5TDOB

Crystal structure of the fab fragment of anti-her2 antibody 4d5 with redesigned heavy and light chain interfaces
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
220
structure length
214
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRKAPGKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLESVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords anti-HER2 Fab Light Chain
publication title Crystal structure of the Fab fragment of anti-HER2 antibody 4D5 with redesigned heavy and light chain interfaces
rcsb
source organism Homo sapiens
total genus 46
structure length 214
sequence length 220
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-09-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5tdoB02
5D2NA 3WSQL 5IBTH 4Q6YA 3MJ6A 3OKNB 4RZCB 3QEHA 3VFNA 3TGXA 2R23B 3GBML 1G6RB 1AFVL 4D0CB 3DWTA 1JHTA 1ORQA 3WJLA 1QYGL 1WV7T 1EGJL 3WFDL 5AAWA 3KNBB 5D5ME 4L9LB 2OQJB 4FQ2H 3IFLH 4L4VD 3GGWB 4ZFOA 3F6LA 2H1PH 2EIEA 3F7YB 1L0XA 4N9OB 3E1F1 2DQIH 2XXCB 2DLGA 4QXWA 5TDPA 2X05A 2YWYA 3ETBF 5DEFB 2VMFA 4UTBL 2FYYB 3G04B 4HK3N 5E8DH 3FB6A 3U9PL 3PABA 2WP3T 4S0SD 5D70L 5C09B 3WNNA 4YHNB 1JGEB 1ETZB 4WI4A 4CL7A 3BKYH 1T0MB 5DD0L 4NQDE 4ZNEA 2CXGA 5C0DB 4QHNB 5L2KA 2OXGA 1BJ1H 3EKCA 3K8LA 1PG7L 1KB9J 1YDPA 2Y36L 2E7HA 4W81A 1YYML 4RNRA 1Q9OA 2VWEC 4RMQA 2Z8WC 1MJ7L 3DV4B 2NW3B 4RGNB 3G6AA 1PDKA 1UZ8A 2H41A 1RJLA 1QR4A 5CZKA 3TIDB 2NY4D 1Z0MA 43C9A 5TFSL 1NCDL 3W0WE 5E1AB 4PD4J 3PQYA 5KS9F 3P0GB 2YD5A 4LCUA 3HUJF 3SPVB 4F33A 2VLRE 5E2VL 1P2CB 2EC8A 1JPGA 1KCKA 4JM4H 1CBVH 5CEXB 2V2WB 3ULUD 1FO0L 2EEAA 3OR7B 3C5JB 3TIEA 4PS4H 2AEPH 4D0DB 2DS4A 3EUUA 3V52H 3VXMB 4ZUTB 4L1HA 2XA8H 2HYMA 3OBAA 1YEIH 4Y4FB 1MUJA 3DURA 1YY8B 3P4OB 1FYTB 5DJ8B 4NNYA 4TOYH 2D7NA 3X11A 4B5EA 1MRDH 5FGSA 4HWBA 4R7DA 4X6BB 1IMHC 4KI5D 4Z7WB 2NYYC 4MXVF 3SDXA 5ADOH 5E7BA 4F2MB 2KPNA 3MLVH 1RZFL 2WK2A 4D3CL 5TDOB 3QO1B 4KKAC 2CDFA 4YBHA 1MFCL 1R6VA 1I1YB 4M61A 1QSEA 4XCCL 4PV9A 3B83A 3BKJH 1FL6A 1MCEA 2BRRH 2FNBA 3O0RH 1FZOA 4XCNB 3U46B 3MV7E 3U7YH 1J0ZA 3PP4L 4Z8FL 2YKLH 2ICCA 4DN3H 2XWJB 1CLYH 5D7JA 2VDRH 4HEME 4YPGA 1HXMB 3IGAB 4RWYL 5CEZL 5E9DB 1P69B 4QXTA 1EDQA 3D48R 4NNXA 1DDHB 5ANMA 4NC0B 1BREA 3O6LH 4XX1E 2PETA 2C7UA 4Z76A 1YPZE 5LCVH 4JDZA 1HHJB 4FTVB 4MCYB 4NZTL 3T0EC 3KJ6H 2D7PA 4P5TB 3Q0HA 2ADJB 3KPOB 4D9RE 2V7HB 3G5VB 5KSAA 2FEDD 3E2HC 5KTEL 5MP6H 3U4EB 4IM8A 4H1LA 4R4BB 5JIIA 4G43B 3HPLB 1BIIA 4ELMB 1L7IL 1GH7A 3KYNA 5DMYA 4KKBC 3RWFB 4LSVL 4X7TB 3EW3B 3D18B 4HIIB 2QADB 1ZLSH 4X6DA 5C9JB 1YEGH 4NJ9L 2VQ1A 4GS7B 4O2CA 1T22A 3FO0H 4G9FB 4TTGA 3BH8B 5JZ7C 3EHBD 5J1TC 1QRNB 2V5RA 3EJYD 1SMAA 1KCSH 1IAKA 2GT9A 1WC7B 1R24A 2YRPA 2MHAA 1SVCP 1WEJL 1A6UL 2ZUSA 1S5IL 2XG5A 1DQJB 3BZFB 1DQQA 4Y2OA 5IIEB 1Y0LA 2O5ZL 4HPOH 1ADQA 2R1WA 4F7EB 3OX8A 1NC4D 2XZCL 4RFOH 4TVPE 4HUUA 5IEHA 3C60A 3CLFL 5HHVL 1PFCA 3WUZA 3ISWA 5CZXD 3OAUL 3U7WH 5EUKB 1WBZB 4G6JH 3DGCR 4AY0A 4IIQC 4XHJD 3EOBB 4KK6D 2F54E 1I7UB 2AV7B 3QIUD 2R1YB 4IOFD 5DDHB 5D5MA 5IFHL 5F7YC 5FECB 4KZEL 1HN1A 5EOTA 1P1ZB 5FM5M 3LDBC 1C5BL 1N8ZB 3EDFA 2AXGB 4X7EC 1BBDH 5I30H 4B50A 1MFNA 2E6QA 3GNMH 4J23A 1IL1A 5HGBA 1BEYL 2PN5A 1INEH 3MO1A 4KPHH 1HE7A 3IKCA 5EOCL 4XHQA 2A73B 3GFUA 2O26U 1RD6A 1NUDA 1WBXB 2EDRA 3FB7B 4JCMA 1KUMA 3PWJA 5KZCD 4F8QA 2PR4H 5D4QA 1IKNA 3DETC 3KPLB 4HF5H 5EBLB 1P9MA 4LBEB 4KTYA 3BPOB 4OZ4A 1LO0H 4HK0B 5GGSA 3IS0X 3QDME 2DM4A 3G08B 3VXOA 3ZYJA 1D5IH 4XBPA 1UACH 5C3LD 1IQDB 4G5ZL 1JGVL 3C6SA 2B1HL 3WS3A 4M5ZL 1QACA 4HT1L 1LEGA 5CILH 3W0WA 5C07E 3DMMB 3KPRE 5TQ0H 2RHEA 4HK3J 2BJML 5D1QB 3V4UH 1JTTA 2VLRA 3HB3D 3IDNA 1T80A 2IBBA 4MJ6B 2ARJA 1RULL 2AK4D 3CXDL 5DD5L 5JPMB 3HE6A 1FVEB 3P9LB 2E7MA 5F96L 1I8LA 2HVKB 3EFDH 4G6FB 5EU5B 1CLOH 5DQ9B 1X6LA 1I8KA 3JVGA 1H3PH 1NMCB 3DVGA 5HI5C 1A9BA 3SDCC 4OLVL 1FNFA 3FO2A 3RPKA 3AY4C 3S88L 3O9WA 2FJHA 3D0LB 1JWSB 5KVDH 4XNYL 5IBLC 2B1AH 1QLRA 5EU4A 3QDGB 3PJSB 2A6JA 1XR8A 1L6ZA 2I60H 1M7DB 2FJGA 2IGFH 1G7HA 1BHGA 4KJQD 3CVHA 5I71C 5KN5B 3DJ9A 4OIIL 4X9FA 3SE4A 4ZG1A 1J8HB 2MFNA 4KH2A 2ZUQB 1NEZG 3VFTA 4L29B 1A6WH 2YPKA 2BK8A 4AK1A 5IVXB 3MV7A 3AAZB 4HH8A 3OKOA 2VR9A 1G6VK 2R2HA 4PJFB 2VDQH 3QEQD 1RIVH 1F4AA 5E5RB 4F58H 2ZUWA 5GGUB 3FL7A 3CFCL 4N5ED 1AGDB 1EEZB 2W0KA 4KTEH 4I18A 1ZHLA 1KJVB 2OJZH 4NM8L 2JJSA 3PDGA 1YPZA 5B39G 1IFHH 3QEGL 4G8EA 5LQBL 4P46B 4HZAA 1I1AD 4RQQA 3BZDA 2YHGA 5DTFB 4HJ0C 3ILPA 4MAYB 2VLME 4N0UE 4M43L 5JHLL 4XPGH 5I18H 4R4ND 1IC7L 3EYUL 2F8XC 1YNLL 3UAJD 3C2AH 1JZ6A 2DQDH 1DFBL 3PIQB 1IAII 4K3DH 4H20L 2YEZA 4V1DD 2YC1A 5HHXH 5T3ZH 2QEJA 4AYFA 2NY7H 3MXWH 1ZT7B 2JCCE 3MZGB 4G3YL 2AJYH 2M26A 3KLHD 4GMTH 2MCPH 1VGEH 2NX5D 3EOAA 4MXQC 4NHCH 1G9ML 3O2DH 2LQRA 2JELL 5KOVC 5C0AD 5DJ0B 1URLA 1N5AB 1ZXQA 3VA2C 2LVEA 5JO5B 5F21B 3S3SA 3M8OH 3L1OH 1XCTA 3QUYB 4J3WA 2I24N 3MCLH 1H0DA 2VDKL 4JO1H 2YA1A 1Y6KR 1J5OH 5CINL 2P5WB 4XBGA 2AEWA 2VLLB 2R2BA 4L3AA 4R8WL 1CWVA 4GMSH 4JGMA 1U8JB 3LOWA 2CKBL 3ZTJH 1NJ9B 1UB5B 3CD4A 4YHZH 4JM2F 3WSQH 1ES0A 2P8LB 4BFIA 4NN6C 4YXHL 3GBMH 2AJ3B 4U1LA 4DCQB 2NZIA 3OB0K 1EGJH 3WFDH 3CFIC 4KROC 3H3KA 1P6FA 