4N1CA

Structural evidence for antigen receptor evolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
107
structure length
107
Chain Sequence
DIQMTQSPSSLSASVGDRVTITCRASQDIASDLNWYQQKPGKAPKLLIYSDSYLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYYMIPSTFGQGTKVEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/hydrolase
molecule keywords immunoglobulin variable light chain domain
publication title Structural reconstruction of protein ancestry.
pubmed doi rcsb
source organism Homo sapiens
total genus 24
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4n1cA00
2C3VA 5TF1L 3SQOH 4NQDA 2Q6WB 3FTGA 4GAFB 4MD5B 5DHXB 1I9RH 3U0WH 5JXAH 2DDQH 2SEBA 3ARYA 2WBJA 3CNKA 4MA3B 5HHNA 3T0EC 3VMOA 3H0TB 1NEUA 1UQSB 8FABB 5TQ0H 4LF3A 4RFNB 4KHTL 3QUMH 3SO5A 5ALCL 4HXAL 4ODTL 4N90E 3M17B 2FGZA 1U95A 3STZB 2PW1A 2BSSA 3BXNA 3CH8A 1EAJA 3STLA 3VXQB 2YOCA 5C08A 5LGHL 3AU1B 4PGZA 1CBVL 4M62H 3KJ6L 5HDOA 4HX1A 4H1LB 5DJ6A 1I7ZA 4UBDC 4MQXC 3PIQB 5EU5B 1MFCL 2X1WL 3VRJA 1IKFH 3WDJA 3U7WH 1YEHL 4PYGA 2MKWA 3C8KB 2J8UB 1INQB 2EEAA 4CJ0A 2ATKA 5CBAB 2ZNWA 1N4XH 3TNNA 4BZYA 3O2WH 1JMZA 4M7LH 3C08H 5M7QA 1YPZA 3RKDC 4FQLH 1BECA 4KDTC 1A9EB 4U6HA 3QQ4B 4JHAH 3TA3B 3V0WH 2VSCA 5DEZA 5CILH 1PAMA 5DJDB 5FAAA 4OGAC 3CCHA 1RJLA 1EIBA 1QNZH 1D5IH 2ZNXA 5D7IF 3CFEA 2ERJB 2XFXA 3CXHK 4XPFL 3VGAC 1QHPA 4O51A 5IFJB 2AK4B 3TC9A 3OR6B 2FR4A 5ICXA 1FN4B 3MLZL 2ZCHH 4NKQB 3ULVL 5CGTA 4K94C 4RRPG 3MRHA 1I3RB 2FO4A 4K7FB 3TPKA 2FATL 4TUJB 5DMJB 4ZD3L 4HW6A 2GCYA 4EI6B 4EN3C 2MQ0A 3G04A 3BIAX 5T1DH 1LMKA 1EXUA 4TOYH 5BV7B 2QR0B 5D93C 1FO0B 5AWNL 4M6OL 3RZCA 4UIMB 3IF1A 3ZT5A 3T1FA 5IIEB 1C5CH 5JW4M 1BIIA 3PV7A 4JQIH 1KULA 1YEDB 3VGEA 4I3SL 4ZUSB 3MJ8A 4XB8A 2VLRE 2IBBA 1I1YA 3HZKB 4PJ7F 5GRUH 3JBG7 4Z76A 2YMXL 1QUNA 3P9WB 2KPNA 5AZ2H 3DECA 3HG1A 4Z7WB 3S3PA 3AS2A 3FOMA 3ZMRA 2H9GA 5SWSD 1K6QH 5F97E 1KTDA 2GTWA 5IMKB 5D7IE 4XNZC 4BQ9A 2C7UB 3L3IB 4M5ZL 3WLWC 5CEZL 3BGFB 1AI1L 4QOKD 1HN1A 1SEBB 5JHDB 3D0LA 1ZKAA 2VOTA 1QPPA 2J6EL 4KK9D 1HILA 1V8HA 2IG2L 3LPWA 1K5NB 5FHAH 1J0YA 5I76A 4NZRH 5IW1B 3SPVA 4OLZH 2Q87A 1J0ZA 4FXKA 3QIWA 1OTTD 4Y16A 3WUWA 3E8UH 4MNHA 3L5IA 3TBYB 4GRMB 3HE6B 4MNGE 1MH5A 4ODWB 1RURL 5MERA 1F3JA 4WFFE 3WIHH 4FQIH 4OT1L 3Q0HA 1J1XL 2BNQB 3IDNA 2WUBH 2VXVL 3QAZB 1KN4H 4XT1C 3EFDL 2W91A 1CK0H 3B9VA 1IGIH 4FMFA 4QHNA 1LEIB 3PL6C 4HT1H 1KEGL 2CIIA 2OI9C 4KKCC 3BKJH 4LRNL 1AXSA 1VESA 3NCEB 4DKEL 4DWHA 4JKPH 3C2AH 2ZOKA 4P9ML 5CLTA 1UACH 1G84A 1SEQL 4PJ7E 4GOSA 3JUYA 2EE6A 3WIFA 4P57B 4WFEE 3KYAA 3QHFH 4K7PY 1LK2A 3W0WA 2LAGB 4Y89A 3RY6A 2E6PA 5HPMA 5DYOB 4I5BA 1JF1A 4YGVA 3EYUH 3ZKND 4D0BA 4NGHH 1HXYB 4JANA 1HQRB 1VFOA 3LRSA 3MRIA 5TDOB 5E2WH 3WFHB 2QL1A 4OIBA 5IF0A 5HHOB 2ATPA 5IVZB 5TPWL 3C60C 4Y88A 4Z0BH 3QDGD 2VDPL 3O8XD 5EBLA 1MCNA 1FRGH 5DD1L 1LO2L 3WFEL 1YNKH 2X1PA 4XP1L 2BVQB 4PLKC 3KPSD 1QKZH 4L4VA 4BKLB 5IVXB 1N6QH 4ISVA 4KZEH 3RUGF 5DRZA 1U8HB 4OF8A 5B39B 4XCCL 2VO5A 3EYOA 1NJ9A 2ZG3A 3IDXL 3TH2T 3HCVA 5BRZE 3ALPA 5D1QA 5KSAA 1VGKB 3QG6B 1CFVL 3GNMH 4X5XB 5LGJA 4UT9H 1QFHA 2R29H 4U6VL 1ND0A 2F9BT 4OZIA 1S9YB 4JY6B 4I2XE 3G5ZB 1IEAA 3TH3T 4IMKA 8CGTA 2CUMA 3E6HB 5JXED 4WUUD 5CAYB 4X8JA 4G6KL 4AG4L 2FHCA 1NCTA 4ZS7L 3T1WA 1FL3B 3CZJA 4RFEB 4MJIB 4JDVA 4M7KL 5LQBH 4F37K 3UBXA 1CFBA 4K2UL 2AEPH 4YHMH 2VXQH 4S1DD 5AUMA 2VH5L 2BY1A 4P2QE 3MGTB 4DW2H 3GSNH 1YMMD 4PJGB 4KUZH 4U1NA 2WIMA 5DS8A 3GHEL 3DVNA 3MLWL 2Q8BL 4I3RL 2AGJL 4MHHI 4EDXB 1DQMH 1BZ9A 1ZT4A 3IDJA 2NY0C 5DMKB 3WJLC 3HKFA 3RKPA 5D70H 5JDSA 1UC6A 1XGQA 2VLJD 3F7RA 3NIDF 1J1OL 2X9WA 4FQHA 5I17B 4R7DA 3LMJL 4F2MA 2IMNA 4KK8D 2E3VA 1NCNA 2A9NL 4Q6IB 2IADA 1A3RH 5CKGA 5T1KA 4EXKA 5SWZA 2HFFA 3DVIA 1BF8A 1CFQA 4GAYA 3QFJB 4M6NL 2VE6B 4PIRF 1CF8L 4ZG1A 1UEMA 5C0RL 5TF1H 2UZIL 5I8EA 3SDXB 4IOFD 1UWXH 2Q1EA 1IEBB 3NCJL 2NY6D 2OL3B 4JG1L 4ZO6A 5C0JA 1KLGB 4WUKL 1L6XA 2VZSA 3T77B 1U8KB 1B0GA 2DM3A 3UO1L 4V1DA 4QCIB 3VD5A 5MI0C 4PP1D 2XY2A 5ALCH 4ZUUB 1NPUA 4G8IA 4HXAH 1K8IB 4Z7UF 4ODTH 4YK4B 1KG0A 4I77L 4QRPE 4Y19A 2DQJL 2DTML 5I1LA 3R06A 3H9HA 1I3GL 4UNTA 1JUFA 2GK0A 4UTBH 2XWTB 2XI9A 4HUUB 4S1QL 1RMFH 3OGCB 3RVXD 5C1MB 2B2XL 2AERT 5LGHH 5E94B 4UTAL 3DETC 2D7OA 5TDPA 4OZHA 3KJ6H 4OV5B 1TZGL 1T66C 3OSKA 4YWGL 1WEJL 4FN0A 5JPNB 2OJZL 1MFCH 3NIDE 4BK5A 3I3EA 1YEHH 2R2EB 2PO6C 3CLFH 1UH4A 1H9VA 1YUHA 5F1NB 3UTPD 2XY1A 2X4QA 4P0DA 3BH9B 3VD7A 5J13C 3T0DA 5EN2A 4YHIB 2VDOL 2VWEC 1UJ3B 4NP4L 1KENL 2LABA 3E3QC 4HHAA 2ZUVA 5D2NA 4P5TB 1DQTA 4KRPC 1EGJL 1FNAA 3MV9D 3CFKA 3QWOB 4NQCD 5D2LF 1NC4A 5GSVA 3SO3B 1XF1A 1ZLSL 1VFBB 4QRQB 4XPFH 4UU9B 4Z7UE 4OCNC 2B7DT 4WGVB 3SKMB 4GRLD 5JW4N 3MLZH 2YSSA 1XF4B 4MD0B 4ZYKB 4JM2D 3PWJB 4IRSA 2XA3A 1XF2A 1I1FA 2FATH 4AM0B 5E03A 1KT2A 4ZD3H 7CGTA 4ALAH 3VXPA 4JFQB 3GIZH 1CTOA 2NTFB 2ZG1A 1T1WA 3V4UL 1JFQL 1Z9LA 2BVUA 2XOTA 4YFDB 4OQTA 5AWNH 4M6OH 4KJQD 3TH4T 3VXUB 3K3QA 1I8KA 1OAZL 4LQFH 2MTPA 3MRCA 4AQOA 2BY2A 5IR1B 2OX5A 1MCPH 2PW2A 2WQRA 3P4OA 4I3SH 3PWNA 4TPRL 5LWYH 1QFPA 2EDDA 2I25N 1FZJB 2PF6A 1DN2A 3WFBL 5GGVY 2X1XR 1HINL 4EUPB 3RIFF 1Z2KA 3IFOB 2X4RA 3KLHC 