1IARB

Interleukin-4 / receptor alpha chain complex
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
197
structure length
188
Chain Sequence
FKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAAGISYRARVRAWAQAYNTTWSEWSPSTKWH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine/receptor
molecule keywords PROTEIN (INTERLEUKIN-4)
publication title Crystal structure of the interleukin-4/receptor alpha chain complex reveals a mosaic binding interface.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 188
sequence length 197
ec nomenclature
pdb deposition date 1999-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09238 IL4Ra_N Interleukin-4 receptor alpha chain, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1iarB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1iarB02
3FJTA 1VEPA 4TOYL 2A1WH 2YR3A 3QPQD 2F8XC 3O9WC 2JLLA 1GGCH 1WZKA 4GQ9H 1CYGA 5L88L 5DWUL 3SCMB 5HHVL 5EOTA 3KPMA 4X4XA 5GGUB 1IFHL 1FYTB 4QCIB 4DJMA 2XXMB 3QIWC 1HQRA 3NIGE 1QRND 4F15B 3IS0X 1L9NA 1HOCA 4L4VB 2D9CA 4LVEA 1AY1L 1E4KA 3QWOA 4FHBD 5GGVY 3C5ZD 2FH8A 2Q8BL 1T83A 2NY4D 5J9PB 2AXJA 1OP3H 5BS0E 7CGTA 1S5IL 3ARZA 1EEQA 5KSVB 1TQCC 5AG9A 1AGBB 4PJCE 1QSEE 2E9JA 4LSQL 1QFWL 4X6CB 1MNUL 5IBTH 3HZKB 5HVHB 4RMUA 1VHPA 3BQUC 3C2SA 1ZWIB 5FCUL 3N9GL 3G5YA 2XOTA 1I4FB 1CICB 1P84J 3FFCD 1SVCP 3WSQL 1I1AD 3C6LC 1T3FA 5DGRA 2NW2B 4LLQB 3EOAB 5EU6D 2P47B 1YEKH 4JFOA 5E99L 2R4SH 4JREB 4UOW1 1XGUB 4K7PH 4LLVA 3QIBD 3UCRA 1MAML 1RIVL 3RL2B 1EGJH 4KJQC 4KH2A 1HNFA 4L4TE 4P3WA 4KKLC 1KB9J 3RVTD 3V5HA 1MFDL 5E8EA 4KKBD 1MCPH 1MPAH 5HYQB 3EYUH 3QIUC 3G6JB 4OGXL 1JVKA 1FP5A 5DJYA 3D18A 4RFNC 1MCKA 4YFLF 4I4WB 1H15B 4P23C 4UV4L 5DJCB 3BVNA 3NIFF 4KK9D 1I9RH 2NY5L 4P5TA 4BA8A 3O11A 2XN9B 3KNBB 1RQ5A 4LU5H 4YAQB 1RK1A 3B9KC 4P46C 5EFIA 5E24E 2X4UB 5HSFA 4DQOL 1OAKH 4HCRA 4XC1H 3BP7A 1BAFL 2DM2A 5CGTA 3M1BB 1ZVSB 3KDMB 5ETUA 2VABB 5EOCJ 3WIFB 1N5AA 3RZCB 3MV8D 5FA3B 4LSVH 3Q6FB 2YRPA 2AJ3B 4XP5L 3VD7A 2R23B 4XXCC 5FKPB 3J7HA 4YWGL 3ARGC 3SGEH 2BXZA 3I85A 3EFFB 3REWB 1ED3B 4Y19A 2YN3A 3WCYA 1XAUA 2DRUA 1H3UA 4FNLH 5EBMB 4TPRH 2DF3A 5FB8A 3BZEA 2EO9A 4K3JL 3FQRB 3TT3L 3GJEA 4JPVH 2Z91A 1TJHH 3CFDA 3ZHKA 3OG4B 3LIZH 4OBSA 1ZSDB 2AQ1A 4AH2A 4ALAL 5I75B 3BN9C 5GIRB 1KT2A 2R69H 3WNMA 4DKDC 2A9ML 1FSKB 1VKXB 2B4CH 5DD3L 3SPVA 2HRPH 5DS8A 4HWBH 1OM3H 5IMKB 1MCCA 4RDQF 1VADA 3I9GL 3NMEA 2YD1A 4YDKL 1FORH 4PRPD 3V52H 1KLUA 4KKAC 2R0ZH 1CU4H 2F58H 2KQMA 4JDZB 1KTDB 4UTBH 3DX8A 1S8DA 1WBZA 4FMKA 3ILQD 4HXAH 4ODVH 5CEZH 5CBEB 1QLFA 4K23H 4RWHA 2IH3A 3QJHA 2BVQB 1TPXC 1V05A 2CK2A 1KJ2H 5E70A 3LD8B 4Y2DC 3OZ9H 2DQIL 4R97B 3ES6A 3RU8L 4OZGB 4D9LH 4QRPB 3L5XH 4N9GA 1J8KA 4NM4L 5F7LB 1IZJA 3QRGL 1MREL 1IM9D 1MF2H 4OZFA 4HIIA 3GMMB 3UPRB 5IKCB 4TUOA 2VDNH 2ZOLB 1HZHL 4HK3J 4NO5B 1FVDA 5D96B 1BIHA 2EZ0D 4D0CA 3QHTC 2QQQA 3LDBC 3QEQB 4MA8L 1AGEB 4GRLD 1A4JA 1WBXA 1KNOB 3MLWH 2W9EH 3WFEL 3GKWL 1HSAA 1GC1C 3D39A 1Z0MA 3OAYH 5I2IB 1G7PB 1DP0A 1A6PA 1WICA 3MLTB 3WS3A 5D7LD 2HP4A 4JM2A 3MRIA 1KCVL 5C2BH 3MV7E 5J4MA 5JLZA 3CU1A 4I48B 3D3VE 1YYML 3WKMH 1CG9A 1FVEB 1NAKL 5DTFA 2ADFL 2GTWA 5J3HC 1QRKA 4RAUA 3RY6A 2HT4C 3O6LH 3WHXB 3TBSA 3TM6A 4HBCH 5BCAA 3HTLX 3BH8A 4U49A 1ACZA 4PJIB 3U2SB 4QTHB 1YC8A 1NGXA 1RIHL 3NZ8A 3CFJA 3NIFE 4Y7MA 1HEZB 3QG6B 5KJRL 2XZZA 2AJVH 2AK1H 3BZ4B 4HK3N 1FBIL 1YECL 5KVEL 1YN6A 1M6OB 4L9LA 1S7UB 5LWYL 1K8DB 3H9SB 1T80A 5GRYA 5B38A 1KBGH 3RBSA 2CIKA 4Y4FC 4Z76A 1KIQB 2VH5L 2DWEA 4RFEB 2E8YA 1DEEA 3BEVA 4HMEA 4LCCC 3IVKA 2FIKB 3UROR 2BY2A 1AC6A 2FD6L 2BFVL 2NY7L 3HE7B 5C0AB 1RJYA 3I75A 4NP4H 5D71H 3GSVB 4HKXA 5E4EB 2XTJB 4Q9QL 2P5ED 2WUCL 2BERA 5C08D 2VDML 4LSRL 1MQKL 2BVUA 2CDFB 1JWUA 3BPCA 4WFGE 3O6FA 3PV6B 1ZK9A 1T0PB 3PNWB 1E4JA 3AFLA 4PRBA 2NCMA 5DRWA 1QSFA 1ADQA 3QT2A 4DKFL 1MFAH 5TF1H 3TYFA 3FOLA 4MJID 1FFRA 3SKJH 1G9MH 3B83A 3GNMH 3BHBB 1XCTA 1Z3GL 3TPUA 5JHDE 5DMGC 5JXEC 4G5ZH 1IEBB 3HI6L 4UQ2B 5E5RB 2EDHA 1U9KA 2PCPB 4JFHE 5IB2A 3T2NL 5C71A 3RUGB 1NCBL 3LKPB 5T3XD 5I73C 4KUZH 2VXSH 1INEH 3MBED 4OD1H 5DFVC 3PHOA 3LKNA 1KACB 2QQNL 3WJJA 2J4WH 2R9HD 5FEBA 4JAMA 2R15A 2VLRE 1IQWL 4NQSA 1QQDB 4NYLB 1OAXL 4PUBH 3FQWB 4K94C 4Q74A 1HN1A 3OKKB 1UXSA 5BVPL 2A6KB 1MWAH 2C1OB 2DLEA 2IGFL 3BPLC 3ZT5A 3SE9L 5HI4D 3LAFA 4BQBA 2UZYB 5DEFB 3RGVC 4OZFH 3DROA 4K8RH 4I77L 1LO2H 4ZG1A 4QHLB 4F57H 4U1NA 2P5WB 1DLFL 4TVPE 3WO4C 1FIGL 3U36A 1JHTA 4Y4KC 3CJJA 1FG2A 5J13B 1S7SB 3OR7B 1W0WB 2J8UA 1WISA 1IGTA 1LO3H 2ZPKL 4Y5XC 2WQ8A 2PYEB 4JO4H 2PXYC 3L3GB 1UEYA 5KZCB 1ZA3A 1QBBA 3BKYL 4H0HB 2VUYA 3T65A 2G60H 7FABL 3VFOB 2F19L 1I8LC 4PR5A 1MHHB 1DEDA 5IT2L 2R56H 1DN0A 2CDEA 5JW4R 3R8BB 3WD5L 2BSTB 1NFIB 4AMKH 2X4NA 3U1SH 1X7QB 3WYRA 3DPBA 1CGTA 3FB8B 5IM7B 3S97C 3U6RB 2DQCL 3Q5TA 3RHWK 4M48L 3MCKB 3TV3H 3VXNA 4KVNL 3NCYP 3KYOA 2R39A 3CDGA 4FQJL 3UJTL 5LQBL 3DV6A 4JFXB 1IT9L 1J0YA 4Y16D 1Q1JL 2W60A 1J87A 5CINL 5DC0A 3X17A 1INDL 1JRHI 4OTXL 3SDDC 5IEKB 1JPSL 1CBVH 5C70A 5I1DB 3D1MC 2IBZX 4CRPA 4NBYB 5I8CA 3QPQC 3IDMA 4M62L 1KXTB 2V17H 3N85L 2ZCKL 4S11A 3T2OA 32C2A 3SKMB 3SDYL 1BQLL 5GS0H 1PKOA 2AJXH 2A77L 