2Z7WA

Crystal structure of h2o2 treated cu,zn-sod
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
151
structure length
151
Chain Sequence
ATKAVCVLKGDGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAGPHFNPLSKKHGGPKDEERHVGDLGNVTADKNGVAIVDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTKTGNAGSRLACGVIGIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Cu-Zn]
publication title Crystal structures of H2O2-treated Cu,Zn-superoxide dismutase
rcsb
total genus 34
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2007-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2z7wA00
1COBA 4OJAA 3SODB 3PU7A 3KH3A 5CU9A 2WKOA 1P1VA 1XTMA 3KBFA 1DO5A 2Z7YA 1YAIA 1IBDA 1PZSA 3F7LA 2APSA 4A7GF 1CBJA 2AQRA 1BZOA 2Z7WA 3CQPA 4OH2A 1E9OA 1XTLA 1RK7A 1F1DA 3GZPA 3GTVA 1SXBA 1TO4A 2WYTA 1ESOA 1N19A 2NNXA 3GZOA 1MFMA 1OEZW 1TO5A 4MCNA 2ZKWA 2XJKA 3HOGA 4N3TA 3RE0A 1IBFA 3H2QA 1PU0A 3CQQA 1F1AA 1E9PB 2LU5A 1HL4A 1SPDA 2V0AA 1EQWA 2ZKXA 1F18A 2XJLA 2Z7UA 3KM2A 2AEOA 1FUNA 1IB5A 1JK9B 2E47A 5KBKA 3ECUA 3L9YA 3HW7A 3ECWA 2AQTA 1YSOA 1CB4A 2WZ6A 1JCVA 2C9VA 3HFFA 1UXLA 2K4WA 3MKGA 1E9QB 1N18A 3KM1A 3S0PA 4N3UA 2Z7ZA 3K91A 4L05A 1B4LA 2WKOF 2JCWA 3F7KA 1SXNA 3KH4A 1L3NA 3T5WA 1SXZA 2R27A 2VR8A 2VR7A 3LTVA 1SRDA 2AQSA 4A7QA 4BCZA 2WZ0A 1JK9A 1XSOA 2AQPA 1Z9PA 2GBUA 4A7GA 4FF9A 2GBTA 1QUPA 2SODB 1F1GA 4U4IA 1PTZA 1E9QA 5KBLA 2AQQA 1Z9NA 4MCMA 2Q2LA 2AF2A 2ZOWA 3GQFA 3H2PA 1IBBA 1IBHA 1SXSA 2GBVA 1E9OB 1AZVA 4BD4A 3GTTA 2WZ5A 4A7UA 2E46A 4BCYA 1B4TA 1E9PA 1KMGA 4A7VA 1Q0EA 1DSWA 1OZTG 1SXCA 2JLPA 3MNDA 3QQDB 1S4IA 3L9EA 2C9UA 2ZKYA 1EJ8A 2WWOA 3ECVA 1UXMA 2VR6A 1SXAA 1SDAB 4B3EA 2AQNA 1OALA 1SOSA 5KBMA 2C9SA 2WYZA 1OZUA 1BA9A 3CE1A 4A7TA 4A7SA 1OAJA 1HL5A 1U3NA 1YAZA 3GZQA 3KBEA 1SDYA 3QQDA 2WWNA
chains in the Genus database with same CATH superfamily
1RULL 1DANU 5C0JB 5T1KA 4JREB 3VWJB 1GGIH 4NFCA 4FTVA 1GKOA 4NLHA 4HW6A 3ALXA 2HT2D 1U8IB 1UWXH 5FUZH 3TJPA 1CXIA 5K59E 3NJGA 2BVQB 4UQDA 4MMXC 5DYFA 2W1NA 1GYVA 3SHSA 1IT9H 1S9VB 2XN9A 4X9FA 2XRAL 3C8DA 4JG0H 5CGBA 4DPRA 3NIGE 1A02N 1S7TA 3SKNA 4FNSA 2QVKA 4KDTC 1FYTD 3EHBB 3NDYE 3SOBH 2B3RA 3VTMA 4CVXB 1UYWL 4R4FL 4YNYA 3U30C 1HEZB 1LLAA 2VXQL 5CGYD 5FKPB 3BAIA 1QW9A 1AR1C 5I1JH 3RTQB 1CGXA 3GBLA 2A2QT 1TNNA 1DEDA 4U0RB 1MLBB 2EE0A 4OI8A 1KN2L 1P7QA 3KM2A 3SPGA 3CIQA 1MJ7H 3F7QA 2FYYA 1J5IA 1NBCA 5HGAB 4ORGA 2K7PA 2ZYIA 3FO0L 1UASA 4BDVB 4E41B 3H0TB 1N8ZA 4PRPB 3MZGB 