1IARB

Interleukin-4 / receptor alpha chain complex
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
197
structure length
188
Chain Sequence
FKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAAGISYRARVRAWAQAYNTTWSEWSPSTKWH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the interleukin-4/receptor alpha chain complex reveals a mosaic binding interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/receptor
molecule keywords PROTEIN (INTERLEUKIN-4)
total genus 37
structure length 188
sequence length 197
ec nomenclature
pdb deposition date 1999-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09238 IL4Ra_N Interleukin-4 receptor alpha chain, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1iarB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1iarB02
1LILA 4JR9H 1OTUD 5CIPH 1KLGA 1F45A 4QRPE 3TNNA 1ORSA 4IRSD 1YY8B 4JFDE 5FCUL 1A6AB 2AVGA 3D5OF 5EB9A 2GJ6B 4KK6C 1MSPA 1N8ZB 3WEXB 1NCAH 3KYKL 3MX0A 3MYJA 1UB5B 5ID1A 3QPQC 3GIZL 2CIIB 1K5NA 4MAUH 4G3YL 1QRND 4LGPB 4N5UA 5TJWK 1A1OB 1NMBH 4G5ZH 1OCWL 5E5RB 4KRPD 4NFCA 3V0VB 2VYRE 3D39A 2W07A 3BJLA 1RMFL 4L8SA 5GHWH 1S7WA 4I13B 5E4EB 5DWUH 4KVCH 1AHWC 2WQRA 2WUBL 4AEHL 4M7KH 4F7PA 4R6UA 1ONQB 4JFOB 2F8XC 3WHXB 3REWA 1FSKB 2ITDB 5JORB 4QKXB 3UPAA 2PO6A 4HS6A 3FB5B 3VFNB 4UAOB 1U2HA 3CFKA 4LKCB 4FQ2L 2EC8A 1G7QA 2P5WB 3QHFL 3NIGF 5T1MA 3EYQC 4TSBL 2P7TB 4IS6A 1NBYA 4ODUA 4HKBB 1XGRB 4JY4A 1YMMA 5E8NB 4U49A 3NMEA 1ZHNA 2DIBA 3MOAL 4U6XA 1RZ7H 1NFDB 5I1IL 3WYRA 5CIPA 3ZTNH 4YK4C 4MNGA 3BZFB 1MFAH 4YHMH 5BVJA 1U8LB 4HIHA 4JB9H 3I3EA 5IFJB 2RCSH 3FQWB 5JLZB 2UVFA 5ACZB 4ZNCD 4RISH 2OQJB 5E9DD 2PXYB 2HFGL 2APBA 2NX5A 3FJTA 4UUJA 4YFEA 1FVCA 3VI4E 5D7JD 4CDHA 5D7LA 2VABB 1RFDH 4OLVH 1QA9B 3OPZH 2XA3A 3X3FH 3IDIA 5T1KB 4NJAH 4GAGL 1NFIA 3K2UL 3D3VE 5E70A 1LK3L 2CXGA 3DXAB 4GKSA 3WXVH 1TZIB 2RR3A 5BOZG 3SE3C 5C0GB 4E41A 5L6YL 2ZUUA 1VACB 4NKOB 1JPGA 1FJ1A 3WXVL 1WCQA 1F2XK 3GSRB 4JQVC 1NEZG 4YFLI 1JYWA 1ZT7A 3CMOH 1YEIL 4G9FE 5CLWA 1EFXD 5DVLA 1N4XH 4XVUD 1TVBA 4MA8H 2FGWH 1IARB 4OZHA 2X41A 3KYAA 4KI1A 5J1SC 4ONHA 1DDHA 1TTUA 3D0LA 4X6DA 5C71A 2E3VA 2YUVA 4XMPH 4MA7L 4PLOB 4N90D 2HT3D 1WZKA 4IBLT 3UTSD 2ITDA 1OWWA 1F5WA 1RJZB 3MRHA 4PJ8C 4X7DC 4WI9A 5C70A 3T2QA 4OBRA 4P9HC 1MAML 3MLUH 3OG6B 4G8FB 3HAEB 4NNPL 5E00B 3HB3D 3UPRB 4UT9L 2FIKA 1RIHH 4K8RL 5E2VL 3WKNA 2EICA 4K71C 4UQ3A 4M1DL 2D3VA 4LLWA 2EH8H 2XRAL 5FKPB 5I1GL 4P9HH 2AXGB 1HXYA 3UTOA 1OPGL 4WUUE 3S4SB 3G6DH 5IJVB 4OZIA 1X6NA 4Y4HB 5IBUG 3ULVL 3DGGB 4TPRH 2HAZA 4M6AA 3UBXA 4DKDC 2GJ6A 3X12A 3UJIL 4O5LH 4HUWB 4XAKD 2RB8A 1A6VH 2YN5A 4K7FA 4HF5H 2R9HD 2AJVL 3F12B 3RIAK 3ZO0A 1ZSDB 2X7LB 3GHBL 1L0QA 4XNMB 3OR6B 2QHLA 3PGCA 2GK2A 3NIDE 4N0UE 2YD3A 4P4RA 1JZ2A 3MNVA 1G1CA 5CCKL 3FFCA 5I8OH 3F6LA 4L9DA 4C57C 1QYGH 3ZSSA 4LF3A 2H2PC 3BKYL 3FQRB 4XTRC 3QIBC 5ISZB 5DJCA 2HMID 3UC0H 5FM4A 3VA6A 4HX1B 3EDJA 3PWVB 4IIQA 1T5XB 4YR6B 3GSWA 1FZOA 1MCBA 3RZCA 1Q9OA 1T20A 2AKRA 3GNMH 2ZG1A 1E4KC 2CLZA 3W11D 3AY4C 1IBGH 1OAYL 1U8MB 2EE3A 4PRPE 1I1FB 3IRZA 1KIPB 4Z0BH 1RZJL 3TN0A 2Z8VC 1CFVL 4WV1A 1KTRL 4H20L 4IOIB 5GRJL 1CLYH 1JTPA 4XP5L 5E94A 4LBEB 3LEYH 3OZ9H 2VZ1A 3E6FA 1XF2A 1H8SA 2PW2B 5DA4A 1PKQB 3MGOA 1ACYH 4O58L 4G9FA 1QVOB 3WFBH 4P59H 1S9KC 2CJUH 1BP3B 1FZJA 1MCOL 2WBJB 4RMQA 4BQ6A 2HLFD 3BDYH 1UWXK 3QULA 3BGFC 4OZ4A 1C1EH 4FQHB 32C2B 3NZHH 5D1ZD 4FXGA 5FO9B 5DFVD 3U2SA 5KJRL 4NP4L 3D0LB 1MCCA 4YAQA 5ISZE 4PV8B 4GG6F 1H15B 3VXRA 5IK3B 4LASL 4WWKC 2F54A 1QPPA 3FMGH 4NQCE 4HHAB 4LLVB 1P9MA 4OKVA 5AWNH 4GRWH 4LVNC 3MJ6A 4JZJA 4K94C 2DDQH 4NN7B 2R8SL 4JFFE 1FZKA 2WW8A 4Z7QF 1C08B 4D3CL 2ZCHL 2CLVA 4QGYA 1ZHLB 2PYEA 1JGVL 4O9HL 4L4VD 5ESVB 3LMJH 3GHEH 4JKMA 4PJ5B 3HC4L 1EO8L 3PGDA 1D5ZB 4RGNE 4YHIA 4FTVE 3K8KA 4N1EA 5HDQL 4M7LH 5CP7A 3UTSB 4LSTL 3TJHD 4HJ0D 2C3VA 3EDDA 2H9GB 2ZSVA 2NXYD 2BXYA 2RFXB 4JFYB 3HI5L 2D4DA 1A5FL 5MEQB 3TO4B 1IGCH 4G7YL 4ZAKB 3W11C 1AR2A 1CDUA 2GJJA 5FYJL 2E27L 3QXTA 1U8LA 4HIHB 3TIEA 1HQ4B 5KOMC 2PR4L 4G6AC 1EXUB 3G6AA 3LOWA 3QIBD 4E5XB 1IC7H 1MCHA 4DVBB 4LSQH 5BMFL 1AI1L 5IMOB 3OJ2C 4L3CA 3EYUH 4EQ2A 2FZ3B 1WZ1L 1T4KB 1CDYA 2Y36L 3C6SA 4IM8A 4O2EB 3AS3A 4HXBL 4NSKB 3MA7B 5EORL 5T5NG 4YDKH 1BWMA 3RIFF 5IVXB 5I8KH 2Y9RT 1S9YB 3BISA 4GLRH 1Z5LB 2QKIA 3O45B 5EULV 1RZIA 5TH2A 1N0XL 3T0XA 2XFXA 4YXLL 5HGAB 4LKCA 2NY5C 5DA0B 3D1MC 3F7VB 3BIKB 3ZE2E 5J1AB 2PYEB 3G9VA 3S34L 3UC0L 25C8L 1WZMA 4WDIA 2YRZA 5GSVB 3O9WB 2OSLB 2I5YH 3M1BB 3REWB 5EU5A 3OGCB 3S35X 1ADQH 2BNQE 4XXDA 1C5BL 3O8XC 1FO0A 4GFTB 3RTQB 1Q9LB 1S7WB 1R0AL 4XP9H 3ROLA 3LMJL 4LCIH 3SE3A 1PVHA 4DJMA 1RZ8A 5C6TH 2Q6WB 3EO9H 1K6QH 2DIJA 2ZUQC 1OAXL 5EO1B 3ZE1E 3DVNB 1DUYA 5JPNB 5K59E 2GEEA 1CG9A 1NC4B 4JFFA 3MBEA 1BBJB 2ZKHL 5HGBB 1NDMA 5D1ZA 3FO9A 5GIRB 2DQHH 2J8OA 3HRPA 5MHSD 4MQ7A 3MTRA 4GW1A 1S7RB 1UB5A 3VWKA 3PDOA 3T1FA 2VDRH 3MRLA 4AH2B 3IT8D 3K3QA 3WEXA 3AM8A 3LHPH 4FG6C 3MUGA 1HEZB 3Q6FB 3EBAA 1B4JH 1EBAA 1JI1A 1YY8A 3VGEA 3V79C 3O2DL 5KJRH 3QO1A 2O5XH 3B83A 2HT4D 2ZNXA 2P5WD 5ESQB 1WISA 4N0CD 1LO2H 5HYJB 1KB5B 4ZFOB 4F7MB 1MCRA 1J1XL 3X3GL 4XCFL 3DMMB 5A2FA 