1MELA

Crystal structure of a camel single-domain vh antibody fragment in complex with lysozyme
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
132
structure length
132
Chain Sequence
VQLQASGGGSVQAGGSLRLSCAASGYTIGPYCMGWFRQAPGKEREGVAAINMGGGITYYADSVKGRFTISQDNAKNTVYLLMNSLEPEDTAIYYCAADSTIYASYYECGHGLSTGGYGYDSWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (antibody/antigen)
molecule keywords VH SINGLE-DOMAIN ANTIBODY
publication title Crystal structure of a camel single-domain VH antibody fragment in complex with lysozyme.
pubmed doi rcsb
source organism Camelus dromedarius
total genus 32
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1melA00
1QKZL 4GMTL 1N3NB 5I1EL 5H2BB 1J0KA 5DK3A 1T2XA 2H3NB 3NCMA 4TUKL 5I9QB 4GKOA 1CXKA 4FP8L 1CFNB 4OQTL 3CVIL 4G80A 3GKWH 1JI2A 4XNZB 2H6PB 4O2CA 1FNGB 4JE4B 1OCWH 2QLVB 4XP6H 15C8L 3MV7A 2Z4QB 5KOMC 3C2AL 1KIPB 4OGZA 2BVOB 3QUKB 1HWHB 1ZANL 4TSAH 1NFKA 3TFKC 1ES0A 4FQJH 2P5WA 4PJ5A 3ROOA 4HK0B 4QOKB 2F9BT 1FORH 1U9KA 5CEZL 4KTYA 3HZMB 4JZNB 4WVRA 2IPTH 4F37K 1AXSA 4CU7A 3PUCA 4ZAKC 2WBJB 4Z5RA 2NW3A 5T3XE 2HJLB 1MI5E 5DQJB 4NKMA 4K8RL 1V05A 4M61B 2HG5B 3SKNB 2AJZA 4YDVA 1I1AC 3RWJA 2DLGA 1KLFA 2E9JA 4PJ7F 5C2BH 2ZUYA 3MGAA 5I16B 4Z0BH 5J56B 1F58L 4YAQB 1AHWA 3M1BB 5EC2B 4QHLB 5F1KC 2PTVA 1T0PB 3LSOA 4ZFFA 3TBTA 2VDQH 3RA7L 3D9AH 1MJJB 3BZEA 4L8BA 5BMFH 2DQCL 4Z6AT 2X9WA 4KK6C 5L6YH 1X4YA 2C3WA 2QR0A 2Q1EA 1DBKH 3LPGA 2I60L 3DVGA 4HUKB 1MCQA 3T3PE 3C2SA 1NEZA 1G84A 2FIRT 3TFKD 4XB7A 3U46A 5T3ZL 1A14L 3S3SA 3CGTA 3OBAA 4ZFOB 5JOFA 5HYSB 3ISWA 1WAAF 5T5FL 2CPCA 5DFTA 2VDPL 4F8QA 3BEWB 2F8XC 4X7SH 4G3YH 3UTQB 1H3WM 4MAUL 1A7QH 1JWUA 4E0RA 1LE5A 5ETUA 1YEEL 2R8SH 6CGTA 4NN5C 4M1GL 1P4IH 4JDVB 1KB5L 4WEBL 1IGFH 5HHOB 5ALBL 4UZGA 4BQBA 1QPPA 4S2SB 1CL7H 2AXFB 1IMHC 1WCQA 4MJIA 4YHOH 4YIQB 4WV1B 3F8UB 1ZVSB 5EFIA 3W5MA 2A83A 3O3BB 2IGFL 4DK3A 2X1XR 2PR4H 3QQ3B 4TSCH 2NTFA 1IZJA 1D5BA 3V6BR 5LQBL 4MWFA 1YUHA 1BQLL 1R3IH 2YZ8A 4X7DC 2BVPA 2O5YL 1MNUH 5D9SB 4J3SA 4QGYA 1WBZA 5DRZA 5FUCC 4HXAH 4FFZL 4H1LG 3E6HB 1EPFA 2JIXB 2P8LA 1FDLH 5C0JA 3EYUL 3BVNB 4LLAA 3HCVB 4I5BA 3HNSH 5EZOL 4JFDB 2VLLB 2XXCB 3DJ9A 1B0RB 1U6AL 4PRDB 5EOQL 4F7TB 2X9XA 2P8MA 1W8OA 4YGVB 5HDBF 3B9DA 1P7QB 1OAKH 4HC1A 4N8PA 2IG2L 4KKNA 3QIBC 4EN3B 1JGDB 2H9GA 4BZ1L 3QJFA 1QSFB 3N85L 5E2UL 2NY6C 1BJMA 3TC9A 1FPTL 1RVFL 2HWZH 2YC1A 5E2WH 1UYWH 5C08E 4L8CB 1YMMB 4FQQA 3HE7D 4MJ4A 3TZVA 4XT1C 1MVUB 4YDJA 4OFDA 3TBYA 1XGTA 4H25A 4HK3J 1TQBC 3PHQA 5J11C 1S9WA 5D7JB 4XBGB 1WT5C 4IIQB 4U1NB 1TNMA 2VQTA 4N90D 4X9GA 4HH8A 4NWUH 7CGTA 1Q9KB 1JP5A 3AVEA 4PGZA 2EH8L 4OFYD 2F53E 4P3DB 3AS0A 3BWAA 3CFBA 2OI9C 3X3FL 2NXYB 4X6DF 4LFHD 3MLUL 3LEVL 5C7XL 1F8TH 3FMGL 4CL7A 4NWTL 3LH2L 1X5KA 2XTJB 4UNTA 3K0WA 3E3QC 5C0BE 2OX5A 2SEBA 2VISB 1CG9B 4N8VA 3STLA 1B2WH 3QIBD 25C8L 1FFRA 1T21A 2HLAA 4ZUWA 2R23B 3DRQA 1L0YA 3FB8B 2NY6D 3LIZH 3OB8A 4F9LC 1T1ZA 3BP5A 3RVVC 4OIIL 4WGVB 1BD2A 4L3CA 5I1LA 1T83C 3KPRD 4R8WL 4JDTH 2FYYA 2CDFB 4JFOA 4PB0H 4NJAH 3NCEB 3H2WA 3CVHB 1HZHH 1ZEAH 3LKNA 2JE8A 4PJGA 2B1HL 2I9LA 2DM4A 5I15L 3A0OA 1E27B 4NC2B 4XPHH 1PQZA 3V2AR 4PJFE 4OCSH 5EA0H 4NOFA 1NMBH 4YC2C 1NCTA 1KXTB 3L1OL 4NZRH 1QP1A 4OFPA 3NCJH 3SQOH 5DLML 3BP4B 2BNRD 5I19L 5FOJA 4P2QD 3NA4A 3ABZA 1AI1L 4DAGH 4RBPK 1NMAL 2DS4A 4GW5A 5F9OH 1KENH 3JTTA 3VRLF 3VW3H 1MHHB 2CLZB 1J5OH 3WS3B 4AG4H 1QQDB 3RVXC 3OKOB 5TJWK 4UT6L 1UM4L 2DYPA 4OB5H 3UTTE 5DK2A 1I7TA 3BSZH 1K4DA 3RVVD 1NGZB 3GMLA 5EIQA 1XFPA 3AFLA 4NRXB 2IANB 3AY4A 1XGUB 3ARBB 4XBEL 3KNBA 1MI5A 3VGHA 5DZNA 5CJOH 4DW2L 3PHOB 3UZVB 5E9DB 4PLKD 1MHCB 1F4AA 43CAA 2DTML 3X17A 5FO9B 3P9MB 5FDWB 1YMHA 4UB0H 4X6BB 3NGBB 2YXMA 3WEXB 4TN9A 4QXWA 4YK4B 3IKCA 5DRNA 2X89A 1EV2E 5KS9B 2BVQA 1DQQA 4P2OB 2W9LA 1KPUA 1MLCA 3DMMD 3I9GH 3MLTB 3VRJA 5GGUB 2I24N 5CSGA 3RPKA 1ZT4A 3X12B 1BFVH 5F9JB 5IVXF 5IF0A 4OZIE 1W0VB 1P2CA 1BPVA 5IHZB 1RIUL 1NC4A 2XKSA 3BQUB 2D7MA 5FA3A 3KPMB 2D0FA 1IGYB 3RWIA 5AUMB 3TJHC 4TULL 1AXTL 4B53A 5CJBA 4R96B 1T3FB 3VWJD 2WP3O 5E4IA 3DX7A 4R4FL 3W0WB 5DUBB 5ICXA 5ILTH 1T66C 2X4NB 3FKUS 4ZOCA 3KYOA 3QHTC 5FCUH 4WCYH 1QSVA 3C5ZB 4GW4A 4LCWD 3QDJB 4KK5C 4XRCA 2ARJA 3GSRB 1HQRA 3GSQA 3EUUA 4ONFH 3W9DA 5HD8C 2YMXH 4OZHA 4MDJB 3QIUA 1IZKA 2J1KA 3DYPA 2GK0A 3BGFB 2FWOB 3H9HB 4WHTA 4MA8H 3I6KB 4G42A 4GLRH 2EZ0C 1G7LA 3KXFD 3VGEA 4BFBD 4KVNH 1C08B 4C56D 5BS0E 4H88H 4UOJA 1VHPA 2DLHA 3ECBB 4I48A 3INUH 3ARXA 3TH2T 1UT9A 3CZFA 4LASL 4PRHB 5IM7A 1F90L 3M8OL 4C55A 1SJVA 4DEPC 1NLDL 5ESVA 5J12B 1WBYA 2DI7A 3TIDA 1FZKA 1E4XH 4BSWA 3T0DA 4PJDF 4LLUA 4N5UA 5I8OL 1T66D 5IT2H 3D39E 5E8NA 5DFVC 2ZG3A 5EH1A 2HMIC 3SDCC 3DUHA 4F3FB 4LLMB 2FLRT 3NMEA 5ID1A 1GXEA 2HFTA 4G8EA 5HD8D 2R1XA 3GBLA 1P1ZA 1JRHI 2X70B 4W6XB 3T77B 3ZYZA 1XZ0A 2QQNL 4LQ1A 1ZLWK 4HPYH 1WC7B 1OM3H 4ZFGL 2ADFH 3S6CA 1JTTA 4WUKL 2ZPKH 4LSPL 4YHML 2FJHA 3SJVE 3O6MH 1YN7A 4AMKH 3FCTA 5B39A 4FFVC 3ZDZE 3VXSD 2H26A 5C71A 4HUUB 5EB9A 3ZL4L 4JZOB 3E1F1 3VGAB 5I8EB 2F53A 3TBSA 3O3EA 3UTPE 1L7TH 1TXKA 2V5SA 4JG1L 3TVMC 4Z18A 5HHMB 3D25A 4QYOB 4Y16B 1JUFA 2UWEF 5C0BA 5GS1C 