1IARB

Interleukin-4 / receptor alpha chain complex
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
197
structure length
188
Chain Sequence
FKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAAGISYRARVRAWAQAYNTTWSEWSPSTKWH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (INTERLEUKIN-4)
publication title Crystal structure of the interleukin-4/receptor alpha chain complex reveals a mosaic binding interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/receptor
total genus 37
structure length 188
sequence length 197
ec nomenclature
pdb deposition date 1999-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09238 IL4Ra_N Interleukin-4 receptor alpha chain, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1iarB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1iarB02
2DICA 5GRUH 4F33B 4PLJC 2FB4L 5CIPB 3SOBH 5F6IB 5E2UH 3ZYIA 1A8JH 2MKWA 3CDYA 4LHUB 1G7MA 5I74C 4CDHA 4P3DB 1T5XB 2JKXA 1HQRA 1IAKB 1NL0L 3ROOA 4A6YA 1D7FA 5IW6A 4PV9B 3SE4A 5IEKB 5F72S 2HT2D 4HKZB 1II4E 4XPGL 1T0MA 1Q8MA 4PRNA 3BP4A 3OTTA 1JV5B 1LO2H 3IB4A 2DJUA 1ZGLP 3GK8H 1HKFA 2I5YL 3O3AB 2NY1D 4GS7C 2PYFA 3SGDI 4EI5D 3R06A 4Q58C 1A0QL 1A21A 2R2EA 3UTQA 2HLAB 2ZG1A 5MHSD 4J3XA 3QEQB 3ARZA 4Y2DA 4JPKH 3I50H 2GJ6B 4QHNA 1FZKA 4OF3A 1N5AB 2LABA 5SV3A 1KB9J 4ZDHB 3ARYA 3RWFB 1U9KA 1OM3H 43CAB 3PL6C 3FFCA 5H35B 4MNGB 3ARPA 2OI9B 3LHPL 4QRSA 3ZL4L 1F3DJ 1RV6X 3S34L 1EVTC 3PP4L 3EOBB 5LGHL 1D9KA 5BVPL 3L3JB 1K8DA 1I8LA 2O5ZH 2VH5L 3BJLA 4PJ5D 3U48A 4LRNH 1IM9A 1AXTL 1PLGH 3GJEA 3VXUB 5DD5L 1B0GB 3FT3B 2R56L 4Z0XA 1A14L 3UJIL 1LEGB 2XN9D 1UC6A 4PRAA 4X6CF 1NC4D 1OTUC 2AJZB 5FV1L 1WTGT 3PWPD 4NJ9L 2X42A 4EN3D 3PQYB 4HMDA 1MHEB 3RWGA 5SWSA 2WLYA 4Z7VA 5IKCB 4UILH 1RUKL 3H6JA 2HP4A 1AGFB 2FIKA 2V9QA 2XWBA 4LSPH 4FQLH 3TYGH 5ID1A 1JTOA 5IB2A 1S7WB 4PJEB 1A7OH 1YEGH 1JNLL 3BPLB 1CFSA 3TBYB 4ONOA 5M7QA 1U95B 4FZEL 4XMPH 4KVCL 3V7AG 5C2BH 3IFLL 5HHQB 1ZHLB 4LVOB 2H3NA 5I17B 2WAHA 5GRWA 5IF0A 3EDFA 3D0LB 1F58L 2CRMA 4PS4L 1QVOA 1WC7A 3ILQC 3TN0A 1J05B 3AREC 4Y16D 5EO9B 5F3HB 1I85A 1S3KL 4X5WB 4KK5D 4KKBC 4NJAH 2Z35A 3ARRA 2YMXH 3OKDB 4WV1C 5L7XL 3TVMC 4NO0B 1LK2B 5C09E 2LU4A 3OAZK 4G9FB 3FB8B 3GJFK 3P3YA 3PWJB 5C0JB 3PV6A 2WBJA 2W91A 2IALB 3SKUD 3IDXL 3IF1B 4MD0B 3BO8A 4JY4B 4IRZL 2RAMA 4OT1H 2O93L 1E4KC 1MJ7L 5EIIA 3D39A 1H9VA 4L3CA 4S10A 2A77H 2UY6A 1BFTA 3R4DA 2DQUL 1LE9A 5J56B 4GOSA 1REIA 4RFEA 3QG6B 3QQ9D 1OARL 2DQGH 5C0BD 2IAMC 1BQUA 3S36H 2W0FA 4YWGH 1NFDA 5E7BA 4HS8L 2R9HC 3IU3B 2WP3O 2DQEH 4LLWA 3UXFA 1IEAA 2R0LL 3VWJB 3EHBD 1MHCB 3HB3C 2AI0L 2APVA 1J0JA 2FHFA 4OAWA 3EYSH 2F53B 2WWMD 3D18A 2YUZA 4GG8B 4BUHA 5F88B 3WD5L 1GGBH 4PJBE 4XNUL 4WRLA 2ZG3A 3Q6GL 2P5EB 4TULL 4Q97A 2HTLD 2I9LB 5AUMB 2F5AH 4S2SA 2Y5TB 4L29A 2A9MH 2A6IA 3KYMB 1EEYA 4WU5A 1L6ZA 1DBKL 4O5LH 3V5HB 3QUKB 1YYML 2P45B 5JDSA 4LU5H 3D3VE 2GAZB 2WIMA 5DQ9B 4U1NB 3JTSA 3VE0A 2H26B 3CXDH 5HHOB 3RZCD 4XC3L 4F15B 4JQIH 5DR5H 1J0KA 4LMQE 3LKOA 4NO3B 2VC2L 5JXAL 5CCKH 1E6OL 4TSBH 4HIIA 3GIVA 3VXMD 1AE6H 4KQ3H 4M6OL 1F4WL 3E8UH 3P0VL 1IJ9A 1BX2B 2EH7H 2H2PC 4JREB 4FQ1H 4RGMB 3RUGE 5A2LH 4KAQH 3L7FA 1F6LL 2MFNA 1NLBH 2X10A 4HWEH 5D9SA 3S36X 1LP9B 4G8GA 4K3GA 3C6SB 5I1EH 1OGTA 1TLKA 4JPVH 1FL5A 2BNUA 2PTVA 1CGUA 5C7XH 4WW1A 3HUJA 4OF0A 5BO1H 3MFFB 1X6LA 2EDDA 1DL7L 1HEZA 3TT3L 2YWYA 1CTOA 3L3DA 1RHHA 4R4FL 1A1MA 3HPLB 5HYSG 4M4RA 4BK5A 3MLPA 3BPOC 4P99A 5JUEH 4KFZC 3MRHA 4K8RL 1BIHA 3DETD 5C0AB 1FH5L 4Y4HB 4I0KA 4M7LL 1CXEA 4H1LA 5DI8B 4D9QE 5CBEA 1CR9L 3DHJA 4LSVH 1C7TA 4JFOB 2NLJB 4P46D 5IESL 3X3FL 4ZO9A 4PGEA 2QADC 4ZAKB 3NCJL 4BSVB 3H3BC 4BM7A 5INDB 1ZS8B 1HN1A 4W68A 2XFXB 4OFYD 2VXSH 3MJ7A 4YAQB 4JFPA 1K5NB 3MMEA 5IT2L 5DRXA 4CNIA 4GW4B 3C5ZD 5HYJD 1FNEA 2HRLA 2X4SA 2P24B 4C56A 4EXKA 2A83B 1U8PB 3NA9L 4RIRA 4YHLH 3JWDL 1A7PL 1D9KD 5F9AC 5EIVA 3T4YB 5IQ9B 2H1PL 1U92A 5C8JB 1C16A 1I3GL 1QQDB 1CL7L 1U8KB 3H9SB 3Q3GA 4KU1A 4EUPA 1U41A 1F02I 1AKJB 4N0RA 4PJDF 5BW7A 1QBBA 2OR7A 2Z4QA 1WZLA 1DBML 4N68A 2BNQA 3FB5B 2XWJA 5CP7A 1XF4A 1LEKA 5EH1A 1KJ3H 3MNVA 4B0MM 4NQEB 1PQZB 1G9MC 3UDWA 4ODUA 4DFHA 3SCMB 5CGYD 3TNNA 4LSQL 1JZ8A 5LGJA 5FV2A 3W0WB 1GJIA 4L9LB 4HULB 3MJ9A 3SO3C 4J12A 5D2NE 4ONGL 4UAOB 5JXED 2WLZA 3S98A 1WWWX 4G8EB 1KSRA 3QQNA 3P4NA 5DMJB 5ISZE 5C2UB 3H0TB 2QQLL 2V5TA 4FTVB 2LV4A 4Y4FD 5D5MA 5KSAA 2R0WL 5IFJB 4HBCL 3U30B 1L7TL 4JG1H 3O4LB 4P5TB 1DEEA 1OY3B 2EXWD 2IC2A 1KXVC 5MI0B 1NUDA 3ZDYF 4OD2B 1T0NA 2BNRB 5GS0H 3IDUA 2NTSP 3IRZA 2VSCA 2DMBA 5FOJA 5JPMA 5F93C 3ULUD 5F1OB 3I6GA 5HHXL 3SDXA 3VWJC 2VERN 1K9TA 2WBJD 3HFML 5I30H 2YSSA 3AB0B 4KGJA 3B5TA 4LHUG 3OB0K 1AD0A 5F70A 1KCSL 4PR5A 4KKNA 1VFBB 5EORL 2P42B 1SEBA 4JDTL 4YUEL 4QTIL 4TVPD 1AC0A 2XT1B 4GRMA 3FAXA 3UTSA 4M5YH 3VWKC 2ZUQB 1PG7X 1OTSD 2X4OB 2ICEA 5FDYA 5DZOA 1N2RB 3C5JA 3H42L 4KJYB 3DMMA 1GGUA 1KJ2L 2J4WL 3N0PB 1W72B 4N5ED 4DVBA 2OR9L 4JJ5B 3IDYB 4OZ4B 3SE8L 1OQOA 4LASH 2CKBH 4JRXA 5SWQA 3MA9L 1OPGH 2PYEA 2K1MA 3B5GA 1U91B 1CLYL 5D1QB 4Z7UB 4PJXF 4LQFL 1P69B 4HCRL 5HDBE 3CFIC 3QDGB 4PRPB 4WFHD 4CKVX 1XCTA 1N8ZB 4P59L 1TPXC 1NCNA 3KPTA 4JREC 3NA4A 