3FQRB 4WJ5A 3W11C 3OJVC 2DIAA 5DEJA 2AQ1A 1IGFL 1B9KA 2GY5A 4G82A 4P5MA 1WUZA 2VWEC 3KL5A 1KCLA 4J28A 4LCUB 3UC2A 5I1LB 3O3EA 4P5TB 4LQFL 4LCWE 1N68A 1GGTA 3UIZA 3BO8A 4B50A 4DN4H 2F5AL 1S9WA 1QWUA 2DQMA 1KBBA 2ZPKH 4GIPD 5HGHA 1S9YA 3IAQA 4JAMA 3POCA 2AW2A 1W15A 1BXAA 1KTKE 2COQA 3D33A 4MAYD 2C26A 1T83C 4XC1H 1KC5L 1Z3GH 2KI6A 2EECA 4K4KA 5EV7A 2X89D 5DD6A 5FCSH 5DUML 3OKKB 3P2BA 1YNKL 4HFWA 3QIWA 2JWYA 4CILA 5EF2A 4YZWA 4FQXA 5IHZB 3GRWL 1DN2A 1L9RA 3QDME 3BCDA 1AFVH 3FNKA 4XCYB 2JNZA 1S7WB 3RX8A 3PHQB 3TPUA 4ODWB 3K6OA 4FQHB 1XV8A 1MVYA 3FB8A 2GVYA 1U8LB 5D93B 5TDNA 4Z7VA 1Y1DA 3L7FA 2IPTL 5IF0B 2DQDH 4LPXA 4NKOA 4XWGL 3SGEI 2NX5B 1G5AA 3E80A 4BH8A 2A7BA 3IJ9A 4J3SA 5C0DA 2HT3C 3I84A 2B7DT 2DWSA 2X6AA 2HLEB 4I0CC 3VQ2C 4N0UB 5J89A 2J1XA 4G80A 4MNHB 4FHBD 3II2A 3B8YA 2EXTA 2JK5B 1JDCA 3KLKA 3C9NB 2ZG3A 5CU9A 2P5PA 3RWJA 1JV2B 3U6RA 4HUUB 2F74B 5KS9E 3DX9A 4L3FA 3O4LD 3T4AA 5BZXA 3DUSB 4ZUVA 5EORL 3GZKA 3KPOB 4MDJB 2ESVA 2V3DA 4H7VA 1HDMA 1Q94B 1BQLH 3G08B 1WITA 4GW1B 4N0YL 5GGTH 4O4YH 3E6HB 1T80A 4S1RL 4B95C 5E6RB 5EFIA 3AB0C 4PP1C 5EO9B 3ZDWA 3LZOA 5BO1H 4YBQD 2WXLA 5HVHC 3OJDB 3U9PH 4AMWA 5F9OH 2HFEB 3ILQC 5DO2C 4WI4A 3ZKSD 1OAUH 4Z3IA 5I1GH 2A73A 2AJYH 4G9FA 2VDNH 4OZFH 2YD7A 1YEIH 5C1MB 3U2SB 4NZJA 3TFKC 3EFOA 2IWGA 4Z7WF 1WBXA 3MROA 4HA1A 3DETC 3ARGB 5D6CA 2F53A 3OMIB 4IRJC 5GISL 3PWVB 3MV8A 1RVFL 5IVZB 3ZDYE 3MBEC 2OSLA 5C0IA 1MREL 1TYJA 4YHPB 4UZGA 1GCYA 5L0QC 4YHKL 1OWRM 5CSGA 3AMKA 4ABVA 4ZS7L 2ZP0T 2BRQA 3HE6C 1I75A 4FKHA 3ZDXF 3WYRA 1OF2B 1WT5C 5E6ZA 3FB7A 2FR4A 5AKTA 1TLMA 1XD1A 3SE9L 4E0RB 2CJTA 2Z7ZA 3UBXB 1XH1A 1OIOA 1SXNA 1J8RA 2Y7QA 3VGAB 1CXFA 3T77A 3CDFA 2DB8A 4F9LA 1VLXA 3VFVB 2VW4A 4DWHA 1JK9A 4YHLH 5IFJA 3LNFA 3SPHA 5J6SA 5C0ND 1HQ4B 1BFVH 4U6HA 4C59B 4OZHF 4Q6IC 4QXGL 5BMFL 2P8MA 4LCWD 3GMOA 4OD2B 3PV7A 3WE6B 4KKBD 4WI3A 2K9UA 4PMFA 5DI8B 3Q7JA 1ORSA 4UIKL 4U1JA 5LDSA 4J3XA 2FGWL 1DBJL 1JPFB 1T4KA 2B9BA 3BDXA 1Z9SA 3NMEA 5B7EA 1PVHA 1WPCA 3T08A 1FFNA 1MUJA 4PHZA 3C60C 1RZJL 3RWDA 3CLFL 2OP4H 3VCLB 1AY1L 1HE7A 1CL7H 2HKHL 1T1WA 4GQQA 4LKCA 4LPVA 5FFOA 3IPEA 3QDMD 3WTUA 4UBDD 3TNNB 5C0EB 2EIZB 4OGXH 3RX9A 5D7KE 3JYBA 1U36A 3V4LA 4JVUA 2GBAA 3HKZA 3UAJC 3ZTNL 1DL7L 3VE0A 3D1MC 3O3UN 3QNXA 1J88A 3ZKNC 3VRJB 4U3XA 3HNVH 1KNOA 2RCSL 2EDRA 3EYVB 3TV3L 1QFWI 3X14B 5I1DA 1BIIB 2ITCB 2D4FA 5ES4B 5I6MA 1YYCA 5JIIA 3FPYA 3GSWA 1NEPA 5JW4R 4V1DB 5J6GA 5K1JA 1LEGB 1P5UA 3OG4B 3PIQB 5DU7A 1HC1A 5DGQA 