2Z7WA

Crystal structure of h2o2 treated cu,zn-sod
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
151
structure length
151
Chain Sequence
ATKAVCVLKGDGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAGPHFNPLSKKHGGPKDEERHVGDLGNVTADKNGVAIVDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTKTGNAGSRLACGVIGIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of H2O2-treated Cu,Zn-superoxide dismutase
rcsb
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Cu-Zn]
total genus 34
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2007-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2z7wA00
3GTTA 3CQQA 3SODB 5KBLA 1F1DA 2JCWA 1COBA 3GZPA 1TO4A 3F7KA 1YSOA 3L9EA 2AQRA 1Q0EA 3GZQA 3RE0A 1ESOA 3HFFA 1IBFA 2WYTA 1F18A 3ECVA 1BA9A 3H2PA 1E9PB 2NNXA 2AF2A 1SDAB 1EJ8A 1SXCA 1OEZW 1PU0A 1SDYA 1HL4A 1OAJA 2SODB 2AQTA 1SXAA 1E9OB 1U3NA 1SXSA 2GBVA 1E9QB 3QQDB 4A7UA 1CBJA 4N3TA 4B3EA 3KM2A 4N3UA 4OH2A 3S0PA 1JK9B 1SPDA 5CU9A 3GTVA 1N19A 1IBBA 4BCYA 1RK7A 1PZSA 2VR7A 1EQWA 2AQPA 1B4TA 1HL5A 2Z7WA 4U4IA 2WKOA 2VR6A 2WZ5A 2K4WA 2WKOF 1FUNA 1DSWA 2WZ6A 2ZKYA 3KH4A 3H2QA 2V0AA 2LU5A 2R27A 4FF9A 4A7QA 3ECUA 1UXLA 3F7LA 4A7TA 1E9QA 1F1GA 1N18A 3QQDA 1F1AA 3GZOA 1SOSA 4A7VA 1JCVA 3KBFA 2GBTA 2AQNA 1IB5A 1JK9A 2E47A 1P1VA 2ZKXA 4BD4A 1Z9PA 5KBKA 1SXNA 3ECWA 1SXZA 1OZTG 2WYZA 1MFMA 2XJKA 1DO5A 4MCNA 1XTLA 2C9VA 3MKGA 1L3NA 1BZOA 1OZUA 2AEOA 1E9PA 1PTZA 3CE1A 3HW7A 2E46A 2WWNA 2WWOA 3HOGA 3PU7A 1S4IA 2Q2LA 2AQSA 2XJLA 4BCZA 2AQQA 2JLPA 1SXBA 4A7SA 4OJAA 2C9SA 3KM1A 3T5WA 1YAZA 1Z9NA 5KBMA 1IBDA 2Z7UA 2Z7ZA 3L9YA 3CQPA 2WZ0A 2Z7YA 1CB4A 2VR8A 1KMGA 1AZVA 2APSA 1UXMA 3MNDA 4A7GA 2C9UA 1QUPA 2ZOWA 4A7GF 1XSOA 1SRDA 1XTMA 3GQFA 3KH3A 4MCMA 1IBHA 1B4LA 1OALA 2GBUA 3KBEA 1E9OA 3K91A 2ZKWA 3LTVA 1TO5A 1YAIA 4L05A
chains in the Genus database with same CATH superfamily
1QLFA 2G5BA 3MNZA 5IB2A 3GPEA 4GW1B 4XP1H 2Y36L 4R3SB 2EUZA 3FT0A 1DJXA 1PSKL 3MR9A 4HZ1A 4N0CD 1OGAE 3U9PL 5MEQA 3QIBB 4GQ9L 4L2YA 5ESQA 3CFDB 1UWEL 1YEJL 1DBBL 2JI3A 4HUKB 3KXFA 2ZKHH 4QRTB 1CQYA 1ZV5A 1U3YA 4HJJL 4KI5E 5C7ZA 3T4AB 4C56B 4QHNB 4OGAC 3PQYB 5F71A 4E41A 4Z5RB 1LMIA 4H13C 3JWNC 2P5EB 3HZYB 3FB7A 3QHFL 3S2AA 5DS2A 2F9BT 1TZIB 4MAYC 4RMRA 1YY9C 3EYQD 3MXWH 1YEFH 1NAMA 2CU9A 3KYOA 5CHNA 5DQ9B 4DETA 4ETQA 5TQ0H 1SY6A 1ETB1 4KTYA 3DXAB 4HSCX 4X7DC 2G75B 1OSPH 1X44A 1HEZB 5L2JB 1QHPA 5D2NB 3CU1A 4LHQB 5I1AB 4IIQA 3VXSA 2V0AA 1LYQA 1VENA 2DI8A 3SE8H 2XV2A 5C0AB 3TZVC 3ECUA 2ADIB 3Q2LA 3BMVA 4MS6A 1N3NA 4QYAA 4LEOA 1URZA 2D31A 3ECBB 3SJVA 4KHXH 4F9LC 4Z3IA 1NIEA 5AW6B 3TN0C 3QDJD 4XX1G 4OTXL 1DUZB 4PJFE 3GKWH 5A2JH 3OLIA 2CHNA 4BE5A 5ENWB 1IGYA 1E2ZA 2IAAC 2WGNB 3SGEH 4Z0XA 3LKPB 2LVCA 5IBUG 3AY4C 3CFUA 1QRND 3FAWA 3WG7B 5B7MA 3QPQC 4FFWD 5FYJH 2X1WL 4LSVL 3CSFA 4Y19D 2OR9H 5D4HA 4EXPX 5LNDA 5C0BA 3N1MC 2AK4B 1W8NA 4G6KH 2QSVA 1X4YA 3NSFA 2PWDA 3O8XB 3WHXB 1MAJA 5GGVY 4FYRA 4B60A 3V0JA 1T03H 3ASOB 3K6OA 1CG9B 2F19H 2NDGA 1JG9A 1MCSA 2EECA 4GUPB 1NBYA 2B5IC 5DUPL 3JWDH 5JHDB 1B0WA 3ARUA 1KJ2B 4Q97A 1TIUA 4QHUA 2JI1A 4Y4HD 5DUBA 3I6SA 5I0VA 1IAIL 4BQ9A 5F7DA 3T2QA 2FLBT 5LHDA 1QFOA 3MV8E 3CUPB 3LN4A 1D5XA 4EKJA 3MNVA 3FT9A 5JLZB 4P5KA 2IPTL 1HSBA 3QUKA 2YGOA 1JPTL 3ILPA 4FMFA 4PS4L 5C86A 4GSUA 4LVNC 1LO2H 3A24A 3ARFB 4HS8H 5BQ7A 1YQVL 1EGJL 1TVBB 1U3HA 3QZWA 1P1ZB 1FHGA 1BBJB 1FORH 3WELA 3RWHB 4UANA 5E8NB 5D5MB 5E8EA 1T66D 3L7EB 4FTVD 2WLZA 3MLRL 2ZIDA 3QG6B 2X6AA 3IMUA 4FGMA 4ZFZA 3ALWA 4OV6F 1Q72L 4B27A 3TJHC 4W9DC 4NS0A 1O9WA 2ICWJ 1T04B 5L4JA 5K39A 4NN5C 1U8NB 4J3OD 1E6OL 3IDGB 4PJXF 4UQ2A 2VQ4A 4HIIB 4PJCE 4WWKA 5IROD 4GUOA 4JHWL 1FNEB 3MV11 3WU1A 1N6QL 4CC4A 1WCQA 1J8HA 4P9HH 4PJHE 1MJJA 4MZIA 2ZNXA 3AADB 2VXUL 5HGAB 3U7AA 3HR5A 5CD3A 2NY7L 5FGCE 3VH8G 5MHSE 1RPQA 2DEWX 5IHHA 4JFDE 2R1XB 2XKNB 4WIQA 1FGNH 1IKNC 3GNMH 3LIZH 1GVIA 5HGDA 3TBYB 4HQQL 1JF1A 2J6WA 1I8MB 1DQJA 5J1SC 5IMLB 3KEHA 4NKOA 5D72H 5FM5O 5I71C 4LSUL 2L4OA 1BVNT 3HNVL 5F0LB 1G9NH 5T3ZE 2CO6A 4OCSL 4AQ1B 1ORQA 3N41F 1IEBA 1RZ8B 2FATL 3F7QA 4OI9A 1XL6A 3MMEA 4RMQA 3O6FD 5FGCB 5I6LA 2Q7YA 5E6UB 4F20A 3ECWA 4N0FB 4Q9QH 3IN2A 1FFRA 4FQXD 4J1UB 1L9SA 4EI5A 3KAAA 3MRMA 2GSIB 2YRLA 5I6NA 5JPNC 5IVZA 3ETBF 4PTTB 3VG0L 3QPQD 4FFWC 4ZD3L 3S4SA 2CCWA 4N0UE 3DV6A 1ZHKA 3G5VB 4ANWA 1RZFL 2HYMA 2QR0B 1BWWA 4FTDA 3DX9B 4ZS6C 4OQTA 2B16A 5FGBA 3TNMB 2DYPA 5F97E 1L9QA 1KB3A 4J23A 1N10A 4BA8A 5CJXC 3CBKB 5HDQH 4F8OA 1DE4B 4HXBH 2H26A 4N2NA 4KTEL 3RWEB 1Y6KR 4RSYA 5I5RA 4QF1A 4JFEA 3II1A 3GI8H 5HYJB 1GSKA 2CAKA 4WI0A 4R6UA 2Y7MA 1JZ3A 5D1ZB 4KMTH 5I15H 5GPRA 2ZWYA 4KDTA 1T7ZA 4IBZA 4GKOA 3ZYZA 1QNZL 5GRJL 2CR6A 5CMAA 2Y1VA 4HDIA 1AGEA 1J48A 2AABL 3MV8A 3GSNB 4NQCA 3DSNB 4G8AC 4QRUA 1P4LB 2J88H 4LF3A 2XV0A 4PW4A 5J13C 3OKKA 1I9RH 1NCAL 2WO4A 4CBPA 2RTTA 3QR1A 2EEFA 1OT4A 3VE0A 4LNRB 1MI5B 2CO4A 4G5ZH 4TPRL 1G4MA 4CL7A 5DUMH 4WGWB 3BPLB 1BQLH 4Y4FD 3F3HA 3WTVA 1HHJB 1YC8A 2DYPD 3GSNL 1I3GL 1SXCA 3BQVA 2DY2A 4JG0L 2I25N 1T89C 1CR9H 1WZLA 2BIOA 4GG8A 1AY1H 4F9LA 1E6JL 4DEPB 3LYRA 5I18H 5E0FA 5IV2B 2J72A 3FB8B 4L48A 3V0FA 1KCUL 1WZ1H 