1IARB

Interleukin-4 / receptor alpha chain complex
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
197
structure length
188
Chain Sequence
FKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAAGISYRARVRAWAQAYNTTWSEWSPSTKWH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the interleukin-4/receptor alpha chain complex reveals a mosaic binding interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/receptor
molecule keywords PROTEIN (INTERLEUKIN-4)
total genus 37
structure length 188
sequence length 197
ec nomenclature
pdb deposition date 1999-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09238 IL4Ra_N Interleukin-4 receptor alpha chain, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1iarB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1iarB02
4NWTL 3DVGB 3DMMA 3FO0L 5JA9A 4M5YH 4XCCH 1MPAH 3K7UA 1OP9A 4GKNB 4XVUC 4AM0A 4R90L 3IS1X 4U0QB 1UH2A 5BJTB 2CR3A 4YHYB 5AZEH 1G7MA 1DBAL 5AZEL 2DIAA 5EO9A 3CNKA 3UO1L 3LDBB 1JGLL 3JWOL 2YUWA 2XQYK 1U0QA 3VMNA 1ZLWH 3DRQB 1T22A 2YPLB 4RFEB 3CSGA 5HGHA 1CE6A 1WGOA 3FQXB 3FRPA 4JN1H 5GGSA 1UXWB 3MNWB 1I9RL 1OTTD 3QIUB 3WUWB 3DX6A 2PW2B 2AJZA 5T1KB 5D6CA 4M48H 1HYSC 4X0KA 4JAMA 3X17A 4LKCB 4ZFOA 3W0WE 3UJTL 5FYKU 5FYJD 3C6LA 1BAFL 5I17B 4U1LA 3MLYH 3VXSB 2BSED 1C1EH 3W0WB 3MMEB 5CINH 1FCGA 5I19H 1NCAL 1MCIA 3UBXB 4JFQA 5I1AA 1JFQH 1G6RH 5HI3C 4QTHB 2FX7L 3EYVB 5BOZG 3CDGB 1JWMB 5C07E 4ZUSB 1RVFH 4P59H 4XZUA 3OX8B 1IGMH 4G3YL 5IOPA 4XMKL 1QR1A 2PCPA 4XMKH 3VXSD 4CRPA 1BVLA 1P4BH 1SBSL 4PV8A 4O2FA 2EO9A 5F9JB 1OVZA 1HSBA 2DJ4A 1KB5A 3LEVH 2CH8A 3MJ7B 4P5TA 4DZ8A 4JO1L 1T89A 4OFYD 3SGJA 3W2DL 2A74B 5E1HB 2EZ0D 4OCYH 5MI0B 3OZ9H 3QDJB 3QDGB 4WTXA 3GMRB 1JNLL 4AEIL 4M4PA 4KUZH 1IEBB 1CU4L 4PJIA 4U31A 1LO2L 1SY6L 3OAZK 3U36A 3IJHB 3LHPH 4HK3N 5BCAA 4G9DB 4OQTH 4ODXB 1WZMA 3DVIA 5CUSL 3QHFL 1I9JH 5HSFA 2BHYA 3SDXB 2RQ8A 1DQJB 1T66C 3BO8A 3ZE0F 3QPQC 1H3WM 4FQLH 3OKLB 2ZCKH 1BEYH 3N1PC 2X44D 3CSPA 4UOW0 1NMCC 1BPVA 3MBEC 5K9JL 3ORJA 1FFOA 4TVPE 1WT5A 1T1WA 1EV2E 4WGWB 3FAXA 1ONQA 3GB7B 1A6WL 2H45A 1KCRH 4KAQL 1EJOL 4XPHH 4MQ7A 3W9EA 3WD5H 1U93B 1W0VB 2XKUA 2X4QA 2LU3A 2WBJA 3FO1A 2DTMH 4IHOA 4PGDB 2A77H 3EOBA 5IB3B 4FQHB 5DDHB 4JJ5A 4I2XA 5J1SC 5KN5A 3DMMD 3GRWL 4Z7VF 4KRMB 1BQSA 4M7LH 4S0SD 5BZDA 5E2WH 5IW1A 1EAJA 4JPIB 4KRPD 3SGDH 1P6AB 5BS0A 3C8KB 3AS1A 1CVSC 2OJEA 3LS4L 4AIZA 1X6LA 3U9UA 4D9LL 2BNRA 2YEZB 1WAAA 3U46A 4JFYB 4BZ2L 4RAVB 1NCDL 3OL2A 2VZ3A 2ZUSA 5F1IB 4M7JH 4LFHG 4X7EC 2WW8A 3TVMA 5IB1B 1AQKL 3MR9A 4HH9A 5DMIH 1D6EB 4Z7WE 1CDGA 4M4RA 5E8DH 3B5TA 4EVNB 5K9KA 5DD6B 4LCWA 4E42A 2ADGB 2Z4QB 1LEGA 2J4WH 4FQ1L 1G7JB 3QZWA 4NUJA 5C0GA 3V4PH 1KJVB 3F7VA 1TPXB 4FFZL 3I6KB 3V4UL 4JDTL 4WV1B 3C5ZD 4JQXA 4YHML 3AAZB 5C09B 1VFAA 5E94A 2HFFA 3PQYE 4J3OC 4YQXH 1RZFL 1XGRA 2HFGL 4Z77A 4NJ9H 2W59A 5I1DB 3ZDZE 4DOHE 3WMSA 3WJLC 1JMXA 4MCYB 4PYHA 3WS3A 1EHAA 5HHMD 3FB8A 4JFZH 4E5XA 1LNUB 1YMMD 1FDLH 5E2VL 5GISH 1EJOH 1U58A 1D5MA 2XTJD 4WFEE 1G9NL 4OIIL 2HFFB 3E6FB 2E7BA 3BIBX 5ETUA 4YBLC 4YIQB 3QFJA 4WHTB 5DVLA 2A6DB 4LLUB 1ADQH 2APWA 3V6FB 5BOPA 3SJVB 2IANA 4POUB 5GGUA 3IJYA 3BN9C 3MRMA 4JFEA 2B20A 3L3JB 3MRJA 3RA7H 3B2UC 5IHBA 5CLWA 3RIAF 3LB6C 1JZ4A 1M7IB 4HJ0D 3CLEH 3HA0A 1MCCA 3L3GA 1C08A 3LEXA 4H1LH 5T5FH 4AIZB 2JIXB 2CPCA 3U0PA 1HH6B 1T7WA 3LN5B 4HFWB 5MEPA 4I48A 1EFXD 3RTQB 5CIPB 1D5ZB 4WW2A 2XKNA 1MHCB 2AP2A 4CVUA 4LGPB 5CAYB 1RAMA 3UTOA 4Q6IC 5GHWH 3RWIB 1CDIA 4ZTOH 2NX5E 1JF1A 4P3DA 4NM4H 5DA0B 5IBTH 1YQ2A 2NNAB 1E4XH 3PHSA 5KTEL 2F74B 2VC2H 4H5SA 4H20L 4QGYA 2FIKB 4R4ND 4QT5B 4APQC 1T5XB 1CYGA 1MFEL 2CSPA 4HAFA 4PBVC 2CDEB 3IAQA 4HLZG 5J06A 3FB7B 1TZIA 2EDOA 4LEOB 1RVFL 4P59L 4ZMAT 5I8CB 1XFPA 3L5XL 1KNOB 1Z3GL 4I13B 1U8MB 4QRTA 3IGAA 4MHHG 3HFMH 3TNMA 4EN3A 1UKQA 3MLSH 1QO3B 4X7SL 2VXSL 3DO3A 3LKNB 4PRDA 4AENB 3ZHKA 4K9EC 5IB2B 4QXWA 3RIAK 3U36B 4HQQH 3F58L 2UWEF 4QXGL 5I1HH 4PJIB 1I7TA 4MNGE 5LXGL 4HS8H 1RULH 5T3ZD 3QCUL 3BP6A 2EDNA 4XBEL 4OCSH 3SDDA 3NFNB 4F7EB 2IANB 4NZTH 5ADPH 1DQML 2AEWA 4KK9D 3GJFB 3VI3E 4U3XA 1RK0A 4HIJB 1T04A 2ESVB 4D0BA 1R3LA 5FA4A 4HIIB 3U48A 4UT6H 3PL6D 4UQ3A 4R97B 2X9WA 1LO4H 1AJ7H 1J0HA 4TVPL 4NO3A 4ZFGH 3MLZH 4P2QA 4RX4A 5JMRA 2OBGA 3T0BA 5L2KA 3ROLA 5ICYA 2CR6A 4Q74A 2Z31B 4N68A 4R97C 3C08L 4XMLH 3WNNA 5F9OH 3EOBB 5IB3A 3OQ3B 1U8QA 2WBJC 3ARBC 3QAZC 5GS1C 5H2BA 5GS0C 1T89C 2HMIC 4JG0L 1OARH 5KSAD 4IOSD 2OS7A 5JR1H 2JIXD 1A3RL 4MA1C 2EDYA 5CBEA 2FL5B 2GTWA 4XPHL 4XBGA 3NMEA 4DCQB 1I9IL 3P4NA 3E8UL 1MEXH 2J88H 2WNGA 5I1IL 3IF1B 6CGTA 1ZLVH 1IILE 3ZDYF 3WN5B 3WSQH 2F53B 2VDPH 3T3ME 1HIML 5MEOB 3MFGB 1J88A 1X5ZA 2J8UE 4K3DL 3WCYA 1QKZL 1IKFL 4RGOL 3WNOA 3UAJC 1CGYA 4RX4D 3NH7L 4E41D 3CAFA 2V5SA 5CZXC 4RWYL 2C26A 3S37H 4OZHF 3MODH 3RBGA 4N9OB 5CHNB 1MF2L 4HC1L 3MOQA 2PO6D 1TJIL 3D85D 4N8VA 2O5ZH 5DK0A 2Z92A 1MFBH 2Z31C 1J10A 3QNYB 2I9TB 5EBMB 3S4SA 1U91B 2PR4L 4JM4H 2A6IA 4NYLA 2GW5A 1P4LA 5I76A 3IRPX 5D1ZC 3STZB 2R0ZL 1R3HA 1GGCL 4WV1C 1ZK9A 2IGFL 3QJFA 5CEZL 3P0YH 4GG8A 1KTKE 5HTSA 5IQ7L 1FVDA 5J1TC 3EOAB 1AHWC 1CFSA 3RX8A 1DQJA 2ESVD 5C0BD 5E1AA 4QRRA 