5DFVD 5EZIH 2HMID 3ZKNC 1MFAL 4HGKC 1S9KC 1ZHKA 1M6OA 5C0DA 1CF8H 4MD5B 4N0FA 1EZVX 2ZG2A 3OAZK 3H7LA 3S97C 5KW9H 1XR8A 3LCYA 5EOCH 2VZOA 2HYMA 1PKOA 1MJ7L 2VL4A 4M4PA 4BH8A 3VXTA 3N9GL 4KTDH 4LK4A 3SKMA 3VD9A 1DZBA 2B4CL 1DFBL 2FR4A 3QZWA 2V7HA 3GHBH 1F4YH 5K59E 1ZAGA 3VFRA 3MJ8A 2OM5A 4FFVD 4AH2A 5I1JH 1AO7E 4KI5D 4G5ZH 4G80B 3CLEH 5EWIH 5DDHB 4O2CB 1A0QH 4MNQD 4NM8L 2G9HA 2ZUUA 4MQXC 4M7JH 1IKFH 5D1XD 1I7RA 3C9NA 4LVNC 4PRAA 2RIKA 5DMGC 1KN2H 2R56L 1MCHA 3ZHKA 3SEPA 1ES0B 2P5WB 2ZUSA 4PJ5B 1R3JA 5FFLA 1WGOA 4M6ML 2Y1VA 3LV3A 1BJ1J 2NXZB 2GHWB 3QCVL 5DURD 5GGSY 1WWCA 2A73A 1QA9B 3M07A 4R9HA 3RWGA 4FFYL 3UTTA 4JKPL 3JZ7A 2NY7H 2EIDA 2X4UA 2NW3B 1OP3K 1G0XA 4NUJB 3MRRB 4HUWA 5JQ6H 3OJ2C 1HH9A 1DQJB 4HZLA 5KJRH 5F1OB 3CMOH 3IAQA 4YDVB 1CGXA 3O8XB 4PB9L 4H0IA 1T0MA 4Z7UE 2R69L 3JV6B 3SKUD 3VXRD 4KPHH 3DYMA 4ZFFB 3TBTB 3U1SH 5F72S 3BZEB 2YXFA 2LE9A 3T1WA 1W0WA 3HC4H 3ZE1F 2YD3A 5GSVA 3OZ9H 5IROC 5AYUL 4NNPH 4QRRD 1A7RH 1GGBH 5FYKU 4OTXL 2W0LA 2VLME 4J1UA 4YGAB 4QTHA 1DEEB 3ARSA 2HFFA 2LU3A 5E2TH 1OGAE 1GH7A 3T4YB 3DVGB 2CRIA 1ZGLP 4GG6B 1NL0H 4NCC2 3BZ4B 1M7DA 1NEZB 4UTBH 4OZIA 4XMLL 2NZIA 3G6DL 1AKJA 3CMGA 1F3JB 2X4PA 4YNYB 3U46B 3HNVH 5HHPA 2VZSA 5JOFB 1GZQA 1MREL 3V6OC 2ICWI 1KN4L 4JM2D 4K3EH 1ZT7A 1KEML 1CVRA 2AQ2A 3U0TA 1GGTA 1LP9E 2XWJA 4N0RA 4F57L 5IEHA 1RURH 5E99L 1HI6A 5J8OA 3B6SB 2CK2A 4NT6B 3WFCL 2F5BH 5A2IH 3KPOA 1VEPA 3HC0A 4Y89A 1Y6MR 3PJSA 5EFIB 3DVNB 1U42A 2VLJD 3MJGX 1CXIA 3E6FB 4LHJB 3TA3C 2HJKA 5BS0A 3CD4A 1EGJA 1D5BB 3EOBB 1LO0L 4C83B 4O2EB 4MWFB 3TNNA 4FQXA 5BV7H 5AWNH 1EEZA 3AB0B 4OGXH 1WBZB 1D5XB 5DRZB 5IJKC 5CZKA 5C0JB 3DHJA 2IPKA 2C5DC 1EAPA 3WS6A 3BPLC 1UXWA 2QHRH 2VXSL 4OCYL 3G08B 3FQRB 3OKNB 4NBZB 2EH7H 5T1LA 4G43B 5FHAH 5EUOE 1K4CB 1FVCA 1DTUA 4RBPH 3VFMA 2OJZH 4NYLB 2H1PL 2HFGL 4UAOB 4YHPA 2BY2A 3JV4A 4GKZB 1EIBA 4M1CD 5TE6H 5TF0A 4LKXB 5J6HA 1OHQA 2LAAA 4BM7A 1KTLB 1X5XA 4FQQB 5CINH 5IMOB 4JQIH 5D8JL 4R2GB 3TBYB 3TGXA 2CIKA 3B9AA 1K5NA 3FQNA 4BKLB 1H8SA 2C1PA 4NQED 5LVEA 1SQ2N 3TA3D 5BJTA 5T3XH 4PJ9A 1KCVL 2DQUL 1QFHA 4G8GE 4M48H 4PGEA 4DKFL 2IQAA 2K3TA 3FTGB 2OQJB 3KDMA 2F8VA 4KAQL 2K9UA 1BF2A 3L3IA 3ZLQC 4OM0H 1EERB 2NX5E 3ULVC 1A6AA 5KN5B 4N8CL 4JO1H 4YHYC 1WQVT 1IM9B 4I2XE 2VWEC 3VFSA 4E41E 3DX8B 3TIEB 5J9PA 3U83A 1AH1A 1J8HD 3H9ZA 2BRRL 4LU5H 4XCYA 3VFGH 5D93B 2Y7QA 4N8VB 2R9HC 1QSEE 2LV4A 4P4KA 4Y19D 2HAZA 2VDRH 1T21B 4ZUWB 4NIKB 1ZLSL 3DRQB 5I71B 3DNKA 5IG7A 3TM6A 2ID5A 1TLKA 3VU2A 2FYYB 4HIEB 2WLZA 4DJMA 2MOVA 5C0CA 3EFDH 3D5OF 2R39A 3DROA 3O4LD 1W72A 3PL6D 4JPIA 4NKDA 2B2XH 4HFWB 4EUPA 1JWSA 4ZFZA 4CMHC 4RSVA 1HHJA 1YJDC 1T0NB 5BOZG 1XF3B 2NLJA 2XNAB 1PQZB 4RGNB 3NFPA 2F58L 1YN6B 5FXCH 1HOCB 1OPGL 1KSRA 3SE4A 1D6VH 3SDCA 2C3VA 4XMKL 4WWKD 3ULVD 1J1OL 4G9FA 4PRPD 1YYLL 4IMKC 1YECL 4KWUA 2ADGA 1HILB 3QG6A 3L95A 4L29A 2YUVA 1DUYA 2QTEA 4K7FA 3WD5L 3JTTB 35C8H 2DB8A 1LK3L 3BHBA 3I3EA 3U0PA 2E3VA 5KS9F 3ARUA 1NGWA 1C5CL 1HHIA 3A6CH 3I02B 1FAKT 3T0WA 3KGRA 4Z76A 2NY2C 4YUEL 2DYPB 4NFBA 1TZHA 3KYKH 3LDBB 4I0PC 5LCVL 2O61B 1I7TB 3VXMB 5JDJA 4NQSB 3H9SB 3ARFC 1LO2H 2CUMA 4ZNEE 1KG0A 4PP1D 1KJ2B 3BEVB 3T04D 2NY5L 1FYTE 1K8IA 2W0KA 4XPGL 3FZUC 1UCBH 1UWXK 1GSMA 2DLTA 4L9LC 4LCUB 3TT3L 3PWUA 1SEQH 4F9PC 1FL5B 4OLVH 43CAB 2A77L 4Z7UA 3AUVA 4QHNA 1R3KA 1N7MH 4FQCH 1BFOA 3B2VL 1EHNA 3MLRL 4S1SL 5IB4B 5DTFB 5MP6H 1ORSB 2ARJQ 5DRNB 5EO9A 1JGVH 2BVQB 4JZJC 5DJ2B 2YD6A 1RQ5A 1PEZA 2FD6L 2E7MA 3KHQA 1ZLWH 5T33L 2X4RB 4LAQH 3N0PB 3G5VB 5IF0B 1OGAA 1P2CB 1MCJA 4K8RC 4ZODA 3MV7D 1D5IL 2M1KA 1JF6A 1A6TB 3CH1A 2JCCF 3RL1A 5EC1B 2X4OA 4WFFD 1LO5A 3VGFA 4OZFA 4WUUA 5FGBA 1GAFH 3G6JE 4ONHA 3HLAA 1AD9A 1N4XH 1G6RA 2FNBA 5C0IB 1LP9A 3FZUD 3O2DA 4LVHC 4OZHB 3QI9C 1UM6H 4U7KA 2QV2A 2Y06H 3N50A 1FLTX 3TO4C 4G42B 1QBLH 5F7FA 4ZTPL 3SE9H 4QRQA 5ERWA 4XVJH 4H8WL 4JDZA 3UZEA 2MQCA 5CEZD 1KPRB 1FBIH 3WSQL 4G7VL 1EEQA 3OAZH 2XWBA 4Q6YA 1CZ8H 4MXWH 4AT6A 3UO1H 4UT7L 1CWVA 5C09E 3QJHB 1SBSH 2WWKT 4HIIB 2HA1A 2CKBA 2Z8RA 4XCEB 5C92A 4ZAKB 2WW8A 2Z0BA 1PX3A 1ED3A 1E4JA 2M2DA 2CRZA 3MV9A 3PP4H 3CFDA 3VDBA 5ESVB 3LKSA 1WBYB 4I3RL 5K33A 1FIGH 1I1AB 4PJAF 2BOCB 4KRLB 3KLDA 3ZE2E 5FECA 2NTSP 4KDTA 5B3NA 1K3ZA 1T04A 3ILPB 4U1KA 4Q9QH 4GRMB 5C8JB 3RDTC 2PETA 3BN3B 3GMMA 5DVOA 3QULA 3N1QC 5EUOA 5E8NB 4LSRL 3V9FA 4DN3H 3HNTH 1IAKA 5IROA 1I7UA 4M7KH 5EORH 4RZCB 2AI0L 3EHBC 4KMTH 1OAXL 2KDGA 2GIYA 1TJIH 4FS0A 3LKOB 1MHEB 3T0EE 1G0DA 1AC6A 2DTSA 4AEHL 5IQ9B 2VB5A 3ZE0E 5GISL 3T1FA 4U1GC 2MCPL 4Y4HC 1QYGL 3ARYA 1WF5A 4W4OA 4MJID 2KPNA 4WWID 4U6TA 4G8GA 3BPCA 4J4PA 4KUCF 4LGPB 1BX2B 2H26B 2I26N 4WTZA 2WSKA 2Y36L 2FDBP 2NX5A 4NN5B 5DA4A 1T1XA 2QQLH 3JWOL 2OR7A 4G6KH 1T20B 3ULUF 1IRAY 4HG4K 4HLZG 3QHFH 4E41A 4IBLT 2WBWB 4LHQB 5HVFB 4YO0A 3RDTD 4Z7WF 1A7OL 4GUPA 4Y4FC 3CX5K 3H42L 1JUFB 4OLUL 4X6CB 5DVKA 3WDHA 1N6QH 4CAGA 4XH2A 1BEYH 3FHAA 3H0TB 1QSEA 1D5MB 5C0DB 1KIQB 1FGNH 3EHBD 3DRTA 4GRLD 3V4PL 4LSTL 1EFXD 4G7YH 3P0VL 3ZKQD 5D5ME 3MFFB 3MRDB 2EDKA 1AGDA 5JW4M 3D2UB 3NAAL 4WEUD 4PJCF 5L7XH 2NY4D 3VXTB 1HKFA 4MLIA 1INQA 4NP4L 3SKMB 5FYKL 4OZGA 4Y4HD 5HTSA 4MA7H 