1XH3B 2VC2L 4RIRB 3D39B 3IJSA 5DSCA 5HYQB 3DO7A 3RPIA 4WTXA 2WIMA 4FRWA 3ROOB 1L7TL 4QGYA 5HHQB 4PV8A 1P4BL 1MWAB 1BQLL 4UTBH 4LRNL 1C08B 3U9PH 4GRWH 5HHMB 1VCAA 3HE7D 5D70H 1R5WA 3OKKA 4TQEL 4PLKD 1ODAA 2EYRA 4N0YL 5FKAB 3VXRE 5E4EB 3U4BL 5DD0H 3HAEB 3VMPA 3T3ME 3QDMA 4Y4KA 2J8HA 1UM5H 2ZSVB 1TPXB 1PG7H 5ETUA 4XGZB 4M6NH 4YE4L 3SKNA 4X7CC 3GSXB 5T1MA 2W0FB 1WCBA 1MJ7H 4JZJB 1DBKL 5GRJL 1FL3B 3NA9L 2XXMB 3KPRA 3QUZC 1CXKA 3B9DA 5GGTL 5GS0C 3BP5B 4J4PA 4XH2A 3TT1L 2BNUB 2D9CA 5TFSH 1NCDH 4Z7UB 1FZMB 4NQED 3IJHA 4MS8C 3BH9A 3RDTB 5FYKD 3BGMB 1FH5H 3VW3H 3C5ZA 3CFBA 1ZA3B 2HRPH 5EZJB 3GB7A 3FOLB 1AQKL 3WXWL 1FO0H 5C0IB 4XXCA 4M6OL 4ODVL 5DR5H 3TVMA 3NGBB 1VGKA 4Z9KB 4H0HB 4Q97A 1AQDB 4RAVB 3ULUF 3LEVL 3H9HA 2A2QT 1NUFA 1M6OA 3GMNB 2NXYB 3CH8A 4PJ8A 3SDDB 3WNMA 1X5HA 3FQTA 5BS0E 1CDIA 1AD0B 2HKFL 1T83C 3L6FA 2HTLD 3RGVC 5I66A 1RZFH 4D3CH 1JTPA 4YNYA 3PGFH 5C0ND 1ED3A 1MFCH 1NCWL 2BY2A 4RCAA 4KUZL 4U1SB 5DJ2A 4QHLA 4PJHF 2DIJA 3WLWC 3MCKB 4ZXBD 4NP4L 1GSMA 1MIEL 3UTTB 2V2XA 3PP4H 5J6HB 3U48A 4RMWA 4M7LT 5F9WC 3CFJB 3SGDI 4CN1A 4RWYH 4XNQB 5CEZH 1QVOB 3SDAB 3WS6A 1IGYB 4RMRA 3MRDA 3WXVH 2HLFD 1ZHNA 3STZA 5C6WH 4OCLC 1FVCB 3ARGB 1HKLL 1XFPA 4JLRB 5J3HD 4M93B 2GSGB 4Y4HC 4NZTH 3VWKC 4WJ5A 5IVOA 4K71C 5A16B 5JIPA 1RU9L 4ZTPL 4NIKB 3QRFM 2JCCA 1NDMA 3MR9A 3LPWA 3U79A 4Y5YC 3QO0B 3BHBB 3IFNL 4CVXA 1L7IH 3CCHB 4LSVH 3IF1B 5E8NA 3GM8A 5EA0H 5CD3B 4NJ9H 1K5NA 4JFYB 3O3EB 1D9KC 2QQLH 3TZVC 1B0GB 2EH7L 4K55A 4IRSB 5CEYA 4LSRH 1DR9A 1GGUA 2X4RB 4KFZC 2G60L 4WW2F 3QI9A 1WEJH 1OCWH 2CD0A 5IF0A 5JTWA 5CIPB 5FF6B 5J89A 4WTWA 2O5ZH 1AHWA 4NO0B 3O8XB 5M95B 4GBXC 5CSBA 2X1OA 3BQUC 2XZCH 1FGVH 3E6HA 4PRHD 3CLFH 5HHVH 2I9LB 2DYPA 3OAUH 3K4AA 5MEPA 4NKMA 3SGJA 5I17A 1MNUL 4BH8B 2EXWC 1W72A 1ZK9A 3T0XA 1BQHA 1HNFA 1T1YA 3EFFB 5IFHH 4JAMB 3QHZH 4BSWA 2GFBB 1JNJA 2E9BA 3SKOB 1C5BH 4G9DB 1JNNH 1FNEA 3HCVB 1M1SA 2XNAB 4QRTA 5HVWA 4YHKL 4LEXL 1CICD 3NH7L 2YPLA 4LNVA 5D1XD 1QFOA 1C8PA 1AGBA 1BEYH 2MJWA 4D2NA 4N0RA 3UTPD 5F6IC 2MPAL 1GC1C 4XWGL 1WZLA 2HJKB 3VXRA 5EOCH 5IB1B 2VZ1A 4R2GD 1AGFA 2V5MA 2EXYC 3WN5C 4ERSH 3CFEB 3PP3K 4DZ8A 4NQVA 1SJVA 3GJFK 3CDYA 4DGIL 5CMAB 3ZTJG 3LRHA 4K7FB 1H15A 4JQXC 4PJ9B 1IM9D 1HSBB 2XY1A 3MRGA 4PBXA 3RKDC 4POUB 3I75A 5T1DH 5I1CL 4G5ZH 2XZQH 1UZ6F 2XPGB 3KPMA 2B1HH 4K7PX 3B9EA 4DWHA 4M5ZH 2V2TB 4BKLB 4H0GA 2VKWA 4F9LA 1TIUA 3ARTA 3BX7C 1RZGB 3K2MC 2BJMH 2NY1C 1DCLA 2A6KA 3DX7A 3T2NL 4ELKA 5T1KA 5DA0B 3BN9C 5KSBA 3Q6GL 4M3KB 4HFUL 3N50A 3UBXG 3DSNA 5GZND 3MV8E 1I3VA 4DK6A 4PGDA 1RULH 3CXDH 1UT9A 2BSSA 5DD5H 3OB0H 4HC1A 4MDJB 3MRJA 1G9NC 3RWHA 3SJVB 5HGDA 5F96H 3QIBD 4JFFE 3BPNB 3O3DB 3EGSA 3AB0B 3ABZA 4WW1A 2LVCA 4EDXA 1LP9B 4OLVH 1S9YA 3S88H 5KANG 4CAGA 3MV9B 4GFTB 5ERWA 5GRZA 4DKAA 3HMWL 3NFNA 3MGTB 5FYKL 2VE6A 4XNXL 4K9EC 3U0WL 5JDSA 4E41D 4RSVA 1YMHB 5KBNC 3FO9B 4F3FB 4JHZA 1FRGH 4RGNC 2F58L 4KQ3L 4KUCD 5EC1B 1KT2B 3MLXL 4P0DA 3U1SL 4OIIH 1M4KA 4ALAL 5D1ZC 4RAUA 1K2DA 4NWTL 5E70A 1NFIA 1WBYA 2C1OB 4KKCD 3H3PL 5HYSA 2HFGL 1M7IA 3AU1B 1T1ZA 5ISZD 3EYQC 4WFGE 2OS7A 5I1KH 3UTSE 3CFCH 1QBLL 4YXKH 1JZ2A 5TF0A 1BFVL 4Q9CA 1HH6A 4P9ML 5ADPL 4AM0B 1JYNA 3H42L 4NM8H 1IKFL 3MUY1 3QEGH 4KKLC 3RVUD 1TJGL 3MUZ1 1HNGA 5E9DE 2H32B 3ORJA 3BGAA 2F74A 3IDYB 5JPNB 5IJVA 3D3VE 1KBGH 5JHLH 4ZDHB 5DRNB 2WIIA 5EZIL 4HKBA 1HEZA 5E8OA 4NCC1 4RFEB 1DFBH 3QXDB 4L8BA 5IB3A 1EX0A 4JJHA 4MXWH 4U0QB 2JB6B 1KPUB 3E8UL 5DJXB 4ZFFA 3I6GA 5BQ7A 4G3YH 1A6AA 3IXAA 4HKZA 5C0CB 3WUWB 3VRIA 4YFLF 1TNMA 4Z6AT 4WNQA 1G9MH 4RRPA 4GRLD 5TE6L 4XCEB 5E2WL 3AREA 3P9MA 4HIHB 4Z7NF 4PREB 2DM2A 4NQCD 2WW8A 1H8OA 1VKXB 4NN5B 3DGGA 4UUJB 1QRNE 4UDUB 2VDKH 1VEMA 3QNYA 3QUKB 4PLNC 4WFFE 1F3DH 1P7QD 4Z7VB 4U1GC 2CKBH 4KJYA 3LN4B 3P30L 1Q0YL 4YHLH 4PTTA 4P23D 5DMGD 3R0NA 4P5TC 4YR6A 5C6PB 4P3DB 3KR3L 3OKNA 4KVNL 4RZCA 5ENWA 4YXHH 4I0PC 1AI1L 1JRHI 5MEQB 3ESUF 2I9TB 1T21B 2H3NB 4JB9L 2IFGA 4NQXB 2VC2H 4GG6F 4RGOL 2P1YA 3KNBA 3SKJH 3GKZA 2OQJA 2VKXA 4L9LA 4FQIH 1AXSA 2QADC 1IEAB 3GO1L 3TF7C 4N0CD 3B8YA 5ALBL 4XMPL 4WUKL 4GS7C 1P4BH 4JZNB 4P2RD 4U0RB 2OJEB 2BVYA 4LRNH 4X6EB 1X4YA 2FYYA 5GSRA 4Z18A 1FFNA 3U9UB 3G6JB 4HDIB 3HC0B 3ULVD 3UPRA 1AJ7L 1UB6B 4JGJA 4YHNA 2W07A 4TQEH 1EEQA 2IMNA 1AC6A 3V6ZA 1U3HC 3QYCA 3U4BH 1CT8B 4AQ1B 3GMPB 4MQ7B 5I76B 4Q6IA 1VFUA 3LQAL 1RK0B 4MA1B 4NBXB 4WUUB 2J8UF 1PAMA 3CFKB 4WU7A 2UVFA 5E1HB 2AQ3A 4N0FB 5AAMA 2P42B 1K9TA 1DBKH 3DV4A 3LQZB 5GRJH 3NA9H 3WL9A 5C1MB 3GUTB 3MRRA 3SO3B 1NKOA 3ZTNH 3KG5A 2OL3A 5J13B 4LLYA 5GGTH 3P11H 1E4WL 1EO5A 3QFJE 5DJ6B 3QCVL 4JHBA 3QPQC 3TIDA 3MV8A 1LEKB 2DQEL 3BEWA 1S78C 1GC1L 3SO5A 5FOBB 2ZUXA 2DLEA 4QY8A 3NACH 4D8PA 4JFFA 1P2CA 1BGXL 1AQKH 2W59A 3QA3A 4M6OH 1X7QB 2F19L 3CZFA 1YMME 4D0DA 1GPOL 1YN7B 4U1JA 4B53A 5D7IF 1NGQH 3VXMA 1AXIB 1YY9C 3GSQB 1OSPL 5FHBL 4NKOA 2D4FA 4OM1L 3OQ3B 3QFDA 3V0VB 3LEVH 5MI0B 3QG6B 4S1DD 4Y4FA 1OAZH 3P4OA 1WITA 3BPOC 2C3VB 1MCIA 2QQQA 2Z92B 1ZTXH 5L2JA 2FD6H 3PQYD 1F4YL 5INCB 2OYPA 3T0AA 5CD5C 4HJJL 4Y2DB 3VGAB 2ADFL 4N90E 4PG2A 3T77A 2YA2A 5JNYA 1GOHA 1OAKH 5DMKA 5FO9A 4EIGB 2Y07L 5TDOA 5I9QB 3P0YL 2LU7A 3PP3H 4CDGC 