1DVFD 3WIIL 4WCYH 5A2IH 2AK4A 1JJUA 5E24E 2NX5A 1TTGA 3AUVA 4WI5A 4KHTH 1LDPH 1S9VB 2X6MA 4Y16D 1U8QB 3LAFA 5JORA 1QFOA 4I77L 4PJXE 4TUOB 4G9FD 3MA9H 1A7RH 5KZCD 5D7JD 1IM3B 2AJYH 2V2XB 3PGFH 3LEXB 1CLZL 5C2BL 1YNTA 3UTQA 1GJIA 4JQXC 1KB5B 1RZJC 4ZOCA 4K23H 1U2CA 5FYKE 5F97E 5A3ID 4X7FC 4OLWH 4KUZL 4PG9A 1JUFA 1S7RB 1J05B 3Q3GA 1BVLB 4LSRL 4IOIB 1A7QL 4LKXA 4H88L 1G7QB 3QI9C 1Z3GH 4MNGA 1CE1L 2ADIA 3RWGA 5IHZB 4LRNL 1CFBA 2D2OA 4OCXL 4ZXBC 3T3PE 5CBAA 1TETH 4IM8A 5D7LB 2FJHA 4L8CB 2NR6C 5FGRA 5GGQH 5HYSB 2ZSWA 2J8OA 1Y6NR 3KYAA 3GKZA 4BSVA 5F7HA 2F5BL 3BN9D 4GG6E 1IGJA 3MSPA 5FM5O 3F8UB 4ZTOL 3QPXL 4LCIH 1B0GA 2EYSA 1KTRL 1F4XL 1NC4A 3UP1A 1DLHB 4OCWH 3WXWH 3RL2A 3F62A 4X98A 3V0VB 4RMUA 2WWKT 4DGIH 2DQTH 5ADOL 4HKJA 1CFNA 2QTEA 1RUQL 2HTKD 5KVEL 1KF9B 2CLZA 3VWJA 2IFFL 4U1MA 4HIXL 3PP4H 4K3GA 3RUGE 2C7UA 5FM8A 2R0KH 3VRJB 3QCVL 1RIHH 1KXTB 3MRLB 4S11A 5BS0E 3HMXA 3RJQB 2P48B 4I48B 1NDMA 2EO1A 3HNTL 4LLQA 5KVGH 2APFA 1U3JA 4PRBB 4L9LC 1CDUA 2V2XA 2R2BA 4DEPB 4LLMB 5I8OL 3I2CH 2X89A 4JFFD 5FYKD 3UC0L 1PX4A 2HFEA 4PJEE 1VKXB 1C7TA 4XAKE 1HDMA 1BBDH 2FJFB 4RGMB 1LE5B 2DTSA 3IB4A 1J5OH 4KJPD 4F57H 4RCAA 1MRCL 5C0JA 3QJHA 2CRIA 3W39A 4Y8AA 4KVNL 2P24A 1BLNA 1IC5L 3LCYA 4P46A 4OI9A 2NY2B 4PUBL 5J3HD 2WWKO 4PJEF 4KQ4H 4PTTA 5FYKH 5HXMA 3RWFB 2Z35A 3ARBB 2XZAL 2ZUQB 5ESAB 4DOHB 4NJAL 4YEFA 3KYKH 3V8CA 3WO3B 5KSUB 3P77B 1OSZA 1QYGH 1WV7T 1ZA3B 4FZ8H 2BRRH 5H35B 4YDVA 2DQDH 1A7PL 5FHBH 4K71B 4RFNC 3U7YL 4GG6B 3WV0A 3DJ9A 3BPOC 3UO1H 3O6LH 3SN6N 3VI4F 5EN2B 2KQMA 4X6BB 4OZGA 2VKWA 1BIIB 3VE0B 3RAJL 5ISZB 5J12C 3KPNB 1M6OB 5L8KB 3GJFH 4UAOB 1T4KB 1XGUA 5FIEA 5DWUL 1UWXH 1XIWC 2WBWB 4YHKL 2V6HA 1T1XB 2CO7B 5TDOA 2V7NB 4YHNA 4PJFF 4D94A 3GMMB 4FQJL 1G7LB 3CDCA 2ED8A 3QIWB 1MLBB 4U0RC 4XNQB 1IAMA 2EDKA 3O4OC 5EH1A 3BKYH 5KZCB 4XMPL 43C9A 5MEQB 1KJMA 1PW3A 1MLCB 3FN0H 5GRVL 2D03H 4RQQB 1EHNA 3FB6A 1UENA 3BWAB 1U36A 1T5WA 3DRTA 4HFWA 4M6AA 2F8OA 3S36L 3VXMA 5HHOE 2VLLA 3GIZH 3S36H 2NXZB 3KYOB 1UACH 2IQ9H 4NO3B 5D7JA 5ICYB 1MCPL 3QULB 3UYPA 1GZPB 4KKNA 3VXRA 5I2IB 4KJWD 3FFCE 5IHUL 2UVFA 3ZTJG 2X42A 5FHBL 2PF6A 4N8VB 1P7KB 3FN3A 3VI4E 4F9PA 4ZQKB 3GGWA 4G8FB 5GS3A 2HN7A 3HE6C 3V0WL 4GKZB 5SWSB 4ZO6A 4D9RD 3IFLL 4OCWL 5ACZB 1A3LH 1J8KA 2VLMD 1KPUA 3O4LE 3VFTB 5GS0L 2EECA 1XF4A 2EYRB 4FFZH 1HHJA 4MD4A 5SX5H 5IB2A 3B2VL 3QRGH 2YXFA 2V17H 1XT5A 4UIKH 1IAIH 3NBNA 1OF2B 4RISL 3SJVD 4M6OL 4BUGA 5K33A 2FECL 3JTTB 1LO2H 3KR3H 3I50H 3AB0B 3OAUL 1AKJD 3GMPB 2MKLC 5C0AB 4MA3A 2DWDB 1SJEA 4W70A 4Z6AT 1OGAA 4CGTA 2H2SC 2NX5B 4PB0H 5A40E 3VG9B 4PJBE 1T04B 3HI6L 4D0BB 4UNTA 3RWHB 4IDLA 1ACYL 4AH2A 2FO4A 4ZPTB 4I8DA 5DJAA 4JHZA 5F93C 3TN0C 2OI9C 4CDHA 5EBGA 2W07A 4V1DE 4NKMB 4NQDD 5TE4H 3P0GB 1FBIL 5CSGA 4LFHD 3OJVC 1U8LA 2KH2B 3LKSA 5HDQL 1A3LL 4KK8C 1B90A 3VXUA 4YBQC 2P45B 2VWEE 1H5BC 5I75C 4PJ5B 2VSDA 2P8MA 5K9QG 5F21B 3FOMB 4X4XA 1U8MA 3G08A 3FT3A 4ZAKC 4S1QL 2ENSA 5E4IA 3ARVA 5IFAH 5EU6B 3I3DA 3VXUB 1NCDH 4E0RA 1S8DA 2K1MA 32C2B 4XPGH 3ZO0A 4PJ9C 5FK9B 2ARJQ 3MRQB 4Y16B 4JE4B 2HJLB 4R9HA 2Q3AA 3BP6B 3STLB 4S2SA 1IAKA 3MGTB 3RVWC 5C7XL 1B4JH 2H3NA 35C8H 1S3KH 4C56D 3O81A 5IK3A 2R56L 2VDNL 3ARDC 2F54D 2PR4H 3QCTL 4JZJC 3WIHL 5IVXB 3MNVA 2P8PB 3PQYB 2MQ0A 1DEEB 4OZFG 2P5EE 5FA3A 3RY4A 5F7EL 5F70A 3D0LA 3TO2A 4HS3B 3BKCH 1F02I 5HYJA 3NA9H 3MJ9H 4UUJB 2MHAB 2OJZH 3GI8L 1OT1A 1CTOA 4B7IA 3IDNA 1DBBH 2AJVH 5DLMH 1GYAA 4XPBH 3RY6C 1VFUA 5IG7A 3RNQB 4PFEA 1VFMA 5HHPA 5JHDE 1CLYL 4ELKA 3KNBA 1ZT7B 3QIBB 1U8KA 4N8VG 5MHSE 3K3QA 4LOUD 5KAQF 3BP7A 1KTLB 2KPNA 3WNKA 2A1WL 1MEXL 2J88L 4XP5H 3B43A 4ETQA 2D03L 4TSAL 3FFCD 4HJJL 4UT6L 1AO7A 2ICWB 3MV9B 3QDME 5LG1A 4KY1H 2Y6SD 1MCFA 2X70B 3TIDA 3RZCC 1YYLH 3QAZB 2AEPH 4MS8C 1FNFA 2D7OA 4N9GB 1DFBH 4XHQA 1B88A 1X5AA 4UILH 1BBJB 3TBSA 3PJSB 4X4MA 3SKUD 3G08B 5T1LD 2OJEB 1QSZA 4MA1B 3ZL4H 3REWA 4L29B 3AFLA 2ICWJ 1UH3A 4HCRA 4NQUA 1OQXA 3IJSB 5L2JA 5I0DA 4BJLA 3MRLA 5HDLA 1AGFA 4O58L 4MA7L 2AKRA 3BQUC 3LKPA 3I75A 5FYJH 5DJXA 3HB3C 4KROD 4LLDB 4GS7C 2IF7A 2A6KB 2FHFA 5IB1A 5FGBC 5AYUH 2GJ6A 1XH3B 4ZODA 4QRTB 3VDAA 3L3OA 4JFED 3O0RH 1XZ0A 1LO3L 1MJ8L 1D9KB 3LN5A 3SGKC 1PGRB 4DN4H 2G2RA 3QRGL 5I1DA 3IKCA 3QIUD 1ZLUH 4XRCB 4KROB 2H26B 1KTDA 3NH7H 4Y5XA 3QDGE 1J8HD 1N59A 3GSWB 4V1DA 4MNHA 4B50A 5I1CL 1YEGL 3U30B 1W0VA 2WUBH 1F00I 1ZVSB 3QDJA 1KSRA 2WBJB 3DGGB 2EDEA 2KZ1B 3OR7A 4HJ0C 1FGVL 1I1RA 2NW3A 4PJDE 5F3HB 1R0AL 4UINL 1ZS8A 1Z6JT 3DV6A 2YRPA 4AEFA 1R6VA 4YIQA 4DVBA 3HI1B 3GO1H 1IFHH 4JFYA 1GHFL 2FGWH 1A7NH 1AXTH 3T4YA 1JWSB 1NCWH 3IJYB 3AS3A 3H0TA 3ULVF 5EN2A 5L2KD 2BSSA 3QIBD 2W60B 5EA0H 2Z93B 1DN0A 4L8SA 2XN9A 4U6HB 1SM3L 2AJSL 4CW1B 1WTLA 4I3RH 4U1SB 1DQDH 4PRPE 1JRHL 3VMPA 4Y89A 1J0IA 3K4AA 2XG5A 2DQCH 2DIJA 4DZBB 4P3CH 4XXDB 2X4QB 4YX2L 1MAJA 2DN7A 3SDDD 4EUPH 5C0GB 2M1KA 5BS0D 3LS5H 3HE6A 1NDGB 4PTTB 4XPTH 4XXCC 2Z35B 2BERA 1Q1JH 3NTCH 2CLVB 3PWNB 2PW1B 4F57L 1UG9A 1U8OB 1NGZB 3WFBH 1R5IB 1FL6B 5EU5A 4JDTH 5C09D 2N1KA 5KJRL 4JRWA 4MVBD 4MZ2A 3ULUD 3MNWA 1VPOL 4OGZA 4TTGA 5JZ7D 5E4EB 2YEZA 2FEEL 2D7PA 4PGBA 3C5SA 4RNRB 3O8XD 3BEWA 1G1YA 3LRSB 2R0LH 