3DGGA 1MI5E 2R0WL 1D5XB 1MIML 5DJDB 3VFPA 1KJ3L 4ZOEA 4L5FH 3VFNB 1M7IA 3L5HA 5L8KB 4FQCH 3O4LB 3BDYL 4XH2B 5IMOA 3QO0A 2CLRB 4UDTA 2WZPD 3VFVB 1U3HA 3VXPB 2FEEI 5GGSA 3V4PL 3CIQA 5F7HA 1U8MB 5CUSL 1F3JB 5AUMA 5CD5D 3DHMA 5TJWK 1CLZH 4Y1AA 3MQIA 3MACL 5EOTB 2GK0B 3DSFH 2FBOJ 15C8L 5CEYB 3HUJA 1R3JA 2X4PB 4D9QD 4F7TA 1K8IA 1KJ2B 2WBWB 2YPLE 3B2UC 3KJ6H 3ULVF 1C1EL 2EH8L 2M26A 4Q97A 5FYJL 3ARSA 1HOCB 2XV6B 4LLYB 4RGNC 1SMOA 3OKLA 3V4UH 1TLKA 1OAQH 3UTTD 5DQDH 25C8H 1BM3L 3GGWA 2H45A 3QWRA 2IAMD 3MUGA 3ABZA 4AQOA 5E08H 1EHLL 3QIBC 2EEDA 1P7QA 5K59E 4QXGH 4LKCA 1TVDA 1N6QL 1UM5L 2IBZY 5LAXA 5DMKB 1F4WH 4KKBC 3GMRB 3ZT7A 3BT2L 3G5YB 3NIDF 5DQ9B 1RU9H 2YUXA 1FN4A 2BVTA 1D5MB 3ZKXB 3V6OC 1PAMA 4PTUA 3QISA 1OP5H 1UJ3C 1I8IB 1SBBA 4ZTPH 4KK9C 3GBMH 5H94A 4U1GC 5C0JB 3VMNA 2CKBA 2W0FA 2XG5A 3D3VA 1VFAA 4P2RA 1L4IA 3RWIA 5IFAL 4OF5A 5ACLA 4HKJB 4OCRL 5DQJA 1I7UA 4NWTL 3GM8A 3SDCA 3IRZA 2Z35A 4QO1A 3V8CA 4FXGA 3IJSB 4AG4H 5AZ2L 1N2RA 2V2WB 1IKNA 3CLFH 2JK5B 1QBLH 1EJOL 3O45B 1HHKA 5HYIA 2VDLH 1A6UL 4YK4B 3GMLA 4P5TB 1I3RB 1UENA 4ZAKC 4OCSH 3U7YH 1A64A 2RCSL 5JXAH 3OAYK 5FO7B 2A74B 5F97E 4HC1H 3L6FA 4KU1A 4ZUWA 3WKNA 5BVJB 1A7RL 4HPOH 5ETUB 1PSKH 3VWKC 2IALB 3RZWA 1R5VA 4H26A 4F7MB 5C07D 4UOJA 1JJUA 4OD3L 4WWKC 3UBXG 5JW3H 1NEUA 4W4OC 4LASH 4Y19B 4LKXA 2H6PA 1GGIH 3DTXB 3NZHH 1LGVA 5T5FH 1OOAA 3G9AB 4DVBA 3P4NB 3BZEB 1LO4H 3BGMA 1XGYH 2ARWA 1KF9B 4X8JA 3GJEB 5TGBA 3CFDB 5KSBB 5FECB 1FL6B 2EIDA 5AYUH 2FO4B 3MA9L 2GUOB 1CL7L 3STLA 1G6RA 2A6JB 1FLRL 2DLTA 3D85D 1S78C 3ILQC 5IHUL 2DTSA 5IHLB 2AXHA 2A6IB 3RWGA 5CEXA 1JRHH 5SWSB 1BECA 2DL2A 3SEPA 1VADB 4LRNH 3TA3B 2Q86B 3WUWA 3NABL 3QUXA 3AMKA 1KLUB 4GMSH 1CXLA 4ZXBA 4NC1E 2ZNWA 4R2GC 3ARFB 1B88A 4WW1A 2DQFB 3DI3B 3DX8B 1S8DB 1WBZB 5F7YC 1RUPH 3OL2A 4ZD3H 1KOAA 3MRCA 2QSQA 2MPAL 3GRWL 1OWRM 2SEBA 3RWHA 2GCYB 5J6HB 5IB4A 4TTGA 3W5MA 4GRLC 1TETH 4Z7OF 1OCWH 4JFYB 1W8NA 1OT1A 3VRJA 2JIXB 1MWAB 3ULVE 2EIZA 3ES6B 2Q20A 4WY7L 4GRMA 3WE6A 3W81A 1X5FA 4NRXA 2OJZL 2HJFB 4OZFB 4JFEA 1KN4H 5SX5K 3KYNA 5I1EL 3F8UB 4HFWB 4ODXA 4X7SL 3S3SA 1JNHA 1D5IH 4HJJL 1JI1A 4LCWE 1JHKL 1WWAX 4G43B 1WBXB 5EBLA 4WV1B 1MJUL 4FQQA 2CJUL 3C2AH 3VFWB 4M7ZB 4NNYA 1HSAB 1PEZA 5EORL 5DJ2A 2F9BT 1JGDA 1WFUA 3NIDE 4L3AA 5D7IF 3I02A 4CVWA 3VDCA 2XG4A 5TE4L 1BFTA 1KGCE 2AABH 4O2FB 4GQPH 3DVGA 2FYYA 1MQ8A 5D2NC 5GGQH 2FX9L 2E7LC 1OW0C 4XVSL 3P9LA 1JGLL 3ZDZF 4GAGL 1N8ZA 4FTVD 3MRIB 2ICWI 5DD6A 3H3PH 3EOBA 2W0KA 4NHUA 4OFDA 5HPMB 2CUHA 2NR6D 1ERNA 5DTFB 5ALBL 4JDTL 4Q2ZA 3OSKA 4RAUB 3QR2A 2IFGA 4J23A 3U0PA 1OY3B 1S7RB 4OLYL 1YJDH 4PY7B 1TDQA 4IRSD 4YDJA 3CFJB 5HDBF 4EJ1C 2WBJA 3QHFH 2ICWA 4NKOA 4XNYH 3U7WH 1LDPL 2MSPA 5HGAA 1YN6B 2GJ6A 4XXDA 1QA9A 3HAEA 5LGHH 1ZHNA 5B38B 4LFHG 2FH6A 1VA9A 3JZ7A 4ZS7H 1MVUA 2DWEB 4M4RA 1NGZA 4OKVB 1Z6JT 4XCYA 4R3SA 2NNAB 4WUUB 2RAMA 2YZ1A 2Z92B 3KPSD 3P73B 1EBPA 3HG1D 2E9BA 1MI5A 1NGPL 5C09E 1LEKA 3WIHA 3L3OB 4V2CB 5IGXH 5CWSA 2AAVA 4HKXB 2O61B 3QZWA 2O5XH 4M3JA 3V4VL 4KROC 4NQDB 2FZ3B 1YEHH 1DVFD 2Y5EA 4M93C 4N8VA 3MV9A 1I8KB 2DQUL 5I1GL 1JWUB 5IHZA 1GYAA 3B4NA 2WNGA 4M02A 2HWZL 4OI7A 2H2PD 4PRBB 3DVIA 5DRWB 4YC2B 3HZMB 4CJ0A 4EVNA 1T89C 3H9HA 4K7PX 4C59B 2BXYA 4RIRA 1BJ1H 2CUIA 4KDTA 2VXQH 1XCTB 2HH0H 4UBDD 5HHOE 3TPUB 3Q5YA 2NZ9D 4ONHA 5DF0A 3T1FA 1X5KA 2HMID 1JK8A 1V7MH 5IQ7H 2HVKB 3QFJA 5IB2B 1UWGH 4I5BA 1WLHA 3PJSB 3S35L 3HPJB 3ZMRA 1DQDL 1YA5A 2CIIB 1GHFH 2VLME 3VG0L 3IKKA 3BWUC 4XVUC 2BJML 3FTGA 5CJ8A 5BS0B 1I9EA 3LQMA 4NM8L 1BP3B 4KMTL 3WFDL 5I8OH 5ANME 5FGRA 3PHOB 1QSEB 5J1TC 3NACH 3MZTA 4OAWA 4YXHL 4HMCA 3FB7A 3FONA 1M05A 4JAMB 4C4KT 4EBQH 3IDUA 4ODUB 4E0RA 1K4CB 5TDPB 2YUWA 1K3IA 1XZ0A 2PR4L 4AQ1B 4XMKL 5D72L 2XRAL 2BDNL 4Z7OE 3OKYA 4M7KH 1C12B 2BVYA 5E8OB 3OGCA 2HFFA 3DROB 3QI9D 3JTTA 2Z8SA 2IBGA 5C7XH 3QULB 2G2RB 3KVQA 3O41B 4NQEE 3KPQB 1GOHA 1ZANH 4TVPH 5C3TA 4M6NH 4OQTH 4YJZL 3SKOA 1YEIL 4RQQA 1KCUH 4NZTH 3VRIA 4I0PC 1PZ5B 5HDQH 3PWJA 3GSNA 1FG2B 5DJ8B 2DMBA 4K7PY 4OGAC 5D1ZD 5D7IE 4MJ2A 4HKZA 3RFZC 1D7FA 1QRNE 5ICXA 1NJ9B 2AXFB 4X4YB 1MCEA 1MLCA 2OJEB 1Q9LB 5F7EL 1WZ1H 2X1QA 3ZTJG 5HGBA 2V2TA 1ZA3B 4JQIH 1Z5LA 3ZDZE 1MAKA 4W68A 3T65B 2F15A 1UXWA 1MRCL 3BE1L 3IKCA 3GHBL 1FZJB 4OFYA 4X6DA 3NPSC 4K71B 1OP5K 4LPYA 4JFFE 4WHTA 3SDAC 2GSGB 1WWBX 3DX6B 1X6NA 3CFCL 3MO1B 4XB8A 1CGYA 3AGVA 3VXNB 2QV2A 5C0DA 4EDWL 3KYOB 3CDGB 5MERB 5E2JA 1UB5B 4FN0A 5DVOA 3DV6B 5HDBE 3MNZA 4FQ1L 1ZEAH 2DYPB 3VGGA 6CGTA 4D3CL 2PNDA 3HAEH 4OZIA 5D1QB 3JWOL 1MRFH 3I2CH 2A1WL 1ACYH 2FO1A 1V3MA 3GB7B 2Q87A 3IDMB 5JPMB 1GGCL 4GQ9L 2GTZA 4LIQE 1HH9A 4X7TA 1F2XK 5DVNA 3OKOB 32C2B 3ULUH 3IETB 3S5LG 5IB5A 3WIHH 5GRXG 2OP4H 2VO5A 1BZ9B 3F12A 3NCBB 1C8PA 2NY5C 1IGFL 3QHZH 4GW4A 1M7IB 4JZOB 1UM4H 4JY6A 3F5WB 3LN5A 3EFDH 4JCLA 5I1AA 1A3LH 2NY3C 4KTEH 1T66D 5HGGS 4G8GD 3X11A 1R24A 4KDWA 3BKCH 2IPUK 1S7QA 4YHLH 4RSVA 5MEOA 4QHUA 4Y1AB 2WIIB 2HFEA 3V2AR 4G9DA 4AEHH 4UIMA 2D0FA 3QO1A 4PRHD 3VH8G 4HWZB 3HUJB 3S4SG 5IBTL 1W0VB 4R7NB 4PJ5A 3MV8E 3VFTA 5IHBA 4WHDA 1CD1B 1ROWA 1HK6A 1LNUA 3EDJA 4WFEE 2PKDA 5INDA 5JA9A 2GT9A 1LE5B 3TYGH 4DGIL 3VFGH 3OKLB 4OB5L 