1DUZA 1AD9A 2Z8VC 3UTOA 5HHQA 5DQJB 5HI4C 5JIPA 1HDMA 1QSFE 5TDNA 4P23C 1EA9C 4YIQA 1A1OA 1BQHB 1A6TA 3T8XB 3MNWB 4R7NB 3THML 2CSPA 1ULVA 2Q76A 3OR7A 5D2LE 3S36X 1PFCA 3KPNA 4M5ZH 4F7PB 1PW3A 1AI1H 4YBQC 1OB1B 1JRHL 2J6EH 4JVUA 2IG2H 2W65A 4PJXF 4TUKL 4XX1E 1XF3A 3D69A 3PXJA 3HE7D 5CGMA 4L9LA 1RY7B 3GMNA 4OI8A 5HY9A 1NAML 1TTGA 5DRWB 4ZSOA 5EZIL 1FAIL 1U2HA 3RWGB 1RURH 4Z7VA 4HAGA 2B5IC 2FIKB 3FQTA 4OT1H 5DFVC 2ICWJ 1J1XH 1HNGA 4QHMB 5INDA 2VXVH 4LCWE 3EFDH 2XN9B 2YRLA 3RIFK 2CK2A 1CL7L 2YD5A 5DSCB 4LLDB 1SYVB 1KEGH 4LRNH 3PQYB 2IAMD 5CWSA 2D7TL 2CO7B 5GGSA 5FA3B 4PB0L 4WO4D 1SEQH 3HB3D 4QXTB 1R5IA 1DN0A 3DX7B 4HAFA 1FYTD 1HHHA 4X9GA 1OGAE 4GH7B 3UTTE 4WTWA 4GS7C 1CFNB 1NLDL 4ZXBD 3MRJB 2QSVA 4H1LG 1C16A 1KFAL 4Y0GA 3O6FB 1LP9F 1MHPL 4JQVC 2X5PA 1HI6A 2DM2A 3VFUB 1VGEH 1MRCL 1FG2B 4GW5A 3MGOA 5L88L 1MJ7L 4OZFA 5D96B 3L5HA 4PJXE 5TPWH 2WP3O 2DRUA 4I18A 2VDPH 1NEZB 3REVA 3BWAB 4L4TB 5DUBB 1CQKA 1LO2H 4C4KT 1LE5A 5A16B 3ZT6A 3WFEH 4XP1H 5EUKA 3QIBB 4FZ8L 1TVDA 1JGLL 3S98A 3VXNA 1JGEA 1IM3B 2EDQA 4PJEF 5JNYA 3KWWA 1DCLA 2R1XB 2BNUB 3WNLA 3ULUD 1CDJA 4OCYL 4XCCH 1NL0H 1U93B 3F58L 3O6LL 3IDXH 3HLAB 2X7LB 4X7CC 1UADC 3KPRE 2DI8A 5D8JL 5SWSA 2KQMA 2VYRE 1CFVH 3I6LE 2P7TA 5M94B 1XH3B 1KPUA 1MCWM 4GKNA 5DI8B 4U6VH 1IC7L 1XGPA 1T7ZA 3QB7C 1R3KB 4QOKA 3W2DL 4YUEL 1OLLA 3QUZC 1NFKA 5J1AB 3LPFA 1I85C 5HHVL 2QKIB 1LDPL 4ENED 4KJPD 3QSKB 4UQ3B 4G7VL 1LP9E 4XHJD 4G6KH 4E9LA 4AG4H 4Y4HB 1OT2A 1SJXA 4ZS7H 3DX6B 1S7XA 5I8CB 1EPFA 4AT6A 1MNUH 2DQTL 4M7KH 3QI9C 1CLYL 5JW5B 3B2UD 1S9XA 1FFPA 4K2UH 2XA8L 3Q1SL 3G08B 3DTXA 4X6CF 1ZHBA 2VH5H 3H9ZA 3ARDB 3D25B 4RAVA 3ZKSD 5BZDB 4ZUTB 2PR4H 1AQKL 4GXVL 1ZGLM 2IBZX 3MLWH 2Q8BH 4I3RH 3UEZA 3LKRB 1IAKA 3M07A 2AGJH 4IEFB 4PJEE 1F4XL 2V9RA 4L8SA 3RY5A 3KPMB 3VFWB 1IGJA 3TFKC 1GJIA 2DQUL 1RFDL 4N8VB 3KHQA 1LGVA 1MJUL 4P59L 3SGKA 5IESH 2XNAA 3BO8B 1J1OH 4XP5L 5DDHA 4P48A 3LMJH 4WWKD 3DV4B 1F11B 1U8OB 4PTTB 2A9ML 2A9NH 1UB6A 4XMLL 4WW2A 5KS9A 2EZ0C 5KANI 4LSQL 4B7LA 1R3IL 5DTFB 4RMWA 5E24E 3WHXB 2CIKB 5CUSL 5FOBB 4M6NH 1WIPA 1CF8H 3U4EA 5C0RH 5HVHB 1VADA 2UZIH 2NXZC 3FB7B 3QQ3A 2KQNA 1KTRL 1ZEAL 3NACL 3OXSB 3NCJH 4JG1H 2NLJA 4WI3A 2FX7H 1TZIB 3O8XA 3GMRA 3QUYC 4WUKH 2W0PA 3KAAA 3MMEB 1U3JA 4MDIA 3GZKA 2IFGA 2IH1B 3OX8A 4UDUA 5HYSA 3PP4L 3UO1H 4RGMC 2UWEB 3KPSA 3ILQD 3OJDB 1Y6MR 3D0VA 3PWVA 1J7VR 4RA0C 3IB4A 3O4LB 4L9DA 3CPLB 5DJYA 3SKNA 4X6CE 4XBEL 4AH2A 5JHLH 4I77H 4L3AA 4Y4KC 5DJXB 2DQJH 2DTMH 4IMLA 1I3GH 3MRGB 5CP3H 1OLZA 4CN6A 4S1QH 2OJEB 3DX8A 4PY8I 5C0BD 2B2XH 5IB1A 4KMLB 5FO8B 3N1PC 5DMIL 4UTAH 4JN1H 1FSKB 3BUYB 1JE6A 5M95B 3R0MA 1G7HB 1TZGH 1U91B 1WWCA 4YWGH 3W9DB 4P46C 5FGBC 2OJZH 2CMRL 5SV4A 3VH8G 4L3CA 3OV6A 1CICB 1M71B 5JXEA 3OKMB 5HDQH 4LCCB 4Y5YB 4WUUA 4HCRH 1CXHA 4O02L 1L7TL 1ZS8A 2E9JA 2DB8A 3KPTA 4DN4L 2VDOH 4NRXB 3OG4B 5C0GA 4NP4H 3V6FB 4C59B 1KENH 5E9DD 4O2CA 3MX0A 1HXMB 2B39A 1Z9MA 1S7QA 3QUKB 1EGJH 3K2UL 4R0LC 1QSEA 4MYWB 2CUIA 4WEBL 4Y5VA 3PV6B 1UJTA 1FFNA 4NKOA 4JZNA 4FNLL 1QEWB 5DJ8A 1MLBA 1PZ5B 2ADJB 1ZLSH 3ROOB 5F93C 2X89A 3HRPA 4XVUC 4X4XB 5IGXL 5JIIA 3ARFA 2Z31B 4IS6A 1U8IA 4U0RB 5GS1C 1KACB 2VITB 3MBEC 1QR4A 4JZJC 3PJSA 3UJJL 1AIFB 4D9LH 3VFSA 3EGSB 5CZVL 4X6EA 5E8NA 4U4BA 5EU3A 3V4UH 1A6UL 1JFQH 4FFVD 1DANT 1BVZA 3PDOA 4NDMA 3LS4L 2JCCB 1OAZH 4OCSH 2DIAA 4QHKJ 4KH2A 1BBDL 4PJBA 3MRRA 3MNZB 1A1NB 3VJ6A 4TPRH 2VLKB 3O2DL 4JRXD 3PABB 3HPLA 5C09A 4N0UB 4X7EC 2CGRL 1I1AB 5F7HA 3MV7E 1TNNA 4PJ5B 1EV2E 1CQYA 4KK6C 4ODVL 1R3JA 3TBSA 3F8UB 2EIZA 1XGUA 3UAJD 4U1IA 5DK2A 5HYJD 5JUEH 5DHVA 2R23A 4JFXA 4MAYD 4GBXC 2P8PA 4LDLB 3THMH 4XH2B 1J8HB 2J1KA 4DKDC 2GJ6E 2Q7NA 5DD5L 4HK0B 1JRHH 1UXWA 3IYLW 4LKXA 4TUKH 5LGKA 1TCRB 4P4RB 1HQ4B 4C58B 1H8NA 1QO3A 2FSEB 2JE8A 1NGYA 5I1HL 4EDWL 4PRIE 1RJCA 1NAMH 4UT7L 2BERA 5EZIH 5J4MA 1FAIH 1S9VB 3RU8H 2W60A 3AVEA 3VCLA 4NYLA 5A43C 4M7LT 3MUY1 1NCDL 5CJOL 1XIWC 3KLDA 3AUVA 3LHPL 3D18A 2Y23A 1JZ8A 1BD2E 4O2FB 5I0DA 1CL7H 5KSBB 2JJTC 4HWZA 3MOAL 1ORSB 3QQ9C 2H2PC 1D3CA 3CH1B 3MXWL 1MI5E 2GYSA 4TUOB 4PB0H 2C4XA 3MV9A 5C0CB 2BK8A 1JYXA 3DBXA 5E5MB 3V52H 4I0PC 1EFQA 1A64A 4H25B 4PRBB 1WCQA 4UAOB 3U9UA 1NLDH 1S3KL 32C2B 2C3WA 1Q8MA 3LN4A 1KFAH 4QWWC 4KKBD 1A4JB 5CEYA 4JM2A 1MHPH 4CJ1A 3QDAA 4LLUA 5T3XD 2IJ0C 1MRCH 4LCYA 1KCRL 5L88H 1MJ7H 3CFJA 1WUNT 3K8KA 2DLGA 4K23L 1TQCB 3BQUC 4IOIB 3RL2B 1YDPA 3P9LA 4JFZL 2N56A 3VDAA 2BHZA 2RR3A 3L7EB 4P5KA 1RZGA 5GS2D 1W2KT 4FZ8H 4JY5L 1JGLH 1C5BL 1QFOA 4PJCB 3OGOE 4U3XA 4JN2B 1LEKA 4BK4A 3GSOA 1A5FL 4H88L 4UT6L 2NW3B 3S5LA 4OCYH 5F7KC 1T6WA 2PYFA 4PJIA 3F58H 3LOWA 3O6LH 3BH8B 5IW6B 5ESVB 3UYRL 4AL8L 3BJLA 2C9AA 3MLYL 5D8JH 4NQDB 1GZPB 4XP4H 1NUDA 3FTGB 3LB6C 5D5MF 2VRAA 2BNRD 3F6IA 2SEBB 2DIJA 1HWGB 2WBJB 1IC7H 3G6AB 4KKCD 5HHNB 4G6AC 5F89A 4RWHA 3U46A 3NZHL 5IMMA 5CSGA 5IQ7L 3W2DH 4YUEH 4X99A 3U6RB 4LF3B 4QHUA 5HHVH 3LEYL 1AGBB 3HE7A 4F33A 3ILPB 4X98A 1VERA 3JSSA 1U95B 4ZDHB 2YWYA 2DQTH 4OUUA 1CLYH 2BSSB 1KBGL 3BXNB 1F45A 1F3DJ 3STLB 2XA8H 3QCUL 5C08B 3Q1SH 2XYCA 1GC1C 5DC9B 5ICYA 1JPTL 3C5SA 3F6LA 4XTRC 1AQDA 1AQKH 5DJ6B 1I7ZB 