3QJFB 4PJIE 4D0CB 4JRYB 5IFHH 1PZSA 3IDXH 2R8SL 1UT2A 3TA4D 4AXWA 4BH8B 5IESL 3CZJA 3UJJH 3EFOA 2MOQA 4Y5VA 3V0IA 1TTGA 1LO5B 1CGTA 4FE9A 2YAHA 5I76B 4W6WB 4OCLC 3KL0A 4U4BA 2LABA 2GI7A 1QRKA 2EIEA 5AZ2L 4FQJL 4DGYL 1MVYA 3EFFA 1WFIA 3LHPH 4QNPF 4LSSL 1FFTB 1BXVA 1VF5C 3LV3A 1KCVL 3MRHA 2DLIA 5DHVA 5ICXA 2XTJB 4F37F 1SEBA 2OX5A 2PW2A 2AQ3A 2DQDH 2ZXGA 2E59A 4CILA 3ZE1F 1BAWA 2WLLB 1KB5L 3QZWG 5AVUB 2X4OB 3I50L 3CDZB 4M5YL 4NN5B 1KC5H 4E41E 4EOWH 2P49B 3BAEL 5GQBA 3BE1L 1KFGA 1A02N 2ZONA 3HZKA 2R0LH 4IOSA 4MNQE 4FKKA 2VYRE 3VW3L 3P0VH 1NC2D 4GO8A 3ZTDC 5IHBA 3U7WL 5ILTL 4LKXB 1MG3C 3U6XS 2JWYA 3QZBA 1OARH 4X6CF 2Y7NA 3QG7L 3MYJB 4NJAH 2RMNA 5HI3D 3MJ6A 3QXAB 5EF2A 4BFIB 4E68A 3VACA 4OD1L 5I5JA 5E99H 2H41A 4F58H 3N43B 1EHLH 1UJ3B 2G75A 4JM4L 1EO7A 2E9JA 4RLDA 5IMMA 1JV2B 1TEYA 4MTMA 3GQFA 5D8JH 1MCWM 3VXSB 1MFUA 5EF0A 4NIKB 2XA8L 4PJDA 5L6YL 1N8OE 3JWOC 1HSAA 1Z66A 2A6KA 1T2QL 5EPMB 2K70A 3VXRB 3B7UX 1KSRA 1M1SA 3VJ6B 1FA4A 2IGLA 3QDMB 4UNTA 5F7YC 4Z3FA 3OHXA 2A9CA 1X9RA 3U7YH 1MOEA 4YHYC 4GMSH 1G9HA 4NKMA 3V6OE 3GF8A 2GUOB 4FXGA 1U3HB 2XVKA 1N7ML 3F58H 4TTDD 2NRDA 3H9ZA 4FHJA 5KS9E 4XN8A 2YKKA 4H8QA 5KSAA 3C08H 2H45A 2ENJA 3LEYH 1SYSB 1U93B 1Q9WB 1M2OA 1K85A 4W9IC 4M5TA 4N2MA 2Q1EA 5ID0B 2DQFB 2A6IA 3AB0B 4N9GA 5AL0A 4HXAL 2G0KA 3DKHA 1NBYB 4M8UA 3P9LB 1BFVH 4BXVA 2CK0L 3ZGIA 4J2XA 5JW3H 4Y4KD 3EJJX 4IIQC 1C5BH 1NC2B 1AZBA 3JV6B 2I5YL 1OVZA 2Z92A 4GSDH 4XP6L 4JFOA 3DA0A 2J1YA 4YDLC 4NWUH 1MJJB 1RK1A 3UZEC 2Q3XA 2X1QA 2EYTA 1UKSA 3LPWA 5E5RB 1JTTA 5E9DA 4DW2H 4KGJA 4I1RA 2PXYB 1AZRA 3F5WA 4R9HA 3AS2A 2MKLC 3RWHA 1TCRA 3FCBA 3KLHC 4M6NH 1VGKA 4PGBA 3CLFL 1NC4A 1MPAL 2X4SA 1EJOL 1SHXA 5F21B 1AOHA 1T6BX 1XF4A 3IT8D 3ZO0A 4DOHB 3EDJA 3JYBA 1FDLH 3VTAA 4MA1B 4QHLB 3T2NL 2ETWA 2NY6B 2CBOA 4ZOAA 2FZ3B 4R7NB 1FN4A 1LDSA 2X2HA 5DQDL 2J8OA 3L3IA 1U8OB 2KLRA 3PU7A 3QBTB 3LEVL 1NBVH 3WFCL 4ONFL 4AYFB 5FLUA 3S5LB 3UMNA 3VGFA 4H8VA 5C0GB 4G8IB 3P9WB 5L4MA 2HRPH 1I1RA 4NOBA 1MDTA 2TAAA 1QFWL 1CVRA 3KBHE 5IG7B 1ZSDA 4FZ8L 1RP9A 3DPBA 4BYHA 3US0A 4TSAL 1P0SE 1MCQA 5EZIH 1NC2A 3Q0HA 4N90D 1K72A 4WHTA 3DV4B 1K2DB 5C2BL 1CDBA 3LRLA 2P45B 2EIZA 1SFDA 5HJDA 3DIDA 1Q94A 5MP6H 3NZHH 2VDLB 1B2YA 2BNQD 4NAMA 4QRPA 3U1PA 3P4OB 1OIOA 1JF1B 5J4MA 3EFDH 2W9EL 1U8PB 3K71B 1VZGA 1HQ4A 2ADGB 3H9SD 1AHWB 3RBSA 2ZWSA 4KFZC 1MIEL 2WYIA 3BVXA 4OJFH 5DZNA 3ZTJG 4EZJA 1VEPA 1ZLDA 4ZUTB 1ULVA 1RXLA 5FW8A 2E9WA 3TA3A 4O51B 2JELH 1KB5A 2DQUH 2WJ7A 3PREA 3WUWB 4AKQA 4L9LA 3HPLA 2VT0A 3RUGA 2EEAA 4ODBD 3RE0A 1P69B 1OCZB 5LDUA 1Q0XL 4JFWA 4QRUB 3OKMB 4R7XA 4R96A 1DEDA 4X6DB 3KHQA 2EIJB 2GIXA 2DKMA 1E3ZA 2IWEA 2AJYL 5D1QC 5C9JA 4TRPH 3KNBA 1IILE 1OAJA 4B9ZA 4I13B 1QABA 1OQOA 3FF8A 3BPOC 2DMKA 4X9BA 3IU4L 1CXEA 3KDPB 5DC2A 3V6ZB 4B50A 4V1DD 4XVTH 1JGVL 5T3XL 3K1DA 3MRRB 4H8WC 1PZ5B 1A14H 5DK3A 5LLIC 2H26B 5ISZA 1KJ3H 4NWTL 1GKOA 2OSXA 4KROC 1UB6A 1URLA 2NY2C 3PP3K 3ISRA 3RB7A 4K5MA 4RMSA 2JIXB 3BAIA 3WN6A 2WLHA 3D9AL 3NA9H 4HEPA 5F1NA 3P9MA 3MGTB 2H3KA 1DO6A 2Q0ZX 1KLUB 3PAYA 2IH1B 4OM0H 4PJXB 3GSRA 3G6AA 5CJQL 2VERN 3WEXB 1K8IB 2N0KA 3TYFA 1U92B 4LHUB 3T0EC 3DO7A 4JM0A 4ALAH 3PYCA 2HJLB 4Y1AA 1H8NA 4LSPL 1KPVB 3U6XA 2BIQA 3LNIA 5BV7L 1BCIA 1J9SA 5AAMA 1F4XL 3X12A 3QNZB 3ZSTA 4XNXH 4TUJB 4JFFD 1RCYA 2CJTA 3C8KA 2VDNH 3DGDA 4OIIH 3QRLA 4HHWA 4XNQB 2P42B 4AQOA 2VAJA 3NGBB 4HIXL 4XBGA 2ZCLL 5D7IF 3CSBA 4K9EH 2FSEA 4LCYB 1AJ7H 1J9QA 3DVNB 2YKLL 4ZPTA 1SEBB 4BZ2H 4MD5B 2ZUVA 3QQ4B 4UM9A 3DJSA 1OO2A 2UZXB 2OJZL 1EFXD 1ZWIA 4HKZB 1RKRA 4PJ6A 4GKZA 2G2NA 3MRRA 3V52L 4ZNEE 2VJ8A 3O4LB 5DMJB 1AD9A 2FT8A 1WWCA 1QD0A 3EKCA 4P4RA 1DBJH 1NICA 4PUBL 3DJTA 1JZIA 3EGSB 4JDZB 3J27A 1LVEA 3D25B 3P9MB 3LQAH 3QIBC 3QARA 1D6EB 5KOMC 4AM0A 3MUUA 4U1NB 2FTAA 3QUXB 1VB9A 4YPGB 4QTFA 3KPOA 5FXCH 1WO2A 1UJTA 4OLUL 4F1ZA 4OFDA 4GY4A 3ARBB 3FFDA 4LDCA 4L8BB 5DTFB 2HKHH 4KY1H 4J39A 4G3YH 2FAUA 4P46B 3R1GH 2OMWA 4HS3B 4ZUUB 1IAMA 2BNRB 2N1TE 4EF3A 1DQMH 1YN6A 1JOIA 1X5XA 3O3AA 5IVOA 3VFUA 1S3RA 3VFOA 4FXTA 2VXQH 3MV7B 3B2VH 3KLLA 1MCHA 4MX7A 4AQEA 2BPBA 4PJ7A 5D55A 4D8PA 3LN5A 1C16A 2K8MA 4PRHB 2YAOA 1G1KA 4NJ9H 2NY3B 2WIMA 4U1IB 2R2BA 3EO1B 4K7PY 1OT2A 5I26A 5GGSB 3RI5F 1ODAA 1NCBH 2ZWZA 3UL4A 3VFVB 4J3VA 1H3UA 3OWEA 1YNKH 3TXAA 2GQHA 4J3OG 4LPVA 4NCDA 4FQQA 4CMHC 3MR9B 4NZUL 2QADB 3NJLA 2H47C 4X7TB 5KVFH 1Q9WA 4N2FA 5IJCC 3DTXB 5JPMA 3CFKB 1VFAA 1SY6L 2YWZA 4JL1A 1IFRA 5FFGA 1KXVC 1V8HA 2BSTA 2JCCE 4LESA 4N8VG 5DZVA 2FX8L 2F5BH 3NK3A 4F8TA 4FNSA 1U8QB 3GMNB 4WUUD 4UQDA 3LNFA 5D7SH 4R4BB 5A2LH 2X0VA 1TPXB 2QVTA 2GBTA 1CIDA 1SLXA 3W0WA 1G7JA 5JPNB 1N0LA 5EUOE 5I8OH 4TKWA 3LQZB 2D8KA 3D18B 3CVIL 2ATKA 2WBJC 3TIEA 1JTOA 1ACYL 2K7QA 1BFOB 2B20A 3CFJA 3MNWB 1EEUA 1QW8A 4DQAA 1G6RA 5SWSB 2BVOA 5AFAA 4E36A 4OD2B 3I6GB 3MNZB 3WS6C 3C6EA 4HH9A 3C60D 4BQCA 4ZFGH 4PJAE 5IUCA 5EZJA 1F4YH 2IQ9L 4NM8H 5TE7H 5D7JC 3RVVC 2CMRL 4JZNA 1X6LA 1CGSH 5K9JL 5FFOA 3CFDA 2FUTA 4XCFH 1P9MC 1KPUB 4OCWL 4QO1A 4XWOD 3VD3A 4OJAA 3HI6H 3IE4A 3P40A 1IBDA 3EF4A 2FIRT 3MHZA 4NDMA 4NZRL 2ZT9C 2X70A 1M71A 2BVPA 5CLWA 1E5AA 4LLWA 3DSFL 3IBEA 1WITA 3OX8B 