2LAAA

Solution strucuture of the cbm25-1 of beta/alpha-amylase from paenibacillus polymyxa
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
104
structure length
104
Chain Sequence
GGTGNKVTIYYKKGFNSPYIHYRPAGGSWTAAPGVKMQDAEISGYAKITVDIGSASQLEAAFNDGNNNWDSNNTKNYSFSTGTSTYTPGNSGNAGTITSGAPAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Beta/alpha-amylase
publication title A functional and structural analysis of tundem family 25 carbohydrate-binding modules from Paenibacillus polymyxa beta/alpha-amylase
rcsb
source organism Paenibacillus polymyxa
total genus 12
structure length 104
sequence length 104
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2011-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03423 CBM_25 Carbohydrate binding domain (family 25)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2laaA00
3U9PL 2WLZA 3HUJB 4HS3B 3L6FA 3TT3L 1KLGB 4D9RE 5ID1B 1JZ7A 1A6ZA 1E6OL 1DN2A 3CXHJ 4KPHL 5SWQA 3ALPA 2BY0A 5D71H 2YMXL 1FG2A 4V1DD 5D7IF 1CD9B 1U95A 2OR8A 5IT2H 4YC2C 4WUKH 3QB7C 4GUPA 5T1DH 2PUQT 3MV9B 1YDPB 2ZUWA 1TJIH 2O26U 4XBGA 1YN6A 1MHHA 1Z3GL 4RISL 3REVB 5SV3A 1IGJB 4N8PA 2DDQL 4PJ7F 4RGNB 3V2AR 4LPTA 4D9LH 4OLZH 4JY4B 3C8KB 1A14H 3T77B 4PJBA 4YZFE 6CGTA 1WJ3A 1PGRB 1WC7A 4Y19B 2J8UA 5JQ6H 3WKNA 5IMOB 4EDXA 4RMRA 5KSAB 4O2EB 2QSCL 3NABL 1Y6MR 2ADFH 4QXGL 2X4PB 1QYGL 2J8HA 3GBML 5DVOA 5I1KH 35C8L 4AM0A 1GAFL 1NLDH 3GIVA 1ONQB 4RMSA 4TSBH 1RV6X 4LLYA 1RHHA 3IFOB 1TZGL 4YUEL 5JNYA 4BKLB 1T1WA 2UZIH 4R6UA 4A6YB 5C0BD 3W9DB 5F6HI 4KWUA 3UTSB 5IWLC 1NCBH 5I76B 3CCHB 2P5WA 2EH8L 2ICWA 4JRYB 4O5LL 4NRZA 4OD3L 3VD5A 5TE6H 1ACYH 3IU3B 3HUJA 1T6VN 2GY7B 4HS3A 5AG9A 1KLGA 5ID1A 2ZJSL 4XCFL 2A77L 3F62A 4Y2DC 1XGRB 4LK4A 4NZRH 4BFIB 1YEJL 4YZFF 3DWTA 2ZG2A 3TIEB 4FQHB 3CFCH 5HGDB 2IAMD 4RMVA 1ROWA 3SE9L 1KCRL 2H2PC 1RJYB 1YDPA 3REVA 4WCYL 2J8OA 2Q8BL 1IGJA 4APQB 2X6MA 4NC2B 1S7WB 4OLWL 2Y1VA 1KB5B 1HSAB 1QLFB 1NKRA 1X44A 5D1ZD 1D9KB 4JY4A 1IM3B 3C8KA 4L4JA 3T77A 5CD5C 5E8PA 2FEEL 5GPRA 4RAUB 4Y19A 5T1KD 3B9KA 4CL7A 1IGYB 2C1OB 2N56A 5FGBA 4NZTL 5CGYD 3OXRB 4LNVA 3H6JA 4CU8A 3J8F7 2CGRH 5IBUB 1URLA 2X4PA 3BIAX 5JMOC 3FN0L 1Q0XL 4KQ3H 5GGQH 3MLRL 5C07B 3N1QC 3MYJA 3WFCH 1F11B 3IFOA 2ADGB 2IGFH 3MRMB 5GGSB 3SDAC 4PJFA 4BKLA 1NAKH 4A6YA 3W9DA 3UTSA 1NQBA 2CJUH 5I76A 3CCHA 1HH6A 5CEZD 2W9LA 1NC2D 3MOAL 5D7JD 1MEXL 1J1OL 3BQUC 4JRYA 4XMPH 3ARFD 3U7YL 1QR1B 3ARGB 1UB6B 1LQSR 3IU3A 4YDIH 5DSCB 3R1GH 1CLOL 3QEHB 1T2XA 1X5KA 5E1AB 3LEYH 4NSKB 3SGEH 1IEHA 1MCCA 3OG6B 2KH2B 3GJFH 4ODSL 1XGRA 1A0QL 4BFIA 4L4VE 1HNGA 3UJTL 1WBZB 3TIEA 4FQHA 4TOYL 5HGDA 4NJAH 1JPTH 3UEZA 1N0XH 1RJYA 3WIHH 4NNPH 1YY9C 4JHAL 3VXMB 4HPOH 1A6TB 1DUYB 1OAYL 3L3HB 5FKAB 4PRHA 3PV6B 3E6HB 4APQA 1S7WA 1KB5A 1HSAA 4CBPA 1D9KA 1CTNA 1IM3A 5KTEL 3OV6A 2FDBP 4NWTH 2IPKB 4OZGB 1IGYA 2C1OA 2APFA 4JFOA 3RWEB 3U46B 4G5ZH 2XQBH 5F9OH 1J86A 4V1DE 2XPGB 1QRNE 1GOHA 1BMGA 5C07A 4JRXB 3VG0H 1G6RH 4PGJA 1CDBA 2EDOA 3LH2H 4AT6B 1F11A 4JCLA 1HIMH 3H3KA 1L9MA 4GXVH 2ADGA 4N1CA 3MRMA 5DGQA 5GGSA 4PJ9B 3LD8B 2X1XR 4TN9A 3TO4D 4N5UA 3OJ2C 4H0IA 5A40E 5J7CC 1JTPA 4G6JH 3SKUD 3ZYIA 5DJAB 1JGLH 1WZLA 2EC9U 2RJMA 5D6DC 5FCSH 3SCMC 2FO4B 3AREC 3ARWA 3RTQD 5KVMC 1QR1A 3ARGA 1KXTB 1Z0MA 2MPAL 4OCYL 5DSCA 1NLBH 3QEHA 4DGIL 5E1AA 4HUWB 4NSKA 5ALBL 3NPSC 4R97C 2ZOLB 5F6HJ 3VMNA 5LWYL 2GJ6D 1WBZA 1YPZE 5DTFB 5F7UA 2NMSA 1BFVL 1OTSD 4XNYL 5C0BE 3G04B 1A6TA 1IM9B 1DUYA 3L3HA 3BAEH 3PV6A 3E6HA 3ZT5A 3JV5A 4ZNEE 1MCPL 4XT1C 4JM4H 5TPWH 2GJZB 3MRFB 2ESVB 4LGSB 2VRAA 2IPKA 2YR3A 4LQFH 4OZGA 4RIRB 3OMZA 1FDLH 4QTIL 3RWEA 3DARA 3EYSL 3K74B 3U46A 3A67L 2HT4D 2EDLA 2GSIB 2XPGA 5FM4A 3WN5C 4JRXA 2RHEA 4UQ3A 3WD5H 2DIAA 5EOCH 2DLHA 4AT6A 4OGYH 5C0JB 4WEBH 1C5CL 1JMXA 4M93B 5MEQB 3KLHD 4WI3A 1FNGA 4XH2B 4K9EC 2DKUA 1YPZF 3ELAT 2FJGB 3OSKA 3VH8G 1LO4H 1HKLL 3K8MA 5DJAA 4BSVB 1FHGA 5GZOD 5FA4A 1BJ1H 2FO4A 4LU5H 5EUKB 2XWTB 1BEYH 1UH4A 4YXHL 4HUWA 2HVJB 1CLYH 1F6AB 5L8LB 2VN7A 2ZOLA 1GC1H 4EZMA 5BZWB 5TF0A 1OTTC 3H7BB 4UV4L 5DTFA 1BFSA 3HPJB 5JW3L 2DWDB 4WO4B 4KJWC 4QRRA 5C1MB 3G04A 1RU9L 3GBNL 1JRHI 2F8OA 3P0YH 4ZS7L 5CEZE 3EDEA 5DK2B 2A9NH 4RBPH 4IDJH 3DGCR 2GJZA 3MRFA 2ESVA 4RIRA 1GC1C 3N50A 5J3HD 4YDVB 2VDKL 3DYOA 3MA7B 5I71C 4XNXH 1B4RA 4KKNA 3ZTNL 3DLQR 2GSIA 3WUZA 4X8XA 1XCTB 4LLVB 1ADQA 4JPKL 2XWBA 4IMKA 5C0JA 4NJ9L 4JREC 1EAPB 4J3OC 5MEQA 3FRPA 4XH2A 1S9XB 3SY0B 1SEBB 1GGCL 1TJGH 2FJGA 5F9AC 3V8OA 3WFDL 1TQCB 4BSVA 3LKNB 3ZZ1A 4LIQH 4TRPL 4L3EB 4C56B 4HW6A 4H8WL 2AQ3A 4F15B 2ENYA 3DI3B 1F6AA 1LD9B 1BFOA 4UZGA 1G1CA 4XB8A 4PJEE 4K8RC 3DJ9A 1RUQL 4LHUD 4KRLB 2IG2L 3LHPL 3HAEG 2HFGH 2C1PB 3HPJA 1WZKA 2F15A 4NT6B 3RGVA 2BVTA 2DWDA 5IBTH 5I8EB 3S88L 1I9JH 2WINB 5C0FB 5HVFB 1H3GA 5DK2A 3KLAB 3TZVD 4GSDH 5EN2B 5CZVL 4Z7OE 2V2XB 5M7QA 1LP9B 5LGKA 3PWPB 1JGUL 3ECBB 2XA8H 4JQIL 4YDVA 4QHLB 3MA7A 2J6EL 3I02B 3QO1B 4X6CB 2GJ6E 2WWKO 5ANME 1MFEH 1XCTA 3WNKA 2ORBH 4LLVA 1MCIA 2JJWA 4HUVB 4ZUUB 1DFBL 1BF8A 4FNLL 1EAPA 4LPUA 1JZ8A 4PJEF 5GHWH 3D87B 1ZLSL 1S9XA 3KVQA 15C8H 1SEBA 2Z31C 4OSUH 3LKNA 4WTWA 4X5LA 2M8XA 4GG6E 2BC4B 3RDTB 3DOSA 1NBQA 4L3EA 