3GJFH 2A77L 4PJGB 1H3GA 1MCRA 5CBEB 4LEOA 5D1QC 3UC0L 4WIQA 2XOTA 4MA3B 4NP4H 1MIEH 3UTSA 1U8KA 3HNSL 5IVXE 3V4PL 4F7TA 4HZLA 2CDEB 5IV2A 3P77B 1J87A 2ICEB 4PJFE 4JRYE 3STLB 4X5WA 5AYQA 5BO1H 2XWJA 3LN9A 4OD2B 3SGEI 5D96C 3IGAA 1OWRM 5E9DA 1MPAL 5INDB 1DDHA 2AJXH 2HKHL 3D3VA 2JB5L 1U91A 3FB5B 3MYZA 1HKLH 5ESQB 5DFWH 1NANI 1N64L 1QSED 4AEIL 5JDJA 4FQXB 4MCYA 2P4AB 4IOIB 4ODSH 4KGLA 5GZOC 1RU9H 2ADJA 1FNSL 3KPOA 4P99A 2V7HA 4XAKE 3OG6B 1RZJC 1DQDL 4C59B 2AW2A 2G5BB 3ZKQD 1I3RA 3CMOL 3PWLA 2Q86A 1SJHB 3HPLA 4ZS7L 4ELMA 2ZUQC 1H3TA 4MNQD 5D7JD 5KVFL 3RWFA 5EH1A 1MRFL 1F97A 5LAXB 4HIIA 5C9JA 5JIKA 2WWMC 3S5LA 3B9KB 5GQBA 2NXZD 3BH8A 4WI5A 1VSCA 4XNUL 2PO6C 5KAQF 1QRNA 1RFDL 2V9TA 3OKYA 4GO6B 3NZ8A 4QRRD 2APTA 5DZLA 5KSAD 1BZ9B 1RURL 3FRPG 1DQJA 5IIEA 1HILB 4F7EA 5I6XB 4P46C 5HD8D 3NCYS 2A9NH 3BWAB 4MAYC 3U4AA 4PRBB 3BZ4B 4K8RD 1DUZB 4YWGL 4OSUL 4A6YH 5EUKA 1MNUH 4Q9RL 1JWMB 2EDXA 4HAGA 1QNZL 4CBPA 3FQUB 3MLTB 1WZ1L 2ZOKA 3OR6B 1A21A 1RK1A 1TZIB 3V6OE 5JOFA 2R1YA 5DDHA 5FECA 4P57B 4HMEA 5CSZA 4PBWD 2HA1A 3ZE0F 4BQ8A 1P1ZA 4EUPH 3MRBB 3F5WB 5I1LB 3B9AA 4UB0L 3OXRB 4HGWB 3OGCB 3P40A 4LEXH 3NH7H 3C60D 5JXEA 1SBSL 3M17A 1W0VB 2MPAH 2MQ3A 2XN9D 2JKXA 3BP4B 5E56A 1X5KA 5TE4L 3VGFA 4WCYL 3IYLW 3QUYC 2MWCA 4M7ZB 1FORH 1CFTA 4JY6B 3B4NA 4FG6C 4M1CC 4QF1B 2VDPL 1ZSDA 3VXSB 1B6UA 3FMGH 3LY6A 5B21A 4KZDL 2W0PA 5K59F 4DGIH 3FT2B 2HWZH 2IQAB 4OF5A 3G08A 5CJXC 1KPVB 4TN9A 3ULVL 2Y06L 1L9NA 5I1CH 1IQDA 3QFJA 1RMFH 1NCTA 2Z31B 2ZNWA 3TESA 1T66C 2NY6B 1UJ3B 1DSFH 1TXKA 4CADB 1AC0A 4K23L 4OCMC 3FKUS 3T2NH 1CFSB 1EFXB 3OHXB 3L5WB 1CDJA 3TP4A 4HFUH 4E5XB 5IHBA 1NBVL 2AAVA 4MJ6A 5DO2C 1MH5B 4ZFOL 2COQA 1SY6A 5JPMA 2VITA 5IMMB 5EC2A 1YMMA 3P9LA 4M7LL 3WV0A 2C3GA 2HVKA 2JK5B 3PHOA 3DX9A 4LLDA 5IKCA 1OTSD 1I3GL 3FJTA 4L8SC 5E4EC 2RCSL 4TTDC 2FEEL 3NABL 4YDKL 3GM0A 1HXYB 3Q5TA 3TBTB 4LHUA 1MOEA 3THML 1PJ9A 2NZ9C 1JWSA 3HUJE 1AR1C 3HMWH 4FZ8L 1TPXC 4NRZB 5IW1B 4XNXH 2VLRD 1ITBB 3U0WH 5GS0H 1W8OA 5HDBE 5ICYB 1Q9WB 5IFAH 3CUPA 4PJXB 1UENA 3HE6D 2X4UB 4YK4B 2F58H 3MLXH 3GMRA 4WWKA 5F1KC 4ALAH 1P7HL 4RDQG 4L29A 5E5MB 4NWTH 1HHIA 4OZFH 4WI2A 1LDSA 2W65B 3RY4A 5IVXA 3GI8L 4F37F 4TSBL 2D0HA 3RDTC 5FGBC 4M6AA 3H3PH 3X12A 2HFGH 1Z3GL 4PJFA 3O9WD 4MXVE 4XPFH 5HHNA 3VMNA 3PWPB 1INQB 3DV6B 3T0ED 1OT1A 1BFVH 1EEZA 5ADPH 3LSOB 4NBYB 3T08A 4NBZB 3H42H 2EDJA 1IKFH 4Y5VB 4DVRL 2YSSB 3NGBC 4EI5A 1P7KB 1TJGH 3PL6B 1KXVC 1X5LA 1BPVA 5DTFA 1A5FH 2EKSB 4F7CA 1I75A 3CSGA 5GGSY 1QD0A 3RIAK 4HWEL 3PHSA 5EZIH 3MV7D 4FP8H 4UQ2A 4YFDB 4FMKA 3SDDC 3MOQA 1NCBL 1FNHA 3IS1X 3P4NA 2J88L 5BJTB 4HWBL 3QDJE 4YAQB 5JZ7D 3CZJA 3KLDA 5AWNL 4I48B 4X7SL 3S4SG 3O3UN 1NFDB 2X4QA 3KJ4C 3BO8B 5BZWB 3D85B 2OR7A 1A9EB 2WLYA 2B39A 3CK0L 5F7MC 3WFHA 5K9OA 1RZIB 1YECL 4KY1L 2DQFA 1A1OA 3VD9A 3EYVB 3IVKB 1KIQA 1N3NB 1B4RA 1XGQB 2UUDK 1DBBH 4D9RD 5E2WH 3Q3GA 3R8QA 1GL4B 5JMRA 1N5AA 2E6PA 1OWWA 4DJMA 4MA7H 1DQLL 3KPSB 1MI5E 3MRLB 3I3DA 3V7AG 1MCLA 4YZFF 4JPIB 4PJEB 1IAIH 5D2LB 2ED7A 3MRCB 4CVZA 4GKZA 4M1GL 2WBJC 4POYA 3VWJB 3TJHD 3P30H 3I3BA 4DKEH 4OCSL 2EDKA 2EC9T 4UNUA 3V6OA 3VRLF 3KR3H 4KVNH 1QTYT 4ONGL 4YBQD 1X4ZA 1B9ZA 3D0VB 4NQUA 5F7DB 4OM0H 4RGOH 3LKRB 5HYQA 1A7OL 1RJZA 3VD7A 3GO1H 5ALBH 2YXFA 4XMPH 3ROOA 4QOKE 5IJKA 1J1XL 3MBEB 4WUKH 2EIZB 3LKPB 1UH3A 1MWAA 4K8RL 2X7LB 2XG4A 4NRYB 3NN8B 3OXSA 3ZYZA 3MLSH 3PXJA 1NEZB 2PXYB 2VR4A 2UYLA 4XCFL 2Q76B 2LFGA 4GQPH 5F7HA 3WIIL 4GLRI 4ZUWA 1UXSA 4YDJB 2HH0L 3O8XC 5FKAA 4DOHE 1MLBA 3WJJA 4K94L 3BFOA 4XC1L 3D69A 2NR6C 5KVMC 1KACB 4ODXB 1ADQL 1YN6B 3LQAH 2IBZX 3F7RA 2H2SD 1BVKB 1S7QA 3CC5A 1KTDB 2X70B 5F6HJ 5B39B 3INUL 2PKDA 3IDIA 3NCBB 4JZJA 2SEBB 4WEMB 3KLAB 4WTZG 2UV3A 3CLEH 2D3VA 1CU4H 1E4WH 3F12B 3QCVH 2BCKB 1M7XA 4HEPG 2DKSA 4EUPG 2A9ML 3MMEB 3OWEA 2DQEH 1FZMA 3FO1A 4FQQA 1XF2A 1GC1H 1FNGB 1MHEA 1J86A 4Y4KD 4RX4D 4LU5L 3IDGB 3AMKA 3DIFA 1JBJA 3T0VA 1BGXH 1UXWB 1IRAY 5IR1B 5B22A 4LVEA 1FG9C 2CR3A 3FB8B 3KS0J 4X4YB 3SE8L 4GAGL 1J05A 3KPQB 4HUWB 1OSPH 3KPRD 5FHBH 1TCRB 3L5IA 4OM1H 3BYTA 1JGLH 1AQDA 4J4PD 4RAVA 1OW0C 1N0LA 4X83A 3ILQD 3LS5L 3UZEA 4Z0XB 1LP9E 3NFPA 2CRYA 4PJDF 3P4MA 4XXCC 4Z77A 1J0YA 1N26A 4PJ9C 4FFVD 4WDIA 5EB9A 4HJJH 5KSUA 2ADFH 4I5BB 3C5ZD 3GMMB 5DUBB 5LGKA 4ZO6A 1KV3A 2VDML 1JE6A 3RA7L 2Y07H 4I3SL 4Q2ZA 2ESVE 3P0YH 1HDMB 3ARFB 3EOTL 2GTWB 1K4CB 1EJ6A 1EHAA 4HXBL 3TVMD 5IT2L 2XKUA 1IT9L 4O02L 3UC0H 3MLYH 4XI5C 1F6AA 2IANB 2BNRE 3DRTB 4GSDL 1KTLA 3HNSH 2IMMA 4CJ0A 5TH2B 3RVWC 1OQXA 5FYJU 5J6HA 3DYPA 3NIGF 1ZGLM 4I77H 2ARJQ 4PJ8D 2ZOLB 1UVQB 1LNUA 3L5HA 5DK0B 1GGBL 3AB0C 3SDAA 1MPAH 4NUGL 5EIVA 2GUOA 2HKHH 4LGRB 2JB5H 3LIZL 2CR6A 2BVPA 1FVCA 3ARGA 4I1NB 1N64H 3GMOB 1IEHA 4AEIH 1LWRA 4PD4K 1S9XB 4NQTA 4ZAKA 3HS0A 3QDJA 4XPAL 1D3CA 2Z4QB 4HKJB 4WRLA 1FAIL 3KHOA 4D9QE 4N68A 2P7TB 4HCRA 1DQDH 3C6LA 4JRXE 3RU8L 2P45B 5HI4C 4GW4B 4ZS7H 4KAQL 5KVFH 2E9IA 3CCHA 2VNCA 4FQCL 2NTFA 4WI3A 3CVHL 2A6DA 4C57C 5CD3A 5IW6B 2GITA 4S1QL 1TQCB 1EZVY 5DRXB 4OZFG 3TA3C 4ZSOB 2ORBL 1HYSC 5C08D 1RAMA 1MI5A 2DI7A 4ONFL 4ODWB 1RFDH 1NC2B 4NDMB 5HGGS 4IRSA 4B7LA 2OI9C 2NY2D 2KZWA 2VQUA 2HN7B 1F2QA 