2V5MA 4NHCH 4Y5XB 4CMHB 2WP3O 1CE1H 1N2RB 4GH7B 5SX4H 1HH9A 1UM4H 4TUJA 3QT2A 1YEDB 5IR1A 3QFDA 1YPZE 3ZKXC 3D25A 4U1HA 3AVEA 1FNSL 3CMGA 3WNLA 3QEQB 4NN5C 3QEGL 3SKNA 3HC0A 3IDMA 2XV6B 5DVKA 5EPMB 2UUDK 1QEWA 5FF6B 3AM8A 4ZUWB 1IKNC 3BXNA 4J1UB 5E95B 3FOLB 1QVOA 1H3XA 1YPZB 1HXYB 4KI5C 1CE6B 2XZQL 1EHXA 2VLRE 2APTA 4GRLB 5E9DE 4W4OA 3KXFE 5CLTA 4GT7A 4JZNA 4PJBF 2YPLA 2ITCA 3H9ZA 4MNQD 1SJHA 3EDFA 2H41A 4I9WD 1QPXA 1XF1A 3FB5A 1XCQB 2VLJE 5E70A 1U8IA 4XCFH 3QEUB 2WAHA 4FQHA 1HHGA 2E27L 3BEVA 3N06B 4MWFA 3HC3H 4LSSL 5GGRB 4QOKA 1MCPH 4QXUL 4JFQB 1T0MA 1RURH 1EGJL 4HPOL 5JDJA 4AEHH 2Z31A 1Q0YL 4WJ5B 2FWOB 3MV7D 1R3IH 5JR1L 1JTOA 12E8L 1MAMH 1VA9A 2Y6SC 1IGIH 1QSFD 3I9GL 5BQ7A 5INCB 3U6RA 1CD8A 1IAOA 2DJSA 1LK2A 3QH3B 4FTVB 3MLTA 3SO3B 3V7AG 3DV4A 2VITB 4OLWL 3BRDA 4M93B 5J3HC 2N4IA 1G7QA 4NZJA 1BIIA 2DI7A 5TE7H 2EDTA 3S8WA 5BZWA 1KV3A 1M6OA 4N0UE 4WEMB 4TN9A 2IADA 3OF6D 3T2NH 3MJ7A 5HGGS 1ZGLA 2P8LB 3K2MC 1FG2B 1HE7A 3KAAA 5CJ8A 4HUXA 2NTSP 4PJ9D 5EO0A 1BEYL 4OZGF 4NT6B 3KLSA 1G7MB 1E6JH 1MIEH 5FUZH 4JVUA 5JW4Q 1DUZB 1SEBA 4CU7A 1S7UB 3B9VA 5D7LE 2D9CA 4XCYB 4HS8L 1DQQA 2WK2A 2XIDA 3B9KC 3DYMA 4UTBH 1ZT4A 5HDBE 3LKQB 1RY7B 5ESAA 1M7DB 4X6FA 1JV5A 1U3HD 3IFOB 2VIRA 2CDEA 4Y4KD 1I1AA 3C6LC 3NABH 4AEIH 4N5ED 3MC0A 3WS6A 2UY7A 4I0PD 5T1KA 2C7UB 1MFAH 4GRLA 3KPSD 4QOKD 1Q38A 3HS0B 3VXSA 4I5BA 1MHPL 3ULSB 3ABZA 4XCNB 5EBLB 4NQCE 1NQBA 3D0LB 3TO2B 2VQ1A 2R1XA 3EYVA 1G0YR 4GRLD 3CSBA 5DVMA 4ZAKD 4HDIB 4F7MA 2R2BB 4FMKA 4M1CC 1GGYA 3PP3K 4IRSD 3FT3B 1A6PA 1N26A 4JANA 5K9OA 3SQOH 3HZYA 4Z8FH 3MLPA 1IMHC 3O3BB 4ZO7A 1CK0L 5BZDB 2X05A 5DEFA 4QLRA 3LSOA 1JGDA 4KJYB 3VGEA 1XCTB 2JJVA 5I1EH 1G1CA 3Q6FB 1QHPA 3QB7C 4OUUA 2J2ZA 4KRPB 4QRSA 2B39A 4LCCA 4ODUA 4PJ8D 4TNWK 1MJUH 4HFUL 1IARB 5TDNB 2C5DC 3PP4L 1U9KA 3ALXA 3BKJH 1VDGA 1OP5K 2LAAA 4N0CD 2WSKA 3U83A 3VW3L 4ZFFA 1MJJB 1NEZA 4KH2A 3JV4B 1JYVA 3HE6B 3GSVB 4L8DB 3D85A 3MXVL 1CICA 3EHBC 5D7SL 5JOPE 1IQWH 1NBYB 5C7XH 1TQBB 2G5BA 4R7DA 5MI0C 2B0SH 1TZGL 2YD3A 4HUKB 3SDCC 1MFBL 2A73B 1RSFA 5EU7C 5M7QA 1KCSL 5CSZA 3HUJF 4E41A 1KBGH 5JQ6L 5BW7A 1AGDA 1SYVB 1F3DH 4ODTH 1KJ2L 3IDJB 3ES6A 1V05A 2ORBL 3H6JA 1TLKA 4LBEA 4OKDA 4ZQKA 3F7QA 3FO0H 1GC1L 3T0EA 4NWTH 5IM7A 4M7ZB 4P57A 4ZOEA 3FFCA 2QQLL 1KB9J 2C4XA 1X5LA 1DSFL 3MLUH 2XTJB 1H3PH 4WDIB 3SE4A 3P9LB 4LRIA 3U1SH 1RK0B 1FNEB 3KYNA 2GFBA 4JQIL 1J8HB 2EIDA 2XN9E 1L7IH 4EDXA 3Q5YA 2UY6A 4MJ2A 4NBYB 4QRPE 1OM3H 3SY0A 2VZUA 3K8MA 3G6DH 4L4TA 4U1IB 5D1XA 4CVZB 3MRKB 4HK0B 5MERA 3UTTD 3ZKQD 3MACH 5DA4A 5HI4D 4EI6A 2YSSB 3PV7A 3ULVH 3SBWA 5FGSA 1AXIB 4XB8A 3GBML 2JCCB 2IPTH 3EFDL 4OF5A 4HG4K 4EJ1C 1AI1L 2BP3A 4M6NH 4CVXA 1B3JA 5KS9A 2IC2A 1GZPA 2NZ9C 3MLXH 4WI9A 1NMAH 2Q86B 2ERJB 4ZS6D 5JXAL 3W11D 4NOBA 2AK1L 4F58H 4Z7NE 4KMTH 4GW5B 5C0FB 1QFWI 3HMWH 2J7LA 2EYSB 5GRJL 3S3PA 1PLGL 1BOGB 1FGNL 3X3GL 4CVXB 4L3ED 4F9LA 3G6DL 5C0DA 2R69H 5C0RL 3K4DA 4HXAH 5HHVH 4U2YA 1KB5L 3QFDB 2I5YL 2Z8WC 3HE6D 5J7CC 5KG9A 1MPAL 1QRNB 4L1DA 1FG2A 1UXSA 2GITB 4XP5L 3BHBA 4KGJA 2BY3A 3QXDA 3PIQA 3ROOB 1HILB 4RFOL 5GJSH 3P4OA 1F6AB 3QEHB 3S37X 4IDJH 1GGBL 5JDSB 4NT6A 3ZDXE 1J7VR 3TBSB 3M8OL 3HG1D 2GCYA 4UB0L 1EO5A 1B9ZA 5FECB 1TCRA 5C9JA 4XNYH 1I8KA 4YFDB 3F6IA 2NW3B 2AK4B 1NFDF 2CMRH 5ILTL 1JPGA 3IDIB 1YPZF 4U6XB 2WZPD 1WC7A 2V5RA 2ZOKB 1NBZA 2X7LA 2ARWA 1D3CA 4Y19A 1Q8MA 1VACA 5J9PA 3MCLL 4OZ4B 1A14L 1K6QL 2HKHL 5BO1H 1KIRA 1CG9B 3WNPA 4G6JH 3FB8B 1L0QA 4JFFB 4A6YA 3BKMH 4NHUA 4YDJB 3MLXL 1X7QB 2YD6A 1JP5A 4WEBH 4RGNC 1LHZA 4P2QB 4MMZC 4Z7OF 3CDFA 2JF1A 1EDQA 1XIWB 3HC4L 3G5VB 1SVCP 5FOBB 1N8ZA 5CILH 1N0LA 1U8JB 3IDGB 5GGQL 1CD0A 4NC1E 4YHLH 5F7WC 1U42A 2FIKA 2IADB 1G9NC 5SWQA 3MUJA 3NFPA 3KPOB 1MQKH 2XG4A 1Z9SA 1DQLH 3UJIL 3SDAC 5E6IB 2CKBH 4YHIA 4X4ZA 1ZLSL 3RPIA 4GBXA 3OGOE 1BQHA 4Y2DB 4HQQL 2Z8VC 5IGXH 4HGWA 1IEAB 3RVVC 3WS6C 5LGHH 4WWKC 3SCMD 3PWPB 3ZSTA 4AL8L 5BVPL 2VZSA 4F9PC 3CVHB 2EDDA 2I9LA 3U4EA 1DDHB 3PGCA 1NCWL 4ORGB 2XFXA 1NMCB 4WWKB 1RHHB 4M62L 2Z0BA 1UJ3B 3NPSB 1T03H 1YNKH 3IDUA 5I1HL 4ENED 2P8LA 4YK4B 2WIIA 5EBLA 4YUEL 1PD6A 3EZ8A 4NN6C 4WCYL 2Q7YB 2XOTA 1NFDA 1BD2A 1RULL 4JVPA 3NPZB 4CMMB 2YMXL 4JQIH 5D71H 2IH1B 1JPGB 4P4RB 4KMQA 4S1RL 2P7TB 5D70H 4LQFH 1A47A 5E8DL 1JUFB 4AJ0A 4JFPA 3RDTA 4ISVA 3L95B 4IEFB 2COQA 2WUCL 7CGTA 3O45B 4OBSA 5AG9A 4X9HA 4XVSL 3EDJA 4IRJD 4QYOB 3RRQA 1UZ6F 4QTIL 3O3AB 4MDJA 5F89B 4HEPG 1ZLUK 4CNIB 4QOKB 1P9MA 3M07A 4X6DA 4F7CA 3O45A 1FH5H 4P2RA 2W60A 4Q6IA 2YPKB 1T6VN 5H37G 5SWZA 2DYPD 2OX5A 4PRHB 1WAAE 4R3SB 4LCUB 1Q0YH 5TFSH 3MCG1 2ATKA 5E6IA 3F65A 5FYJL 3OXRA 2HJLA 3MLTB 3RWCB 1MCSA 4H25A 3ZYZA 4NC1C 2YA1A 4PJ9A 2FB4L 2PXYC 1EZVY 1RPQA 3VXOB 1FE8L 1BBJA 3VCLA 1EEQA 2YBRB 1A6TB 2VLLB 3MUGA 3BMVA 4ZDHB 5IJVB 5DK3A 5C3LD 1DEEA 1KTDB 1KLFA 4DKEL 2P42B 1XGTA 2A6JA 2EIZA 2X4SB 4F9LC 5DJ8A 5KG9B 3G6AB 5E5MB 3VFGL 4OZFB 1BM3L 5JPNA 4Y0GA 2L4OA 4NKMA 1EO7A 4I18B 5DYOB 4Q9BA 5TF1L 3LPFA 4IIQC 1KJ2A 5EO1B 3PXJA 1LO3H 1MJ8H 1G9ML 4XP1H 1HOCB 4WU5A 3WHE0 2VXSH 2AJ3B 5SV4A 1LQSR 4GMSL 1YMMB 1IGCH 5F96H 3QDHA 1PSKL 1J0ZA 5C8JB 3ALPA 5IQ9A 1YC8A 3DV6B 2MQCA 3ULVL 2DM4A 