4N1CA

Structural evidence for antigen receptor evolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
107
structure length
107
Chain Sequence
DIQMTQSPSSLSASVGDRVTITCRASQDIASDLNWYQQKPGKAPKLLIYSDSYLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYYMIPSTFGQGTKVEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords immunoglobulin variable light chain domain
publication title Structural reconstruction of protein ancestry.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/hydrolase
total genus 24
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4n1cA00
3MRGB 1U41A 4IJ3B 3WNOA 4PJGB 2XWTB 3FB8B 3IJSA 3GRWL 5J6GB 1HSBB 1T4KA 3U48A 1FG2A 1ED3B 2FYYA 1A6AA 1NEZA 3BX7C 3QUZA 3C5ZA 4GMTH 5I8EA 5I1KH 1IT9L 5KS9B 1A9BB 3PDOA 4PG2A 3UTOA 3WL9A 4HUMB 2QSVA 4HWEL 7CGTA 4HUWA 1INEL 5F9OL 3FAXA 2ZUQC 1X9QA 3HNVL 3JV0A 3B5HA 3MRDB 5FO8A 1LK2A 3QIUA 4NKIL 3TO2A 4WI3A 3MGAA 4KI5E 3VXTB 3KPNA 4MJ5B 4U3XA 2VE6A 3D39D 3G5VA 1DBML 4LCUB 2EXYD 1PEZA 1CT8B 4OZFG 4QEGA 2H45A 5DO2C 1KYOJ 2X4NA 5HHNA 2UVEA 1SJVA 3F7YB 2CQVA 1MVUB 2ZJSL 5JXEC 4P23C 3CX2A 1QKZL 3BSZH 1P9MA 1RURL 4L3CA 1NDMB 3O9WD 3KPQB 3DI2B 1OF2A 3WIFA 2CPCA 3GMPB 1C5DB 5ITBL 5JQ6L 4J8RA 5CGYC 3S88H 1WBXB 4YDKL 5BRZA 5C0BB 4ZTOL 1W8NA 2P47B 2WM0A 2YXMA 1AIFA 3H42L 4WUKH 5EU3B 2QHLA 2CIIB 1FCGA 3RA7H 1ZV5A 1NAML 3HNTH 5CIPB 5E4EC 1JYNA 5DQ9A 3ET9F 3LEYH 3UO1L 3TNNB 2JK5B 4F37F 1WK0A 4LQFL 3OTTA 3IFNH 4LKCA 3WNKA 5CGMA 4KZEH 2YRZA 4HKJA 4ZPTB 3RVWD 4OCMC 2NNAA 1T21B 4WHDA 4DN3H 3TO4B 4P57A 1MJ7H 1C7TA 3DTXA 1LD9A 1QRNB 2FEEL 1JZ3A 4YDIL 4LCYA 4LHQB 1F3JA 4H8WH 2ADGA 2CLVB 3QRGH 3UJTH 3MYZA 5AYUH 1EUUA 5L2KB 5JA8B 1TNNA 3DMMD 1CDGA 3UROR 1RQ5A 3TJHC 3PGFL 4F7CA 4Z8FL 5JZ7C 4DKFL 4UNUA 1P4IH 3VCLA 4GW4B 1GAFH 1HCVA 2GJ6B 4P9HL 4GRWE 1IAIH 32C2A 1DSFH 1CTOA 4YFLF 3NVQA 3W39A 2BSRB 1J8HB 4PY7A 5L8KB 4OIAA 4JPVL 4OLEA 4M48H 5F7LB 4QRPB 4QHNA 1M71B 1WQVT 1TCRA 2NY0B 1WEJH 5HGGS 3MA7B 4Y2DC 1F4HA 5E6YA 4Z78A 5F6IB 1ZT7A 2JJVA 4YFLI 4JFFB 2WW8A 5E56A 4L4TA 1LWRA 1U8IA 1BVKB 1NSNH 2LABA 3U9PH 4GXVL 5A2IH 5KZCB 3UZEA 5BVJA 4UUJB 4FQXB 4D94A 4PJXE 1EGJL 3ARGB 1PSKH 4MJ2A 4NDMB 3GNMH 4MA1B 2PYED 5CEXB 1TPXB 3N06B 2A6IB 4BSJA 1NCDL 2QHRL 1MRCL 4J3VA 4XCNA 1FZKB 4DEPC 5DD3L 2CDEA 3EOTL 1G7JB 3MV9A 5DLML 4KKAD 1FO0H 4AENA 2DTSA 1G7HB 4JO1L 4NQEA 2YEZA 4JFEA 1JYVA 4NOBA 4CMHC 4P2OB 4GS7C 2JF1A 3CAFA 4FXLA 4KVCH 5BMFH 4K7PX 1DN0B 1B4RA 2GQHA 3FQWB 4N0FB 5HTSA 4FFZL 3JWOC 4OJFH 3SO3B 5C6PB 5JQHC 1DUZA 2EZ0D 3L95B 1UXWA 4KDWA 4QTIL 2JIXB 2Y4SA 4PPTA 4PJGF 4M1GL 1KB5H 4NZTH 2DJUA 3IS1X 1FAIH 1UWEL 5EU5A 3DUUA 2JJUA 5IROC 5FM8A 3OF6D 5MHSE 2EDTA 1BZQK 2ZP0T 5D1QD 2QADB 5JW3H 3L5XH 4O4YH 3AU1A 3O3EB 1PQZB 5E94B 1LEIB 3WO4B 5KS9F 5E6IA 1AXTL 2FECL 4N0YL 2A9NL 4RCAA 2AK1L 5CJ8A 3IXTA 2IANA 3INUL 4PRAA 3RWJA 2DYPB 2QR0A 4B53A 1JCKA 5HGBA 4KZDL 3QUMA 4FP8L 4PJ5A 4EQ3A 3G5YB 5CILL 4D8PB 2J8UA 2FX9L 1GOHA 4UTAL 1RZGA 1YN6A 4GRMA 3SGJA 3OMZA 1B2WL 4P0DA 2HMIC 2G5BA 3H0TB 3V6BR 4G6KH 2EE9A 2PKDA 4X6BA 2Z92A 1U8OB 3QISA 2ICWJ 4GKZB 3X3FL 1MFCL 4CU7A 2IWGA 3SQBA 4R3SA 1YMMA 2X9WA 4RX4A 2KDGA 3RX7A 4WWKB 4PJ8B 3C09B 2F15A 4MZ3A 4F15B 3WKNA 5KW9L 2BMKB 5C09E 1GVIA 3QR2A 4R7NA 4KI5D 4U3CA 5JW4R 2DQJH 4FRWA 4S1QH 4F33B 1S7WA 1JGDA 4HX1B 4OLZL 4Y19E 4DK6A 3JV6B 4D9RE 1U8PA 1OM3H 4WEMB 3PGCB 4NZUH 2D7QA 3FQTA 3OKYA 4IHOA 4D2NA 4EUPA 3HUJB 4ZUUA 5JHDB 5EOTB 2KH2B 5J1AA 1DLHA 1UT9A 1U8HA 1CYGA 2NY4B 3LSOB 4CADA 5E03A 1NGXB 3C5SA 5F1NB 1RZFH 2K7QA 1QUNA 4DZBB 4C55A 1T3FA 3KXFE 5A2JH 4XCEB 4ZFZB 1RZKL 4EDXA 2WIIA 1JE6A 3CFKB 4PD4J 5I1HH 1BBDH 4LEOA 5TE7L 4A6YB 3PHSA 4KROB 4PBVC 2CMRH 1KELL 1II4E 1Y18B 5I17A 1KXTB 3BP4A 2A6JA 4JKPH 5JW5A 4XPFL 3DVNA 2HAZA 4K71B 2F53A 4BM7A 4QRUB 2VDKL 2B5IC 3VXOA 3P9LB 2GFBB 1KSRA 3VFWA 4QYOA 4NO2A 4BSVA 1U58A 1I8KB 3JWOH 4ZTPL 3GMRB 1INDL 4RAHA 5DVLA 1LDSA 3RAJL 4NNYA 1NLDL 5IKCB 1MREH 25C8L 5I8KL 5GRJL 5T1LA 3U36B 2DQDH 1Y6KR 1TQCB 4LF3B 3T2QA 2DQTH 1LK3H 2B7DT 4G6AD 2NXYB 4BK4A 1MIMH 3OPZL 4MXWL 3MNWA 1JPGB 4LVEA 3RWHA 4N0CC 4NRZB 4PJBE 2N56A 3SE4A 1JGVL 3QT2A 1SBSH 1FHGA 1XCQB 3EO1A 3WSQL 4JANA 4P3WA 1OPGH 3LN4B 5IJVA 1PAMA 4AG4H 3OHXA 12E8L 3P4OB 1WLHA 3G6DH 1S9WA 4QHUA 4QXUL 4P46D 3NIFF 4JRYD 4QO1A 2FNBA 2WQRA 5CUSH 5E9DE 4XH2B 3X3GL 2IALB 4Z76A 4XTRC 4IRSB 5FKPB 2VZ1A 2EXWC 3ZO0A 5ISZA 5I1AA 2XQYG 2A77L 3BEVB 3E6HA 3IETB 2F74B 2N4IA 4QWWD 1I9IL 3BJLA 4NQCA 5E8OA 1JNHB 5HY9B 4U1NB 1ZT1A 4S1DD 4UOJA 3TBTB 4WO4A 1D9KB 1VFOA 5HDQL 1YECH 1QLRA 4XI5D 1JGEB 1JMZA 1XGRA 2VR4A 3C8DA 3BDBA 5ANME 1AKJA 2CDGA 3QZWA 1RVFH 1H3TA 4TVPH 1D5BA 5KSBB 3MLZL 3GKZA 2AJUL 4NO5A 5F6HI 5IEKA 3S37L 4PJFA 5GZOC 5HI3C 3VXRA 1MJ8L 3WE6B 4Y4FD 3CPLB 4FZ8L 5LKNA 3D0LB 5IMLB 2P24B 1JZ6A 2O61B 3IDJA 3PWPB 3OAYK 4JKKA 1MFEH 5DDHB 1DEDA 2AJXL 4OIIH 4OFYD 1IGJB 4LCCB 4HJJH 4WIQA 1UM6L 4GW5A 1EEUA 1B4JH 3IFPA 2E6PA 3FO9A 3G9VA 3KYKL 3IF1B 5DMGC 3LRGA 5LJYH 3FQNA 4JB9H 3KVQA 1IC7L 3CVHA 3H3PH 1K5NB 1RK1A 2YOCA 2IGFL 3ZMRA 2LQRA 3CMOL 1OSZB 3A6OA 2PTUA 2ENSA 2P43B 1EXUA 2NTFA 1OGAB 2OMBA 4M7JH 5J12B 4Y16D 2A73A 3KYOB 