1ROWA 1EAPA 5A43C 4IRZL 3VFPA 1RURH 3KPNA 4GKNB 3QZWG 3FN9A 3L7EB 3WEXA 4NO0A 4KRPB 4M48L 5D8JL 4EXPX 1BVZA 1T04B 1A7NH 5T5NF 4AMKH 4CGTA 1ND0A 1G7IB 4U7KA 5T3XE 1E4JA 5HVHC 1JNHA 4YWGH 2OP4H 4Q9RH 1JWUB 1QNZH 3ZLQC 3WD5L 4R7NB 5GS1B 1WZ1H 4FNLL 2FGZA 4NNPL 1E28B 3V6BR 3GHBL 4U1IB 4CNIB 1LO4H 3EFFA 1N59A 2AV1B 2W9EL 1PYWA 5BCAA 4QOKA 3SKOA 3QI9D 4UB0H 4G9DA 3W82A 4M5YH 3HCVA 2P8PA 4HWUA 5GGQH 5D7LB 2XNAA 3KWWA 4L3EB 4BA8A 4DVBB 1S9VA 3F7VB 2KL6A 2QV2A 4KHTH 1H3UA 1SBSH 2DYPD 1FFQA 4LIQH 5FGRA 3BD3A 2OZ4A 1DUYA 5TE4H 1I85A 3HZMB 2DIBA 4NN5C 2IEPA 4WCYH 1DBAL 4LCCB 2Y23A 3ARBB 3V6FA 4LOUC 5FUOL 4YO0B 2FX7L 1A4KB 3VD5A 4QYOB 5FA4B 5FUCC 4YHYB 4OFDA 1P4LB 2FL5B 2VDPH 4HLZG 2VLJD 4NCDA 4TVPL 4OZHB 3DYMA 4HG4K 5ID1B 2UUDH 3CFEA 2EYTB 4EVNA 5E99L 5IMLB 3GKWL 1OHQA 3TJEL 2FHFA 4L4VE 2OSLA 3LKNB 4AL8L 4MS8D 1FIGL 5EO1A 4HX1B 4KK8C 2YPLD 2Y06H 2BY1A 2WUCL 2WAHA 3KYKL 3ES6B 1PY9A 3NAAH 3QWOB 3VXRD 4JN2B 4K23H 3K81A 3EJJX 3NCEB 5DK2A 2AXFB 3GSOB 9CGTA 2EDHA 1ZANL 3DUSA 1NGPL 1ZVSB 3KYAA 1L6XA 3HMXA 4G8FA 4NOBA 3L95A 3AVEA 3T1FA 1LILA 4C4KT 2FRGP 4RWHA 1GOGA 4M7LH 4BJLA 5K9KA 4QXUL 3BDBA 3IETB 4I8DA 1I3GH 1XAUA 3CSYA 4LLMB 5FCUL 4R3SA 2RCSH 2OX5A 3NABH 4YDKH 3MFFB 5D6DC 1LP9A 2C4XA 4KKNA 1T1WB 3MV9A 4FZ8H 4IRJB 1FJ1B 4LPUA 5CFHA 3MGTA 1G7JB 2OTUB 1MFBL 3DSFL 1Q1JH 1XF4B 2DI9A 1WGOA 3SOBL 1JPST 4JANB 3NPSB 1GCFA 1OAXL 3FO9A 2DF3A 2WWKT 2Q8AL 3SO3C 2FZ3A 5EC1A 1KT2A 4NSKA 2B5IB 2A74A 2YD6A 4M6ML 4W4NA 3ULUE 3RAJL 2RB8A 2DL9A 2BNRA 3IXTB 3MRNB 3STBA 3TBSB 4KDTA 2AEIT 3P73A 4TSBH 4F9PA 1ZA6A 4CW1B 1MCSA 1ULVA 1Z3GH 1J12A 3AU1A 3HZKB 3IDUA 1M71A 3X13A 2WANA 5D71L 2NPLX 2R0KL 3FT4A 2E3VA 1YQ2A 1XZ0B 2RJMA 4LMQE 5GXBB 3WE6B 4LPVA 4DVRH 3QXTA 2H45A 1YEFL 1JTOA 3O6FB 3FQXB 1R3JB 5LXGH 3CVIH 2C1PB 4PJHE 4LLUB 5EOCJ 2M8XA 1CFQB 5IFJB 1OPGH 3B5HA 4HWEH 1SQ2N 1DANU 3QH3B 4ZDHA 2X4PB 4JRXA 5F8QC 1KOAA 1NCBH 5GS3A 1GZQB 2J88H 4Y2DC 5IP4A 4HWBH 3G6DH 3VGAC 3TYFB 1D9KD 5AWNH 5I9QC 2JB6A 5E7FA 2NY0B 2QL1A 5DJXA 3DXAB 4UV7L 1XF5B 3CGTA 5DYOB 2IH1B 3CK0H 2P5EB 5IB5B 4PRNB 4KY1H 4H8WL 2VOTA 3VU2A 1T6VN 2X2YA 1N0XL 4PJBB 2X4NB 4P9HL 5EFIB 4F7PB 1UQSA 4PYGA 2EXWD 1VKXA 1J9CT 3T4YB 3TNMA 3UBXB 1B6DA 4UDUA 2AJZB 4LRIA 1AKJA 2ZUTA 3R0MA 3KXFB 5IMOB 2YUXA 5L88H 4HUVA 1D5MA 4M1GH 4Z7VA 4OCNC 2AQ1A 4GRWB 4U6VL 1RZJH 1WIUA 2VB5A 3L9RA 4FQXC 5JW5B 2QHLA 2WQRA 3L3HB 3KAAA 5ESAA 3FRUB 1PKQE 1C16B 3LKSA 4ONGH 2FB4H 4MZ2A 2CIKB 2I9TA 3ARED 3I6LE 3ZZ1A 1JZ8A 2E8YA 5A1AA 2H3NA 4NQXA 1C5CL 4H0IA 5FKPA 3V9FA 2E8ZA 2QTEA 4H1LH 4JM2A 2QSCL 1IEAA 2GKIA 1J1XH 3UZVB 1U58B 3Q6FB 5EU3B 1DEEA 3NCYP 5DWUH 3L5XL 3G5XA 3GSNA 4X8JB 3PGDB 4U6XB 3U9UA 2BVEA 4Y1AB 1A6VL 1QPPA 4PRPB 1Q9KA 4XCFH 1C7SA 2DJUA 5ACZA 3WIIH 3BPCB 2X4OB 1F4XL 2HH0H 3ZHDA 3D25A 2FX9L 2DWEA 5KVGL 1CLZL 2NY5C 1S7UA 3REWB 5ACLA 1CT8A 4L4VA 5I76A 3PV6B 3CU1A 5I1JL 1ADQH 1RK0A 3D2UB 4XPBL 4MZ3A 2DBLL 3VXSE 1QFPA 2CDGA 1FO0B 5DVNA 4H5SA 3TC9A 2F5AL 3CFKA 5ITBH 3BN9D 4MQXC 1J11A 5C92A 1NBQA 1U8QB 3INUH 4HMCA 3S37X 5GPRA 4N0FA 3RWCB 3GUTA 4X7FC 3OL2A 5SWQB 2CLRA 5C09D 1U8HB 4KGJA 2VUYA 2IAMC 3AM8A 3C8KA 2A9MH 3LB6C 4N8CL 1X5ZA 1LEKA 3K74B 2W60B 3TO4B 3QT2A 4MD5A 1D5ZB 4LU5H 1ZE3C 2DDQL 5JQ6L 2YN3A 3V5KB 1UZ6E 1VPOL 2XWTB 3MJ8A 1HZHH 4UTAL 4XVTL 1N4XH 4LK4A 4YEEA 2MKLC 4M7ZC 3QWQB 3SE8H 4GAGH 1X7QA 4S11A 4WO4B 5CGTA 5C0FB 3H7BA 1IQWL 3VFGH 3GSQA 3HZVA 4NYLB 4RGND 3S35H 3BVNA 5J11C 3V0VA 3D9AL 1DVFB 5ESVB 3LS5H 4TUJA 5C0EB 2C3VA 2J2ZA 4YIQB 4C55A 3BKCH 4P4RA 5EIQA 3VXUB 4YC2B 5J0BA 1TVHB 3RI5F 5DRZB 5INCA 1F3DJ 4URTB 4Z0BL 3MNWB 5A40E 2VSDA 3QJHA 3T4AB 5IQ7L 2VDMH 1YEEL 1CE6A 4JDTH 5SWZE 4QRQB 5EU7E 1UJ3C 3EOTH 3VJ6B 3LH2L 3QCUL 4P4KB 3PWNA 1IGML 4BSVB 4HXBH 4H26B 3HC3H 2HJLA 2X4TB 5IT2H 4WHCA 3VXMD 1IT9H 4JFEB 4O02H 2X9XA 2FO1A 3HNVH 2G2RB 3FFCB 1HKFA 4PJIB 4GSDH 5C0BB 1S7RA 4OFIA 4Y4FD 1FYTD 2CDEA 3BI9X 3HKFA 2Z93A 3P77A 3O3AA 2ICWJ 1T7ZA 2ICEA 3STLA 1QZ1A 4JFQA 1F8TH 4OD2A 1A1NA 5AZ2L 4HC1L 4PJHA 5LBSL 3K4DA 4MAUL 1GGBH 1OAYL 3W9DA 1Z9SA 4R26H 4APQB 4HHAB 1PX4A 1CD8A 3LIZH 4I13B 5L8LB 4O2FB 1I7TB 3EDDA 5ESQA 5DF0A 1A6TA 2V9QA 1F13A 4XPAH 4IOIA 4JFPA 4G7YL 4ZUVB 3H0TB 2VDNL 1RIHL 3FONA 4L8DA 3UTSD 4UV4L 4OBRA 2H9GA 4O4YH 4Q0XL 3RU8H 4EN3B 5I1HL 1DN2A 1PZ5A 5EBWA 4KAQH 2CJUL 4PRIB 4FQCH 3PHQA 5LAXA 1N5YL 1DTUA 1T5WB 5E9DD 3CVHH 4HFWA 4D9LL 4Y16A 3B9KA 3D3VD 1WIPA 2ORBH 3QQ3B 1BAFH 3G5ZB 3O45B 1JYWA 5IB2A 4P2OA 1V3MA 3MACL 4ONFH 4YX2L 4FTVD 4DUXA 2VAJA 4J3OC 3QNZA 5DRWB 3U36A 4IRZH 4OGZA 1J0JA 1FV1A 5J9PB 1HILA 1T7VA 5HHOB 2H8PB 3MYJA 1VACB 4OKDA 1OGAB 1WZKA 1EH9A 3BWAA 4LDLB 3RKPA 1A3RL 1PKQA 5FYLH 1DUZA 4WW2A 2FWOB 5B8CB 3TN0B 4PJ7B 3WD5H 4Z7NE 1TETL 1IGTB 2R1XA 4FNLH 4NNPH 4OF8A 4PB9L 4RA0C 1TTFA 5DEGB 4L3CB 3VE0B 1TZIA 4I4WB 1QRND 1FQ9C 5BZDB 5C0AE 1S5HB 2UZXB 4LVOB 1QEWA 3F5WA 5I1LA 4W4OA 4HGWA 5DGRA 4Q58C 1H5BA 3O2WL 3U0TB 4LSDA 5KVEL 1IC5L 4K2UH 1W0VA 1F58L 1A6ZB 4O51A 3VH8A 1MF2H 2D7QA 5EUOF 4OKVA 2BXZA 3C2SA 1Q72L 4GG6E 5IVZB 5GGVL 1YC7A 2FX7H 1LD9B 4HLJA 4MCZB 1VHPA 4HW6A 3CPLB 3QUXC 4JZOA 4TVPH 4ZYKB 3S98A 3VXSA 3MRKA 4L5FH 3BKMH 3H6JA 5MERA 