4C56A 1P5UA 2P5ED 4LEXH 3S34L 3UTQB 3MGTB 1C7TA 1VB9A 1L7TL 1LD9A 1HH9B 5DC4B 1CICC 4R3SA 4Z7OF 1WZ1L 2LAAA 3MRKB 4I18C 4IBLT 4JQVA 1S7SB 4QCIB 2H2PD 3W0WD 2C1PA 2FD6L 2I60L 4FZEL 4N5EC 4NT6A 2C3XA 4CN1A 3OXSB 3QRFM 2DQEH 1EEUA 4OFYD 5I8EA 1IQDA 5TDOB 3BO8B 1JN6B 3LQZB 5JHDD 5CEXB 2WINA 1T7WA 3FMGL 5C0FA 3C09C 4PB0L 4UOW0 3KLAA 1BM3L 4WI2A 5CD5D 5EN2A 1DCLA 1J9CT 2V2XA 3LS4H 2DI8A 4IRJC 3ECBA 2FATL 4HS8H 3U83A 4GH7B 1CR9L 1BAFL 4QHLA 4JFXB 1KCSH 3O81A 2A74B 1DBMH 3I02A 1MHCB 4X6CA 4G3YH 5KVEL 2PKDA 4YHLL 3NGBB 4GG6F 2YD1A 1FSKB 2NY3B 3P73B 3BUYB 4LSUL 4BQ6A 1GXEA 2JELH 1F90L 5JDJA 4HUVA 4ZUUA 3SDAD 4NN5B 1CLCA 2NXZC 2UZXB 4JG1L 4O2CB 4DZBB 2ED7A 5HVHC 5CJBA 1FCCA 4IIQB 4MNGB 4LFHG 3UDWC 1S5IL 4R90H 3QCVL 4N8VG 2P44B 2HTLD 4FHBD 3FFDB 1KTDB 3JWDL 2X4NA 1IAOA 1UGNA 4O9HH 4GQ9L 3BWAB 3P4MB 2HWZH 2FECI 5SWSB 1NCNA 3UTQA 5IHBA 1HH9A 1ZANH 5SX4H 4ONHB 2ATPA 4KK6D 2ZUUA 2KL6A 1S7SA 4OM0H 4QCIA 3QEQD 3QEUB 1KCVL 4WU5A 1XZ0B 3OXSA 1DBJL 3D9AH 2JJSA 5TDOA 1JN6A 4OCNC 3A6OA 3LQZA 5FA3B 5CEXA 1K6QL 2Y5TA 4LLWB 2VXQH 1FLRH 1Q72H 4HLZG 3MJGX 4TQEL 1J0YA 1UZ8A 5BS0A 3KPSB 4HK3N 3UTOA 1FG9C 4R0LC 2ZUQB 1YA5A 3F8UB 3QEGL 3MX0A 4JFXA 2A74A 1MHCA 1RZKL 1CFTB 3EDJA 1F4YH 5IVXB 1U42A 5FDYA 1LGVA 4GS7B 4LOUD 2FB4H 1E6JH 3P73A 3BUYA 3BHBB 3B8YA 4O2CA 4U1SB 2HKHH 4DZBA 2IANB 4NO3B 1OP3H 3V52H 3MMEB 4PB9L 1HHIB 2ZOKB 2AABH 4IIQA 4MNGA 3ILPB 1PFCA 5DQDH 4NIKB 1MRCL 3OAYK 5DMGD 3SCMD 1FH5H 1VADB 3FFDA 1KTDA 1J7VR 3QPXL 4ZAKB 3NACH 1JNNH 3BWAA 4NOFA 4WHDA 3W5NA 4HJJL 1ZLVH 5SWSA 1J8KA 3G9VA 2EDDA 3B9VA 1CXLA 4JE4B 4X4ZA 3BSZH 2HP4A 3E0GA 4ONHA 3VDCA 1F8TH 1A6UH 4HWEH 4ZFGL 4HFWB 5GJTL 4KY1H 3QEUA 3LVEA 3TYGH 1XZ0A 5F7FA 5J6HB 3Q3GB 1A7OH 4ELMA 5FA3A 3QQ3B 4LLWA 2FRGP 4NWUH 3QYCA 1ZT1A 2YSSB 5HSFA 3KPSA 4K3DL 2FH6A 3TT1L 4FQIH 4X9IA 1ZLVK 1H3PH 2IWGA 3H3PH 2VXVH 4E0RB 3MLTB 4LHJB 3VD7A 1MIEL 3SQBA 4G9FA 4X7FC 5IVXA 1F13A 3T4AB 1JYXA 5TDPA 3O0RH 3W0WE 3IXAB 4I2XE 5FO8B 3HFML 3BHBA 5B4MC 1OSPH 2EZ0C 5JHDE 1V3MA 4NBZB 3I75B 2IANA 3CU1A 1QFUH 3MMEA 1EEYA 4U6HB 1P69B 4M61B 1HHIA 2ZOKA 4EUPH 4LSQH 3ILPA 3IVKB 2YA0A 1JRHL 2MOVA 3UJJH 5DVMA 5IEHB 1VADA 5CIPH 3NA9H 4KKCC 4NKOB 4ZAKA 4YWGH 4YHML 4G6AC 5C9KA 5ABDE 4NN7C 5ENWB 5E99L 2LU7A 2QHLA 3KPLA 5IROA 3VFTB 3G6JB 3FTGB 4ZPTB 2NQCA 1GGBL 2AV1B 4YHOL 4HFWA 3BI9X 1LO0L 1FL6B 2IFFH 3F5WB 5AAMA 1V7NL 5CGMA 4XAKE 3C6LD 4XNUL 5EZIH 2XZZA 4KJWD 5E2UH 4BK5A 5J6HA 5L2KD 1VCAA 5FHBH 3P2TA 3QQ3A 4Z7VE 1UM6L 2R2EB 3VI3E 1T04B 3L3IA 5EFIB 5A16B 2YSSA 5ACMA 1XF2A 4NC1E 4JY6B 1E4WH 4QRUB 1Q0YL 3GK8L 3KGRA 1T2QH 2E6JA 4Q2ZB 4OKVB 1G7PA 4TNVF 5JPNB 4XCCL 4H26B 3KWWA 3F6IA 3UX9B 2J5LC 3T4AA 3QEQE 1B4JL 1DLFL 3HR6A 1UWGH 3OB0H 3IXAA 5EO9B 5FO8A 4LDLB 4YDKL 3INUH 1IC7L 4U4BA 4U05A 3JTSB 4FABL 3S36H 5D2LE 3I75A 1WAAE 1E27A 4Z0XB 3IRZA 1TQBB 4LCCA 4OLYL 3NZHL 4QLRA 1IT9L 1R5WA 3GIZH 4PLOB 4PG2A 4HFUH 2NYYC 4NKOA 2E9WA 5IJVA 2H6PB 2BSED 4Z7VF 3RGHA 5ENWA 3VI3F 2F8XC 3VFTA 4P3DA 3G6JA 4H1LH 2IBGA 3VDBA 3JVGC 5IKCA 3B3IB 4RRPA 4GMSH 5D1QC 3FTGA 4K8RD 3QA3B 4XP4H 2AV1A 2YK1H 5HVWA 1KENL 3OB0K 1FL6A 2NX5B 3F5WA 5IHUL 1XFPA 1YEEL 1FFOB 1CLZL 2JJUA 4UOW1 1LO3L 5IFHH 4MB3A 5I9QC 1T04A 4WFED 2F5BL 4RDQF 4Y89A 1IGFL 5A16A 2WBJC 1FPTH 5TE4L 4JY6A 5D2LF 2JIXB 1S8DB 1WAAF 3SDXE 4UNVA 5J56B 3VWJC 4DK6A 4Q2ZA 1EBAA 3S36X 4OKVA 5FYJL 1OPGL 2DM4A 4X4MA 2QHRL 3PGFL 1UA6H 1DQDH 4H26A 1MVUA 2EDTA 3KPMB 2Q7NA 5EO9A 5H8DA 1BQLL 4WFGD 4CU7A 1YEKH 4ODUB 4KK9C 3JTSA 3VXSD 3MUGB 3IB4A 1IKNA 4X9HA 5FYJU 4Z0XA 1AKJD 1WITA 1OLLA 2V7NB 3FFCD 2Z31D 5A2FA 3G5YB 4NOBA 4OGXH 3B83A 3QWOB 4KUZL 1MJJB 4FMKA 5D7IB 3RY6A 1YECH 4OLEA 1U8MB 1Q1JH 3RZWA 3T1WA 3QT2A 3BPLB 2H6PA 4Q9QH 4WHYH 4QHMB 5FYKE 5DR5H 1WVZA 3B3IA 5J0BA 5EU6E 5ICZB 4PJ7B 3QA3A 5JHLL 3SDXF 4R8WL 2EKJA 2NX5A 3CSPA 4N5ED 4HXAL 4HWUA 1FFOA 2Q8AH 3DMMB 3T2OA 3ZE2E 3QIBC 1U8QB 1L9NA 3TM6A 4RAVA 1GGIH 4EN3C 4HD9A 3TJHC 3QNZB 2LU4A 2JK5B 1XIWB 3U30C 4UIKH 1PZUB 3LCYA 2MQ0A 2JIXA 1S8DA 4UT9H 3RHWF 3BRDA 4NBYB 5ACLA 3QCTH 2AK1L 1MJ8H 2MCPH 4KU1A 3IKCB 1AJ7L 2FECL 1HINH 1DBAL 3RWFB 3E3QC 3KPMA 5E95B 4NFCA 5T5NF 5H37G 5L2KE 4OIAA 2BHYA 1MVFA 4JO4L 5FGSA 4ODUA 2AXJA 1KYOJ 2J7LA 4JZOB 3MUGA 3N06B 1JGEA 3MV01 5IW6B 3ARDB 1IC4L 4DGYH 1QSED 2V7NA 4DOHE 4HEPG 1BP3B 4AIXA 3G5YA 3DVFA 2DF3A 5T3XH 3ZYOA 3MCKB 1GH7A 2QQNH 1MJJA 3RPKA 3ZE2F 1MCHA 1D6EA 4Z18A 2E3VA 1U8MA 2W9EL 2Z35B 2Y06H 4Y16C 4U0RC 1K3ZA 4Y4KD 5ICZA 1FZOA 4PJ7A 4ZTPL 1CE6B 5L2JB 1RZFL 5HDQH 3GMLB 2OJZH 4K7FB 3DMMA 5TFSL 4EEEA 1U8QA 4L4TD 2ITCB 2YRPA 5BV7L 3Q6FB 3U4BH 4M62H 3QNZA 4N8CL 3QJHA 5DC0A 4HG4K 4OLVH 3L95A 4KK5C 3IFPB 3VWKC 3PWNB 3BISA 4G43B 3UYOD 5GS1C 5GRVL 1S9YB 3IKCA 2VB5A 3SE3C 3F7PC 2B2XH 4GQPH 1YQVH 32C2B 5BV7B 1AY1L 3RWFA 4MGXA 4ODTH 4IRSC 1PYWB 2AJYL 3GI8H 5J11C 4JZOA 4U1LB 5KZCD 4E9LA 1GIGL 5IW6A 3ARDA 4WFEE 1BWWA 4FQCL 2XQYK 3MFGB 3R4DA 3DO3A 3MCKA 4X6DB 3L1OL 4OJFH 3V7AE 5FDWB 4G6KL 2OI9C 3S96B 1TPXB 5DZLA 4I13B 2DWEB 2NPLX 2V17L 2K7PA 2QADB 3TBSB 2YRLA 4XAWL 4JDTL 5B38A 2PW2B 4ZQKB 4WFGE 1CE6A 5BRZA 5L2JA 1D3CA 3BE1H 4NQCD 4NM8L 4UOJA 3VXSE 1YMMB 2VNCA 4FRWA 2DQTH 4K7FA 3WNPA 1QBMH 