA 1Y18B 1WAAE 3BIBX 4FP8H 1BM3H 3SQBA 2BC4B 3LEXB 5I15L 3SDAB 4J4PC 3RA7H 4JFXB 5CEYA 5F89A 1BOGA 4DN4L 1HHJA 3NFPA 1QHOA 2QQKL 4LGPB 1VGKB 4UTAL 5ACZB 3W2DH 4AENB 4XC1H 5IFAH 4LEOB 2NXYB 3HI1B 2ZSWB 4C83B 3FN0L 1QBLH 3RWEA 4OD2B 4TTDC 4PGEB 5I16A 4Y4FB 1S5HB 3M17A 3DJ9A 1QSVA 3MUGA 4P23A 1NUGA 1T4KB 2NZ9D 5J6GB 4NRZB 2G9HA 5T1KA 2ZUTA 4OF3A 3C5ZA 4QRRA 1EV2E 5BS0D 4P9HL 1JRHL 5FM5O 5HYJE 1AGFA 3MRKB 5I76A 4FFYL 1FC2D 2XKSA 3H0TB 1F4YH 4HJ0D 1IC7L 4D0CB 1R24A 4LSPL 4U1GC 4PLKC 4WI9A 1UJ3A 1LDPL 4P2OC 1KPRB 5DJAB 1I1AA 2ZCKH 4Y5VA 4G8EB 3VGAB 1B6DA 4GFTB 1C5CL 3GB7B 1AGCA 4PB0L 3AGVA 2O61A 4HS6B 1KTLB 3NIFE 1JF5A 2P8LA 4P4KD 4F9LC 1OF2B 1HXMB 3QB7C 1QBBA 1WIOA 3E8UH 3UTZA 4G6AC 4X6FB 1MLCB 3PABB 1K9TA 3FOMA 4XPGL 2CJUL 4HEPG 3BN9C 5EZIH 1ZKAA 5K9KB 3QQ3A 3PQYB 4OQTH 5AWNL 3RBGA 4HBCH 4QHNA 4ZFFB 4X4YA 2GK0B 3MLZL 3MNVA 1CGSL 4GXUN 4XZUA 4JQXC 3FKUS 2W65A 4KROC 4DK6A 2CKBB 5SWQB 3KWWA 1DBKH 2XA8H 1GIGL 5DK0A 4MNHB 4X4ME 5EUOB 4QRRE 3MJ6A 1HH9A 5BV7L 1N7ML 3WSQH 4TSAH 3AREA 4FQ2H 2E6PA 1MFAH 1JZ4A 2NY5L 2WLZA 2FZ3B 4JFFA 5CGTA 3UTSB 2VR5A 3U7AA 1RZ7L 1RURL 1UXSA 2BRRH 1FO0B 4P5TC 3V5DB 3EZJB 4LSQH 4NZUH 5KSBA 1LEKB 3DUSA 4Q9CA 3IT8D 4PYGA 1HINH 1JPFB 3NCYP 4JVPA 1BD2B 4MCZA 3IGAB 1HKFA 5IT2H 2BMKB 3UEZA 1FNSH 2FBJH 5E4EC 3KS0J 4PV8A 4BK4A 3REWB 1ZHKB 4JKPH 3QUML 1X5LA 1FDLH 2BCKA 2A6DA 3GSRB 2IMMA 3MV9E 4PJ9A 1IAIL 5CJOH 2AJXH 1EAPA 1K4CB 2V7HA 3QDGE 3LQMA 3RWIB 4JDVA 1I8KA 2DQIH 4Y2DC 1RUQH 2ITCB 3A6CH 3G04B 2FJFA 3O8XD 1TPXC 4WJ5B 1JWUB 1JWSB 3EYVA 1C5BH 4FFWC 3CVHA 4S10A 8CGTA 4G3YH 1ZV5A 4YX2H 2IPUK 4S1RL 1OM3H 4YC2B 2UWEB 5IF0B 1PQZA 2GJ6A 3DGGA 3V5KA 4IOFD 4JN2A 4HX1A 4EKXA 5B8CB 1FZJB 3FHQA 4EIZC 5JNYA 1RJYA 2NY3D 4ODSH 4G6FD 3GSVB 4J4PA 3BXNB 2BOBB 4JG0H 4OB5L 2BNRD 3SBWC 2EO9A 5DJ6B 4V2BA 4P3CL 1RMFH 1YMHB 3HZKB 1U58B 4J3SA 4XCFL 1BJ1H 1DLHA 5IVXA 4RGMB 4I8DA 4QXGH 4YUEH 3LSOA 3RWHA 4BJLA 3CLEH 4MQTB 3KPPA 1FH5L 4X6DE 5D7KD 5C0ND 2WUCL 5FB8B 3SDYL 3MRPB 1DQQA 4MNGB 1YQVH 3T3MF 4LCUB 5H2BB 2L7JA 2ICEA 3LV3A 4P5KB 5HGDA 4FQIH 2WLYA 4OTXH 4BZ2L 2DJSA 1J05A 4O02H 3VDBA 2HWZL 4G9FD 3U7WL 5KVEH 1DQML 3BP5A 3IFNL 1AR1C 3VRLE 1ZWIB 4POYA 5T3ZE 2VC2H 1FAIH 4DVBB 2AJYL 3CK0L 2FIKB 4UNTA 2EECA 1HHHB 4ZFZB 1T21B 3ILQD 1K4DA 4NNXA 1DUYB 5HGBB 1CDCA 3P4MA 1BIIA 2YD7A 1TETH 1ZXQA 4DZ8A 2Y5TA 2GJ6E 2APTA 3NCCB 1KTKE 5EOCL 4EQ2A 5E00B 4F9LA 3W9DB 3S7GA 1NLBL 4FNLL 1FVDB 4GSDL 3GSNL 4ONGL 5KW9L 4HWEH 1NMAL 1HI6B 4UQ2B 4Y4KB 2UYLB 3QIBC 4JPIB 4P9HC 1EGJH 2QQQA 3P4OB 3UXFA 2DLIA 2NNAB 1VACA 5EBWB 4NO2B 3PIQA 3GBML 3SKUD 1XGUA 3O2DA 4NP4H 4JO2L 1XR9B 4Z78B 1MF2L 2RQ8A 1FNFA 2X4NB 4P3DA 2A1WL 5CHNB 5BS0B 4GKSA 3RWCA 2VN7A 3X3FL 3S8WA 3RI5F 1X4ZA 3K7UA 1BOGB 4DAGH 1K5NA 1MJUH 3MYZA 1HHJB 3EOBA 4G8GA 2ICWB 5J57B 3IXAA 4P5TA 2JJVA 2E9JA 4NO3A 4JFDD 1YEIH 5AZEH 4BA8A 1XZ0A 3WLBB 4HFUH 4OZ4A 5E99H 4OIBA 3PNWA 1ND0A 3MUGB 5DC9B 1EHNA 4P4KB 2F54A 5DF0A 5C0AA 3NTCH 4QRRB 4X6EB 4GG6F 4XI5D 5GISL 3MR9B 4OZIF 4YQXH 4QRSB 3HB3C 4HIIB 3TIDA 4QRUB 5BV7C 4Y2DA 4QRQA 2VLRD 3CFCH 4NC0B 4ODWA 3ZYJA 2NY5C 2P47B