3KLAB 4LL9A 1QO3B 2VL5A 1Q1JH 2OTPA 4HX1B 4UOW1 4QRUA 5HJ3B 1FG9C 3B83A 4JO3L 3U82B 3RL2A 4P4KB 1TQBC 1J86A 4XNZB 1NDMB 2XQYG 3SDAB 4Q9RL 3SDCA 4YNYA 1SQ2N 4KVNH 1MHPH 4XRCB 2WBWB 4NZUL 1H15A 2E6QA 2MCG1 5HI4C 5DRWB 2FX8L 3D69A 2Y9RT 3VXSE 1MI5B 3F12B 5D93C 3B2VH 3O81A 5FYJL 1WWAX 1FZJB 5BS0D 3PXHA 4YHNB 2B4CH 5JNYB 4M7KH 2EZ0D 4POYA 5I1AB 1NEUA 1CU4L 3VXNB 2FO4A 3CUPA 2H2SC 1IKFH 2IPKB 4LAQH 4RMRA 1ACZA 5ENWA 1OSZB 2AJXL 3O2VL 5JIHA 3MRCA 1VENA 2OS7A 4RZCA 2IANA 1U8NB 3BZEB 5EU4B 4G8GD 3VI3E 1KENH 5GRUL 4O51B 1CYGA 2W65A 4NQCB 2XG5A 3P77A 1NLDL 4HUKB 4NKMA 4QXUH 4OFKA 4CRPA 1A47A 3MGAA 2YD1A 3L5XL 4YHPA 1IQDB 1T0PB 4YFLF 3HZYB 2VDPH 4WDIA 3CLEH 4RFNB 3D2UB 1F4YH 3S5LB 2VWEE 3QUYC 1A9BA 4WU7A 3AVEA 1P1ZB 4P2RB 4ETQA 3FQXA 4QYOA 3VFOA 2AXJA 5T5FL 2ADGA 4ENED 1FBIL 2RIKA 2G5BB 5DFTA 3RGVB 2ZWLT 4PRIB 3UO1H 3IDMA 3WNNA 4LDEB 3LQAL 4RISH 5EOTA 1MCNA 2CR3A 3MRBA 2X41A 1TVDA 3LSOB 5FGBC 4CAGA 2Y5EA 3BW9A 1ZHKA 3U4EA 5JQ6H 1OSPL 3QZWA 1NDGB 3N06B 3I50L 1NGPL 5D6CA 1J8HA 1G9NL 1YEKL 1C08A 5JIPA 3WNLA 5IWLA 1KC5L 1WLHA 1C5CL 1RI8A 2I9TA 3TPUA 1R5WB 2EEBA 3HLAA 3QUZA 1OM3L 4BFIB 5L2KA 1ZXQA 1U3ZA 1HCVA 3EFDL 5EUKB 3NTCH 4R7NB 3GNML 4HXBL 4ZFOB 3DYOA 5I6XB 1ROWA 3QH3A 4O2FB 2OR8A 2EE3A 3GSNL 5FCUL 4WUUE 3MRKA 3OKNA 5CHNA 1OT2A 5DLMH 4LLDA 4PJEF 1YJDC 5BV7B 3RVWC 4L4VE 3SDDB 2Q87A 1V5JA 3WXVL 3WFDH 4OQTH 1YEIL 4JLRA 2IBGA 1PYWA 3MGTB 1A6ZB 4HKBB 1GCFA 1CBVH 2NX5A 2R1XA 4GKSA 5CIPH 3G6AA 5I71B 2IQ9H 4LLQA 2K3TA 3BYYA 4HH8A 4DW2H 2A6JA 5JA8B 3SY0B 2YRZA 2Y07L 2B8OT 3LH2L 5FA3A 3EO9H 1U8IA 4URTB 4XCCL 4L8BA 1T89C 4GMSH 1BAFH 2A9NH 1WBZA 5EIQA 3UYRH 3QFJA 1S7UB 1G7QB 3V6ZB 4K23L 3DRQA 3DROB 3GMMA 4Y0GA 4OFDA 5DQDH 1SYVB 4XX1G 2RFXA 4X5XB 1NMAH 3CFBB 2XV6B 5GJTH 4PJGB 3WIHH 4QNPE 4IIQC 2X5PA 5KTEL 2N4IA 2CD0A 1MUJA 2VLRB 1FO0L 5B22A 4AL8H 3ZKQD 2X4PB 4NNPL 3FT2B 4OZHA 5AZ2H 3FQNB 4P23C 2EYSA 3GRWL 2WZPD 4ZPVA 1MVUA 4GG6F 5I1IL 4YDLB 4H25A 3R8BB 2GFBA 5D1XD 2Q7YB 2HVKB 2O5YH 5ETUB 5E99H 4V2CB 4NNXB 2EIDA 4NZRL 2ZOKB 5L6YH 7CGTA 5IR1A 3MJ6A 1QFWI 2HVJA 3NFNB 4UV4H 3BZ4A 1JHTB 4RFOL 3OX8B 4X6DF 1OWRM 3RA7H 1QSFA 2DQGL 4BZ2L 5L8JB 4FN0A 2EO1A 2N7AA 4BQCA 3N85H 4BSWA 5A2FA 1ND0B 2AEPH 1IBGL 4ODSL 5F7HA 3SKNB 3LEXB 3EYSL 15C8H 1JN6B 5EU7E 2GSIB 4E41A 4JDVA 1VADA 5MHSE 1P6FA 2FH6A 5EFIA 2O5XH 2HMID 1Z3GL 2FEEL 3MREB 4XGZA 3SDCD 4MNQD 4K71C 5F3BB 4GRWE 4FP8H 1P7HL 3OZ9L 3E3QC 5EBLA 5F7EL 3MLTA 4B50A 1QYGH 1FN4A 4PP1C 3HNSL 3C60B 3T8XA 5IFAH 5TE4H 2AQ3A 2VL4A 5EO0B 5E6IB 1YEEL 4TUOB 3O11B 3WXWL 1BECA 3MLXL 4K94C 3VFRA 5CJOL 4JZJB 4ZS6C 5C92A 4M1DH 3B6SB 5J12C 4PJ5E 3IFNL 5E8DH 4GXUN 4PTTA 4FXLA 2YRPA 2P44B 4KQ3L 3V6OE 3ARQA 3O45B 1UACH 3P9WB 4TTDD 1OGAE 3D87B 1PKQB 2CDEB 5KVFL 1U8OA 2MNUA 3PWPE 1PD6A 3E1F1 3FQUB 2H8PA 5HI5C 5FOBA 4YBQC 4HPOH 4AG4H 4E42B 3SKOA 5I1CH 5EO1A 1SM3L 4X8XA 4KAQL 4XPTL 1INEH 3ARFB 5E56A 5FO7B 1MRCH 1FC1A 2P5WB 3S3PA 3G6JB 4MXWL 1NFKA 2CK2A 1FP5A 5JW5B 1P7QB 1OAQH 1QLEL 4V2BA 5HVGB 4G8IB 4D0BB 1H5BA 4Z95H 2H32B 5C7XL 3VCLB 3VDBA 2R23A 1JHLH 5JOFB 1A7QL 3RVTC 1DUZA 3HMWL 4ZXBA 1EBAA 1I1AA 2NQCA 2VDNH 4KV5E 4Q2ZA 2J8UB 4WWKB 1AFVH 5DUMH 1RIVH 4ORGB 3EGSA 1HZHL 1Q9LA 4ELME 3CK0L 5GRYA 2LE9A 2PO6C 3NGBC 1ZGLA 2X1QA 4Y19B 2J5LB 3AXLA 2XY1A 5IHLB 4P9HC 5HGBB 5F7LB 5ACZB 2JB5H 1T1WB 3MV11 4LSVL 3O9WD 6FABL 1DVFA 4HLJA 3OL2A 3SGJA 1BBDH 1TXKA 1QR1B 1J8HD 3KPRB 3RWEB 5KVDL 3VFTB 4I18B 2VLKB 4LLUA 1I75A 5F9WC 3VXTB 1L0XA 5L2KD 3CC5A 4DTGH 4OQ1A 5ACMA 4X6FB 3QPQC 3ZT6A 3GMRA 1NUGA 1EPFA 4YHLL 1BFOB 2CMRL 3FOMB 1V3JA 1TITA 3BEWA 4U1HA 5C0BE 5EC2A 3MNWB 2R2CA 3UMTA 3EKCA 2OTUA 4JFYA 3ZKSD 1MLBB 1F6AB 1Q0XH 4WEUD 2YHGA 4P3WA 4CVXB 2HH0H 2DWDA 4A2LA 5CP3H 4RNRB 5HHMD 4Y1AD 3PP3K 1PAMA 4QCIB 3JTTA 4U1MA 4LVEA 1R5VB 3N1GC 3QHZH 4ZOCA 4DN3H 1OW0A 1XGUA 5DWUL 5D7IA 5DJZA 4M7JH 2J8OA 4XVJH 3DSFH 1RAMA 2B1AH 5DK0B 2KQMA 4JO2H 5GGTH 2AABL 5CJ5A 2HTKC 3TWCH 3UC0L 2AGJH 3PE9A 5GRVK 4FG6D 3P4LA 4L4TA 5LAXA 1JWSA 3OKKA 2F8VA 4UU9B 4M62L 5T3XD 2JCCA 3FHQA 2V7HA 4JG1L 4R90L 1VGKA 2V2TB 4PJ8D 3V4VH 1MCEA 2OXGA 2APFA 4V1DD 2LAAA 5IVXB 1H8OA 3NCMA 5GRVL 3VXME 2UZIL 1XMWA 3LKRA 3GMOB 4GW1A 3MLZL 3G04A 3RIFK 3RX5A 4FFZH 3W39B 5FO8A 3JWNC 2GJJA 5TDNB 3TZVD 3PABB 3QIUC 4X6BB 3ULSA 4OGZA 3LS4L 1BREA 1L9MA 4M7ZB 3S5LG 1CGYA 3EDJA 4KROD 1UXSA 4APQD 1KCRL 5C0EB 1YECH 2Z91A 4LOUC 2P8MA 1WJ3A 4HQQH 2AK4B 5F7NC 4U2YA 2P8PB 4PREA 1QSFD 2AJVH 4AIOA 3HCVA 4UT7H 1IM3B 3WKMH 4G43A 1UA6L 3PHQB 4K3JH 1LDPH 1IGTB 2WIIA 4LFHG 4OZFB 3MLWL 1OQXA 1YMMA 1S9WA 1KYOJ 1GSMA 5GZNC 3L3HB 1YNTB 1G1CA 4P5MB 1CFBA 2DLEA 3O8XB 3QXWA 5GGQL 1A9EB 5F7UA 3F7YB 5JR1L 2C4FU 3MODL 1X4YA 4F3FA 2HT2C 3LZFL 1CICD 1DBBL 5HGHA 2E27H 5ICXB 2C3XA 2BVEA 4HS6A 3EO1B 2Z8VC 3HG1B 3W9DB 3CFKA 1RZJC 3K2UH 4PV8B 1I1YB 3RX7A 3TV3H 1SYSB 5E2WH 3MRDA 3N50A 5HYJE 5EU3A 4M43H 4ZNCD 4YK4C 2NY1C 3SQOH 2VKWA 3GMPB 5C0DA 4EI5C 5JORB 3GSVA 1R3KB 4FXKA 3KWWA 5EBWA 4UIMB 2XKUA 4GW5B 5EU7C 2EDEA 3MGOA 4MD4B 2Z8SA 1J1PH 2RHEA 4LNRB 2PCPA 3B2VL 2GITA 4NQXA 5GGVL 1JZ5A 1I1CA 4M5ZH 1HQRB 4PRDA 4Z7NF 5K9JL 4A6YB 2P46B 2QSQA 5EBMA 3EJYC 1J5OL 4LAQL 3T1WA 