2EDWA 3O2WL 4NN7C 4ERSL 4MS8C 4X9HA 2FX8L 4NUJB 2VN7A 2IG2L 2XRAH 4NRYA 1OLZA 4BZ2H 4X7CC 2NY0C 4W4NA 3EYOB 5A1AA 3ARVA 1B0GB 3RWDB 3BPNB 3Q6GL 5F6IC 1HH6A 3SDCB 3H9ZA 5GRVK 2H32H 5C09D 1P69B 1BJ1J 1BBJA 2IH1A 4L8SB 4PBXA 5IB2B 5IF0A 2C3VA 4V1DA 5CEZL 4MSWB 5TH2B 3BPCA 4Y5XB 4NKOB 2MQ3A 3DROA 4Y19D 4EXKA 2VLLB 1S7XB 4D9RD 1EERB 3M45A 3NFPB 3ARGC 1GGIL 5ID1A 1I9RH 5H94B 4MA1C 4NQVB 5DJXB 1SY6H 4Q6IB 3SHSA 1ZHBB 1TPXC 1W0WA 5GS1B 1N7ML 3I02A 3JTSA 3S4SA 5IVXF 3SJVE 3G6JB 4JO4L 5D1XB 5DRNA 2GTZB 3NABH 1ZGLA 5IT2H 5SWSE 1CDBA 3DX8A 5HGDB 1YEJH 4PS4H 5IHUH 3KXFD 1QSFB 5ILTL 1LDPL 3DIFA 3DRQB 4FQLL 5HYJE 1DQTA 4WCYL 3T65B 2V5MA 5DI8A 1NANI 3AFLA 5JR1H 4OSUH 2VLKB 4F3FB 2RR3A 3SO3C 5MEOB 4RRPA 3GHEL 1JZ7A 3ZKXB 4F8TA 2ZWLT 3D39A 1FNHA 1UJ3B 3ESVF 2ZCLH 4DN4L 5A40E 4Q9BA 2B0SH 2FIKB 1ND0A 2FLBT 2APVA 5DJDB 1MIEH 1A9EB 1CZ8L 2PW2B 3EBAA 4MD5A 5HHOE 2QADC 4RNRA 4ONGH 3O9WA 1KC5H 2VISB 4MNGE 1LO4H 2XKUA 4XNUH 3TBSB 3WJJC 2V2WB 3IJYB 2P8LA 3WO4C 1I1CA 2EH8H 4GMSH 5E99H 4HQQH 4LRNL 2DAVA 3Q48A 1MUJB 5DHXB 2V6HA 3QP3A 2O26U 1T83A 5C7XL 1YNLH 3V0WH 1X44A 4KJQD 4HHAB 1QNZH 4HEPG 3UBXG 4L9LB 2X4PA 5CIPH 1NCBH 1G9ML 4WNQB 1GSMA 5GGTA 3AAZB 2D0HA 4NO0D 1LP9A 3VRLE 4ZFOA 1IGCH 2VL4A 2Q8AH 3MCLH 2WWMC 3MV01 3MNZA 3G5ZB 1Q9WA 4JFYB 4KY1L 5FB8A 1OWRM 1IQDB 3THMH 3HZVB 4MQXC 5KSAC 3BP5B 5EUOA 1IEBB 1HINH 2XKNA 3MTRA 2OJEA 1CE1H 4NCC2 3ZL4L 3CXDL 5F9JB 1AO7E 4HIHA 2M26A 3DMMA 1CLZL 4F15C 2FIRT 1U0QA 4BFIA 3D3VB 3GI8L 1CGSL 2IF7A 4K2UH 5E9DD 1QLFB 1H3UA 3MV8B 3CFIC 2OTUB 5KSBF 4QF1A 1FNFA 2FJHB 2PO6C 3VI3F 5JXAH 1MJUH 1ACZA 2GT9A 4HLZG 1WCQA 1MH5B 3PP4H 1RUKL 1ZEAL 2VLJE 4IRJB 43CAB 3SDAB 1CLYL 4UNTA 1RZIA 2DIAA 3DWTA 3NA9L 2NY4C 3P0YH 3M1BA 4NKDB 1KJMB 5I1GL 4H0HB 5LGHL 3PNWB 4MDIA 3OJDB 4F2MB 2A74A 3ES6B 2XZQL 4YH6A 3TZVB 3UTQB 2R1WB 2V2XB 3AS1A 3MLSL 4AK1A 3CLFH 2PYEA 5GSVB 2MHAB 2EIBA 5FKAB 5IVZA 2VKXA 3VXNB 2VL5B 1R3IL 4KJWC 4ONHB 5HPMB 4KROC 3WXWL 3FOMB 5EC2A 1N0XH 4C83A 5C0GA 4KK5D 1AD9B 1LE5B 4GFTB 3TVMD 1KCSL 3GSOB 1CFSA 4WI8A 1R5IB 4XWOC 4HG4K 3QPXL 3HRPA 2MOVA 1NMAH 3OGOE 3BYYA 1J1PL 2AV1B 1N4XL 3CFCH 3MOAL 4QT5A 3Q1SH 3HAEA 2OL3B 4Y2OA 1M6OA 5CJQL 5GZNC 3D69A 2Z35A 2XWBB 3ROOB 4PV9B 1U92B 4OGYL 2P5EE 3FRUB 1TQCC 3MGTB 1IAOA 2OI9C 2OM5A 3QDMA 1NKRA 5K9KA 1PVHA 3I75B 4LGPB 4I48A 1JPTH 3OF6A 3U0TA 3BGMB 3MRBA 4O2CB 5D1QA 4PRPB 5LQBL 1EMTH 3Q3GB 1CBVL 3BXNB 3OXSB 4ODHL 5FHAH 1JNLH 3E2HB 2VDML 3G6JF 3GHBL 3SPVB 1NPUA 4KJYA 4LARL 4CN1A 2PF6A 3P9MB 1S5HB 3ILQC 4HW6A 1BIIA 4ZFGL 2HH0L 3UYOD 5ELIA 4LHUD 3SQOH 3O2VL 2VWEC 1I7ZB 5AZ2L 2VLME 1WZKA 5GRXG 4KQ3H 3BMWA 3O81A 3SY0A 1GXEA 5IM7B 1RU9H 4OI7A 4J3UA 5DHVA 3SJVD 5TF1L 5DUBB 4Z77B 1OARH 5FYJL 3NACL 5T5FL 5SWSD 4IRSC 3LKQA 1R5WB 4S1RL 1AGBB 2H2SD 3QG6B 1ORSA 1FV1B 3CC5A 1A8JH 5MEPB 3WCYA 4DGVH 1E4KC 1FIGH 5EU7E 5HYJD 3GJEB 1A1NA 4PJCF 2C4FU 5D5ME 5JPNB 1KPVA 1F4YH 3VFSB 5DVOA 1SMAA 2WUCH 5KVFL 3PUCA 3RHWK 1O5DT 4XAKE 4O58H 2OZ4H 3P4NB 4PTUA 3WNNA 2EE2A 1FL6A 1G6RA 2QQQA 4FTVE 4GRLB 1ZS8B 4G8EA 1MQ8A 3FQXB 3RY5A 3N1MC 4LL9A 4I8DA 4OFPA 1FAKT 4KMQA 5HHOD 1IAIM 3NTCL 4RAUB 5DS8B 1T1YA 3O2DH 4M1DL 2W59A 2W65A 3ARDD 3OAZK 1BD2E 2H6PA 3UDWA 3ZKSD 1A6WH 3WKML 5TDPA 1OB1B 4M3JA 5GGSY 3KG5A 4NT6A 1NMBL 1EK3A 3QULA 3QI9B 3HE7B 1X5ZA 4PR5B 1QBLL 2YBRA 5BS0B 4JKWA 1A7OH 1BQHA 3WIHL 4JFXB 3UC0L 3L5IA 4I3GA 5F1SA 2QQNH 4DZ8B 1A3QA 1GPOH 4NFCA 5FUCE 3Q6FB 5DT1L 5J12C 1KN4L 4BH8B 2WLYA 1NANH 2EDFA 5DD1H 2X4RB 3VH8B 3ULVL 2D03H 1QVOA 3MGOA 3L3KB 1D6EB 3TC9A 4P2QE 2E7HA 4Q7DA 4QXTA 3C8KB 1XGUB 1AO7D 4B41A 2ITCB 3EYSH 4JGUA 4MDJB 4UOW0 2BNQB 5IIEA 3EHBD 5IP4A 3SDCC 5GXBB 3TYGL 1NAKH 3MLWH 4JEGB 2XTJB 4U6VL 4L8SC 2W60B 3O11B 1FFNA 1T6WA 5BW7A 5FGBC 4Y5XC 3RPIA 4CW1A 2O5ZL 4JQVA 5GGUA 4HKXA 4JN2A 4Z7QF 5FYKH 5HVHB 1BFOB 5EC1B 4LOUD 4Q6IC 2VLJD 5I8OL 4KTDH 2AJSH 1YMHA 3LH2L 2NX5B 3IRPX 4Z0XB 4OUOA 4CKVX 3QUXB 3ARFC 5EO0B 3EUUA 3ZKQD 1Q9OA 3O3BB 5D1XC 3H9HB 4J6RL 1EFXB 3BZEB 1YPZE 2AJZB 4U0QB 4N1CA 4PJXA 3MREA 5E95B 1MRDH 3MV7B 1NFDB 4LGRB 3OR7B 3NA4A 2VUYA 4LEXL 1JN6B 3EW3B 3MXWH 5DJ8B 3L3IB 4JO3L 2NY2D 4TUKL 1A3RL 3A6CL 4I77H 4F7MA 2OR7A 1QSED 2DICA 3U46B 3ZKXC 1DVFD 3MR9B 1UJ3C 5A3ID 4BJLA 1IE5A 5DEFB 5FGSA 1NGQH 2NR6C 1RV6X 1YNTB 3AC0A 4OAWA 2FCBA 5ABDE 5IESH 3S36L 4JFOA 4OF0A 4MD0B 3VW3H 4YWGH 3ZE2F 4ODSL 4OZIB 3PWJB 5C0CB 3MUZ1 2FJGB 2YPKA 3GI9H 3UPRA 2ESVB 3SKNA 4OD3H 2P5ED 3QNXB 5ID0A 4QHKJ 1QQDB 1J1XH 5E2UH 3SKJL 2XNAA 3O6FD 3MRNB 3VFGL 3ULUF 3RNQB 4M1CD 4P5TD 1UQSB 4L9LC 3DSFH 2QJDA 5T3ZH 4Y4FA 5TFSH 1MEXH 4PJ9B 4JFDB 2RJMA 4OFYA 5DRWA 5CD5C 5ALCL 5DR5L 3IFOA 3CFEA 3QFDB 1FNSL 3D1MC 2W0KA 3DUSA 3ECBA 3K46A 4L3AA 2EC9U 5FHBL 1M05B 2WBJD 3T0AA 3L7FB 3SKOA 1CL7I 4AT6B 3NPSB 2ZOLA 3TJEH 2YXFA 1KEGH 1A1OA 4LIQH 1RUMH 4Y16A 1FORH 5JO5A 3RTQB 4X6CE 4TPRH 5C6TH 5FF6A 4JHWL 3NZHL 4OKDA 5HYSG 4L8CB 4V2CB 4R4FH 4QCIA 4IRJC 1TZIB 1A4JA 4K3JH 1KCVL 4OFKA 3SDAC 4YXHH 1EHLL 2H1PH 5C09A 5F1IA 2KPNA 3M17A 3LEVH 3UJJH 4MAYD 4XAKD 3RIFF 1HNFA 3VFPB 2VLRE 3MRJA 4WI4A 4LLQB 3MZTA 4G8FA 4OZ4A 3QDGE 4PGCB 4YX2L 5I66B 4Y19A 2Y5EA 3K0WA 