3VXPB 2HG5A 5GRUH 4JFDB 4FXKA 5I19L 2BOCA 3P11L 4LLVA 5E2TH 5AD0B 4IBLT 4WU5B 4LSRH 4JFDE 4MD5B 4LDOB 4NQEB 4TQEH 1T2JA 2P44B 4LVNC 4PJIF 1YA5A 4LSDA 2A83A 5IM7B 3O4LA 3L3HB 3G5ZA 4LGSB 2VZTA 1GOGA 3CFJB 4DK6A 3L1OH 4UT7H 5TPWH 3PWVA 4RRPG 4G7VL 2BOBA 1CG9A 2VL5B 4PJDA 3P77A 4TNVF 1N0XH 4BZ2H 5HPMB 3STLA 3MA9L 4X9IA 1AXSA 1JF6A 2NXYC 1IGYB 2UZIH 1AD0A 1KIQB 1ZVYA 1FYTE 1HN1A 4TOYH 3PGDB 5HVGB 4HKZB 3OAZH 3KLAA 3D85B 2YPLE 3KDMB 3MOBL 4C56B 3V4PL 3H9SA 4JFHD 4QHNA 2XWTA 4TRPH 2F5AL 2VDNH 2PTVA 2ADFL 4HZLA 4P46B 3RPKA 1CIDA 3GSNL 5FA3B 3BJLA 4NKIH 3B83A 3QJHB 4Z7WF 3H9HA 3UTPE 1BD2E 2LABA 3OB0K 4KK5C 5BMFH 1I3RA 4L4JA 4MQXD 5IUSA 1S78C 2HN7B 4PB9L 1NSNH 1EEUA 1WFNA 5DUBA 3MLWL 3SGDI 4XI5C 3GJEA 3VWJC 1R24A 4OLVL 2FZ3A 4U2ZA 2F54E 5DQJB 3KPMB 2UZIL 1UB6A 1YEGH 2AQ2A 2X70A 4YXLL 1BWMA 3KS0H 4PJHB 3MODL 5BO1L 1GIGL 3JV6A 3TYFA 1C16A 1JL8A 1R3KA 3I85A 5C0BA 2ZUWA 3R06B 4D3CH 3HNSH 5ISZD 2NXYB 1LP9A 5CCKL 1CCZA 2DQFB 3O3EB 1CDJA 3OKNB 4YE4L 5E8NB 3GSQA 3VXQA 1NFDB 2PCPB 1EZVX 4NC2B 1FG9C 1ONQB 4BFBD 1OAUL 2AEIT 1FIGL 4ZFZB 3OAYK 2JCCA 2ZOLB 5JPMB 3G5VA 3MJGX 1D5ZA 1QBMH 5KSBE 4X4XB 5C0ND 5I1LA 1T20B 1U8JA 4PR5A 4FS0A 3SDAA 3VFOA 4M1GH 1P6FA 5IEHB 1BZ9A 2EE3A 1EX0A 3FQRA 4YXHL 2OL3A 5FO9A 2GJ6B 3ARWA 1BWWA 1EGJA 1A1NB 1CQYA 1U8HA 1AQDB 3TBTA 3K80A 4YHYC 2QHLA 1XF5A 3FCTA 1CLZH 5C2BH 3TESA 3NCYP 2P49B 4XWGL 4XXCA 4J6RL 2N7BA 4P57B 2R8SH 4LCUA 4S0TD 4WFHE 4LCCB 1W8OA 4ODUB 4F15C 5CINL 2DD8H 1ZGLM 5GIRB 2Y36L 4Z7NF 4LSQH 1HYRC 2NY2C 3P9LA 3IJSA 1LWRA 1Z9LA 3L5WB 2R1WA 1UCTA 4EDXB 1NAMH 4B41A 1NFIA 1ZHNB 1BJ1J 5SWSD 5D7SH 1I9RH 1RZGB 3QFJE 3O3DA 2B8OT 4A2MA 3A0OA 3MLSL 4X7SH 1U3HC 3SQBA 2OQJA 4HMEA 2GQHA 1JHKH 2APBA 2P24B 5IG7B 1YYLL 4RA0C 2VLKE 4KI1A 3KNBB 1R0AH 1L9MA 5SX5K 1T2QL 2GHWB 4F7PA 3VGDA 4JFFE 2ADJB 3PWJB 1IKNA 1A6WH 4BFIB 1P4LB 1WZLA 3JWDL 4KV5F 4XNYL 4X0KB 2GYSA 5J6GB 3HR5A 1T7XA 2HVKB 5ECJE 5F9DC 4MJ6A 1V3KA 4L9LA 4QRRE 2X4OA 2AK4E 3KVQA 3CC5A 1NAML 3WJJA 2V2TB 1Y6KR 1OAXH 1WFUA 3VJ6A 3GKWL 1KFAL 4CADA 5C0AE 4FFWC 2NY2D 3WLWC 3CFEB 1OCWL 3FO2A 4RAUB 2Y72A 3Q6FA 4EBQL 1C12B 4GKSA 4PS4H 2GJZB 5IBUB 4PY7A 4G9FB 1EBPA 4U1IA 3CVHH 1I1AC 4MGXA 1DVFC 2Y9RT 4NDMA 3D6GA 2DQHL 5C0JB 5DK2B 1U6AL 5DD0L 1OTUD 1R5WA 5EU3B 5JW5B 3C09B 4Q97A 4O9HH 5CWSA 1TZHA 5LGHL 3X13A 4QHLA 1YNLH 5IESL 3PHQA 1BBDL 1B0RA 1O7SA 3MBEB 1T80A 2IPUG 4HUUB 3BZEB 4C56A 4LCYA 2APXA 2NPLX 3BSZH 3KLAB 3DX8B 5CZXD 3DI3B 5GZND 5F7DB 1ACYH 2XTLA 3GKWH 4G6FB 4GW1A 1OB1B 3RWEB 1UH4A 1S7QB 1DUZA 4IRJA 3NA4A 1PKQB 1S7TA 2PO6C 3WFCH 4Y19B 5IEKB 3U2SB 1A6ZA 3KS0J 2C3HA 4KI5F 4OZFH 1IFHL 5HGAA 3EBAA 2VH5H 3CJJA 2VYRE 1ZEAL 4QWWD 3TPKA 4N0RA 3BH9A 4QY8A 3MRRB 2N7AA 2FO1A 2V17L 4HS6A 4G8EB 5CEZH 3RWHA 1IL1A 2BC4A 4PYGA 5KSAC 3OSKA 3LMJH 3FO9B 4L8DA 2G5RA 4ORZC 2X4NB 3HZVA 3V52H 2Q6WB 4RIRB 1QLRA 4O4YL 1I8MB 2HJKA 5KS9E 4YFEA 1L6ZA 5DJ2B 5INCA 3TV3H 3WFHB 3WHXA 2Q87A 3MJ9L 1CICC 3MRRA 2ERJC 4KFZC 2FH8A 4X6CA 2G60L 1A8JH 2VTFA 4MQXC 1PYWA 1N3NB 3EIFA 2OTWB 2ZSVB 1DZBA 5EORL 4M43L 1GH7A 1TJHL 1KG0A 3CSYB 4WNQA 3C5JA 2BSTB 1AGBA 3MGOB 4N90E 2HWZL 5FCUH 5L0QB 1BHGA 3INUL 4BZYA 2GSIB 3T0XA 5I30H 4YPJA 4OM0L 1CGSL 2BK8A 1PG7H 1II4E 2AEQL 4LKXB 3H42H 2AEQH 2ITCB 4GUPA 4PGCA 3SDAB 2FD6L 3U0WL 3MUHL 5E99L 5EU5B 3TO4C 4X5XA 5CJBA 4AZ8A 2DDQL 1PAMA 5C0FA 5KSVB 4Q9QH 3EAKA 4PJFE 5MP6L 4RZCA 4K23L 3CXHJ 3S5LG 1P7QA 3HE7B 4LVHB 1ZOXA 4YXKH 3BT2L 4PJ9B 2VXUL 4GO6B 1YY9D 1H3VA 4S1DC 3RWIA 1GGIL 1UVQA 1CGWA 1J1OH 2UYLA 5HJ3B 1RZ7L 4X6FB 1NGWB 4KQ3L 5CJQL 1A1MA 5IFHL 5JNYA 3QH3A 4FTVA 4BH7B 2BNRD 1JGUL 4YC2C 1J18A 3ARYA 2C1PB 3TWCL 3VFRB 3SDCD 1KCVL 4ZXBD 4I0CC 4QNPF 1E4JA 4RFOH 4Y19E 2CD0A 8FABA 3LKRA 4HD9A 3RHWF 5F71A 5D6CB 1A21A 2WANA 3WUWA 1IGML 2W65A 4JG1L 4RDQF 5I8KL 1D5BA 2ZCHL 3FO9A 2X5PA 1QRKA 5T1KD 4I0PA 3NAAL 2JB6B 3HC0B 3OR6A 2DD8L 4XNZB 2Y1VA 3FRUB 3IFNH 4MB4A 5L6YL 3MRMB 3OZ9L 3CFDA 3OBAA 4P2QD 4PJ7A 4ETQB 3VE0A 4GJTB 4Y4HD 4P23D 1MFNA 1NGQL 1U3HA 1M05B 1OD7A 1RJLA 5EZOL 2ZUTA 5J6HB 3GBNL 3O3UN 1TQCC 4F7PB 1GGIH 5E8EA 1QFWM 4RISH 1BP3B 1OAKH 1KT2B 5FAAA 1QFHA 2R9HD 3OAUH 3ARFB 3QXTA 3T4AB 4JRYA 2PW1A 3TZVD 1I3GH 2EXYC 3N1FC 2VIRB 1P4BL 4NGHH 1P2CB 2OL3B 1TMCB 3SDDC 2EDBA 2VRAA 4EQ3A 3BQUA 5C71A 2DLFH 4UUJA 2YKLL 4P9MH 4Z76A 1P84J 2CRMA 2GSGA 1AD0B 1KIQA 1UZ6E 1EEZB 4CW1A 1H8OA 3DUUB 2ICEB 2QR0B 4XP6H 3RIFK 1JZ8A 5KVMC 3JV4A 1HHHA 3WO4B 2PNDA 4EXKA 2NLJA 4P2YA 5A2FA 2M8XA 3THMH 3VXME 1RZ8A 1NGYB 4UV4L 2F74A 1B6UA 1CDBA 4S2SB 1SMAA 4U6YB 3LS4H 3MLWH 4MAUH 4S1QH 5DK2A 2GUOB 5GS1A 4M7LL 1S9XB 3IXTA 4XNZC 2A6IB 3ZDYE 4Y4KC 4EKXA 1DBML 1KYOK 5EDXA 4X9FA 2D0HA 3D3VD 4P46D 4ORGA 5DQJA 1JHTB 4HBCL 4LNVA 4Z7VA 4LCYB 4OT1H 5EUOF 3VFNB 4TQEL 2LVCA 5DMYA 3MJ9A 4Z7WA 4GQ9H 2W0FB 5D1QA 5D1QD 4JO3H 5DR5L 3PWJA 4Y5VA 5JTWA 3GJFA 2K3TA 3X12B 4GXUN 3V5HA 4C4KT 2A0LD 1GC1C 4PGDA 4U7KA 5H37H 4G8GE 1T21A 4Z8FL 5E6YA 2JCCF 1MHEA 5JPNB 3RBSA 1CLOL 4JDZB 1T0PB 4H26B 3GMPA 4KZDH 2HKFL 1NC2A 3B9KD 4XP4L 4HKZA 3SGKA 3TT1H 3TA3C 5GGVY 5C09E 5F3BA 2VDML 1MJUL 1A3RH 1AHWB 4FP8L 4FP8H 2WQRA 3HMXL 3GZKA 4F33B 3BGMB 5GRUL 5H2BB 3HMXH 2IBGA 