4K3DL 4P59L 5C1MB 3F58H 5FEBA 5DD6B 5F8RC 2VZTA 3C5JA 4UQ2B 3MLVL 4I3RH 4HXAL 5KSBA 1NDGA 5T1LD 1YPZB 4O51B 1G9ML 4GXUM 4ELMF 2I9TA 5IOPB 3ARBC 2NY6D 3WIIH 3OX8A 3EHBC 1IGTA 3QIWA 3NGBC 1KPRA 3PHOB 2B2XL 5ESQA 1DQQB 2DQHL 2ZSWA 1CLZH 3VXUA 3QIUB 3WCYA 3L6FA 1BFSA 4MB5A 4WUUA 1YEJH 1SEBB 3TJEL 2VDOH 4IHOB 2H2PD 1BPVA 4XNUH 5C08B 4UDTB 2VZ3A 3QIBA 4Y89A 1A0QH 2WK2A 4IIQC 2VL4A 3ALPA 3MCLH 2D7TH 4KVNH 3WLBB 4ZAKC 2FL5A 3BKJL 3DO7A 3GI9H 2X4RB 5I1IH 1KEMH 1E4KA 4G43A 2D7TL 1ZMYA 1DP0A 2ZPKH 4H0HB 4ZUSA 5BS0E 5ICZB 1JHLH 5D7KE 4NZDA 4K3JH 3X11A 2Q86A 4GUPB 1JHTA 3TWCL 3GMNA 3RX7A 4OFYD 1Q9LA 3V6ZB 4UIKL 2VDOL 5CEZL 4PBWD 4X83A 2KZWA 1D5IH 5DWUL 2D0FA 4RSVA 5EC2B 3JWDL 1NC4D 1ZGLP 2C3XA 2NNAB 5DC9B 2VDKL 4PYGA 1KC5L 5DQJB 5F7WC 1FPTH 4GMTH 2Q20A 2HJKA 3QDMA 3X13B 3CXDL 2IH3A 2W0KA 5T3XL 3RX5A 3KR3L 5ADOL 5F9AC 3HE7B 4P0DA 5IMLB 1IGJA 4QWWD 1AGCA 2QBWA 1JE6A 4RGMB 2GSIB 4HLJA 3QG6A 4FQJL 4NHUB 1F4YL 1R5WB 3VG9C 4PRBB 4JHAH 4C83A 4WRLA 4MA8L 3VFOA 3MLWH 4HQQH 4WI2A 4WHTB 5DQJA 1AXTL 5E9DE 5HD8C 1RMFH 1ZLUK 3RWFA 3O2VL 1Z3GH 1P6AB 1GC1H 3NFPB 5D5MB 3O11A 1XR9B 4WFED 4NQEA 2YC1A 1VFBB 5FUZH 3QDHA 3Q48A 3BEWA 3VE0A 2B0SH 3DV4A 3S96A 4S1RL 2BVYA 3N1PC 4X4XB 3CCHA 1DVFD 1IAKB 1KIQB 1Q94B 2PW1A 4KROC 1V05A 3RVWC 1QBAA 2GCYA 3EO9L 3EFDH 5IQ9A 3UTPD 1EZVX 1YJDH 1WBYA 1RUML 3DV6A 4PRIA 4BZ2L 2NLJB 3ARGB 5LAXB 2X4RA 3ARDC 2FL5B 2JK5A 3MRRB 4FFWC 5DI8B 2ATKB 3VXTA 4Z7VB 1MJJA 1EEZA 2EO1A 4E41D 4XCYB 3SQOL 4UI2A 4Y4FA 1RZKL 4EOWH 4R3SB 5L9DH 5HYSA 4MA3B 5C9JA 5JPMA 1U8NA 1A8JH 1IAIL 1L4IA 4GAJL 2F8OA 4OJFL 3ZTNL 3BDYL 3TYFB 4WW2A 4PGDA 1F90H 3KVQA 1YJDL 1FL5A 3NN8A 4QCIA 5FV1L 4Z76A 5C0FA 4N90E 3UTSE 5LQBH 5EZIL 2P44B 4LNRA 1QBMH 5JO5A 2APWA 3FB8B 3CXHJ 5F93C 4XWOD 4P2RE 3A6CL 1PKOA 1RK0B 4ALAL 4N0RA 3MRQA 4PRHD 3RWEB 2W38A 3OJVC 1QRNE 4G8EB 3ZL4L 4DUXA 1KLUB 4KC3B 1KCSH 3GJEB 3PL6B 3O2WH 4Q7DA 1MCWW 5IB2A 4NN7C 1T1XA 5JXAH 4RA0C 4LVNB 3QWOB 4RDQF 5FYLE 3V8CA 4K94L 5GZOC 4BFEA 4LEOB 3QUXA 4OFVA 1JPFB 1U8IA 4FQIL 3VWJB 4ZUVB 1K4CA 1NUGA 2G60H 1MCWM 2B4CL 4KI5C 2VITB 3MCLL 1UCBH 3FT2B 3VWKC 4XT1C 2IADA 4MCZB 1M7DB 1DBMH 2YS4A 2NY4C 4M61B 3ARFB 4LF3B 4O9HH 3S36X 3IFPA 3ZT7A 3W0WD 4WI4A 2CSPA 3PP3H 5EA0H 2CKBA 5BV7C 4N0FA 3HI6L 5KAQF 4XRCB 3VW3H 4G9DA 5F7MC 4MNQA 1NBZB 1RIHL 2I9LB 3KG5A 4K8RH 4UT9H 4XZUB 1E0OB 5EUOB 5CSGA 4AENB 2WIMA 2E9IA 3RVWD 5J1AA 1VCAA 1MF2H 2VR9A 3QEQD 5MEPB 1D6EB 1Q1JH 1E27B 5F3HA 4Y1AA 4LOUD 3NTCH 3QZWA 4S11A 1EAPB 4NQDA 1QBLL 5F71A 4OQTL 3L5WA 3U4AA 4R26L 3NH7L 2J6EH 5DK2B 3OMZA 3DURB 3T65A 1FVDB 4FQXA 4S1SL 1GIGL 4WEUD 2GAZA 3FN9A 5C0CA 1NC2B 1QD0A 3HMWH 4XBPB 1EH9A 5DJ6B 5KSUA 4H88H 3DRQB 2Z93A 5MENA 2F53B 5SX4H 3BH9B 1T0NA 5HHNA 1PBYA 1EXUA 1PJ9A 1IZKA 2NXYC 4LCUA 2V2XB 2LABA 2AJZA 1FAIL 3RNKB 3FT2A 4HD9A 3CU7A 4G6JL 4F37F 4LAQL 2V5TA 2GSGB 4MNHA 1CXEA 1G7PB 4RQQB 3UZQA 4JFQB 4AIXA 3VFRB 2SEBA 5JQ6H 1P4BH 1U8IB 3U0TB 1LO0H 1ED3B 1KIRA 5D71L 1BJ1H 4EUPG 4GT7A 5AZEH 5C0BE 5HGDA 2FX9L 1A7OL 5DQDH 1UB6B 4TNWK 3LIZH 1AHWA 4LPWA 1KJVB 2AI0H 4QTIL 1I7UA 1FLRL 1HE7A 2DIAA 4FP8L 1DBAL 4C59B 3B2VH 3DSFH 4D9RD 1VESA 43C9B 1GC1C 1UB6A 1OTTC 1GZQA 5T1DL 1DN0A 2CMRL 4F9LA 3F65A 5EBLB 4OI7A 2VKWA 2YXMA 4WWKD 2XN9B 2W9DL 1MLCB 3P4LA 3U0TA 3ARDB 3QQ4A 4XVJH 4DKEH 1S5IH 5EIVA 3FCTB 2VLLB 5IG7A 3K8MA 4HJGB 4Z5RA 1MCFA 3RU8H 4QXUL 5ACZA 1ZVSB 3QUXD 4X7TB 4WJ5B 4DOHB 3E0GA 2OZ4L 2AJZB 3RNKA 3MJ8B 3VXOB 5IVXF 4HG4J 4X9HA 1FL5B 4QCIB 4Z76B 1EV2E 5C0FB 1DL7H 2JCCA 4HWZB 2DYPD 5F1NB 3QHFH 1FCGA 4O00A 5MENB 1JV5B 4X4MA 5E8OB 4HIXL 1SQ2N 5SWZA 3RNQA 3CDGA 4K3DH 4PJFA 4F8TA 5IBTL 4TVPD 2N56A 3MODH 5KANI 1EHLH 1YUHB 2DLEA 3WE6B 1IGCL 1JTTA 4G7YH 4LPCA 3L3GA 3MLRL 2J2ZA 2O5XL 1UQSB 4HK3J 1KCUL 1DZBA 5JOFB 3INUH 3QZWB 4YHKL 4ZD3H 1OT1A 4MA1C 1BM3L 5D6DC 3CFKB 4P4KD 15C8L 3P0YH 4MJIE 4OFPA 2W91A 1M7IA 1Q94A 2VXTL 5I8CA 5EZOH 4Z5RB 4KJWD 5E9DA 2RGSA 1INQB 4PPTA 4KRLB 4U1IB 2Y36H 4N0CC 4LCWA 3PF2A 1RUPL 3GSWB 4YR6A 4JRYA 5TQ2H 3KYKH 3WNMA 1MWAL 5CFHA 4XBGA 3PHQB 4Y4FC 2NY3D 1XGQA 5IP4A 4I3SL 2V2WB 3MJGX 1RPQA 3EDFA 3GSOB 3LD8B 5J9PA 1U8JA 1D5XB 1FH5L 5D1XD 2AGJH 3HI5H 2DTSA 4MD5B 4OZFG 1NGQH 3VDBA 1A2YB 1B4JL 1N8ZA 1DEDA 4D0CA 4FNLL 4K55A 1CXHA 3DX8B 2H6PB 4XBEL 1NCTA 1LEKB 1FSKC 5JIPA 5DT1L 4OZIB 2Q1EA 3CJJA 4XP4H 3MXWL 4HKXA 1QRNB 1KTDA 1MI5E 5BJTB 4OCSL 4Y16B 2X1QA 2HKHL 2BP3A 2G9HA 1DQMH 5FFLA 1L6ZA 5F1IA 3MLSH 1RIVH 2XWJA 4ZODA 3SDXB 3BP7A 1T1YA 2DDQL 1UJ3C 3QUZD 4KTDH 2ZUWA 2XIDA 4I48B 4JZOA 3S35H 4B5EA 2YD1A 2GI7A 3PV7A 2XICA 4XHJD 1BEYH 5I8EB 3FB7A 4HCRA 5CEZE 5L2JA 1RVFL 2UYLB 4P23B 2OI9B 4LNVA 3T2NH 8FABB 4PJIB 3NN8B 5JW4R 3WLBA 2YPLA 2R1WB 2AK1L 1ZWIB 3DUUB 4Z7VE 4GAYA 3RWJB 3N0PB 1QFPA 4BZ1H 5HYFA 3TH3T 4XMKL 3O3BB 1JFQH 5IV2A 3ZDYE 2I9LA 1Q0YH 2YZ1A 5C0EB 4GH7B 4G9DB 1INDL 4Q9RL 4DUWA 1OSPL 4G80A 1UXSB 3WN5B 5JNYA 2F5BL 1ZGLB 2E8YA 3PQYD 3PDDA 3MZTA 1JNHB 1XAUA 4YXKH 2E9WA 3MRDB 4HUVA 3FQTA 3LQAC 3TYGL 3IFNH 4MCZA 5I73B 1FNHA 4ONGH 5D96C 4WFEE 1J5OH 1D5MA 4I48A 4JZOB 4KDTC 4JRXE 3NZ8B 4N9OB 4XNQB 2ICWI 5EIQA 1OTSC 3LAFA 4AM0A 5LVEA 3FQUB 4F7TB 1DUZB 3CCHB 2XNAA 4UQ2A 