2BC4B 4TUKL 3TJEH 1CXHA 3FN3A 1U8PB 3FT2A 2BMKA 3ZHKA 3FOMA 1S78D 2Z91A 2HP4A 4IHOA 3FT3A 3VG0L 4JQVA 5JXED 2DMCA 4U33A 1KPVA 2VYRE 3KYKH 1RJYB 2Z31A 1RUMH 1A7RL 5HGAB 2EICA 4XVSL 5T5NG 4ZUUA 1A1MA 4OZGF 1KEGL 2A6IA 5JORA 1FZKA 1KF9B 4CADA 1RZ8B 3L3KB 3ZL4L 2UWEB 4U7SA 4X6FA 4HIJB 3MBEC 3LMJL 4H1LG 1EFXA 1YY9D 2E6JA 1ZANH 5F89A 2J8UE 1NGPH 1UCBL 4E5XA 1MH5A 5CIPH 1NGZB 2HFFB 2YD4A 2PXYC 1EVUA 3T3MF 1U8MB 2NY5L 4YQXL 5BV7L 4QRSB 4QXUH 3V4VL 3DARA 5CD5D 5DUML 3DX6B 5FCUH 5ICXB 3QFJD 3Q2CA 4XCYB 2E7LA 1ZLUK 4KMTL 5DJAA 3GI9L 4WENB 3DMMD 3EO9L 2R8SL 4XZUA 1JGUH 3IFOB 5D1QD 3BAEH 4AIOA 1MFBH 3DSFH 5I1GL 5GRUL 3U6RA 5SWZA 4Y5XC 3MREA 5ICYA 3DUUA 3RVVC 1OAXH 3RWIA 3RX7A 4LLAA 5D7IE 1TMCB 5KSBF 2AGJH 4G6FD 1CL7H 4M6MH 3RAJH 2D7MA 4L8CB 2PYFA 2OL3L 4LL9A 3F58H 4LHUD 4CN6A 3HNTL 3PWPA 5D71H 2WNGA 3AS2A 3DV6A 2R0KH 4N90D 4LSPH 2MTPA 3WFEL 1AP2A 4Y5VA 1YEFH 4HWZA 2YSSA 3CU7A 3WCYA 3PL6A 3EO0A 4TSAL 4LVNC 4OGAC 1BX2B 5IM7B 1JF1A 4QXGL 3OGOE 4OLYH 3EO1B 5KW9L 1Y18B 1VB9A 4U6HB 3EDKA 2QKIA 4XPTL 2CKBB 3BO8A 5BZWA 1QBAA 5F6HI 4PGBB 1Q8MA 4UV7H 4AEHL 1F11B 2FBJL 5I8EB 1DANT 5I16B 3VDAA 4EI5D 3MA9H 2VZ3A 5CUSL 1IGIH 4H8WH 1RZIA 1MCPL 2VN4A 1AGCB 1D6VH 1OTUC 3ARDC 4HMDA 3EYVA 1R3IL 1QSFE 5CJ8A 1FLTX 4MAYD 1RIUL 1E4XL 1KIRB 3RUGF 3MRFB 2C9AA 4NZRL 1MCBA 3ZE1F 1NC4B 1IGCL 4NGHL 2HTKD 2ICWB 1BD2B 3V0WL 4JPIA 3FQRB 2XWBB 3GMLB 3TBYB 3MRCA 4J1UA 1IM3B 4U6VH 5LGJA 3H9SB 3VWJA 4ORGB 3TM6A 3TV3L 5E6IA 3QHTC 3VGBA 3VRJB 3VXPB 3C09B 4BUHA 3K1DA 3C9NB 2W1NA 1HSAB 4GRMA 5CJOL 2Q6WB 5C0AA 4FQ1L 2MSPA 4ODHL 5T5FL 4ZO7A 2NLJB 1C5CH 3LKRA 3QUYD 3V5DB 2AKRA 2QSCH 1CDCA 1O7VA 1V05A 4K7PL 5TJWK 1TQCC 1F45A 2P5WD 3LDBB 1OB1A 4CVWA 3L5XH 5GHWL 4PRHE 2FLBT 4JDVB 1EIBA 4IDJL 3NN8A 1DE4A 4GG6A 1A6VH 1FL5B 1OGTB 4OCYH 5FM8A 1B2WL 1XGYH 3OKLB 5J1AB 3ZE0E 2AXHA 4PJAB 1N6VA 4J6RH 1HQ4A 3GSUB 4UQ3B 5C9KA 5J6GB 4DN4L 2AERT 5DS8B 2FX9H 5KVGH 1LE5A 5IB4B 2NW2B 1T66D 3AROA 3UBXI 3TCLA 5A3IC 2ED9A 3W39A 5I1JH 4CU6A 1S9KC 1I7RA 1EUUA 3D39D 1LEIB 3QP3A 3GRWA 3MGOA 4XPBH 1XIWA 2D2OA 2DBLH 4XX1G 5FM4A 3TO2A 1BVKA 1ZV5A 1MQKH 2F5AH 2X70A 1CD0A 2R2CA 1OVZA 1JPSL 2SEBA 3KLAA 3S36X 1CGVA 3BMVA 5HHMD 3UTPE 5I8CA 4R96B 3F12A 2BCKA 4OGXL 1PX3A 4ZOCA 4PLJD 5AYUL 3OPZL 5K59E 2YPVL 1IGJA 2AK4B 3QIWB 5K93A 5IWLC 3GIZL 5FYJD 2B8OT 2DLFL 1T5XA 1AD9B 2MQCA 5H8DA 5FO7B 4FFZL 2DDQH 5JQ6H 4G6AC 2B4CC 1VPOH 4K3GA 1S7WB 5J06A 4UTAH 3GJFB 4XVTH 5F9JA 1ZHKB 1VFBB 3FB8A 4FQPA 2DM7A 3ZKMC 1SVZA 4CN4A 4MJ4A 4LAQH 1IQWH 4YHYC 5E00A 2J1KA 3LKQA 2DJSA 1X5FA 4G80B 1IBGL 2FSEB 3DRQB 3EJZC 3CFDB 3D9AH 4WI7A 1XGPB 2KKQA 3CH1A 4JFHE 2L0DA 3SDCB 3RZCA 4KDVA 5FA3A 3RDTD 4MJIB 4Z0BH 3WKML 1JUFB 1YEEH 5JW4Q 2NNAB 2V17L 3ZHLA 2LE9A 3ARFA 3LH2H 3QCUH 3RY5A 3RY6A 2BSRA 3QEQB 4M1DL 4HUMB 2R39A 5AD0B 1OM3L 2OBGA 4JG0L 5J4MA 3HR5B 5L0QB 3EDEA 2R4RL 4PP2B 5SV3A 5KSVA 1CE1L 3O3BB 5JHDB 3L3DA 2X1WL 3EYSL 4GW1B 3UYPA 2F53B 2GJZB 1DN0A 3KPPB 3L3JA 2G75B 2NXYD 3RTQC 4HUKB 1ZS8B 3SDDD 2ZOLA 4YDLB 5AZ2H 1UVQA 1SY6L 4HC1H 5LBSH 3TCXA 4MAUH 5JMOC 3UYRH 1OAYH 2BZDA 4S10A 1KB5L 3FTGB 1FSKB 1MCCA 4GW5B 4Z7WF 1O5DT 1ZVYA 2DKUA 2FO4A 3GMOA 3BXNB 5HYIA 1WCQA 3PNWA 3I50L 4IRJC 3S6CA 3RWEA 2BVTA 1S7TA 4V1DB 4JRWA 3LCYA 1PQZA 4G7YH 1JPTL 4LASL 4PG9B 4U1KA 4HKJA 2VDNH 1RIHH 4MDIA 1KC5H 3NPSC 4Y8DC 2IH3A 1MY5A 5I1HH 3MJ7B 1ZLUH 1VDGA 4GW4A 5F1IB 2B5IC 4PP1D 3W11C 4A6YB 2CJUH 2HFTA 3U0PA 1T3FA 2NX5B 3SQOH 2R9HD 3SDAD 4D9LH 1QSFA 3B2UC 5IW6A 3WFBH 5EOQL 3MBXL 4IS6A 5DRXA 3ARGD 3RVTC 2VABA 3QULA 3MACH 2CRZA 3VFWB 1JN6B 1NC2A 5FO8B 3TFKD 4ZAKD 4EUPB 4LLWB 3QDJD 4Z95L 1MQ8A 1NUNB 3QJFB 4YHPA 4X6CB 4H25B 4GKNA 1CGYA 3O6FC 3AXLB 5CGYD 4LCIL 4HH9A 5D9SA 4TNWK 1A3RH 1G7IA 4Q9QL 2DI8A 2BHYA 1E0OB 4NN7C 1T0NA 4OQ1A 1F4HA 2PTTB 4QT5B 5GS1A 4NO5B 4R7NA 3UTOA 4PB9H 4ELMF 1WISA 1ZT4A 4AT6B 4XMKL 4U1IA 1MI5D 1MFAH 1T2QH 4YZFE 4IRSD 4K07A 3VGDA 3QXUA 2NY0C 3MPCA 2CK2A 1XCQB 4O58L 4NQCE 4MNHA 1SM3L 4XP6H 2D31B 4NRXB 4KROB 4NO0D 4L3EA 1MCOL 4G42A 3F7VA 3VRLE 1IC5H 2ZUYA 3HLAB 4LQ1A 2G5RA 1BM3L 1Q9LB 4Y89A 5ILTL 4FQHB 5H94B 4LCCA 3ARBA 2PYEB 5D72H 5EZOL 4AENA 1A4KA 3OB8A 4MVBD 5FA4A 4JFDB 2FL5A 5HPOA 2WWKO 1DLHB 3VDCA 4QOKD 1G7LA 3IU3B 3BW9B 4TUKH 5IMLA 3UP1A 4ZS6D 1K8DB 2CLZB 3OF6A 4ETQB 1OF2B 4BZ2H 3VG0H 4PFEA 1SJEA 5F8RC 3BZEB 1IEBA 2GSIA 5EG6C 5I1AA 3P9WB 4PR5B 4L4TB 4XVSH 4NQEB 1KEGH 2XIDA 3P0VL 3QUZB 3ZL4H 1A7QL 1HH9B 3LMJH 1KYOK 4IBLT 1LK2B 4G8GE 5CP3H 5CJQL 4EI6B 3PGCB 1RJCA 4PY8J 3RWDB 1RZ7L 1IM9A 1MWAL 2NY5H 4YQXH 5BV7H 2XKNB 3B8SA 5DMIL 4OZFB 1PVHA 4QKXB 3V4VH 2CO7B 2EEBA 3PDOB 1T4KB 5DUMH 5BRZB 3MUGB 1G7PB 2BHUA 4F15B 3GIVB 1V8HA 1K8IA 3GI9H 2R56L 2C26A 1TTGA 2GK0B 2R8SH 1G7MA 4JREC 5DQJB 1G7JA 2O5YL 3QZWB 1JPFB 1JV5B 1AO7E 3MROB 4OF7A 1XF4A 5GRUH 1I9EA 4XI5D 4JANA 3DVNB 5E8EB 4ZNEE 3S7GA 4MLIA 3RVWD 4FXGB 3S97C 3SJVD 2UVEA 2CIIA 3RGVB 1B4JL 3ZSSA 1BQHG 3LZFL 4U3HA 4ZXBB 2OL3H 4NC1C 4PJDE 1JVKA 3TO4C 3K8MA 4P3WA 4QHMA 5F7LB 4JFEE 5I15L 3MV9D 3RL2B 3WFEH 1XZ0A 5I8OL 4UZGA 4KRLB 4ONHB 3ZDYF 5EIIB 5F9WB 3X17A 2BX5A 3FQXA 3QEUB 1T20B 1R3JA 2X6MA 2R0ZH 3TBWB 3HI1A 4TSAH 3UJIL 4NCC2 