1HIML 4I77L 4OB5L 3TIDA 4Y5XC 1T0MB 3REVB 1FRGL 4HUWA 4Y5VB 3BP4B 1NAML 4M9PA 1A7RH 4LSUH 1T4KB 2Z31A 4MZ2A 1Q9WB 1OCWL 4HUUB 4JRWA 5K9KA 3I9GH 5HVHC 3MV9B 2PR4L 2V17H 1NBZB 1F4YL 4CN6A 1W72H 1NBVH 3STZA 5DMIH 1X4ZA 4RA3A 1JPST 3CU1A 1XIWA 3GB7A 1FZKB 5EZIL 3PGCA 5TQ0H 4ERSL 4HHAA 5I66B 3QT2A 5F9JA 3GO1H 2Z93A 1F8TL 4HJJH 2NXYD 3QWOA 2QQQA 1CGSL 3CVHL 5AEAA 1DVFD 3T08A 3BKCH 5J13B 2UYLA 3K1KC 3ULUE 4NOBA 1JNNL 4QRSB 4HFWA 1ADQH 3JZ7A 2BY0A 2ERJC 4PJHA 4KMLB 2DQHH 5DEZA 2R1YA 1OAKH 1FL3B 5BZDB 1JZ4A 3DVNA 4HGWA 4OZIA 1K2DB 4JKPL 2XKNB 4CUCA 3G5YA 3F6LA 3RWJA 1O7SA 4TVPE 4HIHA 3QXTA 2VDMH 1SBSL 4Z0XB 3MRLA 2G75A 3EJZD 4WI6A 3TH3T 2QHRL 3U0WH 2UWEA 2JJTA 3A6OA 3F8UB 1LDSA 1KJVB 4RX4D 1N64L 1I4FA 1TETL 4Y16C 1QRNA 3TBWA 1OAYH 3RWGB 5CUSL 4OM1H 2B2XL 5FAAA 4Z7VB 2ZNXA 4KK5C 1SMOA 1FFPB 2DQCL 2EKJA 1NFDE 3OR7B 4UOW0 5F71A 3BISA 1RZGA 1IARB 2Q3AA 4M8QB 5E5MB 4HS3B 3U9UA 2FHBA 1KB5L 1MJ8L 1KIPA 3ARSA 1X6NA 1FZOA 2G60H 4OCXH 3WFHB 3WN5C 4PGCA 4EI6A 3QP3A 1CT8B 5IV2A 3HS0B 1A6TA 2EDWA 4HW6A 3WEXB 4WFHE 5GS1B 3WFDL 2XRAL 1T1XA 2JIXA 4FQXA 2Z9TA 4QGYA 4XPHH 3OB8A 4QRRA 1UM5L 2J2ZA 3B8YA 5IF0B 4ONFL 3WIFB 2G5RA 3L95A 4K8RD 4FNLL 1QVOB 1RJCA 3KXFA 1HYRC 3SGEH 5ERWB 3QQ9C 2Q76B 3AU1B 4PJGF 3M45A 4U1SA 4Y5YB 4KMTL 5GSVB 4KC3B 4H20L 3UYRL 2IBBA 3D85D 4LSDA 4HIXH 1Z9SA 4B7LA 4RWYH 2RJMA 3FO0H 3O2DH 3VFUB 4NBXB 4OIIL 3UTPD 5H94A 3BRGC 2WWMC 3LMJH 3AAZA 3KJ6H 5DQDL 5DZLA 1YZZA 4KTEH 4QOKB 3C8DA 1E27B 5BS0E 2DAVA 1JPFA 5FKPB 3QI9A 1TFHA 2HTLC 5HHPA 4AT6A 1INDL 4OLWL 5GIRA 1T1ZA 2CRYA 3RP1A 3TT1H 2VZVA 5HTSA 3IAGC 3ZE0E 3GHEL 4AL8L 4YXHL 1M05A 4PGZA 3SDYH 5AZ2L 5DJ8A 3UZEA 4PJAE 4HJ0C 4YGVA 5IBLD 2CLRB 2IADA 3M1BA 4HG4K 4BFEA 1UWXK 1S9YB 1I8KA 1BEYL 2ZCKH 3MR9A 4W4OA 1IEAB 4JDZA 2IGFL 3HUJE 1MCIA 2X4RA 4R0LA 1CE6B 3ISWA 1PSKH 3DUUA 5H8DA 4U7MA 4HUNB 1TQCC 5HPMA 1OT1A 3HC0A 5EN2A 4ZOBA 1ZHNA 3S96A 1EX0A 3MX0A 2BMKA 2OZ4L 3V52L 2GK0B 4G9DB 4UUJB 3L6FA 3EFFA 4ZUTA 3LEVH 2VKXA 3MPCA 4F58H 3I02A 4FABH 1U2CA 4NC1C 5BV7H 1ED3A 3VI4E 2YEZB 2CJUH 3LAFA 1QBML 1N5YH 3VD7A 1KG0A 1NBQA 5C70A 3SE4C 2ATKA 5DHVB 4XVSL 1FIGH 3RVVD 4TVSa 5GISH 3CD4A 3JTSB 3VE0B 1HCFX 3HC3L 4OCSL 3EIFA 4GAGH 4ZUSA 5DRNA 4DOHB 3G5VA 3LKOB 3NCEB 1VACA 1KTDA 3CLFH 4HIIB 3GIVB 4OV5B 4AEIL 1UXWA 5AYUL 3BOVA 4P49A 1QYGL 5I73C 1V7NL 3OSKA 4LP5A 3VGAC 1MRFL 3P11L 4RRPA 5GGUA 3L7FB 2R2HB 1KCVL 5FUZH 4MJ6B 2QKIB 3I6LD 4Y2DC 4M1DL 3D48R 3GBNL 1KEML 5H2BB 1A6PA 5E8DL 2ZOLA 1T03L 1M7XA 2BNUB 4L8CB 3CGTA 4Y2OA 5KOVC 1G9ML 4WW1B 2F54D 4K9EC 4ZUWA 5BOPA 3OHXA 3WE6A 2ZJSH 5IK3B 2YD3A 1HEZB 1XF2B 1JGLL 4RAVB 4DGVH 2B7DT 3C5ZC 4QRPD 4X9BA 1IAOA 5D7KD 1N4XH 2PXYB 4GXUM 3JUYA 2JJUA 4MAYB 1D9KC 1RIUH 1I8LC 3O2WH 3LPFA 4XP4L 5HYQA 5FYLL 2KL6A 1N0XH 1BLNA 4PLKC 2ESVA 1RZFL 5EZJA 5C09B 1YN6A 1ZVSB 2OJZH 5BVJA 4K3EH 5LBSH 4NQDD 4XAWL 1RK1A 4YR6B 6CGTA 5EB9A 3GM8A 5JMOC 2VDNL 2W9EL 4JAMB 4XNXH 2VABB 4OJFH 4PD4K 3DUSA 1DQMH 1FFOA 4JFPB 3ARDA 3BDYH 4OCWH 3L3GA 3MMEB 4XZUB 3BKJH 5CGYC 5CMAA 1MIEH 4R96A 2KKQA 1RU9H 3CMOL 2RQ8A 4QLRA 1SEQL 2X1OA 5CZKA 4RIRB 4X6CA 1AR2A 1HXYA 1T66C 1L6XA 1AXSA 3LKQA 2BRQA 4TNWF 4ZFZB 1DN0A 4IMLB 1C16B 3QHTC 3BGMB 4KDVA 5HY9A 3S35H 3UPAA 3RTQB 5L0QB 1YY9C 5FYJD 5FIEA 3QXVA 2BNQB 4NSKB 4GSDL 3BDBA 2EXWC 1LEKB 4JM2B 3TN0C 1WSST 1I1RA 4OZFG 4HC1L 5JOEA 3QQ4B 3QCVH 1HQ4B 1I1FB 3BGFB 3JV6A 4PJBB 4DCQB 3R1GH 1MHHB 2EDTA 4ODUB 4XNQA 2C1OA 2WBJC 2FIRT 1U3JA 3BQUB 3BEVA 1ORQB 4LEXH 4M1GH 3ALPA 1UYWH 4IMKC 2OXHA 1B6UA 5L2JB 1UEMA 2V2XB 2JIXD 3T0EB 1OF2A 5KSAB 5D5MB 4KHXH 3FL7A 3D3VB 2ADFL 1OTSC 3H3PH 3QHZL 5I8EB 4CVZB 1D5IH 4RA0C 2Q86A 3TO2A 4NO5A 3HNTL 1T21A 4N5EC 3NIFE 3T4AB 4MNQE 5HDLA 5IVXF 3S37X 2J88L 3EOYG 2H32H 3IDJB 3SE9H 4LBEB 2AGJL 4J6RH 5FDWB 5D72L 1I3RB 3IGAA 2YSSB 1I8MA 1NUFA 3WSQH 5KG9A 4NN6B 2YPVH 5D4QA 5FYKU 4JPWL 3I75A 2AJ3B 1DQDH 5JQHC 4OCYH 3L3KB 1LVEA 1S78C 1CGWA 1SJHA 3MXWL 3UTSB 5CEXA 3QI9D 5SX4I 3EOTH 1HHGA 4C54A 2XNAA 5B3JF 2ICEB 4HJGA 1CFNA 1SJVA 5E2TH 1G6RB 3DMMB 4PB0L 3HN3A 4XCNB 4DVBB 4ZS7H 1ZLWH 5CBAA 4F7EA 4JRXB 2IBZX 3INUL 2Q6WA 3MYJB 2UZYB 5DJDA 3FO9A 1PX4A 2OSLB 1UJ3A 4ODTH 4P4RB 1YECL 4N8CL 3T2PA 3VA2C 2R0KH 1WITA 4CADB 2EZ0C 1TJHH 2DYPD 1A7NL 3MRIB 4OGAD 5A1AA 3H7BB 4D3CL 3CFJA 2CK0L 4NKOA 4BH7B 3LQMA 3GSRB 4QRUB 3OR6A 2HJFA 4LLVA 4Z6AT 3BWAB 2IH3A 3MRFA 1OL0A 1EBPA 5JDJA 1ONQA 4P2QD 4GO6B 3EYVA 3SGKA 4X7DC 2F58L 3NN8A 4CN1A 5J7CC 5I19L 1YQ2A 1JPTL 1FFRA 1FORL 3BAEH 12E8L 3X3GH 4I0PA 1X5FA 4NHUB 1E4XL 2EC9T 4XMLH 4YDIL 3QDJB 4MJIA 5DF0A 1EHLH 1WUNT 5L2KE 4GRLB 2FO4B 3LIZH 2E7BA 4MSWA 2QQKH 4ENEC 2DQTL 3DI2B 5K9QI 3C6LB 3FB6A 2BJML 3DGCR 1S7QA 2IANB 3CFCL 5E8NB 5TDPA 1EEQA 2FATL 3O6MH 4I9WD 4POZD 3ULVL 4DVRH 3L7EB 5D2NB 4U2ZA 4HKJB 3WLWD 3P77B 1ZT7A 4P57A 3Q5OA 4H8WH 5ISZB 4JKLA 1HYSD 1EO7A 5TFSH 3LB6D 4WDIB 3PGFL 1UGNA 1S9XA 5HHME 3BN3B 4Y1AE 4JVPA 1A9BB 3GGWA 3OJDB 4PJ7E 5C3LD 2XZQL 2HJLA 2IH1B 4M8VA 2E7HA 4LLAA 3FQXB 1QLRB 3BKMH 3HR5A 2CLVB 4J4PD 5CD5D 2XWTB 2BRRL 2ESVD 4RQQB 2VZSA 3BXNB 3FCTB 2CKBA 3IDNB 3IDMB 3OKEB 4L8DA 3BSZL 4RAUA 3NAAH 5BW7C 3S3JA 4WHYG 1B2WH 4TTGA 2W92A 3CIQA 3B9VA 