3GLAA 2EYTB 3KPRE 3GLEA 4F2MB 5TPWL 1ZVNA 5JXEC 3GSVA 5E8PA 1JZ2A 1Y6MR 1NBZB 3BC9A 2HH0L 3GBML 4DK5A 4NHCL 4UIKH 4EZLA 3O0LA 4UBDC 5EHFA 3EJTA 2IAMA 1NUFA 4FP8H 4G7VL 1X7SA 4X7CC 3VVVA 3FRUA 4IHBA 4PG2A 1E7UA 2C7FA 4U0RC 4NO2A 1IGFH 3CFQA 4PAZA 4NX0A 5E2UH 1WBZB 5I16B 2Z3FA 5FUOH 4N2HA 4LU5L 3ERXA 4LQFL 1QEWA 2KS0A 3SY0B 2GTZA 1GSMA 4RGNB 3VXNB 4KI5F 5A2BA 2DZEA 1YEFL 1U8LA 2C1PA 4OZFA 5TQ0L 1A6WH 3QJXA 5FO8B 1WFUA 2VJXA 1F8TL 4M7KL 3DX2A 2C9AA 4KU1A 2NUPA 2F1AA 2Y22A 4NERA 4UM8A 4PP2B 1KCRH 3ZYOA 2F7RA 1TEGA 4KHXL 2BOBA 4XBPB 1Y7VA 2FEEL 25C8L 2XTJC 3NFPB 3X3FL 4OV5A 1G7QB 2RB8A 1EH9A 1CYWA 4OUOA 1MY5A 4LFHG 1EHNA 1N70A 1WBXB 3C87A 5FYKD 4Y16B 2EDTA 5ICYB 5D4IA 5KVEH 1V7NH 3D30A 5FK9B 1ED3A 3KLHD 4KZEH 4Y5XB 5GS0L 2VLKD 3GIZH 3ARFA 3BPOB 4R4ND 1NANI 1TTFA 3O6LL 2ZP9A 3LQAC 1L3NA 3IPBA 2A7BA 3X12B 4L4TD 4BKTC 2WTRB 3RFZA 3HOGA 1L7IH 1X5JA 4UNIA 3VX1A 3P02A 3O6FC 4FI8A 2HRGA 5DRXA 4XNMA 5L4FA 2GK0A 3DHPA 2PR4L 3OZKA 5AW8B 5FFLA 2BVTA 5CS7A 3WNOA 3O6FB 4PY7A 4DTGH 1D9KA 1XGTB 3VSTA 2EE9A 4QR7A 1AMXA 3V7AE 2Y24A 3V6BR 1JMXA 2JIXA 2IPTH 4LLDA 1ZDSA 1F2XK 4Z78B 1Z5LA 2DTSA 1QG3A 1F11A 2OQJA 2NNAA 3GSUB 2WIIA 3H3KA 4X9YA 3PQYA 4DP6X 2AXFA 5CZVH 1T2XA 5D96C 1LJMA 3ZDYF 1A7QL 1DEEB 5A6IA 1LK2B 2OSLA 3FC8A 4HHAB 1OB0A 4OKDA 3FFCB 4NN6C 3S3SA 5HY9A 3OLEA 1EAQA 3DVFA 3QXDA 4U1JA 2ZCZA 3EYUH 1MSPA 4M43H 2HG5A 2ZZUT 3V2AR 3W1ZA 3AQYA 5FKPB 2EJ1A 2WLIB 3QHZL 1AD0B 4GW1A 3ZO9A 4X8JA 2VO5A 4ZPTB 1S5HA 5ESQB 2YPKA 4JR9H 3ESNA 2VQTA 3FUDA 3CSTA 1JN6B 2EC8A 3RGVD 3O3DA 5JOPD 1QA9A 3BIBX 3DIVA 1JAEA 1DQLL 2D7TH 3R06B 4TV3A 3K5RA 2YLHA 4R5VA 1R5WA 3VH8A 4LF3B 2VUOA 4XMUA 5JDSA 3ZLQC 4HF5H 1FGNL 3GNML 3QI9D 4WFFE 2F8IA 4EDXA 5EO0A 2WZ5A 4GRWH 2JB5L 1Y18B 1RZJH 4PW9A 2EDBA 1JUFB 1MW3A 3STZB 3D87B 1JXJA 3QEGH 1RUKL 4Q2ZB 1FO0H 2BY2A 4YSOA 5C6TH 4ISVB 3ZE1E 5ADOL 5DR5H 4JFPA 5JXAL 3EIFA 5DJDA 4F24A 4G6AC 5AYTA 3ESOA 2YEZA 5HI4D 1AGCB 1VFUA 4LCVA 1UCBL 4MB5A 2VO8A 4OF5A 5KYUB 2WINA 1PY0A 3CDGA 2J8HA 3S34H 1CF1A 2ADIA 5HY9B 4FADA 4X7SH 5SWQB 1PZUB 4JFQA 4GAJH 5IF0B 1FYTD 3VFOB 2J8UE 1OOWA 5T5FL 3ZBMA 3WJLA 1WIPA 1AACA 4HETA 3GSXB 3MRPA 4U2YA 4EDWH 2VTFA 1CGUA 1JPGA 2FJSA 5EZPA 3D18A 5EA0H 4CMHB 5GRXG 1OCWH 3M17A 4NO0B 3L3JA 4Z7WB 4KNSA 1UM4H 3OAZK 5DYFA 2XTLA 1YNTB 2F0CA 2UY6B 4MNGE 3ZL1A 2HUEA 4KJQC 1HJCA 4P2QD 1E4XH 3L9YA 5JW5A 4YGVA 3VQMA 4DERA 3BFQG 1UWXK 3BJLA 4Y5YB 3BVVA 2WB1A 4XO9A 1WISA 3ULVC 3HLAA 3OAUH 1QSED 1NUNB 2R0KH 3MV7E 2XQBL 2VISA 4N6RA 1RD6A 2B8OT 4GKSB 4MNQB 4NXSA 5EOCJ 1QNZH 3UMTA 1MFCH 4URKA 1ZA6B 4XE0A 2AABH 5IB3B 1OHZA 5K39B 4ABQA 1U41A 3C5ZC 1B0GA 1M6UA 2GJJA 2TSBA 2XZAH 3FZUC 3ZDYE 1JE6A 4HD9A 2H2SD 2WBJB 4KXDA 5J12B 4EZMA 3EFOB 1R4XA 2DB8A 3CXHJ 2H2PD 2Y0SA 3FN9A 3QNXA 4J3BA 3N1FC 5KYWB 2FJGB 2O5XH 4TUOB 3K4ZA 4WI7A 4XPFL 5CBAA 1P1ZA 3FQWB 4ODSL 2H32H 2HG0A 3TO4D 5AB0A 4FMVA 4ILDA 5F6IC 4QRAA 3K6IA 5D6CB 4FFVC 4QLRA 5C08A 4OJCA 1ACZA 5IMLA 1SLWA 2WD0A 4FQIL 3CDCA 3BO8A 4MZRA 4P2YA 4ZFZB 3U4AA 3QDJE 4JFYB 4AZ8B 2B14A 4IRSA 2PW2B 1NAMH 1E9QB 4PGEA 5EPMA 4A2HA 1N5YL 4GG6E 2OW7A 3KPTA 3OG4B 3SGEI 1FPTL 2BVUA 1IAKB 4FG6D 1J5DA 5HYSA 1G9ML 3I02A 4JB9H 4LLMB 3WMSA 3A6CL 4N6RB 3HBGA 2MIZA 4MD4A 3T1FA 4FQJH 1FGVL 3CVCA 3QXWA 1KGCD 2A6IB 4PTTA 4UTBL 2Z35A 2XTSA 2F7QA 3QXAA 4P57B 1ZSHA 5CUSH 3RPIB 4CN1A 1M7IA 5DDHB 1HDMB 5CCKL 4YZFF 2X89D 3GIVA 3SDYL 1GJIA 4AMXA 1NANH 2VMDA 3DXAE 1I4FA 3P73B 3P0YH 3I50H 1C5DB 2H32B 4A68A 1N12A 4NQCE 5C09B 5IEKA 4AQ8C 1D5IL 4AEIH 4P9HC 4K8RL 5IFAL 1K4DB 1AXSB 2CHWA 1PQZB 3G5WA 4K5LA 2AXHA 2FQFA 1MCRA 3OR6B 4LCWD 5DD0L 2VN4A 1IIKA 3OZ9H 4MB1A 1RZJC 4XHJC 2D3LA 3GJFB 2VDMH 3EG9B 4LVOC 3DSNA 4QYOA 2L7UA 4NO5B 1S7SA 3N9GL 3ZHKA 1T4KB 3JSSA 2PPEA 3NTCL 3TCLA 2IADB 1RJYA 2WTPA 3QZOA 1EUTA 1RY7B 3KR3H 3N5AA 4G70B 1EGJA 2O1AA 1JRHH 1ZLSH 3HG1A 3RWIA 4EBQH 4EI6B 3INUH 1U8OA 4HBCL 1UZ8A 4AYBA 1QYGH 2V7HA 4N2BA 4LLYA 1FAKT 4KQ4L 5A7EA 5T1KB 1T7WA 3IFPB 4MSWB 1E5CA 5LG1A 2VWEE 5EFIB 4TQPA 2A2QT 3MRLB 3DPBB 4PD4J 3FNKA 3QDGD 1LTXA 1LO4L 1FNAA 1PY4A 1RUPL 3QJTB 4GO6B 1N4XL 1ONQA 4YNYA 3UYPA 1QHOA 3V5HA 1KGCE 4AYFA 4Q9RH 4Y4FA 3N91A 4JFEE 4AUJA 3CK0H 1ADQH 1BQHG 4TTDC 5EOCH 5GSVB 4ICWA 5C92A 3DOSB 1U8HB 2BMKA 1IGTA 1TQCB 1AHMA 4S2SB 4DP7X 4TXVB 1DANT 3ZHLA 4GG6B 2N3JA 4B41A 3ZMNA 1OTTD 3CCHB 4GH7B 3WKPA 3GZKA 3L81A 1AZNA 2EIZB 4PLOB 3TA3B 1RSYA 4HMCA 3KPRB 1C08B 3A23A 2IWGA 4XCCH 4AQAB 3V4VH 4G8EB 2CK0H 2Q7AA 4AC2A 1VJSA 3B1TA 3WD5L 3E2HC 6FABL 2IV9A 3F83A 4YHZL 1KEML 4NWUL 2F53A 4BRJA 3KGSA 1PG7W 2O5NA 5E6IA 2BP8B 3RILA 4AMKL 4B3VA 3L3IB 2XWRA 3WNMA 1TVDA 4KKNA 1CTNA 2EKJA 4KRPB 8CGTA 4N8CH 2ZPKL 1R5WB 2G3ZA 4RMTA 2ZXAA 1NDMA 4BEIA 4WFEE 1WWAX 1TTRA 5KBNC 4F7CB 4RAVA 3PDGA 4M1GL 5HDRA 4QTIL 3W2DH 2E7CA 1BECA 1NLBL 2CO2A 4XCYA 3IBOA 4A7TA 4JCMA 5HI3C 3ARDA 4OZHA 3DRTA 4ENZA 1E27A 4DEPC 1SLVA 3BLBA 1Z9PA 2BH0A 4L4VB 5EU6A 5CCJA 3SZ6A 3CN3A 2HG5B 4Z7QF 2QLVB 1KJ2L 3MCKA 1X5ZA 4TUKH 5EU5A 1YYLL 2G30A 5IGXH 4YS4A 5DYOA 3L1OH 2W9LA 3RNKA 4OCNC 5F96L 3V4UH 1QFWH 3HPLB 5ANMB 3BLKA 1UG9A 2VSDA 3C8KB 3RDTD 3LKNB 3OD3A 3TYGH 4C4KT 3DROA 3MI6A 