2DQCL 5IFJA 3VGGA 4ZD3L 1ZVHA 2BNRD 3BRGC 3QH3A 4YC2C 3NIGE 1A4JB 2X4PA 5CWSA 1OTTC 2ADIA 4Y4HB 5HVFB 5HHPB 3VWKB 4BH7A 4P48A 2XTJE 3HTLX 4XPTH 2JJTA 2R2EB 4NQSA 3WFCL 4F57L 5ELIA 3O81A 4U05A 3DXAA 1SJXA 2FBJH 4PJFF 5LG1A 4POZD 5DYOA 1A2YB 4GKSA 5CUSH 5F3HA 5J56B 5EZLB 5IB5A 1MCPH 3WO3B 5FM5O 4GG8A 2CGRL 1R5IA 1NCNA 1ERNA 4J12A 5IG7B 1R3IH 5B38G 4IEFB 1RIUH 1QSEE 4JY4B 1E4XH 5EFIA 4D9QD 4F7PA 2XY2A 4NZRH 5E6ZA 4JRXD 2P43B 2ZSWA 1IGCH 2N4IA 2XRAL 4NGHH 1S8DB 3TNNA 4P59L 3T4YA 3WIHA 2VRAA 2AJZA 5F9OH 3T2QA 4APQC 5EBMB 3BRFA 5HJ3B 1KN4L 3U82B 1XGTA 3CJJA 4IMKA 3S9DB 3AS0A 4HPYH 4MNQE 4GBXB 3TV3H 3BQUB 5C0CD 4WEBL 3NPZB 2O61B 3MGAA 5JW5A 3A6BL 1VFMA 2IQ9L 2CQVA 3FRUA 2W92A 5CJOH 4GRLA 1C16A 1MVUA 5TPWL 2XACC 2X42A 4FQ1H 3DNKA 4NQCA 4ODHH 1MAJA 2CIKA 5CGMA 4BZ1L 1MLCA 2B2XL 4HCRL 3LEYL 4QRRE 4YDVB 3W9EA 3EIFA 3K46A 3U7AA 5I1DB 3IU4L 2Z0BA 1FAKT 1U8LB 1BF2A 5DHYB 4LOUD 1H8NA 1ZGLB 4K7PH 1AKJD 2F5BL 3QQ4A 4UT6H 1YEDA 3C8DA 1PLGL 4W6YB 1XGUB 1QBMH 5GHWH 3MRHA 4X8JA 1X5XA 1CDYA 4Y1AA 1EERB 5DJDA 3ZT5A 1B2WH 4P5MB 4PRPA 4R2GB 5SWSB 3SN6N 4JFXB 3ELAT 4N1CA 4ODUB 3MJ9H 5HYSG 1KJ3L 5F6IB 2X4OA 2ZCKL 4DN4H 1QG3A 2J4WH 2GQHA 2YN5A 1IGFL 5HYEA 1WT5C 2ICWI 5DURB 2OTPA 3PV6A 4HIEB 2IBZY 1U8NB 7CGTA 4JM2D 1MJJA 3OKMA 4WV1B 2FECI 4Z5RB 1BJ8A 3SE3C 1U8QA 3QXWA 4MD4B 4MSWB 5KJRL 1JPSH 4X8XA 2VL5B 4P2YA 1FGNL 2XN9E 5EU6B 2OM5A 1TJHL 4LVOC 2D0FA 3UTQA 1TZHA 4FFYL 4L9DA 4G8GA 2ATPA 1NKRA 2W91A 3OPZH 2VWEE 5F71A 2D9QB 3HI5L 2V9RA 1X3DA 4NZDA 2Q7YB 4B41A 3GJEB 3GIZH 1KXQE 4D0BB 2P8MB 2EDWA 2DLFH 4U6YA 2NY1B 4UIKL 4FFZH 1MHCB 3QIBB 2W38A 1A3LH 5T33H 1C1EL 2HT4D 1X5GA 4M8QA 4XXDB 4D94A 2C4FU 4RRPG 4WO4A 4M4RA 2OZ4L 2A0LC 1IBGH 3ALXA 2BSTA 2FX8H 3MRQB 4OD1L 1AO7A 1DVFA 2VZTA 4RMVA 4E41B 4NT6A 1F90L 1KPRB 1U2CA 3VXUA 1TVHA 2VXSL 4ZFGL 3WKMH 5JOPE 1T89A 2NY4C 4G8IA 5GJTL 4QRPB 2V17H 4Z7UF 5E0QA 1S7SB 3VJ6A 4PJDA 1IAOB 4QTHA 4IMLA 4BSVA 2ZPKL 2EO9A 5ISZB 1OM3H 1R0AH 4JG0H 1RQ5A 4JFEA 5C0JB 1XR9B 2AABL 5D1ZB 1CE1H 5F7KC 3EYSH 4OZIB 2D0GA 4FXKB 2IALB 4I2XE 1F2XK 3HMXL 4HJGA 4OGYL 5CCKH 1SY6H 1JF6A 5GRVL 4Y2DD 1NEUA 1ZWIB 4HD9A 2RAMA 5HDBF 5IROC 1KB5H 1ZOXA 1A22B 3FN0L 1NMBL 4YDIL 4OCWH 4OF3A 4O2FA 4EJ1C 1I7TA 4KI5C 3PXHA 3G5YA 3I50H 2LTQB 5AUMA 1G0XA 1KNOB 1TCMA 4MNGB 1MRCH 1NCUA 1GGIL 4LASH 1JPTH 3VFSB 1R3LA 4QRUB 2VL4A 3BEVA 2CH8A 5GS2D 2VIRB 1QQDA 1YEJH 2HRLA 4AIXA 4EN3A 1EEUA 3ARPA 3REVB 2DQGL 3T0EE 5IOPA 5DD3L 15C8L 2BVQA 4ZQKB 3L3OA 3U30B 1XGRB 5E94A 4OV6F 1FN4B 5GGRB 4FHBD 3MBXH 4WVRA 3HA0A 3G5ZA 5HI3C 3O45A 2W9DL 4N9GA 2MCG1 4QLRA 4PJCF 5ID0A 5T1LB 4Z95H 3HZYB 1MFEL 4ENED 3AC0A 1LMKA 1XT5A 1P7QB 1WZMA 5E24E 1NDGB 5J9PA 2HLAB 3GBLA 1G9MC 4MNQA 1YZZA 3ECBA 4QEGA 4LCIH 2H8PA 3TBVA 3X3FH 4P23B 2ZUUA 1OGAA 3SBWC 3WMSA 1U41A 5M7QA 4LKCB 1SYSB 4Q9QH 2FWOA 5B8CA 4Y16D 1KELL 4PJ7A 1T2JA 3B9KD 3H9SE 4U1GB 3W5MA 5B4MD 1I1FB 2HAZA 3GSRA 5DEGA 2QSQA 3K2UL 4L3CA 4P2OD 4QRRA 1MAML 2HFEB 3VE0A 2P47B 5JW3H 5I2IB 4I0PB 3H8NA 1S5HA 4O58H 3RP1A 5DJZA 5MHSE 5DC4B 2IG2H 5A2IH 1CFVL 3SCMB 1OP9A 1CDUA 3VFMB 3EJYC 5JUEL 1MCOH 4HG4J 5DI8B 4H88H 1U2HA 3U0TA 2BOBB 4XTRC 3QEHB 3VFNB 1EZVX 1BM3H 2Y6SD 3MRPA 5MENE 3OJDA 1J7VR 5ILTH 4OD3L 3I6LD 1JHTB 1A47A 1ORQB 3OKEB 4KK9D 5E08L 5L9DL 1E4KC 1R5VB 5EZOH 3R4DA 5CZXC 1LGVA 1LD9A 1TVBB 1H5BC 3MOAH 3CPLA 4ZYKA 4PGJA 4XHJC 5CP7B 5TDPB 1U3HB 5T3XL 2I5YL 3EOYG 1FLRL 3C09C 4WHTA 3QIUC 4IOFC 3FB6B 4WGWB 1WAAF 2LAAA 4X0KB 2DN7A 2XN9A 2WQ8A 3WLBB 4OLZL 3FFDA 3SKMB 1W0YT 3VFVA 1CYGA 1NAMA 3QBTB 2UWEA 1A7QH 1IE5A 1JHKL 4ZNCD 5L2KB 1I9RL 3VXSD 3RX8A 1RI8A 3RNKA 4XVJL 5J7CC 4WI8A 4KXZH 1YDPB 5CJQH 4RNRB 1Q9OB 3S5LG 4XP5L 3GSNL 1I9IL 5DEZA 3IAQA 3FQWA 4QRSA 2H26A 1F3RB 2DD8H 2ZKHL 4XP4L 4ESKA 1OD9A 1UZ8B 4LCWE 4XCYA 4ZPTB 2Z31D 4XAWL 43C9B 1NCCL 2EDTA 3GHEL 2NY6D 3PQYB 3DBXA 2YZ8A 1EJOL 3IFOA 1ONQB 1EFXD 4NZUL 1EAJA 3BT2H 3UX9B 4NJAL 2X1PA 4Q74A 5SX4H 5HYJE 4MJIE 2YUZA 4OUUB 3HB3C 1B4JH 1UA6L 4Y19E 2GJ6B 2R29L 1MUJB 3QIWC 3DURB 2B4CH 4NNYB 4S2SA 4R7DB 4I2XA 5I15H 4OJFL 2JE8A 3SDXB 4JPKH 1CIUA 1AY1L 3LKOA 3OMZA 5SWZD 1LP9F 5I8OH 4GQ9H 1JP5A 4RMTA 1RHFA 2CDFB 3QXAA 4QO1A 5C0RH 4M61B 4PV9B 3MV01 4WY7L 4RAHA 4O5LH 1FL6B 5D96B 3AFLA 1JHLL 5GRYA 2DQCH 4ZD3H 1CXIA 1BX2A 2X89A 5GSVB 5I8KL 5IM7A 1FZOB 4MX7B 4NKQB 2X9WA 1RUAL 4YXLL 1Y18A 2HJFB 4KJQC 3SGKC 3T0EA 1FZJA 5D7JB 1X5YA 2A83A 1QFWL 3PWPD 4YPGB 3M45A 2DLTA 4QXTB 1HHGB 4F57H 3Q48A 2CKBA 4NNXB 4WEUD 5ANMB 2YZ1A 5I8EA 3K0WA 3ULUL 4TUOB 2GTZB 3VMOA 2C7UB 2FGWL 2N7AA 4HIXL 4Z76B 5L0QC 1EEYB 1F3JA 1AGCA 2CGRH 4DW2L 3PL6D 3PWUA 1I9JH 1DLFL 3UMTA 3TH4T 5KSAB 3TLRA 1KIRA 3MRFA 1LHZA 4XNZB 4YDLC 4H1LB 2ZCHL 2XRAH 2PO6B 2J5LB 4GAYB 4P59H 1I1AC 1J0KA 4NHUA 3KYNB 4JHWH 3KYMB 3FQRA 1FSKC 5K9QG 3MXVH 1KN4H 3GMLA 3LEXA 2MNUA 4X6DB 3UJTL 5DJCA 5C7XL 3HPJB 2VQ1B 1IM3A 3D85D 5F1NA 4EQ3A 3H9SA 3UAJC 4WEBH 1LO2H 3QISA 4LSTL 3VRJA 4KMLB 5SX5K 5E6YA 1QSZA 4LHUG 4YUEH 5TPWH 2OR9L 2Q6WA 3EAKA 3F62A 1IAKB 2GT9B 1R24B 2P44B 5C08E 1MFDL 1C5DB 2FCBA 4IIQA 3UO1H 1DL7H 2NLJA 3A6CL 1DQQB 2B2XH 4HCRH 3KLHC 3T0DA 2QHRH 1BZQK 2R1WB 3OX8B 3IU4H 4HUUB 1LO5B 2IBGA 