2NY3C 2DLFH 1GGYA 2V7HB 1QFUL 4OM1L 4JFFD 5CLWA 3WO4C 3IVKA 1U8NA 5I73C 3MJ8B 4AH2B 4DTGL 5KVFL 1C7TA 3CJJA 5E8DH 4PJEF 4R97C 2R29L 1A8JH 4LCIL 3MGTA 2NY6B 1F4XL 1P4BL 1BQHA 2Z8VC 4OZ4B 5I66B 2FX7L 4PG9B 3AREC 3C9NB 4YH6A 2X7LA 1EGJH 2EYTA 5TF1H 3SCMC 2VJXA 5C9JB 5J11B 4HS8L 4ODTH 3ZT6A 5HY9B 1NGPL 3FO0H 2YRZA 1FZJA 2NZ9D 2A73B 4HUMB 3VE0A 4Y4KC 1FNLA 3PGFH 3E2HC 4F7MB 3SGDI 5KTEL 2X4UB 2EDFA 4D3CL 1S9XA 4PG2C 2CDGA 2OI9B 4I0KA 4W81A 2GW5A 3OPZH 2BNRB 4ODXB 4HZLB 4NHCH 3KR3L 5TE4H 3R8BB 1IAIH 4JFZH 3FO2A 4X80H 4XWOC 3BPOC 2NY3D 1G9NH 2A6JA 1ODAA 3G9AB 3D3VE 3B8SA 1O7SA 4PY8J 1G0YR 4R3SB 4QXUH 4C4KO 3NPSC 4KKAD 2IWGA 4TOYH 2QADD 5GSVB 4QHKI 1K3IA 5TDPB 2VR9A 4I9WE 1LGVA 3U82B 4ZQKA 1G7QA 1TZGH 1MF2L 1UC6A 1P5UA 4UV7L 2HFFB 3ARED 2UYLB 4KC3B 5DI8B 4CJ1A 3KWWA 3GBNL 5ANMA 1A7NL 1IFHH 4CDHA 2C3GA 3UYOD 4YHLL 3RVUC 1JNNL 1AKJB 1VGEH 5DO2C 4HKZA 3VFOB 1QLRB 2OTWA 2DQIH 4ZTOH 2Q87A 1UQSB 4HAGA 3G04B 1T5WA 5IB1A 4YXHL 1ZT7B 1RUAH 4M5ZH 5D1QC 3U0TB 4YC2B 1Q0XH 1KIRB 1D9KA 2JK5A 3RY6C 4RGMC 3G6JA 2Y72A 2J8UF 4M7LL 2KQMA 5IEHB 4IMKA 1L7IH 1RUPL 2YWZA 4JB9L 4M1DL 3IFPB 3KPNA 1FV1A 4XC3L 2ICWB 4F7CA 5TPWH 3KPOB 4E5XA 4P49A 1CCZA 2V9TA 1T1WA 5E8EB 5AEAA 4I0PA 4XCFL 5K9JL 5KANI 2HJKB 2J88H 4TUJA 5KVMC 1W72H 3IDIA 1MFCL 3U9PL 4FQXB 1UWEL 3ARFA 5C09A 2MPAH 1KULA 5KSBF 3BRGC 1EEZB 5HI5C 1CXFA 5KSAC 3NH7L 2J7LA 4K94H 3RVUD 3PGDA 4LCYB 1K85A 5D1ZC 4K3JH 1QO3A 3ZMRA 2I27N 4L9LA 4XNXL 2G60H 2HTKC 4YHKL 4V1DB 5FUOH 1NC4D 5MEQA 1IM3A 2C7UB 4FNLL 3KXFB 5D1QD 1DLHA 1OSPH 5DK0B 1RZFL 3WFBH 1B4JL 4LPYA 5HYQA 4YHPB 3U7YL 4LBEA 3U7WH 3S37X 1GVIA 5DUPL 3O6KL 1A9BA 3TEUA 5J6HB 1CDHA 2ORBL 4LEXH 3RUGE 3CXHJ 4O58H 1M1SA 3QXUA 3QIUD 5DRXB 2CIKB 3FQNB 4ETYA 2C1PB 2R1WA 1RHHA 2W0PA 5CZVL 3EDEA 2BDNH 3H3PL 1YPZB 4PJ9B 5A1AA 1RY7B 2IFGA 3GMNA 5BVJA 4PGEB 1T4KB 3KJ6L 1UWXH 3GHEH 3IJHB 5KSAD 2WLYA 5DJ0A 4PGBA 1RHFA 1A6AB 4M6NH 3LRHA 4OV5B 3HAEB 3FFDB 5EO0A 4WU5B 3ZTJG 4U1LA 2ATKA 4JJHA 5D1ZD 4PD4J 4Z7VF 4APQC 3O2VH 2E7LC 1DP0A 4K23H 4UOW1 5J9PB 1UVQA 1J88A 4Z95H 3IETA 4RMTA 1YDPA 4XCYB 5B38G 2GSIA 4FQPA 4O02H 3RPIA 2VDMH 2Y7QB 1MIMH 3GSNB 4P4KB 1OTUC 3VXNB 3QG7L 2VDOH 4ZYKA 5JQHC 3LKRB 4AQOA 1QEWA 4LSQL 3F7QA 3MPCA 4OFKA 4DEPB 1NFDE 1FVEA 3K4AA 4EI6A 1KB5A 3VD3A 3BT2H 2CR6A 4OZFH 4XPBH 2WZPD 4JPIB 4NKDB 1YC8A 2BSTB 4L8DA 4EUPB 1JWSB 5C08D 1N64L 1G6RH 3BKJH 5K9OB 1QD0A 4OT1L 4XCNA 2FB4L 3O2DH 3SDCB 2C3VB 1JN6A 1GC1H 3GMRA 2GCYB 3RX5A 1XGYL 3C8DA 3QG6B 3IDGA 3MRGA 3L95B 4GXVH 4CVXA 3MLWH 3BKCL 2GJ6E 5GHWH 2PUQT 1EO8L 3MLYH 5DEFB 3U0PB 1H3GA 4RA3A 5FM8A 1IC4L 1HQ4A 4JGJA 2APXA 2CKBH 5D2NC 2B4CC 4Z76B 1OTUD 3BD5A 3TT1H 1NBVH 1DQDH 2FL5B 4FTVA 2J12B 1RZKC 5C0BD 3MA9L 1KBGL 3IDXL 3HZVA 2BERA 5EOTA 5HI4C 1GPOL 5I18L 1A2YB 5E6IC 5JXAL 3TBWA 2VUYA 3OKKA 5DSCB 1K8IB 2JJSA 4HWZB 5E00A 4YQXH 4Y5YA 5E1HB 3TVMB 4HWNA 1JNLL 3P11L 4RFEA 3W81A 4X4XA 1MY7A 5FA4A 1CYGA 5ESAB 1HINL 4Y4FA 5ECJE 5HHVH 1R3KB 3O11B 3GMQB 3GB7B 5SWQA 5GS1B 3C5JB 1BFOB 3FT4B 4JANA 3OJVC 3F7PC 4KKCC 5I1AA 3MRLB 5CBAB 4WENB 1H3UA 5GRUL 4HEME 4HSQA 4OGYH 1U8OB 2F54E 3F62A 2DJUA 4K3HA 5HVGB 4J6RH 1CLZH 2XN9E 5HYJB 1QVOB 1RMFH 3RL1B 5T1MA 1LEIA 1O5DT 1ZKAA 3VXRB 4GO6B 1GGCL 1NBZA 3K8KA 2VLRE 3RAJL 1NDMA 4W6WB 2ADIA 4D0BA 3A67H 1LHZA 1VB9A 5HI4D 3OKEA 1YNKH 5E6ID 3HLAB 4HXBL 4NQXB 1OP5K 5SWZE 5L8KB 4J8RB 4LNRA 1MCPL 2N7BA 4KK9C 5LXGH 1AP2B 3I3BA 2FZ3B 1U8QA 1MRFL 3EOAA 4KJWC 5GGVY 4LVNB 4XI5C 3WLWC 1HXMA 3NFNA 5ERWB 2ENSA 4XAKE 3EYOA 3OKDA 1S7TB 5EU6D 1HCFX 3DECA 4Y8AA 4N0CD 1HSBB 5KVDL 3HB3D 3EJYC 5HI3D 5JW4R 2ED7A 1IBGL 2ICEA 5FYLE 3TP4A 4EIGB 5CD3A 3D18B 4HS6B 5FEBA 3BKYL 4PTUA 1J0YA 3O3AA 5FOBB 4KMLB 2X1PA 4LLQB 5FAAA 3MV9B 3SGKC 2BHYA 1LD9B 3LKSB 2DBLH 5DJCB 2E8ZA 1Q38A 2HTLC 3U6RA 4IEFB 5BVPH 4RGOH 1QBAA 1MEXL 4JHAH 4KXZH 5DJZB 5HYFA 5BO1L 1ZT1A 1IC5L 2G75B 1WITA 4LVEA 4ORGA 1ND0A 1KCSL 4HV8A 3PGCA 1H15B 1Z3GL 4HUVA 4FA8A 4LSDA 3PWNB 4HJGB 1NUNB 3TPUB 5JHLL 4LHUB 4KK9D 4ELKA 4L4VD 4X6CF 2D03L 2Z8SA 2MNUA 4X9FA 4OCXL 4X8XA 4RISH 1R5IB 2VDKL 2A0LD 4MAYA 4O5LL 2BZDA 4ISVB 5BZWA 4K9EH 4Z8FL 4GBXD 3MUGA 3K1DA 4CW1A 3FT3A 5D7LA 4L5FL 4HWEH 5BS0D 4XXCC 4POZC 3MV8B 4MNHA 4P5TC 2AK4E 3SDDC 2HTLD 4CN1A 1HSAA 2RCSH 3GM0A 2YSSB 1KFAH 4YO0B 4M62L 5HHXH 3KPQA 4GUPB 3MV11 4JAMA 1CGUA 3TA3B 5CCKH 4M6OL 5LBSH 2GITB 3PQYA 2MMXA 4QTIH 3ZSTA 5ALCH 3D39D 2VE6A 1AGDB 2HKFL 1D5ZB 1HEZB 2ERJB 4P59L 5BZDA 1INQB 3IGAA 4RQQB 3BAEH 3BPLB 3HI5L 1I85C 1U93B 3CFEA 4OZGB 2X4SB 3N1FC 1OF2B 5JORA 1M4KA 3QDMB 1EEYB 3IVKB 3FONA 2NPLX 1B6UA 5C6TH 4Y19B 3O6LL 1F4WH 4HQQL 4POZD 3MGTB 1S7XB 3QO0A 1WISA 3SDDD 3SJVD 1RJYA 4L4JA 3QNYB 5JXEA 1T5XA 4FRWA 1ONQA 3I2CL 3O4LB 1WLHA 2GJ6A 2EYTB 2UUDK 3RTQA 2Q86A 2DMKA 3UTPD 1U2HA 4ZPVA 1EVTC 4MVBC 3GMPA 3ZYOA 4N0YH 4OKDA 1FZJB 5DFWH 1Z9LA 5J6GA 4NN7C 2J4WL 5GGSA 4NC0B 4Q0XL 2Z9TA 3G5ZA 3LHPH 3VXUD 2VDLL 4MQSB 3MRBA 1H3VA 4U6XB 1CT8A 1NBQA 2OZ4L 4PJXF 4POYA 1S9XB 3LMJH 4PRPB 1G7IB 2AJXL 4KMQA 4YHYB 2VH5H 4LARH 3D85A 1KPVB 5DD5L 1U92A 4APQA 3B83A 5IESH 1INDH 2J6EL 2W9DL 3I75A 4XNUH 2ZSVA 5MI0C 2C1OA 5F1NA 1MPAL 3HG1E 1WWWX 