3FFCE 4LCUB 4NPYA 2ITCA 4XMLL 5F6IB 5CJ5A 1I9IH 3Q6FA 3RAJL 1KJ2L 2QKIB 1X9QA 5DT1H 1CF8L 1NCWH 3VD9A 4OBRA 3IFPA 3M07A 2NY7H 3AM8A 1YEHL 3DVGB 3PWNA 4M1DH 2B1AL 4MCZA 4G43A 1S9YA 5CD3A 1JGDB 32C2A 4L4VB 12E8H 1KJ2B 1PYWA 5IB5B 5E2VL 1YUHB 2ID5A 5IP4A 2SEBA 5B4MD 4YGVB 2YZ1A 4OCRL 3S3JA 3D2UB 4LGPB 4U1LA 5J1SC 4W4OC 2BY1A 4M5YH 4F37K 1I3RB 1CU4L 1KLUB 4X6DA 5DUML 2BERA 3V5DB 1TITA 4KKCD 1MAMH 4P2YA 4G6AD 1B0RB 1ULVA 5FDWA 3S96A 5L9DL 2DWEA 4U0QB 2FBOJ 3D18B 1BQHG 3BKCH 4TUOB 4NQXB 2F58H 5GJSH 4V1DB 1QRNB 3CK0H 4ZQKA 3T08A 1U36A 4KAQH 1MLCA 1BREA 1YMMA 2R69H 1M7IA 3ULVD 3DX7B 3WJLC 3VXQB 5JO5B 1QSEE 1AD0B 4LCUA 1T7XA 4JFFB 5ITBH 4PJ8C 3LKOB 1U8NB 1N5YL 5EPMB 1CDIA 5HBBA 2QKIA 2RCSH 4KMQA 1A7NL 2HRLA 1AR1C 4D3CH 5FB8B 4K3EH 3OZ9H 3DVGA 4IMLB 5M94B 2YD9A 3U2SA 4P99A 4NUGH 3IXTB 1J1XL 4WV1C 1FO0H 2PTVA 1ES0B 2YWZA 2FGWL 1JGDA 4L4VA 3ZSTA 3BEVB 4L8SB 4NO0B 1OP5H 3EOTH 1IARB 1YEIH 2IPTH 5C9JB 2AI0H 1YUHA 1B6UA 1IMHC 2PO6D 1BJ8A 3D2UA 4L4TE 2NZ9C 1B90A 3KLSA 3G6AB 5ILTL 1F5WA 3LKQB 3IJYA 3RX7A 4O4YH 1I3RA 1KLUA 5TQ2H 3V5DA 3LPGA 2NYYD 3P9MB 1B0RA 2QQQA 5DZNA 4GRWE 4C57C 2VLKB 3D18A 4KFZC 4NQXA 2Q6WB 2HMIC 2X9WA 3C2SA 3HC4L 3JV4B 4JFZH 4P23C 4V1DA 4Z7UE 3O2WL 5D1QD 1QRNA 1T83A 1LDPH 3BKYL 1N6QH 3KR3L 3HG1D 1F6FB 1T89C 4CDGC 4PD4J 4GT7A 3U0WL 3UYRL 1BGXH 5B3NA 3DX7A 3FB6A 3VXQA 5JO5A 4Y1AA 4DZ8B 1AD0A 4O02L 5D1ZB 4JFFA 2X40A 3LKOA 1NMAH 1U8NA 4OF3A 5EPMA 4XP5H 4TYUA 4HXBH 3T09A 3BT2H 3U7WH 5C7XH 3B2VH 2W59A 4UTBL 1DBKH 5HDBE 2GW5A 5I18H 3MODH 5FB8A 3U7AA 7CGTA 3QDGB 4CJ0A 2E7CA 5CEZL 2FHCA 4I3RL 3IXTA 4Y7MA 3UZVB 5J8OA 1ES0A 2EXYC 4F8QA 3GEWB 3BEVA 4NO0A 2FX7L 3LMJL 4JZNB 5E70A 4J1UB 1XGTB 2I24N 3EYQD 5JZ7C 4NQCE 3WJJC 2OZ4L 4LP5A 4GRWF 4Z7UF 3ROOA 1EO8L 2DBLL 5EU7E 1NC2B 5D7JB 4KRPD 3DGGB 2I9TB 4KZEH 3LKQA 1DR9A 2DYPB 4QTHB 5DURB 5E8DL 3P9MA 4KDVA 2ZUYA 3VRJB 3MLXL 4WHYG 2PXYC 5B39G 1EMTH 2VLKA 4NRYB 1C08B 3JV4A 1ZT4B 2A2QT 1MCQA 5HDBF 5CCKH 1D5BB 2PF6A 2QBWA 5GRUL 3SKMB 1MIMH 4HJ0C 5AZEH 2P24B 3AU1B 1MREL 2ARJA 2O5XL 2R0KH 4PGCB 3QIBD 4DZ8A 1INDH 2OP4H 5D1ZA 1H0DB 3L5XH 4C58B 4EDWL 3OG4B 4M6NH 2CDGB 2MWCA 1U92B 4BELD 3EYOB 4G8IB 5KVGH 3ILQD 4FQJL 4X7CC 1OD9A 3QDGA 1TTFA 1LK3H 3T0EC 1SEQH 4Q9BA 3GHBH 5I6XB 4PJEB 2R56H 1MCLA 3CMGA 4M6OH 2BCKB 4JZNA 4J1UA 1XGTA 3CVHA 3MXVH 3ULVE 1IAII 1TJHL 3T65B 4JB9L 3U4EB 1SQ2N 2PR4H 5F7HA 1NC2A 5D7JA 3PWVB 1Z5LB 3DGGA 2I9TA 5DMIL 3RTQB 2DYPA 3RVWD 4QTHA 4PJIE 3FO9B 1EGJL 3VRJA 4R4FL 5EO0B 2VQ1B 3VXRB 4KJYB 4EBQH 4HT1L 4NRYA 3UO1L 1C08A 3V6FB 1Q94B 4IRZL 5C70A 2EIZB 1ZT4A 5E6IB 3LKRB 1IQWH 5ANMB 1AQKH 3X3FH 1EHNA 1D5BA 3BH9A 5E08H 3SKMA 4GRLC 2P24A 3AU1A 2Z4QB 2F8VA 4PGCA 4JFPB 5LBSH 1N64L 5TF1L 4NQDD 3H9YA 5KG9A 4JVWA 1IGCH 1H0DA 3JUYA 3ZKNC 3IDJB 4XC3H 5C92A 2C7UA 3QHZL 3ULVF 2A1WL 3WE6B 1FBIH 4HUKB 4BSWB 5LJYH 4XNZC 1LE5A 5CGTA 1U92A 3NPZB 3EYOA 4U1HB 4G8IA 3R0MA 2BX5A 3EUUA 1T21B 3QUML 2GSGB 3HG1E 4HZAA 2BCKA 4PJIF 4IRSD 3S37H 3U9PH 1PSKL 4BH8B 4Z95L 3TT3H 2XZCL 4AIZB 3T65A 3U4EA 4OTXL 4PRPD 4X98B 4OZFH 3PWVA 4FQPA 5IGXH 4I1NB 3LEXB 1Z5LA 4F7CA 4HWBL 3RTQA 1RD6A 4YHKL 2CMRL 3MRQB 3HRZB 3OGCB 1LVEA 4K71B 3D69B 3RX5A 3FO9A 3QCUL 3NMEA 5EO0A 1X6NA 2VQ1A 3VXRA 2DDQH 3V6FA 1Q94A 1EAJA 2EIZA 2KBGA 5E6IA 3LKRA 5C2UB 5ANMA 2OLDA 2VLRD 1Q9WB 1UM5H 4RGNC 2WNGA 4JPIB 4OUUB 1A7QH 4A6YH 4LRNL 1B9ZA 5GGRB 2QSCH 3O9WD 3B9KC 4JFPA 1CWVA 3NABH 2ADJB 4HC1A 5FGBC 5T1MB 2EC9T 5D2NA 4QXGH 1HXMB 1W72L 3IDJA 3GBMH 2VLJD 5H94B 35C8H 4Z6AT 4MDIA 4N0UB 1UYWL 4QRQB 3WE6A 1A6WL 4ORGB 1XGQB 4BSWA 3BP6B 4BYHA 3S37X 1TZGH 4YUEH 4ZFFA 4U1HA 3ISWA 1K3IA 3HRPA 4MAYB 5TGBB 5GXBB 1T21A 5BO1L 3ARXA 5E8NB 2WP3T 3QG6B 2Z8RA 2EH8H 3DUUA 2XV6B 1V8HA 3FQUB 2MHAB 1RZ7H 1T1XB 4BH8A 1T5XB 1TLKA 1J05B 3W81A 5E5UB 3QUZA 4AIZA 3JV6B 1TETL 2ZJSH 3QP3A 4AL8H 2NW3B 2A77H 1KB5H 3Q6GL 5JXEA 1HE7A 4Z9KB 2FO1A 1YEJH 4X98A 5EUOE 3LEXA 3CH8A 2N7BA 4H88H 2Z91B 1MWAL 1NAML 3EW3B 5HD8C 1U2HA 3HRZA 3OGCA 3D69A 5C0DB 5SX5K 5KVFL 4J3SA 1U8HB 1WT5A 4ODVH 3THMH 4DUVA 4RFEB 1M7DB 4OLWH 2HKFH 3MUY1 3E3QE 3FCTB 4LHUB 4APQC 3ARZA 1Q9WA 2G5BB 3C5JB 1N8ZB 4I3GA 1D9KC 4WUKL 5F70A 2P8LB 4JPIA 4OUUA 1CXFA 5JXAH 2QSVA 2ADJA 1S7TA 3TZVB 4PJ8D 1HXMA 3VXTB 1Q0XH 3OL2A 4N0UA 4QRQA 1OT1A 4ORGA 3WNNA 1XGQA 5FUCC 5ID0B 3V4VH 3EHBC 3BOVA 5HJ3B 3Q1SL 4MAYA 5TGBA 5DRZB 5E9DD 3GO1L 5EUOF 2NY6D 4W81A 5E8NA 4Y4HA 3QG6A 4J3TA 2ADFL 1YZZA 4JDVB 1MEXH 1J1OH 3FQUA 2MHAA 3BN9C 3U7YH 5I1KL 5FO9B 4POZC 1NLDL 1T1XA 4HIEA 1T5XA 1I8MB 4TSBL 1J05A 4IS6B 4NQDE 4P5TD 1R3KB 3OKEA 3JV6A 2B1HH 3ARGC 2BVPB 2NW3A 1M7XA 1UG9A 1OB1B 1A0QH 4LPXA 3RP1A 1NCBL 3UJTH 2WUBL 3LIZH 3DVIA 2Z91A 1SY6A 5A43C 4YAQB 1NGPH 4JHAH 5C0DA 1MFNA 5TE6L 1OAYH 2K3TA 1U8HA 4KTYA 4BJLA 5B38G 4RFEA 1M7DA 4P46D 2OXGA 2XG5A 4KHXL 1A9EB 3FCTA 4LHUA 3GMNB 5KTEH 4NCC2 2R9HD 3PDGA 4I2XB 1N8ZA 1FP5A 2P8LA 2LABA 4D8PB 2EE6A 2NLJB 4MWFB 3NVQA 3GSNL 1IVLA 4PRPE 4ZTOL 4OI9A 1MFDH 1JMZA 2VSCA 3LRHA 4Y88A 4PJ5D 3TZVA 3VXTA 4LP4A 5EOCJ 2VLLB 1A3RL 2D7QA 4KK8C 2W38A 3IJHB 5ID0A 2E9JA 3B5TA 5HJ3A 4OF6A 2XXCB 4JPWL 5DRZA 2HH0L 3QUYD 4K3JH 1CYGA 5DRXB 3GSNB 5IR1B 2NY0B 4HEME 4PJ9C 3LD8C 