4LEOA 4H8WC 2NY3B 4Y1AA 4HUXB 2DLEA 5F9AC 4MMXC 1J11A 3TPUB 3JV5A 3LEYL 1HEZA 4P4KD 2F19H 1INEH 4GXVH 5JOEA 2XY1A 3QUXD 5KW9L 1NPUA 4QKXB 3VRIB 2JJTC 2OSLA 3RWCA 4AENA 1G7JA 3DARA 3G5ZB 3QZWB 4HWUA 4JY5L 3WKML 3BGMA 5CD5D 1XIWD 1FORL 1VPOH 3BESR 2Z31D 1WAAF 2B1HH 5HYSG 1IE5A 1DBBL 4I77H 5EU6D 5DUPH 5KBNC 4PIRF 1IQDA 3JWDC 4G7YH 1FH5L 3PF2A 4Z7QE 5IFHH 2PYFA 3M45A 1UADC 3Q48A 2BNRB 1NUGA 1RU9L 4J3UA 2CDFA 4X6DE 3GSNB 5E2JA 3T1FA 3C8KA 3NABL 4YNYA 4KTEL 4OGXH 4JLRB 4U7MA 3TNMB 4EN3B 1GGCH 3PWPD 4OV6F 5JPMA 3IGAB 5FKPB 2APVA 1Z5LA 2DDQH 2GI7A 1GAFL 2ADGA 4P2CG 5CS7A 5CEZE 2B5IB 1WEJL 1SJVA 4JGMA 1P69B 4WI2A 3MRCA 2H6PA 5HYQB 5EOCH 1BD2B 4CMMA 1HZHH 1MWAB 3IDXL 4MQ7B 5BV7H 1JGLH 5ERWB 3A6OA 2J8UA 4PBWD 2J6EH 3BDYH 1EERB 4JDZA 4J3VA 2X4PB 1A3QA 15C8L 3L9RA 1HSAA 3D69A 2AXJA 7FABL 4LRNH 4OCXH 3D1MC 1MFCL 4OLYH 3WS3B 4PRNA 4YC2B 3DRQA 1T1ZA 1K3ZA 1JTPA 4Z77B 3RNQA 4NQCB 1UXWA 2DKSA 4JPIA 2EDQA 4TNVK 3B9KB 1MHCA 5EOCJ 3MOAH 3DECA 1OL0A 4KJWC 4TUJB 4G43B 5DURB 1CGXA 2BJMH 5JIKA 4LLAA 4LPCA 1ZKAA 2DWEA 1UB5B 3BGAA 5EU6A 2GJ6D 1W2KT 2MTPA 3H7BA 4RGMC 4F7CB 3W9DB 1JZ2A 3EFFA 5D5MA 1D7FA 4IMLB 4XPGL 5FM4A 3DIFB 4F37K 1UWXK 1UM6H 3VWKA 3TVMB 1NLDL 4OIAA 2X1WL 3T2OA 1I8IA 1GVIA 2XWTB 2WP3T 3KLHC 3K1DA 4XNMA 4Y1AD 4TSBH 1T6WA 3B6SA 1P4IH 3SO3C 4LLDA 1GPOL 1N7MH 2NY7H 4X6BA 3I6GA 4MD0A 5D8JH 4HV8B 5ITFA 1BFOB 5FGCE 5I1IH 3AXLA 5E94B 3K4ZA 1DJSA 5C0AD 1YYML 1VFBA 2Q1EA 3N9GL 4WUUD 5C6PB 2X9YA 2JJSC 2Y23A 1Q9WA 1QFUH 1RZKH 4NO2B 1EK3A 3GBNH 3DXAB 4XX1E 4NNXA 5DSCB 4EI5A 1P1ZB 3G9VA 5KAQG 2VL4A 4PPTA 3MXWH 2LV4A 4NN7C 1IJ9A 5IF0B 5I16B 3MRGA 4XWOD 3VFTA 5DJ0A 5DJ6B 3BH8B 1D6VH 1K3IA 4MZ3A 4CBPA 2EDLA 3BKML 1L7TH 4PS4L 3PWLA 3GI9H 1C5CH 3S3SA 4MXQC 1X6NA 4YK4C 1E4XI 4JRYE 1TVDA 2I24N 5KVDL 2QL1A 2A77L 1T1ZB 5ID1A 4DFIA 4JM4L 3TEUA 1CDHA 2A6DA 1XGQB 4ENEC 1AQKH 2QADB 4DW2H 5HHME 1A9EB 3N1QC 1NFDE 1QKZH 1U3ZA 1ITCA 3MV8E 4OM0H 3WD5L 3WNMA 1GIGH 4GW5A 2V9RA 4ZUSA 2WQ8A 3DWTA 1FYHB 1B0WA 4UU9B 1YY8B 5F72S 4ODVH 4ZUUB 2DKMA 3FN0L 5E08H 2NW2B 1FPTL 2G60H 4GUPB 2A2QT 4MAYB 3UTZA 3S35L 4KU1A 4PGJA 2NY6C 5TH2A 1A6AB 2V9QA 4I2XB 5GRWA 4BSVB 4UU9A 3PHOB 4TPRH 5F9JA 3JTSA 4Y4FC 3AY4A 3KWWA 4L5FL 2IQ9L 4DQOH 3TA3B 2HVJA 3VXQB 1BLNB 1SBSH 3MBED 1VGKA 4PJEB 4MA8H 5E7FA 1RURL 4MLIA 2ZUVA 3GK8L 3GMOA 1UYWH 3H8NA 3SKMB 4N0YL 4HFUH 4RGND 1RUKL 3QDGA 4HUVB 4OZFA 3NCCB 1V3MA 1K2DA 1S7XA 5CZKA 4PGEA 4WFGE 2HT3D 5DJ8B 3EFDH 1YNKL 2YK1H 3S34L 3HAEA 5GRZA 1HHHB 5CZVL 3P73B 4KKAD 2MJWA 4KK6D 5C08B 4AYFA 3S36X 3E2HB 4YDVB 4BSJA 1RV6X 2XRAH 4XWGH 3BAEL 1R24B 5DJCA 5GGSY 1F4WL 5CUSH 1UXSB 1AR1C 3VFRA 2GEEA 4HG4J 3PIQB 1M7IA 4NKDA 5DT1L 2WINB 1S9WB 3QEGH 1Q94A 4Z95L 1T4KA 1XGUB 5HHVL 4IRJB 5HYJD 1CFSB 2AABH 3MNZA 4M1DL 2X10A 4PJFB 5D1XC 3WL9A 5L7XL 3R0NA 1A7RL 1IVLA 1CICB 1DVFB 1G0DA 4PJ7B 1CFNB 1G6RB 2FX9H 4QWWC 4AEEA 1KELH 3S34H 1BAFH 3E6FA 1TCRB 1NGXB 1NMAL 1HXYA 3SBWC 1AY1H 2NCMA 3CH8A 3D87B 3HC4H 1OAUH 3DVNB 4K8RH 1EEZA 2Q76B 1QBAA 3QNYA 4K07A 3HZKA 3OKKB 1MCJA 5DHXB 3BAEH 4B53A 3ARDD 3GHEL 2XI9A 3PWUA 4IS6A 1E6JL 3T0EC 1C5DB 4HXBL 1I1CA 3QEUA 5LCVH 3L5XH 5EG6C 4P2QE 4Z7VE 5KSBF 4OSUH 2J8HA 4PREB 2L0DA 4G6KL 4G43A 4NC0B 2IBZY 3EDEA 3LS5L 2P5WA 3KJ4B 5CWSB 3SE4C 5HVWA 3MRDB 4CUCA 2R0KL 5TDNA 3T0AA 1F11B 2DQCL 2HT2D 1RUAH 1YDPB 4HT1H 1IT9H 5IBLC 4APQB 1NMBH 1JVKA 1MFEH 2AERT 4OLZH 1CXEA 1INQB 2HVKA 1DN2A 5DRWB 3DX9B 1K9TA 3T04D 4DTGL 4WUUA 2OTPA 1GAFH 2AQ1A 2QLVB 3ZTNH 1BVZA 5ALBL 3NCJL 5M95B 5T1DH 1HXMA 1DUYA 5T1DL 3AREB 5T1LA 1YEDA 4BSWB 4LMQI 3HAEG 1QUNA 5F7YC 4ONGL 3CPLB 4JKPH 1D5IH 1EUUA 1HCFX 1JIBA 2X1XR 3ES6B 4LSTH 3QXUA 1Q0XH 3O3DB 3AXLB 4L1HA 3MV11 1MWAL 3RNKA 1UWEH 2FX9L 5L2KB 1BFSA 3BPCB 3RWGB 5IHZA 3IKKA 3QDGD 2IBZX 4U1LB 1OGAB 3KPRE 3RKDD 4JFOB 1DL7L 1D5XA 3QJFB 5AWNH 4LLQB 5TPWL 4NKIL 1ADQL 4UNVA 1FNEA 1MCEA 4DTGH 1WBZA 2V2WB 4OGAC 3MV9E 3TCLB 1LD9B 1FIEA 2YA2A 4NNPH 4FQIH 3SDDB 2BNQD 3O2VH 5CJXA 1N5YL 4BQBA 4HBQA 3LN9A 3BW9A 4NOFA 4I3SL 3OB8A 1AJ7L 4C4KO 1HEZB 5HGAB 1A0QL 1A9BB 1K8IB 3D39E 2DQEL 5K9QI 4OKVA 3CFJA 4UTAH 1P7KA 1G0XA 2F58H 2BRRL 2P43B 1SYSB 3ARDB 1TDQA 2AXFA 1OM3L 3Q5OA 3C8DA 4FQ1H 3UTZB 4U1KA 3OKMA 4N0YH 2QV2A 2NW2A 4HZAA 2BNQB 5TE6L 2HTLC 4UOW1 2J1KA 5E8OB 4TSCL 1EXUB 4K7PH 1JNNH 4EOWH 4OZIF 4QT5A 1LP9E 2ZOLA 3O6MH 2VLKB 4OCYL 1IBGL 5IVNA 4XVUD 4R26H 2MWCA 1DQLL 3UJIH 1FFPB 2KKQA 2WM0A 5IEHA 2HVJB 4KDTA 2NY5H 3NCFB 1SY6A 1I85A 2DMBA 4XT1C 3ZE2E 1WZKA 1WF5A 1S7QA 2EDXA 1U8PA 1BIHA 5C3TA 3QIBC 4JDVA 4AQ1B 1UCBH 4CL7A 4YNYB 3FT4B 1CWVA 2BNUA 3C60B 1QP1A 4OCMC 5EU6E 5F7DA 3RWEA 1KCVH 3M1BA 4I0KA 2YC1B 4QXTA 4ZS7H 2FZ3B 2GK2A 4ZS7L 1AD9B 3WFEL 4GRWF 4U49A 2OMBA 1GRWA 3GRWA 5IW3A 4M8QB 5FGBA 1T83C 1RFDH 1EMTH 5CHNA 5J6GA 1FO0B 3MUY1 4CU8A 3RPIB 4R90H 5FKAB 4L9DA 1CD9B 1N64L 4FRWA 2DQIL 2Z9TA 4K8RD 3R06A 1MH5B 3IDXH 4MCZA 1U2HA 2NY4C 1OSPH 2CIIB 3GUTB 5GS2D 4TYUA 5EWIH 3D39D 3FHAA 3QQ9D 4PJCF 3W5MA 4QOKE 1A9BA 1K8IA 3IRZA 1N6QH 5D1ZA 1R3HB 4PJBB 4R4NC 1PEZA 5DJ6A 2VDOL 3FQRB 5DJ0B 3DMMC 4ZUTB 3T09A 4PJ8A 2DAVA 4N1EA 1CGTA 3D39A 4C57C 4PD4J 4D0CA 3RVTC 2FX8L 2C4FT 4KKLD 2VL5A 