1YEKL 4UIKH 2VLJD 4MA1C 3GGWB 4K7PL 5F7KC 4JRXE 1D9KD 4YEEA 3SJVD 4NRZA 2R0KH 3RDTC 1EGJL 1T04A 3VFUA 1U93B 1KCSL 3O4OC 4R0LA 2DM7A 3ZZ1A 1CXFA 4LKCB 4GKZA 4WI8A 2XKNB 2OL3L 4ZSOE 1MCPL 4FG6D 3QEGL 4C57C 2O5ZH 3I3EA 1FCCA 3E2HC 4K7FA 3KR3H 4KJYB 5L2JA 4HK0A 4G80A 1TQBB 3IDGA 4LARL 2E3VA 4G6FB 4QOKE 3BYTA 4PJ7A 3FFDB 35C8H 4ACPA 1FNEA 2XWJA 1I9RL 1L7IH 1T20A 2ZOKA 4MNHB 5H94B 3GO1L 3BSZH 2J6EL 4RWYL 1Q9KB 3CAFA 4AEFA 4M8QB 3MV7B 2AKRA 3RVWD 3D3VB 3SCMD 2XQBH 1XMWA 1JPTH 4KK5C 4LU5L 1R3HA 1CDGA 5I1LA 2ED9A 4YXKL 1BD2E 4JY5H 2Z93A 3SDCB 4B53A 4XC1L 2NY2D 1FYTD 4YE4H 3HC0A 3GSNH 1K3ZA 4YBLB 1EAPB 1N2RB 2QBWA 4KC3B 4KGLA 3AREA 1AXSA 4LSVL 4YXLH 2P24B 4NQXA 1HHKB 4PJXF 5DUPH 4YPJA 5C0CE 3MYJB 1WT5A 3GMLB 1CLCA 1KPUB 4KV5F 1F4YH 3H42L 3SE3A 4MXWL 5GS3A 3U9UA 1QYGH 1MOEA 2OR9H 4LCYA 1HIMH 5IIEA 1OL0A 4KK8C 5K33A 2R1WA 3Q5OA 4FNLL 4MGXA 4TPRL 3TFKD 3L6FB 3ZTNH 1WIOA 3Q48A 5MP6H 4H25A 4QWWC 4U1KA 1TJHL 1XF5B 3LIZL 1CICD 3EO9H 3FHQA 4Z77B 5C09A 1I3GL 1R5VB 2MCPL 1OB1A 2Q76B 4QHNA 5HHQA 2R69L 2BX5A 2ICEB 3BKJH 1T6WA 3CVHH 2HRPL 4LKXB 4U31A 3PWLA 4XP4L 1SY6H 3D0VA 4G42B 4IM8A 5GRJL 4O5LH 4C54A 5D7LE 5F93C 1F6AA 1FORL 1N3NB 3V52L 4N1CA 2EDDA 1IZKA 4BK5A 2QJDA 2R0ZL 5AD0A 4X8JB 1CU4L 2F58L 5J7CC 3RWFB 5TGBB 3GK8H 4UTBL 5C8JA 1XGPB 3D25B 4PJGA 3GMNA 2WP3T 4HXAL 4ODVL 3V6ZA 1SHMA 5CEZL 4K23L 3VXOA 1KLGA 5HGHA 1WAAF 3DARA 1DN2A 3JV6B 5JHDB 3RWGB 1KJ2L 4PGJA 5CEXB 4QTIH 4MS8D 3OZ9L 3HPLA 2H9GA 5C1MB 2IPTH 2XN9D 4CN1A 2Y72A 2JJTA 3K8MA 4D9LL 4Y5YA 3MUJA 4KRPB 1H9VA 2VE6B 2BY3A 1MF2L 2XI9A 2D7TH 1C5CH 2CR3A 2VDNL 3N0PB 2QSCH 1I3VA 5FCSH 3RZCD 3Q3GA 3LKSA 5TE7H 1U95B 4JM2C 3RWHB 5I15L 3KYAA 5D7SL 3IU3A 5IG7B 4D8PA 2IADA 3EZ8A 4HS6B 3VRJB 2EIZB 2LTQB 3MBXL 2IEPA 2O5YL 4NRXB 1ES0A 2K9UA 1A5FH 3CMGA 3QUMB 5C08E 3GSUA 4F9PC 1U91A 4G3YH 3KLDA 1AJ7L 3S96B 4NN6B 1MIEH 3A0OA 4ZNEE 5C2BL 3L3KA 1HI6B 5I1CH 3U4EB 1L0YA 1RZKH 5EBLB 3WKML 2CXKA 2QQLL 4QT5B 4FQQB 2NR6C 4U1SB 1NBVH 3O6LL 5ILTH 4OSUH 4LNRB 4DN3H 5I17A 4LSDA 1A7QH 4NKDB 2V9TA 1MCLA 4QRQB 2VC2H 5HY9A 5ESAA 4IRSC 2G9HB 3H7LA 4LP5A 5DMJB 1N8ZB 1C5DB 1J1PH 1BMGA 4OFKA 5E8DH 5DD6B 3EOBB 2VQ1A 2XNAA 1CLYL 5E94B 2AV1B 4HUVA 1KBGL 5E2WH 3RKDD 1BEYH 1DQMH 1N64H 1IMHC 3NCCB 5FUOL 2NX5E 2XA8H 4MDIB 3VXTA 1UYWL 5BW7A 3O6FC 4HUUB 5FIEA 1ZLWH 4YDJB 3T0AA 4QRPD 3V7MA 4YFDB 5MEQB 3U0WH 3K4ZA 4PJXE 5A2FA 3T3MF 3MOAH 2ICWB 1ORQA 4NKOB 4KV5E 3O3EA 4R90H 2V5TA 4ZUVA 1QA9B 1RZFH 1HHIA 3HAEB 5D6DA 1ZHNB 5ID0A 3QAZC 1DVFC 1A22B 4UILH 2P8MA 5EPMA 3QEQD 1CLOL 4S1QH 2GJJA 1GIGH 2ZUSA 3KYKH 3LS4H 1CDJA 1OF2A 2MCG1 3QEUA 2AXGB 1PYWA 3RVXD 3MROA 3QDJA 1FE8H 2H2PC 2APFA 3UXFA 1ZA6B 2D2OA 2FL5A 1MFAL 5TF1L 4YUEH 2BC4A 1MI5B 1LEIA 5I8KL 3SKJL 1G9ML 3GNML 4MHHG 5CWSB 4U1IA 1BZQK 3D87B 4I3RL 2XPGB 4UBDC 4MB4A 4KZDH 2BCKA 3N1FC 4G5ZL 4LAJH 1C7TA 2NZ9C 1UH4A 5DJ0A 3RWDB 1JWSA 4EIZC 2HMIC 3TNNB 1GXEA 3DX7B 4XAKE 2VUOA 2DTMH 1X5GA 3K81A 4I9WD 2MQ0A 2P7TA 1E27B 4OCXH 1TCRA 3E8UH 1NBZB 2W92A 4UAOB 1XGTA 2AEPH 4I18B 1AKJA 2VXSL 1INEL 4OD1L 2BOCA 3RTQA 3H9HB 3VXSA 5BQ7A 1FNLA 4OLUH 2J4WL 3EHBD 4FRWA 3B5TA 1BQHB 4LPVA 3TH2T 5JHLH 2YPLB 3D6GA 4XI5C 4J3OC 4NO2A 4M1DL 2KDGA 1WAAE 1S7WA 3G5VB 4PUBL 4V1DA 4J2XA 4NUGL 4CN4A 4H88H 3L3IA 3M17A 3PP4H 4F7CB 2FIRT 1JK8B 1MWAL 1D5BA 3HS0A 3WV0A 3QFJB 3F6LA 4I5BB 1LVEA 3H9SD 4P48A 4O2EA 2XQYG 1WJ3A 4Y4HA 3OAUL 4XC3H 3QI9C 3KYMB 1P9MA 5DHYB 2YD3A 5ERWA 3RA7H 3MLYH 4HEME 3CSYB 3HE7D 4AIZA 1M05B 5C0AD 2VQTA 4E0RB 1YEJH 3QUZC 1IC4L 1B2WH 4U6HA 2B1HH 5AAMA 1XZ0B 3QDMA 1JTPA 3U46A 2XTJD 2FJFB 3H6JA 1LO3L 3OGCB 3T1WA 1SQ2N 2HFFB 3GHEH 4JHWH 3JTTB 3HCVA 4U7KA 4HBQA 1CFSB 4NCDA 4U1MA 4P2OB 4ZTOH 5LGKA 2HFGL 2G60L 1AE6H 1CD0A 3JWNC 1Y6MR 1B0WA 4OBRA 2R56L 3VRIB 2IQAB 4X6BB 1VGEH 4AMKL 2GITB 3GSNB 5FYJU 3U1SL 4X6FB 3L95A 1NUDA 2NLJA 3MFGB 5JNYB 1JF1A 3O3UN 4U0QB 5JA8B 4M61A 3TV3L 1IEAB 4LSPH 2I07A 2DD8L 5HGBB 5E2VH 1ZT7A 2APBA 4HMDA 5T1LA 2GJZA 2VJXA 4U2ZA 3TJEL 3VXQA 1IC5L 3FT2A 1Q72H 43C9A 3TIEB 3F62A 4X5WB 1S3KH 5F7DB 4MNGE 2UZIL 4LVNC 4PV9A 1QSZA 4YHMH 3SY0A 3U30B 3H7BB 4HUXA 3EYVB 5D1XA 5DT1L 4Z78A 2V17L 2F5BL 1CGSL 4LPTA 5L9DH 4HDIB 3RKPA 4MX7B 3R0MA 1DSFH 1FVCA 4M9PA 1HSBA 4TTDD 1TZIB 4RNRA 4JJ5A 3VXME 1Y6NR 1XR9A 3CVHB 4X4ZA 1AIFA 3T3ME 2IJ0C 1NGQH 4L5FL 1EBAA 2YD6A 4Q9RH 4CADA 4Y5VC 2P5WD 2OI9C 5CHNA 4XP9H 2Z9TA 2BSSA 3CUPB 2G5BB 2VOTA 5EOQH 4XNMA 4JRWA 1A1OA 3FO1A 2EKSA 4LK4A 5F89B 1S9XB 2GTZB 2ZG3A 1HH9B 1CLZL 2IH1B 2F8OA 3DSFL 3CFKB 4B0MM 5B22A 4IIQC 1MCDA 4P9ML 1ZXQA 2FBJH 5IVXA 2PYED 4EZMA 4LEOA 3F12B 2J5LB 3KJ6L 5KZCD 2OQJB 4GW4B 5IESH 1J8HA 3LB6C 3OJDA 1WEJH 3BH9A 5FF6B 3LN5B 4LSUH 1FPTH 3B9EA 1F2QA 4HIXH 3X11B 4GBXB 1R24B 3V4UL 5FGBC 4S0TD 3KLSA 4ZPVB 4LP4A 2EDTA 2R29H 1P4BH 5BRZA 4QHUB 5E08L 3BKMH 1OAZL 4AZ8A 4G9DB 1D9KC 4UIMB 4Q58C 1T21B 1CQKA 4QXGL 4LSTL 2R2CA 4KPHH 5F9JB 2ICCA 3WS6C 4F7EB 1F4WL 2VL5A 1L6XA 5DRZA 4FG6C 5IMLA 1RU9L 1LNUB 1VSCA 1AR1D 4F3FB 4LVHC 3C8KA 1J12A 4OIIH 3TBVB 1NCCL 5F9OL 2AVGA 4TVSa 4BKLB 4KK6C 2VAJA 5HVGB 3U83A 4MAYA 2VITA 4ZTPL 3ZKMD 2W9LA 4DOHE 3GBML 3NFPB 4NRZB 2H26B 3AU1B 2V5SA 4R0LB 4KFZC 