2VLRE 1BJ1J 1FGVL 2CGRL 4JDVA 2P8PB 4KQ3L 5GGQL 2EH7L 1Q9KA 5FO9A 1CIDA 4NKIL 5IQ7L 3WFCL 4MJ5B 2FIRT 4GG8B 4OCYH 3TCLB 2H2SC 4RWYH 1OAQL 1I8MA 3KLDA 4IS6A 1R3KA 2BVPA 5ALBH 5CBAB 2VLJE 5E03A 5LWYH 3DRTB 5MEPB 2H32A 4XMPL 1I1YA 4XHJC 4XNYH 4YAQA 3IDGB 3GUTB 4JFED 4U1MB 3MNZB 3LEYL 2VE6B 4ONGL 1A9EA 4Q9CA 5HYJE 5TE7L 3GMNA 2Z9TA 1ZAGA 2IPUG 2GI7A 1N0XL 4Q6IB 3WIHL 3N1GC 4D8PA 3GB7B 5D2LB 1M71B 2NLJA 4MWFA 4PR5B 3EYSH 3A67H 3D39D 3FT4A 3GKZA 1IAIL 1N5AB 4CDHA 4JR9H 1Z0NA 2VLLA 2FX9L 1ZEAH 4NWTL 1C5CH 4FXLA 2H1PL 2V6HA 4U6XA 4MJ6B 3P0VL 1AI1L 5SX4I 1UFUA 3KDMB 3T0ED 4RMQA 5IR1A 2Y7QB 3H9HB 3GSNA 4M93C 3QULB 1EUUA 1NDGA 1HKLH 5F9OL 5FCUL 2P8PA 3NCMA 2YUWA 4PLKC 5KVDH 3VG0L 1G6RL 5EOQL 4FFZL 4MJ5A 2RIKA 4GG8A 4ODBD 2CDFA 3TCLA 2FR4B 1IGIH 4GXVL 4K7PY 5EA0H 2DKSA 1RJCA 3GM8A 5CBAA 5C0CD 5MEPA 4GKZB 4X0KB 3QDMB 4XPHH 4UV4H 4CRPA 4M8QB 5JW3H 1DP0A 3SDXB 5E9DE 3ULUH 3IDGA 1PDKA 3GUTA 4GXUN 3RGVC 4ZS7H 3RL1A 4WO4C 3MNZA 3PHQB 3MRPA 2BOCB 3FO1B 5KAQG 1W0YT 4M02A 4NKDB 1T5WB 4R2GD 4WI8A 3OGOE 5CILL 4Q6IA 2VDKH 3GB7A 5D2LA 4PR5A 1WAAA 5A2KH 2R1WB 3PWJB 4MX7A 3DX6A 3ZTNH 3RWIB 3ULUC 1N5AA 3SKNB 1PKOA 1CIUA 2CO7B 5D7KD 5FOJA 5DO2D 4GO6B 4KTEH 4FXKB 3WMSA 2B5IB 1WTLA 4LQFL 4K9EL 3M1BB 1OLZA 4MJ6A 4HBCH 1SM3L 3KDMA 3KHOA 3H9HA 3QULA 1GGCH 5EU6B 1KELH 2P46B 4FFWC 5L8JB 2P5WD 1TQCC 5EOCL 2FR4A 5IOPB 4H8WH 1XH3B 2BHZA 4UNTA 4Y5YB 4PJ5E 2P4AB 4S11A 2ZSVB 4OZFG 5ADOH 4GKZA 1RY7B 4X0KA 3QDMA 5E5MB 1LO4L 2B20A 1MAKA 2IG2H 3LHPH 1DQQB 4M8QA 3TO2B 5K9JL 1JWSB 3SDXA 4JQVC 2YUVA 4AJ0A 3S88H 3RA7L 3SHSA 3WHE0 3IAQA 3ULSB 4E5XB 1QG3A 3PHSA 3UZQA 5E00B 1QHPA 3PHQA 2RB8A 2BOCA 3FO1A 1GC1L 4NKDA 1T5WA 4KMLB 1VGKB 3C6LB 1M6OB 2F5AH 5L2KB 5D5ME 2ARWA 4PJAB 5C0ND 3OKLB 3B9KD 4JDZB 2J6EH 3F58H 2F54B 2R1WA 3PWJA 4F9PA 2P47B 4X5XB 4KVNH 3RWIA 3SKNA 2A9NL 3BYTA 3CFJB 4IDJL 2XA3A 4PP2B 4JFEE 1AIFB 1DFBH 3M1BA 4LPVA 1VPOL 4YIQB 4OGAD 1WICA 4KKAD 4L8DA 2D7NA 1JF1A 4WHCA 1QFHA 5EU6A 3UTSD 1RZ8B 1FE8H 4FFYH 3KPOB 3MYZA 5DJXA 5IOPA 3HNVH 3D39E 3S34H 1XH3A 4Y5YA 4K8RL 1J5OL 1LEKB 5DEGB 3RWHB 5E0QA 1WZ1H 5CJOH 1TJGL 1VKXB 5E5MA 3C8HA 2R8SL 1A5FH 5D5MF 5HD8D 3QUXB 4XP9L 1ZHBB 4MQ7B 2I60H 1DQQA 4FZEH 3TO2A 4LIQL 3BP7B 3T0EE 4JO1H 3OR7B 4E5XA 3ULSA 1TENA 3FMGH 3HMXL 4PB0H 1I7TB 1JHLL 5E00A 2JJSC 5AWNL 1BM3H 3HZKB 1T7YA 4PRHD 3X17A 5DFTA 5C6PB 3C6LA 5DD0H 1M6OA 2YOCA 4LPCA 5L2KA 2FATH 3TH2T 4PJAA 2YD5A 5IBTL 3OKLA 2OK0H 4JDZA 5K9KB 1NEZG 3PXJA 2F54A 1N7ML 5C0CE 4MA7L 3LB6D 4C54A 1MY7A 2VZOA 4YHLH 3WDIA 5INDB 2QR0A 1ED3B 4PGBB 4ZSOE 3CFJA 2C9AA 3NGBC 5C07D 4ESKA 1X5AA 2VXUH 4PP2A 1FSKC 1AIFA 4JFHD 2NY3C 3GSVB 3WS6A 4H5SB 4GJTB 2DM7A 1I9RH 4YIQA 4NN5C 1QQDB 1S5IH 1X5XA 3ZMRA 3QCVH 3VFPB 3BN9D 2FH8A 1MFEL 4IIQC 1RZ8A 2ORBL 3JWDH 4POZD 2DLTA 1XGPA 2BY2A 3QPQC 3KPOA 2J8UE 3QFDB 1U93B 1HNFA 3QXTA 1LEKA 5D7KE 5DEGA 4PRAB 4XBPB 4MXQD 4PGEB 1VKXA 3BD5A 3QUXA 1ZHBA 4S1QL 2YC1B 1WISA 1KCVH 1KN2L 4O58L 3U1SH 3BP7A 1DBJH 4ZYKA 2BP3A 3OR7A 3TNMA 2XWJB 4LEXL 1I7TA 3HZKA 3CFDB 3HLAB 5F1IA 3S5LG 4C4KT 4TNWK 2P5WE 1ZHLB 3SDYL 4Q9RL 2EDYA 1II4E 4OF0A 3RNKB 3HUJE 5D70H 5K9OB 2DQEL 5K9KA 4Z76B 2ZUQC 2NY5H 3SO5A 3EJZC 4JJHA 2X70B 2VABB 3D0VA 5ELIA 2RBLA 5INDA 5KSBE 4I48B 2VDRL 2J8UF 4PGBA 1G6VK 3N9GH 1JZ4A 4KK8D 3HHRB 3MROB 4JRXD 1YN7B 3FHQA 1J11A 1CFNB 3G9AB 4GS7C 3GSVA 4H5SA 4OLUL 4F33B 1CFVL 1EDQA 4F7TB 2J2ZA 4RFNB 4PJHE 3O41B 4QWWC 5GGUB 3L7EB 4ALAH 1MOEA 4G3YL 1MRCH 3VFPA 3CH1B 1BBJA 2NY5C 3DBXB 3QPXH 25C8L 3QFDA 2R2CA 1U93A 2GAZB 4ZAKC 1WZMA 4G9DB 1QSEB 4XGZA 3WSQL 2OTWB 4DN3L 5IROC 4XBPA 4FXGB 4ZFGH 3L3KB 5GJTH 4NZDA 4R90L 2C5DC 1HWHB 3HUJF 4XHJD 2YC1A 3DSFL 2PYED 4O9HL 4PJFE 4Y4KB 5I75B 4QRRD 2XWJA 5EZOL 1CL7H 5KSBF 3UTSE 2I27N 3CFDA 3HLAA 3OBAA 1ZANL 3BMWA 2HFEB 1E4XL 1REIA 4K3DH 1ZHLA 4OM0L 4YDJB 2HG5B 3PHOB 1MJUH 3TT1H 5DDHA 4PJHF 3JWNC 3RNKA 4GBXD 4L4TB 4U1IB 5K9OA 3L3GB 1J8HD 4XWOD 4U3XA 4Z76A 1MIEH 3K4AA 2DQCL 2X70A 2VABA 3TWCH 1FLRL 2JCCB 5LXGL 1Q72L 4I48A 3UZEA 2ADIB 3HFMH 2PETA 2YEZB 2GY5A 3QXAB 1YN7A 1CFNA 1TNMA 5BXFA 4YK4B 3ZKXB 3L9RB 4F33A 4F7TA 1GPOL 1J10A 3O41A 4M1GH 4PRHE 4Z7UB 3L7EA 4X4XA 2X4OB 1F4YL 3BH8B 1MCJA 5IB3B 5FHAH 3TBYB 5AYUL 4PG2C 4P2CG 4YHMH 2MKWA 4PJFF 3ARYA 5KZCB 5CZXC 1FN4B 5AG8A 1PVHA 2E8ZA 2GAZA 3QQ9C 4G9DA 2M26A 2GUOB 3V52L 2OTWA 1PY9A 1GGBH 4DVBB 4FXGA 3L3KA 5C07E 1JWMB 1LO0H 2GK2A 1FH5L 4JFHE 4XNUH 4E41D 4TSCL 5C0EB 4IJ3B 3GKWH 3VGEA 1ZVSB 3RGVD 3WBDA 2CUMA 2K7QA 2WMPA 3NCFB 4RZCB 1CXEA 1KF9B 3BSZL 4HBQA 1RJLB 5D6CB 5E4IA 1F8TL 2HFEA 1A6UL 1PJ9A 2FEDC 2HG5A 1Q0YH 3GK8H 1FV1B 3PHOA 4KY1L 1I1AD 3OKNB 3TYGL 1YJDC 4U1IA 5J1TC 3L3GA 4GXUM 2RGSA 3PE9A 3BZDA 1B4JH 1DLFH 2JCCA 4GMTL 1QUNA 4G8GB 3RI5K 2ADIA 4C83B 1MCRA 2YEZA 3QXAA 4YDKH 4FABH 5BOZG 1SJHB 4FQIL 1H3PL 4UILH 3NZHH 1U8JB 1FVEB 1IKNC 2GTZB 2X4OA 3BH8A 4FFWD 1JUFB 5IB3A 3HS0B 3TBYA 4NQVA 2O5ZL 1VEPA 2EDNA 1FN4A 1S9WB 1OSPL 5CJQH 1XF4B 3RY6C 5I1IL 3P3YA 2GUOA 1G7MB 4MQXC 2RQ8A 4BFGA 4FOMA 3CUPB 4LSQL 1ZKAA 4DVBA 1JWMA 4JRXE 5IHUH 3DVNB 5C0EA 1CLZH 1CFQB 3F7QA 3NA9L 4YWGL 1ZVSA 4C4KO 5CLTA 1P6AB 4X83A 1ZS8B 1EJOH 2F5BH 4RZCA 4LHQB 5JW4Q 1RJLA 3CLFL 5D6CA 