3P11H 4PJBA 5I1GH 4PRAB 4HWEH 4RMWA 3BZEA 4KROC 4PGEB 2AS5M 3LQAH 2IFGA 3L5JA 3KLDA 4URTB 2QKIA 4HV8A 3EW3B 3VFPB 3L3IB 3SDAD 1XF5B 5B8CB 5GRJH 1S7VA 2CRZA 3FCTB 3UPRA 1G9MH 4OF7A 1CVRA 2NTFA 1FO0H 1C16B 1UA6L 2XWJA 5EB9A 3RDTD 3DSFL 3T3MF 3SKNB 2X4PA 4G9FA 4E5XB 1KJ3L 2VZOA 1QEWB 2VXVH 2EICA 4I3RL 2BVQA 5CIPH 4ZYKB 2DI9A 4XPTL 1HXMB 4YAQA 1PQZA 1QSFE 5EO1A 1YN7B 2CQVA 3P0VL 1JBJA 5DUBB 5FGCB 2MOVA 3X11B 5A2KH 4KZEH 4YBLB 3DXAA 1BF2A 1AGCA 1DBJH 2XWBB 5MENB 2NR6D 1XCQA 2Y4SA 5I8OH 3VXTB 2FJGB 4XAWL 5ID1B 3ZYOA 1G7IB 4XPAL 5HHQB 1FVDB 4NNPL 3ULVE 2YUVA 1FSKB 1IM9A 1BFTA 1HZHL 3EYFA 5EULV 3ZHDA 4C83A 4ZFOL 1I1AB 2AJXL 1A4JB 1UA6H 3RL2B 1DLHA 2JKXA 2CKBL 4CN1A 2OCFD 1JE6A 5ALCH 3O4LD 2B2XL 2AAVA 4OCNC 4XNMB 3F5WB 2ZUYA 4PJDF 2F8XC 4M5ZL 3FOMA 1PBYA 1EVTC 4R4FH 1E27B 2VAAA 3G6JB 3CFCL 3OKEB 4CN4A 1K85A 3QQ4B 4OLZL 3RTQC 1RD6A 4P2RD 7FABH 4OD1H 3LQMA 1OPGL 5DTFA 4KZDL 1JMZA 2IQAB 1KIRB 3WE6A 1P2CA 1X4YA 4PY8I 1G6RA 4H5SB 1TJGL 3V2AR 3CZJA 2Y7QA 5KSBB 1A7OH 1YY9C 4S1SH 3X3FH 2YOCA 3ILPB 2VSCA 4LVHC 4YDIL 1W72A 4MQTB 5AD0A 4F2MA 4BQ8A 5J8OA 4OGYH 1F97A 2AV1B 3OKOA 2WMPA 3TBTB 3OR7B 5KVFH 3DIFA 1K2DB 1S7XB 5EZLA 5GISL 3EZJB 5KSAB 1KYOJ 1NCUA 4WHCA 5DJCB 1QSEE 1N4XH 1EO8L 5JUEL 3RL1A 1LMKA 1Y18A 3QUMA 3WYRA 1KB9K 3ZE0E 1HINL 4UDTA 2BFVL 2BY0A 3TPUA 5I1KL 4LDLB 1KPUB 1ZTXL 4DW2L 3MLVH 4BK5A 2OM5A 1F5WA 2E9IA 3ESVF 1YYMH 4WFGD 3IKCB 4MD0B 3GGWB 2W0FA 4OZHE 4FFVC 1PKQE 3HUJB 2D7QA 5IW6B 4XRCA 4K9EL 1BGXH 4U6VL 5DRZA 1QBLL 4R7NA 2V2WA 4OI7A 1F4WH 1XF3A 4M1GL 3OAYH 4P23B 5ENWB 2AI0H 4K8RL 2GT9B 2P4AB 2EDHA 2DQFA 4UQ2A 3DX7B 4NM8H 4RGNE 4C58B 3W0WA 3PHOA 5I6XB 1QFWH 3C6LB 2ARJA 4G7YL 3RVUC 5I76B 1TQBC 3DURA 3V8OA 1D9KC 2R29H 1OAYH 1PEWA 5TQ2H 1WIOA 2AJUL 3EYQC 4JKKA 5E8PB 5AG8A 1BZ7B 2JCCE 2UWEB 5IVZA 3NIDF 2DB8A 4B0MM 2GSIA 3FAWA 3UZEA 4Q9QL 3MLVL 3BQUD 3O2DA 4D8PA 1FL3A 2ZSVA 3O6KL 5CIPA 4WW2C 2HRPH 4U1GB 5DRNA 2X4UA 2BSRA 5I9QB 1MJ7L 2YRZA 3RX5A 3T65A 3JXAA 1GCFA 3NCEB 4F7MB 5DQDL 4EZMA 2DQIH 4PJ8C 2QJDA 4YO0A 4NP4L 3O8XB 5MHSD 4GBXB 2OTUB 5DI8B 5C07A 5CILL 3EOTH 5JQHC 1KFAH 2JK5A 5FDYA 3HB3D 1NDGA 4HS6B 1NLBL 4LPWA 4TVPD 1PVHA 1EFXA 5J1AA 1CS6A 5F1OB 5I1CH 3QUZD 4G5ZH 4YR6A 1MVUB 5KVGL 3G6JE 1F90L 5D72L 5EUKB 4JQVC 1T0NA 2HLAB 3MXVH 2DLHA 3A6BL 4JZJA 4X5WB 3DHMA 1KUMA 4BM7A 4GBXD 4M6MH 1FZKB 3BIAX 4XCYA 1KOAA 3MUGB 1ODAA 2Q76A 2OK0H 5J1AB 5F9WB 4HIXH 5ABDE 2OK0L 3CLFL 5JQ6H 4XP9L 4WRLA 3RQ3A 3A6CL 1MOEA 3LKOB 1Q9LA 1RHFA 4JKPL 3P73A 1W8NA 4DGIL 2VLRD 4DVBB 3IU4H 1YEJH 5HI5D 4U3CA 5TJWK 1EJ6A 3I50L 1QQDB 2AV7A 4ZNCD 4K3JL 4ODHL 3VXTA 5D8JL 4P2RE 2VITA 3KPTA 1V3JA 4QHMA 1G7HB 3THML 2HP4A 1CGUA 1T2XA 1G9NH 4OIIH 2G9HB 2VLRB 5ESVB 3OX8A 1QBBA 4PLOB 2E5EA 4MD5A 5TH2B 1WFOA 3BD5A 4ERSH 1N5YH 1NL0L 4V2BA 3MRBA 3DVGA 3CVIH 2QSCL 4JY5H 5ICXA 5I18H 3UMTA 3DSFH 5EU4B 5DZLA 3UTTA 1CFTA 2VLRA 3IDYC 2F9BT 3SE8L 5GSVA 3TGXA 2A6KA 5IV2A 3CSYA 4WNQB 3GMOB 1FNGB 4KK8D 2VDLL 5CP3H 5D7LA 2Z4QA 5I8EB 3ZE2F 3VWKC 3LRGA 2VH5L 5HY9A 4KVCH 2JE8A 2DM2A 4O02H 5JHLH 2RAMA 1ZXQA 5DEZA 4TULL 3MJ8B 4ZAKA 3W82A 1CFTB 4B5EA 2CK2A 2K7PA 4TULH 2HJFB 2R2EA 4DZ8B 1KJ2H 5D2LB 2EIZB 2H32H 4NBXB 3BDBA 3VFNA 4NJAH 1LP9F 4OM1H 4POZC 3QUZC 1S5IH 4JR9L 3SKOA 3BO8B 4WW2F 2GJJA 2VJXA 3B3IA 4YHPA 3SOBL 3OKLA 3VFGH 1J1XL 2XQBL 5EIVA 3A67L 3T1WA 4JO2L 1DP0A 4O51B 3NCJH 1I7ZA 1IEAA 5B22A 5C0NC 5ALCL 2RIKA 2E8ZA 2WBKA 3ME0A 1AO7B 2ICWA 4YXLH 4DKEH 2D0GA 3DPBA 4OF3A 1MAML 4PBXA 1G7PB 4KDWA 5GGUB 1IGIL 3I9GH 3MRJB 1MWAH 4JFEB 3BP5A 4BQCA 5F8QC 4FHBD 1I8MA 3MA7B 3VFUB 1XGPA 5ICZB 2O5ZL 1NEUA 5DJ2A 3WFHA 1YEIL 3OR6B 3EOAA 3JWOC 1RFDL 1F3JA 5KS9F 4M43H 2NQCA 5FOBA 4G8GA 2OYPA 2GCYB 3HPLA 3IDGA 1RMFH 5L8JB 4HKXB 2VZ1A 2R9HC 5K9JH 3VWKB 1LNUA 5LBSH 4S1SL 2EH7L 1ZA6A 4UT7L 2YD9A 3NFSL 1NUFA 3CCHB 4DN3L 2ESVE 1MCHA 4LPTA 1GHFH 1FZJA 3EO1A 3CUPB 3L95A 4BQ6A 5A16B 3G6JF 3HLAA 1JYNA 3T0EE 2DBLH 2ZPKL 3BP7B 5J12B 4RQQA 2IBBA 4QRPB 1NBZB 2X7LB 3UBXA 5I1AB 1TJHH 3TVMD 5D5MF 2XN9B 2D3VA 2IFFH 1QZ1A 2ZNWA 5E9DB 4NRXA 4NQCA 4KDVA 5JHDD 5EZLB 2YD7A 4FABH 4QRSB 3L7EA 3SHSA 1G9EA 2LAGB 2OTUA 3CVHL 4ZTPL 2ICCA 4NO5B 1B2WL 3OKMB 1ND0A 5L88L 3BIKA 4TVSa 3EJJX 3IF1A 1U95B 3BZFB 3EYUH 4MXVE 5ID0A 1ULVA 4GMTH 4FQ2H 2GITA 4PLNC 3G04B 2IWGA 3HUJA 2BHZA 1MNUH 3ECBB 3DUSB 3NIDE 4GSDL 1PZ5A 3WDIA 3V5KB 1S9XA 3EYSH 1ZLWK 3TLRA 4J2XA 4P5MA 4NCDA 1NLDH 5C08D 3RDTC 1RIHL 3TO4A 4GMSH 5ID0B 1I4FB 4FNLH 3HS0A 1KPVA 1QRNE 3T0ED 1HKLL 4FXGA 1J0YA 5D93C 4RFNB 2ICES 3QIWA 1P7QB 2BMKA 2DICA 2FSEA 5F7NC 5SWZE 2Q3ZA 5TE4L 3HZVB 3TH2T 3OF6A 2BVPB 4PRAA 2CJUL 43CAA 3FFCB 3T4AA 4PJAE 2ZOKA 4WDIA 3QHZL 1F4XH 3GMQA 4WHYH 2DOCA 5AZ2H 3UTTE 2CKNA 4W4OC 1MCQA 1L0XA 1CICD 1TITA 3BD4A 5HDOA 5C0IA 4GG6F 1MAKA 4X99B 3O11B 4LSUH 5FDWA 1XCTA 1ZE3C 1D5IL 3A6CH 2BSTA 4NFDA 2EDJA 3PUCA 4LAQL 4CVZA 3MCKB 3B4NA 3U6RB 2W65B 2CDFB 2HT4C 4FFYH 3MUZ1 4XVJL 1KACB 5MERB 3P0YL 5CSBA 2YXMA 4BELD 2BSSB 1UACL 4NRYB 3V7MA 1UFUA 1HKFA 2P46B 4XNXH 2P5EA 3P9MA 3TF7C 3ULUF 4U1GC 4TUOA 1VESA 5C08A 4BZ1H 2ZG3A 4HX1B 1JZ5A 3V4VH 1A5FH 1MRDH 2AV1A 5D71L 3TCLA 3V7AE 3GSVA 1G9MC 4HWBH 4TSCH 1INQA 