4LDCA 2CGRH 3NTCH 5EZJB 3ZDZE 3VI3F 5LG6A 3CDZA 4N8CL 5LBSA 4GY4A 5EULV 1R3IL 3S4SA 4D0CA 4ZNEA 3FUJA 3ULUE 4O58H 1ZAGA 2WVUA 5DJXA 5MEQA 3GBDA 2TSBA 1J8HA 1L0QA 2XQBH 35C8L 3BFQG 1ORQA 2DN7A 3P0YH 4NPKA 1F5WA 1GA2A 4MJ6A 3CCHB 5DHVB 3CPUA 4ZXBC 1RZIB 1G9NC 1IB5A 5ANMA 3RG1C 2FZ3B 2O61B 4K07A 5LCVH 2R8SH 1YSOA 1DVXA 4FULA 5KSBF 1QHPA 1ILSA 3FF8A 3RUGB 1B0IA 5CUSL 4X6DF 3S0PA 5JXAL 3M8OH 5HHME 1BZQK 3K2UL 5BQ7B 1MRFH 1QNZL 3WTYA 4N28A 4OQTA 4W68A 4I8DA 5E1AB 1YZZA 3MOBL 4MBOA 2K70A 2PYFA 2QTVA 2RD0A 2WZ0A 3CZKA 43CAA 2UY7A 3O9WB 2WBXA 4HHGA 1RUKL 2D4DA 5DUBB 5LAXB 3PABB 3HS0B 3HG1E 4RWHA 4LVNB 4XPFL 4A04A 3CVDA 3G6JB 4DKFL 5FYKL 3RQ3A 5D7IA 4Y5VA 1FNEA 5EU7C 3QUXC 1G6RA 5J1TC 5J56B 1F45A 1BQKA 2HT2C 2IPUK 3PUUA 4OLZH 4Y2OB 4QTHB 2VGLM 2FEEI 2FSDA 4HPHA 3HC4H 4B97A 2NRDA 5D70H 4MJJA 4XNUL 3US1A 4NN5C 5HJ3A 3LX9A 3MTXA 1UVQB 4N9GA 1JF6A 3ERXA 4WRLA 4LASL 3GSRA 5D5MF 3AROA 1AS7A 4BKLA 5D7KD 1FZMA 3U36B 1D5MB 5CGYC 2AK1H 2N7SA 4LFHG 4P2RB 1JXDA 4OZFB 2VDNB 3UJJL 1GW6A 4P57A 3MRJA 3EYUL 3L3GA 8PAZA 3SE4A 4RETB 1KTLB 3PPSA 3LAFA 2H32A 2XA8L 3RNQA 4EVNA 1CBVL 4WLCA 3LV3B 1H3PH 2DQHL 5AOZA 1M1SA 3IDNB 1DQDH 5GRXG 4PJGF 1B2WL 3OG6B 4JANB 1YPZF 5JDSB 1U0QA 5K9OB 3RIFK 4W6XB 4WW2F 1Z9LA 1OW0C 1RIHL 5B1BB 4W9EC 4NLAA 2F58H 4FN0A 1N3NB 1WLHA 1WA0X 4RMBA 5F7MC 4AEHH 3SBWC 4RGOH 4JM0A 2YGNA 5C07A 1JRHH 4BFEA 4MAYC 4PJFF 3ULUD 3GHBH 4N26A 5I1AA 3L9YA 4FFWC 3D7PA 2Y7OA 2P3YA 5IQOA 1NCIA 3ABLB 3FOLA 4B9JA 5KW9H 4WTXA 2FATL 5KSUA 2EC9T 1U8JA 3ZRCC 2ADJB 2PWDA 2RBLA 5PAZA 3EYFB 2RR3A 4FX5A 2DQCH 5EEXA 5IB1A 1NGWA 3G5WA 1SQ2N 5E9NA 4ZTOH 3CQFA 3KAAA 4NPYA 5HHMD 3RWGA 2M1KA 1HSBB 1Z9PA 2AP2A 5HDRA 1F3JA 4YSSA 2GI0A 4JQXA 1LTXA 1ZKAA 2R23A 3WFZA 1FG2B 4FG0A 2BZ7A 3IETA 5IBUB 3W82A 3NCFB 5JR1H 5KN5A 5HGDB 5B21A 2X10A 3QGVA 3SKJL 4F3FA 4OCWH 3TPKA 3FDWA 2O5YL 5K9KB 2PO6D 1JGUH 3HNSL 4GSDL 3HG1D 2OJEB 4GKOA 3TEUA 4JFYA 3VXSE 1WD9A 3H42H 4B9KC 4PSPA 5JW4M 3FMGH 2F8IA 3AACA 3UGXA 3C08L 2MHAA 4L4TB 5EBLA 4RZKA 5HI4D 4I0PD 4O5LL 4AYMC 3L3HA 4HCGA 1KDIA 2H3NA 6PAZA 2P43B 1TTFA 2NYZA 4HWZA 4YBQC 2D31B 4NRZB 2CJUL 4IOSA 3DVGB 5EO1A 3FQWA 1O6SA 3FQ1A 5T5NF 4KVNL 5CP3H 4YLBA 1TXKA 3O0LA 3UO1H 3RKDD 1S7UB 3EZJB 5D8JH 5HHOB 5EZIL 1J5DA 1R1CA 1WAAA 2FQGA 4R9HA 4XVTH 5GS0C 4MJ4A 5G2NA 2DLTA 1NBYB 2QPFA 2ZWKA 4Z76A 1KGXA 5DTFA 2ZSVB 2PYEB 2V7HA 2GHZA 4TULL 2BO0A 1W0VB 4N25A 3NSXA 1RPQA 2G4GA 4HXAH 4XNQB 1I8IB 3CZSA 3PXLA 4QOKA 1ECYA 3QC6X 3OZLA 