4LCWB 2A0LC 3RVWC 1IGCH 5I76A 3LN4A 3I6GA 4NZRL 4S1RH 3TIDA 5KS9F 4OFPA 4K7FB 4S1DD 1X5AA 4G80B 3T2QA 2VDQH 1JPFB 3GBLA 4AG4L 4JFDA 4X9FA 3CLFL 4YDLC 3O4LD 3J8F7 1KCRL 1FNEB 2EE6A 2GYSA 3QPXL 4GW5A 2VAAB 2IFFL 2VDLL 4JQXA 1CN4A 3MREB 2B1AH 5GJTH 4E42A 1C16B 3EJJX 3HR6A 3BP6A 1J0HA 1RHHA 1P7KB 5DJZB 3TP4A 5JXAL 5CEZD 4PB9H 3TBTA 4HC1L 2ATKA 3CFIC 3TFKC 1LEGA 4YHNA 2C4XA 2YHGA 4HPOL 5HVHC 5GS1B 1QNZH 5AWNH 1PFCA 5D4QA 3C6SA 4NQXB 1BVKA 5DUMH 1FGVH 1K5NA 1N59B 3HLAA 5JDSA 3GBNH 1FNAA 4OCNC 3FQNB 5JW3L 2C9AA 4LASL 3U9UB 4JREC 4RMTA 2GSIA 3CZJA 1GGIL 4XGZB 3RWEA 5T5FL 4NWUH 1JYVA 4G6JH 1MFBL 4KHTH 4YR6B 4CW1A 3EYOB 4YLQT 2DL9A 5I30L 1NC2A 3O2DH 4GMTL 1R0AH 3OX8A 2YA1A 1F4XH 5AYUL 5C09B 2MQCA 4EI5B 3QQ4A 5C0FA 3EOTH 3VD5A 5HHQB 4Y0GA 3RWJA 3D0LA 1NFDA 4DN4H 1Q94A 2Z31C 1JRHL 1QFHA 1V3JA 2L7JA 4MS8C 4LRNL 3NN8A 5HYJA 1JTOA 4HKBA 1P4IH 4FTVE 1KB5L 2AS5M 4PG2C 4R4BB 1QLRB 1S7XB 3UC0L 3PWPA 1KPVA 5IK3A 4BSVB 4TNWF 1UWXH 2E5EA 1BHGA 1RUPL 4ZD3L 1BGXL 5B39B 3V6ZB 5EIIA 3JWDH 2QLVB 5HHOB 1KLGB 3RZCC 4OIAA 2CLVB 2M2DA 1F3DH 1FZMB 4P5TD 3S36H 1OCWL 4HGWA 2MHAB 1JZ8A 1IARB 1NCAH 3HZVA 3NCMA 4KI5D 4NBZB 2FEEL 1NCTA 3MJ6A 4JFQA 4NKMA 1ZHBA 4YIQA 3MA7A 2DI9A 2A6DA 4PRIA 3DMMC 1JPGA 4WI2A 5ANMB 3SGJA 2R2HA 4PLOB 1TTUA 1BZ7A 4WO4A 3VGFA 4DEPB 3WNKA 4QRRA 3MLPA 4DAGH 2XZQL 4OCYH 3JV0A 3FCTB 1D5IL 1KJMA 4AL8L 2PW2A 2X40A 1FFQA 4NPYA 3HE6C 4YO0A 3MODH 3IU3B 4G7VH 1CXKA 3C2AL 4D8PB 2IADB 2X9XA 2FEDD 1FSKC 4PJDA 4OCMC 5CLTA 4Y19D 1FL5B 1HH6A 1AGFB 2ORBH 4QKXB 4GFTB 3UO1H 2AABL 2JCCE 1T7VA 2FGWH 3CSPA 3FO2B 5GGQL 1U91B 1CFQA 5IOPB 4NQEB 1D3CA 4P99A 2CK0H 1XR8A 2WK2A 2ITCA 5CKAA 5CP3H 4BZ1L 2GK2A 5GHWH 1T5XB 3RIFF 4CVUA 3RKDC 3ZYZA 2IPKA 3LZFH 1K6QH 1QR4A 5SWSD 5D7IB 1YJDL 5I17B 4MCYB 1HYRC 3MJ9A 3TA3D 4ELKA 4R97C 5HY9B 5KW9H 1RVFL 2LU7A 4TUKH 5ESAB 3PHSA 3FRUB 5L2KE 4K3GA 3QHFL 2DS4A 4XNYL 4UDUA 3ARFD 4FQIL 1J05A 1DQQB 4P5MA 3QWQB 2VQ1B 5LGHL 2XNAB 4OZ4B 4P2QE 4WU7A 4HUVB 1FFPB 4JFFB 2IBBA 1QKZL 3X3GH 3TVMA 5IBLD 5D96C 4OI8A 5DD1H 4ZS7L 4XPGH 4EQ2A 1KYOK 8CGTA 5KOVC 3IAGC 4GS7B 3ARDC 3MLVH 5DUBA 1RUKH 1FJ1A 5GISH 2JIXD 3CH1A 4R4FH 3QCTH 2I5YL 3V6FA 1W72A 2RBLA 3O3EB 2MFNA 4ZUVB 4K8RD 4CVZB 4Z7WA 2PN5A 3IFPA 1U3ZA 4G8IA 2LFGA 3FT3A 3HNSH 1NEZB 1IGML 5F1IB 5T1MA 2APVA 1A0QH 3KWWB 3FN9A 1DFBH 5EPMB 3DX9B 1J0KA 3CLEH 1OF2B 3MXWH 3PXJA 3UBXI 3MROB 2X4RB 2FL5B 3K4DA 2YPVH 4HF5H 4K3EL 3JV4A 1C08B 4RAVB 4R96A 4MJ5B 2VXQL 3EHBC 1RJLA 4ZS6D 2BCKB 5IROC 3UTSE 3VWJB 4ZFGH 5DJ0B 1ZHLA 5IQ7L 1UWGL 5DRXA 5HGDA 2P7TB 4NUJA 1GHFL 3UBXA 1F00I 3WXVH 5FGSA 5T1KB 4X6CF 4IMKC 3Q6GH 1KSRA 2APXA 4XRCA 5ADOH 4OLWL 3RTQB 1U8KA 4KKNA 2C3XA 5L6YH 4UT9H 4NO2B 4LLUB 3O9WA 3GMOB 4BSJA 1NCWH 1U6AH 3M17B 5GJSH 3LOWA 3HS0B 4M7KL 1YYLL 2XTJC 2Q7NA 2ZSWB 3K3QA 3MRHA 4KXZI 4JRXB 2Z4QA 4M6MH 3QIWA 3QUML 3JWOC 1GRWA 4NZDA 5F88A 5C7XL 3G6JF 3ZSTA 5D2LF 4WUUD 4ZSOB 4TVPL 3QXAB 3S37H 4JB9H 4AIZB 4OQTL 5GS0D 1KCUL 2ATPA 4NZTL 1U8LA 4WJ5A 4KRNA 2DM3A 5BV7L 4M5YH 4U6HB 3QQ9D 4F2MA 5K9QG 1VEOA 3MGTA 4QOKB 3LS5H 1YY8A 4NQDD 3V5DA 4Z5RA 3Q1SH 2XACC 4ODBD 1OQOA 4K2UL 1HXYB 1JF6A 1KV3A 2NTSP 3O2VH 4R6UA 3IU4L 2EDKA 4GLRI 3MLSH 4JQIL 1D5ZA 1KEML 4L29B 2OXGA 3FN3A 1BD2B 2EDLA 3MLUH 4HIJA 2BY1A 5K9OA 4Y88A 5IW1A 2F53E 4XNUH 4XMPH 4PGDB 1A4KA 3VFSA 5HJ3B 2E9WA 1XGRB 1LE9B 1JF1B 4ZQKA 1EXUB 3IF1A 5C0CB 5EC1A 4FABH 2ZJSH 5HBBA 3QIUA 3GUTB 1MEXH 2VSCA 5C0IA 4UU9B 5J6GA 4TTDC 2J88H 1HQ4A 1KJVA 5T1LB 3EOYG 5BS0D 4PYHA 4P23A 3OF6A 3T0EA 2BNRE 5F9DC 4G9FE 4XAWH 1QSED 4JHAL 4K07A 1T0MA 4HH8A 4FQXB 4ISVA 5ALCL 5CZVH 2MKLC 5E03A 5CJQL 4HUXB 4RGMC 5D1XB 2HT2C 3PGFH 4XWGH 4Z78B 3K74B 4O9HL 5F1KC 3B9KA 4P46A 1EUUA 4U3CA 4MXQD 5F6IB 4TQEH 1XR9B 3V0AC 3PHQA 2VLKE 5F7MC 3X12A 1AIFB 1SYSB 4R8WL 1A6VL 3NH7L 1IQDB 4LDEB 1DUYA 4NCC2 5IJVA 4KJPD 1NSNH 3IJYB 4X5LA 1TNMA 1E28B 2BNQA 4ETQB 2D31B 2DMKA 3P9MA 1KPRA 1A3LL 4JLRB 4XXCA 4KTEL 5CHNB 3ARGA 2QR0A 4XNMB 3MTRA 1A1OB 3FO1B 2EKSB 3BKCL 3OQ3B 4YHLL 3TBWB 1WWWX 2XWBA 1P53A 1JZ4A 3E6HB 2X4TB 2X4QA 4AEHL 4IOFC 5IVZA 4ONFH 4PGBB 4MJ6A 1MHPH 4MVBD 2A38A 5I74B 2EXYD 3MRBA 4PREA 5IVXB 1NL0L 4OZGF 4JDVB 5CGYD 3D5OF 1JNJA 2W0LA 4FFVC 4MZ3A 4DVRH 1B90A 1EEZA 4JANA 5DLML 4ORGB 3PIQA 1OAYL 3KPLA 1AR1C 4NJAH 1RJZA 4OD2B 3VFGL 1HNGA 4JKLA 4EN3B 1RAMA 2FWOB 1XCQA 3IDIA 4PJHF 2HLAB 4HLZG 4UIKL 4I2XA 4LF3A 2X42A 5IVNA 3BAEH 5BRZB 5FDYA 4I8DA 5J8OA 3ZKMC 2R0KL 3V0WL 3NTCL 4NO0A 3FQXA 2IANE 4X8XA 4L4JA 2O5ZL 3UPAA 4NGHH 3W0WE 4CJ1A 4S1DC 2DYPD 3VU2A 4F80A 4QXUL 1UWXK 4J3XA 4YGVB 4Y8AA 2JCCA 35C8L 5D1QD 4Z7UA 2F54E 5DRNA 1PKQA 3AREC 1A2YA 5GSVA 4Y2DA 3ARUA 1MY5A 1DE4A 3OKNA 4KWUA 3G6JE 5D2LE 2XQBL 4N68A 3LEYH 5D7JC 1A8JH 4XPHH 5KTEH 1F4AA 5C0BE 3LN4B 3I6GB 4JY5L 4F7PA 5HHXH 3N06B 1QVOA 2ILLA 3IXTB 4PJIF 3FO0H 1BWMA 4GAYA 4GAJH 4YE4L 4HWEL 3KLAA 4YHYB 4KXZH 4QHKI 1BFOA 4GW5B 5GGTA 5DUPL 1F4YL 3DOSA 4S1SL 4XCEA 4E42B 1QEWA 1I8MA 2FLBT 1NCDH 2CRMA 5TDNA 3AB0C 2A2QT 4LLMB 1QYGL 4Y1AD 2XFXA 3V6OE 2OR9L 4M7JH 1HIML 2OS7A 2EYRA 3D69A 3BIKB 2NX5B 3ZTNL 2ATKB 2KH2B 5I8EA 1B4JH 1H5BC 1IGJA 3QRFM 3WNLA 4WIQA 1T1ZA 2V5MA 3EO9L 3C6SB 3L5WA 