5I15H 5FYKL 4ZUVA 3MBEA 1MAJA 1D6EB 1LWRA 3DURA 4YFLI 2BVQB 1JYNA 2DQIL 3RDTA 4P2OD 1INQA 3MJ8B 2D7OA 3OAUH 1ZHKB 4M03A 4OZFH 4OKDA 2FWOA 3QZWB 3LS5H 3UJTL 3UDWC 5D6CB 1EO8L 1C08B 3VW3H 5BJTB 4Z8FH 3M17A 3KYNB 2FEDD 4PJ9D 4PJDA 3GO1L 4V1DE 1NMBL 1RZKH 2NW2B 3QXUA 1OB1A 2YBRA 2XA8H 3QUZB 3HLAB 1OD7A 1UKTA 4YDJA 1NAKL 3QNYA 2FCBA 3P4MA 1QEWB 3ZDXF 4IRSA 4LCWD 1OAKL 1PBYA 3B43A 2V7NB 1JIBA 4YFDB 1U8MA 3HE7A 2HRPH 4LLMA 3OF6A 4H5SB 4JHZA 4F7CA 2ZSVA 1T2JA 3OKNB 5CHNB 3SJVA 2NTFA 4KRPC 5KW9H 1F3RB 5KSBE 3C5SB 3NCFB 4DGIH 3UTTD 5C71A 5FHAL 3RU8H 3S9DB 3TLRA 2DLFL 2YK1H 5HYSA 1Y6MR 1T3FA 4Z76B 4JLRB 3HPJA 3HI5L 2BVTA 3F5WA 4OM1L 5ESAB 3JV4B 2AV7B 2NX5B 2OTWA 2R1XB 4FQIH 3O3DB 1HOCA 1IEBA 5I8CA 4JFDE 3MSPA 1BWMA 4XPFH 3WNOA 1QFWM 5HDOA 4JHWL 2VR4A 3QFDB 3KG5A 4NUJA 3BT2H 3VFPB 5FA3B 4XP5H 1U8IB 2P47B 2FYYA 4G6ML 2PTUA 5HYIA 3GSQA 2UVFA 4WFGD 1MWAB 4JGMA 4W70A 4HGKC 3VXSB 1JJUA 4PP2A 5FB8A 5J3HC 2JJVA 3ZZ1A 3RPIB 2VITA 3GI8H 4WI2A 2ZZUT 1HSBB 5E00A 3MBXH 1SY6L 3F7QA 2ZKHH 5ALCL 2DQDL 2YD9A 3KNBA 1P7KA 4G5ZL 1J88A 3ROLB 1WAAA 5GQBA 1WZMA 4K94L 5T1DH 4YHZH 4IBLT 3O6KH 5K59E 1B0WA 1F90H 4WNQA 5F96L 2C3VA 4GBXB 4ZPVB 5KS9E 2WK2A 3VGGA 1PG7W 4OTXH 2XOTA 4XPAH 3MV8B 1P84J 1N7ML 1RFDL 1UEYA 3K3QA 4X99A 2I24N 4U0RB 5HYEA 2EIZB 1H3UA 2EE2A 5IR1B 4PJIB 4PJXA 3SDCC 2NXZB 1UB6A 3BZ4B 3BPNB 3WJLA 3MLSH 2C5DC 3X12A 1DE4A 4KUCF 1G7JB 1VA9A 1EAPB 3D5OF 4Z7WB 4BSWB 4X7SL 3ZTJG 1CXKA 2D31A 3C9NA 2XQBL 2W1NA 3K81A 1U8QB 2R8SH 1XR8A 1ODAA 1I9RH 1Y6KR 4NC2B 2NPLX 3JWOH 5EWIH 4FQ2L 4WO4A 1GHFL 4JDVB 5CEYA 3S7GA 1I8IA 1XF3B 3BIKB 3MA7B 4OQTA 5DGRA 35C8H 1WFUA 4F33A 3LEVL 4EQ2A 5CIPA 3M8OH 4F57H 4LHUA 5CJBA 4X83A 5EA0L 5ANME 5C3TA 2UUDK 5HVFB 4P3DA 1T5XA 1GPOL 1K4DA 1FN4B 1FLRL 1HILB 2NY3D 4PV9A 5IEKA 4I0PD 4IRJD 4HKZA 5HD8D 1M6OB 4N9OB 4DZBB 2YD4A 2OL3B 1EERB 4KZDH 4MJID 4JR9L 4WUUB 3FN3A 1N26A 2HT4D 1JV5A 3FN0L 2FD6L 3ZDZE 4H88H 1H3VA 4PTTB 3QUXB 3VG9B 1IAIH 5EU5A 4PGBB 3O3AA 4L4VB 1NCWL 1J10A 4HK0B 1MAMH 3WIHA 4WHYH 1VGEL 4NUGL 1BF2A 4R8WL 1C12B 1I3VA 3NCCB 2EC9U 4TUJA 1P4BL 4P9MH 3QEQA 5ILTL 4BQBA 3O9WC 5IHBA 4MGXA 2GJ6A 3VD3A 4Z78B 2D7NA 4MA7L 2AS5M 4ZDHA 5CJQL 1EJOH 1PEZA 1H5BB 3RWFA 5IWLC 1NCDL 2VE6B 4S1SH 4J3UA 43CAA 3VFWB 4A2MA 1P2CA 4RGNB 5H35A 4MNGA 3K0WA 1I1AB 4O4YH 4XB8A 3C09C 4DUXA 2JELL 1CL7I 3EOBA 4M9OA 3DV6B 3UJJH 3GUTB 3P0YH 3L3JA 1U8LB 1BD2E 5CZVH 1OD9A 4I3SH 3MBED 4PLNC 1JFQL 3VXUA 1B0GA 3FT3A 4JO4L 3RDTD 3QBTB 3L1OH 2EYRB 4G6JL 2AJZA 5I8KH 5HYFA 1UM6L 2OJEB 1MCPH 3PQYA 1BVKA 1N0LA 1IGFH 3NFSL 2E9BA 1MHEA 5DD6B 2NY0B 4W6XB 4LLUB 4XNXL 5TE6H 5INCB 4OJFL 1BJMA 2IFGA 3AY4A 3UTPE 1DQML 1R24B 2GW5A 1AGFA 1D5BB 1BFSA 3PGDB 3NPSB 4BFBD 1S7WA 4JM2F 4PJEA 3GMRB 4IRSD 4R26L 4UIKH 5DHVH 4PJBF 3V0VB 4EBQL 2LFGA 3TBYA 3WUWG 3WNMA 1U95A 1WTLA 3BEWB 1FNSL 5D71H 1Z0NA 4U1HB 1IC1A 5HHQA 1ZHLA 4FG6C 3HNVH 5I17A 1V3KA 1CLOH 1OAXH 3D0LA 1XGRB 4JFYB 5FUCC 1J05A 1YEHH 3KPMA 5EO9A 5F3HA 1J0IA 4X5WA 2R4SL 3OKDA 5MEQB 3QCVL 5I1GH 4N8VG 4NO0A 1LK2A 2NY5H 4DZ8A 1QA9B 4GQ9H 3FB8A 5C0JA 2C4XA 2J6EL 2EIBA 2IALA 4ODHL 4GRWB 3H2WA 4OF6A 4MD0A 4JFFD 4IJ3B 4LCIL 3R8QA 1QACA 1B4RA 1J1OH 1RUQH 4O58L 3Q1SH 1JWSB 3OKKB 4QXWA 3RUGF 2AXHA 3CDFA 4AMKH 5BXFB 2CIIA 2VLJA 4JFEA 3ILQD 1VGKB 3O4OB 1MJUH 3QG6A 3IU4H 1BZQK 1KJMB 1VPOH 1RZJL 4KKBD 3MFGB 4GG6A 3TVMD 1RIHH 3UYOD 3VFNA 2VISA 4F2MB 1OGAB 1X5LA 3IU3A 4Q6YA 5C0CA 4PFEA 3C2AH 4GW1B 1A6AB 1MHCA 3ZTJH 3K8LA 4EN3B 3TM6A 1TIUA 3MLYH 5FO8B 5E08H 5A2IH 5J11C 4GG8A 5F88A 3F58L 5CWSB 4Z0BL 1MREH 4WTZG 4X6DA 1KN4L 2P5EA 4AJ0A 5DUPH 4UZGA 2QLVB 3I6LE 2ARWA 2I9LA 2GI7A 2WMPA 3RWIB 4OLYH 3QDMD 4R2GD 2EICA 4DGYL 3KYMA 3WDHA 4MJ4A 3U4AA 2P8MB 2F54E 2W9LA 3ZKMC 2ED7A 4PREB 3V5HA 4D9RD 1FLTX 2DBJA 3QUKA 4UT6L 1RUPH 5GGRA 2QSCL 1P9MA 2WIIB 4QRPE 1MCOL 3LEYH 2K9UA 2GAZA 5DQ9A 4ELMB 5D7KE 4RBPK 3QAZB 2DM2A 2H26A 1YMMB 3OJMB 3Q6FB 4HWBH 1S9WB 5HHOA 5GS2H 3NIDE 3O3UN 4NO3A 2E6JA 1XGQA 1MH5B 1MAKA 1MPAH 3UTZB 1J0HA 2A73B 3WFEH 3RI5K 4NQDE 3C8HA 3HE6D 3P9MA 5CP3A 5C07D 4F3FB 3V4PH 4NWUH 3C08L 5MP6L 3DO3A 3ARGA 3NVQA 5EOQL 1AQKH 2MOVA 2X9WA 4BH8B 4OLVH 3B9EA 1LP9A 4KH2A 1KLGB 3C6SA 5AD0B 2LQRA 3MRDB 5EU3B 4PJHE 5J8OA 4C4KT 5GGTA 3MFFA 1AO7D 1BMGA 3O0RL 3P40A 4IOFD 5IGXH 2NY6C 2WANA 3GSVB 3GKWL 3KWWB 5EOCL 4RGNC 5C0BB 5EBWB 4ZXBC 3MGOB 3HPLA 5CLWA 1GGCL 3W5NA 1I7ZB 2PCPB 2R29H 3BP7B 1JZ3A 2YA1A 5FYJE 1ITCA 2A38A 2WWKT 1EHLL 5SWZA 2ENSA 4XXCA 1CLZL 2ICCA 2HFGH 4K7PH 4Y88A 1GZQA 4QHUA 1XZ0A 3SE3C 1XGYH 4OGXH 4HUWB 2NXYC 1CG9A 2NLJA 5I2IA 4KZEH 1RD6A 1DVFC 3IXAA 4U1KB 5BOZG 2GJ6D 1TVHA 4ZAKA 4BSVA 5INDA 1NCTA 1ZS8A 3G08B 3QEGL 2XFXA 1JPSH 4HWUA 5B38G 5EU6A 4GXVH 5K9KB 4YAQA 1K5NA 2XTJC 4YO0B 1IFHL 1J1XH 4EOWL 4YZFE 4GW4A 1G6RH 4KK6C 3SGEI 2DQJL 2VDOH 3GI9L 4X0KB 1J87A 1KELH 3T1FB 3EJZC 3LQZB 2A83A 1U8PA 5IFHH 1KCUH 1XIWB 3U7YH 3ARBB 2WNGA 2AJYH 5C8JA 2APXA 4WI4A 3K74B 3AS2A 1QQDA 1U8KA 3H9SA 1M4KA 1CFTB 1IGCH 5F9JB 3NCYS 3VXMB 5JW4Q 1KACB 3VDCA 5GGSB 4HF5L 4PB9H 1CDYA 3QWOB 3BPCA 3MV7D 3NACH 4ZFGH 3FB5A 2QADD 4ZYKB 1A6UL 1IC5H 1LHZA 5HXMA 4GMTH 4NQEA 5ADOL 1NCBH 3OAUL 1GC1C 1PQZA 