4UUJB 1A5FH 1ZEAH 4MXWL 4OZFB 3O8XD 1XR9A 1T22B 2BSTB 1M05A 4Z77B 5HYJA 4MS8D 2ZOKA 3QH3A 3MLYH 5I8OL 3ZT6A 4LLAA 1OD7A 3IJSB 4LLYB 4ZFGH 1CN4A 3RWCB 4P5TD 1UXWA 4EIGB 1R3HA 2VUOA 1B0GB 5D93B 1D7FA 5IB2B 4G9FD 5DTFB 4M1CD 1EA9C 1IEAA 2W0PA 5GGRB 3D2UA 2HMIC 3G5VA 4WHYG 1QR4A 1FN4A 2NW2A 3O4LE 2MQ0A 4TULL 1QSVA 2FGWL 5I6XC 3LZFH 3IDXH 2VDML 3MBEB 4P48A 1TCRA 4GRLA 4H20H 3P9MA 4HFUH 5I1GH 5C07D 2XT1B 3B2UD 1B3JA 3U9UB 3ARTA 3WXWL 3GM0A 1FNLA 1JNLH 4IOFC 3I02A 3FO2A 1V7NL 2W9LA 1NBVH 2JIXD 3IU3B 3MV9B 1V5JA 4PB9H 2EE2A 3KLAB 1E4XL 2VDNL 3BP5B 4OGZA 3EHBD 5HDBF 4WWID 3D3VA 5CKGA 1RFDL 3SO5A 1XCTB 3SY0A 5TE4L 1Q38A 4PRID 1T03L 3RA7H 4DW2H 3THMH 4CU7A 3WE6A 5CJQH 2C3HA 2HTKD 5FOBB 5I16A 2R0KH 3H9SE 2NW2B 5H35A 5ID1B 4HWBL 3SCMD 4ZFFA 4Q6IB 1CZ8L 4WGVB 4QY8B 3CDGB 3I2CL 2ICEA 2BDNL 4O2EA 4OLEA 4J6RH 4HWEL 3BEWB 2DWEB 2IAMA 1F90L 3LPWA 1I9EA 3OF6A 3L5JA 1L7IL 2XKNB 1MEXL 1DBJL 1CICA 2CUMA 3VXUB 5I18L 5J6GB 4QF1A 2A6DA 4F37K 1HQ4A 1MCJA 3LRHA 4PD4J 4QRQB 4R7NB 1KEGH 2BERA 3A6BH 3VJ6A 1MHEA 1A7RH 2NZ9D 1NMAL 1IGTB 4M6ML 4ZTPL 5H37H 3DJ9A 1TCMA 5HHXL 3V4PL 4NHUA 5CSZB 4JPIB 1XGTA 3QUMB 2GSIA 3SDXE 5HYJE 2VC2L 4MA7H 4PTUB 5D6DA 5EOQH 1EHAA 1IEAB 1AGCB 4P23C 4UILL 3VXSB 1IGJB 3H9HB 1R3KB 1EERB 5SWQB 4G8IB 2D0GA 1UH3A 2P8LB 3O8XA 5JW4N 43CAA 2DKUA 1MRFH 5DUML 5J13B 3S8WA 5CEXA 4Y19E 3VXNB 4R8WH 5J6HA 3BPOB 2CO6B 2ENYA 3GBML 4FQLH 3ULUC 1FZMA 1KNOB 1YEFL 2J3SA 2C9AA 3MBEC 1YEKH 2BSSB 5IF0A 4OSUH 4GAYB 3RWJA 2GTZB 3TNMB 4DUVA 3M8OL 3T0VA 1ZT1B 4NFBA 4LAJH 1T03H 1G0XA 1XF3B 3KNBA 3O41B 2Z4QB 3AM8C 4JRYE 4PBVC 1X9QA 3JBG7 3MJ9H 3FB7B 3WDHA 5FYJE 3S3JA 2Z93B 3WNPA 5J57B 4Y8AA 1EZVY 5IM7B 4L1DA 2ARJQ 3OAUH 2FEDC 4RISL 1RV6X 2WINA 1NFDF 3QIBB 2V7NB 4MJ2A 5GGTA 4FS0A 4OLWL 1G6RH 3HMXA 3QFDB 5FHAH 3L6FB 1I4FB 1B4RA 4GG8A 5K9KA 1UZ6F 3QEQA 1D6EA 5HGAA 4ZPTA 5JHDA 3GSXB 4OIAA 3FRUB 1JGDB 1FC2D 4DVRL 5C6PB 3CH8A 3K7UA 3LKPB 4YHPA 1MCPH 4S1SH 4MSWB 2FJHA 2W65A 1GZPA 1IAII 4X6DF 2E7LA 1DBBH 2QEJA 4AT6B 2YA1A 5CHNA 1FHGA 5F8QC 1K2DA 2F53E 1N3NA 5KSBE 2BNUA 3EIFA 2FZ3A 1UM6L 3MMEB 5ISZA 4JDTH 3TFKD 1EHXA 3AROA 1BD2A 5B39G 1LP9F 3MREA 3T0WA 2HTLC 4QRQA 3MNVB 5TPWL 2UWEA 4JO3L 1G1YA 4OCNC 2J8HA 1FYTB 2X7LA 4XNMA 1OAUH 1WEJH 5DSCB 2DICA 1CICB 5E6ZA 4YDVB 1PSKL 4NFDA 1K8IA 1MCOH 5B3NA 1SVCP 4LU5H 1YMMD 4TVPE 4KQ3L 1BIIB 3TEUA 5IHZA 3QUXB 1QSED 4R0LA 3FOMB 2IMNA 3QBTB 1JMXA 4OF3A 5D5MF 4MAUL 3VGAC 1L7TL 3QXWA 4MJID 5CINL 4XBGB 3ESUF 4KQ4H 5KOVC 2Q6WA 2FIKB 2FSEA 4LQFH 2MPAH 5SWSD 3GNML 1PSKH 3OKLB 1CGXA 5TQ0L 5JZ7C 1OD9A 4JPKL 4P2RB 1R0AH 1IGFL 2ZJSH 4NBXB 1ZLWH 1I9JL 4BUGA 2F15A 1A6UH 3I75B 1YMHA 2D7QA 3WL9B 5C09D 1JBJA 5DJXB 5T5FH 1QSFA 1UQSA 2EZ0D 2PXYC 4GW5A 4JFPA 1P84K 3O45A 4I1NB 3CDFA 1H0DA 3ZDXE 4PV9B 1NQBA 3MROA 3ILPA 4OD2A 4QNPF 3LQZA 5ICYB 4Y4FB 3IVKA 3VCLA 2A73A 3I6KA 3OKLA 2VXUL 5J06A 2OL3A 3VRIB 1CR9L 1JNNH 5B38B 3VXSD 5F96L 5K9JH 2P5EB 3W39B 1N6VA 4UB0H 4XP4L 3DYPA 3WFDL 1IILE 1QHOA 3GO1L 1KB5H 1XR8B 3G5XB 2EIEA 3A0OA 1CL7L 1ES0A 1PG7W 3MNZA 3I84A 3GSNB 2DQUH 4ZSOA 4XPBL 3GJFK 3GKWL 4DCQA 1XIWD 4TUOA 3ARDA 2FX9H 3QEHB 4O2FB 4OLYH 5FHAL 3JV4A 3C5ZA 1I7RA 3K0WA 1T3FB 4LSDA 3DXAE 4HZLA 4LHUG 3U36A 4UBDC 3E3QC 3TVMD 1T0NB 1GVIA 3VFOB 3EOBA 4YO0B 4TQEH 1WZ1H 1BFOB 3G5ZB 5ISZD 3NCYP 1KJ3L 2R0WH 2L7JA 1F4AA 5CD5C 3ARSA 1J5OL 3AAZA 2R29L 2XA8H 1MCEA 3X12B 2MKLC 1G6RL 2GK0B 5BS0D 1FC1A 4QHNB 4Z0BL 4JZJB 4XPTH 2P7TA 2NY4B 4IS6B 3ZDYF 3T0DA 1A3LH 1ZHBA 3BOVA 4PJ9B 4NCC1 3E3QE 4S2SA 5D2LF 1QBBA 3GSXA 3RWDA 3LN4B 5IWLC 1DE4A 4P5TB 3HI1A 2XZQL 3ZKND 1H15A 1UWEH 2UYLA 4P23A 1JYNA 3WIHA 4DGVH 2XPGA 2NY1D 5EUOF 4JN1H 5E00A 3VGHA 4XMKH 1Z9MA 1KJ2L 2PXYD 1NSNL 2CKBH 2UY7A 5EBWA 2LU4A 2FSEB 3WUZA 5C0NC 1RSFA 3QAZB 3WV0A 4J8RB 3P77B 3RL1B 4LCCB 3F7YA 4ZUSB 1Q8MA 1N6QH 1OQOA 1F3DJ 4N1CA 4JQVA 1U3YA 2V5RA 2Z4QA 1J1PH 2QQKH 1M7DA 3BFOA 4KK5C 5E94B 2AJSH 1KBGL 3HE7D 3IXAB 1J0HA 3MFGB 5IR1B 3B6SA 2A9ML 4ODHL 3NIGE 1RIVL 4FABL 1FG2A 3PJSA 2R0KL 3MRJA 1AP2B 4IHOA 2YD6A 1SEBA 1A2YA 3MR9A 2UZIH 5M94B 4GKSB 4M6OL 1NGXB 2VN7A 3ULVF 1FP5A 1CFNA 2ICWB 3MXWH 3A6OA 4PJ8A 5FK9B 5I1AA 3PP3K 4XH2A 4ZO8A 1ZTXL 3SDCB 5EPMA 3FAWA 4ETYA 5C3LD 1OARL 3B9KB 4BH8B 3X3GH 2E7MA 3LQMA 3U36B 5HI5D 1NGQL 2VTFA 4EEEA 4DW2L 4M48H 4OZIF 4M8QA 2YKLH 5I1HH 1W0VA 4HXAH 1JNLL 4ZOCA 3RWEA 3MR9B 4M48L 4DCQB 1I9RL 5CBEA 5CLTA 4Y2OA 5DLMH 4UT7H 4OZFH 2FB4H 3QJHA 3MRKB 5KZCD 3LKPA 4YHPB 3SDXF 3FQWA 5JLZA 4OD3H 3C6LB 2E7LC 4F2MB 4I77H 5BVJB 4MNGB 3FOLA 3KPOB 5CIPB 4LIQL 3RA7L 2P5EA 3L3GB 2BVPA 3W39A 5T3XE 3EJZD 3CNKA 4LSRH 4PJXA 3P77A 2DLGA 4JY6B 4BFIB 3O6ML 5E24E 3IAQA 2DS4A 5D7JB 3E6HA 1HCVA 3FB6A 3HZYA 2A73B 3I6KB 1PZUB 4Y5VC 1HH9B 2XZAL 1S7RA 1X5AA 5DLML 3VWKB 4TSCH 3CC5A 1I9RH 5GIRA 3HFMH 3OAZH 5C7XH 4X6DE 3MLRH 2DQCL 2YA0A 3ARGA 1YYMH 5ITBH 4CVXB 4HUMB 4PRAA 4NOFA 3W5NA 1M71A 4QTHA 1ZT1A 3RGVA 4EI5B 4GRWE 5FYLH 4TOYL 4L8CA 5TE7L 4DK3A 4GRMB 5F89B 4BFGA 4JJ5B 4MA3A 1S9WA 4QXWA 5DMIL 3U46A 3TO2A 1JPGB 4M6OH 3IDJA 1AC0A 1MJJB 3U9UA 3LRSB 5F9DC 5JQHC 5MP6L 2QSVA 3MJ7A 4MQXD 3VD4A 5C0AA 5FDWA 5TH2B 3DV6B 1FFPB 1V3JA 3STZA 3AXLA 4Q6IC 