2R2EB 5AUMB 2EO9A 5I75B 3ZKNC 5FCSH 3CQPA 3QA3A 3E8VA 2HAZA 6CGTA 2COQA 4I0PC 9PCYA 1Z5HA 3PRZA 5FKAA 1GGTA 4M93C 4FQCL 3N85H 1ZWIB 4OLWL 3MBEA 3VGEA 5ADPH 4KVNH 3H0TA 4DZ8A 5JW5B 4ONGL 1D5ZA 1IQDB 2OBGA 2PN5A 4N24A 4ZMNA 5EU6D 4QOKA 3GRWH 1TVHA 1UB6B 3CFBA 4G83A 5ID0A 2ESVB 2OSYA 4K71B 4HJSA 4X9IA 1T0PB 3R19A 3D4YA 4LP4A 4MJIB 1LQBC 2V8LA 3TTSA 2JH2A 5JZ7C 4JPSA 4MJ4A 1ZT4A 2UWEB 1FZMB 4A67A 2PCXA 1UADC 4PSPA 1YN7B 5HDBE 1AE6H 5DWUH 3OHXB 3VD4A 1TETL 4ATWA 3H3PH 1AZCA 2WAQA 1DLFH 1XGRA 2JE8A 2QL1A 4YC2C 2FGWL 4PIBA 2B9AA 1RHHB 2WVVA 3N40P 3OPUA 1R1CA 2B59A 3QQDB 2F5AL 4TSBH 4NRXA 3L9RA 5IB5A 3GSQA 2KZKA 5IHLB 2PR9A 2ESVE 3FZUD 4XP9L 4BCYA 1N8ZB 1CT8B 5LG6A 5I1LA 3RY5A 4JAMB 4O02H 1WEJL 4GRWE 4PGEB 3ZZSA 2PP9A 4QOKD 4LIQL 2BZ7A 4MJ2A 5JW4R 2DLHA 3BN3B 3CFCL 3NUKA 3BD4A 3QDJB 4JQVC 2MJWA 2BSBA 1KIPA 4Y2OA 2CRYA 5DHVH 2HKFH 4HHGA 4QTHB 5KUKA 5GGUB 4AIZB 1UD5A 5IW3A 4N2KA 2DJ4A 2VZVA 2WUBH 4RX4A 1IV8A 2IGFL 1CXLA 5I6XC 3L13A 1J8RA 4LBAA 3VRLF 4G6FD 4OZIA 2O6CA 4P0DA 2OL3L 1ML0A 3JTSB 3O4LE 3TFBA 3HC4L 2ZCLH 5D1QD 2IDTA 2NLJB 4YUEH 1Q4NX 4JKPL 4UB0H 3LY6A 4KK6D 5KSBF 1RUAH 5B39G 1OSZB 3Q1SH 4JFFE 3CUPA 5BUPA 4BZ2L 1VFOA 4JFXA 3WNJA 2NCEA 3GXUB 3QRGL 3TVMB 5D2NE 4V1DB 1RIUL 2BX5A 2W07A 2P8PA 3EF7A 4YH6A 2YUVA 1BJMA 3AG3B 1P2CB 1WS7A 2QKIB 2ZUQB 2LHAA 3L7FB 2WY3B 3K6DA 1FFOA 3PDDA 3VXUE 5IVXE 1SUJA 5IB5B 1PYWB 2BNRE 2MQ0A 5E1AA 3R7QA 3ARVA 1KGWA 3L7EA 1EAOA 3NSDA 5HYSB 4O5LH 4PJFB 5LB1A 4PUBH 2IDUA 5D71H 2EH8L 3GXFA 3SYPA 1BJ8A 4RX4D 1KT2A 3QULB 2Y07L 4NT6B 3B3BA 1MNNA 3WUWG 2X53A 1TEFA 3D09A 4U0RB 5EC1A 4HPYH 3STLB 4LGPB 3LPPA 4V1DE 1MHEA 1OAXL 1SM3H 3FOMB 3TWYA 4JZNB 1HZHL 1KFAL 2Z31B 2ZP8A 3GMQA 3O9WB 4UUJB 5AYUH 5H37G 1IBZA 3ZTEA 1F00I 1GRWA 1JPSH 3TF4A 4A6YL 4L9DA 4Z95H 2FO4A 1NH6A 2VXQL 3PHSA 4E42A 1AS7A 3QUZB 1VFBA 3EYVA 3OVUB 1W16A 4J3SA 4XNBA 4A39A 5BZZA 4EN3D 1GGIH 4PV8A 3MRDA 5KSBA 4K2UL 5F7EH 2ICEA 3G6JF 3E6HA 4PU2A 3BPCA 5D7JD 1PQZA 5ALBL 4F57L 3WUWA 4NJ9L 5D7EA 4JRXD 1NOFA 2IAMD 4XMPL 1LEGA 3L3OC 1CE1H 1CLYL 3QUMB 1INEL 3OF6A 3SDDD 3TYFB 3HIZA 4QXUH 4KK9C 1S3KL 1UA6H 4PJEE 4F91B 1EAJA 3HC0A 3L5JA 5SX5K 2DMBA 2WLMA 4AK1A 1J86A 1NCCL 4GQRA 4OD3H 4H0HB 4WHYH 1VSCA 4XOBA 1NL0H 3WENA 4QRSB 2VW4A 2J2ZB 3IMTA 2A99A 4DP5X 4HCGA 4C58B 1UWFA 1D3CA 2DH2A 3RA7H 4JFSA 3WFHB 4F1SA 3PHAA 5D1XE 5I74C 1JZ6A 3BP5B 4M7JL 2PCYA 4LBEB 5EZOH 3DV6B 3ZMRA 1K8DA 3N0AA 5GZOA 3MRMB 3CVIH 3ATAA 1KLGB 1DFXA 2ADJB 1NJ9B 2VLME 3W39A 4AJVA 5CCGE 4X5PA 1GJWA 4KH2A 3ZKQD 2X1PA 3PCYA 2VN3A 12E8H 2YD0A 3EO0A 3Q13A 1EWHA 1T0OA 1PEZA 3QFJA 1KCSH 4FS0A 4CAGA 1CF8H 2BW5A 1NGWB 1I1FA 2R7EB 1F4YL 4PJGF 1UQSA 2ZOTA 2QGCA 4AQZA 2NY2B 3DNKA 3HW7A 4KK8C 3QNZA 5F1IA 2NZ9D 3G5ZA 3LKSA 4YDZA 3BEVB 2YQGA 2WWNA 1CTOA 2BW4A 1AR1D 3IMSA 3ME0B 1IVTA 2GPZA 2ZCHL 1AQDA 1ZXKA 3U1SH 4YHYB 3KWVA 1B90A 3KEDA 2OXGA 3UYRL 3HCVA 4UAOB 3WEMA 3MLWH 3HB3C 1IC0A 3MO1B 1UENA 1VFMA 3CGTA 3L4ZA 4HWBA 4UU9A 1G7HA 4M6OH 2IF7A 2R2HB 1VDGA 3LRMA 4WSGA 5DJAB 4ZUWB 2VM3A 3IS1X 1T21B 3QFGA 3SGKA 4YSCA 5DEFA 1JHKL 3UG5A 1QOKA 3FH7A 3SKJH 2XFXB 1TJIH 4B97A 2AW2A 3L1GA 4U6TA 5FDWB 5E1QA 2NUTA 3QH3A 2OFQA 3ZR6A 1X5GA 4DWHA 5GGSA 3QFJD 4NQVB 4MXVE 4H20H 4AIOA 3LKRB 5CF3A 1VACA 1KNOB 1YEIL 4LCUB 3WS6A 1C1EL 2JB6A 1DFBH 4G43B 1MHPH 1KLGA 1DBBH 4JG1L 2VLRB 2ARJA 3W38A 2IOMA 4F80A 5IHZA 1XCWA 4M9OA 5LWYL 2QZQA 3QIWB 1EVUA 5DVOA 1BIIA 5FCUL 3F6IA 4JHZA 2EDQA 4Z78A 1OTSD 5IJDC 1M9SA 4FI7A 2G60L 4WCYL 5HYEA 3BEWA 4X80H 3NIFF 5DS8B 1SXAA 1VHPA 1CLCA 3SZKC 4LSTH 4WQOA 4CSTA 1OB1A 1Y6NR 4J6RH 4UIMB 1LEIB 4OR1A 1XBRA 2X9ZA 1WBYB 4YK4B 1RULH 1HINL 2A74A 1LWRA 5B1BB 3F62A 3PJSA 1LEKA 3S5YA 3TJEL 1MFBL 3ELAT 4BZ2A 3NOIA 1AS8A 1AQHA 4YK4C 4ABUA 2MNWA 3PGDB 4HIHB 1VA9A 4OSUL 5HVGB 3DUUB 4RAHA 1TCMA 4R97B 1A1NA 3CMOL 3AACA 4KTGA 4R0LB 5G55A 5K1VA 1XF2B 1WCBB 5DSCB 1JPST 1C5CL 1UXWB 4KK8D 3OJDB 1XGTA 4PRPD 2H6OA 1ADWA 5DA4A 3WJMB 4YHOL 5GRUH 1A8ZA 2KL6A 1WAAA 3KCWA 3JQOB 3SKUD 3D2UD 4ZS6D 4YHLL 4Z7QB 4M5ZH 1HXYB 5F7KC 4LFHD 1UEYA 4P23D 1MRFH 3NCJH 2P5WE 1S7QB 43CAA 2QEJA 5DVLA 3GSVB 4OU3A 4HOZA 1ZTXL 4ONOA 2ATKB 4K94C 3WIHH 2CDFB 2MCPH 1HOCA 2CHDA 4L8DB 2BOCA 4JPIA 2VDLH 1B2WH 5FKPA 4U1KB 1Y1DA 4OZFG 3VWKB 1XH1A 1AGCA 4YL4A 3JWNH 3SDXA 3HRZB 2QQKL 3UPRA 5LBGA 4Z7VF 5GJTH 4Z7QE 1ZY9A 4DPBX 2WP3O 2NY4C 3NFNA 1D5BB 2IMMA 3SOTA 4OFKA 3WTYA 2RAMA 1TYJA 1U8IA 1LO2L 2V6HA 5ICUA 2FUQA 3RB5A 4AH2B 1D9KD 1MAKA 2E9IA 4UYPA 1IIIA 1ZVHA 4PB0L 2D7PA 5GS1A 4UT6A 4GLRI 4JDEA 2OK0L 2P5EE 2RGSA 3TPUA 2COVD 2DTML 1T5XA 4P49A 2GJZB 4LCWA 3FQRB 1QR4A 3MLRH 3EYUL 4I4WA 1BQHA 4M43L 5EU4B 2JF1A 2YEQA 5BMFH 3QJHB 2CCVA 3NIFB 3QO1A 5C0BD 2JCCA 1QSEB 4LGSB 2EACA 3S8FB 3UAJC 4BDVA 3DJ9A 2B3RA 2HRHA 1CLVA 2I07A 5GGVL 5EEYA 1ZA6A 3QNXB 5DD5H 4IOIB 5D4JA 4ZMVA 4FQXC 4NRZB 4ZJ9A 4AGLA 4GSRA 1JXGA 3LNHA 1T22A 1ZVSB 2R0ZH 1WBZA 5I16A 3PL6C 2HXAA 4U3CA 4Z7VE 1LE5B 4IDJL 2C1OB 3HAEB 2ITEA 5DT1L 4XZ4A 5B38A 1IM3D 5T1LA 2MCMA 2ISDA 3SDXF 4D9QD 4KKQA 2JB5H 2EE3A 5CM1A 1KIRA 4XOEA 2NYKA 4BIKA 3QAQA 1S9VA 4QEGA 3ZHNA 1A0QH 4G82A 4ZTPH 2DQTL 2N01B 3ROOA 3NPSC 4IOFD 3MRFB 