1H8OA 5HVWA 4J3SA 3D9AL 3RZWA 1V05A 1F4XH 2LU3A 2NY3D 3SCMD 1ZGLB 5GZND 4ZOCA 4WO4A 4PLKD 4HUVA 4XP6L 3UZQA 2HJLA 5ESQA 2DQUH 1RFDH 2ATKB 5D1XA 2YHGA 2VQUA 3GFUA 1FYTA 5FYKD 2HLAA 5HHME 1MJUH 4P59H 3TNNB 3U0PB 1UYWL 4XP5H 5J6HA 2XQYK 3AY4A 5DD0L 3W11C 4LLMA 4ZXBA 2A9MH 3GMMA 1DL7L 1YPZB 3LSOA 5D5ME 3ET9F 4XMLH 5K9OA 1U3HD 3A6BL 4G8GB 4LSQH 4DOHB 1R3IH 4U6HB 2APFA 1WZ1L 3C6LD 1CL7I 5CUSH 2BRQA 4KKLC 1KJ3H 4R4BA 3MYZA 3CCHB 1RJLB 2ESVD 1ZEAH 3BN9C 3NACH 1D5ZA 2BSTA 4JFFB 5JOFA 3CFEB 1MQ8A 1SJEA 5FO7A 2XFXB 1FNSH 3ZKXC 4O51B 3S37X 1I9IH 2FR4B 4XVJL 3PP4H 5ICXB 4DZ8B 5C70A 5MENE 4HFWA 2D9QB 1NCBL 3MRHB 4Y4FD 3PWUA 3TO4D 4XBEH 4U49A 5EDXA 5L0QB 2APXA 2GCYB 5JO5A 1YQVL 2OXHA 3CX2A 4JE4B 3WJJA 2OR7A 1FLRL 1EXUB 3CMGA 1JWUA 4FTVD 3EBAA 2XG4A 4V2CB 1FLTX 5DMIH 3IF1B 1B2WL 1FJ1A 3T1FB 1M7IB 1MJJA 3TV3L 3T2OA 1BIIB 3VWKC 2APVA 2R0WL 4TNVF 3IJSB 1A0QL 3MJ8B 4IRJC 5IVXF 1I1YB 2BNQE 3H8NA 3OKYA 3QO1B 4I0KA 4G6JL 4AMKL 4Z76B 2VXSL 4JVWA 1WCBA 5F88A 3IJHA 4O02H 3EDFA 2RB8A 3HG1B 3FOMB 2H9GB 4DN4H 4FABL 1KTDB 2GTWB 3K8MA 4HMCA 1KYOJ 1J5OL 1G0DA 3NPSB 3G6DL 4YE4L 3MRMA 3BFOA 4PGDA 4CDGC 1K3IA 1CD9B 3HTLX 2X42A 3I84A 3SJVE 2R8SL 3K2UH 5IJKC 1HILB 5GRJH 4WEBH 2NQCA 1YECL 2GY7B 1DZBA 1IAIL 3WNKA 3VD4A 2GSIA 1N64L 3JV6A 4FNLH 4KTYA 5LCVL 4FXKB 3QIWB 1PX4A 3U30B 4Y16B 3WUWB 3OKKB 5CSBA 1RD6A 3P2TA 3T0VA 1MH5B 2NY1B 5MERB 1F3JB 1I1CA 3OKNA 4TNVK 4IM8A 5CP7B 3IDNB 4U1MA 3LKNA 1TJHL 5I18L 2ZUUA 1TIUA 3GBML 1FPTL 4QHNB 1OY3B 4P9HL 4LAJH 5EUOF 2CIIB 4PJGF 2I9LB 2WQ8A 4MXWL 1FFOA 4PV8A 4E41D 3BPCA 3VFNA 2ZOKB 2ICWI 1MIML 3LS4H 4KROC 5IVXE 5F6HJ 2J88L 1C08A 3WIFB 1OW0A 2GT9A 3O3UN 1LK2B 3W0WB 3D3VD 5HPMB 3O2DH 3MRPA 3X11A 4I5BB 4PLOB 5ISZE 3FO2A 1JTOA 2OR8A 2PXYC 4G5ZH 2CGRH 4OB5L 4Q0XH 4D0BB 1IBGL 1MHEA 3MYJA 3K46A 5EZJA 4JANB 4ODVH 4XX1G 3LRSB 1D5XA 4NO0D 2WV3A 1PEZA 1YN6A 5HD8D 4BYHA 4FQ2L 2VL4A 5IF0B 4P5MA 2ATPB 2GI7A 3PGFL 1H3UA 1REIA 4X6BA 4O58L 2VNCA 5C0BA 4TTDD 3AXLA 2DLIA 3V0VB 1ONQA 3K2MC 2AXFB 3BMWA 4OM1L 5C0ND 4L4VB 5FYLH 3IS1X 2HT4C 2AABH 5IBLD 1T80A 4WJ5A 2I60L 2QSCL 4WCYL 2ADFH 1DBBH 4UT7H 3EYOB 1NJ9B 1S7WA 2NX5E 4CGTA 3LRHA 1UA6L 3EOTL 5EUOE 5C9KA 2V6HA 1ZK9A 5CJOH 4PJGE 3HCVB 1M6OB 3N1GC 3FJTA 3LHPH 4U3CA 5D1QB 5KSAB 1AJ7L 4HPYH 1MAKA 3BP5B 3TT1L 5E9DA 1ND0B 4OZIB 4O4YH 3MOAH 1MCIA 2MFNA 1IEAB 4AZ8A 43C9A 4ZPTA 1KJ2L 3NFPA 5C07B 4YX2L 5INCA 4A6YA 2IQ9L 4X8JB 1AC0A 3T0EA 4KKAC 4F7EB 3U4BL 4NWTL 2F53B 4JDVB 3QJFA 4GJTB 5DVNA 3GMQA 4WDIA 3UBXB 3KLHD 3O3AA 1F8TL 2NY2D 5AUMB 2YBRB 3FHAA 1KCRH 1WK0A 4PR5A 1UT9A 1ITBB 4U1NB 2A6IA 3P4MA 4J3VA 4NO2B 1R24A 3CFDB 3DVNB 5DS8B 5FM5M 4BELD 4YBLB 1AR1D 2Q8AL 4JFZH 4NSKB 3C5ZD 1IC4L 1ZT4B 1BZ9B 3ETBF 4PBVC 5FYLE 3SGJC 3DUUA 2OK0L 4J3OC 4MZ2A 5JDSB 3HUJE 3RGHA 1C5BH 2NTSP 3MJ9A 4RISL 4R7DB 4JRXA 1H3WM 4JKLA 3SY0B 1A5FH 4H88H 4UT6H 2V7HA 5T1KB 1K8DB 4YNYA 5SWZB 3FB6A 2HFFB 2X4OA 2QSTA 1CFQB 3SDDC 4GAYB 3UYRH 4AL8H 3DARA 5FO9A 2ZUTA 3MLYH 3VFGH 5I8EB 5HYJA 1XCQA 2ZWLT 1SM3H 1UH3A 1CI5A 1R3LA 3MRKA 4KDTA 5C0JB 4S11A 3QHZL 3C09B 1MREL 5B4MD 3NZHH 5IQ7H 3PXHA 1B0GB 3MUHL 4N8PA 2BXYA 2NY5L 4V1DB 5GPRA 1PVHA 3RVVD 3LEYH 2YUWA 4MVBC 4FXGA 2G75A 1CD1A 4F7MA 3NAAL 4G8IB 2A6JA 1KG0B 3IAQA 4Y19B 1L7IH 5I1LB 3R06B 3H9HB 2EIBA 3HRZB 1JUFB 2GK0B 2BVPA 1FE8L 1KBGH 2DS4A 3QCUH 2VZTA 3TN0C 4MA8L 3AREC 4F7CA 1JPTH 4APQC 5A2JH 4I48A 2D7NA 2WWMC 1GGTA 5TDPB 4RRPA 3DX9B 4HIIA 2EXWD 2VISB 3RX7A 1JJUA 4JAMA 2DM7A 4HQQL 3DSNA 4OQ1A 4UINL 3V95A 4XXCA 4AQ1B 3D9AH 1FZKB 2J8HA 4Z8FL 1YUHB 3FFDB 4U2ZA 3VI3F 4ODXA 2H45A 4XVSL 2X4QB 1KNOB 3LN5B 3UDWC 5DD0H 5EN2B 1J05A 5FUZL 3TA3D 1DL7H 1WBZA 2F58L 3L7FA 3A6BH 1HHKA 3VXUE 1UM4L 4HHAB 1RK0A 5D2NB 1WZ1H 5E8OA 4WHTA 4NWUL 4OLXL 2W9DL 4JY4A 4RMRA 3WNOA 1TVBA 4G8EA 3TJEL 2AK4D 2HJFA 5HI3C 4GQ9L 1BJ8A 1NC4B 2CLRA 4K71C 5GSVB 1LNUA 1JHTA 4X4ME 2HMID 1JBJA 2YSSB 2ZG2A 5HXMA 2RFXA 5C2UB 4IRSB 2WUCL 1XF2B 3V5HA 1NCBH 1JNLL 1I1FB 2GHWB 4U7MA 1KT2B 1QVOA 3AFLA 4LAQH 4U6YA 1F4AA 3FOLA 4WI7A 4MB3A 1YQVH 5AD0A 1T1WB 1GGYA 1FLRH 2VN4A 3X3FL 1BEYH 1I8KB 4KUCF 1B2WH 1PZUB 3TV3H 1N59A 2BNRA 3DXAE 3WN5C 1G7PA 3SDAC 3V5DA 2R0WH 3VI3E 3PL6A 4YLQT 1MELA 2Q86A 2PW2B 3P4OB 2NZ9C 3PWNB 4DGIL 1A0QH 4L29A 1OT1A 4HUXA 3UJTL 4I9WE 3VI4F 3TCXA 4NHUA 4FP8H 3FQUA 2X4RB 1YEFL 1YJDL 1DUZB 4G6JH 3TBWB 4AMKH 2VXSH 1AD9B 1RJZB 5HHQB 2XN9E 2H6PA 2N1KA 4HGMA 1KPVA 4POZC 4FABH 5JHDD 4YIQB 3PQYE 1A1OB 5C2BH 1SVCP 3N85L 1J5OH 4JEGB 3OR7B 3G6DH 3EOAA 4YE4H 5FF6B 3KPNB 2CXKA 2R8SH 3ARBB 5J11B 2PCPA 2NZIA 5C8JA 5C0EB 2EDBA 2NXZD 2FEEL 4M93C 2W65B 1XF3B 1YECH 2BFVH 3D69B 1F3DH 1G6RL 1IAIH 4J23A 4C83A 1IE5A 1KN2L 3HE6D 1N64H 5LCVH 3GMNB 1DEEA 4UV7L 1SMAA 5HY9B 3SCMA 4N8CL 4N90D 4LPWA 4ZSOB 1U3ZA 5EZLA 2FD6L 3SE8H 3I75A 3FQTB 3VRLF 1V3LA 2EDHA 5INDB 1TJHH 5I18H 2DJUA 2DWEA 3GBMH 1FPTH 3EJJX 4OKDA 4L4TE 4ZTPL 1VDGA 4LSPL 4PRAB 1SJVA 4MXWH 3C6LA 5DA0B 5CWSB 5GGSB 1MIMH 2ICCA 2ESVA 3VI4E 1R5IB 1DN0B 3KPLA 2J88H 2C1PA 5I74C 5E6IB 1U8LA 4AEFA 1HHHB 5DEGA 4KPHH 4MNQA 2BSED 1MVUA 4LCIL 2KDGA 4XNUL 1BMGA 3RGVD 2F19L 1C16B 4OB5H 3AC0A 1IBGH 1QFWM 4NN6C 