4HDIA 3WHXB 3OXRA 4LSPH 3N40F 2XX0A 1KBGL 3D87B 4PLJD 1VGKB 1Y6NR 4CN4A 3KDPB 4ALAL 2NZ9C 3B7RL 3HG2A 4R97C 4UM9D 2WUBH 2BVPB 2UVFA 4PCKA 3RZCD 5C0NC 4W4OA 1BJ8A 3NPZB 3GXNA 3OR6B 5T8IA 4BZYA 4MJIB 3EO1B 4KKBC 2XJLA 3AS1A 3CVIH 4QHMB 3NCJL 3BAYA 3RX7A 4PJEE 1D9KD 1R5VB 3GC3A 4MSWA 3QG6B 1N7ML 5AL0A 1TQSA 3Q1SL 2V9TA 1E30A 5E56A 2C3WA 2WLYA 5IP4A 1E28B 4G8GA 3UAAA 2CALA 1GZQA 1JVLA 2OR9H 3EOAB 4ISVB 3KM1A 2IDFA 1E4KC 4N5ED 5DD5H 2WTOA 1SLWA 4I48B 5I24A 2E4FA 2YR3A 3CLEH 4JFFE 4JCWA 4UBDC 4POYA 1FFOA 3O45A 2KKQA 3ARED 2X4TB 4W9GC 5DMKB 2NTSP 5BXFB 3SQRA 2D03L 3GJFH 1Y0LB 1KYFA 1WTGT 1VB9A 3ME0A 3ASWA 3HE7A 2CO4A 2XA3A 3WELA 4PJ5A 5BPPA 4Z0XB 5J12B 5JHMA 4C56A 1SY6A 4NQQA 4Z7WB 1PKQB 4FQJH 4X4ZA 3N1GC 4HZAA 1WUNT 2AEPL 3LEVH 5EU5A 1TMCB 2OMTA 4DOHE 2DTMH 1I3RA 5FFLA 3A4DA 1IBBA 4PJXF 1UB6B 4YSCA 1FI8C 2MPVA 3DO3A 4OKDA 5AOIA 25C8H 3ZDXB 5TQ2L 3LXAA 4X7SL 1S7VB 1NGXA 2AXFA 2VN3A 5F9DC 2VOTA 3M6DA 4Z7UF 5D9SB 4F1ZA 2JMRA 2X70A 2R56H 3IDXH 4LIQH 4Z7QE 4JFVA 1MW1A 1XCQB 1A7OH 4JKPH 4HGMA 5SWSB 1Q9OA 2IANA 2YFNA 3RDTA 4PRBB 4TNEA 3NZHH 1TCRA 4NQEB 1MFDH 1JGEA 1PD6A 3HG4A 4YHNB 1FNLA 5DHMC 3DO7A 3L95A 4OZHB 4LSQL 4TNVK 3V55A 4WWID 5EOTA 2VXSL 5T1MA 4DP1X 5L9DH 2I26N 1NUNB 3SE3A 1XTMA 2GFBB 1D6VL 1OAZL 4HEME 3GSQB 4Y7MA 3QEGL 2VSCA 1HXYA 4DHLA 1D5IH 1HI6A 3WNPA 5I8CA 5D2LE 3K6FA 2DLFH 3MRFB 3VGHA 1X5ZA 3HIZA 5AG9A 4R5TA 5TFSH 1NFAA 4PY7A 3F2LA 4XMTA 5D55A 1A4KB 2I07B 4K7FB 2DWEA 5IOKA 4MNQA 3NFPB 3WFBL 4WHDA 4OJCA 2HWZH 1MH5B 1QFWL 5I0YA 3AS0A 3UPAA 3LXBA 3UX9B 2MMXA 3W9EA 1N5YL 3VWKD 1A0QH 1H15B 1Q4NX 1OAKL 4QRPE 1ZA3B 3ZL1A 3RDJA 4NQCE 1H8SA 3PWJB 4EIBA 2C1OB 1RZKL 5C3IA 1BFOB 3L6FA 4H26A 1G6RL 1NFDE 4LNRB 1RD6A 2FL5A 4NB7A 3VXTA 4E5XA 2VM9A 4GAGH 3IDYB 4N2HA 1H3TA 3QXAA 1WYJA 4IKLA 4NNPL 5B4MD 1CB4A 4XAKE 3Q01A 1JI1A 5I6OA 4P0DA 2EUWA 1N18A 4YVNA 4S0SD 3P0GB 4YX2L 2WSKA 5JOEA 5CINH 3VI3B 4OAWB 2HVJA 4R90H 1OO2A 4LLYA 3KYOB 4AJWA 5EU6E 3WFDH 1M7UA 2VJXA 4WJKB 1A6AB 4KROB 4OCRH 3V7AG 1SLVA 3UXFA 1Q1JL 4DF9A 5KZCB 4JFFD 2ITFA 1WZ1L 1V8HA 3TX4A 1YN6A 1SBBA 1F8TH 4UQIM 5CJ8A 3TS8A 1RIVH 5L2KA 1JGVL 2XWTB 4AQEB 5IHWA 2AQ3A 5INCB 5EEUA 3K6DA 1OB0A 3DX1A 4FEIA 3CFMA 1T2JA 2PXYC 1ACYH 1WHPA 3WS3B 3VW3H 5DJ0A 4Z7NE 1PQZB 3EJYD 5KSBB 4I13B 4X6DB 4G6JH 1S7RA 4PB0L 3SCMA 2JKJA 3AT8A 5IBTL 1VA9A 4M7JL 2X12A 5KYYB 1NICA 2P28B 2WTRB 2XVKA 4U1SB 3QO1A 4NO0A 1TF4A 2OQJA 3TIDA 4B9YA 1FNHA 3KXFB 4Y19B 4GXVL 1YECH 5F0JB 5MENB 2VN6A 