3T2PA 3PXHA 1FV1A 5EZIL 1FZMB 3OKNA 3U0TB 4PRID 5FYJH 1NL0L 2YHGA 5FHBL 3PGFH 4QOKD 3EAKA 1INQB 2J4WH 3WXWL 2YBRA 2I07B 4WW1A 4G8GA 3LKPB 1BQLH 4PJIB 3CFBB 2PYEE 3FHAA 1ZLWH 4C83A 3BKJH 1E4WL 4QRRE 1SJHA 4E42B 3SE8L 3SPVA 5J06A 1QNZH 2DJUA 4HG4J 1U8JA 5AUMB 2GTZA 2IQ9H 2OJEB 1S7XB 1JUFA 3HS0A 4KUZH 4F7PB 4KI5C 2PO6B 3SBWA 1J8HE 1S9WA 5T5FL 2I9LA 1XF4A 1RULH 2A0LC 2L0DA 1OW0A 4LDEB 5IB1B 5E4EB 5CS7A 3BPLC 1P7HL 4BZ1H 5FM5M 3CUPA 5JHLH 1KN4H 4MJIA 5DJDB 3UBXI 5ITFB 2AEIT 4HXAH 1RVFH 1CFQA 1WIUA 1GGTA 2ILLA 5GGVL 5IG7B 3DMMC 1BIHA 2GK0B 1ZS8A 4GFTB 3HG1B 4LEOB 5I19L 2YRZA 4GMSL 1V3KA 1BZ9B 2ICCA 3ALWA 5BS0D 4KQ4L 5C6TL 1G7LB 1DUZB 3ARVA 4NUJA 3U0TA 1TMCB 1I8LA 3T0XA 1HKFA 4DN4H 1XCQB 3GHEH 1INQA 1DBAH 4OM1H 2APBA 4HKZB 2I07A 4E41E 3LKPA 4PJIA 3CFBA 4JO4H 5L8KB 2NY3D 1A4JA 1SBBA 2ZWLT 5KJRL 4E42A 3EO1A 4X6BB 4U6TA 1CS6A 5B21A 3WIIH 2XRAL 5AUMA 1NCTA 4K3HA 1UA6L 1DQDL 2OJEA 1K85A 3ARDC 1S7XA 5C0GB 3K1KC 2F9BT 3QPQD 2PO6A 5CAYB 1KBGL 4NQSB 1SJXA 2W9EH 1YEKL 3RU8H 2Z93B 4S10A 5SWSD 3RVTC 5IB1A 4KRPB 1WSST 3CD4A 1EXUB 3MOQA 4ZTPH 2ENSA 2YPKB 4IOIB 3C5SB 4JFYB 3L3OB 3LY6A 4JQXA 4MCYB 4W6WB 2XKUA 3RNQB 1YECL 5TFSH 1G7QB 5IG7A 3RKDD 5BV7H 2BRQA 3LSOB 2DD8H 4AENB 3HG1A 1GGUA 4LEOA 4N8CH 1BZ9A 1HYSD 3LEVL 5KW9H 3KPSD 1FGNL 2Q8AL 1DUZA 3C5ZB 2DL9A 4TVPD 3AM8C 3EJZD 1XCQA 2CIIB 3QXVA 3MLYL 5EUOB 2EDEA 3TA3D 2WUCH 1AY1H 4GLRI 3L7FB 4HKZA 4G9FD 1NUFA 4FTVD 1JCKA 1UZ6E 5HGHB 1GIGH 4PBWD 3VGDA 4YH6A 4X6BA 1PW3A 3GMRB 2IAND 1MJ8L 1Z6JT 2MCPL 4FQCH 1HINL 4F9LA 5C0GA 1W0VA 2BSSA 3L1OH 1TZHA 5ADPL 2X42A 5C09E 4PV8A 4NQSA 1V5JA 3MTRA 1T66C 4PRIE 2V17H 4ZAKD 5MP6H 4WWKA 4QOKE 4XAWH 3WL9B 1TPXC 2QADC 3FQRB 1EXUA 4DGYL 3BP4B 3BMVA 3Q5YA 1FIEA 3O6KH 4IOIA 4NM8H 4OCSL 2QQNL 2IH3B 3C5SA 3L3OA 4JFYA 3EO9H 3FN3A 4MCYA 5HYSG 3RNQA 3RVXD 1G7QA 5EWIL 4P2QE 1EEQA 1FAIL 4XMLH 4MQTB 1LK2B 2XFXB 3LSOA 3PWUB 4AENA 1KJ2H 1XMWA 4JPVH 5F3HB 4YO0A 5F6IC 3RWJB 1UZ6F 1CF8H 4M8VA 4F3FB 5HDQL 5D93B 3AMLA 2B1AH 2OJZL 4LCYB 3W9EB 3SKOB 3C5ZA 1F58H 1UCBH 2CIIA 1HXYB 2NNAB 3KPNA 4GW1B 5EUOA 3SDCB 3GDBA 4RSVA 5IESL 5FYLD 3L7FA 2CRMA 5JW5B 5E2VH 4QRTB 4OLVL 4XC1L 4OCRH 2EDQA 4WY7H 2IJ0C 2XT1B 5HGHA 1BZ7B 2YUZA 1AO7B 1YEFL 3NAAL 3GMRA 5FAAA 1YQVL 1CU4H 2VLMD 4LCIL 5DUMH 5BS0E 5CZXD 2BY3A 3CVIH 2MMXA 5L9DH 2ICWI 1KTLB 4L1DA 4N1HB 1NSNH 4AEFA 5I8KL 1QHOA 3WL9A 2G75B 1DQML 5J9PB 3HNTL 1ITBB 3FQRA 1S7QB 3EYUH 1IAKB 2BNQB 3NCCB 1T83C 2AJZB 2OI9B 3M8OL 3SGJA 2IH3A 3BDYH 4OJFL 2J1KA 2YPLB 3CMOL 1CBVH 4HMDA 2ZZUT 1LK2A 3FOMB 3PWUA 2VUOA 1N5YH 1FNEB 1I9EA 4LLAA 2AJVH 3RWJA 3MBXH 1A7NH 5ACZB 4F3FA 3O9WB 2EIDA 4LCYA 2DQTL 2BK8A 5SWSE 5K9QI 1WWWX 3W9EA 3SKOA 1J1XH 5ICXB 1HILB 1HXYA 2FGWH 1OAXL 2NNAA 4GW1A 3SDCA 3TVMB 1JYWA 4OF7A 1I7ZB 3GRWA 5JW5A 3DIFB 4L8SC 4QRTA 1IBGH 2R1YB 4LSRL 3W2DL 1NCWL 2ZUSA 3UPAA 5F8QC 4FQQA 4ELME 1BZ7A 1AO7A 3STLB 5ILTH 2O5YL 4JHBA 3L5WB 5HYJB 7FABH 1FYTB 2BVEA 4JVPA 4S0SD 12E8L 1PEWA 3KPSE 1T4KB 1J12A 3MV7A 1B6DA 2IADB 3VH8B 5T33L 1CDCA 1G7JB 3T3ME 1JF6A 5C0RL 4U3HA 1KTLA 4TVPE 4WRLA 2B8OT 2G75A 3HC4H 3TYFB 5J9PA 1DLHB 1X5FA 1HCVA 1S7QA 3KR3H 4G9FE 4OGZA 5IVXE 2DMBA 1IAKA 3UMTA 2BNQA 4HGWB 3QRGH 3ESUF 4M5YL 4FTVE 2AJZA 3KPRA 5DJ6A 2NX5D 3I84A 2YPLA 1MUJB 2PTTB 5DD1H 2IANE 4O02H 4P4KA 3BKCL 3QNYB 5GJSL 3FOMA 1WWCA 1FNEA 4YDLB 3VGGA 5D1ZC 4K2UL 4UTBH 3CK0L 4NHCL 1I8IA 5ACZA 2DI9A 1J0HA 3O9WA 2DMCA 4ELMF 5CEZH 4LSDA 5CGYC 1A1MB 5LG1A 2IMMA 4I3RH 5FGCB 5ICXA 4WWID 1HILA 2R15A 2FX7H 3LMJH 3TVMA 4JO3H 1I7ZA 4XCYB 5DI8B 2OZ4H 3DIFA 3T3MF 2V2WB 4X99B 1J1PL 2R1YA 3HB3C 5DD3L 5E9DB 1VFUA 2HT3C 2NTFA 2NY6B 1GHFH 2PW1B 1EO8H 2DBLH 5IVXF 2EYSB 3MJ9A 3STLA 5DJ2B 1FO0L 3L5WA 5HYJA 2NY4D 1EV2E 1FYTA 5D7JC 4NCDA 4KI5D 3EOTL 3GMOB 5E8DH 1UKSA 3VH8A 1T4KA 4P5TB 2IADA 1G7JA 2AI0L 2HJLB 3K1DA 2OCFD 2ZP0T 3MLXH 4RGOL 5GGTL 3VCLB 1N4XL 5DJZA 3TYFA 3VU2A 5F3BB 1DLHA 5FYLE 2AJSL 5EO1B 2AW2A 3QWRD 4HGWA 5AAWA 2ZCHL 4O4YL 5LCVL 4R7NA 4YHIB 1MREH 2O5XH 4JKWA 3HAEB 2ICWJ 1MUJA 1A9BB 2PTTA 4P46B 2Y6SD 3DMMD 5CFHA 1H15B 5C08A 3QSKB 2CKBA 4WTZG 3QNYA 2J3SA 4XI5C 2VLME 4D94A 4EDWH 4JFZL 3I2CH 1L0QA 1LDPL 3R8QA 1N6QL 4FQJH 1H8SA 1YQ2A 4UIMB 1P7QB 3RIAK 5DMKB 1A1MA 4PRNB 4EI6A 3G6JE 3NBNA 2FLBT 1CVRA 1NMAL 5I6XC 5DI8A 3U7WL 5C7XL 2V2WA 4X99A 3B2VL 1TJHH 5E9DA 4JB9H 1AC0A 1A47A 3MODL 3QUYB 8FABB 1U8OB 2PW1A 3KAAA 1X4ZA 1NMCB 4HF5H 2R4SH 1RJZB 2OL3B 3ARDD 4J3VA 5DMIH 3W11C 2OR7A 3MRJB 1B3JA 2CQVA 3SE4C 3D6GA 1EGJH 3RTQC 4R4FH 2HJLA 2H41A 2FSEB 4HT1H 1YY8B 3VCLA 3FL7A 5F3BA 3HPLA 1WV7T 4P2RB 4UINH 3ZHLA 4BH7A 5E6IC 2LQRA 4YHPB 3GSUB 4KJPD 4MD0B 4YHIA 5BRZD 2VDOH 3BP5B 1OTSC 3VW3L 5EZJB 1HZHH 3HAEA 3G6JF 5TF1H 1A9BA 1EPFA 1WIOA 3MLPA 1H15A 1MFCL 4QHNB 2E27H 3QHZH 4M1CD 1YC7A 3NOIA 2A1WH 5EIIB 3IAGC 2CH8A 5CCKL 1P1ZB 1KJ3L 1T3FB 5AZEL 4UIMA 1P7QA 3QUMH 5DMKA 3CJJA 3NZ8B 2MQCA 4PRNA 1FIGH 2HT4C 1INDL 4WNQB 2OP4L 3QI9D 3L5XL 4NRXB 1N0LA 4EKXA 1AC6A 2NX5E 3RVVD 4Z95H 1FC1A 3QUYA 4NP4H 3MRCB 2APWA 8FABA 1U8OA 3KLHC 2C4XA 1LK3L 3M45A 3GHBL 1FNFA 1RJZA 2OL3A 5JXEC 2R56L 4YHNA 1A1OB 4M6OL 4YHKH 4PV9B 3QCUH 4N8VB 5ICYB 1T66D 4YEEA 2FSEA 4K71C 4NGHL 4RX4A 