4RAUA 1JZ7A 1NGYA 1DL7L 4G6MH 1NAMB 2F5AL 1QHPA 4JY6A 4IDJH 4ZQKB 1K2DA 3ES6A 4ENEC 1F13A 4DGYH 1AO7D 2F54A 2P5EE 3RA7H 3EYFB 2WMPA 4XNMA 1PFCA 2ZOLA 4ODVL 4HKZB 2R0ZH 1CQKA 4GRWB 4PJIA 1NCBH 4CMHB 3MRMB 5T5NF 3BH9A 2OL3A 1IGCH 2HVKA 3Q48A 3PWLB 3QUXC 2VLRA 1JPGA 3BD4A 4GSDH 3MRKB 3CXDH 3O45A 5EOCJ 3FB6A 3QNZA 4HH9A 5FYLL 1U3JA 1VFAB 3KPNB 1FV1B 1BAFH 4OCWL 5E8OB 5FUZL 1IJ9A 1T1WB 4X5XA 2WAHA 3X11B 3T8XA 4U0QB 2NY2B 2IC2A 3KPPA 4DVBB 3FOLA 1FLRH 4I0PB 3UTSE 1GOFA 4Q9RH 5CIPA 3ZKSD 1Q0YH 1QRNB 3IDIB 4PY7B 4HLJA 5ENWA 3X13A 3ARFB 5C9KA 3MBEC 4ENED 4PRNA 1JHKH 1VDGA 3MXVH 3QQ9D 1G6VK 1CFQA 3OMZA 1XF1A 1FQ9C 3ME0A 5EBWA 5L9DH 2XFXA 2FX8H 1QR1A 4L9LB 2VLMD 4FXGA 4JM4H 3MUJA 1OGAD 3DTXA 3DWTA 4HIXL 1I3GL 4P3CL 4H8WC 2O5YH 1MWAL 1ETZA 4HWBL 5I1IL 3PWPE 3ZDXF 2CLRA 5J3HC 2FEDC 3QUXD 1S8DA 4A6YL 5ICYB 3MA7B 4JZJB 5I1CL 3ARGA 3EYUH 1GIGH 4ZXBA 2APTA 3B9VA 3OAUL 4XPTL 2IJ0C 4NUGL 3OKLA 1OAYH 1QFWI 4DCQA 3N1GC 1IKNA 4FOMA 5EZJB 5CKAA 3VI3E 1BOGA 5SV3A 1KTKE 3L3HA 4UQ2A 1JF5A 5T1KA 3MLZH 3LZFL 4LCCC 3N85H 2FIKB 3NA9L 1PKQB 5GGQL 3BW9A 3F12A 3MBED 4P23C 3L5WA 3UZQA 7FABL 2EIEA 4U1MA 4F58H 3MCKA 4AIZB 3O41A 3TN0A 5CAYB 5EO0B 5TQ2L 3QI9B 4ZS7H 2AK4A 3F58H 4XX1G 1WIUA 4Y0GA 4MJ5A 3RU8L 3DSNA 1A47A 4KV5F 1UH3A 3TO4B 3GUTB 1JYXA 3RKDC 1ORQB 3IETB 3LQAH 1OGTA 5J3HD 3IKKA 2ESVE 4L3EE 4MYWB 2W9EH 4KQ3L 4ZS6C 4JO3H 5K9QG 5F9DC 2IFFH 2AJUH 3QFJE 5D71H 1PYWB 3FQTB 1FNHA 3BXNA 3FO9A 4YX2L 3ZKXC 2DIAA 1C7SA 3LRSA 3JWOC 1NAKH 1U3ZA 1FVEB 4KHTL 4EI6B 4NHUB 1KB5B 5EU3B 2X1OA 4JRYB 5D6CA 3STZA 1LEGA 2QHLA 4L8DB 5EIIA 1P9MA 3FB7A 3GFUA 2Q8BH 3RDTB 1HHHB 4KI5F 1OP5H 3HUJB 2A9MH 2ILLA 4IOIA 3BIBX 4XCNB 4YBLC 3V4UL 1JMZA 2NR6C 1MRCH 1SM3L 5CBEA 3F5WA 3P2TA 1JN6B 1JZ6A 2O26U 3ZT7A 3RY5A 5JO5B 5BRZB 3PIQB 2L0DA 1EFXB 2QQQA 4WW1B 3HE6C 1H8OA 1T1YA 3OR7B 4HDIA 5I75B 3QXDB 3RKDD 4PUBL 1WUNT 4QNPF 4NNXB 1CIDA 4U1GB 4XHJC 4Y4HB 4E41D 2BFVH 4ZS6D 5HDLA 4L8SA 5DS8B 1CGSL 5FYJU 5CGYC 4JFFB 5BW7C 3OG4B 2DQFA 4FTVB 2GT9A 4LFHG 4KROD 1CDCA 1J1PH 3HZVB 5EOTB 1BBDH 3MREA 1IGML 1S9YB 4JRXE 4X0KA 4MDIA 4P5TA 5L8JB 1PLGH 5EN2B 4EKXA 2IBBA 4OJFL 2D0GA 2EIZB 3U4BL 3H9YA 3CDFA 1HCVA 2XA8L 5I1GL 1C1EL 2VKWA 5C0RL 4RFEB 4Y5XC 2R1YA 3WXVH 2DI8A 1V7NL 4HKBA 5CILL 4HX1B 4Y4FB 5DGQA 1TJGH 1JHLH 1NMCC 1FAIH 3P30H 1YYML 2LTQC 2NR6D 5SWQB 4ZUVA 4F33A 2Q76A 3NCBB 4J3OC 3BZFA 4JANB 3TJEH 4I77H 1BZ7A 3DVIA 2V2XA 4Y2DC 5D7IF 1TZIA 5F1IA 3R0NA 3HE6D 3IU4H 5HPMA 2CSPA 3MROA 4UU9B 3C8KA 3EDFA 2DIBA 4L9DA 2P5EA 4JM2F 5FYKD 5GJTL 4XVTL 2W91A 1MAMH 3I3DA 2NY3B 1J8KA 2ZSWA 4FQ1L 5CGYD 3U79A 2XZQH 3WO4B 4RWYL 1A6WL 2IH1A 1G9EA 5I73B 2EE3A 2Q7YB 2ADIB 3QUYD 1J11A 4XPFH 5ID0B 4D0BB 4M03A 5DJXB 2R0KL 4R97B 3GI9H 4NZTH 2I25N 5DT1H 1E6OH 3U0WL 5IJVA 4LNRB 4TULH 1AXTH 3AREB 1I75A 2WINB 3G5XB 3OKMA 3FQUA 3QA3B 5DHVA 1HXMB 1FYTD 4FQ2L 2YUXA 4IMLA 4MD4A 3SCMB 4I3GA 2WNGA 1E6JH 4TNVF 1UM5H 2AP2A 1ZHLA 3DXAB 2ICEB 4XWGH 3UTSA 4Y4KB 2VZ3A 3GI8H 3E2HB 4UT9L 2FLBT 4PTUB 4IRJA 3BN9D 3O3AB 2CLVB 5DVMA 1OWRM 1C8PA 2WUCH 4NQDD 5C0ND 2IMMA 2VQ1A 5H94B 3RHWF 1ZA6A 4OD1H 4RFOH 4IRSA 1GHFL 3FRPG 2OYPA 3BPOB 2V2TB 5DHYA 5HGBA 4PJ7A 4S1RH 4XAWL 3MRQA 1XCTA 3P9LB 3QWRD 4LASH 2X1WL 2NY0C 3NIFF 2HJFA 1OB1A 5IEKB 4HV8B 3NPSB 3PWPA 1U91B 1A6VL 1J12A 4HUVB 3K74B 1RZ7H 4X6FB 4XVSH 2YPLB 2VOTA 4YXLH 1JYWA 3GSWB 2UUDH 3VXQA 1IILE 3GNMH 3QXTA 5E5MB 1MRDL 3BISA 1D9KD 2R0LH 1SJHA 3QXWA 3CPLB 2BY1A 2ZUQC 5IFHL 4HZAA 4XPAL 5DMIH 3L3OA 5T5NG 2H2PD 4MAYB 2RGSA 1WAAA 3T0EC 2FBJH 1WWAX 1UJ3A 5D1QB 4JJ5B 4X83A 2APWA 4RAVA 5T1DL 3I50H 4RGMB 3IT8D 3FT3B 5D7LB 3GZKA 1MSPA 1L0XA 4MNHB 1KB9K 3S3PA 5C09D 4O4YL 5FB8A 1GGIL 4WUKH 1NBYA 2GQHA 5F21B 3LEYL 5GJSH 4B7LA 4LDLB 1A5FH 2YD5A 3DUSB 1JWMA 2NY0D 4N9GA 1QG3A 5LGHH 6FABH 4K3DL 4HHAA 1JGLL 5IWLC 3OX8B 1NC2D 2ESVA 4O2FA 4OLEA 3PQYB 1LO4L 3CZJA 3F6IA 5I2IA 4ODSH 3MOAL 1AGCB 5KSAB 3SDXF 3MJ7A 5ADOH 5CJ5A 4AQ1B 4MZ2A 2OL3H 2Q8AL 1U8LB 5BZDB 1MFAH 3RWDA 3IGAB 5IB5A 1G7JB 1CICA 3CFEB 1KJ3L 3DIFA 4PJDE 3IFNL 1NSNH 2DI9A 3I6LE 4KGJA 3NPZB 1UACH 3T0ED 3MNVA 3ULVF 5JORB 1IAMA 4PJHF 4WO4C 3FONB 4AK1A 3UPRA 2XACC 2N4IA 4OSUH 1UH4A 3S4SG 3QDAA 1EDQA 5DMYA 3QHZL 3EDDA 1RJYB 3MXWH 4Q97A 1T5XB 4Z0XA 4I13B 3S34L 4OFIA 3VA6A 5CIPH 4F7EB 2MJWA 2D7QA 1JK8B 1KCUL 4X9IA 5BCAA 5GRVK 3C60C 4Z7QE 4XC1L 3WFEH 4UDUB 5E1AB 4WEMB 3VG0L 3B3IB 1FP5A 4JHWH 2JJTC 4P23A 4MJ2A 2GFBB 1WIOA 4JO2L 3TYGH 4BK5A 2IBZX 2A6DA 4JPVH 3L5HA 2DQDH 4JRXA 3V52L 2YA1A 3D85B 3WIHA 1U92B 4APQB 1R24A 4EBQL 1LILA 4F15C 4X6DA 3FHQA 5L0QC 1BOYA 1V7ML 1KELH 2VNCA 1T6WA 4BUGA 2C1OB 2DQHL 2W92A 5SWSB 4WO4D 5F1NB 1ZWIB 4X99A 5JW3H 5TDNA 1RK1A 4PB9H 3T2NH 1A3QA 4DQOH 3F7YA 1K2DB 3AMKA 3GSUA 3PWVB 4HMDA 2R69H 4QOKE 4HKXA 1KC5H 4XNMB 4D9RE 1BZ9A 1V8HA 2ZOLB 2VL5A 1JMXA 5JW5A 1PDKA 2PYFA 3X3GL 3C60D 3WNKA 4NRYB 1QFWH 2X05A 3G5YA 1YEIL 5LWYL 3BH9B 3NN8B 4MJ6B 1FN4B 5M94B 2EXYD 2Y07H 3NTCL 4NGHH 2CO7B 5DJDA 2VKXA 4M02A 4NZJA 4ODWA 1Z5LB 1WEJL 1RZGA 3O45B 4F37F 3SGEI 3G6DH 3FB6B 3QNZB 3ARDC 4OF3A 2JB6A 2P7TB 4DK6A 4PJFB 2HH0H 5E24E 1SYSB 4GAJL 5CMAA 2I9TB 5EBMB 1MQKH 1RUKH 1N5YL 