1LP9F 4QHNA 4NBXB 3VFOA 2FEEL 2I32A 1UD4A 1LILA 2NY4D 4UT9A 4YO0B 2WWNA 4RAUA 3Q6FB 5E8PB 1P7KB 4G1EB 5CSZB 4DPCX 1L9NA 3G7TA 2D7PA 2R4SH 3S2CA 3CHPA 3OHMB 4EBQH 2EILB 2VR3A 2MQ3A 3N5AA 1INEL 4LSSH 4QPEA 5I66A 3ULUC 1UZ6F 3WBDA 1FE8L 1KT2A 2EIMB 5I74B 3ZW3A 5KG9A 2BWQA 1ETJA 3ARFD 4PJ7F 2ZUSA 4ODTH 2MNJB 5CJOL 5C08B 2DOCA 4OJDH 1VFBB 5LO7A 3H1ZA 2DQTH 4ZFOL 4MYPA 2IH1A 2ZF9A 5DT1L 4UUJB 1XGTB 3CDGB 4A39A 4JZJB 2NNXA 4PRHA 1JNHA 4AIXA 5D5MB 5E51A 2ZOKB 5AVTB 4RFEB 3LVTA 3H9SA 2A1WH 3NIDF 3W1ZA 3FO9B 1MNNA 4PJAA 3VXRE 5GGVL 1EVTC 3Q5YA 4TQHA 3S36L 3GJFB 3JV6A 3C09C 3DGCR 2CBMA 4AE0A 2ODIA 2YD8A 2HG0A 2PO6C 4L4VE 3WIFA 2EIEA 3P9LA 1WBYA 1XDTT 3K81A 2SEBA 9CGTA 2NY3B 5KVEE 4D0BA 4C83A 4TRPL 5FYJH 3M1OA 4O00A 4BK5A 1YO4A 2JI2A 1KIRB 1NSNH 4YDIL 1NC2A 2UZIL 4LBEA 5DMGD 5LGHH 1KCSL 4XAKD 1YPZB 5HI4C 2D7TH 1B3JA 1HHHA 2VMCA 4I0PC 1FZKA 4K7PL 3V0JA 2P5WD 2XWBA 4WW2B 3PQYD 1XAKA 2JVUA 1LNUB 5FYLH 2IEPA 5B1AB 2HX9A 3LJ3A 1IVLA 3ASOB 4K0OA 3GMQA 4RFOH 5E4EB 1KDJA 3BSZH 1HQRB 3VGDA 5EU6D 4UZSA 2FD6L 2C7FA 5EU3A 2WW8A 2ENPA 1OARL 4X99A 2Q2LA 1BVLA 2Q10A 4F33A 5ID0A 2ZYRA 1AG0A 2F7IA 4PJFB 4YIQA 4F1SA 2E86A 3BDYH 5CF3A 2VH5L 4Q0XL 5DS2A 3VXME 4MD5B 1VJSA 1L7IH 4PJHF 3IU3A 1JMXA 4QNPF 2LLNA 4X6FA 5ABDE 1H8NA 5DVKA 4UB0L 2NT0A 5C2BH 3T0EB 2BLFA 2IDSA 3BWAB 4RNRA 4JLRA 1J18A 2W92A 4Z5RA 3V0VB 2HN7A 1G9MC 4DGVH 2C4FT 1UURA 3B9VA 5GJTH 3FRUB 1V3MA 1XEUA 4NOFA 4UDUB 4PLJC 2JQAA 1U3NA 1KFAH 1ZGLP 1J05B 1I3UA 5K39B 1MDAA 2N4IA 2HT4D 3H9HA 3QQDA 3MV9A 2YXFA 5FKAA 3PHAA 3RZCC 4AIZB 1U92B 3T1FB 5CU5A 2H6PB 4NZRH 3W0WD 1S7QB 3PDGA 2WHVA 5LN4A 2HCZX 4S1QL 1ZVHA 2WCPA 4BSWB 5DD3L 4Q9QL 4AK2A 4W4NA 2HJFB 5E99L 1AQDA 1D9KC 1KPRB 1JWSA 3FT9A 4F8NA 3A47A 4MMXB 3LKSB 4CU6A 4HOZA 3FC8A 2Z91B 1QSEB 4HWBH 4HV8B 2WJ7A 3KPSD 2WXHA 3M17B 3IGAB 2MCMA 2CKBH 5FCUH 2ZXEB 4FXKA 1R33A 4IRSA 4N5EC 2A5UA 4YPGA 4AV5A 3IS0X 5T1JA 5D4JA 1DBKH 3NABL 1OSYA 3VD9A 2GG1A 1OF0A 4KHXH 7PCYA 3AXLB 3UIYA 4QRTB 4F20A 5TE6L 3MLRL 3BZEA 4HH9A 1AR1B 1R3JB 2FLMA 3CMOH 1KB5A 1D2PA 5E2VH 1E3ZA 2W60B 4H20H 3QYNA 3IU4H 4J3VA 3VXRD 2FEJA 3RBGA 1JVOA 3LRKA 1T0MB 1FG9C 1NCUA 4H8PA 4WI0B 1AXSA 2AJ3B 4F7TA 1SJEA 2VZ3A 3MRLB 2VQ1B 1KCBA 4L4VD 3REWA 1FHNA 2EE2A 5JIMA 1I4FB 4MD4A 2JLLA 2XG4B 4Y7OC 3O0RH 1U8CB 3PFQA 4G2AA 4P2QB 4UOW1 4UAHA 4LL1A 2R1WB 1IVTA 1QR4A 2X1XR 3NN8B 4HP5A 1EX0A 1HFUA 4GRWE 2OULB 3NIGF 4PS3A 1PNCA 4OFQA 2O5XL 2YSSB 4OD1H 3WXVH 3ZIYA 5IMMB 1QTSA 4WY7H 3IRPX 2ZG1A 