2X4TB 1YY8A 5C0CB 1O7SA 2QADD 5SWQB 1WT5C 4FQLL 2V5MA 4P2RA 3GJFB 5FFLA 1FG2B 2GFBB 4ZSOB 4XCNB 4YHPA 3GSUA 3HC0A 4OT1L 4MD0A 2V9RA 1MHHB 5EZJA 1YMMD 3QDAA 1A22B 5FV1L 5HVGB 1WLHA 4QHNA 5A2LH 1W72H 2A6KB 4DFHA 4PUBL 3PL6B 4R2GB 1UYWH 4KI5E 1IQWL 2Q20A 5EIIA 1AQKL 1P1ZA 4W6YB 5E08L 3U4AA 4X80H 1T3FA 4JG0H 4OQTA 1M4KA 1EERB 1MFAL 5J3HC 1A7PH 4WTXA 4LF3B 5LBSL 4MAYC 3TBWB 3AS0A 4WNQA 1IGCL 3IRPX 4N1EA 3VFGH 4L4VD 1R3HA 1PG7L 1FBIL 4WW2F 1AGCB 1TETH 3C60B 1T1WB 3MRCA 3Q6GH 3D2UD 2P48B 1EEZA 4DCQB 5ECJE 1AH1A 4FQ2H 2P5WB 2D7TL 1A1OA 1NAMH 2ICWB 4U1GB 4PV9A 4NRZB 2IBBA 2NY1B 4N8VA 4WGVB 1BQUA 5DRNB 5ICYA 1EK3A 4ERSL 3QDJD 1Z9OA 1I85A 1DZBA 2X4TA 5C0CA 4KI5F 3QISA 4Y5VB 5F88B 1U3ZA 3GJFA 5KSBB 5IGXL 2GFBA 3PDDA 4ZSOA 1QRND 2VXTL 5HI4D 1FZKB 4XCNA 4XP6L 3T3PE 2PTUA 5DVLA 3RL2A 3ARBD 5JA8B 2QQKH 4HUUA 4HGKC 5IIEA 4N68A 4MS8C 4PJHB 4Y1AD 2A6KA 4N9OB 3PL6A 2EIBA 4JFFD 3TZVC 1ZGLM 5E8PB 3AMKA 5EC2B 1UM5L 3B9KB 3Q1SH 2YUXA 4GAYA 3RUGA 1A7QL 3GO1H 4XP1H 4A6YL 3X11B 2A9ML 4LF3A 1A6PA 3TBWA 3LS5H 1UQSB 3WFEH 5JR1L 2AJ3B 4IOSD 2YXFA 3MYJB 1KIUA 5BRZE 2C3GA 4NO0D 1AGCA 4PRBB 3C60A 4PJFB 3GGWB 4UU9B 3EJYD 2WUBH 1HH6B 3HMWH 4DCQA 4DUWA 3T3PF 4XPAH 1TDQA 4NBXB 1RZ7L 5DRNA 4BFEA 1KG0B 2GEEA 1NGWA 1FCGA 3D5OF 4AL8L 3BGAA 1KB5L 4XRCA 4Y5VA 5F88A 4KHXH 2VLKD 2D31B 4ZUSB 1FFNB 1QRKA 1U3JA 4XWGL 5KSBA 5DHXB 5D8JL 1FZKA 4H88L 4I77L 5J6GB 1X6LA 3GSNH 4ZTOH 5JOPD 4PJHA 5MERB 4ODVL 1R6VA 4NM4L 4PRHB 3THML 2HT2D 4OF8A 5I30H 2HKFL 2VUYA 1A3RH 4X6DE 3HI5H 5EC2A 5IJKA 3X3GL 1BVKA 1YYMH 4JPWH 4JFOB 5IBLD 2HH0H 3MV11 3X11A 5JXAL 1H3VA 1TCRB 3MFFB 3QDGD 4TNVK 2G9HB 4HCRL 1FGVH 1UQSA 3OB8A 1IGML 2AJ3A 2EH7H 2NY0C 3QR2A 4NKIH 5IQ7H 3HB3D 4Q6YA 1OAQH 1U3HB 2HT3D 4PRBA 1YMME 3VXPB 3V4VL 3A6BH 3GGWA 3MC0A 3X13A 3K2MC 1T7VA 2X10A 4UU9A 4LCWB 4UAOB 1PLGH 4F7EB 1P53A 1YMHB 2HTLC 4LMQI 1IC5H 4M5ZH 2DYPD 2IQAB 5DURD 4NDMB 4NC1C 4P9ML 1KG0A 1L7IH 2B1HL 1T0PB 3ESVF 2FNBA 4ONGH 4ETYA 2D31A 4OD1H 1EFQA 4X6DF 4ZUSA 1FFNA 5TE7H 4KK6C 3LIZL 3H2WA 5J6GA 5GRXG 1NGPL 1NUNB 2W92A 4Q6IC 5MERA 1IAIH 1CE1H 4XI5D 5DJ0A 4UBDD 2Q76B 2W9DH 2FX9H 5E94B 1EUTA 1D5ZA 4NKMB 4CVUA 3QDJE 4JKPH 1F4WL 1RIUL 2H1PH 1IGTB 2VERN 3P0VH 1AI1H 1HQ4A 2DQDL 1TCRA 1WCQA 3S3SA 4AEEA 3MFFA 1MFDL 1IRAY 2G9HA 4P57B 3DETD 5FCUH 2O93L 1T03L 2LVCA 4UQ3B 5EOQH 1VFAB 4FFZH 4LOUC 5DWUL 3ZKQD 1DSFL 1U3HA 2WWKT 5GS2H 3VXPA 1JBJA 1MJ7L 5FO7B 4AQOA 5I1HH 2E5EA 1FNGB 4Y1AE 1G7IB 4K3JL 4LCWA 4JFFE 3V5KB 1CK0H 4HCRA 3W11D 4R26L 1DQLL 4F7EA 5DMGC 1YMHA 5FA4B 4GW4A 2A83B 2IQAA 4BM7A 3WHXA 4NDMA 2VO5A 4RWYL 5DEZA 1T1YB 4KJQD 4WENB 5DYOA 2O61B 3TPUB 3VXRD 2BRRH 4JGUA 1CXKA 3CDCA 1S7VB 3VFNA 5E6ID 1PAMA 2PYEB 4UNUA 4ONFL 2EO1A 5CILH 5I2IB 4J4PA 5FYKH 4QRRB 4HHAB 5FUZL 4OB5L 5EZLB 1I3VA 2D4DA 2Q76A 3CSBA 5KAQF 3F7VB 2ZNWA 2HAZA 1ADQL 4F9PC 4GKOA 3GMPB 5E94A 1H3TA 5HPMB 5EORH 3O6FD 4NKMA 2LV4A 4GBXB 1J8HB 4K9EH 1IGTA 3RHWK 1SM3H 2B5IC 2VLKE 3EGSB 3R0NA 5CP3A 2DTMH 1CFSB 4FZ8H 2VL5B 4P57A 4MYWB 3N85H 2VDLH 4JR9L 1VFAA 1Y6KR 1ZEAL 2XWBB 4HKJB 5JOPE 1CL7I 4JN2B 5FO7A 1P9MA 3QUZD 4I18A 4U1JB 4MB5A 1G7IA 2Q3ZA 4Y5YC 5JXED 3V5KA 3KPQB 5IVZB 4R9HA 1PQZB 5FM8A 4HMEA 5KVDL 5K9JH 3QZWG 2A83A 3RA7H 3MRNB 1X5LA 3TN0B 1IGIL 1T1YA 3QDGE 5DQ9A 5EA0L 2O61A 4OFPA 2Y9RT 3TPUA 1TIUA 1BFOB 3I50H 3QXUA 1SBSH 1KPRB 2BJML 4PLJD 1S7VA 2XZQH 3PIQA 3PP3K 4E41B 4XPHL 5F44A 2PYEA 5I2IA 3RGVB 3BPCA 1XGYH 3K8KA 3QIWB 3C6LC 5I1GL 3ULUL 4HHAA 5SWZB 2E6QA 4MD5B 1CDJA 2B7DT 5EZLA 3OQ3B 2XTJB 2JB5L 3F7RA 3F7VA 3GMPA 4YE4H 1I1AB 2UUDK 5HPMA 4GBXA 5L0QB 1J8HA 2H45A 3V4PL 1VPOH 3WS6C 4MAYD 3EGSA 1BLNB 4HX1B 1CFSA 2VL5A 5F93C 4Y4HD 2X1PA 4XVSL 4KTEL 5C2BL 4WEUD 4HKJA 1KC5H 4JN2A 2DLGA 4M03A 1NGQL 1DVFB 4HBCL 4K8RH 2DQJL 2GYSA 3AROA 3S97C 3U36B 1J5OH 4U1JA 4WEMB 2P1YA 2V2TB 1IKFL 1MF2H 3KPQA 5GGRY 5IVZA 2R8SH 1KELL 1PQZA 4XP9H 5T3ZD 4TTDC 3IDYB 3OWEA 3WKML 2BSTB 3AVEA 1MELA 2QTEA 2ED8A 4ZOCA 3QUXC 3MRNA 4PJXA 3TN0A 4QRPB 3HMXH 1P7KB 2K9UA 1JHLH 1OTUC 5AWNH 4P2OD 2DQGL 4R3SB 1KPRA 5ADOL 5HHXH 4E41A 4EIGB 4OAWB 3QIWA 3JUZA 2Z8VC 5HHNB 3NA4A 1IQDB 5SWZA 4MS8D 3UXFA 1N7MH 4MD5A 4MA7H 3GNML 5DJYA 1OP9A 3T2QA 1I1AA 5JIHA 5C09B 2F5AL 3JV0A 4PRIB 3OPZH 1DN0B 3RIAF 8CGTA 5F1OB 3VXRE 4UTAL 4QOKB 3OJVC 4HWZB 1BLNA 3F58L 4HX1A 1TVBB 2EDKA 4KVNL 1KB9K 1FNHA 3BGMB 1I1CA 2VDML 2X1OA 4LGRB 5JDSB 3P40A 2MJWA 2BOBB 2NR6C 2APXA 2ATKB 4P2QB 1DVFA 1VEMA 2ZUTA 3T0BA 3U36A 3BJ91 5D2NE 5IEKB 1X7QB 2V2TA 2NCMA 3QH3B 4S1QH 1FE8L 1KN2H 4O58H 2X4NB 1IAOB 2BSTA 4FFYL 3LPFA 1BJMA 2L4OA 4M7ZB 4MZ3A 4QRPA 3HNVL 1P7KA 1CGUA 4G6ML 4ZOBA 5E1HB 1C8PA 1CGSL 3FAWA 1BQHB 2ATPB 5CJOL 3IFLL 5B3JE 4WI7A 3SDYH 2OYPA 4Q9RH 4OV6F 1A5FL 1SMAA 3HZVB 3TIDA 4LVHB 4WU5B 4OAWA 5BCAA 5TQ0H 5HHNA 4HIIB 3ROLB 4JO1L 2Y07H 5HYIA 1HCFX 2Y5TB 4LRIA 5LAXB 1KEGH 3EYVB 3VG9B 2VDRH 3F12B 1UZ8B 3TLRA 5BS0B 5IUSA 1JP5A 3S3PA 1A64A 5DD0L 5C09A 4PRIA 3V6OE 5DUBB 4OLUH 1CFVH 1DN0A 4MMXC 2Y36L 1ZGLB 4QOKA 2Y23A 4HWZA 2OK0L 5T1LD 1UEYA 4RFNC 1TVBA 1HOCB 2NY0D 4OFDA 1PZ5B 3BGMA 3TBTB 25C8H 5JDSA 4AH2B 1RURH 2VXUL 2WWMC 2BOBA 4WDIB 5AZ2L 3OKKB 4XAKD 2DKMA 2ATKA 4P2QA 2DI7A 3WSQH 2LU3A 