2NYYC 1JI1A 5D2NB 3S96A 4X5XB 3T8XB 2DQJL 5AZEH 3FOLB 2ICWJ 2X4QA 1XMWA 2GI7A 4UDTA 1YA5A 3D3VD 4MX7B 2D4DA 2CK0L 1XF5A 2Y25A 2X9YA 5EU7C 3HS0A 4U6VL 4M6AA 3GSVA 1CFQB 1FHGA 3K2UH 4LDOB 5F6HI 1G7HB 5EBWB 2XFXB 4I9WD 2FX9H 1NCAH 1JFQH 4H1LB 1EAJA 4Y5XA 1Y0LB 5ISZA 4CGTA 3OQ3B 5GIRB 3K8MA 4KJYB 4UIKH 5J1AA 2KBGA 3P73A 5EU6B 3RWFB 3R06A 1U8PA 2B20A 4PJBB 4WRLA 4QF1B 3SDYL 2MFNA 2VXTH 1ZS8B 1FG2A 5HHOE 3BE1H 2IEPA 4Y2DA 5CHNA 4Q6IC 5TE7L 1VCAA 1IGJA 2GKIA 3U9UB 5C6PB 1MFDH 2A1WH 2YD2A 2BK8A 5E70A 3A6OA 4LLYB 5LKNA 4TUOB 3BW9B 3DETD 4NPYA 4NKOB 4UQ3B 3MCKB 4G8FB 1A3LL 2JLLA 3P4NA 4KRMB 5FYJL 1KLGB 5L2KA 1IEAB 3DYOA 1AY1L 4L4VB 4KJQC 4MJ5B 3BDYL 1BVKA 1DVFC 4I4WB 4XCCH 1QSFE 1BJ1H 2Z91A 4IRZH 4QRSA 3C6LC 4I3SL 1TCMA 4WU7A 5IBTL 4PBVC 4JVUA 4PRIA 5DEGA 4U3HA 5A40E 1EO7A 1Q9LA 1YMME 3T0XA 4R26L 1ADQH 2BJML 4MQ7B 2AEWA 2QQKH 3CSBA 2AKRA 3WNOA 1U3HC 2AQ3A 1OP9A 4Z9KB 2DQGL 3HI6H 2VYRE 5EUKA 1RZIA 2VQUA 4EI5C 2XPGB 3OXSA 4C59B 1A7PL 4OD3H 4WFGD 3STZB 1MVFA 1NCUA 5EIIB 4HBCL 2QSCH 4PJDA 3BPNC 4XTRD 5CP7A 5CBEB 1DQLH 3F5WB 2AGJL 4X7TA 5MHSE 4NO3A 5IW6A 3UJJH 3L5JA 4IOSD 2PYEE 5F96H 1I8LA 5TDOA 1RZJL 4P46C 1AFVL 1VA9A 2WQRA 1CIUA 2BVTA 1DE4A 5ICZA 3FO1A 4HIHB 3SE8L 3C6LD 2OSLA 3U36A 2XY2A 2DIJA 3THMH 3MSPA 5IGXH 5IV2A 2VMFA 2A9NL 4W68A 2GT9B 3QCUH 3S37H 1W2KT 4BK4A 1RIVL 5I1KL 4X0KB 4P5TB 1MFEH 4EI5D 3SJVB 4TPRL 1N3NA 3LS5H 5H2BA 5D2LB 4YUEH 1BQSA 1E4KC 4PJGF 2H3NA 2MQ0A 2R1YB 4DOHB 4M5YL 5DEZA 4XP5L 5GQBA 2C4FT 1T2QH 1CFNA 4FG6D 1H9VA 1XEDA 2UWEA 5HHQA 2H6PA 2NY5H 2Q76B 2X6MA 3RBGA 3QP3A 4OIAA 1WFNA 1BZ7B 2C26A 2Z4QA 4JG0H 2V2XB 3VXUB 1TZIB 3QDGE 4HD9A 4P46D 5J13C 4RFNC 1T7VA 3S88L 4G9DA 4HK0A 1EUTA 3OGCB 3CH8A 5FHBL 4LIQL 5C0GB 3QEUB 5BOPA 3L5IA 3QXAA 2FD6H 2HN7B 3HZMA 2ZSWB 4JZNA 4Z7NE 3QUMH 2IANE 3DX6A 2IH1B 3JUYA 2WBJA 2HKHH 1JPST 3MRCA 4JR9L 1JGUH 5I30L 1TETL 4KJPC 3SGJC 4JPWH 3SKNA 5E9DE 4DUXA 2CKNA 5I16A 1I9JH 3M1BA 5EC2A 1KEGH 1F2XK 2AV1B 3FQUB 4LSVH 4X4MA 5DHVB 3ORJA 4EDXB 1MJJA 4IMLB 5E56A 3D6GA 3HN3A 5KVGH 2ADJA 1OLLA 3WUWG 2AV7B 1ZHLB 1QZ1A 4NN7B 1DANU 3HZKB 5D7SL 5SX4H 4ELME 4FQIH 4GAFB 3O3UN 4C54A 1OD7A 5JTWA 2ATPA 3WXWH 3N06B 5F88B 4ZFOA 3T3PF 1B9ZA 2O5XH 2DJ4A 3GKWL 2D7NA 5DHYB 5MI0B 1OCWL 2YD7A 3BEWA 4XP6L 3UTQA 1E28B 3KPSD 1S7UB 3QDJE 3MO1B 1OB1B 3TPKA 5EPMB 5IBLC 2HFEB 2XN9D 4TSAL 5KG9B 2WWKO 4NNYA 4FQJL 5M7QA 3MOBH 3DV4A 3KAAA 1FORL 5HHOA 1NCCH 3GIZL 2AXFA 4YIQA 1N5AB 5SWZD 2H32H 3O3BA 4LSRH 2IPTL 2I07A 4BFEA 3W9EB 3HTLX 4W70A 1NCDH 2AI0H 2DM3A 3K2MC 4HEPG 1VFBB 3WIHH 1QR4A 3QUXB 4XAKD 1S7WA 2IH3B 4Z0BL 4RAVB 1Y18B 1IAIM 3RGHA 2JIXA 2PXYC 3WLBB 3BVNA 1ZVHA 3ARDA 2VDQL 3D9AL 5FYLD 1HHGB 5DUMH 5BMFL 3HPJA 2M26A 1Z9MA 5L8LB 3GIVA 4JFDA 3OV6A 2VLLA 5FB8B 2D4FA 1NBYB 4CVZA 1J10A 3LB6C 4ZO9A 2D31A 3FJTA 5L6YL 4F7TA 1IC7H 1DBKL 4GOSA 5F7DA 3TLRA 2B0SH 3TBVA 4EN3A 3HI1B 1JGDA 2YBRB 1HWGB 2DD8H 4HG4J 5IBLD 4F7PA 9CGTA 5AZ2L 1DANT 5F93C 3CX5J 3MBEB 1YMMA 3ARGD 1U41A 1MVUA 4NQTA 3GMOB 1N6UA 4X7SL 4G3YL 5FGCE 2FGWL 1A6UH 3BKMH 1A7QL 3EYQC 5D7JA 5IB5B 1ZOXA 4XBGA 1CDJA 4IIQA 2R8SL 1KXQE 3V4PH 1P4IL 1LE9B 1Q9KA 1IGFL 4IJ3C 3QUZC 3LKQB 3T3ME 1U8IB 2PXYD 1BWWA 4G6AC 4G6FD 4YHOL 4PRBB 1CLYH 1MELA 2BY3A 3QPXH 4M3KB 3RGVC 3SDAC 2DDQH 5HHME 1NUFA 5C1MB 2PR4L 2XQYK 3LB6D 3TN0D 4JFXB 3WDIA 1KYOK 2ZCKH 5A43C 2KZWA 1R3IL 1CG9A 1DSFH 4Y1AA 1MNUL 5KVFH 1OW0A 2AK4D 3CK0H 5E94B 4LCCB 5D72H 1FDLL 4NO0D 3HNSL 5KSVB 4P23B 1OAZH 3WFZA 3CVHA 1YNTA 1DLFH 5DJYA 1X6LA 5IR1B 3EYQD 2PW2B 1E27A 2RR3A 4YPJA 3D48R 3UC0H 4X6DB 3ARTA 5J1TC 3LPFA 2X4TA 2HWZL 4LRIC 4NO5A 1QRKA 5E2WL 1FE8H 1UYWL 3QUZD 2Y9RT 1B3JA 3BP4A 4PJFF 4EZMA 5F3HA 5TDNB 1XT5A 1I1YA 5JIIA 3SO3C 3OWEA 2DKMA 1YC7A 1MHHA 4FHBD 2CLZA 1O0VA 5I8CB 3KPLB 3ZKXB 2P5WE 4PJ5E 5JOEA 1CD0A 4RIRA 4HKXB 2VABA 1CTOA 3UDWA 4DWHA 1LK2B 1RULH 3OKOA 1P6FA 4JO4H 4NWUL 5IOPA 1MIEH 1DBAH 3B2UC 12E8H 1NGZA 1MF2H 1PW3A 4YBLB 4NRXA 2Z31C 3DBXA 2YPVH 2IANA 1PZ5B 3IS1X 4X9BA 5DJDB 1F8TL 3ARBA 4N0UB 4J7RA 1B0GA 2CIIB 1RZGB 3K1KC 2ZCLH 3EJZC 1FC1A 3MRNB 4WFHE 3O6FC 4MB3A 3PHOA 4UBDD 4QHKJ 4Z78B 1B2WL 3HE6B 5MERA 1MHCA 5FO9A 4WJ5A 5CMAB 5FDWA 5KSUB 1AE6H 4GXUM 3LIZL 2EDEA 2EE2A 3GO1H 4BZ2H 4JDTL 1KCKA 5TQ0H 5KS9A 4PB0L 3WN5C 4NJAL 1UH2A 1T80A 3IXTB 4LOUC 3MLTA 1I7ZA 1HZHL 5CSZB 4ZMAT 1ZEAL 4GG6E 5GGUA 2X4QB 3X12A 3LAFA 3Q6GH 4M1DH 4UDTB 1SYVA 2VLKB 1W0VA 1QLEL 2GEEA 5IHZA 1A4JB 3HG1D 3BQUA 3MRIB 1NKOA 3KPMA 3GSVB 1IGYA 1HYSC 5EA0L 1NMBL 5HDQH 5M95B 1MJ8H 3B5HA 3DV6A 1T3FA 4R96A 2PO6A 5GRWA 4Y5XB 1R3LB 5ISZB 3SQOL 3W0WA 3ZKMC 2P5ED 3ESVF 2FBOJ 2HRPL 1NMCB 2Z31D 2LTQB 3C5ZA 4YXKH 1A1NB 5IHLB 2ZWLT 5F9OL 1KENL 3VW3L 3GSRA 1J5OL 3EJZD 4AG4L 4KKLC 1FG2B 3VFWA 1URLA 4Y2DB 1WJ3A 2FWOA 5CHNB 2V6HA 1DBMH 1IGJB 4OB5L 1VEOA 2X1QA 4U0RC 4B5EA 4LLVB 4NQDB 3BSZL 5IVXB 1FRGH 3HMXA 1YZZA 1C08A 5DD6B 3FB5B 4I8DA 5DC9B 3ECBA 1LQSR 1B4JH 2JCCA 4PJ8C 5IB3B 3QEHB 5DR5H 2ZKHL 5CJOL 4PRHA 2CMRH 4EEEA 4DN4H 3PDOB 3QIWD 1OQOA 3BP6A 1Y6KR 1U58B 4UB0L 2FATH 3UTSD 1KT2A 4HW6A 4YBHA 1JPFA 3CSYA 2Q3ZA 1XCQA 1AR2A 5DF0A 2AEQH 5GRZA 5FCSH 4BUHA 4GQ9H 3CFJB 3ZKMD 4MCZA 