4H5SA 3SY6A 5I8EA 3W5NA 2XZQH 4LDEB 1ITCA 3QQ4A 4OJYA 1AQKH 1C12B 3MODH 1OOWA 3RWHB 1G7IA 4JRYB 4BEIA 1QEXA 2XZAH 2DQFB 4QHKI 2F19H 4G43B 1Q9WB 1PYWA 1ZCRA 4OCMC 2DV6A 4WI9A 3UAFA 4Y1AB 3VXMD 1OK0A 1BZ8A 2ZNXA 2R1YB 3QXTA 5I5MA 3FU3A 3KYMB 4Q4IA 3A67L 2GW5A 3PREA 1P6WA 2NSXA 2BERA 5GJSL 4ELKA 4FMFA 4HXBH 4ZFZB 2W59A 3QEHA 5LWYH 3IT8D 1KWGA 4MB4A 3CN4A 4HCRL 4APQA 3GXIA 1XL6A 4QLRA 1R3HB 4FI7A 4ZZKA 3WXWH 2I25N 3FZUD 1DDHA 2A83A 3MJ8A 3QB7C 1ES0B 1EAPA 5DRNA 2LAGB 4AENA 2VDPH 1J9CT 4PJXB 4FTVE 1MAKA 2IOOA 2OZ4A 1OGAB 4K8RL 1ILUA 1TZGH 1T03L 2VRKA 4F37K 3S5ZA 2WLJA 3VFMB 2XN9E 1XH2A 4E9TA 2YMXL 3FUFA 4PI2A 5B4MC 1GC1C 4Z7UB 1N5AB 3FTGB 3FHAA 4U31A 2DLIA 1AYOA 3GSOA 1U8KB 4QRRA 4D7BA 3AB0B 1TYEB 4BRJA 3K71A 1NCWL 3OL2A 3GZOA 4XVUD 5DJ6A 5HVHB 4XB3A 4JO4H 4ZMZA 1R24B 5F96L 3ASNB 4UV4H 1IGJB 1X5XA 2YPVL 2XYCA 4Y88A 3JWNG 4RX4D 3WNMA 2XG5B 1KYAA 1S5IH 3BGMB 5CD5D 2XBZA 2ZXWB 5D6DA 2QPDB 2VC2B 3RY6C 3ZE1E 5EIIB 3V4VH 1BZ7B 1WIOA 5C09A 5CM1A 3I2CH 5ETUA 4PTTB 3MBEB 3ARUA 4Y1SA 4A6YL 4HJGA 3C5SA 3HS8A 5L0QB 4BINA 3EXLA 3HE6B 1N26A 3VJ6A 3EJYC 3QCVH 5KVDE 3UZVA 1AIFA 4Y9FA 4HKBA 1XZ0A 2OMBA 4DW2L 4KK5D 3X11B 5CCKH 3SJVB 1AQMA 5DFVC 1ONQB 4FYQA 3FCSB 5B1JA 1MQ8A 4GFXA 3ABMB 3QAZC 1C8PA 3UROR 3RVWD 1FPTH 1THAA 3ESMA 2Q3AA 5F1NB 4F2MA 2OR8A 1OP3H 3VDAA 3MOAL 2BXYA 2NY4C 3C87A 3VX0A 2DYPD 2YBRA 4GQRA 4PRDA 2AHIA 1KUMA 3RL1A 3SKOB 1CICA 1G5GA 5FO8A 3T8XB 4M1GH 4JR9H 5TDOB 2BNQE 1CTNA 2YPLA 2OW6A 3O6LL 4PPTA 1JAEA 3VDCA 1LE9A 2LU7A 1I82A 5E94A 3WJLC 5I5JA 3C60B 5LGKA 4UIMB 1P53A 2GEQA 4JCLA 4OT1L 4QHLB 1W91A 2VLKD 2NY5H 2XN0A 4Z7VE 1LO0H 4TVPL 4NFDA 1SJHA 1ZWIB 2ZSWB 4JFZL 3MLYL 2B59B 1IAOB 3H56A 4HUNB 2V2XB 4LPYA 3RURA 1MJ8H 3JT0A 4NM8L 5DHYA 4ZX5A 3JZ7A 4JJ5B 2Z8SA 3VD7A 1IM9D 5ADPH 2VITB 4X7FC 1N6QL 2VM4A 1NAMA 1LEKB 2J2ZB 2WKOA 2X2IA 5TE7L 4DP2X 5J13C 3DYOA 4E36A 1YMMB 4KZEL 2FWSA 4HSQA 1MEXL 5AYTA 5IW3A 3RY5A 4FJ6A 4W9IC 2ESVE 4Q2ZB 4FTVD 5FYKD 3QUMB 4MMZC 2I7OA 1UM6L 3D50A 3VFWA 3GNMH 3CZEA 2QQLL 3WFEH 4OH2A 3Q44A 3U46B 3N41F 1LWHA 5B39G 2CH8A 3WFCH 2YOAA 2XN9D 1CD0A 5IJKA 4ZOEA 3RVVC 4WFGE 3SQOH 1FL6B 1MFAH 1DUYB 4GO9A 4HMEA 3UC0L 2CXKA 1DVFA 1UEMA 5DK2B 4QF1A 3EBIA 2QKIC 1LP9B 2BDNL 4JFDB 4NKQB 1BV8A 1VERA 3ARDA 3GEFA 4KK9D 5GS0H 4I18A 2Y5TB 4QO1A 1GZHA 2F53E 5AOMA 1F18A 4KMTL 2X87A 3AXHA 3QEQA 3P9WB 4KK8C 4M5TA 1JS4A 4OFPA 1NCNA 4PYGA 5IT2H 3LHPL 2DYRB 1M2OA 4ZXBB 4G9DB 1FAIH 4PJ7B 3DGDA 1U30A 4KQ3H 1A6WH 2VIRA 