3ZKMC 5T33L 3CK0L 5HHOD 4Y4FA 1HSBA 1JF6A 1YEIH 4KAQL 3Q6GL 4GW5B 3MGOB 3DROA 2DQIL 5DHYA 4FQ2H 2PYED 4XGZA 1A7RL 3PGFH 4FTVA 4O58H 4FQXC 3REVB 4W4OC 1HYRC 2CUHA 3ROLB 1LE5B 3IFLL 5EUKB 1CDHA 1AHWC 3OWEA 2XIDA 3VXNB 4OM1H 1JGEB 3QPQC 5KZCB 1HWHB 3QXAA 3VRLE 3BESR 5JNYB 2I60H 3KWWB 2QSCH 1A21A 1H3XA 1RQ5A 4OTXL 5GRWA 3BRGC 5CCKL 3LS5L 4M61A 1UA6H 1A7PL 3EOTH 1FIEA 1Z5LB 1A6VL 5FYKU 5GQBA 5SWSB 1AJ7H 4PRPE 2P7TB 2BOCA 1KPUB 5ACMA 4GKNB 5IJVA 3TT1H 1NFDA 1GGIL 3GBNL 4QOKB 1H0DA 2EDRA 1KJ2H 3N1FC 3DWTA 4YX2H 4Q6YA 4NZTL 4QXUL 5DD3H 2IQ9H 2V7NA 1JZ2A 3O3EA 2P43B 1VSCA 4Z0XA 4L8BA 3U4BH 4NWTH 2VSDA 2HTKC 1W0YT 1S7XB 2X4PB 4QXWA 1ZMYA 3VXMD 4AT6B 5FKPA 4OLWL 3V6OE 1S9XB 5CSZA 1FFPB 4CADA 3N06B 5DC4B 5DZLA 4GG6F 4KVCH 4MCYB 4RAVB 4RFNC 1FL5A 4YDKL 3TO2A 3EYSL 4AK1A 4CDHA 1NMBL 2WMPA 3FKUS 3S97C 4UNVA 1A6ZB 1PJ9A 2Q8AH 4U1KA 1IAKB 1LO3L 4PG9B 5ILTL 4E41A 1IC4H 4MS8C 1MAJA 2XZZA 4L8SB 1R5VA 1IGJB 3SDCC 3T3MF 2OK0H 4YAQA 3WHE1 3WXVL 3QXWA 4HS6A 2XNAB 2A83A 5DDHB 4RISH 3D3VA 3BIBX 4WY7L 3O41B 1B4RA 1RIUL 1UB6B 3QFJD 4ZOBA 2P47B 4U1LB 7FABL 5KS9B 4QF1A 4WHCA 4U7KA 2E9IA 2ITCA 5K33A 4NO0A 2O61B 3SOBL 2CLZA 1VADB 4DKFL 3QQ3B 3EO0A 1H5BC 2EKSA 3NPZB 2NLJB 3DYMA 3QHZH 1I7UA 3O8XB 3GMRB 5B22A 1OP5K 1MREH 2H2PD 1F97A 1URLA 1T89A 2C4FT 2FJHA 4UDUB 5HYSB 4JRWA 2NY5H 5JMOC 2PN5A 4QT5A 4JPVL 5F9WB 3D0VB 3O9WB 3PWVB 3NAAH 5CGYD 3SKNB 4GG6E 1L0YA 3INUL 4Q9QL 4OFIA 1FQ9C 3GB7A 2RGSA 4F7TA 1FE8H 4QWWD 4OF5A 2XKSA 3DX8B 2M8XA 4DEPB 5IB1B 4MA8H 2GIYA 3MPCA 2CKBA 5T1LA 4I13B 3H3PH 2EXYD 1RZKL 3MFFA 4D0CA 2BX5A 1INEL 3T3ME 3HC0B 1IEHA 2CO6B 2IH3A 3H2WA 3RWEB 4HQQH 1LEGA 4UINH 4JRYB 1U58A 3WO3B 4L3CB 2E9BA 1L9MA 3MCKA 4Z8FH 1MRDH 2VDML 1U6AH 3ZE2F 3QULB 4XVSH 2X4NB 2XQYG 4X7DC 5I1AA 5GGRY 3S88L 1SY6L 3RQ3A 4K94L 3W39A 5FUZH 3EIFA 4BFIA 2F58H 1WFUA 3TZVB 1PBYA 4K9EL 1UM4H 4KFZC 4O2CB 4D9QD 4EI5B 2BOBA 1CXKA 1X6LA 5DJZA 4MLSA 3ZT7A 3Q5OA 5L2KE 1QSEB 4NWUH 1CVRA 4OLXH 2W9DH 3WO4C 3P9MB 1LDSA 2H32B 4Y5VB 3MBXH 4ESKA 3TJEH 1FFNB 1OTSC 2VLKE 4GQ9H 4NKOB 1JCKA 1DBJL 5DJ8B 3KPPA 2R1WA 3C5ZA 4AENA 1I9JL 2HVJB 3HMXA 2XQBL 4ZFOL 3ARFB 4IS6B 4KI1A 1AO7B 1RU9L 4LEXL 4YR6A 4LDEB 4RGOL 3T4AA 2WUCH 5DJAA 4BZ1L 2I9TA 3PJSB 1JNLH 1Q72L 2JLLA 1PG7W 3VFSB 5IMLA 4W70A 4X6EB 5E8NB 4HJ0D 1J8HE 1WAAF 4IIQC 4HUMB 5EU3B 2IANA 4FFWC 2OTWA 1P9MC 1IILE 3X3FH 3T04D 2RQ8A 3PDOB 4MA3A 4NDMB 3PG2A 3RX8A 1C1EL 4R8WL 4LLVA 5L8JB 8FABA 2NY6B 3F7YA 4HKXA 3WSQL 2FO1A 3MRRB 3ZE2E 3QAZC 3VJ6B 5JR1L 4YGAB 4DGIH 3CGTA 1EERB 3UJTH 3HPLB 2FBOJ 2XTJB 5C09B 1YJDH 4KWUA 1L9NA 4GLRH 1R3JB 3VXQA 3TBSB 1BQSA 3BE1L 1P1ZB 1XGUB 2OS7A 4U1IB 3GSRA 4WFGE 5DHVB 2R23B 3QO0B 3HAEH 2P8PB 2I07A 1NBZA 3KG5A 3N85H 5HYFA 1CYGA 3CXDL 1S7UA 4H1LA 1H3VA 5D7KE 3QEUB 1UXWB 4LKXB 5FHBL 5ITBL 2XRAL 3BN9D 3C8KA 1G6RH 4G9FE 3CFCL 2J8UA 12E8L 4OLUL 1KN2H 1QO3B 2ZPKL 1NGYB 1H3TA 4UV7H 3RHWF 2Y5TB 4N8CH 4HEME 4NIKB 1DLHB 2W60B 2FD6H 3VCLB 3GSVA 1WAAE 4NYLB 3MRQA 4CU7A 5FGSA 3RBSA 3TA3A 2M26A 3DMMD 5EBMA 4ZTPH 4HWZB 4EZMA 3RVWD 1EO5A 1FFQA 2DIBA 3G5XA 4LSPH 1A14L 4JCMA 4K3GA 3EDKA 2C26A 1BFOA 3MV9B 3VWKD 5IFJA 4QO1A 4OBRA 4YXLL 2HT2D 2CLVB 4P2YA 4LHUG 3O6FD 2CDFB 1NGXB 4JHBA 1AGDA 4IRJD 4LP5A 4EJ1C 3AMLA 4LCIH 4XNUH 4BH8A 3MXVL 3BGMA 2F19H 5F96L 1W0VA 3LN4B 1G9ML 5L9DL 4JM2B 4EI6A 4WTZG 5T33H 1GCFA 3CK0H 2YZ8A 4LLAA 4PJ8C 5EU4A 5BS0A 1YPZF 4LLUB 3RHWK 2QR0A 4KAQH 3Q6GH 4L3ED 2DQIH 1ZLWH 1JK8B 1N0XH 5J8OA 5LBSL 1WBYA 4UIMA 1NANH 1A7RH 2HTLC 1IT9L 1YDPB 3P9LB 4PS4L 4MDJA 2FEDD 1D7FA 1PKQE 1YEDA 2FCBA 3IFLH 1FNHA 5FGRA 4P5KB 1RZGB 3V0AC 1KB5A 2BVTA 3ARUA 3QBTB 2EH7L 4MA1C 2GKIA 2VUYA 4PP2A 4MZ3A 4M9OA 5E2UL 3J7HA 2ZP0T 3IAGC 5EA0L 1LEKB 2QV2A 3OB0H 4Z7WA 4JFDA 4Z95L 1EHNA 5LG1A 5C08E 1JZ5A 5DD6B 4G6FD 4OTXH 3S5LB 3ZE0F 5IQ9B 1JYVA 5FYJU 5CCKH 3LS5H 3OPZL 1A7PH 2XACC 1A6VH 1VEPA 5IMKA 5A2IH 3I2CH 1Q38A 1NGZB 5JHDA 2DM4A 2JIXD 4PJ9B 5IBUB 3EJYD 3SHSA 3PHSA 1VFAA 4LPVA 4O9HL 4NN5B 5I75B 1GGIH 1OOAA 4X5LA 5IMMB 4JGMA 2P4AB 3GBNH 1JVKA 4X99B 4Y4HD 1F4WL 1FAKT 4QXUH 4GAGL 3HE7B 1TQBB 1ZLWK 3KPQA 4F33B 3HE6A 2YPKB 4X98B 2P8MB 4NPYB 5EH1A 1YPZE 4CW1A 4F57L 4F9PA 4G43A 4GLRI 3EDJA 2BVYA 4IJ3B 4OUUB 3ARDD 4OLWH 3UPRA 5J7CC 2FDBP 4RGNE 4ZFFA 5ICYB 3C5SB 1Q0XL 4LGPB 2GEEA 4DQOL 2G60L 3EYSH 3BJ91 5D6CA 1NMBH 3V8CA 1DLFL 1AQDB 3QEQB 3OB0K 1RUQL 2FEEI 4YK4C 2NR6C 2VR9A 2QQLH 5ILTH 3TYGH 5DT1H 5HI5C 2FL5B 4CN1A 3ZLQC 2HJLB 5DYOA 3ULVD 4QRUA 1OP9A 3ZE0E 1CD0A 4M02A 5D1XB 4ZNCD 1FYTB 3WXVH 4CVXA 5J6HB 4M9PA 3VFPB 1N5YL 2Q7YB 1RIUH 1EVUA 1HQRA 3GMMB 3RGVA 2OR9H 5K9OB 4M00A 7FABH 3WFHA 3X3GL 3VH8A 4LSSH 1UKTA 5HHOA 2P24A 4BA8A 5A2FA 2GTZA 2BJML 1ORQB 3MODL 4R4BB 5EU7C 3SOBH 2EO1A 1H15A 4M43L 3GM0A 2JJWA 2PYEA 5F3HA 3CFBA 1Z6JT 1D5ZB 4HWUA 5FA4A 5JOFB 1AXIB 1GGCL 1PLGL 1SJEB 4TVPE 1BGXH 5FO7B 5KVMC 3W5NA 3L3HA 1P4BL 1OGAD 3LH2H 3O4LD 4XAKE 1U8HA 4JPVH 3C5JA 4Z5RA 3GJFH 1Q1JL 3BISA 4HFWB 3KS0J 4WGWB 3HR6A 5FUOL 1D9KC 3K1KC 1JI1A 3PWUB 5JO5B 3INUH 4Q9QH 2A0LD 3QG6A 1OWWA 4KQ4L 1JWUB 5CEZD 3LKSA 3MBEA 3MREB 4JZJA 4NFCA 4JY6A 5EIQA 1FJ1B 1MJJB 3MRDA 1RZKH 5I0ZA 