2CIIA 3H9HA 1TQCB 2YUXA 4P3DA 3H3PH 3TA3C 3V5DA 1I7RB 1JF1A 4JN1L 3VFWA 3MNWA 4B0MM 3AUVA 1GGBL 2DKMA 3DYOA 1MRCL 3HNVL 3QCVL 2ESVA 1S7UA 5DJYA 1XGTB 1K8IB 3GSNH 4PGCB 5D2LA 1G7PA 4FQJH 3HE7A 5IMLA 3MV7B 3F7QA 1DLHB 5F7KC 2ATPA 1B0GA 3TNNB 4ZXBD 2KH2B 3B8SA 3IJSA 4R9HA 1M7XA 1A1NA 4K2UH 5DZNA 1YN6A 2I07B 5FYJH 4CGTA 2KDGA 2O5YH 1LE9A 2LVCA 4GXVL 4PRPA 1T7VA 4PJ8D 3SKNB 4ZO7A 3EYQD 2IPTH 2RQ8A 2X44D 5KSUB 3QCVH 4JKPH 2WANA 2XN9E 3ZKNC 4Z7OF 5DO2C 1AGFB 3T65B 4MQTB 2YPKB 2R8SH 5DK2A 3KPSD 2VWEE 4FZEL 4MHHG 4NO3B 4RMRA 3B9KD 1QBLH 1G9NC 2IH1B 4Y1AB 3K46A 4JFDA 5FYLL 3PV6B 2OBGA 1J0YA 2R1XA 4D0BA 1CL7I 3CSYB 3TWCH 2PETA 3TN0D 3GJFH 3BP5A 3QPXL 1I4FA 1IEBA 2DYPB 4JCLA 4OCYL 3V0AC 3WUWB 4G6AD 5I1JH 4JQIH 4UDTA 4M9OA 4BH7B 5EBGA 4NCDA 4Z7UA 1PZ5B 5JDSB 4PS4L 5AWNL 5T1LA 2DM7A 1FFOB 4JAMB 3D48R 3FL7A 3WD5H 4B53A 1NJ9B 2YA2A 3HUJE 1N5YH 2GFBA 4ZAKD 3UTQA 2H8PA 1PW3A 4S1QL 1KFAL 3HPLB 4X6CE 5BOPA 1TITA 3PHOA 3VFGH 2ZG2A 4ODWB 4NBYB 5TF0A 4FXGB 5FO9A 4AJ0A 5FCSH 32C2A 1N59B 1MCNA 1J05A 3MZGB 4NKQB 5KG9B 1YPZA 4O51A 3T08A 3WFCH 5IB4A 1BIIA 1NC2D 2IANE 2YPVH 3PWNA 4LMQI 5C0AE 4U1KA 3EYOB 4BFIA 4JFEE 3TH4T 1E28A 4H8WH 2OTUB 2V2TB 3U0WH 4Y0GA 3PHSA 3BZDA 1AKJB 2EIBA 3TO4D 1T1WA 1TZGH 3DVFA 3W9EA 5HHMB 4XCNB 3VD9A 4OV5B 2COQA 1VPOH 4APQD 5IIEB 5JDJA 2H1PL 2FIRT 5DK0A 1B0WA 3B5HA 1R5IA 4HIIB 1QP1A 4PJDB 1QTYT 2B1HH 4KV5E 5EBMA 5SV4A 1CIUA 3ZL4H 1Q9OB 1C16B 1RUQH 2YUWA 4M8QB 2VB5A 1RU9L 3MODL 1NC4A 3RIAF 1MJUL 3FQRA 3FB8A 4P46B 3D25A 4U6HB 1TIUA 4ZS7L 1JGDA 3FRUA 4F7MA 1W8OA 3UXFA 4ELME 4HIJA 1KB9J 4UOJA 4PJGA 1J8HE 4LPTA 1FO0H 3CVHH 3U7YL 3BVNA 2VN4A 5DC4B 2EECA 4NQSB 4U1IA 2N7AA 1CBVH 4R3SA 2FO1A 4Z95L 1INEH 3U48A 4N8PA 2VZOA 3KGRA 2FJFA 3B6SB 3AGVA 5K9QG 4P2OD 3S97C 5AD0A 4MZ3A 2MCPH 1J05B 4UV4L 3SKOA 2V7HB 1FLRH 4EI6A 1GHFL 3BIKA 5DD0H 2YPLB 1V8HA 4ZUUB 4YE4H 5HHOA 1A7OH 5DQDL 5HHMD 3OB0H 1U8HB 3ARBA 4JRWA 3F7YB 5L2JB 3I3DA 3OXSB 3HPLA 5DMGD 2E7HA 1XF3A 3KNBB 3O41A 3WSQH 4QRRE 3BGMA 3SKJH 5IHUH 2QQQA 5EBWB 4K7PH 1RIUH 4TPRL 3RTQA 5IESL 3V7MA 4X4XA 1FFOA 1DVFA 4XPAH 5EUOE 3LKRA 1JV5A 1RHHB 2A0LD 1FFQA 4M4RA 2QSQA 4Y2DB 4LARH 1G7JA 3PWPB 1YNKL 5F21B 3O3AB 2EH8L 2MJWA 1HI6A 3GJFA 2FX8H 2WUCL 4JFXA 4YHLL 4GKOA 4TQEL 1WC7B 5ALBL 4AQ1B 1DBAH 1DLHA 4NNYA 4ZAKA 4HK3N 1JWUA 4ZNEA 1GGIH 5I66A 4KKBD 4MXQC 1QLFA 1XMWA 3H7BA 2XA8L 3GM8A 3MQIA 3G5VB 4NGHH 4MA1B 4PRHB 4XP1H 3MNWB 4OGAC 3RGVC 4JFFD 5GPRA 4NWUL 5GRZA 4X5WA 4M93C 4XPAL 5I66B 4NUJB 4NZJA 1OHQA 43C9A 1RK1A 4J1UA 4QEGA 1R3HB 4JGUA 2IH3B 3BGFB 2H45A 3BPNB 4LP4A 3KYOB 3LKSB 3PG2A 3LV3A 4LSSL 5C07A 3FZUD 3U1SL 1OSZA 2W1NA 5BRZE 5D1XB 5H8DA 3WO4C 3DMMD 3HMXL 1QFUH 4Y2DA 3QDGB 4MQXC 1AFVH 1GGIL 4PGCA 4Z7WE 4NQXB 3GSNA 2XNAB 3MPCA 1XIWA 5ELIA 4Q6IA 4XMLH 3QNZB 3TFKC 1BLNA 1LEIB 2B4CC 1NFDE 4TSAL 3H8NA 4O02L 1KEML 1AE6L 3DBXB 1R24B 4TNVF 4QHMA 4FQ2H 4I5BA 4OZ4B 4Q6YA 3C87A 3PQYE 4L1HA 1KYOK 4HWBH 5IMMB 2X9XA 5E99L 1XGRA 5ICYA 2Q87A 3U7AA 3GK8L 4X0KB 5E2WL 3WJLA 4G9FB 3BKCL 1MUJB 4LOUC 3STBA 5AZ2L 3VRJA 4WUUB 1WWCA 1I1YA 5GRWA 4LSPH 2IF7A 2F54B 4KKCC 4YDLB 3JTSA 1XH3A 1JGUH 1UWGL 1NGZB 5EUOA 4AENA 1QSEE 5GJTH 4D9RE 4HJGA 4KUCF 3VDCA 1IGIH 5IOPA 3WHXA 4S1DD 4TSBH 2H2SD 3N50A 4XRCA 5HHOD 4KVCL 3ZZ1A 4YDIH 5BQ7B 1KPVA 2R0LL 3MV7E 3GIZH 4KGJA 4GG6E 2XY1A 2YZ8A 3MLVH 4A6YL 2AJXL 1R6VA 3MXVH 2PKDA 5D72H 1PKQA 4OD3L 2EDNA 5L8KB 2VDNH 5GS2D 2E27H 1QOKA 4K23L 1UGNA 1VEMA 5CD3B 1NBQA 2IG2L 4WWKB 4MMZC 1OP3K 3T77B 4K7FB 4N5EC 1NGPH 1PX4A 2CR3A 1VKXB 4I3GA 4OZFA 2CLZB 3V6BR 1KCKA 2NZ9C 1A6AA 2FX7L 2JJWA 5C07E 5JOEA 1VENA 4ODXA 4XNQA 3EFFA 3FO9B 4M02A 3IDXL 4M1GH 2B39A 3HC4H 4Y1AE 3H9YA 1PEWA 3GSOA 5AUMB 4GW4B 1HINL 2NY0D 4HIEB 1KELL 1HH6B 3MCKB 3IAPA 4LCYA 5CZXD 4XB7A 3OB0K 1B6DA 2B0SL 5FCUH 5DDHB 4WEMB 4XXDB 1KTKE 5FO8A 5HVFB 3CH1B 4AT6A 5D6CB 1IGML 4HGKC 2HVKA 3UBXB 4OGXH 1FIGL 2DAVA 2EEDA 3L5WB 5FGCB 3B3IB 4S1QH 3MLWL 3WDJA 4NN5C 2OM5A 2FATL 3RL2B 2GUOA 5JHDD 1DQDH 1YEHL 3LB6C 3JTSB 4MB4A 2XG4A 8FABA 4QRPB 3HC3L 1TVBB 4AMKH 1QR1B 3S37X 3WS3A 2VQ1A 4HGWB 4JFZH 3TM6A 5JPMB 2EDWA 3QR2A 2IQAB 4DZ8A 3F5WB 5GJSH 2VDPL 3KXFA 4IMLB 3T3PF 4XCEA 1AJ7L 3H3BC 4EZMA 4MJ5B 5D2NB 3NCFB 1UA6L 5F3BA 3CX5K 3GB7B 1BZ9A 5C08E 3BN3B 5JIIA 3T2NL 4DN3L 1CLYL 3ARGD 4PRIB 3SOBL 3TZVB 3MUHL 3TYGH 3SQBA 1BQLL 4WV1C 1T3FA 5CZKA 2AJUL 4A2LA 3D85D 1JFQL 4UTAH 2VR5A 5EC1B 2VDQL 2BVUA 4KZDL 2WWMD 1XIWB 3I50H 5IG7B 4QHNA 4XC1L 2GK0A 4D0CB 4NO0B 3PWUB 4KAQH 3QJFB 3ZKMC 4UAOC 2FD6L 5IFJA 1BZQK 3L7EB 1DN0B 2EKSA 4RGOL 4Y19D 1OLLA 5CP7B 4OFKA 3TGXA 3HKFA 1DVFC 5FDWB 3HR5B 4C83B 2AEWA 1NCDL 3GJEA 3BSZL 1FYTD 4OD1L 4CDGC 5LGHH 1QA9A 1YEJL 4PTUA 3SO3B 1MHCB 4D9LH 4TUOB 4ODUB 1A3RL 1E6OL 1PLGL 4RX4D 4KTDL 4LDLB 1AGDB 3FRPG 5DC0A 1P9MC 3UO1L 4YBHA 3P4MA 4JZJC 1MNUH 4LNRB 5JO5B 2Q8BH 1ETZB 1T89C 1P7HL 1CE6A 3CFJA 5I18H 1TMCB 4PRAB 3TZVD 5HHNB 2NNAA 2YBRB 1PYWB 5HI3D 3SHSA 4PGBB 1WLHA 1FNEA 1U58B 4LVEA 3QEGH 3CC5B 4Y5YA 2OL3H 1RJCA 4XCYA 3ZLQC 1JPST 4QRTB 2NQCA 4PLKD 4Z8FL 1SM3L 3F5WA 1FRGL 3N1FC 3VXRD 4GUPA 5GGRY 2Q86B 5I19L 1YYML 2QHRH 2XZCL 3C60B 2X4NA 5GRVL 4HWZA 5D70L 1LEIA 