3IF1B 1TJHL 3I9GL 3IS0X 2HVJB 4IRSD 4YDLC 3EFFB 3WKMH 1BFVL 2Z91B 4F3FA 4LLMA 4QRSB 4WU7B 3RVTC 1QNZH 4PRIB 3CLFH 1ZTXH 5H35B 4P9HH 1MCOH 3C87A 5E95B 2X70A 3P3YA 3LN5B 3D0LB 4X98A 4F2MA 3T77A 4WY7H 1Q72H 3GM8A 4URTB 2WWMC 1BJ8A 1WC7A 1R5WB 3ZSSA 5FCUL 4WCYL 4WTXA 4PS4H 3CUPB 2CRMA 1FFQA 2UY7A 4ONFL 4LKCB 2NY0B 2XZAH 4XP4H 3TH4T 5CLTA 1RUQH 1JV5B 4MA8L 4JVPA 4NO3B 5GGVH 3ZDZF 3JXAA 5JUEL 4KVNL 3QBTB 4H88L 4JY4B 4QYOA 3INUL 1YJDL 2ZUQB 2ZCHH 4ZD3H 5D4QA 3FO1B 5CEYA 4D0DA 2OSLB 3RVTD 4P99A 3WMSA 4HWBA 4GJTB 1BD2E 4MD5A 3VD7A 2N1KA 1E4XL 2XG4A 1DDHA 3MZTA 4L3ED 2V17H 1ZA3A 2WWMD 1IC4H 5IT2L 3QFJD 5HGGS 5BQ7B 1X5IA 4RGNE 5D6DC 3HFMH 1BMGA 3CSPA 4DUWA 4P3WA 5LGJA 3UBXB 1S3KH 4OUOA 2J2ZA 5JXAH 3QQNA 1CICD 2UWEB 5HHQB 5K59F 5DDHA 3EOTH 1REIA 2M8XA 4MNGB 4HPYL 4KZDH 2IAMC 1OM3L 5A2KH 2ADFL 1A6PA 2ZPKL 3PG2A 1U0QA 3AM8C 3O6ML 1QBBA 3WHE0 1J9CT 4G9DB 5FM5O 3ZDYE 4AMKL 1P53A 3P40A 3VXME 5HGAB 3H9SE 1QA9A 3QXAB 5D5MB 1U8JA 3NACH 5J89A 1L7TL 3DX6B 4WO4B 5B39G 4NQCB 1KLUA 1UJTA 3QNXB 4NUJA 3MRRA 3MRCB 1I4FB 2UZYB 1DQJA 1UCTA 3WL9B 3IDUA 3O8XA 3RGVA 1EX0A 1Q9WB 5EZIL 3JV6A 3DLQR 3V4VH 2GK2A 1CF8L 2E7CA 5KOVC 4Z7UF 2ADJB 5KW9L 1C12B 2CXGA 3C60B 2DM7A 2P46B 4WNQA 1T22B 5EOCL 4H0HB 5IFJB 1LVEA 2A2QT 1MCPH 1T7XA 5ABDE 1DEEA 3L7FA 1NANH 4KTDL 3T4YA 4DGVH 5JMRA 2B5IB 2IAMD 4GG6A 4KY1H 3BZ4A 4NZUL 2EDTA 3GHBL 2ATPB 1F3JA 1F4YL 4YNYA 3Q3GB 1UB5B 3H3KA 3BGAA 1CLOH 4ZDHA 4G5ZL 3CLEL 4F15B 3QZWG 5EWIL 4P57A 1JTPA 5LG1A 5L0QB 2GY5A 1A0QL 1HKLL 3NIGE 4WGWB 1F6AB 4M7JL 1IKFL 2HLFC 4OAWA 4OZHE 3PXHA 1KN2L 4NNYB 3B6SA 5F6IC 3DV4B 1MJUH 1LP9F 4NT6A 5F7KC 3PXJA 4TTGA 2E27H 2HRLA 3HE7C 4FABH 5I1DB 3LKPB 2FEEL 1NDGA 2R2EB 3VCLA 4E42B 3O9WC 2IPUK 3DVNA 3E6FA 2J3SA 2NY7L 4LSUH 1IVLA 2GJZB 2I07B 4R0LC 1S7VA 1HXYB 2R0WH 4XZUB 3EOBA 5C0AD 3VWKC 5GS0H 4C83A 1C5BH 4O2EA 5I74C 5JQ6L 3CVHH 5KJRL 4PGCB 4TRPH 3AAZB 3CMOL 4DFHA 1D5XA 1S7WB 4OCXH 4OIBA 1G9MH 1CDYA 3ARDB 4KPHL 4MS8C 3FAWA 4I18C 3U1SL 4HIJB 5K93A 3HPJB 1E4WH 3G08A 3FQRA 3OKNA 3GIVB 3HC4L 4FQLH 4G43A 1PSKH 3OZ9L 5E08H 4CVZB 2D31B 4NNPL 4S1DC 1K4CA 1A7RL 4X7CC 1GGBL 5F7DB 4NYLA 4HGMA 5E2TL 5F7NC 1KNOA 3TBVB 2HLFD 5GZND 1K6QH 5EUOF 4QEGA 4AEFA 3QEGH 4UTBL 4F7PB 5DQ9B 4GKZA 2AW2A 4JFEA 5DA0B 4PBXA 1TPXC 2XZCH 2BNUB 3TNMB 1A6ZA 3HNVL 4K7PX 4LKXA 3EIFA 2X09A 2XWTB 1KTLA 4NO2B 5IMOA 4K3EL 3O9WD 1CE1H 3OB0H 5C2UB 1SJEA 3K3QA 4KUZH 2V9QA 4BKLA 4RMQA 2DL2A 3VWKD 4NZDA 3FTGA 2OQJA 3MACH 5KN5A 2F5BL 3WJJC 1IM9A 4KRPC 4MS8D 4P59H 3GRWL 4Q6IB 3DX8A 3TIEA 4ALAH 1F6LL 4FXKB 4X6CE 3RWCA 2JELH 4S1DD 1F11B 3HA0A 5BV7L 4YEEA 3OHXB 3WYRA 4Y1AB 1BVLB 4OGXL 2A6KB 2IQ9H 4YDIH 3DSFH 4JFYB 5FUCE 4XB8A 4HIEA 2QHRL 1G7PB 3I2CH 1LO3H 2EH7L 4RX4A 5FO8A 2BNQA 4JKWA 1YNTB 3LY6A 3BUTA 5FYJD 5DJYB 4JY5H 4HFWA 4LGSB 1XIWA 2OJZL 4PLKC 3JVGC 4LL9A 2JJVA 1RZJC 1T0NA 4Z7VA 5MENA 1XF3A 2XNAA 5K9KA 1YN6A 1DVFB 1HOCA 4PTTA 2X4TB 3RI5K 4NO5B 2B1AH 3C6LB 3HHRB 4D0CA 4Y2OA 5CINL 4KRPD 5F3HB 4JQIL 4HFUH 3DMMC 3MJ9A 1HILA 1I1YB 1ROWA 3HMXH 3RNKB 3I6LD 1SY6H 1QHOA 1VACA 5C3LD 1MCRA 3H6JA 1T03H 1U3HB 2AK1H 2XT1B 5T3XL 4RIRB 4JPKH 4M48L 2VABB 4EI5B 2DBJA 3I02A 4QHUA 4H5SB 1CFSB 1H3PH 1I3UA 4OM0L 1TIUA 5IOPB 2BOBB 1JPSH 3UPCA 3VWJC 3EYSL 2O61A 3VXMA 3QCTH 4NQSA 3H9SA 4MXVE 3S36H 3BPNB 1SHMA 3DBXB 1KJ2A 2BNRE 3BEVA 4TNWK 1B0GB 2LVEA 3A6BH 3OF6D 5DXWA 4LU5L 3QH3A 3VFGL 4D8PA 4LCUA 3QDHA 4HT1H 1Z9OA 1FL5A 5MERB 2VDRL 1BFTA 4WJ5B 5DMKA 4CBPA 1YQVH 1PG7H 4H26A 3AXLA 5CJQH 5IB4A 5DTFA 4LF3A 1ORSA 3P9WB 5DJ2A 3EKCA 3EFDL 4RMVA 1MCLA 1I7ZB 1IARB 3GBMH 3KLSA 2X4RA 1F00I 3G5VA 2B2XL 1SYVB 2I5YH 1ZMYA 1FG9C 4HF5H 1R3HA 1MUJB 1A6TA 4ZOAA 3C08H 5JNYA 2CJUH 2NW2B 3TCXA 1D6VL 3MNWA 5EC1A 3DV6B 5D6DA 2PO6B 4FQHA 4LAJH 4WFEE 4CJ0A 4QOKD 5C07D 3DX9B 4D9RD 4U7MA 1EHXA 4HAFA 3O0RH 35C8L 4L4TB 4OLZH 3KPTA 5C0IA 4NDMA 2GUOB 3VFWB 5CJXC 5IVOA 4DKAA 3A6CL 2QL1A 3UXFA 1DN0A 2F19H 5F7WC 3KYKL 1N26A 5J13B 4RFNB 5I1IH 4PLNC 1KPRA 2AABH 4W4NA 4KU1A 3QEQB 1LO2L 5F1SA 1JL8A 2FHCA 2KQNA 3QJHA 2JCCB 4HIIA 1UCBL 2YRLA 3KPSB 4XCEA 4ZAKA 2YZ1A 2C3HA 3ULUH 4OLVL 1LDPL 3BP6B 5D70H 4V1DE 1I1AA 2BOCA 3K4ZA 1KT2B 1N7ML 4FQCL 1JPFB 5K9QI 3CSYB 1XCQB 1VADB 5IMLB 2AEPH 3ILPA 3KXFE 5GGQH 3L9RB 4GRMA 3L3GA 1JGVL 5C8JA 1TVDA 1F3DH 4MCZB 3ZE2F 4U1HB 4LAQL 2N7AA 3LN9A 4J3WA 2D7TH 5E6ZA 4RZCA 5TQ2H 4MHHG 1M7XA 5B38B 1EVUA 3JWDH 4GW1A 2FH6A 3LKOA 4G6JH 1MHEA 3UCRA 3RX8A 4X98B 4F2MB 4M4RA 5IQ9A 4K3GA 3VGDA 3G6AB 4LRNH 4OLYH 4IOFD 4OLWH 1J1XH 4CRPA 1GAFL 5GGRY 1YPZE 1I9RH 4ERSH 3MODL 5EBLB 3WFHB 1LEKA 4NCDA 4PJAB 3DGGB 3ZE0F 2ZJSH 2GTWB 1RFDH 1UM6L 1BX2A 4KI5C 3VI4F 2CD0A 4C58B 1KCRL 1QBLL 3SE9L 4XVJL 3HZYB 1T20A 3FRUA 3BD3A 1FBIL 3CFKA 4OF5A 5D1XC 5DJAB 1CZ8L 4MXWL 2JIXD 1J0HA 1VERA 1WZ1H 4D9LH 4X6CA 1SBSL 1PY4A 1RZ8B 4TVPE 2AJYH 5CEYB 1NQBA 3H0TA 4D0DB 1D5MA 1KIQA 1MWAB 2DQTL 3PP4L 5EDXA 1AGEB 1T2JA 1P7QD 1FIGL 4WHCA 4G8IB 1U36A 1XH3B 3KYMA 2MKLC 2EECA 4QRPB 3FT2B 5C0CE 3TH3T 4A6YB 3MFFA 3MRDA 1QSFD 3D2UA 2PXYB 1DDHB 4Q9QL 1ZA3B 4G6FB 4PV8A 4PUBH 2GAZB 3B8YA 5D5MF 4YE4H 3QRGH 4P5MB 4FMFA 1YMMD 4DN3L 3R4DA 3HNTL 3EAKA 1X5GA 