4C58B 4PJXB 4GLRH 4Z7VA 3R06B 4B7IA 2WAHA 3BKJL 3CVHL 3IXAA 4IRJC 3AVEA 1PG7W 1FAKT 5HHME 3QWRD 1LD9A 1U2CA 1MCNA 12E8H 4P9HL 1SY6L 2X5PA 3P4LA 5DK0A 2AERT 3RWEB 2AK4A 4O5LL 2BK8A 3O8XA 3MGOB 5KAQF 3L9RA 4CW1B 2FSEA 5ABDE 1U3YA 4R4ND 3REVA 1T2QL 4Y5YC 3SO3B 5GRZA 3OX8B 4LEXH 1A6WH 3X13B 3VG9B 4G6FD 5C0FB 4Y4FA 4XNXL 4L1HA 5H37G 4LNVA 1OTUD 4APQB 4HG4J 3D0LB 2V7NA 3K80A 3MFFA 4C56E 1EZVX 3OPZH 4XWOC 4WW2F 4QTIL 5IB3B 3RUGF 4YK4C 4NBXB 1YUHA 2IPTL 2NPLX 3MV7D 4FZEL 3D3VD 3VDAA 1R5WB 1CIDA 3M07A 5I71C 5J11B 1KIRA 1KPVB 1M7DB 3SDCD 5F1NB 4NZUH 1JTTA 1T2JA 2EYTB 3WLBA 5EIIB 5TE7L 1LP9F 4CU7A 3TN0A 3QH3B 2OZ4L 1CF8H 4NQCE 4XP6H 3QA3B 4M1GH 2IMMA 4OZGE 2JB6B 3KPPA 4QRPE 3WN5C 4MXVF 3B8YA 1GGBH 4J3TA 3ULVL 4HGWB 3HZVB 1G7JB 3S5LA 3PL6B 2QKIB 2KUTA 4YIQB 1YMMA 3KJ4B 3MA7B 1A5FL 3LVEA 2A6DB 1HWGB 2P45B 3QDGE 2C1PB 2R2HB 2HKHL 4PJHE 4G3YL 1BZ7B 5JXEA 4NSKB 4JG1L 3QEQE 1MJ7L 1J0ZA 2X9WA 4NC0B 5KOMC 1B9ZA 5CCKH 5I1CL 5JOFB 2PW2B 1RZKL 4PJAA 4YO0B 5DD0L 5F3BB 1FO0B 4UT7H 5EU7E 1X3DA 1T7ZA 1NUGA 4QHMA 1V7NH 1NBVL 1J7VR 1VESA 4WI3A 1A14H 4OSUL 5ILTL 3VH8A 4DN3L 2OBGA 3S4SA 3IGAA 1FAIH 4BM7A 5EB9A 4WFGD 1EZVY 1L0XA 1GGYA 4PJFA 3TA3C 2VC2L 2L0DA 1VFMA 1CFQB 4HJGB 4ELMA 1HDMB 1J1PL 1XR8B 1WC7B 4JO3H 4PP1D 5E8DL 1QSVA 1E6OL 5ITFB 5DJ6B 1BEYL 2VDRL 3RGVA 1DQML 1EVTC 5D6DC 4NO3A 5ICYA 3VGBA 3TH4T 2IPKB 2VISA 3MRQA 2OXHA 4KAQH 1DBBH 3EAKA 3EYQD 4JFHD 3LHPH 5GGTH 3HMWH 1KXVC 4Y4KA 2NXZC 3U0WL 5MENE 4KRPD 4NHCH 2EC9U 3MOAL 1GC1H 4R90L 4UDUB 3OAZK 3O3DA 1WFNA 3RGHA 1RZFL 2GKIA 4P5MB 3SKNA 4Y5XA 3CDYA 1Q0XH 4WU7B 4MNGB 1XIWB 2PXYA 3TVMB 5FV1L 4S1QL 1VACA 3PQYA 2AJSH 2HT3D 3TZVB 2PO6B 3KYKL 3SDXA 2UWEA 4WV1C 1FJ1B 1FE8L 1AO7A 2BSRA 3T3PF 4M7ZC 1I8LA 1QO3A 2AV7B 3E1F1 3U4BH 3VXMB 1RIUH 3NGBB 4DWHA 1BIIA 4B7LA 3E3QE 1FV1A 1FNSH 3V6FB 3HZYA 4DGVH 2B0SH 1HE7A 5GRUH 3IFPB 4KZDL 2B20A 4TSAL 1DBMH 3QJFA 3BDXA 5T1MB 4CVXB 5FDWA 4TVPD 1HHGA 3RPIB 3ZTJH 2DTML 5C6WH 1KCLA 3E8UL 4XX1G 1P6AB 2HJLB 4A6YH 4HT1L 4UTAH 2AEPL 3C09B 4FMFA 1RUML 3SDDA 4ZUTA 3JV4B 2YEZB 1DQLH 3L3DA 2QADB 4OLUL 2WWMD 2Q6WA 4CMMA 5JHLL 4M5ZH 1RJLB 4D0DA 3C9NB 1WBYA 4H88L 1H3TA 3CXHK 3PP4L 4HHAA 2FJGA 3RUGE 4K3DL 1JI2A 5IW3A 3UBXB 1U92A 5DK2A 3O3BA 1T2XA 1CFTB 3V95A 4XC3L 2VR5A 5DGQA 3W11D 1U8KB 2ED7A 3K8LA 3MLYL 4AT6B 4JY4A 3FMGH 1SJHA 1LP9E 3QYCA 2BVPA 1YEJL 5MI0B 5SWZE 5CS7A 2DLFH 4L8DA 4PS4L 5EC2A 1B2WL 5DYOA 3NFSH 8FABB 4MXVE 1IBGH 5C2UB 3MRKB 1K4DB 3D2UB 5FUZH 5EUKA 4DOHB 3MRHB 2Z4QB 3T4YA 3GHEL 1RZIA 3QIWB 3P9WB 4FXKA 1ODAA 4DZBB 2BP3A 4F9LC 3QQNA 2C3VA 2YSSA 5GQBA 4ZTOL 3TH3T 3FFCA 3F58H 5C0BA 1AE6L 5JW4N 4YC2C 1MI5D 2GQHA 5EU6A 4WJ5B 3G6AA 5B21A 1NBYB 2YD4A 1VGEL 3AM8C 3QIBA 3MGTB 2X9YA 5IFJB 5DO2D 1KC5H 3V5DB 5LGJA 4Z5RB 5HYSB 1AQDB 4LSPL 3QUKA 4KI5F 3GSXA 1ZAGA 3BQUB 4K94H 4XCCH 5E2VL 3IDYB 4XPFH 1D5ZB 4H20H 1AD9B 3ESVF 2JJUA 1KEGH 3C6LB 4BQ9A 1G7HA 1HCFX 1KG0B 1UJ3A 1F4HA 3ZKND 2FHFA 5EZJA 2DMCA 4WDIB 4PJBA 4YHML 2YPLD 4J3VA 5JPNA 3IDXL 3X3FL 4PBXA 1NAML 4S2SB 3FO9B 4AJ0A 4ZOCA 5EC1B 1DSFL 1V3LA 3QFJD 4N1HB 3QIUB 4POZD 1A6ZB 3P11L 4U05A 5C0IB 5J6GB 4QNPF 1KJVB 1LQSR 3EBAA 4FFWD 2NY1C 4DTGL 4P23B 1NGQL 1A1NB 1U8NA 3VCLB 4Q9RL 1EERB 4PJEA 5M94B 4KJPC 4MD4A 1ZE3C 5CILH 5HVFB 4GG6A 1QBMH 4J8RA 4XP9L 3S36X 4ZAKA 5EOQL 3CX5K 3HMXA 4LIQL 2ADIA 5DDHA 2WW8A 5IVOA 1T1YA 3B9KB 4MD0B 4NQUA 4P46B 1JWMB 4QGTA 4ZFZA 3AC0A 3T3PE 1LO5A 4RISH 4C56A 3VGEA 4MVBC 1HKFA 2EXYC 1JUFA 1E4XI 1DUYB 1AGDB 3ALWA 1VFOA 3VWKA 3TESA 4DCQA 1WEJL 2E6QA 4FTVB 4DK3A 3GIVA 4LSUL 1KPRB 3I6KA 4HFUH 5I1IH 4HIXL 3EYFB 4GXUM 4F33B 4WWKA 4N0YH 1GJIA 2CGRL 4W4OA 2R29L 3WHE0 3OKEA 4LSSH 1P4BL 5J1AB 5BJTA 3ME0A 4ZFOB 1JZ2A 4H1LB 3TPKA 4PREB 3MRBB 2H41A 4X0KA 2DQGL 3QDAA 2VXTH 4ZDHB 4OUUA 4LGRB 4Q6IC 4OIIL 1RJZB 3VXRA 3WFCH 3GSOA 4M1CD 4BFBD 1G9NL 1QFUL 1UCBH 4RZCA 3WFZA 1VFBB 2QTEA 1HXMB 5HXMA 5FYKE 4ZFFB 1W8OA 3B6SA 5EUOA 2BNUB 3PGDB 2HTKC 1T22B 4S1RL 3HR5A 1IM9A 1AGCB 1FHGA 4NOFA 2JCCB 4JM2F 1J10A 4TULL 5D5MA 4GRLA 4WNQB 3AMLA 2B1AL 5GJTL 5CD3B 1DE4B 4PB0H 4PP2B 3PWVA 1F11B 3QCVL 3SQOH 1YQVH 3QNYB 4G8EA 4U1JA 3RX8A 1HILA 5CLWA 3BW9B 2KBGA 1NDMA 3AS3A 4X4MA 1QNZL 5AWNL 3LDBB 1I7ZA 2CRZA 2D7NA 1QLEH 3DRQA 5KSUB 4LDOB 4M43L 3ILPA 4X98A 5L2KB 4RMSA 5DUML 4KI5E 1FGVL 4GBXD 4QF1B 3H3BC 1QEWB 1YNTB 3GBNL 1UB6B 3MRFA 5E8NB 4I3GA 3SE8H 5TDNB 4ZUSA 3GJFA 4EEEA 4P2QB 2DAVA 2DDQH 3CFBB 1BBJA 2QQKL 3G5XA 1E4WH 3ULSB 5D2NA 2E7LA 1K2DA 4G6JL 1OW0A 4HX1B 4KHTL 3DGCR 5I8EB 4G6AC 3O2DL 3KHOA 4R4NC 1T1ZB 1MCBA 5GGRA 3ULVD 4JGMA 1F4XL 2DN7A 3EOTL 3P0VL 4Z7VB 4AENA 4PPTA 1MUJA 2P43B 3CPLB 3DJ9A 4DN4L 4QNPE 1LD9B 4EXKA 1RULH 5GZOD 3B43A 2ADJA 4X5XA 4FFYH 5DK0B 4JRYA 3TBYA 4LCWD 1P4IL 3L9RB 3TO2A 2XICA 1Z9MA 3REVB 4A6YB 5C0EB 5I66B 1M71A 2DIBA 2DI7A 3LRSA 2C4FT 3FL7A 3NIGF 2P5EA 3VRLF 1MCJA 3WXWL 4QLRA 4Y8DC 1JFQH 4Y4FB 1YJDC 2JKXA 4LRIC 2AEIT 3P0YH 4JE4B 2V7NB 3MFFB 4LCCB 2H2SD 4DUVA 4EXPX 1QPPA 3UTSB 2VR4A 4LOUD 4OJFH 4JO1L 3S36L 1YUHB 4NT6A 3S37X 3FB5A 3MR9A 1NCAL 5J12B 2B7DT 5DJAB 4MJIA 5M95B 1MH5A 3OXSA 4WI4A 3EJZC 4ZOAA 2A83B 3WEXA 3P3YA 3MJ7A 3N1PC 2VIRB 5D70H 1T5WB 