5DJCA 4NJAL 2AEPL 4U7MA 2F9BT 3Q5OA 3MRMA 4LFHD 4BSWA 2E7LC 1QBBA 2UWEB 2R0WL 1BD2D 2ZCHL 5E2TH 3CSBA 2NY6D 1X5LA 4K8RD 4X6FA 5A2KH 3AREC 5C07D 3CX5J 4HBQA 2V2TA 3OKDB 3OR6B 2YMXH 1I8MA 3FB6A 4CN6A 3KXFA 1AE6H 4HS3B 4R4BB 1K4DA 1A3LL 4PJIB 2NZ9D 1AY1L 4P5KB 4YHNB 3GIVB 4DOHE 4WGWB 5KBNC 4QGTA 2HT2D 2WZPD 1YYLH 5C86A 1HHHA 3NCJL 3OKEB 3TIEB 4YHZL 4QTHA 5B8CC 3QCVH 1CE6B 5GHWH 2YN5A 3BT2H 5D72L 5J11B 1NLBH 2ERJB 2R69H 1HIML 3LAFA 4P2QD 1EO8L 1UWGL 1KCUH 4MCZB 1TITA 5DHYB 4KK6D 1K3IA 1N59A 3O3DB 2YC1B 1V5JA 1IKFL 1YEIH 4GUPA 3RVXC 4EDWL 3OKMB 4KUZH 4ZAKB 4WW1B 2AXFB 2AI0H 3UX9B 1IM3A 4M43L 3DX6A 3O3AB 5FUZL 5GGVH 3VD5A 4OLWH 1NFDF 4O9HH 2HKFL 2BK8A 2LVCA 2Z93A 2NY3D 1ZSDA 4PRHE 5DMIL 5IR1B 3FQUB 5FOBA 5IB4A 4G7YL 1FNGB 4PJBA 4N8CH 3FHAA 2Y1VA 4RISL 4O5LL 4XVJH 4NO0A 4G6JH 3MBEC 5CHNB 3CIQA 2PN5A 4KKLC 2VOTA 3WJLC 3QIWB 2XY2A 5DA4A 4ZUVA 4GAGH 5DYOA 3NCCB 4Y4HC 4MJIE 5D4QA 3LQAC 1PBYA 2VERN 3D85D 1ZHKA 1DBAL 1G7PB 2E8YA 1DQDH 3EYVB 1Z5LB 2BFVL 4OCXH 1BM3H 3WNPA 3MRKB 1W72H 3KPSE 4H88H 4YNYB 1NL0L 3I9GH 3CZJA 4M93C 4YHLH 2D2OA 1FGVH 4HBCH 1TLKA 4TVSa 1FDLH 5E9DA 3BKCL 2DWEB 5C1MB 4HGWA 2VQ1A 4N8VG 5IHBA 5IGXL 4QLRA 4GRLC 1HKLH 1E6OH 4YDJB 4WWID 4POZD 1NCWH 2QQLH 2DQEH 4OFVA 1OW0A 4PJDB 5E24E 3ARSA 3WLWC 3T3MF 2VIRB 3SEPA 5E1AB 4ZSOE 2GY5A 4NOFA 3VG9B 3T8XA 5MP6L 3S34H 2P5WB 1PY9A 1XIWB 4S1SL 5INCA 2B1AL 4FQPA 4OCNC 5SWQA 3BKML 2FO4B 4Y8DC 1T04A 5I1IL 5ANMA 5CBEA 3L5JA 1V3KA 4MNQB 4PRIB 1L7TH 3WUZA 3BZDA 4J2XA 2DQCL 4QRTA 3QCUH 2KKQA 2EDRA 3QXWA 3HI5L 3HFML 3HE7C 1FBIL 5T3XL 4XWGH 4TUOA 3ARZA 2ZOKB 4Z0BL 3CZFB 3EDEA 3G6AB 2C9AA 1G7LA 4FHBD 4HKBA 4EBQL 4PJEB 3PL6B 1ZT4B 5DD5L 4HH8A 4XXDA 1KF9B 1TZGL 1NBZA 1HHGB 1I1AD 3EOBA 4MXVE 1HXYA 3RL2A 3IXAB 1XF2A 1IGMH 2I5YL 5IW6A 1EEYA 4Z95L 4G42A 1C5BH 5C0EA 2AEWA 2OL3H 1RJYA 1KYOK 2XI9A 4XPBH 2XTJC 5LWYH 1KENL 3IJSB 5JDJA 1U3HB 4R8WL 1CGUA 2JCCE 5DD0L 1T03H 3TPUA 1HHKA 3F7RA 1QO3B 1H15A 1T4KB 3VG0L 5FA4A 5JA9A 1CQKA 1HCFX 1MRFH 1WFUA 1FG2B 1MWAA 3O6ML 2FYYB 1A6AB 4BZ1H 1NEZB 3QUZB 1KJ2A 3C5ZB 5I8EB 4BQ9A 3QXUA 4HMCA 4NJ9L 2B2XH 5HVHC 3WD5L 3STLA 3C08L 1MCCA 4KRPB 3PDOB 4ZO8A 2COQA 2UWEF 3GIZH 3ZKMD 2CK0L 3QXTA 4HUWB 3QUXC 1A6PA 2VLRD 3GSNH 1X5HA 2OP4L 4FQ2L 1G1CA 1DQLL 1MCWW 4RAVB 5FO8B 1LK2B 3QIUB 2DLHA 3FT3A 3EJYC 1CS6A 1DLFH 1RD6A 4LHUA 3TO2B 1O7VA 1T2QL 1F4XL 3SDYL 5HJ3A 3WLBA 1MF2L 1MFNA 2ZUWA 4PJIF 3UP1A 3KPNB 43C9A 1PZUB 1DTUA 3IAGC 3FZUD 2VE6B 3G5VB 1P4BL 1WZ1L 3B2UD 2DQFA 5SX5H 1OQXA 2Z91A 5HHNB 3SJVA 4OGXH 3T0BA 4IS6A 4L3CB 5SWSA 1CL7H 3U7WH 3LQAH 3MX0A 2A6KA 1OF2B 1I7UA 4P3DA 3WIFB 4HF5L 4ELME 2WANA 4PB0H 1SEQH 4XC3H 5HYJA 1F4WL 4J8RB 1FGNH 5FA3B 1D5ZA 5BRZB 5J1SC 1IC4L 4RA3A 3RQ3A 1RZ7H 1AGFA 1AIFB 2FECI 1I4FA 3CDGA 5MERA 4Q9RL 2B20A 3EKCA 5F7EH 1BFVH 3WFHA 5I1CL 2IAMD 2VDRH 5DQ9B 1N5YH 3ZDZF 4WU5B 3EJJX 1OT1A 1AXIB 1ZTXH 1NGYB 4LKCB 4R97C 3U7YL 5AZEH 4HKJB 5F7WC 4KKBD 2NNAB 5HHOA 2VDQL 4P57B 3DTXB 4DTGH 1LD9B 5TQ0L 1T7VA 3P0VH 3REWA 1MHPL 3NIDE 2ICEB 4LCYB 1FFQA 4LPYA 1F3JB 4MNGA 4Y4KB 4PJ9C 2ADGB 1YC7A 3ARDA 4YO0A 1PKQE 4UDTA 2OCFD 2MJWA 4F7CB 4YR6B 4N90E 4OZFA 1CGTA 3VCLB 3R8BB 4MAUL 4KKCC 1I3UA 4UV7L 2WQ8A 3O45B 32C2B 5FV1L 2XZCH 2EH7L 4HMDA 3STBA 2YRPA 1XF3A 2VNCA 4YBQD 1CFNA 3W39B 4PY7B 3UJIH 4LSQH 1CF8H 1YZZA 4P4KC 4M8VA 4QHNB 2ICWA 4JY4B 4JPWH 3NPSC 1TCRB 5C0FA 4HLJA 4M6OH 4Z78B 1LNUA 3C2AL 4YHYB 4LMQI 1CD9B 1BIHA 1RULL 4L4TB 3CNKA 4GMTL 4MJID 1U8IB 2D7NA 4PJDF 3UTZA 1V7NL 3HMXA 2Y07L 4ODVH 1I7TB 1AO7A 5BVJB 5JORA 4L1HA 3RVTD 1EEQA 3QDJD 4G5ZL 3KPSD 3F7PC 4M7KL 2DJSA 3GRWH 3K1DA 2DRUA 5F3BA 1NBVH 4YAQA 1IT9H 2YD4A 1J9CT 3D25B 4XCNB 4ODBD 4XNZB 2CDEB 1F6LL 2GJZA 2IJ0C 1GJIA 3NCYP 2RHEA 4AENB 4HWEH 4XPAH 4NQEB 1IAMA 5CAYB 2GW5A 2VLJA 2YEZB 4POYA 1QPPA 4BKLA 5ADOL 1X7QA 3DARA 2G9HA 4GW1B 2PTTA 1INEH 5ESVA 4PJEF 5F9OH 1KB9K 3HNVH 4NKIH 2YSSA 2X9YA 1FZOA 1NGPL 2APXA 4UT9H 1S9VA 1WIUA 1AR2A 3BAEL 1P2CA 1DBMH 2R0LL 1DUZB 4I18A 5D93B 2E7MA 4L4VE 5D7KD 1P4LB 4XT1C 1UXWB 4X4XA 1OTUD 2ZJSH 3HNTL 2FH8A 1WC7A 5EU5B 3DUUB 2UUDK 1RURH 1RK0A 3CH8A 1AR1D 4LNRA 2W92A 2AXGA 3RDTD 4JM2D 1DVFA 5B39G 4D0CB 5ICYA 2BRRL 3AU1B 5JQ6H 4YGVA 5K33A 2HLFD 2VITB 2XG5A 5IB1A 4QRRE 1OP3H 4DN3L 1YNKL 2ERJC 4ZTOH 5E6IB 4YDKH 4N5UA 5BVPL 1ITCA 1J8KA 3IXTB 1A02N 3H42H 2IANB 4PRAB 3RWJB 2CGRL 1NAMH 5D2LF 3OQ3B 5GS2H 5HGBB 5C9JA 4DAGL 3SDDD 2P8MA 4ZAKC 1KTRL 1P4IL 3UO1H 4NN5C 4PJ5B 5C0AE 4HXAH 1EZVX 2P5EA 1GAFL 4LQFH 1TQBB 2FBOJ 4R90L 2NY1D 3EYQC 5SV3A 1H3WM 3REVA 1RZGB 1YN6B 4GRMB 3O6FA 4YFDB 4P5TA 4YDIH 5L6YL 4X6BB 4NP4H 2Z92B 5DURD 1EBAA 4R3SB 1FL5A 3W9DA 3PGFH 4M61A 1YMMB 3F6LA 4Z8FH 4FFVC 1FH5L 4DKFH 2DI7A 2Z8VC 1TJIH 3QIWC 4M9PA 5EFIA 4R7NB 5DA0B 4FABL 4G7VL 1P84J 4O2FA 4EI6A 4JPVH 2B39A 3LIZH 5DFVC 3BUYA 4HC1L 4OD1L 3DX9A 4IOIA 4XX1G 5GIRB 1KXVC 3GO1L 1S7WB 1JGDB 2DIBA 2BERA 2WBJA 5FCSH 3C9NA 3TF7C 1U8PB 1IRAY 3FQTB 3MXVL 4IHOB 4ZUUB 3AS2A 3FFDA 4CBPA 5J1AB 1DLHB 2HT4D 1U8HB 1MHEA 4GXVH 3O4OB 1RJZB 4CADB 2VQTA 3C5SB 4JPIA 4M62H 1EGJH 1MNUL 1T3FB 1RZKC 3IDIA 5D5MA 1JUFA 1WSST 1W2KT 1ADQA 1QLEL 5EBLA 4MAYA 