5EORL 4M7KL 2OMBA 1EK3A 4KMTL 4NQUA 3REVA 1RZKL 3QIBA 4YBQC 4G9FE 4Z7WB 5LGJB 4DGIH 4HPOH 4NO0B 4OZ4A 1ZGLM 1A1MB 2XA8H 5I66A 4PG9A 3KPRA 5KBNC 1RPQA 5DD1H 2VXVH 2WANA 2YD1A 3RY4A 1YNLH 1GZPB 4X6EB 5MHSD 4FMKA 1X5YA 2NXYD 2WIIB 4BQ6A 5C9JA 1BGXH 4NRZA 5HY9A 4PJCB 2PYED 1WT5A 4JM2C 3T2QA 1RJZA 3TCLA 1U8JB 2QQLL 4G6KL 3LOWA 4F7MA 2OK0H 2WK2A 3B9KC 1KLUB 3QHFL 3NCCB 3QUZB 4IJ3B 5TFSH 2EXWD 2BNRA 1ITBB 4ODXA 2VAJA 4P2QA 1OSZB 1YEDB 5IW1B 4PJEB 4HWUA 3RGVB 3SDAB 4MB5A 4Z7OE 4HC1H 1JZ2A 1N6QL 3FOMB 3PABB 2X41A 3LQZA 5CWSB 4U33A 1BEYL 5DWUH 5F3BA 2G5RA 1FGNL 1OVZA 4R3SA 3FN0H 3OL2A 4YBQD 3CDCA 4G7YL 5IQ7H 1A21A 1TDQA 4YHZH 5TDPA 1FZOB 4WNQB 3AS2A 4F9LA 2VXUH 5L7XL 3VJ6B 1T83A 2UYLA 3L7FB 5DI8A 2ZUTA 2CR3A 1CGYA 4NJ9H 5I8KH 2GSGB 4DVRH 1NKRA 4MA7L 3SBWC 2DLFL 2J5LC 4GKNB 2QEJA 3LS4L 5H8DA 5HYJE 3FFCB 4OBSA 4NC1C 3VFOA 1QLRA 5J1SC 3UTZB 1UQSA 5H37G 3IYLW 1JCKA 3BH8B 3G04A 3JVGA 3VXRE 1TTUA 5E8DL 4ZDHB 1BBJB 4WUUE 4P57B 1O7VA 4S0SD 3QDGD 3WNMA 2R15A 1MHPH 1WCBB 3FRPA 4ZO6A 1KIRA 1P4LB 1SBBA 3B9KD 5MEOB 4OAWB 1DEDA 2BY0A 4M43H 1EGJL 5TF1L 3SO3B 2DMCA 3G9VA 4M1CC 1GL4B 3IFPA 2IAND 1CK0H 2EEAA 2XA3A 4ODTL 1AQKH 2ICWA 3FO0L 3QYCA 2FJFA 1A4KA 3E8UH 1NDGB 1ZLUK 3VCLB 5E8EA 2Q3AA 4MMXC 3PGFL 3BGFC 4JCMA 5E9DD 3K7UA 1VFUA 4GG8B 3U4AA 1IQWH 2BX5A 1S7VB 5CGTA 2H45A 4QRTA 5FM5M 4JQVC 3OPZL 4NHCL 5TE4L 4BSJA 4TQEH 5DQDH 2PTUA 1IAIL 4JFZL 3MV9E 2Q6WA 4P2OD 4X80L 5HHNA 1GGUA 1CVSC 4JQXC 1G9NL 4LP5A 4LCYA 3O6FB 1HNFA 1MCWM 4V1DA 2J8UB 4KTEH 4QXUL 4YR6A 4KI1A 3RZCC 4TOYL 1JE6A 2C7UA 3KXFA 2XQBH 1YEKH 2LU4A 2VAAB 3MJ9H 1KJVB 4XP1H 4C56A 4J2XA 1TZGL 1JZ8A 1KB9J 1Z0NA 2AJVH 5DK0A 1KNOB 3WN5B 3PE9A 4JFEB 1OY3B 1VGEL 4ZO8A 1A6ZB 3C5ZD 1OTTD 2DQIL 4ZTOL 2JB5H 1RJLA 3NCFB 2HT4D 3QDJD 2VIRB 5KSBB 1QFWM 1M05B 5IKCA 5DRXA 3PL6C 1SJEB 1RUAL 4QXGH 4M5ZL 1MFBH 3Q5TA 1JF1A 1KJ2H 3RUGF 1YPZA 2R2HB 3SOBH 1KTRL 4MLSA 1I1CA 3TO2B 1ZSDA 1T4KA 3L5XH 3AROA 1L7IL 2MCG1 3FQWB 5CUSH 3IJHA 4KVCH 3MV8E 1ACZA 4WWKC 1GCFA 5J57B 1XF2A 3HAEA 4OV5A 3FFDA 4WU5A 5TPWL 3B4NA 3U4EB 3QB7C 1IT9H 1P6AB 3S4SA 5F9WC 3RZCD 5B8CC 3RWCB 2J88L 2OS7A 5HGHB 1W72L 3MUZ1 2MPAL 1F2QA 3PDDA 4M7ZC 1Z6JT 3GSNA 4AEIH 3VXNA 2FO1A 4Y16C 3K8LA 3EO0B 2UVEA 4PJ8B 3LKRA 4K94L 4K3JL 2G60L 1HNGA 3NIDE 4GMSH 1TFHA 4ODUA 3P77B 5FUOL 4PP1C 4YPGA 4QO1A 4P2RD 5IW3A 5DVLA 5FO8B 1N2RB 5FF6B 2BNQB 3F7RA 4OZGE 3O4OC 1AQDB 2BSTA 1XIWB 1OSPL 3SKJH 1NFDF 3RJDA 3QDME 2P24A 3WFBL 4XC1H 5JHDB 4Z7VB 5MENB 4R6UA 4HS3B 5K9OA 4KDVA 4LMQI 3VG0H 3U7WL 5K9KB 2FECI 4PTTB 1T7WA 4YDLB 1EFQA 3TWCH 2CGRH 4D0CB 4QY8A 2X5PA 4LEXL 2GCYA 4KHXH 4O58L 4ODHL 1VACB 1WFTA 1C5DB 1X5FA 4OUUA 5DEFA 2BDNL 1R5VA 2XKNA 3T2PA 4QHUB 1WV7T 5F7EL 3V6ZA 3GHEL 4IS6B 5HHMD 3EGSB 4Y16D 1CR9H 2FL5A 2EC8A 4M6NL 5B21A 1EEUA 4OQ1A 3ULVE 3NZHL 4PYHA 1MY5A 4PRPE 1A2YA 1YEFH 3O2VL 2VWEE 5DSCA 1V3JA 4K23L 4HWZA 4CDGC 4ETQB 4Z95L 3W2DH 1VEMA 3QH3B 3R8QA 4O02L 3TVMA 4D8PB 1CBVL 3X3GH 4O9HH 3UBXG 2VDML 3RBSA 1MIML 3V5DA 5DMJB 2W07A 5ESAA 5FDYA 4DZBB 5DMKB 3O11A 2VDOL 3BP7B 3GMQA 3GB7A 1M71B 4H26B 4XNYH 5GS1A 3C5JA 3AXLB 3FT4A 1CDBA 1NCWL 4LF3B 1AHWC 3BDXA 1S9VB 3W11D 4U7SA 1AGBA 3P0YH 3MRLA 4WI3A 4XNQA 5CBAA 4XP9H 1UEMA 1U8OA 3BT2L 4XPBL 5ANME 3IDYC 5GRXG 2K1MA 4PV9A 2CXKA 1G6RL 3Q1SH 3BKJL 2ZOKA 4GRWE 1R3HB 4U3CA 3O2DL 3ARWA 1KGCE 1QVOA 3VXOB 5HYJA 3PV6A 2NY1C 5JNYB 3MNWB 2VC2H 3VMNA 1JRHH 1GC1L 5ITFB 4FQHB 3VXRA 3VFUB 2P5WD 3MRHA 4PJ5D 1KOAA 1S5IH 2C9AA 4WW2F 1R0AH 4GXVL 2NXZD 1XF4A 4J23A 3MLWL 4NQXA 5GHWL 4P48A 4QRRA 1S5HB 2EC9T 3MLYL 4J8RA 4NDMB 2DQEL 1AP2A 2FZ3A 3FQXA 2CKBL 2LFGA 2F74A 2Z92A 4P2CG 1DN0B 5D7IA 3TT1L 2WM0A 1DQDL 3SY0B 5F89A 3MBXH 1S7TA 4LLDB 3GJEA 4WFHD 3MLSH 1HSBA 5INDA 5F6HJ 2J8HA 1QRNE 3U30C 3D18A 4HS6A 4YQXL 4U6HA 3V5HA 1WICA 2VERN 5FOBA 4LLQA 3CC5A 2Y23A 1BVZA 1LD9A 4RNRB 5DJCA 1E0OB 3ZT5A 5HHVL 2Y5TA 2NY1D 5DJZA 2FJGB 5CEZE 1DBJH 3W39B 3L3GB 2G75A 3OG6B 3AU1A 2VLJA 4EQ2A 3VMPA 1H15A 4OGYL 1IAOA 5C0AB 3PWNA 1OAQH 4EOWH 4HJGA 1S78C 3C5SB 5CEXB 3TPUA 4LHUA 1MH5B 4TNVK 4J6RL 1CLZL 3TV3H 3WDJA 4GRLC 4YDKH 4ZUUA 4GW1B 3RIFK 1RMFL 1F97A 2E5EA 4M8QA 4UAOC 1JPTH 3R1GH 5JPNB 2F15A 1CDIA 1HDMB 1R5IA 2NY4C 2E7HA 1N8ZA 3V6OA 1DQMH 1PKQE 5E8PB 2ITDA 1J86A 2BCKA 3A67L 1YNKL 1Q1JH 2Y6SD 3ARZA 5GGTL 1OP3H 3TZVC 3WFDH 1LEKB 3BGMB 3H7BB 4ISVA 5J0BA 1PZUB 1EJ6A 4MMZC 2V2WA 1KIUA 2EDLA 2V5MA 3QWOB 3MV8A 4OCRH 4LSSH 3FRUB 5F6IB 5E03A 4QGTA 1ZLVK 3CFKB 5HYEA 4MCYA 3ZTNH 5T3ZE 2YSSA 3MRFB 3KYAA 4RAHA 3HE7B 5B3JF 4U1JB 3O9WB 1BREA 1L9MA 4P9ML 5JOPE 4NN6C 4LLWB 4DKEH 4R0LB 4XBPA 3TA3A 2NZ9C 2GITA 1S78D 5I74B 1RD6A 4OBRA 2DBLL 3GJFB 5BVPL 3KYMB 4RGOL 1YEJH 4JHAL 5IJKA 5KVEH 2XXMB 4GH7B 2MKWA 1D5ZA 1HEZA 1QBML 3AS1A 4JRYE 4PV8B 4I18B 3R0MA 4ZOEA 4RQQA 1U93A 1EXUB 2X4SA 3HUJE 4AJ0A 3TZVD 2AJ3B 4R2GD 1OF2A 1CD8A 1VSCA 4IDLA 5BV7C 2RQ8A 3QDMA 2A9NH 1EEYA 1OT2A 1Q94B 2MHAB 5JIHA 3REVB 1MCEA 3QIBB 2OP4H 4Y19A 2AQ1A 4WI4A 5E2VL 4S1QH 5GS2H 1UB6B 4KKAC 5BRZE 2QADC 2OXHA 1S7XA 4RGNC 3V0WH 5GS3A 4MD0A 1ZLUH 3QNYA 3QQ4A 3IDJA 1EBAA 3KPRB 4UINH 3RNQA 1FNFA 4HCRA 4U1SB 2YD8A 3O4LA 1IM9D 3PL6A 1YEGH 4Q9CA 