1J0KA 3QISA 2KQNA 4ZSOA 3EJYD 1CR9H 3NPSC 3T3PF 5LKNA 2Q86A 1SY6H 4NRYA 4OD2A 2HMID 2Y07H 3DV4B 4HPYH 3FMGH 4Z0BH 1Q72L 3O6LL 4EQ2A 2BZDA 4PB9H 1AGDB 1SYVA 5CJXC 4AIXA 3WIHH 5E00A 5I15L 1A1MB 1DCLA 1ZT4B 1OOAA 1MCOL 4EDWL 1YEHL 4Z7WB 3C60A 3GIZL 1JV5B 3IFOA 4P48A 1S7UA 5BV7B 4I18C 5KVDH 5HYJE 2OZ4H 1WCBA 3HKFA 4P5KA 5FCUL 4E9LA 2PXYA 3PV6A 3MROA 5H8DA 3IVKA 4OFKA 1MJJA 2HFTA 3ULUL 4F3FA 4MAYD 3CH1A 3QIWD 5JOPD 4DJMA 3D25B 4MYWB 4U1HB 2AI0L 4KMTL 3HMWL 5DK0B 1JK8B 5EPMA 1NCBH 4OLXL 3MRHA 3BZDA 4EI6B 1FAKT 2GK0A 1I85C 2ZCHH 1YEEL 3C2AH 4HUWA 4LLUA 4R2GD 4U05A 2KL6A 3S35X 4ODSH 4JANB 1W72H 1FP5A 1CDYA 5CD3B 3WUWG 1E4WL 1F4YL 2Y06H 3ARUA 4N90D 5F89A 4LLWB 5DQ9B 3R0MA 2J5LB 4XXDA 1KCKA 3B9EA 3L3GB 3QNZA 5DMIL 3BE1H 4N8CL 1M71B 3QIUC 3DVFA 2MMXA 1V7NH 4HWEL 3QR2A 4NKOA 2FGZA 3UPRB 2H1PL 2F8VA 4PP1C 2EH8L 3VFVB 3RUGF 4YGAB 1CBVH 1T7ZA 4Q2ZA 3MV01 2Q7YA 1IAOB 2Y25A 1P53A 4O2CB 4YBHA 4U33A 4NO0B 1DANT 5HGDB 5DD1H 2A73A 5EU4A 1TCMA 2VXQL 1LDSA 1JGVH 1GL4B 1N4XL 1WICA 5SX4I 1F11A 3EGSB 5FYLH 2RFXA 3G5XA 4LIQL 1HHJB 1VENA 2EC9U 2JJTA 3NA9L 1UJTA 3OXSA 2H2SD 5DYOA 3ZKND 3DUHA 4TTDD 2J6EL 3ZT5A 3DX9A 1IGTA 4XBPA 4LHQB 5I73C 1OARL 5FO8A 4N0FA 3RGHA 3CDYA 3ECBA 3VGAB 3P4LA 4G42B 1L0YA 4OV5B 4MDIB 4K2UH 5C0DB 3VI3F 3QPXH 3BYTA 3OHXA 3UJJL 4I9WE 5EU7E 1TQCB 1GGTA 5ALBH 4Y2DC 5IVXF 2R56H 1XAUA 3V5DB 3VXUE 4OB5H 25C8L 4HMCA 2IH3B 2YR3A 3TA3A 2DQUH 5FO9B 1LO4L 5FYJU 1UM5L 1B0GB 2X40A 4ODBD 4P23A 4Y2OA 3RKPA 4IS6B 2EC8A 4M93C 2BNQA 1NC4B 4GFTB 1F6FB 3D2UD 4HWZB 2VQUA 4UILL 4DWHA 4M5ZH 2B4CH 1WZ1H 4PG2A 5DRXA 1WZ1L 1Y0LA 5IW1B 1S9VA 1CL7L 2JELH 3LKPB 3ARXA 1LE9A 3HR5B 4AL8H 5BVPH 2LTQC 5DHYA 5F88A 5HPMA 1ORSB 3QXAA 4NQEE 4JJ5B 3LN4A 3SQOL 1CXIA 3UROR 1FRGL 5IVZB 2GY7B 43C9B 4CNIA 3O6FD 2DQJL 3S96A 5GGTL 4FQ2L 3I2CL 2DQJH 3GBMH 4OZIE 2OR7A 1MFDH 3ZSSA 3U79A 3H9SB 4QHNB 3OKOB 3WLBB 4OZHA 3BUYB 4ALAL 1S9WA 1IQDB 2C3XA 3LDBC 3ULUE 4RMTA 3KG5A 1FCCA 1ZGLB 1KEMH 2VR4A 5HHOD 1XGYH 4HX1A 1A0QH 4QRPD 3GM0A 1SYSA 3ARDA 2AXGB 1CQKA 2N56A 1KC5H 4DCQA 4YQXL 4WU7A 3SKMA 1EO8H 5JUEH 1Q9WB 4IMKC 1F6AA 3QWOA 1RUPL 5D6DC 4R8WH 4M1CD 4W6XB 2E6QA 1IQWL 3IS0X 2H9GB 5DEGB 4FQPA 2FHBA 4JFXA 3QG6B 4LOUC 2NYYD 4MXWH 1MCKA 3DTXA 1NBYA 4JM2B 4PP2A 1NGPL 3C60C 5I66A 1EFQA 4QO1A 3WJJC 1FZKA 5KOVC 1JNHB 3ARGD 2IPKB 5JOFA 3W81A 1R3JA 5A1AA 1OLLA 2J8UF 5FUOH 4DGYH 3PABB 4ZNEA 5FUOL 1D6VL 4DGYL 3QUYC 2JLLA 1QLEL 1UEYA 4ZUWA 1H15B 2AJ3A 5KANI 5IQ7H 1AE6L 1VGEL 4Y1AE 1ZHLB 3DX6B 1NKRA 4RBPH 1YDPA 3KPPA 1WWWX 4Q0XL 3B9AA 1OP3K 3NOIA 2XACC 4JG0H 4LU5L 2BNRE 2HTLD 5EOQH 3MR9B 4HH9B 1ZV5A 3NIFE 1ZGLP 4EI5C 4BQ9A 1VKXA 5F88B 4HF5H 5HHNA 3VGBA 2JIXA 4MXVF 2BVOB 3WLWD 3QCVH 1NMBL 5CEXB 3IDYB 5I16A 1EGJH 3E8UH 3RTQA 4PLKD 2C4FU 1E27A 3OKEA 3VXSE 4L4TB 2FBJL 2DKUA 2FEEI 2C3VA 2VLME 4GKNA 3VG9C 2Z8RA 4Z9KB 2XZCH 5FA4B 3VGFA 4R6UA 4PRIA 1MCLA 2CUMA 3JUZA 4OI8A 3CFKB 2OI9B 1QFWL 4NCC1 5GZOD 4X80L 3C5SB 4RNRA 1S9KC 4ISVB 3GHEH 1N0XL 2PKDA 4JM2C 4M6OH 1CL7I 1ZHKB 3KR3L 5DO2C 1E4WH 1F4YH 1KJ3H 2Y06L 5TF1H 5BXFB 3OJDB 3GSRB 1FL3B 4HULB 1S9YA 5E2TL 3P40A 5F7LB 1OLZA 4CMHC 4LASH 3LB6D 3QO1B 1FZMB 4O2EA 2R69L 2YS4A 3RZCA 1A6AA 1WWCA 4N5UA 1AIFB 2R4RL 4M02A 3LKOA 4ODWA 3V0WH 1BZQK 2X1OA 1OF2A 1MJ7H 5DFTA 3VFSB 1RJCA 3D0VA 3NAAH 1JZ7A 4JRXE 3HRZB 3F5WA 4L3EA 2PO6B 3QO1A 3OGCA 1BF8A 1AE6H 1VACB 3PQYA 2LE9A 1OAQL 2ZUUA 5E56A 1J5OL 3N1MC 3IFPB 5DT1H 1QNZL 4ZPTA 4OFIA 2RGSA 2EIEA 1R3LB 2H6PB 4P49A 5EOQL 1BX2A 3LOWA 4N0UB 4IRJC 4GW4A 4LLYB 1EH9A 4TSBL 4XC3L 1MH5A 4MCZB 1XF4B 4G6JL 2BY1A 5HD8D 2Y7QB 2ADFH 3CFDB 3L9RB 5MENA 3P30H 1YEFL 1KCRL 1DQMH 3IYLW 3WHE1 1YMHB 4WO4B 1W72B 4LNRB 3DBXB 3S97C 1C1EL 4YWGL 3O3AA 4MDJB 4YWGH 3FHQA 2W0LA 3IAPA 4KUCD 4P23C 4NZUH 4RWHA 2BSRB 1FVCB 3UC0H 5JXEC 2VE6B 4N5EC 5BS0B 3VXPA 1QACA 1I1FB 4XZUB 5LQBH 5ANMB 3MRHB 2YD2A 4JFFA 4L4VB 2K7QA 2FD6H 3D48R 3DROA 5HY9B 3U0WH 5ACLA 3MJ8A 4ZAKB 2ZCLL 4KK5D 1FPTH 1IKFH 4RGOH 4Y5YC 2PYEB 3GSNA 5T5FL 1AQDA 2D9QB 2QKIB 3FQTB 3WKMH 5T3XE 5TGBA 1YUHA 2FRGP 4XCFL 2HWZH 1RZ8B 4NUGH 4OD2B 2AKRB 1FFOB 3F7PC 3EOYG 1ZSDB 4L4VA 3FT2A 5MEPB 3U4AA 1X5KA 2XKNB 3LKQA 1JTTA 1X5GA 5C0RH 4RRPA 3QFJD 3L3KA 4KVCL 4JREB 4G6AC 5JHLL 4MXWL 5TDPA 5JIHA 1R5VA 4M9OA 1UJ3C 3O6ML 3ARSA 5ACZA 4GBXC 4G9DA 1AKJA 1S7SA 4R96B 4YUEH 3S35H 5CGYC 5LWYL 2H3NB 1NC4D 3VD9A 3K46A 3OKNA 5E8NA 4Z0XA 3N85L 3U4BL 3C60D 3RX7A 4IIQA 1U8KB 4XNUH 2V7HB 2FJGA 3QZWG 4XH2A 1A2YB 3QFJB 4WHTA 2AV7B 4OZGB 3MV9A 3QUYD 4MA3B 1U8NB 1X5JA 5D1ZD 3TO4D 1CIUA 1PSKH 2IPKA 5JOFB 4JB9L 4GOSA 3QQ3A 5ISZA 1JGEB 1KPRB 2FL5A 1CLYH 2GTWB 3FONB 4Y5YB 1MHEB 4PJ5A 2KDGA 4JHBA 2IH1A 3F7RA 2OR9L 3EFFB 3NCBB 2E7LC 5I1JL 1CDCA 4RMRA 5FB8A 3RNKB 4OJFL 2MCPL 3SE9L 4P2OA 1EIBA 3UX9B 5DZOA 4JFPB 1JCKA 2VKXA 2GUOA 5I15H 4G8FA 1KT2A 3RVTD 3CMOL 1MLCA 1CGVA 4KKCD 5D1ZB 2YZ8A 5HHPB 1UM6L 3WE6B 3L3HA 1AO7E 1H9VA 3HUJE 4BA8A 3QDMA 4ZPVA 4YXKL 1HQRA 1VGEH 3ULUC 2CIKB 3VW3H 3GSOB 4Z95H 2XTJE 4IRZH 4WFED 4ZFOB 4NBZB 4W6WB 4XX1G 2A0LC 4EBQH 1E28B 4JJHA 2X09A 3O8XC 4NO5A 1JRHH 3VG0H 3DGCR 3ZE1F 2ZJSL 2OXGA 3WIFB 1U91A 4PJHF 3VWJD 2D31B 5H94B 4IDJL 3O6FC 