3C60B 4QWWD 5IEHB 5GISL 3V5DA 2F5BH 3N85L 3JV4A 5TE7H 1PLGH 1HWGB 2FLRT 2FIKA 1UG9A 2BNQE 2XFXA 1AE6L 5MENA 3VWJD 5AZEL 5E6ID 1FL5A 1OGTA 3KS0H 3OTTA 3BE1H 3D1MC 4S1SL 5D5MB 3OKLA 1E27A 5J1AA 4Z7VF 1GIGH 2ZCKH 5J6GA 3MLUL 1OP5K 1RUPL 1IGFH 3H9ZA 1G7QB 4JJ5A 1LEIA 4HUXB 1Z0NA 3HRPA 1U6AL 1SEQH 2H2PD 1VADA 3JV6B 1Q94A 1KLUA 3MO1B 5IGXL 5KJRH 5EUOE 3IKCB 1CXFA 1AIFA 2VN7A 1BWWA 4NQDB 1CS6A 5DJYB 5CKAA 3F7QA 5DXWA 2OMBA 5D93B 1TJHH 4R96A 1AFVH 4P5KA 1JZ7A 2FATL 2LV4A 3CDGA 1QYGH 4XC3L 3HI5H 3I02A 3G6JF 4OZ4B 2JJWA 2ADGA 3HE7C 5HSFA 3T8XB 2VLJE 5TDNB 5C2UB 4PLKC 1DQML 2EDLA 4XBPB 2OLDA 1XIWD 1C1EH 4LCWA 3C6SB 3P4LA 1VFBA 3WS3B 3B3IB 1TDQA 3O6KL 1D5BB 2OZ4H 2YWZA 4OZGE 5BW7C 1LEGB 3W0WB 3RVVD 2YPLE 4KQ4L 1K3ZA 4G80A 5EPMA 5LGHL 3CFDA 3IB4A 2EDBA 2RFXB 4JFZL 4OD1H 5C0GA 4XT1C 1VFOA 1XGPA 2VLRB 4L8SB 3PWVB 1F90H 3SDCA 3E6FA 2CLVA 2H6PB 3AY4A 3IDXL 4LLQA 4RX4A 5HYJA 4ZFGH 2VLKB 4MJIA 1N6QL 4KVCL 1JUFA 4TSCL 2Y36H 5GJTH 2VXUL 1I8KB 4CJ1A 1YYMH 2GK2A 4Y19A 4BZYA 2PCPA 4Y0GA 4GAJL 4YHML 3O9WB 5DUPL 2Q87A 2FJHB 4PBVC 4PJ5B 3GSWA 4TNVF 5J12B 1MJUL 1QLRB 2IC2A 3LHPL 4PP2A 2A6JB 4XWOC 5JHDA 4PPTA 1XR8B 4JE4B 3HR6A 4ETYA 2GJZA 1CFNA 1OOAA 3HMXH 4PRDB 3KPPA 5HDQL 4OGYH 1G7HB 1ZS8A 3RZCD 5KSBE 5E2VH 4X9GA 3CVHB 1UC6A 4P3CL 1BOGA 3VFTB 2YPKB 3FTGA 4F15C 1NMBH 4XP1L 3MV7B 3ARFD 2Q20A 3OKOB 3MCG1 1KCUL 2R2HB 2HTLC 3MLZL 3PF2A 2EIBA 5C0NC 4JO2L 2OTWA 4OLWL 1PBYA 4U7MA 3JWDL 4PJGF 2X5PA 2Y5TA 4I18B 3MJ7A 2PTUA 2DQGH 5F1IA 2F9BT 1YPZB 4A6YA 15C8H 4G8EB 4ZXBC 3MX0A 4RQQB 3ILPB 3KJ4B 4XCCH 3TWCL 1KCLA 2VDOL 1HI6B 3ARZA 1JN6A 4XBEL 5FO8A 2YEZB 4LLWA 3RVXD 2YC1B 3Q1SL 2HLFC 2EE9A 4Z8FH 4C83A 4X4XB 2ATKA 5FK9A 5J3HC 1H8SA 4PY8I 4I9WE 3AXLA 1NCAL 5FB8A 1CI5A 4PJCB 1GOFA 1HWHB 5C86A 3EOAB 3FCTB 5EULV 3UDWC 1KIUA 3GSVA 1QSFD 3RUGE 1KELH 4HS8L 5C08A 1CXLA 2WBJB 2BOCA 2PTTA 4NO5A 4HBQA 1O7SA 3ZE1E 3K2UH 4X5XA 4NC2B 1XCTB 4U3XA 4C54A 1NC2D 1H0DB 2EE6A 5KTEH 5ICZA 1CFVH 2BNQA 5E8PA 1X4XA 2C3XA 5JUEH 2HG5A 2NCMA 4KRPD 3ARXA 2A1WL 2F54B 2V5YA 5A3ID 1OY3B 2KH2B 3DECA 2HT3D 3HLAA 1D6EA 4BFIB 4NZJA 4U1LB 3WHXB 4OD3H 4FQHA 5H94A 4LPCA 5E08H 5L9DH 1X5JA 2PYEA 3P3YA 2GIYA 3NIDE 3DO7B 5SWSE 3RPIB 2ITCA 1A6UH 3IFLL 4LNRB 1S5IH 2FR4A 2H1PL 4HUNB 3FAWA 4PV8B 2DQIL 3VD3A 5T3XH 2I5YH 3IJYA 1FLRH 1GHFL 2CLZA 5EUOA 1NQBA 3WNKA 2AP2A 4L3ED 4ETQA 1F6LL 1OF2A 4W70A 1EXUB 4DTGL 4MQSB 4KJWD 3UTZB 4KV5F 3RWJB 2I07B 4OLZH 3OKKB 3KYOB 1G0YR 1EHXA 2EYRB 3LQAC 1CICC 3ARBD 4KZEH 3QUZA 1WTGT 3QUMA 3QDMB 2VLJA 5D1XC 5BOZG 1I4FA 1JHKH 1HH9A 5SX5H 3IDMA 4XVJH 5ETUB 2QJDA 3MA7A 4WI6A 1WCBB 4OZGA 4X80L 5HPMA 4XP5H 4R2GC 3T65A 1EV2E 2RQ8A 3OF6D 5C07B 3CNKA 4YGVA 1S9WA 3PDOA 1VA9A 4XVUD 5CZVL 1YA5A 1NCCH 2AS5M 3GHEH 1V7NL 2DTSA 5C09E 1DP0A 2GK0A 1QFHA 2VZUA 4WV1C 3T2PA 3C5ZB 4FABL 32C2A 2K3TA 3CFBB 4NZUH 3MROA 3GRWL 4M4PA 4NJAH 3GB7B 4PB0L 1YJDC 3DVNA 4JM4L 3IDJA 1WFUA 4X4MA 5JXAL 1CXEA 3SKUD 1OP5H 3JWNC 3IKKA 1I1CA 1CDHA 2VTFA 1B3JA 1PD6A 1T83A 1VGKB 2FEEI 1U93B 3RGVA 1JGVH 2XA8L 5GZNC 2R29H 3RL1B 1CTOA 4HT1H 3RNQA 3H9HB 5B38A 1M6OB 4JFHD 1MIML 1U92A 4RGNE 5H2BA 3FQTB 3QIBC 4OJFH 5JA8B 3L6FB 1I7ZA 3RJDA 1NAKL 2X1XR 4OZIE 3RL2A 4ONHA 5EIIA 2Y7QA 3MJGX 4WY7H 4M9PA 2X44D 1T20A 4BFGA 1OQOA 1JHLH 1TFHA 3LAFA 5I8KH 4KWUA 3OJVC 4PJXF 5IESL 1NBZA 2V2XB 2Y4SA 2EO1A 1KJ2L 4YXLH 3VXME 4AEEA 4XNYH 1YUHA 4Y4HA 4FMFA 3VWKA 4DN3L 3RVTD 5T3ZD 1QFWH 2HT2D 1FYTE 4JHAL 5ABDE 1T2XA 2R2EA 3MRDB 1MELA 1JI2A 2JIXA 3LRGA 4N0UB 4Z7WE 3ULUH 5F7EL 1A2YA 4Y5YA 1N2RA 3FAXA 1RVFL 1MCWW 2CK0L 4HIXH 5EZLA 2FHBA 5LCVL 4CMMB 4DW2H 1YQVL 4J3UA 2EDOA 4WJ5B 3S3PA 5A2KH 1HHHB 1DLFH 2NY2B 4BSJA 4LGPB 3FZUD 2EZ0D 3TA3B 2P24A 5DHVA 2JCCB 5MP6L 2G9HA 2ZCHH 1D9KA 3TZVA 3RVUC 4CVXB 4OFPA 2OI9B 1NUGA 4X9IA 1INDL 5EBMA 5E8NB 5HJ3A 3UJTH 5JQHC 2NY0D 4IJ3B 3RHWK 3RUGA 4UOW1 1YEGL 4DEPB 1K6QL 3DXAD 4GBXA 2LTQC 5LQBH 3BQUA 4LSTH 4LIQE 5I1EL 5CEYB 1CK0L 2BVOB 2X41A 2OR9H 5E03A 5HVHB 1NFDF 4M43H 1KCSL 4U1MB 35C8L 1MFDH 3QXVA 1IC7H 2CPCA 2UY7A 3EYUH 4F7MA 4LPTA 1YNLH 4KTDL 3A6CH 4I0KA 4FTVE 2IADA 1AHWB 3MNVA 4H20H 2LAGB 5HY9B 5I1DA 2RBLA 4RFOL 3U30C 5GISH 2DYPB 2C3WA 2WP3O 3KXFD 5MEPB 1CG9B 3K8KA 2K9UA 1AE6H 4ELME 5IBUB 4UINL 1FPTL 3AUVA 4PJEF 5FFLA 3HG1B 2JELH 5D2LF 2ZG1A 5SWSA 3ZT7A 4JFXA 3RX5A 4ODUA 4FA8A 4R0LC 4G9FE 1QFWM 2Z35B 3MLUH 1FFRA 3MRIA 1RUPH 1J10A 1SEBA 2C5DC 1FNEB 1C7TA 4P23C 5DMGC 2IFFL 4OV5A 1MCQA 4HIEA 3SEPA 3TH3T 3ARYA 5CINH 4HSQA 1U8NA 3WN5A 1U6AH 3ULSB 1ZHBA 4R8WH 1G84A 1QLFA 3LRSB 5IEKB 5FV2A 1YNKL 2AVGA 3E3QE 3VXRB 5JLZB 4PGZA 1HOCB 2ENSA 4Y1AD 4JQXA 1ZT1B 4PRPD 5EU6A 5A2LH 1RZKL 1AGFB 3R8BB 2R23A 3UZQA 1FNLA 1CF8L 4YBLB 1G6RA 4D0CA 4P2QB 1FC1A 2FATH 3QQ9C 3SCMC 3K80A 4WHDA 2PR4L 4CKVX 1KCRL 8FABB 4HF5L 5AG9A 2Q7YA 4D0BA 1PEWA 3ULVC 3WDIA 3GGWA 5D2NC 4N8VB 3F7YA 1L7TH 1DQMH 2X4SB 3MRGB 4QCIB 3TPUB 1IC4L 5B3JF 4NUJB 3I75B 3R06B 1ZGLP 1BQLH 1UGNA 5DEFA 4HBCL 3BRDA 3G04A 3KPMB 3WJLC 1KULA 2VSCA 4FOMA 5CILL 4QNPF 5C09A 2Y1VA 4KQ4H 2FH6A 1JGEA 2DOCA 5LGHH 2A6KB 1ETZA 4ELKB 5T1KB 3V4UL 4JFZH 1AGEB 1T7YA 2VR5A 3MRQA 4N0YH 4G8GD 4PGDB 1T0MA 1KPRA 2BSSB 2EH8L 