3L3DB 1P7QD 3ZTCC 4DZ8B 5JDJA 2RH0A 1E5CA 2QDVA 4PGDA 3QJSB 5DEGA 4BA8A 2E59A 1PG7W 4JDVB 1RJYA 4CVUA 1JE6A 3DV4B 4GW5B 4XPGH 4ZT1A 2I85A 2LU3A 2FBOJ 4RA0C 5I6XC 4XMKH 3LN4A 1SF3A 2VAAA 4K55A 3G9AB 4TUJA 2G0KA 1XSOA 1TKWB 5FDWA 3NIDB 4G8EB 1SOKA 4BH7B 1KTRL 4XXWA 1U91A 1GVIA 3NZSA 3NIFF 3STLA 3SDYL 4FQIH 2VN5A 2HT4C 1MWAH 2DEYX 1KFGA 2BVTA 2G9HA 3ETBF 2LTQB 3TO2A 1AP2B 1CTOA 4JHVA 1MIML 3STZA 3JV0A 4L1BA 1K9TA 1KGUA 1L9SA 1O5DT 4XRCA 3V6FB 3TN0C 2G2PA 3QUXB 3AZUA 2VDPB 4JW3A 1A3RL 3CVHL 4I1NB 4EF3A 3L3OA 2Q86B 3DMMA 2V7NB 1ADQA 4GSQA 4M6OL 3QIWD 4MXQD 2BNQD 4FQXD 2VR6A 5C0BA 1U8QB 3VB9A 1F02I 1OZUA 4X50A 1KTDB 1HEHC 3DSFL 1SEQL 2J6EA 3ES6B 1FYTB 3O6KL 4YSPA 4PCYA 5EOCH 3VXUB 4UOJA 2F6AA 4YWGL 1XBRA 3W9DB 1JWUA 1UWEL 5D2NC 5DR5L 2IOIA 4CSTA 3HAEB 4DVRH 1KB5L 5LGYA 5FGCE 4P9MH 1FFTB 4X9HA 1CGYA 2CR3A 3LIZA 3EJCA 4PUBH 1G9HA 2XLLA 1TEGA 3MJGX 4KJQC 2WB1A 1GZPA 3V4VB 4HIEA 4XMXA 2UX7A 4PJHB 2L3BA 3BUBA 1KOAA 2KZBA 1DBBH 3MLSH 4JM2A 2X4SB 4QJ5B 3VFUA 4FLQA 4LLDB 4KX8A 1IKNA 2ESVD 2XU9A 3WJMB 3SDAD 1IEAA 3K1KC 2C34A 2CO7A 3O81A 3V52L 1ESOA 1D3CA 2UY6B 5JA8B 3FSWA 2YWYA 1E2VA 3VO0A 1DQLH 5C0CB 4WFGD 4WK2B 1AGEB 1CK0L 1QWHA 3S88L 1B4RA 4HX1B 4ZNEE 2ZUQB 5AVQB 4G9FD 5I8KH 3IDMB 4XBEH 1J8HE 2GT9A 3FT3A 4OJFL 1UJ3C 1GXEA 2A6IA 2XN1A 1SYVA 5HVWA 5ANME 1WWCA 4BSVA 2CUMA 1G94A 2F53D 3DYPA 4MAYB 5GGSA 5E5LA 3KWWA 2WIIA 1EHLH 2IDCA 2NDFA 4DP4X 5IG7A 1K85A 1XF2A 4LCCB 4XP4H 5I30H 4R5VA 4NUJB 3AY4A 1FVCA 4EKJA 5GGQH 2JXMA 3B8SA 1E8YA 5AZEH 1DFBH 4ILDA 5KYXB 1P84J 1VZIA 1T21A 5DC0A 3LB6C 4P8QA 1H8OA 3LOWA 3O6MH 3QZLA 5FGSA 3SDXE 2R2HA 5CEZH 2FJGA 2IFFH 2OL3B 5G55A 5J7CC 1V7MH 2RFXA 4CU8A 1C5CH 4PJ9A 1F1GA 3A24A 3RGBA 3KPRA 3MRKA 1UM5L 3GSNH 3U0WH 2HRPL 3FZUC 5D7IE 4KWUA 2OZ4L 3NP4A 5D4QA 3VGGA 4AG4H 1M4KA 4KY2A 4PTUA 4UTAH 1CJYA 3TNMA 4KPHL 5L88L 2BNRA 4AZUA 3FO2B 4PFEA 3TOPA 5KSVA 4NGHL 2ENQA 2HPOA 2VAJA 3O4LB 1AXIB 5DJZB 4WFFD 2Z4TA 1EJ8A 4G71B 3LPWA 1ZS8A 4OM0H 4AV4A 3EYSL 5HYEA 2EVFA 3FTUA 1QA9A 3OVUB 4JFHE 2HVKB 4XVUC 1RZJC 2O6CA 3NIGB 4LSTH 3RJDA 4WVRA 1KULA 4P99A 4JFXA 1WFMA 2C9XA 5HYIA 4R84A 3VFPA 4JCMA 1GYWA 5CD5C 3O2VL 3DROB 1QEWA 4WEUD 4OZ4B 4KI5E 4IEFB 5FB8B 4X8JA 1FRGL 4HS6A 2WSPA 5TF1H 4XCCL 5I2IA 2DD8L 3QAQA 2B1HH 2P52A 1EK3A 1Y6MR 4GXFA 5H2BA 1D7BA 1LDPL 5GGRY 5F1IA 4PWJA 3QI9C 1C5DA 4HOWA 1XTLA 3D69A 2JB5H 4OF6A 2F5BH 2PPDA 4M62L 2CK0L 1A3LH 1WQVT 4EI0A 4MJ5B 1HOCA 3K72B 5DDHB 1HXMB 3WEMA 3FCTA 5JQ6H 4LQ1A 