4EIZC 1IARB 1INEH 3WD5L 1FZOA 3JWDL 4YBHA 5BJTB 2VLRA 2FHBA 2VDMH 4RFEA 2P5WB 1UVQB 3CLEL 4FOMA 3WXWL 5T3ZE 3S88H 5F88B 3QISA 3IJHB 5C9JA 3BKCL 1SY6H 3KPRD 2M1KA 4K94H 3VXMA 3F7VA 1MLCA 4EIGB 1GRWA 5FV1L 4K9EH 2OBGA 3MRMB 2ZJSL 4PGDB 2J4WL 2NPLX 3GJFK 1X5YA 5FUCE 1X5JA 1JHLL 3IDYB 4OZIF 2APTA 3W0WE 2I27N 1YNLL 2GSIB 1DBJH 2FH8A 4HWBL 4QRRE 4FQQB 4QTHB 1M05B 5HVFB 4CL7A 1I9JH 3NABL 3L3KA 5D7JC 2O5XL 2Y6SC 4ZAKC 5DMGD 3OKNB 1RU9H 4LEXH 4RGOH 3FQNA 2GUOB 1A6WL 4BZ1H 4CMMA 4U1MB 1Q72H 3LKNB 2HKFL 5JOEA 1WTGT 3QFJA 1QBAA 5J9PA 1YYML 4HG4J 3SDXA 3BKML 3MRNA 4HC1L 2LTQB 1EDQA 1XIWA 4XZUA 3TN0D 4LRIA 4HS8L 1JV5A 2F8OA 3BPCB 3VFNB 3B4NA 1C1EH 4R8WH 1U8KA 4M6ML 1C08B 3V8OA 4P2OC 1IGFL 4QCIA 3WSQH 1DR9A 2GT9B 4OGXL 3NGBC 4PJ5D 5HHPA 5JR1H 3I6KA 3MRPB 3QFDA 1K8IA 1IGCL 3RTQC 3FO2B 9CGTA 4HWNA 2DKMA 3HN3A 3UMTA 1UWGL 3MYJB 1WIOA 1XFPA 2D0HA 4I0PA 5EZJB 5D72H 3AS0A 1D5XB 2CH8A 1YN6B 3BE1H 5BVPL 4KZDL 4M1CC 3MGAA 3VGGA 3QDJB 4P5MB 2FHFA 5FM8A 2A73A 4LP4A 3BP6A 4X6BB 5E8DL 4OV5A 5C0BB 2OSLB 4PD4J 3W5MA 3AXLB 3CXDH 2K7PA 4ODHL 1ONQB 3OB8A 3MROA 3QEGL 5FHBH 4CVUA 4N5ED 4ERSL 4OLUH 12E8H 3KJ4C 5F1NA 2ZPKH 4JFYA 4WJ5B 4QRTA 1LK3H 1IAOA 5D96C 3BEVB 1EEUA 1PSKL 1X3DA 3WIHA 2NNAA 1T03L 3B6SB 3VWJD 5I1EL 3EYVA 5C6PB 3AB0C 3GSQB 1RUAL 1F6LL 5LKNA 3RPKA 5E9DB 1DUYA 4NRYA 5JZ7C 4MAUL 4OZHF 4I2XA 5TE6H 1MWAL 1TMCB 4ZPTB 3NFPB 3K4ZA 5IROC 4K7PL 4KXZH 3VXOB 4A6YB 2FX8L 4JLRA 4FQCL 3I02A 3X14A 3T0EB 4X4YA 3PWJA 4WI6A 3B9KC 4KHXL 3QJFB 3GMQB 3MXVH 5F96H 4WDIB 2DD8L 1OHQA 1CR9L 1G9MH 4JFQA 3O3AB 2VDQL 5C7XL 1I1RA 3ARWA 4U6XA 4OFVA 1IGML 5LBSH 2A6IB 3P4MB 3VRIA 4CVZB 3VDBA 1IT9H 2DWDA 4PS4H 1CDYA 1MSPA 4J4PC 2X9XA 1L6ZA 4OKVA 5TH2A 3DUUB 1U92A 4MX7A 5JORA 1MIEL 4DUWA 5A2KH 1HYSD 4Z7NF 3U7YL 4MJ2A 1EZVY 5LXGL 2EH7H 3IFOA 3P11L 4Y19E 1CDGA 5EA0H 4L8DA 5GGRA 4Z95H 1WIUA 1RIVL 3VA2C 1WFOA 1MCWW 2V7HB 4NQDD 3FQWB 4YNYB 1QRNE 4MJ6B 1TTFA 1BP3B 2X4OB 5DJCA 5F8QC 3OPZH 2WBJD 4OZHE 4XWGH 2HLFC 5FO9B 4OCMC 5HYJB 1ZTXL 1KTLA 1CG9A 1R3LB 1WQVT 3MRKB 3GI8L 4ZS6D 4O9HH 1N8ZA 3G5VA 4LHJB 5D6DC 4R90H 1F4WH 1LO4L 3VGDA 5SV3A 3P0VL 5DRWA 1Z3GL 4GAGH 1EBPA 4FXGB 3IETA 1IC5L 1CD1B 3MV7D 3V6OC 2OLDA 3RWGA 4F7MB 5I9QC 2A6JB 3H6JA 1FC2D 3Q3GA 4F57H 3VXTA 4KRNA 4QHMA 4K3EL 1OTUD 3F7QA 3TM6A 2BVPB 2G9HA 3LAFA 4JFHE 4LLDA 4F7CB 1OAUH 1Q0XH 4I48B 5GJSL 4DQOH 2G60H 3DMMA 4EN3B 1GH7A 3QPXL 4JHWL 4HJGA 1DLFH 4HIIB 1G9EA 4Z7NE 2C3GA 4JAMB 3B5HA 4NNYA 1KXQE 1MUJB 2QADC 3IU4L 3VWKA 4RFOL 5F8RC 4DUXA 4H5SB 4YJZL 3MRJA 4ODXB 4OGYL 1TPXB 3O6FA 4G8GD 1G7LA 1MFAL 4PRDA 4IRJA 1FSKC 1F4HA 4Z7VF 3LZFL 1N5YH 3QIUC 2VIRA 1WBZB 2NXYC 1TVHA 2ED8A 3X3GH 1RK0B 3VG9C 3LY6A 4PGCA 3EHBC 4JFFD 4WHTB 1FVCB 2R1YA 4ZOAA 4R2GC 2VZUA 1C7SA 3BWAA 3MODH 4L3EA 1J11A 1GIGL 2ZUQC 4LCCC 4M43H 4Y5YC 5DUBA 4JY4B 1TVBB 4G8EB 2B4CC 3H42L 2UUDH 2HJFB 1CXFA 4LASH 5E8PB 1B6UA 3A6CL 1PLGH 2CLRB 4KXZI 1FORL 3CVHB 5SWQB 1LNUB 4PTUB 4JO3L 3BPLC 4Z7UA 4OCWH 1FVEB 1HHIA 3MLTA 2R1XA 3BIKA 2CKNA 2RFXB 4HIXL 4PGJA 2R56L 3BZDA 35C8L 1Q1JH 3PWLA 4EEEA 4G9DA 3V5HB 2HAZA 5FUOH 2CK0L 1QVOB 4U6YB 2HTKD 3L95A 4Y5XA 4OZFH 5AD0B 4KQ4H 5JXAL 1KC5L 2DDQL 5E4EC 1N59B 2BNRB 1G7PB 2JIXA 1YEJL 2V5MA 3V5DB 3WD5H 3PL6B 3WL9A 5GZOC 5IWLC 3QUML 3JWDH 4YEEA 2Q86B 2G2RA 1VEOA 4UQ3A 2WZPD 1E27A 4HH9A 1UM6L 3TVMD 4L29B 2W07A 4MS8D 4HUXB 4UNUA 4Z7VE 5DQ9A 3HG1D 2VDNL 1V3JA 2WBKA 3DX6A 5TQ2L 3FQUB 5GRYA 1U8PA 5E2TL 3WXWH 1NQBA 2UUDK 2H6PB 3BKCH 1KPVB 2Z91A 1SVZA 1QSFA 3D25A 2B0SL 4D0DA 3ZDYF 4RZCB 4ZUTA 1TETL 3RDTD 2E8ZA 3EOAB 2XWBA 2ZJSH 3ESVF 2J4WH 4U33A 4KMTL 1JHLH 2C1OB 3LKRA 1I1AC 5C8JB 5F7WC 5EC2A 5B8CA 4U2YA 1F58H 4C83B 2WWKO 1YNLH 2HJKB 2VQ1A 4HWBH 1DEEB 2NY1D 4N8VA 3NABH 1BHGA 5EZLB 1KUMA 3DV4A 1F11A 3FRUA 1FHGA 1X5XA 4PTTA 1G0XA 2O5XH 1XCTA 2YS4A 3C08L 4NJ9L 4PJHF 3VXSB 2DJ4A 5IK3A 5FECA 4XWOC 2E8YA 5J3HD 1A6WH 4GMSL 4LCWA 3WHXA 3MTRA 2DWEB 1YYMH 2A74A 1TFHA 4HC1H 4BJLA 4J1UA 1GGUA 4HS8H 3WYRA 3KYKH 2QLVB 2P5ED 2ESVB 1A1MA 5E7FA 4M6MH 1M1SA 2EDOA 2C1PB 3L5XH 5A3ID 2UWEA 1IGFH 5DEGB 2VXUH 3OJDA 4MNQB 5EU6E 1OGAA 2H3NA 1IGCH 3FO9A 4DGYH 2DLFL 4Y1AE 3ZDYE 3MRGA 5JIHA 1ADQL 1ZVSB 3VFRA 5SWSE 2MNUA 1JNNH 2JF1A 4WW2F 5T5NF 4MQTB 5BVPH 5DHYB 4KZDH 1W72L 3G6JB 2VZ1A 4PJXA 3KS0H 4FTVB 4QOKE 5E8DH 1SHMA 4UAOC 4L4VD 4PBWD 2J6EA 3W9DA 1FC1A 3K8LA 4ODHH 1MCCA 1IKNC 3QEGH 4P49A 4ERSH 4UOW0 3OKMA 2QHLA 1WZKA 4PJHE 3QXAB 4LCUB 5GS0D 3M8OL 3SGJA 2YD3A 1PSKH 3ULUL 3BZ4A 5H94A 1T03H 4M3JA 3ZHDA 4M61B 1RUAH 3SE4A 2PTUA 1GOGA 4OAWA 2BSRB 2UVFA 3MV8B 4J7RA 1OD9A 3RA7L 1S7VA 3KPRA 3QUKA 2BOCB 2E7LC 5C07D 5IJVB 1UXSA 3H9SD 4CBPA 2EYSB 1NFDB 2EYTA 4LVEA 4QEGA 5F7EL 4MAUH 1MWAH 1H0DB 5GS3A 4BSVA 2RJMA 1O0VA 3IJYA 4K7PH 1YJDC 2FX8H 2F53D 3CC5A 2V7NB 4NNXA 1MCRA 3HAEG 4FQCH 4YHLL 1LP9A 4X0KB 5KG9A 2WWKT 4Z0XB 1NSNL 3FRPG 4FQIL 4RIRA 1CN4A 3RWCA 1YY9C 1GSMA 3CSGA 4KHXH 5MI0B 1J0KA 4F9LA 2ID5A 1WT5C 2BHYA 2WSKA 2DD8H 5CSZB 1CR9H 3LCYA 1IGIL 4O5LL 5C7XH 2D7QA 2MCG1 3OKOA 4M4RA 2VZ3A 3QDGE 1IGMH 1LE9B 4NQUA 4RWYL 3RNQB 2FIRT 3O45A 3TN0A 4U1KB 3W9EA 2NYYC 4E41B 3KPSE 4PJEA 5JW3L 1R5VB 5C6WH 