1XD1A 2NTFB 4POZD 1IC7H 4LSUH 3VNYA 2MRYA 3PUUA 1S5IH 3UX9B 1EVTC 4AVKA 4Z3EA 1BOGB 4G8GD 1HWHB 2GTWB 2WLNA 5AOJA 4YHML 4GEIA 3S34L 2VL4A 4R8WH 1FYTB 3NN8A 1OAQL 1RJZB 3L08A 1PDKA 4I9XA 1CZ8L 1QVOB 2Z93A 1SQMA 4IBYA 3RHWK 4KVCL 5IMOA 3MLUL 4N2DA 2OI9C 2QQLH 3L3KB 3FTYA 1JPFA 2VE6A 1KGUA 2F1BA 3I2CH 2O26U 2NR6A 3G08B 1H8OA 1XGUB 3AREA 4QY8B 3TBCA 3PWUB 1I9JH 1UM4L 4K9EC 4JPQA 5T3XE 4PRPE 1F13A 1QUNA 1YLBB 5KYWA 2QDWA 2EUWA 1IEHA 4ZNEA 3FYIB 3KD4A 1HDMA 3E1ZA 4HXBL 3REVA 4YHKH 5LNEA 3ZKXC 2JKLA 3BMWA 2WWKT 4XC1H 4QRPB 1IC4L 5I74B 3EXJA 2NY3D 5DLMH 4JN1L 2RCSL 5DXWA 3S88L 3ULSB 3VI3F 4KO5A 2M2DA 4WI5A 4B96A 1PLGL 5F93C 2FIKB 3FQ4A 4U3XA 4UYQA 2J25A 5HGGS 5FA3B 2AV1B 1M2VA 2NY4D 5MEND 3CPUA 1IAKA 3IK2A 2NTFA 3IU3B 5JHAA 1NSNH 4PV1C 4Q89A 1QFHA 1P84J 2D3VA 1KTLA 3GBEA 4G1MB 1Z9SA 3OGCB 4GAYA 1RPUA 3BXNA 3MACL 3IVKB 1AC6A 2O6EA 3O2DH 1HHIB 2EUXA 4JM2A 5C7XH 1BMWA 3I9GL 2X4RA 1ZTXE 3QR2A 5CEYB 1JVLA 1KB9J 2YGPA 2ARJQ 4BFFA 5E95B 4FA6A 3AXHA 2NW2B 2O5YL 2OP4H 4IGBD 4JO3L 3ULUC 4UQ9A 4DKFH 4YFEA 1AGFA 3WTSA 4P2RB 4MBOA 3UP1A 3S97C 3C5ZD 3KLDA 3U36A 2CR3A 2IH1A 2V7NB 2IOOA 4YDIH 3VSQA 3VUAA 1M57B 1OEZW 2EXWC 4Q0XH 5D2LA 4PGDB 1O7SA 1UOLA 1XGPA 1FNGA 4FEMA 4PREA 5C0FB 4KRLB 5FX3A 2IXQA 3TN0D 3BPLC 4UQEA 3NZSA 3DETD 1CD0A 1KXHA 4AOFA 2V9TA 4IMLA 5DFWH 3HC2A 1P5UB 2EICA 2WV3A 4IM8A 1YUHB 4UQCA 2CKBA 1CXKA 3TS8A 3B5TA 5T33H 4FNTA 5IHWA 2YA1A 3MRBB 2DIBA 4DGVH 3DO3A 1U91B 4BFOA 3KPPB 3ET9F 4PJFF 2FLRT 2BHZA 4JJ5B 1U8KA 3GSWA 2GIYA 2VLJE 4K3JH 3QUYB 2TRYA 3H42H 1EO5A 4NFCA 1F1AA 1IKOP 1S9KC 3J2PA 3BIKB 4JHUA 4QAMB 2KUTA 4O58H 1P1VA 2N56A 5CXPA 5DJZB 3T77B 1BQ5A 1XIWB 3QIBA 3T4AA 3QIUB 3TVMC 3KPSB 1QSFA 4LVEA 4PRBB 1OF2A 1ZGLP 1KN2H 1SXZA 2HPTA 4QRPE 4TQHA 3F7YA 4KOBA 1H3PH 1PJ9A 3QJZA 2JKJA 2WINB 3BUYA 2AEWA 2V17L 3EJZC 2X3AA 1QSVA 1K8IA 3AABA 3QG7H 3SYOA 5AWNL 1L4IA 1JRHL 2D4DA 3INUL 1RMFL 4OD1H 1YEKH 1Q9LB 1XR9A 2IFFH 4ES8A 4ELKA 3HE6C 3UDWC 1W72H 3QUXA 4AEFA 2YUXA 4XRCA 3GMOB 4N1HB 3U25A 4B9CA 4PJEF 2MPAL 3W5NA 1PD1A 1FC2D 5D5ME 3ARGC 2J6EA 3GKZA 4B6ZA 4XNDA 1I8LA 1ZE3H 1ID2A 4HAGA 3PGCA 4ZQTA 3TBWB 5LCVL 2R1YB 5L0QC 1ASOA 3AS0A 3NIGB 1ADQL 5CLTA 5I0ZA 5ELIA 4H0GA 1O6VA 4H25B 5I1CL 1B6DA 2XC8A 1B3IA 4Y5YC 5J11C 4GSQA 4YC2B 3QJRB 4BSWA 2NNRA 2AI0L 1HHJA 3ARTA 3L3OB 3BKJL 4AK2A 3O4OB 3ZTNH 3JBG7 1JIBA 1NEUA 2WLLA 1A8JH 4XCCL 2QVIA 3QRBA 5CEZL 1TQTA 3V4VL 1OAZL 2FX7L 1TF4A 4YDKH 2KDGA 4YE4L 3HZKB 2NYYC 1EIBA 4PJ7E 2Y72A 4LLVA 5KYXB 2PUQT 3NCYS 2MOGA 3T8VA 4UTCA 1NUDA 2JTDA 4UAHA 1CU4L 4WI8A 2MH4A 3FRPG 2J4WH 1ZV2A 1HSBB 2P80D 4JUTA 4WUKL 5DJCA 5F7FA 3VXME 4BSVB 4ODVL 1QTPA 4P3DB 3SOBH 3WIHA 3NESA 3S36H 4MCZB 5CKAA 3OBAA 3SGJA 1HIMH 3L9RB 5LJYH 4X5XA 3P11L 1GTNA 5FUZL 1XCQA 3EG9A 1YEEH 4PY8J 1KIQA 3B7SA 4CSPA 4O9HH 2EDFA 5AKVA 1BVKB 2FB4L 5E2VL 4HPHA 1C9SA 2IADA 3L4CA 1NPJA 1IB5A 1EZSA 1A5FH 3OKYA 3D12B 2BDNL 3VFTA 2E74C 1E4WH 4Z7WE 1JYNA 2XXGA 5C0AD 1YYLH 1WWWX 5IGXL 1HHKB 3HNSH 5F96H 5KSUA 3O4LD 1R3IL 3N3EA 3TZVD 4AV4A 1BD2D 3UABA 4QPEA 5JPMB 2QFPA 3MRLA 5LO7A 3D52A 5GHWH 2IGTA 3N0PB 3UAJD 1GMEA 4Y8DC 3JTBA 2HRLA 3TEXA 2FBRA 3MJ9A 3CVHH 3LB6C 4KX7A 3LN4B 3FRUB 4WY7H 3UH8A 4S2SA 4TQIA 3ULUL 3GINA 2Z31C 4NQDE 3UG4A 3FUNA 3EDDA 1R24A 4ZAKC 1UWEH 1CC3A 4JRFA 4OGZA 3SCMD 4BWTA 2IH3A 4Y2DD 1DN2A 3HAEH 3X11B 3QJQB 2VXVH 3K0YA 1IZJA 5KVDL 3ISWA 4XT1C 1TSRA 3BGFC 2F19L 5I6OA 1AAJA 5GJSH 1TOXA 2JLLA 3LTVA 1H5BA 4PRHD 1JS4A 4RGOH 3VQ1C 2D3NA 1A7RL 2ZSVB 4RFNC 4X2UA 2AJVL 3TO4C 4OI7A 2FJHB 4HWEL 4JFDD 3RG1C 4BGDA 1BBDH 2CA4A 3VWJC 3KPLB 4TL5A 3HBPA 2WWKO 3IGFA 3U0TB 2WM0A 3MN8A 4PWJA 1CBVL 3PWPA 1HYSC 1HHKA 3L3HB 1WAAF 4JM2D 1WTLA 1AIZA 1NFDF 1TJGL 1XGUA 2WQSA 4LRIC 1BXXA 5AYQA 1J0KA 2FO4B 4TSBL 5FEBA 3JYCA 2UYLB 3CAFA 5IQ7H 1BWMA 4ZTOH 3O9WA 2ICEB 1QBLL 2R69A 1T80A 3DIFA 4O02L 4UINL 3O2VH 4F3FB 4F7TA 3NIGF 1FVDA 3P54A 2YD6A 3OGOE 4WEUD 1G9EA 1NTDA 1IM9B 4XVOA 4ZRGA 5J6HA 3ARSA 3ZX1A 5IB4B 2HKFL 2V5YA 1AR1C 1RH8A 4ZXBC 4P2QB 1JYXA 4OLXL 5C09E 1A7NH 1M2VB 6TAAA 5GS3A 4G6FB 3KZ8A 4P06A 4UT9A 2QGEA 3W9EB 3B83A 3FU5A 2R4RH 3HG5A 3ZDXB 3K6SA 3TIDA 4GNKB 5JQHC 5F7HA 3D0LA 4XNXL 3UPAA 5FO7B 4F7MB 1OWWA 5DRXB 4OAWA 4MNHA 2ZUTA 1GOGA 4ZK8A 1WZMA 1Q9OA 3OKKB 1RUAL 3H54A 2LLLA 5J13B 3B4NA 1A4KB 2Y7OA 1DQQB 4JW3A 4K23H 5LDSA 3L3HA 4V33A 1BZOA 2FNBA 4ODHH 4JQIA 5CZKA 1G7PB 1TPXC 1G7LA 5EDSA 4UDUA 4L8SA 4L8CA 2FATH 4BH8A 3L6FB 3V0EA 2VLLB 4UQ3B 4L3EA 5L2KE 3IRZA 2KT6A 1LO5A 3MUY1 2CKNA 4FQPA 2W80C 3CC1A 3KVPA 1SN0A 1V5JA 4ANVA 4QXTA 4D9RD 1WFTA 3EJPA 2XCMC 5ACLA 3RZCA 1WHPA 3T08A 1CI5A 3KGTA 3P3RA 4JN2B 1QQDA 1OM3L 2C9PA 2PPDA 4KXBA 5EUOF 3MJ9H 1HQRB 4R83A 2CJUL 2QLYA 1BG9A 1E8YA 4L29A 2WQWA 1AG0A 2BRRL 1EV2E 4XVUD 4LNRA 1V3KA 1KWKA 5EEWA 4JHWH 4G59C 4NN7C 5E03A 5SX4I 2EXYC 2AMGA 5DJ8B 1GS7A 3CHRA 3SD5A 3OAZH 4RBPK 1TZAA 5EOQL 1ZANH 4UT7H 4F92B 3HS9A 2DPKA 3KG5A 3V6FA 1N8ZA 1WPCA 3E7JA 5E08L 3U4EA 4S1SH 2PWFA 5I15L 2WQVA 4WFHD 2YPKB 3FQUA 3K1KC 4I89A 4D94A 2ED8A 2FQDA 4LRNH 3LKRA 4JFHE 4OFIA 1S3KH 4JPVH 1UA6L 3SGDI 3AU0A 1E9PB 5BS0A 3B56A 1Q9KB 2R69L 4GT0A 1P4IH 4BFJA 2NUTB 2Y6TE 