5SX5H 2ENYA 4F7TB 4HGWB 1EXUB 4XT1C 3HRZB 2NY7H 4HIHB 5I75B 1ZLUH 3W0WA 3FT4A 4L9LA 4TUKH 2UWEB 5HDBF 3SEPA 1KTKE 1NGXB 4G8EA 2BXZA 4K8RC 4H26B 1I4FB 3PHSA 4IJ3C 3BUYB 3H0TA 4U1IA 4CVWA 3HMXH 4LPYA 4Q9QH 4OLZH 3ZE2E 3O4LA 2GTWB 4P5TA 1RZGB 3RWHB 1UJTA 4OD2A 2BNRA 1KIPB 4UDUB 1EFQA 2EDYA 4R4ND 1ZWIB 2VAJA 1A6TB 4G9FD 4P46B 4HMCA 4XNYL 4BQ6A 4MWFB 4FQIL 3CNKA 1VFBA 4TYUA 3ZO0A 2A6DB 2VDQH 3CXHK 3T2OA 3KXFB 4M48L 4M93B 2Q8BL 1OP3H 4A6YL 1IGIH 4G3YH 2CIKB 3BT2L 5HYJB 3ES6B 4P2QE 5IBLC 3HZMB 3K8MA 5C0IA 4PPTA 1DLHB 1N2RA 3LD8C 4XXDA 4KJYA 1UKSA 2ED9A 1W72A 4L3EA 5D1ZB 3VI3F 1FNGB 5H94B 4KQ4H 5JMRA 3D9AH 1NC2B 4YPGA 2IF7A 3TGXA 5I1DA 1YEFH 4X7TA 4RMWA 3VWJD 2HFFA 2DDQL 3QCTH 5L9DL 1QP1A 4PTUA 5HHPB 1U91A 5D1QA 2F53D 2ZP0T 3NZHH 5B8CB 4Y8AA 1V05A 3IETB 3QDGA 4FA8A 1M05B 1CE1L 3OBAA 1N8ZA 4YHZL 1YDPB 1JI1A 3JSSA 3WIIH 3O6KL 1ADQA 3IJYB 4YGVB 2V5RA 4I9WE 3KLAA 1QO3A 4MCZB 2EE6A 4HX1A 3BD4A 5IHUL 2FEEI 4K9EL 3RVVC 1XFPA 1RK0B 2NY4C 4JDZB 2X4RB 4MA3A 4YXKL 1NDMA 2NY2B 3DUUB 4EEEA 3SDAA 2B1HH 4PUBL 5HPMB 4LGSB 4XRCA 3HC0B 1ZLSL 2F15A 1DBAL 2MPAH 3FONB 3ECBB 4DKAA 5DVLA 2HYMA 5HHOD 1HKLL 1FDLH 5DRWA 4XBEL 3MRQB 3EFFB 2CDGA 1YNKL 1I9JH 1FYTD 2XZCL 1D5MB 1U2HA 2DKSA 2ESVE 4YHNA 5JNYA 4P3CH 3K7UA 1KG0B 5I1AA 2XACC 4DQOH 3EO0B 3VXNA 1GOGA 3V6BR 2ATKB 5D8JH 3QUMH 1JGVH 4JN2B 5I1HL 1JRHI 4KXZI 3J7HA 4OIBA 1OSZA 5IB3B 1GIGL 3KPLB 2ITCB 5DRNB 1U8NA 4H0IA 5EU4A 5CJ8A 4KTYA 2DI7A 1B4JL 4O51A 1KB9K 1ZOXA 1UXWB 4OGYH 2Z31C 2JK5B 4R6UA 5C08E 1IT9L 1N6VA 1T7ZA 4F37K 5HI4D 5F9OL 2DJ4A 3VD9A 3HZYA 4TPRH 1MWAH 3D2UA 3STBA 4LCWE 3S5LA 4OD1H 3WFBH 4P2RA 3ZTNH 1HXMA 4IEFB 4NM8L 5C0AD 3O2DA 4BELD 3MLVH 2H2SD 4Y4HD 4LSSL 2BCKB 4PY8I 3RGVA 5IMKB 2N56A 4PRIA 4AQOA 3UTTE 1QBLL 3ZT5A 3KPSD 1YYLL 1DTUA 1VCAA 1Z0MA 3AMLA 2QSVA 4NOFA 5LQBH 1T1YB 1MF2H 3VA6A 3HZKB 3RY4A 4ZAKD 1LO3L 3N1QC 4PJFE 1IAOB 2AJUH 1KEGH 1BFVH 5IVOA 1HH9A 1K6QH 3IDGB 5TQ2L 3UBXG 5DJAB 3UAJD 1MFAH 1FGVL 1IC4L 4QNPF 1BLNB 3VFGL 1K3ZA 3QUYD 5TPWL 4B41A 4LVNC 3U4BH 5FGCE 1R5WA 3QHFH 2JJTC 1XR9B 4UV7H 1J18A 4WFGE 4PY7B 2GKIA 2BOBB 4Z7OE 5EUKA 1FE8H 4ZFOA 2X9XA 3DUSB 1AKJD 1FFOB 3ARDB 3P0YL 3L3GB 1DP0A 4W6YB 3UPRB 4R96B 4ISVB 4PLOB 3SN6N 4NQED 1HXYB 4LKCB 3SDDA 1P4IL 4RMTA 3SCMD 3I85A 1DN0B 4PJAB 1WIPA 4DEPB 3MGTA 1A6ZA 4FQXC 4NN7C 4MD5A 1ETZB 1CF8L 1A6WL 3H3KA 4U6VL 2FH8A 5F7WC 3WO4C 4X80L 2X7LA 1ACYH 2KZWA 3CVIL 4JG0H 4FTVD 4JFHD 3SY0A 1X5KA 1R3IH 2OL3H 4NHCH 2W0KA 4WW2B 1QFUH 3I2CL 1WBYB 3NH7H 4XNQB 3NIGE 3ULVD 5DZNA 1G7QA 3V6ZA 2BNRD 2DQFA 3DROA 1CLOL 2GEEA 3ILPB 1OAXL 5E2JA 4RGOL 1FAIL 3RVWD 4G8FB 1QSVA 4WGWB 2VJXA 1G84A 5FGSA 2ZCHL 5KN5B 4PJGA 4OM0H 3QI9C 1IKNA 3LOWA 1OF2B 5GS3A 3BWUC 5CKGA 2VLRA 4M6MH 3CSBA 3NABL 2X4PA 4OLUL 3L5JA 1A6VL 3FT2A 3U9PL 5KSVB 4HXAL 2MQCA 2Q86B 3FQNA 3BZDA 2CRIA 3B9KB 3DPBA 1BIIA 2HVKA 5ETUA 4W4OC 4NNXA 3AFLA 1S7XB 4R0LC 4F9PA 2FGWL 2XG4A 3Q1SL 2ZOKA 1I8MB 5J1TC 1KPUA 3V95A 5KG9B 4UTBH 3C87A 1YPZE 3NFNA 5EZLB 2HLFD 25C8H 3ZKXB 5IB4A 1JHTA 3MYZA 4MJIE 2WQRA 1UKQA 2EDLA 4KI5C 5D1QD 1MFCL 4OGAC 2LVCA 1GL4B 1R3LB 2XNAB 5CKAA 1ND0A 3QDGD 4LPVA 4PRPD 1CFNB 2A6KB 1CDGA 2XXMB 4I8DA 2VR5A 3CX2A 3SKNA 4OI8A 1WBXB 3LEXA 4KV5F 2AK1L 3KYAA 4F7EB 5CBAB 1MSPA 2GSIA 3U6RB 4ELMF 2MWCA 4P4KD 4R4BB 3FO9B 3QYCA 3MREA 5JW4N 2APTA 4ZTPH 4IHOB 4FOMA 5DC9B 4MX7A 1N6QL 1PFCA 3C60A 4QF1B 1QFOA 3CFJB 1MVFA 1MI5D 5EO0A 5E6IA 5CEZL 3OR6B 4TUOA 3RHWK 5F89B 2VXQL 4LLVB 4RWHA 1RY7B 4HWBL 5F1SA 4JZJA 1B3JA 1NGZB 2B0SH 2DN7A 3PNWA 4JN1L 1CZ8L 3B6SA 5EUOE 4TSAL 3W2DH 1TJGL 4POZC 4TSCH 1C1EH 3NN8B 3V4UL 1KNOB 2DF3A 1MPAL 4G80B 3O45A 5E4EC 3KPQB 1M1SA 3EAKA 5LJYH 1PKQA 3WLWC 3DIFA 5E2VL 3DV4B 1KIRB 3WFEL 3FQUA 1HYSC 2YPLD 3V4PL 2DD8H 1WVZA 5ALBH 3MJ9L 3ARFA 3MLRL 4GRWH 5TE7L 5FO7A 4NQCD 4YJZL 2P5WA 3G6JA 5D1XB 4C4KO 1KIQA 3H9ZA 3VFSB 3V0WH 1EFXD 2HFEB 1P7QA 1QFWH 3G9AB 2ZUTA 5CD5C 1RZ8B 4D0BA 1KFAL 2XZAL 3D2UD 5J1AB 3FB6B 2H32A 1CK0L 3VCLA 1VSCA 3QDAA 3CJJA 5IGXL 3RIAF 5JOFA 5I18H 4OZGE 2WWKO 5DEFB 2VDRL 2C7UA 4WWKA 4B7IA 3WKNA 1V7MH 2LU7A 2DI8A 3S88L 5DGQA 5HGAB 2X4TA 4FQHA 3G5ZA 1JGUH 2BC4B 4ZQKB 3ARDC 5JHDD 4P57B 4XCEB 5HI5D 2KPNA 4YBQD 3TPKA 1HDMB 2IG2H 1YQVL 4FQCH 4YH6A 1O5DT 2HFGL 3RKPA 1OAUH 4KTDH 2FEDC 3HI6H 3GBMH 3GGWB 4NRXA 4PJ9C 1HSAB 5ACZA 5GHWL 2HJLB 4JFXA 5K93A 4ELKB 1QR1A 4FFWD 3KPRA 4WEBL 5K33A 5JTWA 2VLKA 3X14A 2YUWA 5EPMB 4MNQB 4L8DB 2CKBB 3O3BB 4UMGA 2BFVH 3VXTA 4JFFE 2VZTA 4RAHA 5T33L 5KVEH 5TH2B 2YA0A 5EZOL 4ZUVB 4X6FA 5F6HI 4MA1C 5DD0H 2IQAB 2X2YA 3VXQB 1NJ9A 5FHBL 1BFOA 1E4WL 1P4LA 2DTSA 5F1IB 3FOMA 3OJVC 2AJYL 3O6LH 2PO6D 2X89A 4W81A 5SX5K 1YNLL 5DO2D 4PJDB 5IHZA 3RY6A 1EK3A 3SDDD 2ZCLL 1LO0L 5T1LB 1F6AA 3QIWA 3QO0B 4CVXA 5CINL 5BZWB 4GMTL 4RNRA 1UQSA 5DS8B 2EDNA 4QCIA 1U8MB 3OKMB 5ADPL 1GRWA 3HI1B 1ZT1B 1R5VA 4PBVC 4F7CB 2L4OA 3BGAA 3SJVB 2QHLA 3QPQD 4YDKH 4XPBL 4HK3J 2DM7A 4LGPB 1VERA 1JGDA 3QDME 4N0UE 5J4MA 5DK0A 3DI3B 1RULL 1QOKA 2JTDA 3HPJB 3K8KA 1URLA 4D9RE 4HFUH 1NMCB 3OPZL 1MCCA 4ZSOE 4UU9A 2OTWB 4WI3A 5I1JL 2NW3B 4RMQA 4OLZL 3KDMB 4G7VL 2V2TA 2NMSA 3PWNB 2W9DH 1JCKA 1BM3H 1OP9A 4NUJB 3N9GL 4WI8A 