1CE6B 4K9EL 1TQBB 4NRZB 5HPOA 3ETBF 4JFFE 3CFIC 3AMLA 4FTVE 1RJZB 3TCLB 1ZHNB 5TH2B 5ELIA 2RCSL 3VFPA 4U6XA 4WWKA 4PJHA 4PRPA 1G7IA 2AXGA 1CFTB 3MUY1 1KFAL 1X3DA 4KRPB 3KJ4C 4P2QB 2EDDA 1KPVA 4P5KB 5HHXL 1BD2D 2EICA 4GLRI 4NM4H 5D7KE 5B8CA 3LQZB 5CCKL 4RX4D 1ACYH 5F3BB 5LBSL 1UWGH 4QTIL 2E8YA 1UGNA 3L3KB 5I30H 5ALCL 3LEXB 5HBBA 1NAMA 1RUMH 3DHMA 2OR9H 4RGND 3MMEB 3VRIB 4ZG1A 2YK1H 5IHUH 5EO1B 2A6IB 3UJTH 3OJDB 4LGRB 3MLVH 3BAEL 3WUWA 3EYFA 2DWEB 1GJIA 1E4XI 1AGFA 1FGVH 4PJXB 2YKLH 3OJMB 2UZIH 4OLXH 5C6TL 3M17A 4PLJD 3MRMA 3U7AA 1F4WL 2H2SC 3HAEH 1FNSH 5D7SH 4LP4A 4R4ND 3PWLA 1UZ6E 4YHNA 2DYPD 3MRKA 3UYRH 1I8MA 3NABH 4UILL 3VXMD 3DMMB 3H9SD 5FKPB 5DC0A 2VITB 4EDWH 1LWRA 1VFAA 4O51B 3GSNH 1S7RA 3SKOB 4AZ8A 4TVPH 4NQVA 5T3XD 4AL8H 4N0YL 1MI5D 2FJFB 5E8OA 1A4KB 3ILQC 1OAUH 1QTYT 1RIHH 4U4BA 3QIUC 4JFQB 3X11A 3LHPL 5HGDB 3DXAE 4DVBA 3VWJB 5GRJH 1BFSA 3LMJL 4HGWA 4QRTB 3O2WH 4TSBH 4WTWA 2DICA 5JLZB 1QRNA 4PY7A 2VH5L 4LARL 4OQTA 1Z2KA 5CJ8A 5C07B 3HC3L 2BC4A 3GIZH 1CS6A 1K8DB 2X89D 2Q6WB 5IESL 4EUPH 1INDL 4LCWB 5HHNB 4HUXA 4XNUL 4UIMA 3QO1B 3RX7A 32C2B 4ONGH 5I6XC 1KUMA 1X7QB 4X4ZA 1BLNB 1YY9D 4F9PA 4YR6B 2XRAH 4X5WA 2H2SD 4G6ML 4JN2B 1NFIB 1J05B 4IDJL 5DD3H 1XR9B 4C56B 5ICYA 2YPLE 3MA7A 1P7KA 4JZJA 4DGYL 3DUUB 4JRWA 1KXVC 4A2MA 3VH8B 4FZEH 4K55A 2R0ZL 1I9IH 1NCBL 1RJLB 5EZJA 3ILQD 5IKCB 5IMMA 1IGCL 2OR8A 2UY6A 1JF1B 2OJEB 3HMWH 4GSDL 2FIKA 3VI3F 1PKQA 3CXDL 5IIEB 5AZ2H 3RIAK 1F45A 5JR1H 5JMOC 1B0WA 1ZSDB 5SX5K 3V0VB 5D7LE 1UKSA 3ULSB 4JN1H 1WZLA 4AIZA 5HDOA 1BAFL 1XF2B 2FGWH 3GDBA 3QI9A 1TQCC 4ZAKD 3V6FB 3S4SB 3TO4A 3EJJX 1FLRL 3GUTA 2P45B 5DGRA 4Q9RL 1ORQA 1I1AD 5IVZA 1Q0YL 1I8IB 3GGWA 1JGEB 1ERNA 2FEEI 3T0VA 4LQFH 4OGAC 1JHKL 4X5LA 3PQYE 4PGDB 3MXVL 2YHGA 1CFBA 1S7QB 4HJJH 1PYWA 5IMKB 1KYOJ 2P4AB 3FQTA 5L9DL 2FX8L 4X8JB 3VXSB 2X10A 4JM4L 4ODUB 1HIMH 4KK6D 4YPGB 5L88H 1N0XH 1OARH 4KZEH 3KLAB 1UFUA 4NHUA 4LPWA 5EU3A 3NFSH 4JRYA 5ADPH 3V8OA 1DBBH 1CD1B 3RDTA 3W5NA 1HHHA 2P24B 3HUJA 1GIGL 1J7VR 4JGMA 1OAYL 3P4OB 2Y5EA 4QY8B 4NKIH 5JO5A 1SMAA 5BRZA 4Y8DC 4BFGA 1NLBH 3PIQA 4OFVA 4GRLA 4UV4H 2BMKB 3GSOA 5IBUG 4WW1A 1EFXA 2YUZA 1EMTH 3MLZL 1OL0A 2VRAA 4OUUB 3WCYA 3OR7A 2IMNA 2F53D 1YEHH 1U8KB 3QXDA 1R5VB 2W60B 1AJ7H 2XKNB 4HKJB 2VXQH 4NNXA 5SV4A 4QHMB 4Y4HA 4JCLA 4RMRA 1FNEA 3V6ZB 4OGAD 2LAGB 3MUHL 4BSVB 5DS8A 4F58L 4JFFA 5EZLB 3JUZA 3RFZC 4K7PH 3M45A 1JZ4A 4ZS7L 3F58L 4R7NB 1S9YA 5EG6C 3KLHC 5EN2A 5DJ8B 3J8F7 1INEH 2EIZA 2W1NA 3S35H 4MNQB 2OCFD 3LQAL 1EBPA 1XGRA 5D1XB 1EZVY 2W9EL 2R4SH 3D2UD 4H20L 3S3JA 4JO3L 3HRPA 3EW3B 4R90H 5SWSE 3V5DB 3WIIH 1SMOA 3OTTA 2IFFL 4PREB 4HX1A 5F9AC 2AJUL 5D71L 4BZYA 4N0CC 3L3DB 3HB3C 2PYEB 5DURB 5HI3C 1WBXA 5ITBH 1P69B 4ZNCD 1T7ZA 1Q9OA 1AGBB 1ZVYA 3L7EA 1NAKL 4XNQB 3MRJA 3L3JB 4JGUA 2YPKA 1IGIH 4N1EA 4ZSOB 4UU9A 4PV9B 3GRWA 2B39A 2Q8BL 3Q6FB 2A9ML 2ZOKB 1K9TA 4PJIE 3MLXH 2VDNH 1MRCL 3PV6B 3DI3B 4GAYB 3K46A 3VFNB 1L6XA 2XICA 3CU1A 4CKVX 3UJIH 3MRHB 2Q7YA 3U2SB 1QLEH 5ID0A 3VFVB 5JPMB 5DJXA 1XF4B 1ZLVH 4ZUSA 3KLHD 4QRRB 4WI7A 3UTTD 1NGQH 1KTDB 3AREA 2W65B 3FQXB 2WINA 3G5XA 2F74B 2FSEB 5JIKA 2BFVL 3QA3A 4MXQC 2Z92B 5D2NE 5D7IB 2HRPH 3SCMA 5F89B 2A0LC 3RL2B 3GJEB 5INDB 3IDMB 1J1PL 1BBDL 1C16B 3EO9H 4JM2B 5EBGA 3DXAA 4QWWC 3QDGB 4Y4KA 1PLGL 3PNWB 4BQCA 4OCMC 3MQIA 4U6HB 4GBXC 2Z93A 3V5HB 5FGSA 3B9KB 1QUNA 4PG2A 2CLVA 2DWDB 3CC5B 2YEZA 5H94A 3WXVL 4KQ4L 1II4E 2EDBA 4FQXC 3TF7C 2O5ZH 3EO1B 1TJGL 1JHLL 2P8PB 1FAIL 3P30L 2Y5TB 3CSGA 2V2TA 4B7IA 3TJEL 4I77L 3DO7B 5EU6E 3P9LA 2ZKHH 1AKJD 5I76B 4PJBE 3AU1B 5IEKA 4JHBA 2VLJB 1U91A 3WS6C 3IU4L 1IAOB 5HVWA 3MCLH 1F4HA 1NUGA 4HCRH 4X6FA 2YPLA 3ELAT 3GSWA 5BXFB 4WFED 5INCB 3KYNB 5E5MA 5IB2B 1MAML 4ZUUB 4MXQD 4M8QB 1G9NC 4AEEA 2J5LB 3CPLA 1TJHH 2XZQL 4JKLA 3GEWB 5I1HH 4FZ8H 1N8ZB 5GS2D 4XPFL 1P84K 2BCKB 2ITDB 4J12A 4ELMB 3ULVH 4P0DA 5GGRA 3F7VA 1ITCA 3GI9L 4QWWD 4OD2B 4NZTL 1FH5H 1BM3H 5DT1L 1E6OL 3RVXD 5D1QA 2V2WB 4JJ5A 1CU4H 1IGTB 3RY6A 4PLOB 2V5TA 4PJ9C 3P4MA 4FQXD 4L4VE 2ITCB 2OTPA 2A38A 5AD0B 4MCYB 3SGDH 1E6JL 1UM5L 1NAMH 3SHSA 3DUSA 1RU9H 2R4RH 4XWGL 3GI8L 4V1DD 1IL1B 4NQEB 3OX8A 4XBPB 5T1LD 1MOEA 4GFTB 4RRPG 2WUCL 5DD0H 5JUEH 1FZMB 5A2FA 2AS5M 4OD1L 4RFOL 4GRWH 1AGCA 3CDYA 2GTZA 4P4KC 5KSAA 1ZXQA 1YJDH 4XMPH 4S1RL 1MCWW 5D1ZA 1U8LA 5DZLA 2A74B 4U6YB 1G7JA 4GAGH 3RZCB 5EULV 1J8HB 1N6VA 1RZ7L 3VMOA 1D3CA 4XVSL 3PP3K 4YXLL 3TJHD 3GNML 1IEBB 4PJ9D 4K94C 2R0LL 1QKZH 3CNKA 4GMTH 4MD0B 4MSWB 5I1EH 3QQ4B 5DMIL 3IDJB 3SE4C 4M9PA 2RFXA 4KK5D 1U8MB 1NGXA 3RNQB 3VD5A 4P2RB 5JA8B 2W0FB 4TUKH 1A1OB 4F7EA 1I9EA 1W8NA 4PPTA 1F3DJ 1JK8A 4FP8H 4L1DA 4OQTH 2FBJL 3CVIH 3PL6B 3SDXB 1U8HB 4WHYH 3MYJB 3DURB 1HH6A 5C08A 2EZ0D 3I50L 4Q2ZB 15C8H 4UDUA 5E1AA 1QFOA 3C2AH 1DQTA 2FO4A 3B3IA 1A02N 4P4KD 2GFBA 1ZANH 4Z7QF 5FGCB 4WWKB 3VFPB 4TVPD 4PJHB 2AXGB 5GJSL 5D2LE 1A5FL 4YHIA 5CEZH 3CU7A 1RV6X 4F8TA 5LGHL 6FABL 4DOHE 2E7LA 5F9WB 5C0CD 1EO5A 3OXRB 2BSSB 4TVSa 5B8CB 4MQTB 5SWSA 4M7ZB 4ODSL 1ZWIA 4R4BB 4K8RH 2X44D 5ADOL 3VXUE 5JW4N 2OL3L 5EU5B 3RVWC 1F58H 3PWVA 3SDCD 4G9FD 3WUWB 2VZ1A 3QQ9C 1I1FB 4QCIB 4AENB