2D03H 2BCKB 2P8LB 1AGDB 3K46A 3QFJB 4MXWL 1DN0A 3UC0H 3FH8A 4UQBA 2XV6B 4PR5A 1JZ4A 3QDHA 4XWGL 3WI9A 2EDWA 1RZKL 3WGUB 4ZX3A 2OLDA 2HFEB 5E94B 1BVZA 4WI4A 3WUZA 3NRFA 4FABL 4ADGA 4LKCA 4BK4A 3F7PC 2W65A 3C6LB 3OHMB 1AG6A 1HXMB 3O9WD 4V1DA 3C5SB 5BZWB 4ZMAT 2ZAIA 2F6AA 4FZEH 4DOHE 4JAMA 1OE3A 4FF9A 5I17B 3BKYH 3MO1A 4G8GB 2I9TB 1N59B 3BT0A 5CO1A 4DT2A 1WICA 4LZKA 4PJCB 1YEGH 4CA4A 1M3JA 3BP7B 3BKCH 2G5BB 1JCVA 1L9MA 4N5ED 4PJ5D 3ABZA 5EF1A 2K9UA 3JWDC 4W9ZA 2E47A 3ABGA 1I75A 3U1QA 3U4BH 4H0LC 3HN3A 5JDSB 3IJYB 4I87A 1RURH 4LMQE 5E6YA 3FQUB 3TH3T 1CDGA 3VD0A 4NM8L 1WFMA 3A67H 2XWDA 3WY2A 4IRJC 4H7VA 4KMTL 4XX5A 2AJSL 1WTGT 4R3SA 4HOMA 1G43A 2CQVA 1EPFA 1JNLH 3BD3A 3KYMA 1MEXL 3QR0A 4JFFA 5IHZB 1E65A 1RU9L 4WI2A 4E9LA 2J5WA 1BD2A 2DQDL 3QCUH 5CP3A 2PTTA 2DQFA 3OLDA 2CO7A 1KN4H 1F4HA 3NJFA 1SHMA 3L95B 5D2LF 4BSVA 1B4JL 2ZOLA 1KYAA 4JQIH 3D2UB 4L3FA 3WNPA 2Z7YA 4NRYA 3OAWA 2G9HA 3C9NB 1HI6B 3AJ7A 4G5ZL 4TPRH 4LP8A 3SYAA 4LLQB 1BSIA 4JHVA 3DTXA 4O2FA 1WVZA 3ARGD 4ZW8A 2UWEE 2OMTA 1LD9B 1CFVL 1OARL 4HLZG 1I3GH 5DD3H 3KS0J 1JPGB 4G7VH 4R4NC 1C1EH 1NAMB 4JFYA 2JFCA 2MQ3A 2HX9A 3SKNA 4NZFA 4MJJA 1IO4C 5FA4B 4L05A 3QIWD 1N64L 2LW3A 1XVSA 3PAVA 4AL8L 2ZD0A 3BP7A 4ETYA 4QGYA 3PWVB 1KCUH 1WZ1L 3OAYH 2IVFC 5I8EA 3AY4A 5BRQA 3L54A 1V7ML 3MV9D 1YPZB 5IESH 3QFDA 2ZG3A 5L6YH 5I73B 4ADIA 3WJJA 4NKIH 1BBJA 4QHLA 4P2OB 1F97A 3FO1B 2Z6FA 4L1TA 5A3ID 1BQHB 1R19A 4JHBA 4FLSA 4H2AA 4NN6B 4I0KA 5BW7C 4JFVA 1R46A 1F3JB 3GT6A 1NMAH 3RRQA 5C1MB 1UM6L 4MA8L 4WFGD 5G2NA 4AKOA 3RGVB 3ZVVA 3WCYA 2ZCKH 4JLRA 3KM2A 5T8IA 1T83C 1A1OA 4K3GA 4L4TA 4C4BA 1F58H 2ZE0A 1R75A 5HDBB 1NOAA 3EHBD 3M8OH 2Z8WC 4PD4K 3PXHA 4WGKA 2Z7WA 2G9HB 1T5WA 1A6ZB 3QEQB 1K2DA 3QZMA 1IGJA 3AU1A 3MRKB 3ZDWA 1V05A 2O6FA 2YA0A 3KLAB 4JMNA 5G4OA 3OKLA 4IOIA 1EBAA 3ME0A 4MMYB 2JI2A 4KMQA 5E2TL 3QC5X 5C09A 1K6QL 2XBTA 3DGGB 1T4KA 3BUPA 3B9KD 1T1ZB 2WN2A 4HMDA 3FQXB 4NJAL 2NY5H 2AQNA 3BESR 4L37A 5KVGL 3RWIB 1DVTA 3FO2B 4UTBA 5ALCH 2XVBA 4P5TB 4DW2L 4Z77A 4L3CB 1TYRA 1VZHA 2BINA 2XJKA 3SKOB 3TPUB 4OIBA 5KAQF 5KSVB 3U4KA 1PTZA 4DF9A 5IOKA 3HE6A 3UDWA 5FPIA 2PTUA 3D50A 4AV5A 4C83B 3RL2A 4JJOA 1NGWA 1VIWA 2R7EA 4M4RB 4BA0A 1OE2A 3FU6A 4KXCA 1A22B 1P6AB 4JLRB 3EOYG 1PZ5A 2H2SC 5PCYA 1N67A 4L3ED 2RIKA 3T09A 1YEDA 3MUHL 3BSZL 2DLFL 4TVPE 1WUZA 3PWJB 4IEFA 5ECJE 1XD0A 3DX9A 1NBVL 2Y5TB 5ANHA 3RVVD 4KZ0A 2KH2B 4DGIH 1CFMA 1DUYA 2KQMA 1BEYL 1NCDH 3RZCD 2AV7B 1S78C 1D5MB 2Q76A 2CGYA 4DZBA 2I85A 4QYOB 4XNQA 1FLTX 3V4PH 3FUIA 4PLNC 3BH9A 5ID1B 3Q8FA 5EF3A 3NCBB 5EZIL 3IPEA 4GRLB 1JPEA 4FFYA 1H9VA 1GY2A 2L04A 2RJMA 4AT6B 3LSOB 4WEBH 4OT1L 3ML8A 3V0DA 3KE0A 3WNNA 4URTB 5MP6L 1ED3B 1J1OL 1MJUH 2PETA 5CJBA 1CLOL 4GAYB 3IFNH 4J27A 2NSXA 1JI1A 1Z5YD 1WG3A 2R0ZL 1J8HD 5AEAA 2NX5A 5GRYA 1E28A 5EWIH 4HG4K 5EFIA 5FA3A 2JELL 2DWEA 4WKZB 3B9AA 1U9KA 1PKQB 2VDQL 2X09A 2XBDA 1BAFH 3PP4H 3KJ6L 5TGBB 5BO0D 4YDMA 4DK6A 2FD6L 4WV1A 1JSYA 1BM7A 3BD5A 5AENA 4M6NL 4ELMF 1E27B 2FECI 3IDNA 2KQNA 3O6KL 2XZCL 4TL4A 1A0QL 3QIWC 3ULAB 2DQTH 4N2IA 4YPGA 5GGQL 1OP4A 1VPOH 3AUVA 1D9KB 3D06A 3E3QC 4QXGH 1WV7T 2VR6A 3I6KB 4Z7OE 3IETB 5E6SB 3VMPA 4R4FH 4J28A 5DJ0B 1S5IL 3LPFA 3TN0A 3TJPA 1AP2B 1GZHA 2MKWA 3PL6D 5KS9B 4YDLB 1J7VR 4K7PH 2ZUQC 1OAQH 4R84A 4OCXH 4PFEA 3VGBA 2PCPB 1A6TA 2TSAA 5JIHA 3TWCH 1AMYA 5HYJA 3MCKB 2VMCA 3U6RB 1IGIH 4XCNA 4Y9BA 2C4XA 4HUWA 2OMWB 1T0MB 4HS3A 5FW6A 2IWFA 5T5FH 4G8GA 2JTYA 1MI5A 4G1EB 5C09D 4S10A 3WO4B 4E9WA 4KQ0A 4NC0B 4DZ8B 5CD5C 4MJ5B 2UXGA 3QI9A 1GGCH 4JX0A 4RAVB 3DVGB 4P9MH 4W9FC 4XAKE 3K2KA 3S7GA 1JV5B 3JZYA 3WE1A 3NJVA 2EVJA 3C6SB 3ZTJH 3MUGA 3WTUA 2Y6SC 2E9BA 1JGLL 1THCA 5DJZA 1TQBC 3BPNB 3DXAA 3K8KA 3T0XA 1L9OA 2A5UA 4B7LA 2YUZA 3QE5A 3HFML 2IANB 4PREB 4EDXB 5EO9B 2FJFA 5K9QI 1N9PA 2EVFA 4MBRA 4TLTA 3CFKA 1QO3A 4GXVL 3LRHA 4JZJC 5HJ3A 1AVAA 3PV6B 5BNXD 5HYSG 4YEFA 1GYWA 3MSPA 3VWJB 3RX8A 4TQ8A 4JKMA 2BVOB 1YN7A 2JIXD 1FVEA 1VAHA 5T3XH 1IT9H 5T1DH 4X4YA 3QQNA 4RGNE 2F2HA 2D7QA 2WKLA 3C5ZB 1A14L 1IGYB 4LOEA 4M1DL 2J43A 3FUJA 3SPIA 4HMEA 4U1IA 1M7XA 1Z0NA 2D2CC 5EC2B 3G6JB 4HFWB 4BHUA 4ELDA 1QA9B 4OFPA 4OLUH 4YAQA 3GUTB 2R2CA 4C57C 4NZJA 2QPSA 1EMTH 3BIKA 1XGYH 3CN4A 2IH8A 3KCPB 1P7QA 3M07A 5TF1L 4OF8A 1G6RL 3PHOA 2E27H 4AIEA 4UZUA 2DJSA 4KKBD 1NM9A 5DD6A 4PN6A 1CG9A 3AXLB 3GXDA 2WXGA 1S7WA 4DN3H 1URIA 1R3KA 3FCGA 5JO5B 4Y9GA 4HX1A 1FGVH 3JVGA 1MRCL 4C55A 5JIDA 4TSCH 1BZQK 4L4VD 2IANA 5TFSH 5IQOA 3BHBB 3DTDA 3PS6A 3HR5B 2W91A 1AO7E 1EFXA 4AYSA 5CD3B 3PWUA 2VC2H 5C6WH 1A66A 1ILSA 3ILPB 3P9LA 4JO2H 1JGEA 1VCBC 3SDYH 3VD7A 3H1ZA 4PJIB 2AP2A 2X6CA 5FYKU 3N44B 2V3EA 1R5VB 4BE6A 4UOZA 4DO6A 4ODUB 5GS1C 4JFXB 4LL1A 1NDGB 5IB1B 3LRSB 5E5LA 1BLNB 2CBMA 1JGDB 3ZYJA 3U0WH 4W9EC 3MAWA 5IJKA 1ZS8A 5KJ7E 2X4QA 1AKJB 3CVBA 3FCSB 2A6KB 1TQWA 3HHSB 3SHSA 3EH4B 4MVBD 5D9SA 5IBLD 1PAMA 5T1MB 4FDWA 4UBDD 3ROLB 1J5CA 2IIJA 1B6UA 1SYVA 5EC1B 5AVYB 5C08B 2XKUA 1C12B 5HVWA 2MOVA 5ITBL 1JZEA 3RFRA 1HJBC 5FYKE 3IM1A 4Y5YA 4HPOL 1PZ2A 2FGZA 1HILA 3UTTB 1FFPB 4YDJB 3Q8CA 2VITB 3C60B 3F7VA 4IBVA 5IKCA 3MGOB 1HHHB 1S7RA 3CXHK 3RGHA 1YRKA 3PNWA 