3DOSA 1XIWC 2F74A 3LEYL 3IYLW 2OTWA 4JGMA 3ULVC 3IF1B 4OLZH 2XTJC 3MRNB 5L6YH 1O5DT 3QSKB 1WWBX 3BKML 3ARDD 4K9EC 4KRMB 4NQSA 5IVZB 1F4XL 1VFBA 1RUAH 2VRAA 1TQBB 3O11B 5DDHA 1ZXQA 1QSZA 1MAJA 1IKFH 2LVEA 2X89D 4L8SB 4HIJB 3NACL 3QEUA 3L3JB 4QRPD 1WFOA 4M62L 3O3UN 5GSRA 4UU9A 1BM3H 1GGTA 4X4YB 4XC3L 4KKAC 3HG1B 3FFDB 2A77L 5MEND 1ZSDA 5IWLA 1HHJA 3U4EA 3WSQL 2FHCA 4G8GB 3LQAL 1NEZA 2WWKO 5LGJA 3DGGA 1X5HA 3QDJB 4HAGA 1HHKA 4JDTL 1S7SB 4UV4H 3RU8L 2UWEB 3BPLC 3QEQB 1IM3A 4BSVB 4LCUB 4NOBA 4GG8B 5D7IF 4V2CB 3QPXH 1FL3A 4ZDHA 1DL7L 4KKBC 3BPOC 1M05B 1E6JH 5EC2A 3WBDA 3QUZB 5JQ6L 1RHHA 5I1KH 1KLFA 2DQGL 3I85A 1JN6B 5HGHB 4J23A 4L3EE 3VGAB 4PY8I 3T8XA 3EYVB 5GZND 2WBJD 1KJ2H 5KG9A 4GW1B 1IMHC 4WFFD 1O0VA 3N85H 2VQUA 4A2MA 4NWTL 2CXKA 2IEPA 2J5LB 3QXDA 1NPUA 1CG9B 1MHHB 4PJEB 4CVUA 4H1LH 3FQTB 4NRYA 1N64H 1D9KD 2Q3ZA 1AQKL 4KK8C 3EYSH 1R3JB 3C8HA 2XXCB 5EZJB 2X1OA 4P5TA 3O81A 1L0XA 1A1MA 5F9WB 1A4JA 1WITA 3H2WA 4Z8FH 3FT4B 4YPJA 5I74C 5I71B 1BVZA 4NM8L 3QXVA 3GMRB 5GGTH 4R96B 2V7NA 4NGHL 1QFHA 5GSVA 2DYPA 3WUWA 1MY5A 1P4BL 5T3ZE 4R4FH 3U83A 2A9NL 4MD0B 5C0DB 2CKBB 1Q1JL 4GRLD 1NUFA 1YA5A 1R3JA 3S4SG 1A3LL 2BK8A 1JGVH 4YC2B 3VD5A 4NO3A 3MJ9A 4DTGH 1BJ8A 1GPOH 3GO1H 1FVEB 4OCSH 2NY2C 1AGFA 3L1OH 4FHBD 1BFTA 4NC0B 2JIXA 5ID0A 1A3RH 5A2LH 4P9MH 2NX5B 2ADGB 4FXKA 2K3TA 4CMHB 5I1CL 5MI0B 4L3CB 3V4VL 4FNLH 3IDMA 3VXNA 4PJDF 3CK0L 3RGHA 3N1QC 3MV11 1QLEH 1KB5L 4WHTA 4ZFOL 4Y4KC 2RIKA 4R26H 2EYTB 4YHNB 1KTLA 1GJIA 2CQVA 4U1LA 3FMGL 3BD5A 3O3EA 4JRYD 4R2GB 2P5EE 3O6LH 5I1EL 2Y5TA 4NO5B 1MH5A 5HYQB 5GS1A 1TZHA 5B38A 1YC7A 3L3IA 1BVKA 3ARGC 1NEZB 1S7UB 5DJYB 2OMNA 5AYUL 4QY8A 2ADIB 2V17H 3GGWB 2OCFD 5IGXL 3VA2C 3I6GA 2EDYA 4D3CH 4NQVA 3HE6D 3K1KC 4HKBA 1MI5A 1LP9E 1OP9A 1X4YA 4P3DB 4YNYA 3FFDA 5D1ZB 1RURH 4RAVA 2A74A 2ZCKL 3JWOL 3STZB 5INDA 1IEHA 1KENL 5D1QA 1UVQA 1ZS8B 3ARWA 4QHKJ 4X7CC 4KKNA 4DTGL 4ZUTB 2R1YA 1BFVL 5C0RL 3VGGA 3JSSA 2C4FT 3V6FB 4MAYD 3B8YA 2AV1B 1T2JA 1CFTB 3PGFH 8CGTA 2VWEC 4HKJA 2PTVA 5DD1L 4YFLF 1F6FB 3JXAA 2B4CH 4Y4KB 2DBJA 3IU4H 4I0CC 1D9KB 2WUBH 1NGWB 1RZJH 5IEHB 4PG9A 1M7IB 3GMNB 4FQCH 5I16B 4OFYA 4M3KB 1YECH 1KCUH 1P7KB 2IH1A 4X5LA 5JOFA 3ROOA 3TBWA 1X5XA 3QXAA 1XCTA 3SY0B 5LWYL 2NYYC 3HE7C 2OR9L 4ZUUA 1X5YA 1YN7B 5TQ0H 1T89A 5IHZB 3LCYA 2ESVD 3E6HB 1N0LA 2GQHA 4QT5B 3QXUA 3MA7A 4A6YH 1S7XB 4QXUH 4Y5YB 4F33A 3C6SB 4D9QE 3CSPA 2OTPA 3VE0B 1Y6KR 5L2KE 1CDGA 1LNUA 2Y5TB 4NO5A 4XAWL 4YDVA 2DRUA 3OWEA 3QIUA 5MP6H 4Y5YC 1JMZA 4LLUA 2CGRL 3BRDA 3B4NA 3T4YB 2HVJB 3P9MB 1CDHA 4U6HA 3K81A 2H26A 1R5WA 2DOCA 5J4MA 4AMKL 1QKZL 2VLLA 3X17A 4TUKH 1IC5H 5FECA 5GS0C 3ARUA 5GRUH 1IAOA 1MHCA 3SJVB 3L5IA 5HHME 4NC2B 3BX7C 5FYJU 4M5YL 2OI9C 1S9VA 1D5MB 4O5LL 4CL7A 2W65B 3DGCR 5DFWH 4IOSD 4AIOA 5KVFH 4F8QA 3B9KA 4S1DC 4P5MB 4HUVB 1ZLUH 5IIEA 5C0AB 5JHDB 4JFDD 2IAMC 2Y7QA 3MOQA 1LVEA 1JF6A 3EJZC 3R4DA 1F2QA 3RVTD 2WBJC 3QO1B 4RBPK 4EN3B 5HYIA 4D8PB 1UXSA 3MYZA 3MV01 1N2RA 4AIZA 2OTUA 5FHBH 3O6FA 1C5DA 1RUPH 2R0LH 3Q1SH 3MRLB 1W0WB 1K4DA 4AH2A 4AM0B 4KZEH 1AD0B 5ADPH 4OB5H 5IJKC 1FPTL 1BBJA 3QA3A 2ADFL 2YR3A 4CVXA 5SX4I 4G43B 1MI5D 1T04A 1XF4A 5FAAA 5I2IB 4UQ3B 5B3JE 1MHHA 3UTZB 3ISWA 1FDLL 1KT2A 1JYVA 3CU1A 3GMQB 4RAUA 4UIKH 1HH9A 5D1QD 2GAZB 4HPYH 3H9ZA 4QYOB 1MFNA 4KFZC 4BSWA 4PJBA 2YWYA 1FLTX 1GCFA 1C5DB 1T2QH 4DZ8B 3X3FL 1QSEA 5D72L 1IC1A 2P42B 3F6IA 2XOTA 1A21A 3JWDH 1ZWIA 3DUUA 4XXCA 5CS7A 5H37G 1QRNA 1A7PL 2Z31A 2FECL 5T5NF 3CXDH 2VIRA 1CL7H 2HG5B 5I73C 3RQ3A 5L2KA 1KEGL 1F3RB 4HCRH 5ETUA 2R56H 1II4E 3RI5K 2O5ZH 1HYSC 4OM1H 1Q0XL 1A7QH 3R1GL 4OAWB 2BSRA 5JW5B 4WI8A 5K33A 4KHXH 5CWSA 3VH8G 5T33H 2VC2H 4NRXA 2V5MA 1BFOA 5IHLB 5FUOL 4KVNL 2NXZB 3SKNA 1H3XA 1OB1B 4L8BA 2G9HB 3A6BL 1NCDH 1IQWH 3DARA 3MLTB 4K3JL 1QSFD 3D39E 1XZ0B 2XN9D 4FP8H 2OR9H 5ITBL 1A7PH 4PTTB 1CFNB 4PJ8B 3TJEH 2IPKB 3QIUD 2D7PA 4EDXA 5D7LB 4EIZC 1LEKA 4JRXD 3LKNA 4KJPC 4BSJA 3AC0A 1K8DA 4N9GA 3WHE0 4M00A 5E9DB 2XZAH 1J7VR 4ZFFB 2H9GA 1H9VA 4W6YB 1BMGA 4PJCB 4Y19A 5LCVL 5MERA 4LIQH 3PGDB 2JJVA 1XGQB 3MJ7B 5ABDE 4WI5A 1YUHA 1PX3A 5EOCH 3F58L 2R0WL 1ZHLA 2HTLD 1C7TA 5SWZB 3OGCA 1RY7B 4TULH 1E4WL 4V1DE 4EOWL 2UZXB 3RBGA 5L9DL 3NIDF 2HH0H 1EJOL 4EI5A 1EHLL 4L3AA 3BIAX 4MNGE 5MHSE 1T66C 4R0LC 4X99A 4ONHB 5D1QB 5FYKD 3NTCL 3TA3B 1ZVSA 4X7TA 3QEGL 1GAFH 5IKCA 4N8CH 4O4YH 1V7NH 5BZDB 4GMSL 1ZA3B 2M8XA 2APTA 1U8QA 1NCAL 3TZVC 4ENEC 4F9LC 2AK4D 3EOAA 3MRBA 3P0VH 4KK5D 1G7HB 4GKZB 5JXEC 2BSED 2WZPD 3DXAA 4LARL 3RWHA 3GRWH 3EOBB 1MFDH 3CX2A 2HN7B 1KJVA 3UYPA 5D2NC 5IQ9B 3S5LB 1SY6H 3DTXA 5ESAB 1HINH 4WI3A 5E8PA 3MJ8A 4Z7UE 3STLA 4DVRH 1REIA 4W70A 2BSTA 2FBJH 2VXVH 3P73B 1CD1A 1BWWA 2BXZA 1K85A 3CLFL 4RBPH 2PXYA 2VDLL 2Y6SC 5DD5H 2LU3A 3RZWA 1P1ZB 5D5MA 5H94B 4NC1E 5I75B 1T5XA 4ENED 5F70A 5EOTA 3KPRD 4JFHE 5A2IH 1HWGB 2X89A 5DJCB 2V2XA 5AZEL 1KCVH 5EU7E 5F88B 3ZKMD 2BMKB 2VLRE 5CJOH 3MMEA 1AHWB 4FFVD 1FO0L 2ICWA 2OL3B 1UT9A 2NY4D 1U8KA 5E2UH 4J3TA 2GJ6D 2DI9A 4R96A 4M6NH 1EDQA 3PJSB 4U1SA 5DHVB 3ARFC 1H3PH 1OVZA 1MJUH 3DURA 5DRZA 3OKNA 4OCWH 2LU7A 2N4IA 3GKZA 1B6UA 3O0RL 2R0ZL 3L3KA 3UMTA 3V5KA 5IJVA 2DQIH 