5FHAH 2VDRL 5K59F 3TIEA 5BV7C 4GLRH 2HKHH 1HQ4A 1WK0A 1MI5A 2VDRH 3L3IA 4ODXA 4Q6YA 3KPQB 5BVJB 1A1OB 4J7RA 3LQAL 2NY1D 1IGTB 5C09A 2AW2A 3K8LA 2CLRB 4UV4H 1K8DB 1S9YB 4I4WB 4N0FB 1AP2B 3QUYA 1KXQE 3OJDA 1NJ9A 2EKJA 1TVBB 4M7LT 2F53D 1N3NA 5IMLB 5BV7L 1N64H 1PQZB 4GRMA 3CK0L 1I7RA 4NQDB 3VMOA 5EZOH 1FJ1A 2MSPA 1H15A 4AMKH 3JVGA 2LU7A 3BPLB 4ONFH 4LP4A 1BVKB 4WFHD 5I71C 4N8PA 4RA3A 3S37L 2V7NA 4YHNB 4KTYA 2Q8BL 4YEEA 1IAIM 3IETB 4I5BB 4TTDC 3RWFA 4LEXH 4CVWA 5ITBH 2BC4B 4LCIL 3TN0D 5HYQA 1BMGA 4LL9A 4G8EA 3V5DA 1B4RA 1IM9B 4H1LB 4C83B 5ERWA 1A6UH 1LVEA 3NIGF 4PJXA 5GGVH 2OL3L 3AMKA 4LHUD 4KKBC 3V5HB 1FRGH 3DTXB 4PRPA 3FQWB 2OQJB 5C0EA 1SJEB 1F3RB 5D7IF 3Q3GB 1N5AA 2GTZB 4M00A 2YWZA 1V7MH 5M94B 1V7ML 4WW1A 5DHVH 5IBLD 2I60H 2BX5A 3PJSA 4OFVA 2OTWA 5GSRA 2XZQH 1NBVH 1BQLH 4M3KB 4PRBA 3O2VL 2FATH 3DBXA 3O9WC 2VDLH 3O2DL 1W72L 5GGRA 3SKOB 1B0RB 1EXUA 4KPHL 5DD5H 2WLYA 4JHAH 3PP3H 4V2CB 1NEZB 3VXRB 5I2IA 2NTFB 4X6CE 1K4DB 1CLCA 5JXED 3LQZA 4ZXBB 1PX3A 4X99A 2EE2A 1AFVL 3MRNA 4U6YA 1NANH 1CT8A 5JHDB 3H42L 4K2UL 4WI4A 4LHUG 2JB6A 4QF1A 4HPYL 1ZWIA 3CFBA 4NKOB 2VDMH 4ZD3L 2M26A 2A1WH 1GOHA 1T3FB 1FZOA 3OG6B 1CFQB 1IAIL 3HRZA 4L3EB 5HI5C 3BYYA 2VC2L 1VADB 4L3EE 5BMFL 3SE3A 2GAZA 1J9CT 2G2RB 4RWYH 2O5XH 2I9LB 4DKFL 1ZVHA 4QHKJ 4NSKB 4X83A 4POZD 1YN6B 1MY5A 4R2GB 5I30L 4BZ1L 1YEKH 4EN3C 5HHXH 1VADA 1A4KA 4LVEA 5IVXE 3DYOA 3NZ8A 2WV3A 3X14A 1OTSC 2DBJA 4FQXB 2HYMA 5EORH 2A9NL 1KCSH 5TDOB 1PYWB 3BPCA 1H3TA 3CFCH 2PTTB 2I07B 3R1GH 1KB5H 3D2UB 4RFEA 1UKTA 3KPNA 3FRUA 1F2XK 4H20H 3TYFB 4MDIA 4P3WA 3C5JB 3UXFA 1PKQA 1S7TB 4JRYD 3CFEA 2DF3A 5EOCL 2IPUK 4LLWA 1X5HA 1MCBA 1Z0NA 5EZIL 3VJ6B 1FFNA 5FXCH 4R4BB 4K94H 4O5LL 3MMEA 1PG7X 4CAGA 3UTQB 2OP4L 1MLBA 4XNQA 1X5YA 5FM5M 4DN4L 3ZKMC 3BH9B 3L6FA 3NACL 4NNYA 4P4KC 3KXFA 4WO4C 2R1XB 3GHBH 4TVPH 4L9LB 5KOMC 3BQUB 4RIRA 4Y4FD 5DD3L 1KEGH 3C6SB 3QWRD 4DEPC 5LGKA 4YHIB 8CGTA 2R2HB 5LVEA 1MCDA 1S7WA 1EAPA 3BKYL 4JRXA 4UNUA 3TBYB 4X5LA 2C3WA 5JW5A 1RU9H 3NIGE 3FB5B 1XF2A 1CFVH 2FEDD 4NZTL 3W2DH 1DUYB 2BVUA 2R4RH 3DX8A 5IIEB 3RA7L 3V6OC 2FDBP 1R5IA 3ARRA 3JV0A 4NQDE 1A1NA 4JRXB 2NY1B 1YEEH 5IROA 5IF0A 4PY8J 1MFDL 5F3HA 5GS0H 1YNLL 2E7CA 3HE7C 1KPVB 2NY4D 4FMFA 1MHPH 2YWYA 4FXGB 3L5HA 4KRPC 3C5ZB 3HAEH 4JCMA 2PYED 3QHTC 3DHJA 2OJZL 1J12A 4UT9L 3IJHA 3WDHA 3OJ2C 4B7LA 4W6YB 4U1SA 4DUVA 3BRGC 3O11A 2CLRA 2WIMA 1OCWH 1RZIA 5E8EB 5C0IB 1BGXL 3MGTA 4KKAC 4F3FB 3ARED 4LIQH 3FQUA 2NY4B 2C1OA 2VLJD 3O41B 4Y4KB 3MO1A 2G75A 1T7YA 2DBLL 4KI5D 2CLZB 2VQ1B 3W11C 4GKSB 4OB5L 5IQ9B 2DLGA 1NL0H 1HSAB 5DD1L 5EWIL 2BVTA 1YQVH 3J7HA 4Y4FA 4FG6C 1SVZA 4JO4H 4OLUH 2FNBA 3BDXA 4UDUA 4R4BA 3VFOB 5GXBB 2X4TB 5CD3A 4WJ5A 1T66D 1NDMB 2CXKA 4D9QE 4DUWA 3QRFM 3MBXL 2GK0B 2BCKA 1YEFH 5EC1B 4D9LH 3GNMH 4EXPX 5JORB 1UKSA 3N0PB 4HJGB 1WWBX 5IMKB 4OT1L 3V6ZA 3WUZA 3S7GA 2VE6A 3MRKA 3QXVA 4HK0A 5IJKA 3MRBB 3PWUB 2C3GA 3O6FA 4HIHB 3UJJH 1JGEA 1OGTB 4P0DA 2JB5L 4JPKL 1FFPA 4ZUUA 4JEGB 3KJ6L 2YBRA 4WEUD 4U1JB 4OQTL 3ZKSD 3S9DB 3UZVB 3BPOB 4L8BB 5HYEA 1R3IL 3MPCA 3UTTB 1Q72H 1OAQH 1J05A 2PYEA 2R0WH 5F1SA 4G8IA 4L3CB 2ITDA 2XPGB 4LHUA 5EU3A 5MP6H 1XGPB 4QY8B 1S5HA 2YUZA 3JVGC 1BX2B 3T8XB 1UZ8B 1IBGH 3UDWC 3RJDA 4PJFA 4Q9CA 1JHLL 5ISZE 4PG2C 5BRZA 1ADQA 4LBEB 1QA9B 3QI9A 3AY4C 2XXMB 2CJUH 1I3RB 1RZJH 2OMNA 3DLQR 4HIEB 1UQSA 5DWUH 2F54A 3GSWA 3JWNC 1AC6A 5D4QA 1EVUA 2O61B 1TXKA 5T3XD 4FQCH 4OGAD 1OB1A 4LPUA 2EE6A 4K3JH 5C70A 4OD3L 3B3IB 4YHPB 2X1QA 2D31A 4XPBL 3TWCH 1ZEAH 3Q6GH 4AT6B 2W92A 3E6HA 3BH8A 1Q1JL 3CVIL 3NTCL 4PJHA 4C54A 2ZUXA 1D5MB 3N50A 3U7AA 3FQWA 3R4DA 1A2YA 1JFQL 1G6RL 1PDKA 2YD8A 3G9AB 4QRRB 3D0VB 3D3VE 2EE9A 4WGVB 4F7EA 1I7UB 5T3ZL 3DXAD 3F6LA 3IFNL 3IDJA 4LP5A 3K2UH 1QLFB 1DBKL 3VD4A 2VDKL 1HWHB 3X12A 4IRSA 1JGDB 2FYYA 1EPFA 5D2NC 3LIZL 4HF5L 3VFWA 4LIQE 5TQ2L 2C3VB 4PP1D 3G04A 3T65B 1C08B 2AJYL 4ZNEE 1TTUA 5J13C 1FFNB 2ZKHH 3W9DA 3MACL 1K4CB 1FNLA 3CU7A 4PRHE 5CJOH 1N6UA 4H26A 1A6VL 4NUJB 4FQQB 2UZYB 4IIQB 1LGVA 1JF1B 1JWUA 2L7JA 1I7TB 1SMOA 2VXQH 1VEMA 3MZTA 1WEJH 4XVTL 4WHDA 3B6SB 3KPOA 5CGTA 2F53A 1HINH 1QSFB 1Z5LB 1QSEA 2RCSL 3EOTL 4ONFL 1IZJA 5F1NB 1RUAL 1MWAA 1NLBH 1OSZB 3VGAC 4BKLB 3DYPA 4BK4A 3OMZA 1KNOA 5EO0B 3CZFA 4P2OB 5I1EL 5DQDH 4GRWB 1GGBH 4N0UA 3IDIA 5LBSL 5B4MD 2FECI 3MNZB 1MNUL 2VUYA 3GSRA 4JM2A 1RIVL 4ZO8A 4XAWH 1T1WB 3FL7A 1HYSD 3NCYS 5C0CE 4FFYL 1R3JB 3TNNB 2EKSA 1TETL 3RWJB 3AU1B 1D5BB 3I3BA 4L4VD 1FZJB 3EO1B 5EOTB 3OJMB 4K3EL 2XY2A 5MEND 4M7KH 4HIJA 4OTXL 1DN0B 4L8SB 4U6HA 4P2OD 3RFZC 4J3WA 4PJCA 2QSTA 4IMLA 2BOBB 2HRPL 3KPRB 4KDTC 1QFUL 4ESKA 1WJ3A 4OJFH 4OF0A 1ZT7A 3RZWA 2VABA 3FFDA 5ICZA 1QSVA 2P5ED 3QQ9C 4NZRH 4Y1AB 1I8LA 2BCKB 3WN5C 1T7VA 3ETBF 4UBDD 1BQLL 1P5VA 5AWNL 4MJIB 5I8EA 1LO0H 2E7MA 3EYOB 3HFML 4GAYA 4JY4A 4OUOA 5KW9H 4UIMB 4ZFGL 4Y5VC 3VRIA 5I8CA 4P2RB 1YEHH 1A7OL 5IESH 2EIBA 1FNAA 1RK1B 4YHLL 5FFLA 3P3YA 2BVYA 5EFIB 3HPJA 4JKLA 5ACMA 3OB0H 1MSPA 4LSTL 1C5BH 5E6ID 5GJTH 5TDPB 2WBJD 3GNML 1JYWA 4UIMA 4MX7B 3GK8H 4MA7H 3T77B 3QEQE 3IAGC 1RUKH 2V5TA 3I75B 3PG2A 2QQQA 3BX7C 3MNVB 4R7NB 5GZNC 5AAMA 4YBQD 1FN4A 3MREB 4DQOL