5A16B 1MQ8A 3ETBF 4ZUUB 1CFVL 5IVXA 1Y18B 4WFED 2FYYB 2VLRD 3SKMA 3GSQB 1X7QA 3GMOA 3SPVA 3QNXB 3T65B 4FQPA 4S1QH 5C07E 4AEEA 3W39A 5TDNA 3PABA 5ID0B 5MEND 1PEWA 2HTKD 1GGYA 4X9IA 5DHXB 1PX3A 3BN9D 3RWDB 3U79A 3KJ4C 5D7LD 3BJ91 5CFHA 1IGIL 4X9FA 2VXVL 1UJ3C 5C0EA 1UM4H 4U1LB 1IAII 2CLZB 4LARH 1F2QA 3TA3A 1AO7E 4LCUB 2E5EA 4LRIA 2P8PA 5I0DA 5GJSH 2C3VB 3MRNB 1IM3A 3TO4B 2VDKH 1YEJH 2FRGP 2FL5B 3FFDA 4KQ4L 3PHQA 4WHTB 2EH8H 4OZFA 3PDDA 1L9NA 4X99B 2E9JA 3NPZB 1MFEL 5H37G 3VGDA 1NCAH 1CD1A 3L3HA 1YNTA 1MEXL 4P5MA 3UTOA 4QXGL 3QRGH 4PJXB 1RUMH 3CH1B 4Y1AB 5F6HJ 1C5BL 3QIUD 4NNYA 5GGRY 3SGKC 5J6GA 4EIZC 3O8XA 2VMFA 3E2HB 3UYPA 3F7YA 4XP1L 5AG8A 5E94B 2NY3C 3ZYJA 1EEZB 1WZ1H 4QEGA 1XCQB 4I0PC 5HD8C 2AEQH 2D31B 4K2UH 3TCLB 4LOUD 4PYGA 3W9DA 3ULUF 3MOBL 4PV8A 1I1YA 3IAPA 5GS0C 1SYSA 4WO4B 5CEYB 3DWTA 1DQQB 3GSXA 1S9KC 2BX5A 3GMPA 5GZND 5JORA 1JHKH 1R3KA 4PJ8B 3O6FB 1D6VH 4UIMA 4GW5A 5JO5B 4V1DB 4MD4A 1S5IH 4LNRA 3FHAA 1K4DB 3MV7E 2F5BH 2DBLH 2YUVA 4P3CL 3MUGB 1T6WA 4MDIA 5D8JL 3MCLH 2DOCA 5F8RC 3TZVB 1NFDF 2P5WD 3REVA 4Y5VA 1QSED 4F8TA 2BDNH 4WUKH 5KSBB 1E28A 1T4KA 4KROB 4APQB 4FZ8H 3DXAB 5EU5B 1Q9WA 4HUUA 4MHHG 1DQLH 3LN4B 4POUB 4X7CC 3MV9A 2W0LA 4I3RH 5F9DC 1NBZA 4TPRL 5HGGS 1JE6A 3MBEC 3GMNB 4Q6IC 5IBTH 4WWKD 4D9LH 3RDTC 5HDQH 5T3XL 4OD1L 4TUJB 4OCMC 8FABB 4JFDB 3P73B 2FBJH 4XCYB 4JM4H 4N0YL 3TC9A 3EJYD 4UI2A 4Y19D 5I66A 2EKSB 3U0TB 2V2WB 3RPKA 2FX7H 1P2CB 4O02L 2G2RB 2HKHL 2J7LA 3EYUL 1KXQE 4G9FE 3T2NL 2F8OA 1VFMA 3KPRD 4LVHB 1X5YA 2VLKD 5LWYL 1FL3A 5BZDA 4IRSC 3QJHB 4M1CD 1CICB 1DLFH 1X3DA 3HE7C 1K2DA 2XKNA 1JBJA 3NFPB 5ECJE 1FFQA 1LO5B 3MRJB 4N1HB 4P48A 1JWUA 5FYLE 2WSKA 3UEZA 3RRQA 2B4CC 3ZE0F 3JXAA 4UV7L 1KJVA 4HLZH 1BVKB 3V5DB 4PJAF 2RB8A 4WCYH 1FGNH 1NMCC 1FFPA 1YMHA 4LF3B 1ZV5A 3OR7A 5D7SL 4QRQB 3HUJF 5E5MA 3BVNB 4M8QA 3ULUH 4HS3A 1LO4L 3QEUB 3DVGA 3LKPA 1SJEB 3GJFB 3QWRD 3BE1L 4MA8L 3S3SA 1ULVA 5B3NA 2F53E 3WFHA 5FF6B 4FXGB 1CT8A 3HS0A 1MNUL 4M6NL 4WW2F 3WEXA 5KJRL 5GS1A 4TVPH 5DD1L 5GRXG 4OUUB 3MROB 5CILH 3WIFA 4AEHL 5J6HB 2G9HA 1DSFL 3VI4F 1WICA 3BKYH 5ERWA 3KPMB 2C9AA 2Q76A 3AU1A 4OCRH 5ESVB 2D7TH 1VFUA 2VXTH 4JKWA 4TNVF 1MFDH 4DZ8B 4Y5YA 1GAFH 3KHOA 5GSVA 4X98B 1QFUL 1QSZA 3NH7L 5CD3B 4GKZB 4HK3N 5HHOE 3S8WA 4YXLL 1NCCH 1D5ZB 5A3ID 2AJSH 3VFUA 4D0DB 5DA4A 4I5BA 3R0MA 2IPUK 1FYTE 1Q94A 1U8HA 1IGMH 4IDJL 4QOKA 1E27A 3WDIA 2BVYA 5FKPA 1OAZL 2WBKA 5H37H 2R2BA 2CIIB 2VLJB 4R2GC 4JFEB 1L7IH 2FBOJ 4M6ML 1KGCD 4QGTA 4Z77B 3WJLC 1AY1H 4U31A 1ZEAL 7FABH 2MHAB 4KPHL 4MXVE 1X5GA 4GG6B 4J3SA 4LMQI 2CLRA 3VFNB 3WFCH 2VISB 1PKOA 4ZOAA 1U58B 1S9YA 5C0CB 2Y06H 3BDXA 2AK4D 4NZTL 1CE6A 2UVEA 1WIOA 4LSRH 4R7DB 4DAGL 5LCVL 3T2QA 5DFWH 4X6DB 25C8L 1AQDA 1MRDL 4YHOH 1BQSA 5DVNA 2GK0A 4G9DA 4UUJA 1JZ7A 3HE6C 5C0AE 4M6AA 5F6IC 1CXLA 2YEZA 3KPSE 4MMZC 4EIGB 5CGTA 4HJ0D 5AWNL 1ERNA 2BK8A 3DARA 2GK2A 5GGRB 5DHVA 4JANB 4S0TD 1M71B 4X4XA 3TJEL 3QQ3B 1BD2B 4NKIH 5D7JB 4IOFC 1E4XI 1FVEB 5D2LE 4YHMH 3DJ9A 3HG1D 3DO7B 1AJ7H 1XGQB 1W8OA 4OV5A 4LLYA 5MEPB 3QPXL 5IB1B 3MNZA 3MC0A 3VXRE 1BQLL 1TJIH 4XVTL 2VQ1A 4ODVH 3SQBA 2YZ8A 5C9JB 3P9MB 3D85B 3R0NA 3QCUL 4PGDB 2RCSL 5HHVL 2R2HA 1CVRA 3SBWA 1QPPA 3ARGB 4MJ6A 5JW4M 3BZFB 1KTRL 2QKIA 1UWGH 5H2BA 1JNHB 4F9LC 4E5XA 4L8CA 2YXFA 1GC1L 1NKOA 4KK8D 1CD8A 1SMAA 3LKNA 5IK3A 1ZANH 3QG7H 1XF2A 4LCCB 4RAVA 2R0ZL 4NCC2 2OI9C 4WENB 5E9DB 2AXFB 5DC4B 1WEJL 2PXYA 3TP4A 2F19L 4MAYA 4HZLB 5SWZB 3MV9D 2QTEA 1P5VA 3PWVB 4U7KA 1F4XH 1IC7H 4BK4A 1GZQB 2V5SA 1XZ0B 1B9ZA 4FTVE 4QHUB 4NZDA 5C09A 1ZVSA 4QHKI 5DJYA 4JPIB 2BSED 4K3DL 4XP9H 1CG9B 4Y2DD 5I2IB 4YHYB 2P7TB 3IXAB 1TVHB 4YR6A 2X70A 3ULVE 4JAMA 1E6JL 2VABA 1U3HB 1V7ML 3NIFF 4HD9A 5EU6B 3AY4C 3U7WL 3FFCD 4BZ1H 1NSNL 4XZUA 4XCFH 3F7RA 4X4ME 4U3CA 5BRZB 2O26U 4KTDL 3IJSA 2VSDA 2I07B 4U3HA 4PRHB 3BPLC 1YEDB 4UINH 2BXYA 1T2QH 4ZFZA 4IMLA 1W8NA 3QXDB 1IM9D 5DT1L 3BGMA 4CN4A 4PLKD 3CU7A 3F65A 4YBLB 2LTQB 1MCRA 3RTQA 5GRJL 4LVOC 5TJWK 2E7MA 1UWEL 2JB6A 3BPCB 1PG7H 4HWBA 4NSKA 3U2SB 2EEAA 5KVEL 4JM2A 5FYJU 5FYKE 5SWSD 4MAUL 2DMKA 1DZBA 3QQ4A 1VEMA 2HWZH 1I1FA 1HQ4A 1PW3A 5FM5M 4PJBA 4DCQA 4R4NC 1HINL 1MHHA 1UADC 3U0PB 3CZFB 3W11D 3O6LL 3VXOB 1OTTC 3FT4B 2CPCA 3C8KB 1ZSDB 1G7IB 2XTLA 1T66D 3BQUA 4Z7UE 1ORQA 3A67L 4JO1L 4PRPE 2YOCA 3FO2B 2H6PA 4ODWB 5L2JA 2V2XA 2HKFL 2WM0A 4DKEL 2EECA 4NM4H 1BJ8A 3RAJL 4U1IB 1YY9D 3T0EA 4QRPB 3T09A 4U6YB 3D3VA 4KJWC 5TF1L 4TOYH 4UB0H 5K9QG 1AHWB 3P30H 5I8EA 4CVZA 4AENB 3TN0D 4WI5A 3F6IA 1MIMH 3FMGH 1H3PH 3CZJA 1FVDB 3T4AA 2AV1A 5DEGA 2VXUL 1X4XA 3IDJA 4TRPL 4LBEA 4LIQL 5FDWA 4JCMA 3F7PC 2N7BA 4XWGL 1I3RA 3RUGA 3WMSA 1UCBH 1CDIA 4NN5B 3NMEA 1TNMA 3OXSB 5ABDE 1MI5E 4G7YH 4QOKD 4FFYH 2AJ3A 1MCDA 2GCYA 4TQEH 4WHCA 3L3KA 4YQXL 1KN2L 1KYOK 3D39D 3JUZA 2Z8RA 4OSUL 2Y36H 5C0IB 4UT9L 1HHIB 4HT1H 1T7YA 4XXDB 3EUUA 1G6RA 4RMVA 4Y4KB 4MYWB 4XCNA 4L3EB 2YPLE 2VLLB 4YPGB 3DBXB 5LG1A 1P9MC 5I1DB 3E3QE 4X7TB 2IPTH 3MYJA 4NQCE 2HFFB 5D70L 1KOAA 3IVKB 4PTUB 2OSLA 3MCKB 1Y6NR 2EDOA 4F15C 4O9HH 1A3LL 4P4RA 2IFFH 3GZKA 3FTGA 3OAYH 4PJ7F 5AZEL 4XTRC 4CADA 5DJ2B 1S78D 4MQ7A 2WUCL 4ZPTB 3MRIA 1YEJL 