3MRPA 4O51A 4P4KB 5EO0B 5IEHA 1N7ML 4DAGL 4OCYL 5DURB 5DZNA 1XH3A 3G08B 5SWZA 4I3SH 4NZJA 3IB4A 4A2LA 3H2WA 2ESVA 2X4SA 2W1NA 4YPGA 3ROOB 2IWGA 1T89A 2OTPA 5F96H 5FKAB 1MCQA 1OAUL 2ORBL 4KY1H 3QUYC 2FGWL 3A6BH 1CGXA 3EDDA 1OD7A 2WUBL 3SGKC 1CVRA 2CK0L 3HB3D 2W59A 2D03L 3R4DA 4WI6A 5C09D 4PP1C 1ZGLA 4EI5D 1LK2A 3D39E 2YKLH 3GSQA 5T3ZE 2J8UF 4HH9A 5I73B 3NBNA 5LXGH 2LAAA 2Y1VA 1K6QL 3LZFL 5E6IB 3UZEA 4TNWK 4BFEA 4ZO7A 1I7RA 1T03L 3GZKA 3S4SB 1AHWB 2RQ8A 5D7KE 1GAFH 3EYQC 5JQHC 4QEGA 3OHXA 1EJ6A 5KW9L 2K7QA 4TUKL 1WIUA 1UACH 3HKFA 1A6TA 4KRPC 1YQ2A 1Q9OA 5CMAA 3BPLB 1J88A 1BVLB 2EIBA 3ARBC 3G6DH 1G7LA 5JORB 1OSPH 2F53B 5E00A 2FX7H 2NTFA 4U1LA 3BX7C 5HHOD 3X3GL 4HGKC 5DD1L 4NNXA 1EMTH 4L8CA 3IFOB 1S7VB 3LV3B 1NLDH 2HT3C 3MLVL 1IM3A 1CGUA 5GISL 3NA9H 3SE4A 2VLMD 4R4FL 1X4ZA 3QCTL 5HD8D 4J4PD 3V9FA 5ACZB 2P8PA 2BNRB 1QFWI 1CDUA 4W70A 3IRPX 3GJFH 3IYLW 4G9FB 3PP3K 4Y5XB 3HNSL 1RZ7H 4WEBH 4DZ8A 4NN6C 1A0QL 2HLFD 2PXYB 2UYLA 5LCVH 1DFBL 2DWDB 2ARJQ 1VACB 3CLEL 3PQYB 4PLJD 3QXUA 5IR1A 1U3JA 3MXWL 3L5IA 5BV7C 2XWTA 1CI5A 2YPVL 4HF5L 5B4MC 4J3WA 2VLKB 1FV1B 2F74A 5JZ7D 3RIFK 3SDAA 5SV3A 4NKIL 5TPWH 2A73A 1H0DA 4NQED 1OLLA 3QJFB 2C26A 4LCIL 3WBDA 1HHGB 3C60B 2ZCLL 2D0GA 3TJHD 1QSFE 1NC4B 4WUKH 3HUJF 4UI2A 1TVHA 2NY2B 1F8TH 5EOCH 1GSMA 5ADOL 3SDDB 4ZUTB 5CJBA 1YDPB 2HTLC 3VRLE 5L6YL 3W11C 4BUHA 4MAUL 3DVNA 5FO9A 1MHEA 5GSRB 1DQJA 1T1XB 4KJWD 3W9EB 3BEWB 3RAJH 3WJLC 3ARRA 5GJSL 4HS8H 4EI6A 1R6VA 4JM4H 3F65A 4JFFD 5EN2B 4ZPTB 4JEGB 3AXLA 2Y5TB 5K93A 5IV2A 3VGAC 1XGQA 4LHUB 1OTSD 2YK1H 2IANB 3TCXA 3S37L 4JB9L 1EAJA 4LBEA 2BVPB 3S7GA 1FO0L 1YEDB 4L8DB 5EC2B 3W0WB 4OV5A 3UTTA 4HUNB 2IAMA 4O02H 2X1XR 4LAQH 1NLBH 3LS5L 5KVGL 4L8SB 5DO2C 3Q1SL 1F6LL 1OTTC 1PG7H 2F54B 3EO1A 2V7HA 3KGRA 5LG1A 1RZIB 4XPBL 3MLSL 2AJYH 1CZ8H 2YSSB 5D2LB 3GMQB 4RGNB 2AI0H 5D6CA 4O2CB 3MLUL 1VB9A 5C0BB 4AM0B 1AQKH 4X9HA 3ZKNC 3T0EC 4FXLA 4XNUL 4U6YA 2GY5A 5CJ5A 2J8UE 3RDTA 4KQ3L 3EJYD 1BBDL 3OKDB 3V7AG 1YPZA 3NCJH 3RL1A 2C7UA 5C92A 3VWJD 1ORSB 4FABL 4UQ3B 2ZJSL 1UA6L 4IRZH 1PQZB 1MEXL 4QRUA 1SYVA 2J88L 5ESQB 4POZC 1I1YB 5T1KD 3H0TA 1CGWA 2RFXB 4PY8J 1AKJD 4HPYH 4ZUUA 4D9RE 2BOBA 3RTQD 4XAWL 1CGSH 5EZJB 5F7FA 1PX3A 3TO4B 5CZVL 5JPNB 3MJ8B 3PGFL 3R1GL 4XWGL 5DK3A 3PE9A 4WFED 5L88H 5ID1B 4JN2A 1N6UA 4TQEL 3VI4F 1IFHH 1X5LA 5HHMB 4JRXD 1FFOA 1H3PH 2CMRL 4U6VL 3WFHA 2X1OA 4NRYB 4WFHE 4EDXA 4Q9BA 1NSNL 1WUNT 1I1RA 1EFXB 4WU5A 1BOYA 4MD4B 3CSGA 2VN7A 4PRAA 5GGVL 3RNKB 2OK0H 1AY1H 4P2OC 1IAKA 5C07A 1I1FB 4AY0A 4ZAKB 2LAGB 2V5YA 2EO1A 1MCRA 1B0RA 1T1YB 4X7DC 4KRLB 4QOKD 1AI1H 1S5IH 2P8LA 3F7YB 5FYLE 1MHPL 4C56B 1QFWH 2VZUA 1J0IA 3T0BA 5GZND 1GOGA 4XHJD 5FHAH 4L8BA 3P77B 1ITCA 1XF3B 4JR9H 1P4LB 3P30H 2YBRA 4D0BA 4R7DB 2GFBB 3O6KH 1Y0LA 1BD2D 1DUZA 4NFCA 1WVZA 4WWKB 4Y1AE 1RK0B 4QRSA 2M8XA 2C3HA 3BAEL 4M1CC 5HVWA 3HUJE 1RIVH 3U30C 4JKPH 5SX4I 5FA4A 5C0CD 4NQCB 4X6EA 2DKSA 1MFDH 3P4MB 2F5AH 4OLZH 3L3JB 4NGHL 5T1LD 2AEWA 4OUUB 4U3HA 3VE0A 1N4XH 1YY9D 4X9IA 2BMKA 3CZFA 1B0GB 3INUL 4HIEB 4P9HC 5BOPA 4ZYKA 1JIBA 3VXRB 4UV4H 3BGFC 2XKUA 3QDGB 4MQ7A 3DI2B 4PJHB 2EKJA 4FQXD 2ZG2A 3UPCA 4HW6A 4RZCB 3DUUA 2B2XH 1U8PB 5FYKH 1UH3A 1IC7H 5D1XD 2YXMA 3PXHA 4QXTB 5ESVA 2OTWB 1REIA 4M9OA 3LEYL 4HS3B 1TZHA 5KTEL 1SEBA 4R2GB 3GSRB 2OTUA 4DQOH 1NPUA 3FO0L 4RMVA 5F7WC 4OZHA 4PG9B 4QYOB 3L7FA 2ITDB 4YDVA 3OJ2C 5IQ9B 5HI3C 2IF7A 5INCB 5D5MB 4XP5H 4MA7L 5T5NF 4P2RE 3FOMA 4GBXC 4YWGH 4NC1C 3PWVB 5IMMA 1PLGH 4PFEA 5FM4A 5K9QI 1KLFA 2ID5A 3P4OB 4M7JL 3K1KC 1ZLUK 5DHVA 4IS6B 3DUSB 1A9BA 4A2MA 4LLWB 4F9PA 3FHAA 4FFZH 3WNNA 3O8XC 1B4JL 5CBAB 5KSAB 3ULVC 2CDGA 2OMBA 2ZUQB 2DKMA 3ILPB 5MENB 3DETD 4X98B 4N5ED 4OM0H 1MJJA 4EN3D 1A6AA 1RZ8A 4JPWH 3MRRB 4PJ8B 5KG9B 5JIPA 3BZFB 4ZUSB 2PTTA 3HC3H 4MSWA 3GJFB 4HCRH 5BRZD 1D6EB 5A40E 4HXBH 2EE2A 3I6LE 3I9GH 4WWID 4CNIA 4YDKH 1JMXA 4LVOB 4IRSA 1A7BA 4JZJC 4AIOA 3ULUF 1RZKC 3ET9F 1MLBA 4MCZB 5JW4Q 1IGIL 5GGRB 1BFVL 4LEXL 4P3DA 3UX9B 1MUJB 1U8HA 3GMPB 4N9OB 4MAYD 3VI4E 3EO0A 3TN0C 3OMZA 4YBQD 2ADJB 5EO1B 1UKQA 3KPSA 4JRYB 3MC0A 1DLHA 3FQUA 3MMEB 4GUPB 3BXNB 4HUWA 5EU3A 3MZGB 5E8PB 43CAB 3HG1A 2H8PB 4DK6A 2VDOH 3QRGH 3VJ6B 3ESUF 2R1XB 1NGYA 3LRSB 4G7YH 5IP4A 4MJ4A 4NZUL 1U58B 1HZHH 5IF0B 1KB9K 3UTQB 1DVFA 4UMGA 4ZFOL 4MQTB 5GS1C 2DI8A 1BX2A 1CF8L 3ALPA 5HYEA 4MA8H 1XF2A 4M1GL 4WW2B 1GGBL 3ZT6A 3GKWH 3IAPA 3MR9B 1IL1A 4XNQA 3RPKA 2FJHA 2IPUG 1H8SA 3CXHJ 5K9KA 3MRNB 1OPGH 4JFZH 3VFMA 5FO8B 4X80H 4GOSA 5K59F 3UTZA 4HULB 1U8QA 1S7TB 2DLGA 2NX5D 3WEXB 1QR1B 2HN7B 4KROB 4GG8B 1S5HA 1UEMA 4UUJA 3MRPB 1SM3H 2D9QB 3CVIH 1LP9B 1XH3B 4I1NB 3HB3C 4BK4A 5I0DA 3QQ3B 5SWZB 5EZLA 3HRZA 2BHZA 1OD9A 4EI5C 4UT7L 1MY7A 2ESVB 2JB5H 4UV7H 4MD5B 3RWCB 1CE1H 1FZOB 2CO6B 4JFEE 4XHQA 3T2PA 5C9KA 1SJEB 2PUQT 1FAIL 5D9SA 4PJ9B 5I18H 1CT8A 5SX4H 5KJRH 4BYHA 2QHLA 4HAGA 1OGTA 1HHJA 1G1YA 4KMQA 1OP3K 3ECBA 3CMOH 5F3HA 5T3ZH 5LWYH 2VZ3A 1INQB 1LK2B 1JN6A 2AGJH 1ZT4A 2ZCHL 1A9EA 2EXWD 4JPIA 4APQD 4POYA 1NGWA 2GW5A 1IC1A 3QI9A 2VR9A 5C9JB 4YHPA 1KIPB 2VNCA 2PYFB 4KAQL 2OLDA 3PABB 1DBBL 4NN7C 3DIFB 1NANI 3O81A 2FD6H 3LHPL 4XAKD 2NY7H 