1HKLH 1MIEH 1LVEA 4OJFL 2D3VA 3D39B 2NCMA 4YAQB 3U7YH 5LXGH 4N0UA 4HS6B 4BFEA 2EE9A 1X5LA 1BPVA 2A83B 4NGHL 4PJ5A 5SWZD 4LARH 3HNSL 2PO6B 3S34L 1LWRA 3VFVA 5F9OL 4QF1B 1ZSDA 4M03A 1SJHA 4F15C 3FFCE 3IU3A 2ITCB 4Z0BL 4NO0B 4XH2A 2CLZB 3CU1A 1FRGL 1II4E 5ITFA 1MVFA 1ZTXH 1GC1L 2EKSB 3QJHA 3BMVA 1BVKA 1I7UB 1TCRA 1B0RA 2IPUK 4X6DB 5GRVL 1GYAA 4PJBF 4WUUE 1LO4H 2Z8RA 4KRMB 4PJAA 2P1YA 3P0VH 4Y2DD 1Z3GH 1IC5H 1WBXA 4P3DA 4RGNC 4IDJL 4X6CA 4D2NA 4ORGA 4K3EH 3MJ6A 2I5YL 3VWJA 3EDEA 2YUXA 3GB7B 4F7TB 4LHUD 1YMME 4O2FA 4HG4K 4PJ8D 3PDDA 2CKBB 2DQFB 5T1LB 4EKXA 2ZSVA 5GJSH 3MFFB 4D0CB 4X5WA 2E27L 3JTSA 3RL1A 3RRQA 2V2WA 2IH3B 1T4KB 2Z92B 1LEGB 4R4NC 1U58B 5IFHL 5L0QC 3F5WB 1CFTB 3MCKB 3IU4H 2VLJE 4B50A 3SDAA 1CZ8L 4RFOH 1CE6A 1PDKA 2NX5D 3RZCC 5I1AB 4OGYH 5TE7L 2EECA 5LQBL 1IFHL 4LIQE 1MFAH 2YC1A 4OCRH 3LZFH 3W39B 4OZGA 4DAGH 2Y4SA 4KUZL 2NY2B 3EOYG 1E6OL 2JELL 2BOBB 4OBSA 5JMRA 1H3PL 5DJZB 3GK8L 4PD4K 1GIGH 4NQEB 4PJBE 1DQML 3H42H 4N0FA 4FFYL 3A6CH 4UB0L 1YEEL 1FORH 3KPPB 2R1WB 1PQZA 3C5ZB 4R3SA 4AENB 4JO3H 2XG5A 3K1DA 3NPSC 3WHE0 25C8L 3LEVH 4YR6B 3T4AB 35C8H 5CIPB 4Z9KB 5DJAB 4PRNA 1QA9B 4HUWA 2CK0H 3DPBA 1XEDA 4XPGL 3ALWA 1G7MA 4JM2F 5IMLB 1Z9SA 1OD7A 1ES0A 1MCJA 1GZPA 4WENB 2B5IB 2IANB 1XGYL 2F54B 2OTWB 3V6BR 2VJXA 4Y16C 4BM7A 3EYFA 1KC5H 5GGSY 4XHQA 3G6AA 4LSRH 4U3HA 4LLVB 4GW4B 1NDGA 3U6RA 1YEJH 3F7YB 4HKXB 1CIDA 2ZSWA 3MJ9L 2Q20A 1AGBA 2E7HA 1OVZA 3ILPA 1UM6H 3UTPE 1AE6L 4HIEA 3MLUL 2VDNH 1V3MA 5TQ2H 4ZODA 4ZDHA 3MV7A 1NMCC 4CU8A 5E2TH 4UTBL 2IF7A 1JL8A 4K8RC 1AP2B 1RMFL 4HWEH 3H3KA 4PJIF 2E5EA 3GSRB 5FUCC 5J6GA 3P4LA 3ARBD 2B0SH 1FNEA 1NBZB 2I07B 3GKZA 3FN3A 3BT2L 1EGJA 1TETH 3RY6C 4P2RD 1S7UB 2Z93A 3MV9E 2I24N 1P7KB 4KMTH 4NQCE 2F15A 3CLFL 1ZGLA 1JI2A 2DMCA 3O3DA 4E0RA 4FQXA 1QQDB 4RX4A 3M45A 3Q5YA 5J0BA 3U0PA 4PJDF 3DUSA 3VXRB 3RFZC 1U8JA 2QJDA 1QSZA 1JWMA 3GSVB 4NJ9H 3MRQB 3TP4A 3OAZH 4G8GA 1RZKC 4GMSH 4BFBD 2YD6A 2NW2B 1RUKL 5EBMB 3GGWA 1BD2A 1RZ7H 1CU4L 3G5XB 4JFFA 1NCAL 3MRLA 4Y2OA 5E6ID 3DGCR 4C56B 3HR5A 1BFOB 1MI5A 4I1NB 2V5TA 4DZ8A 2EDLA 4PY8J 5MHSD 1B6DA 5GGVH 5D1QC 5KSAC 4NKIL 1AGDB 3QUZB 5HGAA 2YD7A 3TEUA 4PJIE 1CTNA 3IAPA 4BH8B 5E95B 2CXGA 3BGMB 3UX9B 4K9EC 1W0VB 4ALAL 1CGWA 3GIZL 4X9FA 2DLFH 1ADQH 5EU4B 5BS0B 5EWIL 5T3XL 3JUZA 5I2IA 2UYLA 1W72H 1WBYB 3QI9B 1M7IA 4LQFL 4XMKL 3QNYA 4MDJB 1EO8L 5C0DA 2R0KH 3FONA 5KZCD 1MCPL 3IJSA 4PJDE 2MKLC 3OAZK 5LWYL 2G5BA 1KB5B 3E1F1 5TGBA 5IB3A 3DVGA 2W9LA 3H3BC 3MA9L 5D1ZC 3QO1A 1NAMA 3TVMA 2X1OA 4PP2B 1T5WB 5LVEA 4C55A 4DJMA 1HCFX 4WI9A 4GKSA 3M8OH 4JFDB 4NBYB 2VDRL 3ULUH 2CR6A 4YHOH 2CDEA 1RK1A 4ZAKD 4LVOC 5DFWH 1QLEL 3ULUF 1LHZA 1ZV5A 3L5JA 3RA7H 2GW5A 2J8OA 1ZA6A 3DXAD 4JO2L 2NY7L 1VFAB 5ANMA 1ZE3C 5F7EH 3RDTA 1D5MA 2NXZB 1FYTE 4I9WD 1H5BA 3OKKA 2E7CA 1UH2A 5HJ3A 3KPQB 4P2OD 5DJ0A 4YHLH 3LQMA 1NSNH 5CP7A 4CW1B 1Y18B 4G43B 3MUJA 4J12A 4XI5C 4RGMB 3RTQD 3UTZA 3I3DA 3UPRB 2Z4QA 1BZQK 3AS3A 4O5LH 4ZFFB 2QQKL 2ZOLB 2I9LA 2R9HC 4JKKA 4M1CD 1G9NL 5D6CB 5F21B 4RWYH 4K3JL 5J57B 4LOUC 4X80L 3N1MC 5KAQF 2VZVA 2FZ3A 2P5EA 5JW3H 4PGBA 4J3UA 4M5YL 4NC1C 4QRUB 4OJFH 4UILL 1T1YA 4WU5A 4P46B 1S7TA 4CVXB 3QZWG 4LPXA 4OI9A 2DKSA 3ULUE 2EYRB 2Y07H 1BLNA 2Q3ZA 3HNSH 3S34H 1VGEL 3RGVB 5JTWA 4CMHC 3QP3A 5JW4Q 4WI4A 2DMKA 1IQWL 5F9OH 1RAMA 3GJEA 3VH8B 1OGTA 2P24B 2GTZB 2YD9A 2QQNL 3MC0A 3NCBB 1H15B 4PGEA 4FXLA 2PYEB 5F3HB 3V0VA 3CFBB 4PJFF 1ZAGA 1GC1H 1RUML 4MXVF 5FA4B 3RVTD 3QCVL 2AXFA 3WNMA 5DWUL 3O9WD 1KLUA 3L3HB 5DO2C 4LPTA 3TBTA 5BCAA 1G9MC 1T0NA 1R3HA 4Z5RB 3C5JB 1R0AL 1UWEL 4UQ2A 1NL0L 3U9PH 4IDJH 3CJJA 4OF6A 4OV6F 4PLJD 1M6OA 1SBBA 1RHFA 3KPOB 2I5YH 3I3BA 1ACZA 4GMTL 4KQ3H 3LKSB 1C7TA 5ID1A 3MBEB 3BP5A 4JZJB 3RI5F 4WVRA 1BJ1J 3OKDB 3MRDB 4JRYD 3S35L 2ICWA 4IIQA 2E27H 5C07A 1FZOB 3H9SA 2DLHA 1P9MA 2VDLL 3K81A 2FX9L 5IFHH 4YC2C 4J4PD 4F7EA 2VLRB 2GSGA 1NBYB 1CZ8H 3L3GB 2F53A 3SEPA 3BKYL 1MNUL 1T5XA 5TE7H 3TZVD 4GG8A 1IFHH 5C9JB 2HN7A 3PNWA 1N6VA 1HHJA 4JPIA 3VXMB 4EI5D 2YBRA 3F7VB 2OMNA 1MLCB 4PJFE 4PRPD 5GRVK 5EFIA 1QSED 4MXVE 3FAWA 2PR4L 1B9ZA 5D7IB 3HNTL 4NO2A 1E6OH 3CFDA 2JELH 2ARWA 4F3FB 1QHOA 1H3PH 4NSKA 3GK8H 2X89D 3RUGE 1O5DT 4GBXB 4FFYH 3T08A 1UCBH 4UB0H 5K9QG 3ARFD 3IS0X 2WIIA 1YEEH 2N7AA 1W8OA 1PGRB 3RI5K 3AGVA 1AO7D 5IESL 2BVOA 3L3KB 4LLWA 4MNGB 3SY0A 25C8H 1K8DA 3FQNB 5J11C 4CMMB 4H0HB 5IHZA 5J06A 3BYTA 2IMMA 4XPGH 2YR3A 4C57C 1X4YA 4HBCL 3ZSSA 5J9PB 3KXFD 5C0BE 4YQXL 4GXUM 4L9LC 1FL6A 2ARJQ 3MRNB 3KNBA 4UIKL 1XGYH 1HZHL 1ZA3A 1XIWB 4XZUB 1JV5B 2FX7L 3HI1A 3PGDA 4PG2A 2DKUA 3NMEA 1J12A 4PJ7B 2C3HA 3DUHA 5FOJA 3V6ZA 4WU7A 2XTJD 5C09D 1EHXA 3MJ9H 5HHPB 4N68A 1NFIA 3I6KB 1V7NL 3QFDB 2XPGA 5B38G 1AE6H 5JHLL 3MLUH 1FV1A 4Y2DA 3IRPX 3ZTNL 3HRZA 4I0PB 1Q94A 5F44A 3VG0L 1PY4A 3PE9A 3BPNC 3Q6FA 4YFEA 5E08H 4U0QB 2NXYD 3K4DA 4JN1L 3KLSA 2A73B 4LHUA 3BP6B 4HMEA 3BT2H 3EHBD 3DX9A 4OFPA 4PJ8A 2VISA 5EOCJ 2FH6A 5C0IA 1P6AB 5TJWK 2YA0A 3MROB 3TJHD 2Z0BA 2WLZA 4WTZA 5CHNA 1FZKA 2JJSC 4TULL 1RHHA 3F12B 5HDQL 3FFDA 2H2SD 4HCRL 4JFYB 4QRTB 3EO9L 1IAOB 2L4OA 1KNOA 3LN5A 1E4KA 2NNAB 4I18C 3EYVB 4DVBA 