1I9RL 3MOBH 4Y5XB 4RDQG 3WLWC 5IEKA 4DN3H 1X7QA 1NEUA 5B3JF 4RA3A 4LSPL 4N0UE 3QH3A 5A3ID 1CXIA 3G08B 4JM2D 3DSFH 1EHLL 3TJEH 4YHYB 1CG9B 5EZOH 3ZHDA 5HYQA 4Y4KC 2BHUA 4AQ1B 5I75C 1BQHA 2XY1A 3VGBA 1E4XH 4J12A 1KTKE 2X5PA 4WU7A 3HZVA 4GRWH 4TVPL 1C12B 3U1SL 3R8BB 1NFDE 4HIIA 3ROLA 3SDDD 4XPTL 4ELMB 2IEPA 3ZL4L 3PGDB 2DQCH 3EKCA 5LAXA 1FNAA 3EYVA 5LXGH 1ZT1B 3PDOA 5T3ZE 5GS0D 3OAYH 3F12A 3V4UH 2ERJB 2D9QB 5LGHL 3ABZA 5DUBA 1HSBA 1GPOH 4PJGE 1MQKH 5D70L 5JUEL 1ZGLA 3DYMA 4YK4C 3TA3B 3ZKXC 2DJ4A 4O00A 2NY5L 3MJ8B 4G9FB 4EXKA 3MRRB 1HOCA 4N0YL 5TDPB 1PZ5A 5AYUH 1CGWA 4FTVB 3TBTA 3N9GL 4AH2A 4YGAB 1BVLB 4WDIA 3OKKA 1OY3B 3JVGA 3FB8B 1R24B 1EEYB 2WLYA 4Y5XA 3SN6N 2DM2A 4M7LH 1UWEH 3QG7H 4ALAL 3CX5J 1ZTXL 4Z5RB 3QDMD 3G08A 4TSCH 1NFDF 1TVHB 5I15H 2R39A 1AGEB 5MENA 1XF5B 3O6LH 4IJ3C 1CG9A 4JANB 3KPLB 5D7SL 3BW9B 1G9MC 5IK3B 5LVEA 2CXGA 4ZNCD 5GS2D 3K7UA 5B39B 4M4RA 5JQHC 5T5NG 2HLFD 5FIEA 2ZSWB 1F4AA 5DD6B 2HFFB 4PJGF 2P43B 1N3NA 1C12A 3IYLW 3G5XB 1QKZH 2DQIL 4DKEL 1CD1B 3O11A 5FYLL 3QIUD 3PGDA 4PY7B 1L0XA 1CL7L 2XZAH 3H9SB 3V0AC 3L3IB 4GMTH 3FT3B 5EU7C 3EFDH 1BBDH 1JFQL 2FIKB 3P0GB 1XF2B 4POYA 2NXYB 3ZDXF 4DFIA 1MJUL 1SYVB 1KIRB 1G7PB 1IAMA 3BZ4B 3EYFB 4IOFD 3TA3A 3HE7B 3MJ8A 3KWWB 5FYKD 4PY8I 2VQTA 3MRRA 3TWCL 4DGVH 2O5ZH 1RHFA 5EU6D 4FTVA 1BHGA 1FL5A 4P49A 1BVLA 2E9IA 1JV5A 3SBWC 5I1IH 3HE6B 3FB8A 1E27B 3VFSB 1R24A 1UM4H 3OHXB 4LCCB 3FONB 1OW0C 4M1GL 1KJMB 3NCJL 4G8EB 1R5WB 2X7LB 3ULVH 4Z5RA 4C55A 5EBGA 5FHAL 2GKIA 4RNRB 1FFPB 5IJVB 1TVHA 1D5MB 1AGEA 2QSQA 1XF5A 4N0CC 3I6KB 4JANA 4EN3A 4AG4L 3BW9A 4P3DB 5IK3A 1JI1A 4DKFH 3ALXA 5IKCB 5B39A 2Z92B 3CLFH 2B39A 2YN3A 3O45B 1YJDL 3T1FB 3L3JA 2ZSWA 1FVDB 5DD6A 1UVQA 4MXVE 2HFFA 5HXMA 2VR4A 3ULVC 3GKWL 2EEBA 1NL0H 2R2BB 3G5XA 1CD1A 1S7UB 4PY7A 3P11H 3WXWH 1I8LC 3H9SA 2F54D 5DHYB 3FT3A 5F9WB 4MJ2A 2FIKA 4M43H 4DW2L 5HI3D 3ZKMD 5C6WH 1SYVA 4KVCL 1QFWH 3SE8H 3VMOA 3P30H 1KIRA 3LV3B 2EEAA 3BZ4A 3EYFA 3HCVB 3HE7A 2A6DB 4KGLA 5BMFL 1MVUB 4WHTB 4LDOB 1ZOXA 4Y16A 4RFOL 5T5FH 1KNOB 2PO6C 1SHMA 3FQXB 3HE6A 3VFSA 4M7JH 5E6YA 3OHXA 3FONA 4KHTH 4UILL 3SKJL 1KJMA 1KEML 4G8EA 2X7LA 5E4EC 3DURB 4MXVF 4TTDD 3V0VB 4RNRA 1FFPA 3QUXD 1MY5A 1UACL 5GGVH 1MHPH 1D5MA 4ZOEA 1A7BA 4JQXC 4IM8A 5CJQL 3I6KA 1OTUD 4JM2F 5I19H 1RFDL 4KRMB 1C5DB 2Z92A 3V7AG 3NH7L 3O45A 4XX1E 4YFLF 3T1FA 1FVDA 2W0LA 4KQ4H 5C6TH 4YXLL 3SGDH 2R2BA 2OQJB 2VWEE 1S7UA 3BD4A 1F4HA 3RFZC 1EJOL 1G9NC 3OAZH 5DHYA 4RAVB 3QDME 1NKOA 2VR5A 3IGAA 1ZWIB 5C0IB 1BQSA 3AY4A 4WW2B 3D48R 5I1AB 1C16B 5KJRH 3I85A 4I3SL 2P42B 2R1XB 3LV3A 3HCVA 4ZXBB 2XRAH 2A6DA 4ZG1A 2VC2H 4ZO8A 2J4WL 4WHTA 3EYQC 1RUPH 3B6SB 3EOBA 3FO0H 1KBGH 4LLUA 4KROD 4BQBA 2YD3A 2BVUA 2VKWA 4F9LC 4WUUD 1KNOA 2NR6D 3BKJL 1YNLH 3EDDA 4PTTA 1V7ML 4MSWA 5IFAL 3FQXA 1JGEB 1U8KA 3UTTB 2NY4B 1QNZL 2VDQL 2WIMA 4KRPC 3OAZK 2R29H 2IQ9L 3DURA 4PY8J 5GQBA 2XN9D 2DQHH 3V0VA 1BECA 4DEPB 2H26B 1D6EB 1RAMA 1W0WB 2YD8A 4LASH 1RULL 5IVNA 2E6PA 1HDMA 3LN4B 1C5DA 4BZ1L 2BMKB 1FZOB 4QO1A 3LEVH 4GOSA 1KN4L 4JO2L 3KHQA 1RVFL 1FGNH 3O2DL 3K2UL 1HHJB 1NCCL 3OTTA 4MJ4A 3KYKL 4PPTA 2OQJA 5DMJB 3MLYH 4ZUTB 5HY9B 3ZSSA 5IMLB 1U9KA 3C5ZC 1MRDH 1PBYA 4JFDA 3JBG7 3QJHB 1ZWIA 1MCDA 5C0IA 4XVTL 3L95B 4HDIB 5GRZA 3S8WA 3ILQC 4WW2A 5CINL 5I1AA 1C16A 2WQRA 2R1XA 1MPAL 1OCWL 5JW4N 4DN4L 4ZXBA 5K33A 3GHEL 5M95B 4IHOB 4OM1L 4ZFZB 4ZS6C 3B6SA 1BD2D 5ADPH 1WWAX 2WWMD 5HHVL 5HI5D 3GMQB 4PJAE 2E7BA 5IV2A 3VGAB 3QFJB 4J3UA 1EFXB 2F54E 3WLWD 3UTTA 5I1JH 2FYYA 3MV8D 3WIIL 3HNSL 4OCMC 4NO5B 4OCSH 3RVWC 2H26A 1BFTA 2DQFB 1W0WA 5EWIH 1WQVT 3SGJC 2GHWB 3RU8L 4P3CL 1FAIH 1VDGA 3VGFA 5GRYA 5E2TL 1QBBA 3GRWH 3LN4A 3QWRA 1ZHNB 1MCOH 5B38B 2BMKA 5BRZB 3DUHA 1QLRB 2XTLA 1RSFA 3OAUL 1HHJA 1KULA 1I7UB 2D3VA 5D93C 1F3JA 5HY9A 4NPYB 4ZUTA 5IMLA 2DD8L 1D6VH 4EJ1C 5IESH 4ODHH 3V95A 3SDCC 3MLZL 4LQ1A 4PJAF 4XC1H 2HLAA 4HDIA 5KW9L 2D9CA 2HJKB 4TUKH 3TC9A 1TVDA 3O2DA 4MCZB 1HYRC 3NAAH 1YEFH 2VZVA 3TV3L 4CJ1A 4OCXL 3QI9B 5FECB 3ET9F 5F72S 5CD3B 1T22A 4LCIH 2WUCL 1NANH 4NCC1 4IHOA 2QQLH 4ZFZA 1B0GB 2ZCLH 4HUXB 2SEBB 3GJEA 5EDXA 3GMQA 1WEJL 4PP1C 4P23A 5I8KH 3DI2B 3T0WA 1J87A 4HH9A 1DQMH 3QFJA 1EFXA 3HNTH 5DF0A 1OSZB 5C0AD 3MCLL 5D72L 2KKQA 4N0FA 4NO5A 3M8OH 1NUGA 5JMRA 2DQFA 4DTGL 1ZHKB 1G0YR 2BFVL 3CMOH 5GISL 5MP6L 5JPMB 4I4WB 1I3GH 4MA1B 1KIPB 4P4KC 1ZHNA 2MNUA 2B4CH 4LKXB 3BUTA 1QLRA 3O6KL 4WUUE 2AXFB 1MLCB 1R3IL 5F9JB 4RMTA 1M7IB 3EO9L 1Z9LA 1I7UA 3O9WC 4HPYL 3CC5B 1OAXH 1UWXK 5DFWH 4GRMA 4Z78B 2XN9E 1RZJH 4JPVL 1TXKA 3TVMC 4LSRH 3W2DH 4G8GD 3S35H 5E5RB 1UH2A 2HJKA 4P59L 2B4CC 1X4XA 3U2SB 5F7YC 3BRGC 3MACH 3QI9A 5FECA 1QPPA 2O5YH 1F58L 1UCBL 3WFHB 4XVJL 1JTOA 1B0GA 5T33H 3RWGA 1YEGL 4HUXA 1MCNA 5C0RH 1JNLL 4CMHB 3MR9A 1JZ5A 1RZJC 1V05A 2D4FA 4WY7L 4KXZH 1WF5A 4EUPG 3MBED 5FGRA 4ZFOB 2ZUXA 1OSZA 3OR6B 3IJYB 4MLIA 2IMNA 4ZMAT 2Z8SA 2D7PA 4NKQB 3FN9A 3KYNB 3QDJB 4MJID 4LVNC 1ZHKA 3CVIL 2NY2D 2ZG3A 4N0CD 1OOAA 1NSNL 5JPMA 4M48H 2ZNXA 4I4WA 2EYRB 3BXNB 1KIPA 4HSQA 5MI0B 4FQXB 3EYUL 4K2UH 1BD2E 4LKXA 4NZUL 1BPVA 1KPVB 4NHCH 4YDLC 3E6FB 3ARBB 2AXFA 3CDYA 5F9JA 3S35X 1MNUL 3BDYL 1Z9MA 3FRUB 3FB6B 4Y1AB 3LPWA 