4U1GC 3IJHA 5DRZA 4U33A 1A3RH 2CMRH 1WBXA 4GYBA 4A38A 1WS8A 3ARFC 4XPBH 4ZQKB 1LO4H 1GPOH 1BYOA 1YNLH 3Q6FB 4RFEB 4ZUVA 3T9WA 1MQKL 3DPDA 5I1CH 2A9NL 3FQTA 3B2MA 2XG5A 3NABL 1VFBB 4KRMB 4WWOA 5DVKA 3KWWB 4NUMA 2ENYA 1A64A 2RBLA 3VDAA 1UT9A 1ORQB 4XB3A 4JM2F 4NAJA 5GSRB 3ZT5A 2F8VA 5C6PB 4K5PA 5I1HH 1I4FB 3P73A 3RDJA 4RDBA 2VDPB 2YRZA 1LNUB 2WXLA 4XXCA 5IEKB 2F18A 4WK0B 1O7VA 3ZIYA 2WXJA 5KVFE 3RWFB 4FFZH 3BDYH 3D85B 4NT6A 4MXQD 4OZGF 4FP8L 3IKKA 5DCCA 2JJVA 3QUYA 1YCSA 3AS1A 3T0WA 1E4XI 4GQ9H 4U7SA 5TTRA 4HWBL 4LIQE 3VWJD 4RAUA 2HLAA 2QADC 2FX9L 3N44F 2YD9A 3QIUA 4ZX6A 4W4NA 4PGDA 5EZLB 3S37X 4N4YB 1H3XA 1OGTA 1M7IB 3PWJA 4X9GA 2NYYD 2P80A 4ZQKA 3PQYE 3GK8H 5F1IB 4JRYA 2F58H 2A6JA 3BOVA 3SDDC 5I1EH 3U0PA 3S3PA 4XCFL 1F3DH 4EO5A 2BDNH 2Z31D 3IETA 1E4WL 2AVFA 2ED6A 1JD7A 1AXSA 2QV4A 4YXKH 1ZAGA 3TONA 1Q9LA 1XR9B 2WSDA 1NPUA 4IRJB 3QEUA 1SXNA 4KZCA 1U92A 3DO7B 2P46B 2X9YA 1U58A 4KPHL 4ATTA 5HYJD 25C8H 5FGRA 5GHWL 3DARA 3O2DA 5D1QB 4J3OC 1HKLH 2XTJD 2PYFA 3HJEA 4WHDA 1OP9A 4PPTA 5T1LD 1EJFA 3CVHL 3QH3B 2OX5B 5AAPA 5C9JB 1AKPA 1LP9B 2C3WA 4QJ5B 2A0LC 3RWCA 3APFA 4KZEL 3X3GL 2JLPA 1QLFB 5TD4A 5IB2B 1UWGL 1T7YA 1YAZA 2Y7QA 2JJUA 3V9EA 3V0GA 1H3TA 1GOHA 3TTYA 2I7OA 4LSVH 2BNQA 2EYSB 2WQAA 3DVGA 5ADPL 2P28B 3JT0A 5JIPA 3IMBA 1AQMA 5E6IB 1R5IB 2BIHA 1G0YR 1TLMA 3F6LA 4YX2L 4FQXB 2AK4E 1SJVA 1HVXA 1ONQB 1SMAA 5ACMA 3SBWC 4XXDA 2VDPL 1BVOA 3GO1L 5ERWB 4BQ6A 4NNXB 4ELKB 1LILA 3G6AB 3BKML 4G7YL 3WLWD 5LNGA 4OZGA 1TYEB 4FX5A 4NOFA 4K3EH 1A7BA 5D70L 4TULL 2OZ4A 2BFVH 5J6HB 1JV2A 1M3IA 5EO9A 4HBQA 4FCHA 1QI5A 1HT6A 4ZUSB 1I1CA 3GSXA 3MRPB 1DANU 5INDB 4LPUA 5KYUA 5DJYA 5ESVA 1I8AA 2R59A 3E9TA 3TBVA 5C0CA 5DS8A 1YSOA 4WU5B 3L9EA 2W0KA 3EJQA 4KOCA 4JDTH 5I6PA 4CVXA 1XFPA 4PJDE 4HIJA 1NGYA 4P04A 5C8JA 1I3RA 2J7LA 3D0LB 2Y2WA 2ZYRA 1ID5I 1DDHA 3RAJH 4DAGH 1DVUA 4ZTOL 1JYVA 2OW6A 3L5XL 4NO0D 3AG2B 2FQEA 3SQOH 1UXWA 1SXSA 1LMKA 5EO0B 1EDQA 5TK4A 1T6WA 3D39A 3MZGB 4XP9H 3LRGA 4ZT1A 1EERB 1VACB 3C6SA 2R0WH 4GP4B 4IOSD 4JY5H 1FZJA 3GBDA 2PPAA 5AVRB 2Q6WA 1CK0L 3PF2A 4X83A 3CFCH 2W38A 3QUMH 2WBJA 3WSQL 1E6OH 4UQ3A 2WKOF 2HLEB 2DLTA 4Y1AD 2CM5A 1R3HA 2GVYA 2XN9E 4I7ZC 4X5LA 3AQDA 1E90A 1IBGL 3B43A 1D6EA 2BY1A 2YAEA 4CBZA 4ES9A 4L4VA 1BZEA 4RGMC 3GD1C 1JI2A 2X6MA 2Y5EA 3GMLB 1GW0A 2FWOB 4NQED 4RQQA 1YPZF 3UZVA 2FNWA 3R8QA 3C5ZA 3KPQA 4HVBA 1IGML 1ZMYA 3LIZL 4F33B 2PXYA 2DBLH 1NGZA 4GI9A 3JWNG 3O3AB 4HWZB 5EBMA 2ROXA 4TNFA 2WXHA 2JMRA 2IALB 4MX7B 1LO0L 3ZE1B 4KTDH 3PNRB 3HNVH 1GAFH 4RVBA 4OF7A 3VFTB 1UXSA 2ATAA 5J8OA 2BWIA 2EDLA 4RRPA 5D7IE 1Q1JH 4D9QE 1ASPA 3UPRB 2OTPA 3FFOA 2QSCL 3KGRA 4RA0C 2G5UA 1CURA 4WU7A 4N9GB 4LOVA 1GR7A 3S3JA 2M1KA 3OKEB 1XQ4A 2WZ0A 2XV3A 5BVJA 1IQDA 2GJPA 3V0HA 2HJKB 4NQUA 5LBSA 2X9XA 4PR5B 4FNRA 3X13A 1IGCL 2BSCA 2CO7B 2WZPD 1ZLVH 3HG1D 2XY1A 4NIYE 1T20A 2X2IA 1OAUL 5EOQH 2CCLA 3GBNH 1HE7A 2DQGH 4NC1C 5G5DA 4HKJA 1CL7I 2HLFD 4WDIB 3OAUL 3VI4B 2LAAA 2M26A 4WGVB 3CLEH 1CD1A 2MNUA 4ZZFA 5HYJE 3P0GB 1XGRB 2B4CC 2A9DA 5E6RB 4U0QB 2EDYA 3R4DA 2DI7A 4IBLT 1NGZB 3BDBA 2PABA 2R69H 5A3IC 5T1MA 1H8SA 4XXWA 2OMYB 5A6LA 5GSRA 3EZJB 1RZ7H 4OD2A 4L9LB 1KBWA 1RUKH 1PCSA 1FO0L 3CG8A 1EJ8A 4O02B 4XWGH 1EO8L 5ACZA 1GYVA 5AZEL 1UZ8B 4AE1A 5I1LB 1PG7L 2XN9B 3TV3H 2CGRH 3OKMA 3VFMA 5C0EA 4AX3A 4EE2A 4BKLA 1A7OH 5HYIA 1RJYB 1EBPA 4ENEC 5FO2A 4H8WH 2Y25A 1N2RB 1PYWA 3WEBA 2WVTA 2HFGL 3FFCE 3MMEB 5F88A 1BQLL 2GSGB 3DI2B 4PV9B 3K72A 3IJHB 4P3CL 1AANA 1X5AA 4FFYL 3VXNA 3NIDE 4R90H 4DKEL 1KPUA 4H1LG 4L1HA 4QO1B 1KTJA 2WTOA 2R27A 1N5YH 3VG0H 3DX7A 3LPOA 1KB9K 4HJ0C 1PX8A 1J1PH 1A6PA 5HDWA 3MLSL 4PRAB 2C1OA 3HAEA 2FQGA 3U4BL 3KL3A 4MNQD 1K5NA 5ICZB 3SCMA 1CS6A 2NY5C 4WSKA 4D8OA 1VCAA 4G8EA 2W07B 4BFRA 4XVJL 2QPFA 4QNPE 3EYVB 4HJIA 3GI8L 5CUSL 4JZOA 4KJPD 5F0MB 4P3WA 3CCHA 4MCNA 3BZDA 1RPKA 1ZEAL 3MKGA 4MCYA 2XN2A 2B2XL 2IDSA 5HHMD 1YMHA 3F85A 5BUGA 4O02A 1F2QA 3M1BB 2XZAL 4JCWA 3ULSA 1RI8A 1ETZA 2VR9A 2VDQB 2AQQA 5D1QA 1HWWA 2UUDK 1JXKA 1T1ZA 2G3XA 2XRAH 5BO1L 2GI0A 3NSCA 1NCAH 2Z7UA 5CIPA 4F7CA 1QFUL 5HGHA 4JFUA 4GINA 4MD5A 5DD0H 4ZSOB 3C8DA 5E7BA 1MHEB 6PAZA 1E30A 3II3A 4FL4C 4TVSa 2B39A 2UV3A 4A7GA 5F7WC 3PGFL 1DBKL 3G7TA 4PLJD 1MNUL 1XH3B 3NTCH 2AZUA 2TRHA 2FLMA 1ZE3C 1J12A 3R0MA 1B88A 4M7LH 4D9LL 3RVUD 1BOYA 1EXUA 5HHXL 1R5IA 2Q8BH 1E6JH 3DX1A 1H15A 1IKFH 2BHYA 5EORH 1DQIA 4X6DF 4NSKA 4JVWA 4UT9H 1X4XA 2YARA 4K73A 4Z6AT 4NKIL 3GZPA 4PW3A 3BT2H 3FSOA 4HDIB 4DZBB 1U58B 3WTXA 2MCAA 1G87A 4HUVB 5CD5D 2JV6A 4X80L 1FG9C 5D1XB 3EYFB 1WD9A 4WI0B 5CR8A 2OA9A 1WA2X 3PLYA 1MCBA 4JJ5A 4LAQH 3G5ZB 1F42A 4NUJA 3JUZA 1AGEB 5CCKH 3BXNB 3TJEH 3IVKA 5EBWA 3MRBA 5I8KH 1JNHB 2XDHA 4Y2DA 1NPNA 1E67A 1MUJB 3FCUB 1MREH 4E9SA 1I8KB 3ASNB 3ZT6A 2YZ1A 1FE8H 3CMOH 1D5IH 5DHDA 3RL2B 2B4CL 5JPMC 3VFWB 3O3DB 4GQQA 3OMNB 1S78D 1G5AA 1CFTB 5E2TH 1L9NA 3QGVA 3ATDA 5IM7A 1GGUA 1H0DB 3BUYB 4R5TA 3WD5H 3ARDC 3AITA 4LB8A 3L2NA 2YAPA 3D34A 2VMFA 4IKIA 5JW3L 1YEDB 2X6UA 3TBBA 3C6LA 3W9DA 1P7HL 5T3XD 3CSPA 4RMVA 1E5BA 5HHPB 1L5GA 3T71A 3VG9B 5J06A 3CFIC 3OZLA 4ZPVB 3HR6A 3VFUB 1Z3RA 4XP5L 3W2DL 1NCJA 4YSEA 