1BOGA 2NX5A 5E70A 2LVCA 1RZJL 4WHYH 4NQSA 3ARGD 1RUKH 2PTTB 3JWDC 4HKBA 4NM4L 4KJYA 1TJGL 1DUYB 1CU4H 4NRYB 4QTIH 3SGEH 4ZFZB 1EAPA 1NCAH 4HBQA 4I2XB 3RNKA 1WV7T 4P4KD 1ZHKA 1I7TB 4JLRB 1MRFH 4HS3A 4JRXE 3I02B 3O2DA 3X14B 5I1KL 2A77L 2L0DA 3KLAA 4X4YB 4NKIH 2BDNL 2CPCA 3DO3A 1IGYA 4D9LL 1CGVA 2EC9U 3QCTL 1GPOL 5H37H 1RUPL 5F9JA 2C5DC 5EWIH 3AS1A 5T3XH 4U6XB 4KK9C 4C4KO 4MMXC 3CUPA 1WWWX 5JIKA 5C71A 5F9DC 2VLMD 3VRIB 3FN0L 4WFHE 1FGNH 1OTTC 4OCSL 2DWDB 4XMKH 1YNTA 4AIZA 3IDGA 1EO8H 4MMZC 2A6DA 2A38A 4OKVB 5TH2B 1P7HL 1U92B 4MX7B 5JORB 1T0PB 3MA9H 3A0OA 2I26N 3HUJA 3R1GL 4ELKA 4U1GC 3TBWA 3MLXL 1RJZA 4L8DB 5GGRB 2VDRH 3JTTA 1S7RA 5JUEL 5E2VL 5DJCB 4PJ9D 1QLEH 1WISA 2J2ZA 4L8SC 4JO1L 4KK5D 5FF6A 4I4WB 3ARBA 2Y25A 1KTLB 1CG9B 4JO2H 2NY7H 1TITA 5T5NG 3SGKC 5C0EA 2CJUL 4POYA 1G7IB 2IPKA 1N8ZB 4P2RA 3Q5TA 2F5AL 3G5VB 4G80A 2W9EL 4WW2C 3ZKNC 3DGGB 4H20L 3IETB 3RU8L 3BI9X 4GRWH 5EOCL 3UYOD 3ZKXB 3S8WA 5DK0B 3Q3GB 4ETQA 3NN8B 2W0FB 4JFEE 4XC1L 3VXTB 4LFHG 1NCWH 4GRWF 4GUPA 1FZMA 5T3XE 5JPMA 3QEHA 1QD0A 2VXTL 4MWFA 2G9HB 3PWPD 2KBGA 3GSNB 3HMWH 2QQKH 3QEQD 2VLLA 1T1ZA 4PRAA 2ZKHL 1FNGA 3DMMB 1G9NH 3L6FA 4HJGB 4K3JH 2BY3A 4R97C 4M7JL 4X80H 1UM5L 5FGCE 3V52L 4NNYB 5E6IA 5D1XD 4RDQF 2HKHL 5E6YA 5FYJL 3VWKB 4M5YH 4UILH 4DEPC 3RVUD 2O93L 1E6JH 2V5RA 1G7LB 3EYQD 4PRDB 4ELMA 4IRJB 1VPOL 1WGOA 2VIRB 4KY1L 1P84J 3WFZA 2OZ4L 1TVHB 3E2HC 1IQWH 1INDL 3CDYA 4JKMA 4PGCB 3MACL 3DRTA 3U83A 3OG6B 4PRHD 2BNRE 2R1YB 5JXEC 2QQNH 4L3EB 1KCUH 3SGEI 1ROWA 4CAGA 3IGAA 4J8RA 3ROLA 2EH8L 2HYMA 1RUMH 2IPUG 3QCVH 3PDGA 5DWUH 4FHBD 1KCVL 4Z7UB 1OAYL 5FCUL 1RJYA 1HHIB 3MLTB 4L5FL 4GRWE 1BZ7A 4X4MA 3BIKB 4S1DC 1FH5L 3PWLB 1R0AH 1UWEH 4G9DB 3QXDB 4XPHL 2CDGA 1CE1H 5BV7L 4HLZH 1FO0L 2B8OT 1Z5LA 5E00A 1J86A 3K74B 3L95B 4Y5XB 3BEWB 3C9NA 4G6FB 4ODBD 4BQCA 4XP4L 4GMTH 3NFNB 4ZAKA 2OCFD 2CR3A 5ETUA 2D4FA 2QBWA 3PHQA 1CLOL 5KTEL 3OF6D 5F7NC 3NFSL 3S35H 2JIXB 3BZFB 3DXAA 3WL9B 3IXAA 3C8HA 3DJ9A 2G2RB 4KK8C 2VDLH 4RAUA 1E27B 2NYYD 2P5WD 4HH9B 2FX9H 5ENWA 4KROB 3O4OC 5DQ9B 2DI7A 5FYKE 3G9AB 3ZTJH 2HFEA 4M6AA 2X4PA 4P2OA 1U8PB 3UCRA 3BKYH 3NCYP 4Q2ZA 3QDME 4IOFC 3FZUD 4FMKA 2F74A 2NY6C 4MJ5A 2Z91B 1F90L 1BFSA 3RTQA 5TF0A 1QSFB 2PXYB 4MCYA 4D0DB 3UTQA 4NJAH 1XT5A 3HNTH 2XWBB 4CUCA 1A6ZA 4M8VA 4KJWC 1NFDF 4PG9A 4PP1C 3T09A 4X83A 1G0YR 4UI2A 1NUNB 5EC2B 4GXUN 5B8CB 1QFUL 1I8MA 4P2CG 5F7UA 2VQ1B 4LEOA 1QLFA 3FRUB 1VEMA 3O41A 3T0WA 3L3DB 3RVXC 5DMYA 1XCTB 1I3UA 4J6RL 4U1LA 2GFBA 5IK3B 5FECB 5L8KB 2D7PA 4S0SD 4LCWB 2DL2A 4FTVE 4JJ5A 1KJ3L 2O61A 4HBCH 1T2JA 4JO4L 4YQXH 2A74B 1T7YA 2JJUA 3CD4A 1XGRA 4UIKH 3ZYOA 1HZHH 4J1UB 1BIHA 3QXTA 5DURB 1FNSL 5K9KA 2C3XA 1A1MB 3IRZA 1WSST 4OLVL 1I9IL 3QQNA 3JWNC 3M1BA 2ARJA 4E5XA 3O9WA 3WKML 3H7BA 1OGAB 2H3NB 1V7NH 4GSDH 4PFEA 1AXTL 3C8DA 5IROA 5FIEA 3FO9B 3ZTNH 3QDJD 5F7DA 4YHYB 3UPCA 3VFRB 15C8L 2DF3A 3VG0H 2XV6B 2FECL 3B9KA 4K55A 1DVFD 1NFDE 1X5ZA 5A2LH 3KYNA 3OQ3B 2AJVL 4PJXB 3T0BA 4YHNA 3HC0A 2O26U 4QHLA 1IGTA 1EO7A 4GRLC 3RP1A 3RWEA 1MCOL 3JV5A 4HUKB 4JRYA 1PEWA 1IVLA 2V5SA 4JM2C 4XAKD 4DUVA 4TULH 1U8QA 5IVOA 4RBPH 1ZHLA 1BJ1H 2X44D 2QHRL 3QULA 2IBZY 2X4NA 3EO9H 3LQAH 4J4PA 3ARZA 1DBKH 5IT2L 4JGJA 3BZ4B 5H94B 2ITDA 4JKWA 4HIJB 2V9QA 3GSXA 4OAWB 4DFHA 3TZVA 2BHUA 5I1GL 1RZJH 2YKLL 1S7VB 3ES6A 3KPRB 3TPUB 4EI5A 5FXCH 3SGDH 4PRPA 5C6TL 1F6FB 4NM4H 5GRJL 1UXSB 4E41E 1TJGH 3P9MA 2H32A 2EYTB 3GSUA 5GISL 2XZAL 5BVJA 1TDQA 3ULSA 3T0ED 3PGCA 4BSVB 3TF7C 3IJYB 1QLRA 2HVJA 1XR8A 3I50L 3CC5B 4NNXB 3D3VE 4RA3A 2AJYL 5I1KH 2HVKB 4HSQA 1LP9B 2A77H 4Y8AA 1AO7A 5KG9B 4RIRB 5D6DA 3RWCB 2BDNH 1T83A 1MCBA 4U1JA 1AR2A 3QCTH 5I75C 1G7QB 3V6OA 1GPOH 3BVNB 1RUPH 3X13A 1SYSA 1RVFL 1O7SA 3OKOB 2IC2A 4RBPK 4WI2A 3HE7C 1F6AB 3KXFA 5IEHA 3FN0H 5ESAB 3N50A 3O45B 3TN0B 2Z8SA 4F80A 3W9EB 2X6MA 4QRRD 1UEYA 4UBDD 4MQXD 2VMFA 4PJEB 1WF5A 3SE3A 2JB6A 1P4LA 3ALXA 1KLFA 4LKCA 3S4SG 1GAFL 5CD5C 1GHFL 1QG3A 3HZVA 3KDMA 4G5ZL 3GRWL 4Q0XL 3R1GH 5C92A 5DJ2B 1OSPL 2AJZB 3MLXH 3VD9A 2R2CA 2OXGA 3WV0A 3LPGA 1TJIL 1P1ZA 3AM8C 4HIHA 5D7LE 3B8YA 3VFVB 5JQHC 1H3GA 2IAMC 1ZSDB 2MQ3A 5E2VH 1SJHB 3RKDD 2OL3L 2XZQL 3QO0A 3IU3B 5CINH 1NKOA 4JO1H 4WO4C 3HB3C 4JQXA 5ITFB 3QEUA 1NKRA 5BXFA 4OGAD 3QJHB 1BVKB 2CJUH 5FYLL 2EDTA 3AY4C 1B0RB 1KGCE 1KJ2A 2AABL 2F5AH 4ZXBC 4F58L 4JDZB 1QSVA 2W9EH 4PJAB 3CU7A 2ADFL 2Y5TA 1DBBL 4KGLA 4H20H 1DLHA 1WBXB 4HFUH 5EOCH 4P3DB 3TIEA 3QUXC 5C0FA 4X6CB 4XC1H 4GG6A 4ORGB 1ETZA 3MLVL 3VWJB 4PV9A 4HPYL 4EN3D 3V4PL 2VXTH 3DVFA 4YDVA 2R15A 3BPOC 4H1LH 4O4YL 4NOBA 1DQDL 2ZSVB 1AGFA 2ZKHH 3ARGA 4TQEH 2UVEA 4PLNC 4X5WB 2H26A 1WTLA 3S9DB 3JTSB 5KOMC 3RL1B 1TCMA 2V2WB 3RX5A 3LKOA 3OJMB 4M7JH 1UM5H 5J1TC 1P53A 4BH7A 3ULUC 4ONOA 1IAMA 1JPGA 2CLVA 2HKHH 2J8UF 2CDFA 4P4KA 1NGXA 5FYJH 3WJJC 3WN5B 2F5BL 4AEIL 3SDAB 1CE6B 5IWLA 5D1ZD 4OF0A 1S78C 5IW3A 3OAUL 2YC1B 1N7ML 4MHHG 1VPOH 3EZ8A 3G5YB 3OTTA 4XPTH 4B5EA 1JZ6A 1C8PA 4KY1H 2OZ4H 4OZGB 1JK8A 1INDH 2IWGA 5AG9A 3K7UA 3SGDI 3MACH 3MO1B 2H41A 3MLRL 4LSDA 3O6ML 5C0AD 3VFOB 4BQBA 4BZ2L 4ENEC 3WLWD 4KJPC 1NGWA 1A2YB 5T5FL 2EH8H 5H35A 4U1SB 