3H7BA 4RGMC 4BH7A 3GSRA 2VDLL 2VIRA 1QZ1A 1AR1C 3BMVA 4N8VA 3GIZL 4MA3B 2NR6C 1KPRA 3ARGC 4U6XA 3BWAA 5JHDE 5JHLH 3UCRA 4J3TA 4NP4L 4XC1H 4EDXA 1JYVA 4U6HB 2OYPA 3THML 1A4JB 1QNZH 3HC4L 2OK0L 4KY1H 3RNQB 1F4HA 2W0PA 3LDBB 2IBZY 4GKOA 3TJHD 4DKFH 2CDGB 4NHUA 3ALXA 3HMXA 1UT9A 2FJGB 4G6KL 4CDGC 3QDJA 2D3VA 1ZVHA 1I9IL 1T6VN 1TDQA 1RMFL 4MJ5A 4GRLA 1ZTXH 4OI7A 4Y4HC 5L88L 3C6LA 1RJYB 5HHNB 3QO1B 1X5JA 5I9QB 2C1PB 1DFBH 1MCJA 1A5FH 1BGXH 1JHKL 2CGRL 5E8NA 4MNHA 5SX4H 3L7EA 5J9PA 5KSBF 5D2NA 4ZAKC 3SOBL 2R69H 4IIQA 5E2UL 1S9VA 4HKJA 1QKZH 4EKXA 1CDUA 2BHYA 3CSPA 2F5BL 5ISZA 4WTZA 4P23A 3UAJC 4FQQB 4OF8A 4JGUA 3MRGA 3OJDA 1Z9LA 2IH1A 1HXMB 4MAYD 3TESA 1QLRA 3ABZA 1LO2L 2CLVA 1FPTH 4GH7B 4HIEB 2XWTA 3ZMRA 1D5XB 3GK8L 4RQQA 1X5XA 4YBLC 3BXNA 3FCTA 3IDNA 3OKEA 3ET9F 3QIBB 2PW1A 4YE4H 1BWWA 1BHGA 3U83A 3LKSB 3L3OA 5KVGH 1D6EA 1IQWH 2BVQA 3QISA 3MJ8A 2FB4H 5HDQL 4M00A 1HH9B 2JJWA 3X13A 3WLBB 4JPKL 3SCMC 1S7VB 2A0LD 1NL0H 3IKKA 5BJTA 3W5MA 4P2QB 3KYNA 5AAMA 4L9LC 2EO9A 2M1KA 4PIRF 2NW2A 4MB4A 4C56D 4UAOC 4WFEE 4WTXA 4XPGH 3EYOB 1R3JB 3DX6B 1QEWA 5DMKA 2QSTA 4J3VA 3STLB 4ALAH 5K59F 5KS9F 5CEZD 1N59B 2V7NA 1U8JB 4LPUA 5DJXA 4J8RB 4E9LA 2BNQD 3U30C 4H5SA 5MENE 4P5TC 2O5ZL 5FA4A 1A0QH 1CGXA 4LRNL 1PLGL 5MI0C 3ULVC 5D7LE 1V3MA 1KV3A 3C5SA 2H41A 3T3ME 1JUFA 3QULA 4P0DA 1FO0B 1T83A 4Z76A 5ESAA 3JV4A 2AV7A 3QUMA 3AB0C 4JQXA 4MD5B 4UILL 3BQUD 1I7RB 3O3DA 2D7QA 1YUHB 4LSPL 5DJCA 4FQLL 3TYGL 5DJ6B 3CX5J 2X7LB 1F3JB 4YEFA 2YC1B 3QFDA 1A7OL 3T0ED 3GSOA 3VFPA 3ZL4H 3VH8B 1YEGL 5KSAD 3S34H 3D3VD 3V6FB 2ZUQC 1I3UA 5M95B 2XYCA 5LGHH 1ZKAA 4M3KB 1NUNB 5B38A 5BVPH 4XMPL 4KRPD 1NCUA 2FSEB 5C2BL 4F8QA 2VH5H 4LKXB 2YR3A 1MWAA 2DQFB 1AXTH 2DIBA 3A0OA 3VXSA 3ARVA 5DD5H 1CDCA 1WFNA 2R56H 2KZ1B 3IDYC 3UJIH 1JWMA 1S5HB 3U46A 3RPIA 2HLFC 4NKDA 1A02N 3MZTA 5KZCD 4NJ9H 3FQWB 4ZD3H 3U1SH 1HSBA 4NJAL 5F1KC 2YMXL 5D1QC 2EDFA 4P2OB 3ROLA 4UTAH 1AIFB 1RUKH 3VJ6B 3QEHB 4LPXA 4OCLC 3UTSD 3ZDZF 3VRIA 4GBXA 2AJSL 2YUXA 1IGJB 4LEOB 1T7WA 2PW2B 3MV8A 2JJSA 5DHYB 4OT1L 5C08B 3DX8B 1BIIB 2V9RA 1TMCB 1HWGB 3CSYB 2EIZA 3MXVH 3DMMD 4P4KC 4FZEH 4XNZC 2A77L 4KVCH 5J3HD 1KPUB 3IFLH 3SDAC 4LCWB 4PJIA 2M2DA 3UBXI 3TYFB 4JRXD 1KT2B 5IB4B 2PYED 1F58H 4PS4H 2P5WE 3BH9B 3G6JE 5GGVY 4O2EB 1QSEE 5SV4A 1T2XA 1G7JA 3VDAA 1EO5A 2KUTA 1EAPA 1S3KH 3KPPB 3S36L 4Z7WA 4YWGL 3JV0A 2EYTB 3MUHL 4D9QD 5L7XH 2DQEL 2R4RH 3VGEA 2Y06L 1U8QA 4E0RB 1FAKT 2VQUA 4PJFB 3IDXH 1GGBL 2J8UE 4JZNA 4HDIB 1CDHA 4IRZH 1XF3A 4I48B 3BIKA 3MA7A 1MJ7H 3OAZH 2F5AL 2WW8A 3OQ3B 3GJFH 2A9ML 3GMLB 4Y19E 3MZGB 5FGCB 1C8PA 5DDHB 3B2UC 4O5LL 4MX7B 3MO1B 1HILA 1OARH 5DTFB 1M6OA 4DZBA 1W0WB 3BH8A 5FXCH 4RFNC 4LU5L 2OQJB 2OL3A 2E7LA 4HS8H 4KRMB 3QDJD 3CXDL 4WUUA 1VHPA 2R0LH 3PNWB 4JQIL 5DR5L 3V2AR 4GRLD 4YHML 4YBHA 4S1RH 1XH3A 5CCKL 2AI0H 3QUXA 4TSBL 2Z92B 4X9GA 1AE6L 3E8UL 4PGBA 1Z6JT 3RGVC 4L4VA 3WD5H 4KJPC 1RVFH 4XNUH 2XN9E 2EH7L 3DIFB 4CBPA 3Q6GH 4HK0A 2IAND 4FQ1L 4TULH 2W60B 5F44A 2QEJA 1C12A 2QL1A 3N1PC 5C0NC 3DVFA 1NLBL 1KIQB 4HWEL 1G7HA 1JF1B 1UWGL 1DBKH 5ISZD 1A4KB 4Z78A 4FFWC 1ZA3A 2RR3A 5I1EL 4JPVL 4GAYA 3CMGA 1YYMH 3SKJH 2VE6A 1AGEB 5BO1L 3VFWA 1NGWB 4PJCE 4XC3H 4BSJA 2C7UB 4JY6B 2VC2H 3IKCA 5DQJB 5JXAH 1E6OH 4I2XE 2XI9A 4M6OH 2X4TB 1F4WH 3DV6A 5DD3H 5JUEL 5I6XC 4FQHB 3G5ZB 3P0VH 4G6FB 5ELIA 3GUTA 3RWCB 1U8LA 1ZVYA 2X4QB 5ESQA 2Z0BA 5DO2C 4NRXB 2EYRA 4OLEA 5BV7C 4XP9L 3SDDC 2OJEA 4JFXB 4NFBA 4PG2A 2YA2A 3BYTA 3T0AA 5DD6A 1JZ6A 3X14B 1CFQB 2R1WB 5INCA 3U7AA 2VXSL 5EG6C 1R24A 4F7PB 1JVKA 3QUZD 2PTTB 3KPNA 5I71C 1D5BA 4BZ1L 2AXGB 2YD8A 3PGDA 1A7BA 1DL7H 3BIBX 4R97B 2YD7A 3MACH 3TT3H 4PGJA 4C83B 5DURB 4IRJB 4R4FH 1NJ9B 2DRUA 1AH1A 2R39A 1P4LB 4NPYB 5DUBB 3V0VA 1L0QA 3IS0X 1KGCE 1Z9OA 4JRYB 1FH5H 5IHZB 4M7LH 3DSNA 1RURH 1FSKB 1KLUB 1XGRA 1PG7L 1TENA 3FB7B 1CR9H 3EYFB 1HNFA 3QIWB 1KJ3L 2AK4E 5IESH 3OWEA 3GSUA 3X3FH 1C5DB 4AY0A 1UQSB 1NQBA 2DL2A 2BSRB 3NCJH 5MEQA 1IKNC 1UZ8B 2NX5D 1IVLA 1QA9A 5I74B 2OBGA 1NANH 2EE9A 4HAGA 1IAIM 3NIDF 5IT2H 1K85A 1JGDB 1TZIB 2YS4A 4YDLC 3NA9H 3CDCA 3JWDH 1IZJA 1A7PH 2GJZB 3BN9C 3QFJD 4F9PC 5JIKA 1GGIH 2RBLA 3UBXA 1I3GH 3VXSD 1CL7H 5BXFA 4L8SA 4GS7B 5E8EA 4TOYL 4JFQB 1HI6B 1KJMA 3VFVA 5EUOB 4ACPA 4PJ5A 5GS0L 3HG1E 3FMGL 3C2SA 3RKDC 5IJKA 3V6OA 4PJHF 4F2MA 1OGAA 1JL8A 3SKMB 3DRTB 3QA3B 1X7QB 3SPVB 1NC4A 1A6AA 4EN3A 4XI5C 5DSCB 5I30L 2HA1A 4LSQH 1UCBL 1PJ9A 3MV8D 1X44A 5CWSA 4ONGH 4NC1E 4G7YL 2ZPKH 3PL6B 4BYHA 4FFYL 4JJHA 3KPOA 3H8NA 4NBYB 4M5YL 3RWIA 3MRRB 1OLZA 2R0WH 3T0VA 4QT5B 4HBCH 1A1NB 3MUY1 1L7TH 3TA3B 3GKZA 5JA9A 2E3VA 1JK8B 3C60C 3FFDB 5CSBA 1NGYA 4LASL 1NEZB 5E6IC 2CKBL 4ELMA 1MFBH 1OPGL 1CD1B 3Q6FA 1J8KA 4JZJC 5HHXH 3L5WB 4J1UB 4YZFF 3DGGA 3HFMH 1MH5A 4NNYB 5J6GB 1KCSH 4E41D 4CU6A 5EORH 2LU3A 4WI7A 3UTZA 1Z9MA 4YUEH 1NAMB 4QTIH 4NQTA 2A73A 2FECI 5C0FA 5J0BA 3RJDA 1H3TA 1Q1JL 3D0VA 2VN4A 4GLRI 3ARFC 3QXAB 3ZKMD 1IEHA 3OB0H 4ONHB 4BH8A 3FFCE 4GKNB 3CFEA 3H42H 4NO2B 1KLGA 5AD0A 3IFPB 1H3WM 4HH9B 4KVNL 1KJ2H 2J4WH 1MHPL 3FOLB 3SE8H 2ARJQ 3GSXB 1QNZL 3AREB 5HPOA 4RRPG 5C0BA 2BVOB 1CLYH 4WV1B 3TVMB 1PY9A 1I7ZA 1RQ5A 1XT5A 4WWKC 