4EDXB 2WIIB 4KV5F 1NCDH 2QHRH 1MRCH 1XGQA 1BQSA 3SCMD 4FTVA 2W38A 3EOTH 3QDHA 3DNKA 4WFHD 5I17B 5IB3A 3BP4B 4QNPE 2UV3A 5JW5B 5LAXA 3DVNB 4ZUWB 5JDSA 2F53B 4Z9KB 5DK3A 2HRLA 3GMNA 3RGVD 4RSVA 3VXOB 5KAQF 3OAUL 2DLIA 2DQIL 1BD2A 3L3JA 4FFZH 3T3PF 5FCUH 4B7LA 3VFWB 4QYOB 3CLEH 4W6YB 4BSVB 1U58B 4U1MA 1FLRL 1IKNC 5CWSA 2R2EA 5DRZA 1XT5A 3KYNA 1XGPA 5EIIA 2PUQT 5D6CA 3MLXH 4MA8L 1CG9A 4FFWD 2FL5A 5JOEA 4HFUL 3QHFL 4QTIH 2OYPA 5T1LB 4M1GH 1A6ZA 1UWEH 4ZMAT 2Y5TA 4QRSA 4G8GB 2PYFA 4KTEL 4PGDA 3PABA 5EPMB 3ZKNC 1W0YT 3ALXA 3TA3D 3MNWB 1U3HC 1JFQH 3QYCA 1AXTH 3BESR 4N0YH 1OP9A 2EDHA 2A9NH 3C5ZC 4P2QA 1CICB 4G6KL 3BJ91 4UU9A 4LLVA 3K2MC 3QIBD 3SOBH 4KRPC 3ZE1E 4PG2C 4JANB 1JZ8A 1H5BC 4KZDH 4FP8H 4UZGA 4YE4L 4X6DE 4ORGA 5F7HA 1A1MA 5IJVB 1N8ZA 4PUBL 5CILH 3OHXB 1DJSA 3HLAA 1S9WB 4QHUB 2FX9H 4UTAH 1AD0A 5F1OB 3HZMA 5C0ND 1B2WH 2DQJL 5JUEL 4X80L 2Y23A 2V9TA 4JZJA 5HGAB 3VFNA 3ARQA 4Z76B 4QGYA 1MFCH 3ZYOA 5ISZB 5I1AB 1JK8A 1T1ZA 3E6HB 2X7LA 4G6ML 4QY8A 1BF2A 4NQCB 1ZT1B 5K59E 4YDVA 4WO4B 4OZGB 1LO2L 3IDYC 2CR6A 4CUCA 1YPZA 1QLRB 2NY5L 1CGYA 3WMSA 1XR9A 4OCYL 5GGSA 3D85A 1XGRB 3HC3L 1AKJB 2CDGB 3QZWB 1R3KA 4L4VD 2DDQL 4OLZH 3VWJD 3FN9A 3BQUC 4OZHF 1D5BB 4XPGL 1IBGL 4NO5B 5I1HL 1HI6A 1GZQA 5IEKB 2DLGA 4PJFB 2ZZUT 3VXRB 2DBLL 1UH4A 1AQKH 4UILL 2FEDC 3IRZA 4HIJA 4YFEA 1QBML 2RIKA 3IDJB 1LE9A 3BWAA 1KLUA 4QRRD 2OS7A 4GQPH 3BRFA 3IFPB 1E4WL 4HWBL 1HDMA 1RZKH 3FO9B 3L6FA 3FQNB 3MRHA 4DW2H 4Y4KC 2CIKA 2EE3A 4HULB 3CVHB 2DD8L 1QFWL 3DVGB 1RK1B 5CJXA 5C0AD 1J0IA 1KELH 4OLUH 3V9FA 1DR9A 4NZDA 4XPFH 3NMEA 1EXUB 2NTFB 5IBLC 5C8JA 3EJZC 4OKVA 4Z7OF 2VDKH 2A73B 2JLLA 1MIML 5HBBA 4NBYB 4NRYB 1CFQA 3QQ4A 4ETYA 1EEZA 2OK0L 8FABA 1HNGA 3TT1L 1EBPA 2WBKA 3B3IB 3S5LB 3VI4F 1INDH 1MCHA 5TDNA 3R0MA 3RAJH 1NLDH 3HPLA 2G75A 4ZUTB 1EA9C 1HH6B 25C8H 4MVBC 3NCYS 5I8KH 1IFHL 1I1AA 2X1PA 1U8NA 4OTXL 5GRJH 4PY8I 3AMKA 5AAWA 1SJHA 2IH1B 5IF0B 4H1LH 2C3VB 4V1DB 3HMXL 1N64H 4HH9A 5EU6E 2J2ZA 3O8XD 3OPZH 5DRXA 1F3RB 3DROB 1CXFA 4TVPE 3VD3A 4AG4L 5DO2D 1MPAH 3G6DL 1SYVA 4PGBA 5ID1B 4P2YA 4LQ1A 5JXED 5B3JE 2Q8BL 1FG9C 1W0WB 1UEMA 4GXUM 4XXCC 3I02B 2CKBA 2D3VA 3JTSB 4W4OA 3S4SB 1I85A 4X6CA 3WSQH 2P4AB 3QXVA 3GJFH 4F57H 4N5EC 1ZGLB 1WFNA 5HYQA 5CP3H 3BH9A 3DX8B 5CGYD 1ZLWK 5JLZA 3DIFB 2HFTA 4DFHA 3CU1A 2NTSP 12E8H 3VGAB 1KGCE 1H9VA 4QXUH 1YECL 5HD8D 2Z0BA 1S9XA 2VLRA 4RMUA 4MLIA 4KXZI 1ZHLA 2XQYK 5DD6A 4Z7UF 2Q76A 1H3GA 4P48A 1F02I 3WS6A 3D39B 1I9IH 3AY4A 2JB5L 1LEGA 2YR3A 5HDQH 2H2PC 4MD5B 3VD4A 4GBXB 4XB7A 4RNRB 3O9WB 3NFNA 3TJHD 4PLKC 3QCTL 1YEHH 5JZ7D 1D6VL 2P8LB 4FMFA 1B4JL 3DYOA 1UKTA 5E6IC 5C0IA 2AJUH 2ITDA 2DKSA 3VDCA 4JB9L 3HR6A 1MHCA 1QZ1A 4NZRL 1MJ8H 2DWDA 4HS8L 4IOFC 3T0WA 2HTKD 1G9MC 2WINA 2OTWA 4FZ8H 3H9SE 4Y5YA 2VMFA 2X4PB 4TTGA 3PHOA 1YY8A 4Y2DD 2IAMA 1UADC 2GEEA 1TQBC 2AJXH 4S0SD 3KYMB 4PJAE 5FYJU 4L29A 1LP9B 3SGJC 4ZFOB 2QL1A 3KYKH 3MNZB 3P3YA 1Q9WB 5IBUG 5FB8B 2VKWA 4JHBA 5T1KB 5D6DA 3FOLA 4EI5C 3OB0K 1IC7H 5DGQA 4YEFA 5EUOB 4DUXA 2XKNB 5I76A 4OZGF 1OAKL 2IGFH 3CMOH 4IIQA 1PG7H 4HIHB 3HI1A 3DMMB 3ZSSA 2MKWA 4JFZL 4K23L 4X7DC 4BFIB 4JCLA 4LSTL 2ZKHL 4LBEA 1PYWA 4UIKL 3SGDI 3O2WH 1RSFA 4ERSH 2FX8H 2IG2H 2P8PA 4PRHA 4QF1B 1HQRB 1KIPB 1PFCA 4PJFF 1SY6L 4J3SA 5HYIA 3B8SA 2GT9B 4Q6YA 5KTEH 3PQYE 1WF5A 5JHLL 4KDTA 3L3OA 1RZIB 4MJIA 5CEZH 5FEBA 1IGYA 2GCYA 5KVGH 3M1BB 5IT2L 1GGCL 1K9TA 2OXGA 5IWLC 5IHUL 4P4RB 5IEHA 5L88L 3UBXA 4P49A 5ACZA 4U1JA 1YEEL 3KHOA 1W8OA 1GGIH 5C0BE 2A74B 3KPSA 4Y5VC 5HHVL 3K8LA 1F45A 2PYEB 3MRRA 5CKAA 5IVZB 1X5AA 1EJ6A 3FB5A 4NGHL 5H35A 3KS0H 1U95A 3GBLA 5EC2B 1P7QD 4C83B 3KPOA 2YWYA 2BOBA 2ZCLL 2RGSA 4ZSOA 1LDPH 1BHGA 1CFSB 2JELH 1U6AH 2VRAA 4FQLH 3IT8D 1ZANL 1BFSA 2ICES 4HWNA 1KC5L 2M2DA 2YD2A 4QT5B 4L8DA 3HAEB 2F8OA 5FO7B 3GHEH 2EIDA 1M6OB 3K3QA 4JVPA 3D69B 2Z35B 2XA8L 3ZTNL 5JTWA 4O2EA 3V8OA 4DN4H 1JF5A 2HMID 2EIZA 2AGJL 3LS5L 2JJTA 1KT2A 3QDMB 1CZ8H 5K9KB 3MFFA 3MYJA 5EO9A 4I48B 5ERWA 1FCCA 3U0TB 5D1QB 3RDTA 4JM2A 3DETC 4P9ML 5EU4A 2VH5L 3SE4C 3WFBL 4KJYB 3V2AR 2V17H 1CICC 3ABZA 2YD7A 5C7XH 1BIIB 5EU6D 3IU4L 1HINL 4WI9A 5FK9A 1VENA 4TVPD 1G9MH 3V7AG 1GIGH 5CJOL 3ZYZA 3SDDA 3SY0B 2ARJB 1UXSA 2JCCA 1MHHB 4W81A 2RB8A 2ADIB 5DHVB 4KY1H 2C1PB 2Y7QB 1CN4A 4BZYA 1MJUL 3LKQB 2NW3A 1QFPA 1OD7A 4HK0A 3X11A 2VABA 3PP4L 3CXDH 1ORSB 3CC5B 2YD9A 1KGCD 4F80A 1UKSA 1CLZH 3ZDYE 1A1NB 4HFWA 3GI8H 4WO4C 2A2QT 1CGSH 4JZNA 5K9JL 3PXJA 2J12B 2Z8RA 4P59L 5BZDA 3NIFE 4PTUB 4NHUA 3AVEA 4LAJH 4MXQC 1YEDA 2J8OA 1D5IL 1FL6B 1G6RB 3MUHL 4UAOC 3EFDL 4G8EB 1RUKH 2JJSA 3CLFL 4HV8A 1ZGLP 5AYQA 2R4RH 4LVNB 2CXKA 1T1YB 3F12A 4W6XB 1MCIA 1LP9F 3KPRD 5LGHH 2W65B 2H6PB 1MELA 1TJHL 4ELMA 2WBWB 5TDPB 4TNVF 4AL8L 1VERA 4FXGA 2X1WL 4XX1E 1L7IL 2EDDA 2XZQH 5EUOF 3QULB 2OBGA 1AGDA 2YBRB 1R3IH 4WJ5A 3H9SD 1DANT 1DQML 3WXWH 2K3TA 1HYSC 3ARPA 1BQHB 4N0CD 4OCWL 3SCMA 4WFEE 3DUHA 3KGRA 3TBYA 3GZKA 4JRXE 4F9LA 3IDXH 1RHFA 4XP1L 1S78D 4PP2A 2ZUSA 4AIZA 2ED9A 3O4LE 2BJML 5I15L 1U9KA 1QVOB 2QKIA 3MGOB 5K9QI 1DBBH 2E5EA 3GEWB 4I2XB 1J1PH 3RGVA 1EJOL 1N4XH 4YPJA 3ARXA 2MCPL 3QQ3B 4QXTB 3IJHA 1I9EA 