4RWYH 1IVLA 4M5ZL 3U30B 5C2BL 2VMFA 4NRYB 3FB5A 1QACA 5FGCE 1LGVA 4UDUB 3BH9A 5KTEH 4J8RA 2H1PH 4MDJB 3B9KC 4K3EH 4PY7A 4P2QE 4IDJH 2BHYA 5I15H 1K3IA 3EYVA 2LE9A 2WBJA 4N0FB 3V7AE 4MHHI 2FGZA 4N0UA 3TP4A 2XWJB 4Q58C 5SWSA 1EEYA 1T04B 2J6EA 5I2IA 1IQDB 3O6FC 1EUUA 4NP4H 1GXEA 3X14B 3BKJH 3QDAA 4XC3H 4LPVA 2P5ED 5E2JA 4B41A 5AD0B 3RY6C 2DF3A 3S37L 1CGWA 3OKOA 2I60L 3AREB 3HAEG 1CGVA 4ZUVA 3VWJD 5DRNA 4ODSL 4B7LA 1DLFH 1L9MA 3AAZB 5K9OA 2EDHA 5J6HB 4LEOA 4HUUB 5DSCA 4JKKA 3HG1A 2VZUA 1AXSB 1UJ3A 3BE1L 1LDSA 3NZHL 5I1DB 2OX5A 3CDCA 5EU3A 4ZS6C 1HHIA 3H9SA 1UG9A 4F7CB 1BD2B 1F4HA 4HBQA 4P5KB 3VXSA 1JL8A 1NGYB 2CRIA 3ZE2F 5I1CH 2HKFL 1JWSA 4LCWB 1JPTH 3WNNA 2QV2A 1NCNA 5D7IB 4XP1L 3O0RH 5CSZA 1PQZA 4KMTH 1R5IB 2P8PB 2EDFA 2AAVA 4G7VH 4OV5A 1C5CH 2D9CA 1ZVYA 3EAKA 4X6EA 3MV8B 4WTZA 2GYSA 5E5UB 3VFMA 1GOHA 4NM4H 5I1KL 3CFEA 2DQTH 4WUKL 3VRJB 1MFEH 1WIPA 2DWEA 4HFWB 3TBTA 4PUBL 3TBYB 3EYOA 3LHPL 1X5LA 2VDRL 1EEZB 5TGBA 3U6RB 3TC9A 3T1FB 3NAAL 4PJFB 4XP9L 2X4PA 5FXCH 2X2YA 1IBGL 1OAYH 2VLJA 2BY1A 4WW2F 5I75C 5FOBA 3SKMB 2VSCA 1N59A 5L0QB 5BZDA 5F1NA 2XYCA 5MENE 5GRXG 1P2CA 2VSDA 1BX2A 1G7QB 4P2QA 3MLZH 5J12C 3KJ6L 1A47A 5T1KD 4LCIL 2GCYB 3WL9A 1QRKA 3FO0H 5AAMA 3BEVB 1IC5L 2BNQD 1NLDH 3O6KH 4IEFB 4NZUH 4Z6AT 4YWGL 3B9AA 5TDNB 4ZYKA 4KHXL 5KN5A 2XY2A 4JHBA 3SE9H 1DTUA 1MLCA 2V5YA 3QQ9C 3BHBA 4Q2ZA 4KAQL 4WNQB 3NACH 4OCXL 4ELKB 1NCUA 1DQLL 4MXWH 5ENWA 5GQBA 1MEXH 1J11A 4NNXB 1KPUA 3TPKA 3DIFB 1TENA 2XFXB 5GGUB 5FGBC 3T0EA 1WBYB 2WP3O 4PRBA 2HRPH 4R97B 2Z92A 2BCKB 4PJCA 1Z5LA 4Q0XH 3SBWC 4AY0A 2PW1B 3RDTC 3HNTL 2EDXA 4NT6B 4RCAA 2OK0L 1A02N 5IROA 3H7BB 1T4KA 4PGEA 1X44A 1P7QB 1NSNH 3VFRA 3NIFF 4I3RL 4ERSL 3DNKA 5JIHA 2YC1B 4JFEB 3R06A 4POYA 3VJ6B 1U95B 1MFCH 3QDMB 1XZ0A 4PJEE 3WLWD 1URLA 4JG0L 3TZVA 3GI8H 2A6JB 3UAJD 4PUBH 5JXEA 2DM3A 3HC3H 1JPTL 1WAAE 2F53A 3HG1D 2DQUL 2P47B 4BFBD 2IFGA 5F3BB 1FNSH 3PIQA 2UZIL 4PJDE 5D2NA 3TBVA 2Z8RA 4F7TA 1SMAA 3HUJA 1D3CA 4OGXL 3NGBB 4FA8A 2IQAA 1DEEB 2XXMB 4WO4D 4RFEB 5JA8B 1F8TH 4X4ZA 2VDMH 3LZFL 1EO8H 2P5WA 1RZ7L 4KY1H 1KCRH 1IM9A 5D70H 2NTSP 5F3HB 4PGJA 3GRWA 2NTFA 2WBWB 3DHMA 1CICC 1OAZL 2YKLL 5I1HL 4MD0A 4R4BA 1UM4L 1VEOA 1OWRM 5DK3A 1H8OA 4YZFE 4HS6B 2I60H 3D3VD 3ULUL 3BO8A 5JMRA 4HMDA 4UNTA 4MX7B 5BVPL 3T3MF 5HI3C 4JFOA 2WINB 4NQCD 5FUOH 1DJSA 4LLVA 4UNUA 4D9LL 1MJ8L 2R1WA 4QTHB 5DS8B 2D4FA 1A0QL 4OLXH 2APFA 3ARFA 3RPIA 2IG2H 1JZ7A 1T6VN 4M43L 3KPQA 4ETQA 1HKLL 3IDGA 1CICD 3Q3GB 3N1MC 5CJBA 1F3JA 2WWKT 4G8GE 1M6OB 4H0IA 4ONGL 3RHWF 2YD9A 5GZOD 3O3DA 1JYXA 2AJXH 2EDBA 3I2CH 4JO1H 3MO1B 3RGVD 4DN3H 3DROB 3T77A 4G3YH 4LLYA 4ELMA 2AERT 1UFUA 4ZQKA 4Q97A 4MXQD 3THML 2AJUH 4IOIA 2JB5L 5E8DH 3ARXA 3QIWB 5JXAL 2EE6A 3SPVA 1FFRA 3DROA 1XF5A 1KN2H 1T22A 3MRCA 5F6HJ 3UAJC 5JW4Q 1Z9OA 3PWNB 1KCLA 3K8LA 4L3EA 5E08H 1NDGB 5A1AA 3DHJA 5J0BA 1HHJB 3DLQR 1MJ7L 5ADPL 3NZ8A 1TNNA 3OSKA 2VH5L 1Z2KA 3RY6A 1FNGB 3BO8B 5CJXC 4C4KT 1MHPH 2DI8A 1MCLA 4WO4C 5FB8A 3DO3A 4Z7VF 4K8RC 4PP2B 5B21A 3RJDA 3WHE1 4DAGL 3IETA 3H6JA 5LQBL 1MFDL 3VXMA 5J13C 3QI9D 3VDAA 5E4IA 1NGXA 3QYCA 4PJCF 5SX5K 3SGJC 4C58B 5JDSA 4Z9KB 3RUGA 2GITA 4F33B 3B9DA 2Y23A 5DMIH 1AO7A 1CLOL 3GBNH 2R1XB 4D0BB 4LHUD 2JK5B 3MRRA 1MAKA 1DQDL 1YEHH 1DUYB 4P9HL 5JPNA 1OAQH 1RZIB 2BOCA 4P49A 3CPLA 2G75B 1U95A 3WNKA 4RFEA 2YPKA 5B38G 7FABL 3QNZA 3IFLH 3EUUA 2VQTA 4QRTA 4V1DD 3GIVA 5KVEH 2LTQB 4TSCL 4GRWB 4NQXA 4P9ML 3RVVD 5GS1C 4CBPA 5GS2H 1D6VL 4H8WC 5EG6C 1X5ZA 4DAGH 4OUUB 1OSZB 3GMOA 1KJMB 1Q9KA 1ETZA 2M2DA 1P84J 1LK3H 3OZ9L 5LGKA 2IANA 1RI8A 4JFEA 4W6XB 2Y5EA 3P0GB 1AI1H 1UWXH 4R7DA 4ZTOH 3KWWB 5A43C 4JO1L 1FN4B 2ESVB 3V8OA 4E41B 4Q9RH 5IVXA 1I1CA 3BQUD 4I9WD 4OLWH 2AK4A 1CVRA 4Z7OE 5IQ7H 4LSUL 5D8JH 3RTQC 4E42B 1RQ5A 1U8JB 1LHZA 2A0LC 4GBXA 3GMMA 4PRIE 5JZ7D 3O3EB 1KXQE 4NNXA 1NAKL 4BM7A 1BF8A 1KN4L 3BW9B 3L7EA 5CCKH 1FL6A 1G6VK 5I1LB 3U9PL 4WCYH 4XNYH 2EEBA 3UBXG 2WWMC 3ZYOA 3TO4A 4PP1C 1G9NH 1YNLH 1QPXA 4PJIF 4UOW1 2P43B 4GRMA 4QHKI 3WJJA 4L8CB 3IXTB 3QHZH 4PJGE 3BQUC 3CFEB 2MOVA 1CQYA 1FBIL 1EAJA 4X6EB 1RZGB 2C7UB 1NL0H 1P2CB 4Y5XC 4X6FB 4TSAH 4YUEL 4FQHA 5AEAA 1WEJL 3TT1L 5ICXB 2VLJB 5TE7H 4A6YA 3M17A 5T1DH 1CXLA 5HD8D 4GG6A 4WIQA 5E0QA 3BP4A 4EUPA 3FTGA 3LB6D 4JY6A 5GGSY 4PV9A 1RULH 2JCCB 4CVWA 2DQFA 2J8UA 4RRPG 4F7CA 1KN4H 4PV8A 4F2MA 5IB3B 2HFTA 4WEBH 3VFNA 3C5ZC 4GKNA 1KUMA 3VFVB 2UV3A 4JREB 1KIPA 1AXSA 3TBSB 2A6IA 4O58H 2I9TB 3OTTA 3QULB 5D7IA 5I30L 5FO8B 5FF6B 4ZOBA 1Q9WA 1YEFH 4ZS6D 3ABZA 1F4XH 2GY5A 4KV5F 4MNQD 1IAMA 2EC9U 2ZP0T 2A9NH 2AEPH 4LCCC 3SGEI 3LRGA 1NAMB 3WUWG 1YNKH 5F1IB 1ZVHA 2FLBT 2MCG1 4ZSOE 5I74B 5I71C 2PN5A 3C09C 4OTXL 4AEEA 2UVEA 4J12A 4KJQD 5HVGB 5I1DA 1GGYA 5D7LD 3ZTJG 2P46B 1G7MA 2NR6C 4FFWD 5IVXE 1N26A 3NPSC 3EFFB 3CFDA 3ULVD 3Q5YA 3E2HC 1FORH 2FH8A 4DN4L 5LGJB 3Q6FA 1FGVH 2EYRA 2X4TB 1TETH 2NY1C 3VWJA 5DRNB 1QFWI 1VKXA 1ERNA 4JFQA 4CMMB 3KPLA 3PDOB 1W8NA 1AQDB 3GSQB 1C5BH 3VXQB 2J5LC 2BJML 1GGUA 4MQ7B 1KLGB 3BRFA 3HTLX 1PAMA 5CBAA 4LMQE 4JE4B 4GSDH 4GQ9L 2AXGA 3L3OB 4UU9B 2D7MA 4HPOL 5C0IA 1GYAA 5JOPD 3S34H 5BS0A 3HE6C 3FFCB 3PL6A 2DJUA 4C55A 3KYNA 