2F8VA 3IDXH 4JVWA 1Z2KA 2BDNL 3TO4D 3MRJB 5C0DA 3RWHB 4QHNA 4KVCH 5HGDB 5F88B 4YE4H 4TSCH 4EBQL 4QRPA 3EGSB 5L8KB 1S7SA 2N1KA 2JJVA 4GAJH 1NGYB 1IAOA 4WO4D 4YHMH 2NW3A 5DUPH 1X6NA 5BS0B 3MOBL 5ERWB 1MJUH 3TT1H 5K9JL 2VE6B 5D1ZA 3GK8L 2GJ6E 1VESA 1AO7D 2ZUVA 4OZIA 1DVFD 5E1AA 4PGEB 3JSSA 4FXKA 4XB8A 1WJ3A 2I60L 3VXUD 4NM4L 5HDQH 4C56B 2IGFL 3SPVA 4MMZC 5CEZD 5C71A 1OTTD 4P3CH 3WXWH 5D7SL 5CEXA 2V2WA 1K2DB 4ODVH 3OR7A 4DUVA 3C5JA 1WBYB 3UROR 1YJDL 4P4KD 1A0QL 4ZUTA 1KCUH 1M7IB 1KNOA 3MLZH 2P49B 4JFED 4U1NB 4JG1L 3VFSA 1YY8A 5DJ8A 1FYTA 4JO2H 4F58L 1X5IA 5C0BD 3S35X 4X6BA 4EQ2A 1HH6B 3ZDYE 1F02I 3S34L 4KTEL 2HKFH 2OJZL 4Z7WA 2I27N 2AK1L 3QDGE 2F8OA 4F2MA 4ZQKA 1XGRA 3QO1A 2F74B 4JY5L 5F93C 1I1YA 1NCWH 1J1OL 1LDPL 3TWCH 4KUZH 1FBIL 2WIIB 4HKBB 4XPGL 2MOVA 4P2CG 1J8HE 5E8OB 3C2AL 4LLVB 4XBEH 4ACPA 4LHQB 1W2KT 3HZYA 3U46A 4XCNA 3Q1SH 1GZPB 2XTJD 1TLKA 1EBAA 5DK3A 5BQ7B 4EN3D 2HLAA 5F9AC 4KMQA 1NCAH 5DD6B 1EK3A 1HXMA 3DLQR 4BUGA 2MCPL 4PRID 4LKCA 4NHCL 2CXKA 2HMID 5CJBA 4KK5D 3AREB 3P9MB 2CO6B 2EE3A 1I1FA 1FDLL 1HHJA 4FTVA 5GRWA 5D7JC 3ROLB 2HFEA 4P5TA 5I73C 4ZTPH 3QNYB 3G5VA 4JO1L 4I0PA 2WINB 2NXZC 3U4EA 4CUCA 4R4BA 1HYRC 4G43A 3IFNH 1WIOA 3S36L 1EVTC 3VFMA 4DGYL 4HS3B 4X7TA 4JKLA 4YHZL 3QWRD 3D18A 1OGAD 5SV4A 3LV3B 2BOBA 5ENWB 2M1KA 5KSAC 1QPXA 4G9FA 2DKMA 3TN0D 4XNZC 4HULB 3OV6A 2EH7H 3OKEA 2J5LC 5HD8C 1HK6A 1R5VA 3H7LA 2YOCA 2G60H 3MSPA 1TVBA 4K8RC 1WC7A 1AXSB 3VFOB 3WIHL 3BZFA 5CP7A 1U3HA 5JR1L 1HIML 1GHFH 5BV7B 1KYOJ 5GSRB 1FFNB 1H3XA 1KXTB 1II4E 4RISL 2P5WE 4X0KA 4DTGH 1JZ3A 3UPRB 1WBZA 4J3XA 4K94C 3WLBA 1BZ7B 3EOBA 3SKMA 3V6ZB 2I25N 1I7UA 2AV7A 3MZTA 3C60C 3WNPA 2P46B 4Q6IB 3DVIA 1NSNL 2A0LD 1D7FA 1UM5L 2IAMB 1N8ZA 4UAOC 4M6NL 4WU7B 2AXGA 3D39E 4YHKH 3P2TA 4X80H 3WL9B 4TVSa 3MRRB 1OT2A 1AXTL 2OL3B 4OZHF 4LLYB 2N7BA 3KLSA 5DVMA 4XWGH 5CZVH 1C12B 4ZPTA 2QR0B 1GRWA 2OMNA 3MV8B 2A73A 4V2BA 1V7NH 5HHME 3VI4F 3BEWB 1OL0A 4HKXB 1WBXA 1A64A 3FB7A 3QRGL 4QY8B 4FABH 1FH5L 3VW3L 1ONQA 5J11B 3KPLA 4D8PB 4JFFB 5EBLA 1TITA 1WFTA 4LBEA 3GRWH 4PB0H 2HRPL 5FYJE 4OI7A 4HK0A 5JXAH 3QA3B 5DR5L 3CZFB 7FABL 2VLKE 4U1JB 5D93C 4OUUA 5LJYH 4NKOB 1CQYA 3QFDB 1IKNC 5HXMA 2GJ6A 1P9MC 1E6OL 4WFHE 4Z78B 1MIMH 3DMMA 2OXHA 4F37K 5L2JB 3LPFA 4PJ5E 2GJJA 5D1QA 5CLWA 2CRMA 3Q6GH 1OTSC 5JOPD 5I19L 1NAKH 3T77B 4Z7UE 5JNYB 5DMKB 5FO9B 3PGFL 1T7XA 3N1FC 1FVEA 2JF1A 1CL7I 3BPLB 4LEOB 5EU5A 2NYYD 4M9OA 3ZYOA 5DQ9A 4MHHG 3VH8G 3SY0B 1IZKA 3QHFL 2NTSP 5IW3A 1CCZA 5DFTA 3UTSB 5GSVA 3KDMB 1U8KB 4F7TB 4KKAD 4MX7A 4HZLB 5IESH 1KJ2H 3HE6C 5IV2B 3D0LA 4RGMB 3VCLB 2HJFA 3LN5B 5HI3D 5FYKH 2BY0A 3QDGA 1I8LC 4X5WB 3PJSA 5HDLA 4I3GA 4JHAH 3JVGC 3RBGA 3UPAA 1JMXA 1HHGA 1RUQL 4NO3B 4AQOA 4MYWB 3HN3A 1M7DA 1B0RB 3BGFB 3WXVL 3D3VB 4OB5L 1U91B 3O9WC 4KQ3H 4X4ZA 5F7EH 3U1SH 4TUOA 3B9VA 2GTZA 1RVFH 2CK0H 4K3JL 5J12C 5KN5A 5FYLE 1J8HA 1EEYA 1YQVH 1OAUL 4UOW0 3AAZA 2X89D 1CVSC 4G7VL 5KG9B 1NLDL 5IVNA 1I3RB 3PWLB 2Q86B 2GY7B 2PO6A 4GAYA 3SE4C 5GGUA 3C5SB 1QBLH 1B90A 3UTTE 1INDH 1AGDA 2M2DA 5FCSH 3KYMA 4P9MH 2DIAA 2Q7NA 5FGCB 5BMFL 3ZE2F 1KJVA 5EA0L 3S5LB 3HPJA 3H9YA 1K6QH 4P46A 4PJCE 2QQLL 5I1EH 1CK0H 4KKBD 4MAYA 3NZ8B 4LSRL 3A0OA 3MV11 35C8H 4XTRD 1C5DA 4I18C 1OCWL 4KTDH 2JJSC 3I6KB 5EO9B 1H3VA 3PIQA 2DMKA 3VXNB 2KQNA 3MUHL 1BFOB 3DX8B 1FGVL 1KFAL 3WIFB 1LO5A 4PJBF 1BD2D 1W0WB 4WFED 3E8UH 3IT8D 1ZT7A 1UH4A 1CTNA 5F7NC 3H9SD 2ZOKB 4UINH 4S1RL 1FPTH 1RK1B 5JOFB 5TE6H 5CSZB 2EECA 3QHZL 5DJ0A 4GRWF 5MHSD 5JO5A 3TJHC 2Z9TA 1JNNL 3QUYA 2IFFH 1G7QA 4HLZH 2ED8A 1YNTB 2YD2A 2FDBP 2P5WA 4HUXA 4OUOA 2IPUK 2VLLA 4YBQC 3QUXB 3M17B 3JV6A 1U8JA 1CIDA 4MB3A 1YNKH 1NJ9A 1Q0YH 1UB5A 4KDWA 5MEND 4NQDA 2P8LA 5CJXA 1CFTB 5DJYA 1RZKH 1AI1H 1CF8H 2AJ3A 4DCQA 1ZSDB 6CGTA 4JB9H 1L4IA 4HS6B 4ERSL 1KCRH 1XH3A 4RIRA 3D39A 1WAAE 3T8XA 4M62L 4HGMA 1JYXA 5TDNA 5M94B 1IC4H 3CAFA 5F7FA 1JCKA 5HHQA 2GYSA 4HWNA 3QFJB 5T1DL 4HBCH 3DETD 2XZQL 3MLWL 1C08A 3L3IB 3B3IA 1D5BA 1NL0L 3TH2T 3AS3A 2NY3B 5F3BB 2PF6A 1AJ7H 1CGSL 2F15A 1OAQL 2H2SC 4FFWC 5JOEA 2RFXA 2R0WL 4B0MM 4L8SA 3PWVA 1ACZA 3HAEA 2EH8H 3QIWD 2H6PA 2FH8A 2VITB 2BDNH 5EC2B 4EDWL 1YMMB 2VLKA 2IWGA 2ZSVA 1KB5B 3HRZB 4EBQH 4W6XB 3PHOB 3BD5A 4XGZA 3DX9B 4LLDB 5IKCB 4Y5XB 4AH2B 2YXMA 3KHQA 3GSXA 4LCWD 2W0FA 1FL3A 3I9GL 4LHUB 4Y4KC 4PJ5A 3MOBH 3BP5A 3TPKA 1Y6NR 3QG7L 2Z8SA 5K9JH 5LKNA 4IOSD 1MSPA 1NAML 3GK8H 2BNUA 1T7WA 4Z7UA 5HI5D 3RDTA 5FGBA 3SDCD 1RHHB 3CUPB 3BGMA 4NM4H 4PRDA 3T3PF 2KDGA 1FRGL 5HYJD 4MJID 3WBDA 1ZA3A 3GMRB 4WWKB 5IBLD 4J4PC 5EZJA 3FOLA 5D7SH 3ILQC 5C0IA 2XICA 1HHIB 4Y19D 3VG9C 1BF8A 2F19H 4ZTOL 1GPOH 3SJVE 5FDWB 3RWGB 1YJDH 1BJMA 1A0QH 1V3LA 4FFVC 3X12B 1GGYA 4ZOBA 4JRYB 4Y88A 3C5ZC 2WZPD 5HHNB 2VZOA 4JG1H 4OLUL 1FCGA 3ZO0A 4LVNB 5I1KL 1BQUA 3MTRA 5LWYL 4YXKL 3GMNA 3M1BB 5JHDD 1WICA 3S34H 1F4YH 3SDDA 2F53D 3MV9E 3QPXL 1AD0A 1SMOA 2AK1H 3TVMC 1D5XB 4EI5B 1WSST 2RGSA 3BIBX 1MCFA 2PW2B 4PJIF 5B3NA 1EFQA 3O41B 4JY5H 5DQDL 4F7CB 1J1OH 1LDPH 2A77H 1KBGL 1FBIH 4UQ2B 3V5HB 4U1SA 1IZJA 4CU8A 4PJ8C 1HI6A 2BP3A 3BDYL 3P4NB 5I74C 3AS1A 3MCKA 2GEEA 4MXWL 3ARDB 2BFVL 3V4PH 3UTTA 4HJ0D 1ORS