3AB0B 1PKQA 3GKWL 2ORBH 1MI5E 5FHAL 5CJQH 5IIEB 1HHJA 3BKYL 4Q9QL 5C0RL 3C6SA 4OGYH 1NCCL 4JG0L 4GRWB 5AG9A 1T1WB 3DX7A 4YXKL 4YHOL 1FFNB 2FR4A 2X70B 3RPIB 2EXWD 1PG7X 4CW1B 2F58L 5GGUB 4HKXB 3L3HA 4M6NH 4RGNE 2HJKA 3UZVB 3TA3A 3PQYD 1CBVH 2VXUL 1RU9L 4ODHH 5E2WH 2VDMH 3GHBH 3P11H 2CXGA 3WEXA 1YMHB 4LARH 3LVEA 3VWKD 2R4SL 4ZPVA 3ME0A 4ZFGH 2HH0H 5E0QA 1Q9OB 4WGVB 2XY1A 4WHYG 3EDDA 3QIBA 1YDPB 2MPAH 5AZ2H 1FIGL 4PJXB 3MREB 5C0BD 1HH9A 1DEEA 1S8DA 3VGAC 3Q0HA 1X6LA 1X5YA 3N1FC 1RUPL 2WUCL 5HI3D 5TF1H 4RIRA 4LCWE 5FYJH 2AAVA 3RHWF 3QO0A 1YQ2A 3NACH 4R4NC 4F7MB 2RBLA 4J4PC 4S1RH 1J86A 3MV9E 3LKPA 5JIPA 1L4IA 5IVXE 3ARBC 3PWUA 3VA2C 4JFEE 3SGKA 4LSDA 1B0WA 1QRND 3SGDH 3RBGA 5DMGD 3B6SA 3QAZB 4JZOA 4N0UE 3LKSA 5E1HB 1UB5A 3ARUA 4JFOB 4PP1D 1RUQL 4GBXC 4Z7WE 1A6WL 1RZJL 4J3TA 3RUGF 4FQIL 5F96L 1UJTA 2YPKB 5DJ2B 5EZLA 3UPRB 1CLOL 3SKNB 4L4VA 5CSGA 3VWJA 4RBPK 4YHIA 3V5HA 1V3MA 5ID0B 4MS8D 3TESA 3NTCH 3NN8A 2XNAB 4QRPD 4UV4H 1B9ZA 1A7OL 4A6YL 2NY0D 5FYKE 4M1DH 2QQNL 4Y4FB 2V5YA 2EC8A 1R24A 4X98A 1EHAA 1NFIA 3WKMH 4LKXA 3JTTA 3CFBA 3QO1A 3GFUA 1NMBH 4QRRA 1F6FB 4GAJH 2D03L 3IFOB 3CFEB 3RVWC 1I3GL 4BQ8A 3KDMA 5A2LH 5KZCD 3DUSB 2R29H 1QBLH 3ECBB 1ZVSA 4OCRL 3CVHH 3I6GA 3WIHH 3DOSA 3IDGA 3UC0H 2RAMA 1UZ8A 1NKOA 1NAKL 5C0AA 5FYLE 1INQA 3SKOB 4KI5F 1FRGL 1L9NA 2IMNA 2ZOLB 4RMWA 3U30B 1KN4H 2J8UE 4G8IA 1A1OB 2I60L 2Y6SC 2CUMA 5CINL 1XZ0A 2DTML 4E9LA 1CIDA 5JO5B 1SEBA 1FO0A 3OZ9L 2GAZA 1C12A 1MCFA 2AJSL 4KTDL 4FS0A 4U7SA 5FF6B 2DMBA 3TYGH 3MLTA 1IJ9A 4QCIB 4U6VH 1A4JB 4ODWA 1ULVA 5C09B 5F1IB 3M17B 2PXYB 3V6OC 3MRJB 2O5ZH 5FGCE 1LILA 3O8XA 4G8FB 4OZ4B 2R39A 1MCRA 4Y19B 2X1OA 3RPKA 4RGOH 1U91A 5DJCB 5I8OH 1KB5A 2XFXA 3MXWL 1U8LB 3LH2H 1L0YA 3ARTA 3QRFM 3MRMB 4I77L 4BSWB 4V2BA 1BJ1H 2QADD 2W07A 3VFMA 2FWOA 5T3ZE 5BXFA 1UEYA 1N6QH 4OV6F 1HK6A 4J6RH 4X6FB 1WZMA 2V2TB 2E6QA 5EWIL 4JKLA 5F44A 2H3NA 1NGQL 3FB6B 1JTOA 3KXFB 2F54E 4U0RB 4LEXH 3BFOA 4WV1C 4MB5A 4JO3H 2JE8A 1A3RH 4U1KA 4WFED 1IAKA 2EDLA 4OLYL 3FCTA 2IFFH 4JRXD 1J0HA 1HHHB 3O3UN 1FVEA 3DXAE 1IMHC 3F7QA 3PE9A 4QTHB 3DPBA 3O4LD 4LIQE 2WWMD 5HYSA 3GK8L 5J6HA 4U1LA 1NC4D 4MQXD 5KSAD 4TNWK 4GXUN 3C87A 4KQ4H 2VXVH 5J8OA 2CRYA 4KHTH 4ODSH 1MI5D 3L3GA 2VXSL 5EN2A 2PR4L 4AIOA 3CUPA 4GUPB 2BC4B 1S7VA 4NWTH 4PJXF 3SKJH 1IM3B 3VFGH 3DX6B 1MY7A 4NM8L 1OAYL 4TRPL 4OF5A 5BOPA 1QFOA 2PO6D 1J0KA 1HILA 2Z93B 1ZSDB 3RJQB 4ESKA 1ZA6A 3TJEL 5FOBB 5IB4B 4PJBB 1M4KA 5JHDD 3L1OH 3V4UL 1S7UA 5ALCH 2J6EA 5DR5H 2W9EL 4LVOC 4X5LA 1FNSH 3CFJA 4NO0B 1S7RA 2VXTL 2NY4D 4LLDA 4OCLC 4X9GA 5I19L 3PWVA 5HSFA 1CWVA 4ZUVB 2J5LC 5DYOB 5C6TL 1J1OH 3FAWA 1LO0L 1ZHKB 4X6DA 5FHBH 1I8IA 4BUHA 4EVNA 2VDOL 3NAAL 4K3JL 4DQOL 1S7SA 3FN0H 1C8PA 3RI5K 3BIKA 1P1ZB 4LCWD 4DCQA 4KROD 4L5FL 4KI5C 5E9DB 2YD6A 4X7TB 4CVUA 2HP4A 4HGWB 1I3VA 3T08A 1K8IB 2VQ1B 1XAUA 4XVTL 4JHWH 4XWOD 5T1MA 3U4BL 5MEQB 4NQSA 4ELKA 3ZT7A 2LU4A 1KCVH 1EHLH 3T8XB 4QOKB 2XYCA 1YQVL 4PJCE 1WUNT 2XN9E 5SWQB 1T04B 3UDWC 5ICZA 2I27N 1KCKA 5ANMB 4CVXA 3O6KL 5CBEB 4YX2H 4S10A 4F58H 3HC0A 4N9GA 4LDEB 4JFQA 4OQTL 2B8OT 3MUGA 1RIUH 4NJAH 2XA3A 5TQ2H 3AM8C 3QJHA 4M4RA 4TUOB 4JHAL 5F88A 1TETL 5FYKD 4LASL 5IROA 3IGAA 2FATL 1JPST 1JWSA 2OR9H 2C4FT 2R0WH 4YZFE 2H26A 2JJWA 5BJTA 3QQNA 1G7LB 5ESQA 1P7QA 4GG8A 2BSTA 4G9DA 3LEXA 4MHHI 3QCVL 3HR5A 4MD4A 4KUCD 4XXDB 1K85A 1NBZB 1TIUA 3EOBB 4C57C 1HXYB 1AY1H 3RL2B 1XF2B 1V7ML 1JPSL 5IW6B 1LO3H 2H9GA 2BVPA 2Q3ZA 4Z7NF 1T80A 3GM0A 1A7PL 1MCJA 4G42B 3E8UL 5C0EB 5FYLD 3U4EA 3LDBB 4N8VA 5FM5O 4KUZL 4WTWA 3NCJH 2O5XL 4YHZH 1IARB 3B9EA 3IKCA 2BVUA 2E27L 3F8UB 1VFUA 3KJ6H 1P6FA 2AI0L 3DYPA 3RWCA 5IFJB 1H15B 3F5WA 2ZUUA 4OLWL 3U0PA 3H7LA 1HIMH 1MWAB 1UWGH 2GKIA 1VFMA 4G6AC 1KJ2B 3W5MA 2I9LA 1P5VA 3STLB 3UAJC 4N8CL 5TGBB 1U8MA 3VD7A 4X8JA 4EDWH 3ISWA 4LNVA 1MLBA 2Z31B 3BO8A 2UZIL 1KEML 3RVVD 2Z9TA 4CNIA 3OAZH 4M43H 2V7NA 1MCQA 2F5AL 2QQKL 5FUZH 5EU6A 1KIQA 3MODL 3FT3B 4O51A 4X9BA 4LHUB 3X17A 1T0NA 2HKFH 3WLBB 5HJ3B 2QBWA 5DMIH 4OCXL 2MCG1 43C9B 5AUMA 3PWNB 5CZKA 1ETZA 4G7YH 4H1LG 5DJYA 5IBTL 4H88L 4HUXA 2BSSA 3PP3K 4RISH 4Z7QE 2DQFB 4O5LH 2YPLE 3FO1A 3I9GL 4JE4B 1D5XB 5T3ZD 3SJVB 1YJDL 4P2RE 4IS6B 5SWSB 1DBAH 1UYWL 1YY9C 1F3DH 2A6KB 2HJLA 2F54D 4P3DB 4PTTA 15C8L 1WISA 4XMLL 2BFVH 1OTTC 4PB9L 4UQ2A 3QAZC 2DI8A 3S34L 3L7EA 3V7AE 5HYJB 1GC1L 4S1DC 2GHWB 4YHPA 1D5ZB 1KTLA 1NL0H 3AGVA 2YUVA 3BKCH 1CGVA 1AGFB 4XI5C 4R0LA 1MCKA 1I4FB 3CDGB 5MERB 3IAPA 3LV3A 4X4YA 5IGXH 3QCUL 3DXAD 3U0WL 2CUIA 3WFHB 1MJJA 3OWEA 5KVEL 3U7AA 1FZMA 4LP4A 4XWGL 3K80A 4RFEA 5MP6H 3QFJE 5HHOB 4S1SH 4PJBF 3BKMH 1CD1A 2FHBA 1VFAB 1WWBX 4NZJA 3REWB 4AIXA 4AY0A 5I1IH 1FFPA 4I0PB 5JW4M 4MNGB 5I30L 3ARDB 4YO0B 1BREA 2DQCH 4YGAB 1CDHA 3ZE2E 1IL1A 1AGEA 4UDTB 3TH4T 3HI5H 5CLWA 3MACL 4OZFB 1FBIH 4LDOB 4JRWA 5T3XH 3B9AA 1O7SA 4Z0BH 4GKSA 4K9EL 3H9SA 1CFNB 2OL3L 4YIQB 5F7FA 1E27B 4EBQH 4U33A 4ETQA 2ICWB 5J6GA 3MBXL 3U30C 1TZGH 2OXHA 3ARFD 1JHTA 1LNUB 3QG7L 5DEZA 2I5YH 5DQDL 3ALWA 3UTZB 5IFAL 4HXBL 3QEGH 5HHPA 2VDPH 5ACMA 1AO7B 4DJMA 5JORB 1V3LA 3T04D 3UTPE 2VR5A 1KN2L 4NM4H 4XPHL 1KENH 3FQRA 