4XXCC 5DUBB 1NJ9A 4Z7QE 2YD8A 1RK0A 4YWGH 4HUWA 4Y8DC 3K4ZA 5F6HI 2A6IB 2J1KA 3TBSA 4QXGL 4UDUA 4WDIB 5E1AB 4Y2DD 2P4AB 4JDVB 4U6VH 4FFZH 2B5IC 5FYKL 5LWYH 2XI9A 4DKFL 1OGAD 3UTTE 2VNCA 2AI0L 4QTIH 3MRIB 3CVHB 1QNZH 3CUPB 1W2KT 2NY0C 3LD8C 2I5YL 1KN2L 3GSRA 4PLJD 5HHPB 3BGAA 4FQ1H 3T0BA 1INEL 1P1ZA 1I9JH 4H25B 1MVUA 1U93A 3DETC 1RJZA 1U58A 3L5XH 4AEHH 4J3WA 4PGBA 4XAWH 4PRPB 3SGJA 3MRPB 4EDWL 5C0RH 5DQ9B 3SCMC 4M61A 4KQ4L 4H1LA 3CFJB 2XTJB 5HHVL 5T1KA 2E7BA 3LDBB 1HCFX 5DXWA 1EIBA 1MFEL 2GTZA 4WJ5A 3EYFB 5DJZA 1UH4A 1J18A 3MRMB 3QQNA 4GOSA 5FYLD 4NQCB 1AGDA 1PKQE 4OCLC 3VH8B 2V5SA 4K7PX 4RNRB 2Y06H 2F5AL 3MUY1 1NUNB 2NPLX 3L9RB 5FV2A 4KMQA 5HYSG 3QAZC 3NFPA 4HKZA 1MJ8H 5IKCB 4Y5VA 5AYQA 5ESAA 3JWOH 2FBOJ 4OF5A 1CGSH 1T1XB 2X9YA 4NKIH 5TPWH 4J1UB 4PJ5A 3RRQA 1X4ZA 1HILB 1EVUA 1X5GA 5JHLH 3RWHB 5E4EC 3DX6B 3WXWH 2D31B 4NQEE 4D0DB 1FYTE 5JHLL 4JB9L 3QJFA 4NQUA 4JPWH 1ZA3A 3ILPB 4JJ5A 4LCWD 1ZT4A 3WKMH 2GSGA 3GBLA 3OL2A 4R4ND 5I9QC 4W4NA 1JP5A 2GIYA 3ARYA 4YLQT 1M1SA 2OJZH 3QRGH 4GW5B 2MFNA 5TDPA 5IK3A 3OR7A 2BY2A 4OQTA 1XGUA 4PJFF 3P30H 3ZKQD 5EIIA 3KHOA 1I7ZA 4WW2B 4DFHA 2R2HA 2HYMA 4AL8L 2HT3C 5C2UB 1I3RA 4L8DA 3U2SB 4LSVL 1JVKA 4HV8B 3VXPA 1A7NL 2GT9B 2B2XH 4U6XB 5I76A 3D9AL 1DVFB 3WNLA 1TJHL 4MJ5A 4LRIC 4JPWL 4XCEB 5BVPH 3GIVB 5KSAD 5L8JB 1DFBH 1K3ZA 1JPSH 1FZJB 2YSSB 3UJJH 4P46D 3VFUB 2MNUA 3UTTA 5EO9B 3INUL 4YHKH 1EJ6A 3G04B 4ERSH 4ODTL 5EZLA 4PTTA 3NA9L 4XVSL 4J2XA 3PUCA 4UV7L 5KAQG 5MEPA 5FO7A 2VLMD 4PP2A 4XCFH 2XWTB 4QHUB 3BKYH 3G5YB 4RMVA 1BQLH 1XGPA 2A6KA 4WV1B 5C08A 4G42B 3LH2H 4JKLA 5MEOB 3S96B 3PNWB 4JKPL 4Y5XA 2EXYC 4ORGB 3AB0C 4HWUA 1A6VL 1W0VB 4XGZB 3RWGB 5BCAA 2X5PA 4NUGL 3VFPB 3QCUL 3IETB 1KCVL 4EKXA 4KKLC 4MZ2A 4HUXB 5EPMB 2YPLD 5ITFA 1I9IH 4DK6A 5GGVY 4TOYH 2AK1H 1GOGA 4OUOA 3FQXB 1F6AB 4RAHA 3QRFM 3MYJB 5CWSB 3PP4L 3TA3D 3LY6A 4NN5B 3FT3A 1MRCH 1VA9A 4BSWB 4NHCL 3D85A 5EFIB 2DQCH 2EXYD 4PRPD 4XCCH 2HG5A 1IGMH 5DK0B 1HZHL 1UXWB 3OKYA 1UC6A 3FN0L 4EVNA 5K9KB 3GRWL 1U8OA 2FNBA 1XF1A 1FQ9C 3QHTC 4I0PC 4LGRB 1DBKH 3SE8L 4MJ4A 3BD4A 1FG9C 3KPSA 4OFIA 3MRGA 3MUZ1 4U1HB 5L7XH 4LLMA 3QUMH 1GL4B 4L3ED 5BQ7A 3G08A 3CMOL 5DR5L 3KYMA 1CGYA 5DGRA 1N2RB 4AIZB 3HC0A 3P0VL 3M07A 4ODWA 4NN6C 4UINL 5ICZA 3VWJC 5HHQA 4KPHL 2VOTA 3V4UL 2CPCA 3U1SH 5A16A 1BQHA 3QA3B 1ORQA 3QCTH 1DE4B 1TPXB 4H26B 2DQEL 5BW7C 4POZD 3LH2L 1IT9H 2BSSA 5IF0B 5B4MD 4JO4H 4DEPB 4MYWB 5T3ZL 1H3WM 1J1OH 1QFWL 3BPCA 4WHCA 5EU5B 2DQDH 1PEZA 1ZLVH 3I3BA 3HE6A 4UT7L 5T3ZH 3PL6C 4DZBA 5FECB 1SYSB 4U1JB 1J0ZA 4WU5B 4F57L 4JY5L 1U42A 3DRTA 3F7VA 4N8VA 4UT6H 4KPHH 1QFWM 2A6JA 2HVJA 3MBXL 2JJSA 4GRWF 4UINH 5DVNA 3WS6A 3QEQE 3VGBA 4OLZL 4ODVH 1DCLA 2HP4A 2X4OB 5CGTA 4WEBL 4KK8D 2JJTC 5CEZD 4V1DA 3HI6H 1T7ZA 1F42A 1HHGB 1T21A 4MWFB 3ARQA 4G6FD 3S88L 1XGPB 2A6KB 1N6UA 1KFAH 2H32B 5E56A 2XKUA 1WFNA 4LDEB 3G6AB 1XR8A 4UILH 4QHLB 1FGNH 4ZG1A 4KXZI 3LN5A 4K3HA 1JK8B 5L88H 3ULSB 2VLRB 3DVGA 4JM2B 5ENWB 3U9PH 1ITBB 2H2SC 1HEZA 2CUIA 5KTEL 3SCMA 1NMAH 4M6MH 2IBZX 4QT5A 3TVMC 4OI8A 3PE9A 2IQ9H 4MD5A 1ZEAL 3VCLB 4KROB 5TDNA 2IAMD 5I15L 3QHZL 2VLJE 4HV8A 1MQKL 2HWZH 1L7IH 4X9FA 4YHIB 4P2QD 2NY6C 3CFCL 5EA0L 2DJSA 5KW9L 4XNYL 1AO7E 1RZ8B 4M5ZH 5C2BH 3GJFB 5LGHL 2D03H 3BZ4A 2HJFA 2UUDK 1C08A 1NAKH 4Y4KD 3PWJA 3BP6B 1A4KB 4I4WB 2YHGA 3HNSH 4ALAH 1KXVC 2HFFA 1LO4L 5SWZE 5D93C 1JNJA 4HPYL 3BPNC 2DLIA 5IUSA 3Q1SL 3BJ91 4JN2A 1PY4A 3UBXI 1B0RB 1GIGH 3LDBC 3O9WD 4YDJA 2VE6B 1JF5A 2DTML 1A22B 2BOBB 2GJZB 3GEWB 3KJ4B 4NWUH 3BDXA 3SDDC 2VLRA 3DVGB 4JM2A 3GDBA 2R1YB 1NLBH 1HK6A 2X42A 1NFKA 3ELAT 4PR5B 4WW1B 2XQYK 3T0ED 3LS5H 1TCRB 4LAQH 4JO3H 1FDLH 4C54A 2BHUA 2RBLA 4UTAL 2APXA 2NW3B 2YXFA 4NYLB 4YGVB 1S9YA 1T66D 2NY0B 2DQJL 1QLRA 3HZYB 3FB6B 3O6FD 1W72H 3EDEA 5FDYA 1MIEH 2BVEA 3UYRL 2IBZY 4ZUWA 4V1DB 1TZHB 2VDLH 4XX1G 4Y2DC 5DD5L 3MGOB 3OAYH 2J88L 4X98B 1S7TB 3WIFA 1ORSB 4NQDE 3MV8A 4IRSA 3VMPA 1KTLB 4LBEA 3WN5C 1U6AL 1U3ZA 1T1ZB 4FG6D 3UPCA 3MACL 1CS6A 5F72S 2IPUG 3D25B 4JFZL 2J6EL 4JKWA 5C0CE 1JZ4A 1KG0A 3QUKB 4IRZL 4F58L 4R90L 3FKUS 4CN6A 1MCSA 4X8XA 4EUPH 3SN6N 5CHNB 4W68A 1F02I 1I1AB 3RVVC 5DJAA 1FVEA 1GZQB 4GSDL 1S3KL 5B39A 1K9TA 1CDBA 5JA9A 4LP5A 2ZUXA 3WJLC 3T04D 2Z8WC 1I7UB 4ZPTB 4C4KO 5FK9A 4YXLH 3PGCB 3QIUC 5T5FL 5I1AB 1WIOA 5CSBA 4JLRB 2CDFB 3GSVA 3TPUA 1KIRB 4GXUN 4L5FH 5IBLC 1W72L 4F3FB 3C9NB 5IB4B 3LKOA 4L4TA 2JTDA 2Y4SA 3VGFA 1NDMB 5FGRA 5DURB 5DJ0B 1V7MH 5DRXB 1IC7L 4YQXL 2DWDA 4NKDA 5DHXB 4G6KH 5IB1A 4PJIE 4I9WE 2AXFA 4OQ1A 2FECI 3QDJA 1OAUL 4XBPA 1YPZE 4JREC 3C9NA 5DHVA 4PJAA 5CMAA 4PYHA 3FQNA 1RAMA 4PY7B 3M1BA 4I0PA 1QVOA 5EWIH 1ACZA 1KCSL 1F6AA 2BY3A 5GGVH 2ID5A 5J8OA 1XF2B 4HLZG 2R9HC 3QNYA 3QFJA 4O02H 1G9MC 3PV6A 2P8LA 3PABB 3KDMB 1SBSL 5IJKA 1U3HA 4HWNA 5DRZB 2VLRD 4JM2D 1EGJL 4XGZA 1FJ1B 3RWGA 1NBZA 3QQ3A 1EEUA 5J3HC 4LEXL 5C0GA 2Z35B 3OKEB 1DSFH 3QUKA 1BAFH 1WBXB 4FQQB 4KJYB 3QDGE 4JPIA 3MRNA 4Q9QH 1CGUA 4NPYB 4DVBA 1FE8H 2D9QB 4HPOH 1EO7A 2YEZB 1OP3H 3JTTB 5C09B 3ZKXB 3L95A 4LSSH 4MD4B 3TH2T 2A6DB 3N9GL 4NZTH 1NCCL 3ZYIA 4FFVC 4YHOL 5E7BA 3OAUL 3LKQA 2Q76B 1ROWA 3QEHA 4O2FA 1AXIB 2C4FU 