4N0FB 4XHJC 4IHOA 5EB9A 4LNRB 3MV11 1PQZB 4R3SB 4B7IA 1KCVH 1OAYH 4LVHC 5FCUH 3B2UC 3LKQB 4M93B 2Q3AA 3VD3A 4L5FH 5KAQG 3STBA 1KIPA 3RWHB 1JPFB 1S7SA 1FH5H 1MCKA 2MSPA 5DD6A 1ZWIA 5IQ9A 3WFCL 3LDBB 3I9GL 4PRNB 4XPAL 4XPHH 1MOEA 2AI0L 4HV8A 5BV7H 4HUWB 4OFKA 4WRLA 1FO0H 1G7MB 2UZYB 1ES0B 3FT3A 1AKJD 4NUJA 3VFGL 1KB9K 1EMTL 4U7SA 1SM3L 1NGZA 4H0IA 5IFAL 4PJ9A 3EYFB 1I4FA 1CLOH 3PL6D 5KTEH 1PG7L 2R9HD 2F8XC 4OD1L 2J8UE 3NFSH 4ETYA 1NDGB 2ZSWB 1JWSA 3CSYB 4WWKC 5FYJE 2YPKA 2P8MA 4NPYA 5GHWL 4HIEB 2ZCLL 2LTQC 1L7IL 4UUJB 1K85A 5JA9A 3MV7B 4Z7WF 5F3BB 2FLRT 4ACPA 5I30L 1J1PL 2B1HH 1F90H 3SBWA 5J6GB 1FNEB 5EORL 3PWPA 4WW1A 3C60D 3QEQA 2Z93B 4XRCB 2AK4E 3ILQC 2XICA 3IFPB 3T2QA 2FL5A 3O3DB 4E0RB 1QFUH 4FQXB 4NO5A 4G9FA 3C6SB 1WFNA 2HWZL 3JXAA 3P4NA 3V2AR 3VXSD 1AY1L 3DUSB 5FV2A 4N1HB 3OL2A 3VFPA 1U8JB 2Q7YA 1MY5A 1EFXD 1JWMB 4WV1C 4XCNA 4J6RH 1K4DA 1YEGL 4XBGA 5TFSL 1L4IA 4N5UA 4R26L 4LVNC 4EBQL 1P7QB 2WNGA 1ORQA 2XKUA 5GGTL 3ZKQD 3LRGA 4JO4H 3GGWB 1BD2B 1F5WA 4PRHA 2L7UA 3MRLB 2IPTL 1YZZA 3HR5B 1CGTA 1S5HA 4H8WH 1MI5B 4MNQD 3WDIA 2DQCH 1K4CA 4PB9L 5DLMH 2E7LA 1KJVA 4NUGL 4OLVH 3DV6B 2LE9A 2GY5A 4NQVA 3WKMH 4Z7WE 3V79C 5HGAB 1ZT1A 1AXTH 2DLTA 4KGJA 4LAQL 3B8SA 1S8DA 1DDHA 4TN9A 2NY4C 15C8H 1CGSL 1NCCH 5JHDE 1FBIL 2ZUSA 3CDCA 4X8XA 1S5IL 3MREA 1IQDA 3HAEA 3RJQB 5HGHA 5I2IB 2UYLB 5ID0A 4JR9L 1BEYL 1WT5A 1EUUA 2AJVH 3EDDA 3HS0A 3FRPA 1U8NA 3QNYB 5C0DB 3FONB 3OZ9L 5H2BA 3OF6A 1PKQA 1MCOH 4MLIA 2D0FA 4WNQA 2D4DA 1G6RA 5BJTA 2G5BB 2NY0D 5TGBB 5IB3B 3DVGB 3CIQA 4FP8L 1ZANL 1QPXA 1NAMB 1VKXB 3DURA 2P5WA 1UVQA 2QHRH 3TVMB 3TWCL 2ENSA 4XCYA 5IT2H 4GKSB 3TBVB 3MV8D 3SDCB 4M1GL 4UMGA 5I19L 2CDEB 1RK1B 3KGRA 4FFVC 1P84K 1GXEA 3NOIA 5C2BL 4ZUWB 5KW9L 4KDVA 4WI8A 2X4SA 3V9FA 4M7ZC 5I1GH 2YKLH 1KEML 1OPGL 4V2BA 3ESUF 1ZA6B 3HI6H 1MFEL 1TTUA 5C6TH 5ANMB 2BFVL 3RDTB 5GISH 2AEWA 2AKRA 2XZAH 1NUFA 1IZKA 1D5MB 4QTHA 4FQQA 3LD8C 1HH9A 1M05A 1H5BB 3I50H 5EBWA 4HKJA 2B1AL 2P48B 5HJ3B 5B3NA 5EC1A 5DJ0B 3EJZC 3SE8L 2AJYH 3BAEH 3UZVB 3UAJC 1XZ0A 5DVLA 1A6PA 2YUZA 2R39A 2GUOA 4MAYC 5IEKA 3MA7A 3UTZB 1DQLL 5HHOE 5CD3B 4G3YL 3NCYS 2Z4QB 2D2OA 3T4YA 2EDKA 1RVFH 2PYEE 3EAKA 4D9RD 4XCFL 1UFUA 4MSWB 1WWAX 3HZYA 1KIUA 3DETD 1N2RB 5SX4H 5F1IB 4HH8A 3D39D 1T66D 2FZ3B 2YPLD 3V5KA 2XKNA 4KPHL 4MXQC 2P5EB 3VFMA 2COQA 4PGBB 4WHYG 1YC8A 3IVKA 1GAFH 2PO6D 4AYFA 2D31A 3QDHA 1T1YB 4WU5B 5BMFL 4YXHL 1GHFH 5J12B 1S7TB 3GRWH 5HHMB 3UJIL 1OWRM 1BLNB 1OSPH 5I16B 3GI9H 1YEIL 1TJIH 2IGFL 5IG7A 5D5MB 4K7PX 4DK6A 3GJEB 3QDJA 5F1KC 1I8LC 1OGTB 2OL3H 2XZQH 4XXCC 2AQ1A 1ZOXA 3SDXF 2AP2A 2OSLA 3OJ2C 4PGEB 1DVFA 1HE7A 4KRPD 3EZJB 4KI5F 1TPXC 3D6GA 5H37G 1KXVC 1KLUB 4F58H 1ZHNB 4DGVL 5EU6D 4MJIE 3TBTB 3WO4B 2P49B 4KKBC 1T0NB 1R3HB 3WS6C 3BEVA 5GGQL 1HH6A 5MENB 4UQ2B 3B6SA 4W68A 4Y1AD 1QBLL 2FYYA 3GSQA 3VXME 1T2QL 3FL7A 2WK2A 3VDCA 3T2PA 2AJ3A 2ZCKL 3MSPA 5T1LD 3MLVH 2FECI 5CJQL 3V4PH 5ID1B 2IFFL 2E6QA 2N4IA 1DQDH 1WITA 1K3ZA 2F8VA 2ICWB 4IIQB 5T1MA 3H9SB 1Q9KB 2BMKA 3MJ7A 3OAYH 5DD3L 3VXOA 2R0ZL 1JZ7A 2NMSA 4HXBH 4MD4B 2B4CL 1BJMA 3KHOA 3D2UD 4AEIH 3JV0A 2GSGB 3B5GA 4LPUA 2F5BH 2E9WA 1DE4A 3C87A 2AQ2A 5DFTA 5J89A 1T5XB 4NQXA 1JPSL 4XCEA 4GG8B 1BWWA 3QFJE 1JMXA 3OAUH 2HN7B 3PNWB 1N7MH 3SDXE 1HHJB 4JPIB 5HI4D 4KVCL 1YN7A 3FT4A 5F7MC 1CCZA 5EFIB 4KI5E 4P23D 4NQED 4MB4A 4JFOA 3MLRH 4CVZA 3NA9H 3SJVB 3O6MH 4GW1B 4BZ2H 5T5FH 4YBQD 4ODUA 3MJGX 5EOTA 1CLZL 5KANG 2WIIB 4Q9RL 4QRRA 2FGWL 3CZFA 2BVOB 3BWUC 2Z9TA 1RULL 2Z8WC 2MWCA 4LLWB 5A1AA 3GJFA 5E2JA 5ADPL 5K9JL 2VR5A 2X70A 4RDQG 3FQWA 3WFCH 3I9GH 4XPAH 4MJ6A 3CAFA 5IHZB 2IAND 2AI0H 2F54D 3PHOA 5DFVD 1G9NC 1IL1A 3OAYK 1CLCA 1N6UA 2PNDA 1OCWL 1EMTH 1FL6B 1ED3A 3KNBB 4XC3L 5IFAH 2J7LA 1ZA3B 2NY3C 4LFHD 4XNQA 3HI1B 3SCMC 5GZNC 3PGDB 4HMDA 1PG7H 4ZQKB 4OD1H 5SX4I 5EU7E 4F37F 1BBJA 1Y6NR 3P30L 3V6ZB 5KJRL 1NDMA 2J12B 4WU7B 5CS7A 4EUPH 3HC4L 1NFIB 1NBVL 1U3HC 2XPGB 5GHWH 5ISZB 3D1MC 2ZCLH 1FV1B 4Y2DB 5B21A 4X7SL 1GL4B 4XAWH 3C6LC 4PPTA 1Q94B 4OFYA 2DTSA 3O11A 1SY6A 3FFCD 1ODAA 3Q6FB 1UKQA 3WFDL 5I30H 4BUHA 1J1PH 2W1NA 1MQKL 3H3PL 1X5IA 3P77B 4D9QE 4LHUB 3ZHLA 4EN3A 5EORH 1IAIM 4PJ8B 2E7BA 2WAHA 5C0IB 5C3TA 4HLZG 4PBXA 5JOPD 2YN3A 1MUJA 4NN7B 5CHNB 3VXRD 1RHHB 1MRDL 1A3QA 4Y4FC 3TO4C 4H5SA 4LDOB 5DUML 1U6AL 2HWZH 4ZFOA 1AY1H 3HZMB 3VGHA 3WMSA 3GO1L 4DVBB 2YK1L 1BOGB 2NX5B 1NAKL 5D1ZA 5DRXB 4MA1B 1YEGH 4OCXL 4BSJA 5EUOB 4XBPA 4QGYA 4DK3A 5TFSH 4R26H 4RQQA 4EBQH 4NQSB 1FVCA 3CX5J 4C56D 5GGTH 3ZTJG 4HKBB 3AMKA 4KJYB 4KVNH 4NZJA 3MBXL 3UROR 5F6IB 1NC2D 1EAPB 3QNXB 2IPTH 5E8PA 1UG9A 5C0AA 4YHPA 3CVHA 5SWQA 3RNKB 4PB9H 1ZHKB 3QUZD 4PTUA 2PKDA 4HZAA 3KVQA 3OXRA 4NUGH 3E6FA 5ACZA 1FVEA 4HS3B 3NZ8A 3QXVA 3QG7L 3KLAB 5KOVC 4MJ4A 5BS0D 3F65A 3QA3A 1IGYB 3D85B 1U8MA 3QI9D 5F9JB 1HIML 5E8EB 3UTSD 1CGSH 5EOQL 1FBIH 1S5IH 3CUPB 1AKJA 2ADGB 4JR9H 2VABA 1VFUA 5IB4A 3VMPA 1YY8A 5I6XC 1YNTB 4AIZB 3ABZA 4UOW1 3IDGB 1RZFL 2A6DB 3OZ9H 1T04A 5CJ8A 2GITB 4KHTH 4KJWD 5HTSA 2CD0A 2DL9A 3WIIL 4JFDD 3TFKD 2IQAB 1JIBA 1ZANH 3HUJB 4MCZA 3T0XA 3BZEA 4ELKB 1CDCA 3TWCH 3NCFB 5GJTL 2AXJA 3WNPA 4NC2B