3C5JA 4R8WH 2FRGP 5DD0H 2PXYC 1TNMA 5F3BB 3R4DA 5DMYA 1DLFL 5IHZA 3O6MH 5GJSL 4YAQB 4NJ9H 4N9OB 5J89A 3C08H 1F8TL 3ULUL 2C3WA 5IG7A 2GJZB 5EUKA 1VB9A 2BDNH 1WBZB 3PQYA 2NR6D 4WUUE 1X5XA 2CK0H 2VLJB 4HUUA 4BKLB 2V5RA 1T5WB 1X7QB 2XN9D 1SJXA 5ESVB 1HKFA 2OP4H 4FQ2H 1FPTL 4ZS6D 2XPGA 3VWKA 5CCKL 4Z7VE 1DQLH 1OD9A 5D7IF 2YSSB 1T2QH 3SDYH 1F4XH 2V9QA 1FZOB 3GMPA 4Q74A 1C5DA 3CDFA 5CZXC 5F7KC 1S9VB 4YHML 1SEQL 1KLFA 4PJHF 5C0BA 1P2CB 3HE6C 1P4BH 4UMGA 1WZ1H 4I18B 2EKSA 1NBYA 2VUOA 4FNLH 5E08L 4OB5H 4NKMA 4X4XB 2C5DC 3D2UD 3RU8L 9CGTA 1ONQA 4EIZC 2IBZY 2NY2B 1WC7B 4H5SA 2VDNH 1C1EL 1RK0B 4XHJC 1N5YL 4X9FA 2JTDA 4LNRB 2AXGB 5F97E 3SDXF 1DVFB 5ICYB 3ZDXE 3VFUA 4YGVB 3C6LA 1F4WH 3LS4L 4CGTA 1QRNA 5IB1B 4OLXL 2P42B 3MCKA 2FBJL 3I84A 1IC4H 4IEFB 4OUUA 4Q9RH 2ADJA 4WHTA 1QP1A 5I1CH 5C9JB 2J4WL 2P8MB 3QNYA 1NUNB 2YD3A 2A38A 2P5EB 3WFCL 1BVLA 5EH1A 2R1YA 4K07A 2CO6B 3REVB 3I2CH 3ELAT 3O6FB 5TQ0H 1KBGL 1MHPH 2CSPA 4P5TB 1Y6MR 4M6OL 4RWHA 1G7QA 1T0MA 4BFEA 1FL5B 3SDAD 3W9DB 4M61B 3NIGE 3OXRB 4JAMB 4MAUH 1EUTA 4UV7H 3JZ7A 2EH7H 2XOTA 3P0GB 2EO1A 1DZBA 4O2FB 4EI6B 3QUYD 1VGKA 3BUYB 3P77A 3DVIA 3DX9B 3PGDB 4IOIB 2GTWB 4NDMA 5F93C 2YPLD 5B39A 1HEZA 3C9NB 2A6IA 5JIHA 3L9RA 3C2AH 1NBVL 4HD9A 4P2RD 1RULH 5GRUL 2YRLA 3FFDB 3ARED 4L8BA 1G7JA 1V7NH 4LP5A 2Y07H 4KDVA 3O41B 4XPAL 2P7TA 3DV4A 4JPIB 4D0BA 3FMGL 4NNXB 4G5ZH 4M7KH 4CL7A 1BJ8A 2CDFA 5DC0A 3IDIB 1NCTA 5D5MB 2Q87A 1JUFB 5D2NC 1IM9B 4XBGB 3FFCE 5JMOC 4HT1L 4MAYB 5E8NA 5EBLB 3MRLA 4UT9L 3WV0A 3BIAX 4LCIL 4FTVB 5EG6C 4UT7L 1QFWI 1YYML 3S35X 4PJ7F 4GKOA 3QFJD 5IB3B 3HA0A 5ADOH 5LAXB 1JL8A 4H25A 5JDSB 1OAUL 3WUWG 3T3ME 4PRDA 3GMNB 1UZ6E 1OSPL 1CVSC 2FJFA 1BD2B 1NGPH 3DYMA 2I9TA 3RVXD 4UNVA 4NQXA 4C56E 4U1MB 5CWSB 3BAEH 3DHJA 5FOJA 4D0DA 2R2EB 5DRZB 3KYNB 2R0LH 1CXHA 1YN7A 3JV4A 1XGPB 5EIIB 2BVYA 5KSVA 2UY7A 2ICWI 5D6CB 1PJ9A 4Q97A 2P46B 1CG9B 4TUJA 5BZWB 4M9OA 3Q5TA 4ALAL 1A6ZB 3KR3L 4Y7MA 4PGDB 3C60B 3PABB 3LDBC 5T33L 3AXLA 4ZG1A 3RX8A 1WTGT 4JRXA 4HXAL 2BRRH 1EHXA 3MBED 3O4LA 1YNKH 1Q94A 5ALBL 5D8JL 3LKOA 1Y0LA 4Y4HD 4F9PC 1P7HL 1NC4A 5BVPH 5KSAA 1U8OA 2V7HB 4P2QB 3D48R 2NQCA 4NP4L 4UU9B 2NLJA 2L0DA 4LLVB 2VSCA 5B4MD 2CGRH 1KV3A 1M7DA 1MI5A 3UTPD 4XAWL 1LO5A 5KG9A 2XKSA 1RIVL 4DAGH 2Z31C 1T7ZA 2NYYC 2IADA 4ORGB 3V7MA 1A1MB 1TJIL 2L7UA 1N8ZB 5HI5D 3HLAB 3MSPA 4R90H 4WI6A 4FQ1L 1DP0A 4TTDC 1AD0B 1U42A 3DURA 3HZMB 4MMZC 4DKAA 4ZQKB 3LIZL 4RGMB 2WLZA 5L6YH 2PO6A 4HX1A 5CLTA 4JZJB 3VFNB 1TJGL 4WUUD 3VXPA 2NY3B 3WLWD 4JJ5A 2Y9RT 1T1ZB 2FDBP 4QY8B 5JHDA 5I75C 2AJYL 1FH5H 1EAPA 3KS0J 2XWJA 3EFFA 3O2DA 2NY5C 4YDVB 4FABH 1RHHA 4G7VH 5HHQA 1YPZB 1QBAA 5F1NA 1XR9B 5I1LA 5GGSB 4HC1H 4OD1H 4M62L 3D85B 3U2SB 3GO1H 4CRPA 5GGRY 1R3KB 4F8QA 3HE7D 1BLNA 2D0GA 4XCEA 1QSZA 3RIAK 1HI6B 3MXVH 4LCWA 1GZQB 4JRYE 4J3XA 2FB4H 2HKHH 1A0QH 1A7RL 5A2FA 5IVXA 3RWFA 3RZCC 4HIJB 2X4QA 4I3SL 1LE9B 3BWAB 1KLUB 1MNUH 5L8JB 2G2RA 4N0UA 4QRUA 4XRCA 1BF8A 4ODUA 1FQ9C 1DL7L 4YLQT 2GFBA 2HLAA 1WBYA 4BYHA 1HDMB 1QLEH 1WT5C 4AMKL 4Z7WA 3L6FB 5FCUL 3CLEL 4I0PC 4MB3A 3MRHB 2CIKB 2BHUA 3IDNB 3PXHA 3IKKA 1XCTA 4NUGL 1R3LB 3MLXL 1MCPH 3WN5A 3T0EE 1NC2D 5ETUA 4HIIA 1IILE 4Z18A 3B43A 5C8JB 1E4XL 4OKVB 1XGTA 5SWZE 3HC4H 3OAUH 2DQIH 3VGGA 4PGEA 3DO3A 1CFQB 4E42A 1EEZB 1FLRH 3JVGC 4WEUD 3TIDA 4DWHA 1JFQL 4OLVL 5TDNB 2G75B 2ICCA 4MA8H 1GZPA 1U8NB 4HFUH 3QHFH 3BMVA 4LPTA 2WWKT 3EJYD 1SJHB 2ARWA 3SOBL 3UCRA 4KTEH 5D5MF 5GSRA 3B8YA 5DRXB 5GGQL 1ZGLM 2YD5A 3PHQA 3I3DA 4UQ3A 1SYVB 4PGBB 1MAKA 3TBVA 3WHE0 4D9LH 5C2BL 2GUOA 1F42A 2AQ3A 3LPGA 3NZ8A 2CKBB 4QRQA 2HG5A 4TULL 4X6CB 1ZLSH 3BEVA 4PY8J 4HUVA 5CP7A 2ZSWA 1L0QA 1E4KA 5HYQB 5HY9A 4YE4H 4MJ4A 3BH9B 1JP5A 5LGJA 5JLZB 4PUBH 4LFHG 5FGRA 3FFCD 5J06A 3VXUE 1S9XB 2VLRB 3TBWA 3LY6A 5GS2D 1T1XA 3S5LG 5JUEH 4X80H 1ZHLB 4WTXA 4DVBA 1DE4A 1UB6A 3QDGB 5DD6B 3KPLA 4S11A 2Q76B 3UEZA 4I18C 4G6MH 4LLMA 4OV5A 4M7LH 4E5XB 4X4ME 4LLYA 1DQQA 1LEGB 1R6VA 3QDAA 4PLNC 1LO2H 1AQKL 2P24A 4PJ9D 2NY5H 1G0DA 2Q7NA 4JFDD 1RAMA 4OCYH 4C56D 5L8LB 1IGJA 3HC3H 3NFNB 3UMTA 5D7JD 1Q0XH 3B9DA 2VR9A 2DDQH 2F54A 5GS0L 1KXQE 1P53A 4KKCD 4QHMB 1OHQA 5C0IB 4XPGH 1IBGH 3QXAA 4WU7A 4DOHB 4DGIH 4DW2L 1MHCB 4JKMA 2DMCA 2DBLH 1U8JA 2DWDB 1JF1A 3DGCR 4P4KD 4YDLB 4UILH 3N85H 2WINB 4OLUL 2OTWB 4Y5YB 1QBMH 3PHOB 3DXAA 1YY8B 4LDLB 1CFBA 2ED8A 1TZHA 2A1WL 3GSQA 4R2GC 2D7PA 4L29B 5DGRA 1E4WH 4HWBH 2AK4E 2AW2A 1ORQA 4IDJL 4M1CC 3FOLB 2DD8H 1QFWH 5I76B 3T0XA 3W0WE 4IIQB 2ZSVA 5DC9B 3HI1B 5D2LE 1YPZF 4HZAA 4LAQH 3BIBX 4M7ZC 3TYFA 2ADFL 4WEBL 1OTSD 5FGBA 4LBEB 1PYWB 1N64L 4IJ3C 3IB4A 3U83A 2P8PB 4PRHB 1OGTA 2OK0H 1MPAL 4GOSA 3TT1H 1GYAA 4AH2B 4G43A 4HPYL 5JNYA 2UUDH 5IVOA 1IFHH 3ARFA 4OTXH 1Z2KA 3L3OB 4MJIB 4JR9H 1B88A 4F57L 1IGYB 2GCYB 3MJ9A 4APQD 5I9QB 3HMXH 1SVZA 5HGDA 1T20A 2X44D 5EU7C 2KQNA 3UBXB 3H7BA 1WJ3A 5ACZB 4U1JB 4XCYB 5HPOA 1KCLA 4FN0A 1BX2A 3QHZL 2D9QB 3KPSB 2LVEA 2Q8BH 4MAYC 3MRRB 3FB5B 5H35B 4LSUL 5GQBA 3RKDC 1U95B 1PW3A 4WY7H 1P7KA 2D0FA 5I16B 1RFDL 4K3EL 4GKNA 3QNZA 3KPOB 1WZLA 2BOBB 2F8VA 1A2YB 4ZSOB 3V0AC 5DJDA 4AM0A 1DANU 5HI4D 1KCRL 4XNYH 