3HMWL 3OHXB 3QUZA 4LQFH 3BMVA 4X6DF 5I1JH 4D2NA 1PGRB 4NHCL 5FUCE 1RV6X 4GW1A 2ENSA 4X7FC 4J4PC 3H9ZA 4UB0L 1JV5A 4J1UB 4E9LA 3DO7B 4TUJA 1IAOA 4BQ6A 3B3IB 5D1ZA 2NY6C 1S9WA 5DHVH 2NTFB 5E1HB 4DEPC 4NNXB 2AJSL 2AJZA 3B2VL 2Y7QA 4PLJC 1S9VA 2RB8A 3U4BL 5JQ6H 3PL6D 5CSZA 5DA4A 1RIUL 4NQVA 2GJ6E 1FNSL 4GKNB 4OZIF 1IJ9A 4I0PB 5ELIA 1P69B 5C0RH 1HKLH 2P8PB 5JZ7C 3ZKQD 1Z3GH 3DXAA 4TSCH 2VB5A 4M03A 3ORJA 4QRRD 3HI6H 3EDFA 3AS0A 3RX5A 2UYLB 4IMLA 5DSCA 3T2NH 1EO8L 2OSLA 5IR1B 3DURB 4A6YL 4PGEA 1NCBH 3ULUE 2R1YA 3CX5J 4UTAL 2XWTB 3T4AB 5TDOA 2MNUA 1DQLL 1CDCA 2YRLA 3K4AA 5IB1A 5SV4A 2F74B 5BMFL 3SDAB 1DBAH 1U42A 1BF2A 2W9DH 4M5ZL 2A73B 2JJSC 4MDJA 1IQWH 2I25N 3MV9E 3RVUD 1H0DB 3C5ZC 2AJUL 3UTPD 2NY4C 4H5SA 1VENA 2NXYB 2VYRE 3F7VA 1FH5L 2FECL 1ADQH 2YUVA 3CK0H 3KPMB 3GI9H 4X4XB 3AY4A 5DMIH 2EDQA 4N90E 5B8CC 4O00A 4J6RH 4I77H 2WLYA 3LKQA 1HQRB 4Y5VA 4GS7C 1OQXA 3FMGL 4PRNA 1FIGH 4G8GA 3QWOB 3QFJE 1DQJB 1I1AC 3NFSL 4TRPH 1RUQL 4IIQA 5FUZL 1BLNA 4PRHA 5CP7A 2ZUTA 2ZPKH 4LGPB 2IQ9L 2DQTH 5MEPA 1XIWD 3TVMD 3AXLB 1NQBA 3CNKA 3RVTC 3C5JA 3HI5L 4XVTL 5E7FA 2PO6D 3TZVD 4AIXA 5KN5A 2X2YA 2NY3B 1ZOXA 3F58L 4D94A 5J1SC 5FGBA 2JJWA 3VXMD 7FABH 2F19H 4XNZB 1WFOA 4OV5B 1T3FB 2VLJA 5IT2H 4JFOB 4W6WB 4HZLA 1D9KA 3SJVA 4LLVB 2NW3A 2B8OT 3EJYC 1KC5L 5EWIL 3WS6A 4OLXH 4RDQG 3V5HB 3VWJC 4MNQA 2ZUVA 4K94L 3PDGA 5E8EB 5E5UB 3UJTH 4XCCL 3ZHLA 1CL7I 4XPFL 3CXDH 3N1QC 4H20L 5D6CB 1KEGL 5CINH 5DJYB 3D18B 1OGAA 4HLZH 2QADD 2ZG1A 3BVNB 1JPSH 3RDTB 3O4OB 1YPZB 2B5IC 4QXWA 3EUUA 3O11B 3N85H 1I75A 2VRAA 4IBLT 1BQLH 5K9JH 4OV6F 1RK1B 1YNKL 5GGUA 5EFIB 4X6DE 1TFHA 3BP7B 4RX4D 5FOJA 1G9NC 1KJ3H 2D4FA 4ZUUB 4AK1A 3JBG7 3BDYH 1N5AB 5CILL 4L4VA 1QBML 4OLVH 5GRWA 4DW2L 3V4PH 5E2TH 5J9PA 2EC9T 4YH6A 1L6ZA 4IHOA 4JN2B 1A47A 3MACH 3D2UD 5KSVA 1AGBA 3GRWA 15C8H 1NDGA 2JE8A 4PBVC 5ICZA 4N8CL 3QIWD 1T0NA 4JHBA 3WFHB 4CDGC 5FB8B 4OZIE 3M8OH 3ELAT 4XHJC 1FL3A 3GIZL 1I4FA 1CICA 2Z91B 4PGZA 5FYJH 1I3UA 4HFUL 5I1IL 2W91A 3EDEA 4AH2B 1IKFH 4PJGF 3NAAL 4TSBL 2NW2A 4N0YL 4LLQA 3EOAA 1KT2B 2MWCA 4LSSL 1B0RB 2YXFA 3SPVB 3RL2A 1IILE 2EEBA 2P8LB 5DS8B 3K8KA 5FYLH 1X5ZA 5EULV 4WEMB 1UM5H 4LLDA 3BQUD 2PTUA 3BT2H 2VXTL 4UNVA 3C6LD 4OM1L 2MKWA 1H15A 4I4WA 1DUZB 5DJCA 3WFCL 2Z31A 1QLFB 1FC2D 5A2IH 2IH3B 3QJHB 3U0TA 2EZ0C 4Z7NF 1UCBL 5FFLA 4FQXC 3E0GA 4KJQD 3T0DA 4PJ5E 4KKLD 2XN9A 2Y07H 1H3VA 4PG2A 3BYYA 3QIUD 4YAQA 5IFAH 4N9GB 2VDPH 1UC6A 1CFVH 2X4UA 5LBSH 2NZIA 5BOZG 3PF2A 4HIIB 4P23D 4TUOB 3M1BA 1ZVSA 2D3VA 3P40A 3WIFA 2I60H 3RZCA 4ZYKB 1FVDB 5FA3A 2YZ8A 3Q6FA 4G8FA 2Q1EA 1D6VH 4D0CB 3LPFA 1U8IA 3KLHD 5FKPA 1A4JB 4FQLL 4NNPL 4NN5C 1GVIA 3EFFA 3REWA 3SQOL 3H9YA 4N0UA 1ED3A 3D39B 3B9KD 4P46D 3F7QA 3DMMA 1SEBB 5EBMA 2OTUB 4F58H 2QEJA 3FQRA 4PJ7E 1BQHG 1CD9B 3WS3B 4KHXH 1A7RH 4JM2B 3CC5A 2CKBH 1ZSDA 3HE6A 2X10A 2D7OA 5JLZB 5DZOA 5GIRA 1N5YL 3MLXL 1VKXA 1CG9B 4N5EC 4EN3C 2XYCA 3SE8L 2GTWB 1R5IA 4UINH 4WRLA 1YEEL 3RI5K 1CXIA 1E4WL 4HUKB 3TBSB 4HZAA 5DHVB 3BH8B 1NGXB 3NZ8B 4XMLL 4JDZA 3BN9D 2CDGB 1KTLA 1GGUA 4L9LB 2X70A 5CBEA 1GH7A 3NCEB 1J1XH 2BVQA 2CIKB 4Z76B 2CSPA 1RULL 1ZLSH 4YHIA 5B3NA 3QG7H 3W2DH 3BEVB 1DEEB 3IVKB 5HDOA 4MA3A 1X4YA 1VCAA 4JN1L 3UDWC 4KKAD 1MVFA 1I9JH 1MLBB 2H32A 1RJYB 1DTUA 3I75B 2EE9A 2BHUA 3LQAC 5IKCA 1M7XA 4L3CA 2YD7A 2ZOLA 4IDLA 4NO5A 2J12B 1JFQL 2V5RA 2MPAH 3GRWH 1J9CT 5E9DA 3BPCB 4PRDA 1AGEA 3ARDA 4OJFL 3O6FB 1OT2A 4I0CC 1KXQE 4KTDH 1FDLL 5F1SA 4WY7H 1WGOA 5EU3B 1NUFA 1QSFB 5GGRY 3MOQA 4XPTH 1G7PA 3TYFB 3FOLB 3MUZ1 1YMHA 2X6MA 3MBEC 4PJGE 1L0QA 1G6RH 1U8JA 2R9HC 3DBXA 5D70L 5EG6C 1PY9A 3MRLA 5I1EH 1JCKA 2ADGA 4I48A 2WM0A 5L2KD 1Q0YH 5AZEH 1MJUH 1X6LA 4NFBA 3V0VA 1IL1B 5HI4C 2FX8L 4P2QD 5F96L 3ARTA 4ENED 4KY1L 3SBWC 5TE4H 3LKNB 4ESKA 1B3JA 3U2SA 3A6BL 4QTHA 1HEZA 3L3HA 4NQSB 5IROA 3QG6A 4UUJB 1ZLVH 4Z7NE 2OR8A 4B41A 3BZ4A 5CAYB 3WUZA 4RBPH 1EO7A 5SWQA 3SO3C 1UXSB 2JELH 2WINA 1S7UA 1K8DA 5I19L 3H9SA 2YKLL 1TIUA 3VG9C 4H8WC 4IMKA 4JDTH 3UEZA 1KIQA 4APQC 3STBA 4RFEA 3S34L 2J8OA 1AR2A 1DANU 2FIKA 3VA2C 4OLYH 4LQ1A 4OLEA 3O0RL 4KGJA 4U1NB 3HE7A 5C0AA 2PF6A 3LMJH 3ZL4H 1CT8B 1UACL 3U36B 3SE4C 1JHTB 3GSVA 2VZSA 1QZ1A 5J11C 5CJXC 5CKGA 5F3HB 3G6DL 1CK0H 4OI9A 4Y4FD 2J8UB 5HDLA 1IGTB 2FX7L 1A9EB 1XF1A 4JPIB 2CDFA 1NGWB 1XT5A 1EMTL 4YHPB 3UTSD 3PV6A 1KTRL 1JNNL 1NLDL 3PNWA 3MRGA 1IE5A 1G84A 5HI5D 3OWEA 4Y16C 3QUZB 5HHNA 5I6XB 3PL6C 3LEVH 3LRGA 4RAHA 4PR5B 4GW1B 1DN0B 2CDEB 3DRTA 1IAOB 2X4NB 4P4KD 1RZ7L 5EDXA 2LABA 5ENWA 4WEBL 1IEBA 3FKUS 1S9WB 4UQ2A 5DURD 1JYWA 2PCPA 3LQZA 3KXFA 4ZO6A 1TENA 1VERA 4RFOH 5IUSA 1FQ9C 2W60B 2Z0BA 4NQVB 4RGOH 4CMHB 1HINH 1MFCL 4KQ4H 1MELA 4BSWA 5TPWL 1QQDA 3DXAB 4NYLA 3FQWA 5I8CB 3OKKA 3OTTA 5J0BA 4P0DA 4IMLB 2I24N 2C1OA 3S35H 5CD5C 2O26U 3QDJE 3UYRH 1DQDH 2H32H 4PGEB 4WUKL 5DEFA 2R1YB 3DGGB 5IVXF 1FYHB 4NM8H 4KMTH 5DFVD 3EIFA 1F8TL 5E6ID 1EGJA 3VFPB 3W82A 4LVNB 4QHLA 3T77A 2P5WA 3NCFB 5IMOB 2OL3A 3QO0B 4UDTB 1LMKA 1U3HB 5JOPD 5GGSB 3RAJL 2BVEA 2FDBP 2PR4H 4HS8L 2Q3AA 4XMKH 1YZZA 5AUMB 1FG9C 3S9DB 1ZHKA 2IAMC 3OR7A 1UGNA 2F53D 3EYSH 3U48A 3BISA 5TQ2H 2E7CA 3VXSE 1XIWC 1OSZA 1R3JB 4F7TB 