3FUMA 3MOAH 1I31A 4XCNB 1U6AH 4FTVA 1GIGH 2F74B 3M7OA 1KYFA 2ZYIA 4J3OF 1DQTA 4Z7UF 4YPJA 2KDYA 3UOAB 3IFLH 1IFHL 1P4UA 3DHUA 1BFOA 2AXJA 1DBAL 3F8UB 2A9AA 1AFVL 3SPVB 4XN7A 3CDZA 3VJ6A 1F86A 2IDQA 4WK4B 4KAQH 3QEQD 5GJTL 1TZGL 3PV7A 3HB3D 5LBSH 1UVQA 1JRHI 4E9QA 1CT8A 4YVUA 2VGLM 3L2LA 1AZVA 1I8UA 3GRBA 1MW0A 1QFWM 4FMKA 4QOKB 2DM4A 3F58L 1I7ZA 3V4UL 5TDPB 4CVZA 1WLHA 4X0KB 2BP0A 5IQ9A 5JIQA 1P6WA 1VFAB 1O6SB 3V7MA 1KGJA 3D2UA 2HRPL 2K7PA 5HI5C 1FIGH 4JPWH 1MCJA 3Q1EA 3VH8B 5MENE 3UCRA 2VH5L 5IBUB 2IBZX 2YO3A 4Y5XC 3SO3C 1NGPH 4XP1L 3EHBC 4HCRH 4HXAH 2CJ3A 3QP3A 3DMMA 3MUGB 1JK8B 5DC4B 5J56B 3BZ4B 2AGJH 4PJHB 4N68A 3SKNB 3BGAA 3OM3B 3VXRA 4C56A 4DP4X 4TVPL 4NHUA 4W68A 1BQSA 2E8YA 4X6EB 5FYJD 4OJFL 2ED9A 3FXIC 1BVLA 4MJID 1SDAB 1LO3L 5GZNA 4ANXA 5F3BA 3M1OA 2DQJH 3S8GB 3S35X 2UZIL 1NEZB 5D7JA 1UA7A 1F5WA 3K81A 5EC2A 1BXAA 3BVTA 4IBQA 1MCWW 5MI0C 1VGKB 2APVA 4PGBB 5KANI 1AE6L 1MPAH 4ZX4A 2EZ0C 2WW8A 3BZ5A 4NC2B 2X70B 1XF2A 4UUJA 4Y0GA 3TBTA 4AQ8A 4ZO6A 4YDVB 4RH4A 3KPSD 4GKSA 4M7LT 3M45A 5K33A 4IU2A 1S7WB 3HB3B 3ZZLA 3L4XA 5AKRA 2EADA 1KG0A 5T3ZH 2AEQH 4PV9A 3JWOL 5B8CC 2VLKA 4GBXC 5ENWA 1RSFA 3IMVA 2CR0A 5C0JB 4DUVA 4NQEE 2E0PA 1DQDL 2NZIA 3ZHFA 2WO3B 4MYPA 4X99A 3RGVC 3KMDA 2WXPA 2DQHL 3I2CL 1B0GB 1NKRA 4G6JH 1HOCB 4D2NA 1ZHNB 3X11A 4BDVB 4KVNL 2F53D 1FVEB 3C09B 1H3WM 5IJVA 2BHFA 2WVSA 5J9PB 3U2SB 1EEZA 1PNCA 1HNGA 1SBSH 5E9DB 1F4XH 2E7DA 2VM4A 4LCIL 1AHWA 5E51A 7FABH 2X28A 2H8PB 1H5BB 3UERA 5AL8A 1IC4H 4CUCA 5DLML 2ZF9A 3F12A 4MJIE 4E0RA 1A2YB 1GL4B 2E4TA 4HIXH 2F7PA 4P5TC 4HIEA 4QCIA 4K9EL 5FYJE 3CC5A 2EKSB 3WIFB 1XF3A 4AM0Q 4NPYB 4H5SB 5E5UB 3S5LA 3WAJA 3BN9C 5IBTH 4AZ8A 3VYOA 4MD4B 3GFUA 3ZW3A 5IOPA 3H3PL 5L88H 4TNEA 1NINA 2BOBB 1XDTT 2CIKA 1CDUA 4N26A 4XX1E 3O2DL 1EGJH 1FFQA 1IT9L 3RWGA 3VYPA 4M4PA 3A3YB 5I28A 3IU4H 1A6AA 3FTZA 4OZHF 5EUKB 4WW2F 1K4CB 4KXZI 5A2KH 1MRDL 3GTTA 2ORBH 4PVBA 1JP5A 4I8DA 1AQKL 5IG7A 2LTQC 1T04A 3EBAA 2B08A 3C60A 2Z93B 2YD8A 2F68X 1FO0B 3NCCB 1D6VL 2X41A 3IDJB 4PTUA 2E3VA 3EOAB 2CBTA 4G80A 2R4SH 1ET8A 5DK0A 3TOPA 2ILLA 1T7VA 3CHOA 1SF3A 3VVWA 1TQBB 3VFPB 3QEQE 5CJQH 3C6LC 3P2TA 1UYWL 4A6YH 3DK0A 3PWLA 1XH0A 5DMGD 5IQMA 4M6MH 3S3DB 1DQML 3A21A 3QZWB 3FCSA 3KL5A 2JJSA 1MRCH 2IAND 5BV7H 2AJ3B 4X6CA 3UO1H 1KB5B 5CU9A 5ALBH 4F57H 1A2YA 2OCFD 3RVTC 4XMPH 4K55A 2LR4A 3G6DH 3UP6A 5EIQA 4GW5A 1JWMB 5L8JB 4LLDB 5F7NC 3Q48A 4JKPH 1USZA 2WBKA 2I32A 1G94A 4Y2DB 3AWGA 3QRGH 1U8MB 2KMWA 3SO3B 1RIUH 4QLWA 5M95B 1CFNB 2K6WA 4XOAA 4QRQA 4I2XB 1HHHA 1S7RB 4AYID 3I6KA 1F41A 1JV5A 3HKZA 4N0FA 5DGRA 1WYJA 3Q7JA 2WN3A 2H1LM 2UZPA 3GZOA 3VDCA 4A7VA 1I7TA 3T0VA 5K93A 3ZY7A 1J9CT 3KDMB 3FONB 3LKSB 4OGAD 2L8AA 3AREB 3MV9E 4Q9QL 2PO6D 3NRPA 4YEEA 1FAIL 2KPWA 3MBEC 5DJDB 4GG6A 3HA0A 4YFLF 5AG8A 3TBSA 5KTEH 2F5BL 4MDJA 2BC4A 4P2QA 4GXFA 5GSVA 3D25A 4AM0B 3I9IA 3LQAL 4BCXA 1ETJA 1SM3L 5EH1A 5EIIA 2APBA 4N0RA 2V2XA 2EAEA 1TG8A 4Y16D 3HE7B 5AW7B 4I77L 2FIKA 2Z4QB 5HVFB 4PJBA 2PTVA 3HUJE 2AXWA 4PJGE 3H3BC 1PFOA 1GY1A 1FF5A 4XGZA 4XBEH 4PJAB 5TE7L 1RZPA 4AYMC 4NQEA 5B39A 3SEPA 2NT1A 3IWUA 2ZCHH 1YHPA 1MCNA 2GSIA 5GGTL 4W93A 3MUZ1 1W8OA 5GRJH 3ABMB 1CE1L 3PE9A 3Q8BA 3BJ91 1HHGB 1JBJA 2ARWA 1WWBX 2NY6C 2VISB 3NYKA 4PRPB 1QSFD 4KUZL 4B9PA 1QFPA 2A38A 2AI0H 3PPSA 4D3CL 5JMRA 5JIIA 1YNKL 3MNMA 4ZOBA 5GGRA 2DYPB 4I0CC 3D2TA 1JDCA 3SE4C 1XGQB 3ZE0E 1G0DA 5F0JB 3FTGB 3NJNA 4JZJB 1OT1A 4S0HA 5BPPA 1JHTB 1Z9MA 4L5FE 1F4AA 3NJHA 1OAYH 3IJ8A 5AW3B 2A1WL 1KPRB 3TO4B 3LCYA 4XN2A 5C97A 1YUHA 2YS4A 4B0MM 4QXWA 4ODVH 1DL7L 4MHHI 4YLCA 3SOBL 1NWPA 4KY2A 3HZVA 1CYXA 5HGBB 4TQEL 1UVQB 4GQPH 5KG9A 4BZ1L 4XZUB 1CXHA 3OR7A 3DHJA 2AQ1A 4K07A 3OB0K 4LU5H 2CNYA 4KJYB 1NQBA 4KJQD 5ABZA 35C8H 5HD8D 1D5BA 1T5XB 2YMOA 3NEEA 2K4WA 1E2WA 4MRBA 3FUEA 4UTAH 5I1EL 5DEGA 2QELA 3HE7D 5AUMA 5ES4B 5JO5A 1DZ0A 1ECYA 5I1GL 1H6TA 3QG6A 3B6SA 3KPSA 2HTKD 2KLTA 3V10A 2LFEA 1S7QA 43CAB 2X4OA 3VFVA 2R29L 2Z65C 1L0XA 1Z3GL 3VXPA 2HFEA 4HK3N 4N25A 3SPHA 3MLWL 2ZWKA 1M1XA 3HNTH 2PWGA 4N5EC 1RIHL 1W6WA 4DFIA 3FQWA 3M46A 4M5YH 3S96A 1KC5L 4EZKA 1BF5A 4Z7OF 5B38B 3NQIA 3T3ME 4P5MB 4QRRB 4JGMA 2KBGA 2IQAA 3CMGA 4RQQB 3UZVB 3CN2A 1OCRB 5IVXF 1TR7A 4YMPA 2J5LB 3UTZA 5DMKB 5KVEL 2OTWA 4YHLH 3IXTA 3POCA 3WIAA 4H20L 5FB8B 2PLTA 3ULUH 2JJTC 1FBIL 3T0EB 2ITDB 5E5MA 2W9DH 2O5ZL 2J1ZA 2QQQA 3TNNB 1QR1B 4K7FA 4IYKA 2P5WB 2I60H 4FYSA 5JR1H 1E5ZA 4HEMA 5A2IH 1FWXA 3ULVF 2H8PA 32C2A 4ACPA 2FEJA 1L7IL 3G9VA 4PGZA 4V2CB 4D9RE 1I8IA 2FYYB 3BKMH 2X12A 3L7FA 4I0PA 3ZQ9A 1Z9OA 1FL3B 3DWTA 5FF6B 2XA8H 4FQHA 3WXVL 4K4KA 3VI3B 3IDGA 2BZCA 4WWKB 4PMFA 4FKEA 3L3KA 2AAVA 2XNAA 1QEXA 4MWFB 1BBDL 3AREC 2Q3AA 4NM4H 3SKMA 5CP7B 3ZL4H 5IVZB 1FYHB 2PYEB 1RULL 1KXVA 3TZVA 3L95A 3P69A 4ZS7L 3BUQA 1NFIB 3JTSA 2UZYB 5I0DA 3OKNB 1FNSL 2N59A 4FLHA 4GRWF 4LLUB 4PB0H 4PRDA 4X42A 3VGDA 4OSUH 4X4ME 2IG2L 4HJGB 1NCGA 2KZWA 3C08L 4FQLH 2Q10A 4LDLB 2X4UA 3LEYL 1IBYA 3B9EA 1NWOA 3GBLA 4GRMB 3ARBC 1W6LA 4FLOA 5CSGA 5BMFL 2ERJB 4UINH 1G7QA 3EOAA 3HE7C 2Z92B 2VSKB 2XOTA 1CK0H 1KENL 4B3EA 5GGSY 1FH5L 4AGMA 2NXYB 2AV1A 3QUML 3S0PA 4AWJC 5MEOB