3ZHDA 2AP2A 4DVRL 4PJCA 1JHLL 1FFRA 2XN9A 1CTNA 1LVEA 4MJ6A 5EO1A 1BFTA 5EBMB 1EDQA 1KULA 2WP3O 5C0DA 3VJ6A 4ZAKD 1YEHL 5C70A 1RIHL 4HMEA 4L8DB 4KV5E 3WO3B 3T0ED 5DZOA 3MLYL 3EYQD 4O2EB 1JMXA 2NZ9C 3K8KA 1FLTX 2JB5H 2I24N 2E3VA 4AEEA 2EIZB 5SWZD 4HHAA 4N1EA 3D2UA 1N3NA 5L9DH 4L9LA 1PLGH 3C60C 1DDHA 3MFFB 2VO5A 2HYMA 3MYJB 5EO9B 3NFSL 5ERWB 3MJ6A 4TYUA 3RDTB 4FFVD 3QCTH 3PWLA 3T3PE 1D6VH 3LHPL 3TO4C 5EU4B 4JFYA 3PJSA 2FH6A 5DEGA 3ILPA 1CK0L 3RKPA 5CEZE 5DVKA 3ZE0E 1CDCA 4NZRH 4HS8H 5DFVD 1S7TA 1F97A 4KMLB 5T5NG 1PG7L 2Y25A 2R9HC 1W72A 4I1NB 3BZ4A 2EDOA 4WW2A 2IPTL 3SDDB 3U6RA 1YA5A 4EEEA 1UXSB 2C4XA 2JCCB 4HZLA 5AEAA 5J56B 2NY1B 4RGMC 2FJHA 3I3EA 3V5DA 3HUJF 5DJ6A 5J13B 2NY3C 2NW3B 4HK0B 5KTEL 3X11B 2VABB 4RZCB 5DURB 1OAKH 2HRPL 4HK3J 1BWWA 43CAA 3VXUD 3SDAA 4K23H 4JFZH 4XP5H 4HFWB 4MNHB 5M94B 4LSTH 2ZKHH 4JZNB 4UIKH 3H3KA 5KVGL 1X4YA 3E3QE 4X7FC 4FQXC 2D4FA 5BZDB 5GRZA 3QUYA 4NHUB 1CDJA 1YEDB 2V2XA 2YPLA 1KJ3L 2DQHL 2DQGL 6FABL 3BGAA 1N5AB 5JHLH 1QFHA 2IFGA 1AC0A 2E7LA 4P2RA 1ES0A 1V3JA 1UGNA 3WHXA 3AREA 4LSPL 1GGCH 3F12B 1UFUA 5L88H 5E5RB 4POZC 2W0LA 4ONFL 5EZIL 4ELMB 2JELL 4P2OC 1U6AL 1YEEH 2X1QA 4G9FB 4FXGB 5DXWA 3RRQA 3R06B 5HHVH 1IEAA 1XH3A 3F6IA 4OZHE 3RWEA 4NGHH 1AGDB 4WJ5B 2GJJA 4FA8A 1U3HD 3SCMB 3EDJA 1HOCA 3QUKA 5B8CA 4K3DL 3TBYB 3ALPA 2AK4D 2E7CA 3QFJA 4U1GB 4PP2B 1ZANH 4NKQB 1U93A 2X09A 3BP6A 3MLPA 2QKIB 3BGMA 5DC4B 3RGVB 3VMOA 3W0WD 4KAQL 4DUWA 1PKQB 3SPVA 1HHJB 2XA8H 3GSNA 5SV4A 3ZTNH 2V17L 3C6SB 2BZDA 5ACLA 4NCDA 5HVGB 3PF2A 1HZHL 4HG4J 2AGJH 3LS5H 2IMMA 5KJRH 2I25N 3DX7B 3KPTA 3MLUL 2FR4B 4Q2ZA 1GIGL 2BY3A 3FO2A 3QUML 4U31A 3L3HB 3QWRD 2HJKB 3TA3B 4CU6A 4IBLT 4PBWD 3LMJL 3FB7B 4P9MH 3LOWA 2VH5H 2X4OA 3WFBH 3MBEA 3UBXI 3WEXB 3WJLA 2OSLA 3K7UA 3SE8L 4Y4HA 2ZNXA 4ZPVB 1I85C 1R5WA 1ZXQA 3IU4H 3B2VL 1I8LC 1UVQA 5TDOB 3QIBB 3GBML 4WWKC 4PJ8C 3C09C 1R0AL 3BQUD 1HSAA 5CJOH 3OKLA 3ZKMC 1HH9B 1DEEB 3HS0A 1BMGA 2B1HL 2X4SB 3VFSA 2OQJA 5FM4A 2XTLA 3P73B 3P4NA 1RUAL 2BNUB 2LU3A 1S9YA 2FEDD 3QO0B 5CBAA 1QEWB 4X7EC 5E5MB 3LKPB 1AP2A 4WUUA 4X83A 3PWUB 1ZLVK 4RAUA 4K94L 1RZ8A 1ZA3A 4U6XA 5H2BA 4WDIA 2R4RL 4JZOB 5K9JH 4Z7VA 3LKSB 1UB5B 4Y4KD 5KANG 1UWXH 1RZJC 3N1QC 2WAHA 5I74B 3X12A 4P59H 2VAAB 4OGZA 1JF6A 1XGYL 1DQJA 2CUHA 1D5IH 3EGSA 5EZLB 4Z7UE 4L4VB 4GG6E 4RFNB 3EFDH 3VWJB 5IBLD 4YHIB 3EJZD 4PR5A 3FO0L 3V5HB 2C26A 3RWGA 4AQOA 1MSPA 3DGGA 5I2IA 4G8GE 3NN8B 5EOQL 3P2TA 1QSEE 5KOMC 4H0GA 1R24B 4X98B 1N6VA 1TJHH 1NFIB 3TP4A 4LKXB 3JTTB 3CFBB 3TWCL 3IDXL 2HN7B 4K71C 2D31A 2Q1EA 3QO1B 4MVBD 4AL8H 3BP7A 1L7IH 1V8HA 4OCSL 4QRRB 1UA6L 3U79A 5CEZD 3A6BL 4ZFFA 3IFLH 4X8XA 1DBBL 4CDHA 5D6DC 2BY1A 3KDMB 2DKUA 1ZLWH 3BI9X 1ZVSB 4LRIA 1DQMH 4MDJA 2ORBL 3I6GB 3HZYA 2ID5A 3IDGB 4OCWH 2BXYA 4IIQC 3GRWA 4JN1L 1UZ8B 4URTB 5C0AB 1INQB 3ROLA 3STZA 1KPUA 2R0KL 3HMWH 4R6UA 5IVNA 4XP1H 1NC2A 4G8IB 5EZOL 2BJMH 4XMPL 5I15H 2NXYC 2AEIT 1XZ0B 1K6QH 2WV3A 1Q9LB 1EJOH 4M6NL 3UTSE 1SEBB 2MCPH 3MV11 3GKWH 3PV7A 5E2WL 3P11L 2GAZB 1C12B 5L0QB 5JIKA 3BKYH 4Q9QH 5C0RH 4MYWB 3GM8A 3MLTB 1NCCH 4JG0H 4HDIA 2IQ9L 4ODWB 1KTDA 3MLVL 5K9OA 4YXKH 5AWNH 4YHOH 2Q7YA 1AI1L 5I9QC 1F3DJ 1VFBA 3QWQB 2MPAL 3MJ9L 4RDQG 1A14L 2F58H 3KNBB 2CRZA 1VPOL 3O8XB 1F11A 2VXUH 1JBJA 2XZAL 4KI1A 1U91B 2A0LC 4WVRA 5DUML 1MCNA 1KB5B 4OIBA 3L3IA 4I3RL 3M07A 4RMSA 3H6JA 1A7NL 1H0DA 2H2PD 1B3JA 2EECA 2R4SH 3LRSA 2CKBH 4QXGL 3VFMB 2FWOB 5IB5A 5BXFB 5D71L 4PLKD 2H8PA 3I6KA 2H3NB 4M5YL 4AEHH 1D9KC 3OB0H 4KGJA 1N2RB 4JREB 2HFEA 1RUPH 3FFCA 5EBGA 5EZJA 3DBXA 4EN3D 4IOFD 1NAMA 3LD8B 5HXMA 5GRVL 4PYHA 1JHKL 3QPQD 4MMXC 2P49B 4YQXH 1IAKB 3UZQA 4PJ5D 3FCTB 2DL9A 3MJ8A 2VN4A 1FVEB 3RY6C 3W82A 3HPJA 1HQ4A 5F9AC 3MRNA 3DV6A 1PX3A 5HYSB 3ULVE 5J6HB 4F7TA 5DF0A 3OJ2C 1F90H 4UV4L 2JJTC 4HCRA 1L6ZA 4U1LB 4BH7B 4EI5D 5E70A 3IVKA 1RUQH 4OGAC 2GSIA 1KACB 1RZJH 3BYTA 1AR1C 2FHCA 3L3GB 4C56A 4FQIH 1RJLA 3RDTC 4LCCC 5C07E 5F96H 1MLCA 5D7JA 1CLOH 4GAJL 4JY6A 1S7VB 2HLFC 4NO3A 5DJZA 2R29L 3LB6C 2DB8A 4X5XA 3CVHL 4A6YH 3B9KD 4IMLA 4P4KA 4P99A 1HILB 5E5UB 1ZA6B 3VXME 4OF7A 4PGJA 1S7UB 1LQSR 4NNPL 3CFJB 1I3GH 3S3JA 1S7RB 4LLDB 3LCYA 2HFFA 4OD2A 3PWVB 1F00I 4OCRH 3VRIA 3MJGX 5J13C 4X7SH 3GMLA 3BPLB 2FGWH 3BPNC 4R7DA 4X6DB 5FUOL 1PDKA 2AXJA 4BFBD 3MJ7A 4EVNB 2OJZL 2FZ3A 2WUBL 1FRGH 1S7SB 1J05B 3K2UL 4M6ML 2I60H 1OAXL 5CINH 4DCQB 3WFDL 2DTMH 4DEPB 5DJAA 1EHNA 3OZ9H 3U1SL 4XMKH 4RGOL 1ZLUK 5T1MB 5GS1C 4NQSB 4ELKB 4CMHB 2EYTA 4GSDH 3KLHC 1Q38A 3QH3A 1N6QL 3P30H 1IAII 2WMPA 2HT4C 4APQA 3OV6A 5ICZB 5D70L 4CVXB 4I5BA 1U8QB 1A7QL 1DBKL 1SBBA 1XFPA 4J7RA 4N9GB 2R0ZH 4HUKB 4JFQB 3LZFL 3MUGB 3MUY1 4P46A 4G8GD 4JRYA 3QJHB 2LAAA 1XR8A 3TPKA 5F88B 1BZ9B 3IGAB 1JWSB 2H26B 2IFFL 5BJTB 4JPKH 1U2HA 4OI9A 5ESQB 3SCMC 1P7QB 1A6VH 4GG8B 2BSTB 4G9DB 2HJFB 3LEXB 5EWIH 5E8EA 4F9LC 3HR5B 4MD4B 4R26L 1D7FA 1CICD 3RX5A 4YC2B 4GLRI 4KQ4L 2VXVL 4TNWF 1HHIA 4KHTL 1KG0B 2H9GB 2BVPB 2YC1A 2JKXA 2R2HA 4OLYH 1XMWA 4N8VB 2F19L 1CFVL 3T0EA 3IKCB 1WIOA 5FYJD 4NWTL 4HLZH 3GK8H 3BH8A 2I26N 3RWCB 2AV7B 3F5WB 5SWZA 3E6FA 5HHME 3U0PB 3UTSD 5I73B 3RZWA 4JLRA 3WDHA 5ISZD 