1CF8L 3EZJB 4EUPB 2ARWA 5D2LB 1K4CB 2R15A 1S8DA 2JJSC 3FRPA 1U8QB 2EO9A 2J8UF 5IW6B 3P73A 5C9KA 1UACL 4XNUL 1E4XH 1A9BB 3CAFA 3JWNC 1X5KA 1MWAH 4OB5L 4C56E 1N4XL 1ZK9A 5ALBH 1MIMH 5E7FA 4KY1L 5IMKA 1CLZL 1VADA 3JV6B 1JTOA 5HY9B 1YYLH 4ZFZB 4PJ5D 1XGUB 3ZE1F 5K59F 5LXGH 4M8VA 1KLUA 2ED8A 3UPRA 2P8MA 1I8MB 3HAEA 1YYLL 1CK0L 5F7DB 1I8KB 2CIKA 2NY5H 4LLDA 2FH6A 3JUZA 3MRQB 1BOGB 4OBSA 2PTTA 3EOTH 1KJ2B 2R69L 3UDWA 1DQLH 1O7SA 1PYWA 1UACH 5F6IC 1OP5K 3BW9A 3EO1B 2XV6B 4J3OC 3KXFE 5IB5A 4OLVL 1WAAA 4X5XA 5DFTA 2X4QB 4WY7H 5FKAB 3TVMA 3IKCB 2EEAA 4PJBE 1LO3H 4GO6B 3P4MB 4EQ3A 4NZUL 4ZFGL 3O6KL 1E4JA 2O26U 5ADOH 4FXLA 1RIUL 2KQMA 4KDVA 4NCC2 4HW6A 1UM5H 2RCSL 1CQKA 1VACA 4P2RD 2YOCA 2MKWA 3KPNA 3UJIH 1BQUA 3I6LD 5GRUL 2R23A 5D4QA 3HCVA 3R8QA 2X70A 4DFIA 4CW1A 2ED7A 1MQKH 5JUEL 5EU6B 1A6WL 1EMTL 2YRPA 5E6IC 4LL9A 2HRLA 4M62H 2WQ8A 3EJYD 3WJJC 4HS8L 3JTTA 4S10A 2CGRH 1P4LB 2ZOKB 3QH3B 4EI5C 4WTXA 2WIIB 2VABA 1W0YT 5EORH 1HHGA 1T21B 3PP4H 2SEBB 2PCPA 4XB8A 4TRPL 3V0WH 4MNHB 2JELL 3CFBA 4PRNA 4APQC 4HH9A 2ED9A 2LQRA 5L2KD 5IEKA 1FYTA 1TXKA 4S0SD 4P46C 4NQTA 5ETUB 4RMUA 3WIHL 3CIQA 1TVHB 1NAMH 2CD0A 2XTJE 2CLRB 3MRIA 4N0YH 5DO2D 4UV7H 3MREB 5DHYA 1NFDA 2DL9A 5GZNC 1ND0B 5TE4H 2IWGA 1BZ9B 3DRQA 1B9ZA 4JDVA 3W0WB 1CFQB 5ALCL 3PWPE 3DI3B 4X8JB 3VI3F 1BGXL 2HVKB 1YMMB 2GITB 3FQNB 2L0DA 5C0EA 5KVMC 5C0JA 2J4WH 5DVKA 5T1MB 4RMWA 2K7PA 2XWBA 4HT1L 4ZXBC 4XVSH 3D18B 3P11L 2C1PA 3ILQD 4XVTH 3MLSL 5CKAA 1AKJD 1JIBA 4HJ0C 5FKPA 4LCCA 1HXMA 1J1OL 1QFWH 4ONFL 1SYVA 5E5MA 1HKLH 3HPJA 1CDCA 5C6WH 3VI3E 1ZOXA 3QG7H 1YZZA 2VKXA 1T1YB 2QL1A 3P40A 1IC4L 1LK2A 3ES6A 4RIRA 3CVIL 4J7RA 2QR0A 1FRGH 4GS7B 4WHDA 4KROD 1A1OA 2B20A 1NANI 5HPMB 5CD3A 3QZWG 3ZE0E 1MFAL 4YHML 1JHKL 3VXSE 1K5NB 1VB9A 2UWEE 4P5MA 3RWDB 3TNMA 3T3ME 3KLHD 1ZHBB 2VXSL 3A67H 4EI5D 3S9DB 3HCVB 2H6PA 1KOAA 1N7ML 1CU4L 4OM0H 1FZMB 2HLAA 3O6FB 4NKOA 1ACYL 3KPNB 4ODSH 4K71B 1N7MH 3H0TA 2VLJD 5FF6A 2Q8BL 4D94A 3CSGA 1U91B 1G84A 1N5YL 1F8TL 4YBLB 4HUXA 12E8L 2AV7B 1PG7X 1JRHH 2V2WA 4RGOH 5DEFA 5IB3A 1TNMA 1FNFA 5DZLA 4MCYB 4M7ZB 4G8IA 4YHYB 1BQHG 1RZFH 4X4ME 4DGVL 3VFPA 4HC1H 1R5VA 3RDTD 5ANME 3LS5L 3JV4B 4HUKB 3NFSL 4CADB 5E08L 4BKLB 1MQ8A 1KPVB 2Y1VA 4P5TC 4XPFL 1EEQA 3QDJE 5EUKB 4BJLA 1G9EA 3HNVH 5IQ7L 1N5AB 3M17B 5DMKB 1H3PL 2R2BA 1YN7A 5DJ2A 2AXHA 4JGJA 4NWTH 1F11A 2D7OA 1D5BA 1WCBB 1OGAA 1OQXA 4PGDB 1RZGA 5E8EA 5DD3L 1QSFE 3G04A 5BV7B 1CI5A 4MMXC 3LSOB 5CGYC 4U0RC 1LNUB 1E6JL 5C9JB 4O2CA 3VRIA 3H3PL 5IT2H 5DUMH 2CK2A 4Q9CA 5IMMA 2NMSA 5H2BA 3LQZB 4OZHF 2DMCA 3MC0A 2ATKA 2V9RA 3MBED 5HGBA 3QUYB 3QISA 4IRJB 5I1LA 3MLXH 1I7ZB 2YD2A 3BWUC 4XHJC 3GUTB 2FYYB 2BY0A 1JHLL 4PJCE 1RZFL 7FABH 3LEXB 4OGYH 2APVA 4L4JA 1VEPA 2ADJB 3CGTA 2ZZUT 5INDB 1ZKAA 3U0PB 4Y4KA 1GAFL 1IAKA 1KIQA 4U31A 1P7QA 3NCMA 2V9TA 2HFEA 3FCTA 4TRPH 3V0WL 3FO1A 4IRZH 4F58H 3DX9A 3FO2B 3O9WA 3ZDXF 5EOCJ 5D71H 4P2OC 4X6BB 1EJOH 2PF6A 4U6YA 4JG1H 2BCKA 4IRJC 1ZANH 3QUYC 5GGSA 1XFPA 3ZTJH 4G6JH 3UDWC 4JFXB 1RK1B 4N8CL 5GRJH 4MB3A 1JGEA 5D1QC 3O6MH 1J88A 1ZLWK 2H32A 4LLQA 3UYRH 1CD8A 1MI5B 1TJGH 1BGXH 1Z0MA 4ONOA 1T7YA 2DQTL 4WUKH 1IFHH 1FGVL 1ED3A 3LKRB 3VXRE 2OJEB 4NNPH 3U82B 2C4XA 4NQCA 1IC4H 4HS3A 1I1RA 4JHAL 5D9SB 1MPAH 1WWAX 4H5SB 4OTXH 3C8KA 1PY9A 2HJLA 4WUUD 4XNZB 1J10A 2AJ3B 1C7SA 3HRZA 1Z9LA 4M9PA 1A6TA 1LO2L 1VGEH 3O3AA 2FJGB 2E6PA 5JW3H 3T2OA 3OKKB 3T0EC 4H25A 1MVUB 1U93B 2FHBA 2M26A 3L5HA 1U8PB 4K07A 4POUB 1NC2A 5DJ6A 2E6QA 3IDUA 1OGAE 3BUYB 3CSBA 4PG2A 3UX9B 1QO3B 2R4SL 3RDTA 4MAYA 3CUPA 4PLNC 2OR8A 1I8IB 4YBLC 3X11B 2D7NA 3VFMB 3ARBB 1KULA 3RP1A 1D5ZA 1OGAB 2FEDD 1U41A 2WM0A 4APQA 4NO2B 2W0LA 1NCBL 4YXHH 2W9DH 3OKDB 2FDBP 1I7TA 1EGJH 2CLVB 3DMMC 1MLBA 2X10A 3KYMB 1CWVA 5EOQL 3V52L 3WFEH 3EKCA 1U8PA 1MELA 1J87A 4QRSA 3KYNB 5IBUB 4LIQE 5GGVL 2YD5A 3MFFB 3TLRA 3BKCH 4LFHD 4U6VL 4MQSB 3KJ6H 1IL1B 2NY3B 3NIFE 1HQRA 5E03A 2AV7A 1ZA6B 2WNGA 3L3OA 1MCDA 4YAQB 3RVXC 3TIDA 1SY6A 1WTLA 4HS8H 3QI9A 5EU4B 2BNRD 1NMCB 1C12B 2I25N 4K3EL 5GS0L 2NZIA 5GS3A 3NAAH 1CE1H 4Z0XA 4XHQA 1P69B 4E0RA 1CK0H 2QQNH 3O4LA 4AEIH 3FT3B 4BELD 1CT8B 4NN6B 5DD6A 3AREA 3Q6GH 4J4PC 1WQVT 1M6OA 3MGAA 4NZRH 5LG1A 3W81A 3HHRB 1CTNA 3LEVL 5FA3B 4JJHA 3B2VL 1UEYA 3DSFL 4XCNA 2OXGA 5GGSB 4YHLH 3P4NB 1HSAA 4TNVK 4WW1A 4H1LG 3RWIB 1HHKB 3SGKA 2QADD 3REVA 1OF2B 1TETL 2MHAA 2IC2A 4U1KB 3UJTL 4H88L 5IVZA 2OP4H 5T1LB 2HFGH 3ARVA 3HLAA 1T0MB 5HDLA 1VERA 3NPZB 4WVRA 3JWOC 5BW7A 3PWVA 4IIQB 3T1WA 3TCXA 1MLBB 5J9PB 3IF1A 4BK5A 4DWHA 4ZPVA 5EDXA 4NZRL 2XWTA 4QHUA 5FO7B 4M7LL 4U1NA 3WFDH 1MREH 3D18A 2ADFH 4JANA 1P4IL 3DI2B 1QKZH 2XKNA 1SBBA 4MAYB 3L3DB 1DEEA 2Z31C 1QO3A 1INQA 1JWMA 5TDOB 3WFHA 2CRYA 3MA9H 3I6LE 3WS6C 1IRAY 2V6HA 4X9IA 2F53D 4Y4HA 5DRWA 1RJYB 2Y25A 3PQYB 3VFSA 3AB0B 4PJHE 2MSPA 4PJ5E 1RULL 1OAKL 3BZEB 2YBRA 4YEEA 4WI7A 5I0DA 1FYHB 5CJXA 1CE6B 4WFGD 4WO4A 4XAKE 3ULUD 2R2BB 5DMKA 2ATPB 5IBLD 4O4YL 3ZHDA 2VUYA 5ANMA 4MWFA 4DGYL 2W9EH 5CP3H 4CNIA 5IMOA 5K9QI 4CADA 4NQEB 2LV4A 2QJDA 1MY7A 2WIIA 1CLOH 3GBNL 2MCPL 1LE9B 2HH0L 4RWYL 4G5ZL 4NBZB 4RFOH 3OHXA 1A1NB 3BUTA 2ZUYA 4PB0L 5JR1L 4C56B