1CBVL 2AQ1A 3CC5A 1UKTA 3MV8E 2X4RB 1I7RB 2JKXA 1GVIA 3QAZB 3O8XA 4PTUB 4Z78A 1NJ9B 1ORQB 4JFQB 4G6FD 4LPWA 1J1PH 2AJVL 3MBXL 5DD3H 2UVFA 5EOTA 1G9EA 3MO1B 4XNMB 1IILE 3N1FC 2NY6C 2R2HB 2XKNB 3N0PB 2OR9H 3WFHA 5GIRB 3V0WL 5DLML 3WEXB 1OGTB 3HAEH 4FG6D 3V6ZA 4RGOH 1IBGL 5GGTH 5CWSB 4XNQB 4P5TC 3MRIB 3ROOB 3I6GB 1N4XH 3T4YB 2EE3A 3DX9B 2AJSH 4YBLB 4ZFOA 1O7VA 2VISB 3BEWB 1OF2A 2JE8A 4GRLA 1S9KC 3OR6A 4OZFB 5ISZD 2JCCE 2ZCHH 7FABL 1D5IH 3OX8B 4LSVL 5LCVH 1DANU 1DEEB 2XKSA 4MNQD 4ETQB 3KYNA 3QDJA 4Z7WB 4YXKL 1ZE3C 3JSSA 2BSRB 4H1LG 5JTWA 3CAFA 2V9QA 3PP4L 4HIJA 4JCMA 2EYRA 3BN3B 4P46C 5TDNA 3BXNA 1LHZA 4FQXA 2R4RH 1JK8B 1KPVA 3QRGL 2R9HC 1KXQE 3E6FA 3ARBA 2ARJB 1A7RL 2F74B 3FRUA 5DD1L 3T8XB 2OL3H 3GI9L 4PFEA 4X7EC 5C0AE 2X4RA 1I7RA 4YPGB 5BQ7B 3QXDA 4PTUA 4D9QD 3CVHL 1NJ9A 1ORQA 1UJ3B 4JFQA 3OJDB 3RZCB 3IDXL 2YXMA 3MO1A 4XNMA 3VXOB 2R2HA 2XKNA 3QUYC 3ORJA 5KSVB 2VMFA 2JCCF 2OTUB 5GIRA 1NMCC 4JO3L 4NC0B 3CVHB 3W82A 3WEXA 2R23B 3O4LD 3MV9A 1OGTA 5BVJB 3MGOB 4DWHA 2EIEA 3I3DA 5CWSA 4XNQA 1INEH 5HDOA 3MRIA 1GHFL 3I6GA 3T4YA 1IJ9A 3DX9A 4WWKD 3RPIB 3NIDE 2VISA 3GFUA 3BEWA 4OZFA 3OX8A 4OQTH 4G8GE 5GGVY 1DEEA 5IMOA 4ETQA 4GLRH 2P8MB 4Z7WA 3VW3H 5F21B 5KSAA 1Z2KA 4O2EA 4XXCA 2BSRA 1MFCH 1N26A 4YFLI 4XHQA 3L5JA 4LAQL 2FBJL 4S0TD 1ONQA 1JK8A 3BH9B 5CSBA 1KJ3H 1ACZA 3ZO0A 3IAPA 1QEWB 4HK3J 4EQ2A 2F74A 2Q7YB 4D0BB 3T8XA 5KG9B 4XTRD 4YPGA 3C5ZD 1NEZB 2C7UB 5BQ7A 3QHFH 3I2CL 2W65B 4NHUB 1UJ3A 4MJIE 3SOBH 1LE5B 4HAGA 3OJDA 3RZCA 4JY5H 1OARL 4DK3A 5FM5O 1C7SA 3VXOA 3NIDF 1X5YA 5KSVA 5EBLB 4H0GA 2OTUA 1KFAL 2A6IB 3RWCB 1WWBX 4CVXB 3M17B 1JPSL 4ZS6D 5J4MA 2UVEA 2R23A 4X7SH 5BVJA 3OF6D 3MGOA 4H25B 4LSSH 5I1CL 4LNRB 2YD6A 4NGHH 1I85C 4FQLH 2BVYA 4HF5L 1QLFA 3RPIA 5JW4M 2R4SL 5C3TA 4HLZH 2DJSA 2ICEB 4F7CB 1AFVL 4D0CB 4RAUA 3VE0B 4OT1H 4M6AA 2P8MA 5L88L 3H9ZA 3Q2CA 3IS0X 3OXRA 1BOYA 4HC1L 2OM5A 3GJFK 4PUBH 4UINL 5TH2B 5JOFB 1DJSA 3PL6C 4R2GC 3S5LB 5F7KC 1QEWA 1MFAH 2VDOL 2Q7YA 5F7DB 4D0BA 1HZHL 4U2ZA 1U8LB 2XQYG 1OWRM 2DQUL 3HZMB 5D2NB 4M9OA 5ISZE 2CD0A 1DBBL 1MRFH 2E27L 1NEZA 43CAB 4MDIB 3O6FB 2W65A 3SDCD 4MNQE 1EO7A 4NHUA 3IU4H 5DO2C 1PG7H 2C4FU 4BSJA 3O4OB 1UB6A 4ZFFB 4DAGH 4M7KL 3VD4A 3MRGB 1ZSDB 1JZ2A 5SV4A 3C60C 5EBLA 4Q97A 4OBSA 5CJXA 1FIGL 2A6IA 1IZJA 3RWCA 4MVBC 1AO7D 2D7TH 3CFIC 4CVXA 3DUUB 2MTPA 3M17A 3LOWA 1ZV5A 4U1GC 4H25A 3RBGA 3QDHA 4ERSH 3VFVB 4LNRA 2C3HA 3MV7D 4PP1D 3QUZB 4ZO7A 3VXMA 4AY0A 3PF2A 2NY1C 5FKAA 2E7LA 4NP4L 3IETB 4KKLD 4D9QE 1LWRA 5CKGA 1EJ6A 4Y5VC 2ICEA 3RIFK 2VXTH 2AEPL 4D0CA 4XP6H 3MA9H 3VE0A 2BNQD 4OF5A 3WXVL 4G7VH 1QFOA 4HIXL 3KPRD 4H20L 3VA2C 2YPLD 3BPOB 2LVEA 2QJDA 3R06B 2NTSP 2RR3A 5FUOL 4P4KD 1MHEB 5GZNC 3O4LE 5TH2A 4XMKL 4B50A 5JOFA 3RJDA 2M2DA 3S5LA 1PG7X 1XF3B 5BJTB 4PJ9A 2A9MH 5IJKC 3NTCL 3WUWG 5F7DA 5C0NC 5ESVB 1FLTX 3STBA 3H0TB 1U8LA 1S7TB 4X8JB 3VFMB 3HZMA 2X4SB 5JR1H 4Y4FB 1CTOA 43CAA 2BZDA 3O6FA 3TVMD 5SX5H 1A4KB 4X80L 2VL4A 4JG0L 1JTTA 2HTKD 3V79C 1A7PL 3MRGA 5F1KC 1IL1B 3GSWB 1ZSDA 4U1NB 3NFNB 3MJ7B 4OGAC 5T3ZL 5FXCH 4KKAC 3IDNB 4Y4HB 4GKNB 3MCG1 1RIHH 1S3KH 1UENA 5D96C 3V7MA 1SY6L 4L3AA 2LAGB 2X9XA 3VFGL 5HYJD 3WDJA 1FYTD 3T0AA 4K94H 4HIEB 1CDUA 3VFWB 2QSTA 2Y5EA 3VFVA 1NFDB 2PNDA 3OKEB 2W60B 4HS6B 1IM9A 3IETA 3AB0B 1H3WM 4XWGH 5D8JH 2I5YH 1HHGB 4FQ2L 1Y0LB 1S5HB 3CU7A 3KJ6H 4I77H 4KGJA 2OMBA 3V6OA 4MHHI 4L9DA 4PJGB 4P2OB 4NM4H 4K94C 4QHKI 3R06A 5C08D 3TFKD 1J88A 1QA9B 1MHEA 2KQMA 2ZKHH 3TH3T 3X3GH 3B9EA 4I5BB 1XF3A 1QPXA 2EO9A 5BJTA 3MLWL 1W8OA 5J89A 2QQKL 5ESVA 5ETUB 5I73B 3H0TA 4HCRH 4X8JA 3VFMA 3LB6C 2X4SA 4RBPK 3JTTB 4Y4FA 1IGMH 2P45B 5HGBB 4JHZA 1UT9A 3MSPA 5EUKA 2XWTA 3UBXG 1A4KA 3C87A 3WCYA 1F00I 4XP1L 1U3HC 2HVJA 1IL1A 1IC1A 3GSWA 4OI7A 4U1NA 1KPUB 3HI6L 3MJ7A 3NFNA 1NC4B 4P4RB 3IDNA 5BZWA 1K9TA 4GKNA 3LS5L 1JIBA 5AD0B 3H7BA 3WFEL 4UAOC 5DD5L 5JIIA 1Q9KB 1OD7A 4LSTL 2AVGA 4WO4A 1CGVA 4XXDB 3VFWA 4P9MH 1NFDA 2JJTA 5IB4B 4HS6A 2W60A 4AEIL 2VKXA 3W39B 3BPNB 5KS9B 3V9FA 3W5MA 3HMWL 4MXQC 2HYMA 2X2YA 1HHGA 1K8IB 1C1EH 1RIVH 2H32B 1Y0LA 2ICES 1S5HA 1I1YB 4XPAL 4XCEB 4G7YL 4QT5B 2W0KA 5CP3H 4NN6B 1T80A 4J4PC 4PJGA 4P2OA 4UV7H 4K23H 4TULL 2DLIA 1AO7E 2KZWA 3SJVD 1QA9A 1TTUA 3V6BR 4U2YA 1F4WH 1RIUH 3MV7E 4I5BA 5FK9B 2X1WL 1ZLUH 3WIFB 5GSRB 2DQDH 1PY4A 5ETUA 3FT4B 5HYFA 3SY0A 1BIIB 1P7QD 2XOTA 1T03H 3JTTA 5I30L 5MHSD 2BNQE 5DWUH 3EBAA 2W0FB 1DSFH 5HGBA 3HI5L 4LVOB 3MXWH 3KPRE 5J1AB 1MJ7H 4U6XB 3K0WA 1YYML 2YPLE 4ENEC 2A6JB 5T1LB 2YA2A 5INCB 4Y2DD 1KPUA 1AE6L 1D7FA 1ETZB 1P9MC 1NDGB 1NC4A 4P4RA 1F2XK 1YNTB 4R26H 3BDBA 1DQLH 5AD0A 3GM0A 4WJ5B 3EOAB 5I1EL 4XXDA 5I74B 1ZLUK 5CMAB 2CDFB 4UI2A 5IB4A 5KANI 3W39A 3A6BL 5KS9A 4RX4D 4DVRH 1QBAA 2APTA 1PLGL 4JM2B 5DVKA 1HN1A 5EIQA 4LKCB 4ONFH 1CT8B 1K8IA 1LP9A 4P2RD 3PWPA 3S4SG 1IC5L 4XCEA 4M5ZL 3MRDB 4QT5A 5FUZH 3D1MC 3RL1B 4OB5H 2G5RA 3QO1A 1L7IL 5GS0L 4BFBD 4LPYA 3MRPB 4OD1L 3KXFD 1ADQH 3DTXB 5BW7A 2NW2B 1FYTE 3WIFA 5FK9A 4YPJA 3BIBX 5H37H 3SDDB 5D1XB 1LNUB 5GSRA 4GBXC 4XWOC 3MRHB 1H5BB 4MX7B 1BIIA 2J6EA 3DX6B 4QHKJ 1PX3A 1CE1L 3BQUD 2W9DL 2FL5B 1UXSB 4BUHA 3VDAA 4RAHA 2W0FA 2BC4A 3BESR 3RDTA 5J1AA 4JKPL