1K8IB 2YUZA 2J6EA 1MFEH 4Y5VB 3TZVC 3VI3E 4IJ3C 4V1DE 1CD8A 1F02I 3QXTA 3VFOA 2HKFH 1JGEA 1GOFA 3NGBC 1MHHA 4O02L 2R4SL 2BSTA 1NLBL 2BNRD 1NFIA 4G9FD 3MUGB 1BLNB 5IM7A 3VW3H 3WFBH 1P7QB 2PXYD 4CKVX 2YS4A 3C5JB 1MPAL 5F7EH 1A7OH 1UADC 3EYUL 3PQYD 5LAXB 5IWLC 2E27H 2AJYL 5J89A 2JTDA 1U36A 3V8OA 1DBJH 5CSGA 1FN4B 5DA0B 1X5HA 3GHBH 3QDME 1A7PH 5GS2H 4WHCA 2VLKD 4PTUB 5IEKA 5B39G 2QADC 3BRFA 4JVWA 3LY6A 5I16A 1EHAA 2CKBB 1FCGA 2W0FB 1VFAB 1Z2KA 4IRZL 3C60D 4MNQB 3BIAX 4P2RB 3RQ3A 3SKMA 3RWIB 5ISZE 1NC4D 3NCYS 5DQJB 1OAKL 1I7UB 1V5JA 5DJDA 2Q8AH 2Z35B 4HPYL 3SKUD 1WZMA 4D3CH 3VFNA 3SDDD 4FXGB 3O4LA 4XH2A 2CLRA 2Y4SA 3JWOH 4JQVA 3VFVA 4NC2B 3VXPA 1JZ7A 5MI0C 2DQJH 1U8MA 1X5IA 1F3JA 5D7JA 2XKSA 3FQTA 1X5JA 2GK0A 5CEYA 1H3PL 2X4PA 1KJ2A 4ZUWB 1O7SA 4LHUD 4YDLB 1IGFH 1X5XA 3KPRA 4JPVL 2MJWA 2IAND 1FC1A 3KS0J 4LLYA 2OK0L 4H26B 4KTYA 3AROA 3N1GC 4M6OH 3W0WD 2B4CL 1NFDF 1JL8A 1SEQH 4IHOB 1RHFA 1AI1L 4HWBL 1OM3L 3U79A 2H6PB 2F54D 1NDGB 3BWAA 5ICZB 1H5BA 2BHYA 3HNVH 4DVBB 3B2UD 1T0NB 3OB0H 4W6XB 3SQBA 2K1MA 5DMKA 5FHAL 5C6TH 3GMRA 4WI5A 3BGMB 4JR9L 1FL3B 3P30L 5DQ9A 3IDYC 1D5MA 4RGND 1F6FB 4BH8A 3O6KL 3VXUE 5C0BD 4DGIH 2NMSA 4IRJA 4OB5H 3STLB 1G6RB 1I8IA 4OF7A 1O7VA 2IMNA 4U6XA 5IVXE 5DZLA 5C0JA 4JKPL 1KCSH 2COQA 1J8HE 2OL3H 4LLDB 3I3DA 3WUWB 3L5XL 5FGCE 3QEGH 2F5AL 4OLZL 3QUXB 4EUPG 4YDIH 5DR5H 4HKJA 4XB7A 4ZXBB 4YEFA 2RR3A 1N4XL 4LARH 4WW1B 1TJGH 3IJSA 5BRZE 2V2WA 2OX5A 5C6PB 2JK5A 3MRCB 2Z31B 3O45A 1NEZG 3TO4D 3BUTA 2SEBB 3U0TB 5JMRA 2X89A 2B2XL 5FYKL 1EVUA 1AXTH 2BRRH 1IC7L 1I3RA 3MLWL 3GO1H 2J6EH 2W9EL 3FT4A 4RWYH 5IB4B 3KLHC 3WO3B 3ARQA 4PJDF 3DUHA 1JBJA 4WTWA 4GRMB 3WE6B 1R3LA 4LHQB 4YXKH 5FO7A 2A74A 5L0QC 5HHMD 1J18A 2Y25A 4G6MH 4WGWB 4Z0BH 3L7EA 4JFEB 3BJLA 1A7NH 1QG3A 4CUCA 5BVJA 3KYNB 3MUHL 1PBYA 2DKUA 1EFXD 3CDCA 2IALA 4ODXB 4G8FB 1JNHB 5AG8A 2EEAA 2V6HA 4F7MA 3WN5A 1U8IB 4BELD 1TCMA 4ZAKD 3H42H 3NPZB 1PLGL 3MRDA 4MXWH 4NNYB 4N0UB 2X05A 4LPXA 3ZKSD 5DJ2B 1JGDB 3I02B 1MCWW 3DMMB 3DTXA 4HBCL 4YZFF 2EDNA 1WF5A 2YD5A 3OB8A 4JFDE 3IDNA 3P4NA 4L3EA 4C56D 5GXBB 3DVGB 2FYYB 4FFZL 4FQ2H 1FRGH 2D7PA 1ZLVK 3P9LB 3VWKD 2AJVL 2CD0A 2AK1L 4RBPK 5KSBA 3CC5B 5FECA 1FL6A 3HE6B 2FO4A 1I3GH 2MCPH 2GUOA 4JKWA 4NHUB 4OM0L 2A6JA 4WWKD 4JPWL 3HC3L 4Q2ZB 4HCRL 4OFIA 2A6IA 4IOSD 3ZSSA 5SWSA 1R5IB 4HXBL 4XP4H 3U0PB 5GRJH 3TA3A 2Q86A 1NMCC 1KELH 4NQCD 3S3PA 3BPOC 4NP4L 2WBJB 5D71L 3ARFA 2DQFA 4Z7WF 5HGAB 1KTLB 2GJ6B 4IDJH 4XXDB 4ZOBA 1S78D 1SJXA 2X70B 3MV01 2E7BA 3WHE1 1G0YR 3VXRD 2WMPA 3QDGD 5DXWA 2GCYA 5KVFH 1PVHA 5J6HA 4YHIB 1MVUB 1NGZB 4MA3B 2ZUUA 4JFYA 4R3SB 4XCYB 1BPVA 2JIXA 1MWAA 2W65A 1MCHA 5FHBH 1XF4A 2VDOL 2H32B 4R2GD 1LEKB 2AQ3A 3THMH 2HJFA 1HYSD 5L8LB 4G7YL 4L3CB 3QDHA 3QZWB 1B4RA 1NFDE 4N0RA 3OBAA 4HFWA 4N8VB 3MV9B 5E9DB 3UJIH 4ONOA 4PRDB 5I15H 3ARDB 4G43A 5IHZB 5F7UA 5HYJE 4WV1A 5D7SH 3VFWA 4KUZL 3MBXH 3PWPE 3QSKB 3DV4A 1OPGL 2F8VA 2O5YH 4Q0XH 4JFZL 4X80L 4EVNB 4ENEC 1YMHB 4KVCH 5F1OB 2VMFA 4O2FA 1U8JB 3ARYA 3MXVH 4RIRB 3PUCA 3DBXB 1AJ7H 1CXHA 1SBSH 5KSAD 1SM3L 3MRLB 3CVIL 4ONHB 1KUMA 3T1FB 2V2XA 5LKNA 1IVLA 2ADGB 5MEND 5HPMA 2QQLH 4GSDH 5F9WB 2OM5A 2JB5L 4UV7L 4PJ8D 3FTGB 3V0VB 4PRIE 1CE1L 4K8RL 1S7RA 1LO2L 4PY7A 4F57L 4OAWB 1QUNA 2APTA 3FB6A 5I18L 4QRRE 1A3QA 1EHNA 3FB7B 3FONB 3L3HB 1DQTA 5DFTA 3VFRA 5SWQB 3CMOL 5F6HJ 2WINB 5T3ZL 4OCWH 1R3KA 1CLYH 4PJDE 2IG2H 2AGJL 5DC4B 1T6VN 3SHSA 2X7LA 5D1ZC 2QL1A 4JO4L 5FUOH 2FHBA 2LU4A 4OKVA 1ZT1A 2NNAA 3HN3A 4WUUA 1UYWH 2ZSVA 1M4KA 2Z92A 4JRYD 3TF7C 5ISZA 5HI5C 3QXDA 3P73A 4LQFL 3UTPE 5I1JL 1RZJH 5J12C 3SKOB 3L3OA 4RQQB 4KDVA 4XP1H 3MJGX 5JUEH 2O61A 2G5RA 1BOGA 3PWJB 4NQDA 2FZ3A 2QHRH 4P4KC 4PTTA 1I8KA 4HKZB 4JVUA 5ICXB 4F9LA 1CLOH 4YZFE 2VLLA 1MFNA 4RA0C 1MLCB 5L7XH 2V2TB 4GH7B 4P59H 3CFEA 3MRGB 5H35A 1XEDA 1Z5LB 1K9TA 5JQ6L 3HZMA 1UXWB 3IKCB 5HHNB 1CGVA 5I8KH 4X6DB 3S88H 3AM8A 5C0RL 1HKLL 4GRWH 1CBVL 4KROD 4TSCL 4WHTB 5SX5H 4I3RH 3DRTB 4K55A 5JMOC 5ENWB 1F13A 2HVKA 3PJSA 5SWZD 4HGMA 5C0DB 3LQZB 3HPJA 5GPRA 2CIIA 5TE6H 5GS0L 2AJXL 3KXFB 1T1WA 4R26H 2ESVD 5BS0A 4E5XA 3MNZB 5ACMA 4DKEH 2C4FU 1JF5A 5E6IC 3AY4C 4PJCA 1QSEA 2Y36H 4Z7WE 4FQCL 1AHWC 4OZIB 4BSWB 1DBAL 2W9DL 2XTLA 4M4PA 4PJ9D 5F72S 4ODUA 2M1KA 1K4CA 4M1DH 1Z9SA 3TWCH 4NUGH 1T66C 5TDPA 3LKRA 1G9EA 3VXUA 2N56A 2EH7H 4X9GA 1C12A 4X7TB 2AQ2A 4XVUD 1ADQL 2VL4A 3CK0L 3LEXA 1TNNA 5E8OA 5TFSH 5IB5B 3GI9L 5DMIL 5C86A 3OAUH 1EH9A 4J6RL 4L4TA 3QULA 2G2RA 2C5DC 3O41A 3KPQA 4OF8A 3T77B 3AS1A 4JY6B 2OL3B 4RGMB 5I1AB 2P46B 1W2KT 2UZXB 4PBWD 1IC4H 2RGSA 1KFAH 4XBGA 1OAQL 1S7QB 25C8L 5DQDL 4M00A 1PZ5A 5MEOB 5DJ8A 4TRPL 1ZHKB 4NDMA 2HFEB 3MNVA 2DQTL 3QO1B 3EW3B 4HJ0D 1NJ9A 2AXFA 4ETYA 5I1KH 2H1PH 3OB0K 4JKKA 4X4YA 2OJEA 1OSZB 1Q9LA 4PJ5B 3VFTB 2FB4H 4OQ1A 2EICA 1UZ6F 3G04A 2HFGH 2XY1A 1UKTA 3G5ZA 5GGSY 1WCQA 1FZJA 5INDB 5AAWA 2GT9B 2C3WA 1JGEB 2JCCF 4HC1A 4I0PD 4Z7UF 4Z0XA 3DYOA 3I50H 5KANG 2YMXH 2GSGA 4OGAD 2R0LH 3JUYA 1T04B 3DX6A 3MO1A 3VFUB 3KPNA 4M6AA 4OLXL 5EH1A 4C83A 3O6MH 4GKZB 3ETBF 5MERA 3SCMC 3C60C 2DD8H 1UB5A 1AP2A 1MCFA 1G0XA 1MRDH 3JSSA 2VZTA 3CXDL 4Q6IA 2DYPA 3TJEH 5L2JB <