1L4IA 3BP7A 4L4VD 4LQFH 1TNNA 2B4CL 4HCRH 4M7KL 2P43B 3CVHB 1BQHB 5I1LA 3KAAA 1IL1B 4P59H 4C58B 4MDIB 1IKFL 2VZUA 5SWSE 2J5LC 4Z7VE 5T1MB 1TCRB 3ZE2F 2D0GA 3ZE1E 4JO3H 4BQ8A 4U1KA 4CU8A 3VH8G 1E28B 1IGYA 1R3HB 1CD0A 1KENL 4I18C 3G08A 4Q9RH 3QDMB 4N0UB 2L7JA 3LCYA 4M1CC 4QXUL 2NY6D 3KR3H 4NZUH 4YO0A 2OMBA 2BSTB 3BIAX 4RGND 4ZXBD 1EHNA 1Q9OB 1I1AD 2VDPL 3RY5A 3CLEL 3FQRB 2FX8H 2IAMB 4ZSOB 1WIUA 4X0KA 1A64A 2BY2A 2CSPA 3BESR 3T1FA 3LQZA 4MLIA 2J3SA 4MXQD 3LN5B 5FYJH 3K1DA 1KPVA 3ARBA 1MY5A 4ZNEA 3RZCA 5D6DA 1GXEA 1KB5B 2FNBA 1CU4H 1CFTA 1MELA 3UO1L 2A1WH 4JY5H 3VXMA 5GGSA 4RISL 3RY6C 5IMMA 2AJXH 3O2VH 3MOQA 4ZYKA 1FJ1A 5C07B 2D2OA 3CPLB 2NY0D 3OGOE 5DK3A 4N0CD 2XTJD 1S7TA 5JQ6L 1YY8B 4F7TA 4QOKE 1EXUA 1NLDH 5EC1B 4KK6D 3HRZA 3MOAH 1JWUB 3L5XH 2BY1A 4KUZH 3V8CA 3D39E 1I7TB 1WFTA 1F11A 4KK9C 2VZ1A 2EDKA 3VRLE 1NGXA 1AO7B 2PETA 4H26A 3TH2T 1IMHC 3BUYA 3EW3B 4ALAL 3NTCL 5T5FH 2KQNA 1FBIH 1YMHB 4N90D 1ZMYA 3MV01 3QB7C 4QXTB 2GTWA 3LQAH 5DLML 3RWHA 3TF7C 4XNMB 2DKUA 3DVGB 2DIJA 3LKPB 1X5IA 4U6TA 4UDUA 5A3IC 4OI9A 3HZVB 4OUOA 1ZWIA 3JBG7 1OSPH 1WWCA 4P46A 4HSQA 4H8WC 4OQTL 1NGPH 2W07A 1YEKH 1G9NH 4MWFA 2NYYD 1KC5H 1AP2B 1CBVL 2ITDB 1C5CH 4OFYA 2IQ9L 1P84K 2A6DA 1JMXA 2G9HB 2QR0B 1ZT4A 4DW2L 4KGLA 3BP6B 4L4TD 3FZUD 4M7ZC 5JLZA 3C5ZA 2YPKB 2CIKA 1CGTA 3EFDH 5HYJA 3ES6A 4HEME 5FECA 4K7PY 3GNMH 3EO9L 4HXBH 3HZMA 3BPOB 3CH8A 5A2JH 2FJHB 4J23A 4GMSL 2FR4B 5F7FA 1BAFL 2A9NL 2E8YA 3GSNH 1DLHA 3TA3C 5FCUH 4LRIC 4MHHI 4XHQA 4DOHE 3BD5A 5D1ZA 1FNGA 4I5BB 1HWHB 1WCBB 1YC8A 1WT5A 1NC2A 1U8HB 1Q94B 4U3XA 1OGAD 2D4DA 5K9OB 4YC2B 1NMAL 5JPNB 3MV7B 3H7LA 3CFDB 5GJTL 4ZD3L 2QADB 3WIHL 3U1SL 3WXVH 2YD2A 1YEIH 2EDHA 4QWWC 2R2BB 2D7MA 5B8CA 4XHJD 1RZKC 4UTAL 3IETA 3O8XC 2O61B 3LY6A 1YDPA 1FVCB 3IJYA 2XQYK 2ARJA 4MCZA 4G8GE 4NZJA 2Y07H 4HWZB 5JXEA 3LH2H 1RK0A 4XCCH 2O5YL 5E99L 2IEPA 3MXVL 5A40E 5L6YL 5T1KB 1AD9A 2FX9H 4K23H 3EZ8A 4PJFF 4UV4L 3ELAT 4Y4FA 2ADJB 3FONA 3ECBA 1AQDB 5CJXC 1YMMD 3RA7L 2ATPA 1T04B 2GT9B 3MRQA 5IJVB 2XPGB 2Y72A 3LRSA 4L1HA 3N85L 1J0ZA 2VYRE 4GT7A 2YZ1A 1D5MA 2AEPL 4NBZB 5IW3A 5KTEH 2R4RL 1FO0H 4D0CB 1MY7A 4NIKB 4NNPH 3EJJX 3EO0A 15C8L 4Z7OF 3GRWH 3SO3B 1XGTB 2Y25A 4JN2A 2GSGB 2Y6SD 5I1IH 2NY4D 4NRZA 4X4XB 5IB3A 3KPLA 2ITCA 4KK8C 4IMKA 4Y5VC 2O5XL 2H45A 5E95B 4NZRH 4LLYB 4FP8L 2EDXA 3MNZB 4C56E 2JK5A 4S1DD 2VQ1B 5CGMA 4RFOH 5IFAL 5TE4L 4BZ2H 1Q9KA 1WFOA 5CEZE 4GUPB 1IBGH 2BNQE 4YHIB 4ZODA 1QLFB 4ZG1A 4ODSH 4S1RL 2BCKA 4E5XB 4LSTH 1FL6B 5IMKA 5JW3H 3IJHB 1UACL 1FNHA 1RVFL 3LKNB 5J13C 3NIGF 5IVZB 1T1YA 4HPOL 4AG4L 3HZKA 5DK2B 5I1CL 4L5FH 1Z3GH 3VWKB 2Z31D 1INEL 4ZTOH 4I4WA 1MRCL 3IDGA 3OZ9H 5F7EH 4UDTB 3B9DA 5DJAA 3MRMB 1OAQL 3HNSH 3KLSA 4Z95L 3SKJL 3I3BA 3T0EE 5D5ME 1YEEH 5DJYB 3WXWH 1JHLL 1XIWD 1XR9A 4B53A 3ARBD 3MLXH 5DFVD 5CJOH 4PY7A 5I76B 5IP4A 2X70B 2BOBA 3JWOC 1F42A 3IFNH 1AFVL 5DUML 1RIVL 1FYTB 4L9DA 5ITFB 3DTXB 3IDIB 5DD3L 1BF8A 4B5EA 5BS0A 3S37H 5IIEA 5KVFH 3W11C 3UPRA 1TPXB 5E8OB 4ISVA 3SDXE 1JRHH 4KXZH 3IJSB 4ORZC 1U6AH 4DUWA 1SM3H 1JZ2A 4XPTH 1YPZF 2JB5L 4LKCA 3E6HB 4MXWH 1TQBB 1BBDL 4PJAA 5GS1C 1CXFA 3UTSE 2XKSA 1QLEH 2H9GB 4OFVA 1ETZA 4QTHB 3UZQA 1EJ6A 2JB6B 1ORSA 3HAEG 2AW2A 1A7QH 4DTGL 1QRND 3MACL 5F1NB 3F7VB 3HMWH 1NEZG 1I85C 3MRPB 4QHLB 5IEHB 1ES0A 5D93B 1KCLA 4WW2A 4Y5YC 4JRXE 1HZHH 1WBYA 3AROA 2IWGA 2PYEE 3DX9B 1HHJA 3CK0H 2GIYA 5E70A 4JGJA 3ILPA 1RURL 2SEBB 4G8FA 3IFOA 3RIFF 1LD9B 3KPSB 6FABH 1Q0XL 4YC2C 2H6PB 1M7IB 5KN5A 5FM4A 2HH0L 3RGHA 4FQXD 5KVDH 4QRRD 3OXRA 3P9LB 3PWLB 4NQVA 3KXFD 5D2LB 4YDVB 4DN3L 5KSVA 1HH6B 3V8OA 3MQIA 3RVUD 5EUOF 4M7JL 1FQ9C 4XVJL 1Y0LB 3DSFL 3B9KA 2AV1B 5DEGB 3QUYB 2B1AL 2DIAA 3VXRB 5LKNA 4JO2L 5GGTL 3RL1B 3TWCL 4U1JB 2CMRH 4FFVD 1S7XA 3RUGB 1GGIL 4FQJH 4JZOB 4P2CG 5D1ZD 3CDGB 2K7PA 1NC2D 1BQHG 5EZLA 1NKRA 2GCYB 3QDJE 3V4VL 4U33A 1FIEA 4WY7H 1R3LA 1F00I 4AH2B 1Q0YH 2A6KA 1XF5B 1B0RB 4PG9B 4OZGF 2D03H 4HWNA 1N3NB 2IANE 3DNKA 1WBXA 4FFZL 4YIQB 1MQKH 5DWUH 4LPTA 4Z5RB 1JYXA 2ZPKL 3U6RA 1EUTA 3PP3H 2AABH 4R4BA 5DXWA 3TBTB 3UC0H 3WUWB 2NY2D 3REWB 3CCHA 3TJHC 2CDFB 2APWA 3VRJA 4IHOA 3FTGB 3U36A 4OCNC 1Q38A 4M62H 4Q9CA 4HQQL 5HI3D 1VB9A 4R90H 4MQ7B 2AJVL 4HGMA 4KI5D 4UT7L 3GHBH 1I7UB 3WKML 4QF1A 4K3JL 1LDPL 2VIRB 1EZVX 3KS0H 2NY5C 1E4JA 5F89A 1VEPA 1H8NA 2UZIH 1MFBL 4N8VB 3SBWC 1KPRB 5BQ7A 4U6XB 1NGZA 4N8PA 2OM5A 4KJQD 2E6PA 4DN4H 2YWZA 3MLZH 3TIEB 1R5IB 3D25B 2X44D 1KNOA 4G80A 1S8DB 3KPQA 4EDXB 4I1NB 3PIQB 4ZO8A 3DV4A 5FEBA 1KIRA 3AMKA 3GMQB 1J8HE 3LS4H 5FKAB 3PWUA 4KMQA 1KCRH 3LRGA 3WJJA 2E27L 2HJKB 5D1XA 2PXYC 1WAAF 1LEIB 4MJ5B 4MAYC 2DTMH 3VFSA 3K2UL 2HFEA 3TV3L 2QBWA 5E2WL 1RZ8A 4CVUA 5J1AA 1G1YA 4M43L 1UA6H 4WEMB 4YLQT 1H0DB 3SQOL 3PDOB 2GUOB 3V5KB 3MLWH 3X11B 5IOPB 4MNHB 5DEFA 5J9PB 4OKVB 4IIQB 1J1PL 1S9VB 3S4SB 1A1OA 5HGAA 4ZQKA 2BC4A 1VFAA 4M5ZL 5GGQH 4XCEA 3MUZ1 4P23B 4OIAA 1HDMA 5JR1H 4ODXB 2DWEB 3MODH 2A0LC 3Q0HA 4IOIB 2VAAB 2X05A 3MRGB 3LZFH 1HSAA 3T0DA 2NX5E 1DBBH 4RMUA 4ELKA 1A7RL 3D1MC 1Z5LB 3LPGA 1MCBA 4LSUL 1C7SA 2F74B 5EPMA 5DRZB 3B3IB 4MNQA 1W0YT 1RJLB 3O3BA 3RTQC 4ZFFA 5L0QC 2PW1B 2R15A 3KR3L 3I9GL