1M7XA 3GMQA 2VXSH 5E7BA 2I9LB 2DQUL 3S9DB 2PR4H 1U8MB 3L1OL 1I3RA 5GGTL 5D7SL 3NCMA 1MLBB 3TLRA 3BO8B 5ADPH 4ZFOL 4L3EE 4CNIB 2V7NB 1J1OL 4NM8H 1OAYH 4TRPH 3V6OE 5EU6B 1KIQB 3QIBC 3EYVA 4NC1E 5GGRA 2GITA 4O51B 4JG1L 4J12A 1T0NB 1T7WA 1C08A 4IOSD 5AUMB 1ETZB 3FN0L 4ENEC 3GUTA 2CH8A 4S2SA 5DJYB 3V4UH 4EOWL 3FRPG 2DLTA 2BSSB 1NCAL 2W9EH 3FO1B 1YJDC 2VXTH 2GK0A 5I19H 4P3CL 2MNUA 4QNPF 4C4KO 1FIEA 3V6FA 1LO0H 4PREA 3QHTC 5FFLA 2VDOH 4PTTB 3NAAH 1GC1C 4DQOH 4UQ2B 3L7EB 3VXUA 3BOVA 4YHPB 3BE1L 1KTLB 5IW3A 5I74C 4L5FH 1B0RA 1HYSD 4FQCL 1Z9MA 4R0LB 3GMOA 3V0VB 3CXHK 1QFWM 2FSEB 3LV3B 4F58L 4X4YB 4JVUA 4XVTH 2C3XA 1MJJB 4J1UB 3TZVC 3U4BH 4RFNC 3VWJC 5I71B 1RIUL 3ULVD 5TQ2L 5E6ZA 4X4MA 1FZMB 5B38G 2X4TA 2R15A 4RFEB 3G6AA 2OR9L 1YQVH 1A47A 1NQBA 4HWZA 4ACPA 3ZHKA 2CKNA 1K8DA 1FFPB 1IKNA 3O6KH 3FJTA 3W11C 3VA6A 5JMRA 4OM1L 3QEHA 1AGEB 3RUGE 3LN5A 4OQTH 4U49A 1CQYA 4H1LA 2O5YL 1YUHA 1ZE3C 1LO3L 4K9EC 4JHAH 1QHPA 1TETH 4LASH 5E2JA 4YXLL 1VGEL 2FATH 1AQDA 5F3HB 3UPCA 4GKSB 3H9SB 5FO9A 4EIGB 1KIRB 3VXMD 4ETQB 1U3HA 3MA9L 4PJAB 3KJ6L 3HI6H 1Q9KA 1QO3A 4YBLB 2AK4A 1RI8A 1ZVYA 1JHTB 1DFBH 1T2XA 1V7MH 1JPSH 3GJFA 2J1KA 1A7PH 5CP3A 1H5BA 2YPVH 3E8UH 3E2HC 4NIKB 5K59F 5HHPB 3W0WA 5L0QC 1JNJA 4TSBL 2O5XH 1JV5A 5D2LA 5JOPE 2E27H 3FQRB 4KK8D 3C5JB 4RAVA 3NPZB 2E9BA 2N1KA 3ARRA 4R4ND 5IHZB 4J4PD 3WIIH 4RBPH 4LLAA 4HJ0C 2AQ2A 3O8XC 3ULUC 2M1KA 1A7BA 3F7VA 3ARBD 3L5WA 3QWRA 5IG7B 2BOCA 5EUKB 3PQYB 1U3ZA 2UZIH 1KEMH 3MOBL 5C08E 2PW1A 4HUUB 4U7KA 4GBXD 2F5AH 2XPGB 2QQKH 3VWKB 3BEWA 3MODH 5LBSL 3VFTA 2X1XR 1UACL 4BK5A 1Z9OA 1IC5L 2F5BL 1SM3L 4RMTA 5FA3A 4OZIF 2V9RA 3BQUA 3R1GL 5IBTH 3QDJE 2EKSB 4JREC 1NBYB 2CRIA 5T3XE 5B21A 2L4OA 4M02A 3S35L 4NKMB 1J87A 5HD8C 1T66D 4LLUA 3LD8C 3VXSE 4WI2A 1YJDH 4ZXBD 4TSCL 1ONQB 2MQCA 5INDA 4K7PY 2Q86B 4S0TD 4H5SB 4WU5A 1G6RL 2XACC 1UYWH 4CAGA 15C8H 1NGYA 3GJFK 2PTVA 4XMLH 3GB7A 4PB9H 2ZUYA 3VFUB 3O6LL 5T1KD 1NDGA 3C6LB 4UTBL 1GC1H 2IBGA 3MCKB 4HCRL 2ICEA 4I2XE 3KPMA 4Y4KA 4OFIA 4CN4A 5I8CA 4NSKA 1Q0YL 5DWUL 4OUUB 2XQBL 1A4KA 4NFBA 2ADJB 4WHTB 4YR6A 3U0WH 4TQEH 2RCSL 2EKJA 4YHKL 1NJ9A 3QNYB 5KVEH 5IQ9A 3QI9C 3HG1E 1OQOA 4Q9CA 1J5OL 3O45A 2Y6SD 5D7KE 5HHMD 1BVLB 1OCWL 4I0CC 1UCBH 2R1YB 4NN7B 3VMNA 1H8SA 2HTKC 4JY4A 4GH7B 5B3JF 3TVMA 5DTFA 5I30H 4XPTH 5I1JH 3KLDA 5AAMA 1G7QB 1T0MB 4NHCH 5TE4L 4L3ED 3MC0A 3MACH 3VXQA 5C0JA 2CO7B 2ATPB 4JQIL 3QEGL 1I7TA 5DK2A 4K9EH 3BPLC 2HFGL 2VDPL 3JBG7 35C8L 1WAAF 1VGKB 1FC2D 3P77B 4NM4L 5DSCA 3RL1A 1SVCP 2R8SL 4GLRH 3MBXH 3X14A 4IMKA 2BVOA 5B39B 1HEZB 2EDJA 3L9RB 3QG7H 4XXCA 2VZ3A 4AQ1B 4ZOBA 3D25A 2W9DL 2D7TL 5DQDH 4L8BB 5F89A 5IFAH 4HXBH 1WFOA 2MKLC 3WL9B 2BDNL 2I07A 4FZEL 2W1NA 2P7TB 3VE0A 1KN2H 3DV4B 4GW1A 5TJWK 4D0BB 4XPHH 3MRCA 5TPWH 2CDFB 1PY4A 2DOCA 5E8NB 5GJSH 4JO2H 3MRLB 4U05A 3GSXA 2K1MA 1F8TH 3ULUH 1VEMA 1MVFA 1P4LA 3HB3C 4FNLL 4OB5L 5KVMC 2EYRA 2X4NB 3T2PA 3QDMD 2EEDA 4C54A 1SQ2N 4H25B 5TE6L 1FPTH 5CCKH 4PJAF 4L4JA 5CMAA 2G5RA 1E4JA 2VDNL 4PRDB 1CFTA 3GBNH 2FJFB 4D0CA 1E4XI 2EICA 3RP1A 3MMEA 2I9TB 4U4BA 4NQXB 4YHMH 2EO9A 3TEUA 2VITA 4ZDHA 4BELD 2W0FA 4D0DB 1XEDA 3BHBA 3BD4A 4XNQA 2QV2A 1YN7B 3JV4B 4YC2C 5E08H 2ZG3A 5KSVB 3N9GL 4MQ7A 3CCHA 4OZHA 3RU8H 4EN3A 1OAQL 4TUJB 4KJPD 2V5SA 1UM4L 1KB9J 4HIEA 5CEYA 4CDGC 4D3CH 1C1EH 3AXLB 2ATKA 4JRXB 4ZOCA 1UENA 5C9KA 5DMJB 2BY0A 4WFHE 3LS4H 2CR3A 3O4LB 4OLXH 1YEFL 3I2CL 1CR9H 2MWCA 1Q94B 4MLSA 3LKOB 1Y0LB 2FBJH 4EI5A 5I73C 1NC4B 3VFOA 1G7MA 5KSAB 3QEQE 3UTTE 2PCPA 2NLJB 4YUEH 1MI5B 1M7DB 5IMMA 5JOPD 1LO5B 5KG9B 2J4WH 1SMOA 4XP6H 4Z7NE 2IADB 3VFRA 1MCWM 2YA2A 1FFOA 3VGFA 1YEKL 2BSED 3S96A 2CLZA 3WFCH 2X2YA 2AJVL 2MSPA 1FL3A 2SEBA 3DURB 3WUWA 5GIRA 1KBGH 3FT4A 2QLVB 3B9KA 2PO6B 4RGNB 2C3GA 2ZUVA 1G0YR 3VXPB 5C08D 4JJ5B 2OX5A 3KLAA 1ZT7B 5I18L 1EAPB 2J6EH 1G1YA 3SE3A 3RTQC 2XWJB 3EFFB 4M03A 1RJZA 3BN3B 3TN0D 1RHHB 5HHQB 5IWLA 1O0VA 4U6TA 5I1LB 4ODTL 1M1SA 3AMLA 1J7VR 5T3XD 1JYWA 4Y5VA 1BLNB 5EULV 3VXSD 3S3SA 1S3KL 4JDVA 3QJFA 5GRUH 1U36A 4LCWB 4R0LC 1BEYH 4LSVL 5IMOA 1X5KA 5L2JA 3MLRL 3MV9B 3L5HA 5IVXB 3RWFB 5I71C 5FDWA 5IOPA 2X4QB 3QQ9D 1NGWA 1KJVA 4JFEB 4ZUWA 1MFDL 1WVZA 3FMGH 7FABL 2G2RB 3BGFB 4N0UB 4UB0L 4XRCB 4ODUB 4NBZB 5J57B 2HLAB 1WBYB 4DFIA 1JYXA 4HT1H 4Z7WB 3FT2A 3W9EA 2Q20A 4HAFA 4LCIH 6CGTA 5CSBA 3HG1D 1XCTB 4Z7UA 5EA0L 4GG6A 4UT7H 5CZVH 1YYMH 4LPVA 4PRBA 3WN5B 2XG4A 5ETUB 4HIIB 4GAFB 4G8GA 2OI9B 4OF8A 4RA0C 5JOFA 1OAUH 3DJ9A 5EPMA 3TV3H 1XGTB 4PV8A 5IJKC 4E0RA 1QSEA 1OSPH 3UAJD 3PP3H 4CMMA 4PGEB 2YHGA 1C16A 3QSKB 4CJ0A 4E42B 4YBLC 3TIDB 1F6AA 1IQWL 5J11C 5C6WH 4FQJL 1S78C 4YPGA 3NH7L 1CICA 1GZPB 1WGOA 3ZYIA 1D5MA 3ZDYF 4ALAH 2QR0B 3KR3H 1G9EA 1HXMA 1BVZA 2GIYA 4NQDE 5T33H 4XB8A 3QUMB 5GSRB 3D6GA 4K7FA 4HKZA 3PHQB 5E8DH 5CKGA 3RWIA 4UQ3B 2J8UB 3TBVB 1P5UA 1TENA 3CSPA 4ONOA 5ALBH 1MOEA 4U6YA 3DLQR 5D8JH 5J3HC 2GUOB 2G5BB 5HGAA 5F21B 3UTSA 3NZ8B 4QRQB 2HG5B 3BN9C 5EBWA 3T77A 3B83A 4KRNA 1YY9D 4HUVB 3OKKA 4XAWH 1OTTD 5CP7B 2ZSWB 1RIVH 4E41E 1XF1A 4MWFA 4HIXL 4PD4K 1SJEA 1DBJL 5LGJB 3DI3B 4OZGA 4QOKE 4MCYA 5D2NE 3WFEL 1FNEA 3VWKC 4FQ1H