3BH8B 4DPBX 2EE9A 3II1A 4JNXA 4P5RA 4YXHH 3SZ6A 3RVWC 5KVGE 2AITA 5C07E 1UD8A 1VGEL 3QJXA 4LCWB 4Y2DA 5B3JF 1TSHA 1ZK9A 1FDLL 3DXAA 4RGNE 3TXAA 4Z77B 4Q4EA 2VZTA 1SF5A 1MRDH 3JBG7 2V2TB 4FLRA 4YXKL 1K4CB 1J8HD 2E27L 2DQJL 1HZHL 2JFCA 3IJYB 4WFHE 5IR1A 4NDMA 1T7XA 1PAZA 5LVEA 5C86A 1HCZA 5ICXA 3U4BH 1MNUL 1T6VN 4EUPB 4LHQB 2QQNH 4L5FE 3ZMEA 3MRMB 1D2OA 4OVVA 3QDMB 4NRYA 5BRZA 3MKKA 3FQNA 2F08A 2ILLA 3QNYB 1H3VA 4LLQA 1MHHB 1HVXA 1LD9A 1KXVC 1NAML 4FNQA 4I9WE 1XF3A 4IRZL 2VDRH 4DSYA 2Q76B 3HLAB 1XGRB 3E3QE 3CJJA 2W9EH 2DTSA 3PGFL 2WZAA 4GT0A 2BWDA 3SGKC 4Q74A 1O9WA 4H0HB 5G5DA 4X7CC 4L0YA 1E9PA 5GRVK 1U33A 4QDGA 5IQ7H 3UPRB 4K3JH 2WKGA 4GQPH 4JHWH 2RB8A 3G04A 1UXWB 1FC2D 1OGTB 4AY0A 4FZEH 4M03A 3KPMA 1FHGA 5BV7L 3KVPA 3FULA 5T5FH 1R3KA 1U21A 1JZHA 5ALBH 1FC1A 1JTTA 2EKSA 2OTUA 3GKWL 4XE0A 2IAMA 4XNYL 1EUUA 4G72B 1BQHA 5CLZA 1AO7B 2DS4A 4XNXH 4AGLA 1KV7A 2ISDA 3QPQD 5C92A 5E23A 4JFHD 1ND0A 3PDDA 1NEZB 2TAAA 4KK9C 1WAAE 3MRPB 4ZUUB 4ZTPH 4R7NA 1HYSD 1KG0A 1HYRC 5ILTL 3GXPA 4YH6A 1OB1B 4NJAH 4BZ1H 3B5GA 1YJDH 4ETQA 3VH8B 4NQXA 3CXDL 4BYHA 4Q52A 2Q7YB 1TQCC 1LMIA 4KI5D 3LZLA 3NFNB 1KF9B 2BIQA 2YGOA 4JDEA 5IJCC 1T3FB 3ARZA 1DLFL 3OHXA 2YEZB 4PJDF 4L8DA 2R7EA 3BGFB 2GTWA 4QOKE 5D72L 2NLJB 2VDMH 2AMGA 5ANHA 1A1MA 4IHOB 4G6MH 1HCVA 3TC9A 1XVSA 2VE6B 4PLNC 3MJ9A 1L5GB 3WEAA 2AV1A 2OAAA 4Z7QF 3UTPE 4ZJ9A 2WQSA 3RI5F 1L9QA 2ZKXA 4YAQA 2YQGA 3B2PA 2AABL 4JHZA 4K94C 4NBYB 3TZVB 3FFOA 3T0DA 1AGFB 3ZRFC 3GSNB 3M7FB 1RK0A 1QLFA 3QQNA 3RB7A 5C07D 4NT6B 6TAAA 1ADQL 1WBZB 1WWAX 1ZEAL 4G8GE 3TBVA 3R1GL 3HC3H 1W0WB 2YA1A 5F2FA 1BZ9A 1P2CA 2B8OT 4KKCC 4R26L 2J73A 3QZBA 5EA0L 3N41B 5TK2A 3WENA 2EDMA 4KQ4H 3DOSB 1HNFA 3P73B 1JYNA 3F85A 3QIWC 5EF3A 4X6CE 2J6EL 2ZOOA 4FQXC 4WFHD 1KPUA 5F7BA 3EH5B 4GO8A 1MCIA 4GPVA 3Q9QA 4D8OA 4FNTA 1JF1A 4A2LA 1ZTXH 4L3CB 3TASA 4PW3A 3OLEA 4OKVA 1D5ZA 1PAMA 4NO3A 4C56E 1PBYA 3LIZL 3AY2A 3GO1L 3NEXA 4TQEH 4LPTA 3QJUB 3NZ8B 4I9WD 3RA7L 5GRYA 4DEWA 1W6WA 3GS4A 5AW5B 3K8LA 3FK3A 2FB4L 2PXYB 4N8VA 1QVOB 3T8MA 3WKML 4NUQA 4AT6A 3KPPB 5AAMA 3T4AC 4Z3EA 4EI6A 3AAZB 2F8OA 1K6QH 3CFDB 4U1IB 5AOLA 4AUJA 3FQXA 1ZJAA 2EYTB 5TE4L 3BVNA 1FL5A 2IANE 1A6ZB 1U93A 1A64A 1JK8A 2WOYA 4XN9A 1ZLEA 1I9RH 1JPSL 2W9DL 2Y25A 1JZEA 2R1XB 5JXED 1AHMA 3DK2A 4YDZA 3NIFB 3H6AA 4PREA 2ARWA 4IOSD 1BIHA 1EV2E 2UUDH 2WGXA 4IJ3C 4Y16B 5AW2B 4G6FD 4XXCA 5ITBH 3O11B 1GGBL 1QBAA 1FGVL 3H53A 1FVDB 2H3XC 4B0MB 1WC7A 4LLUB 4M43H 1BD2E 3WTVA 3B5TA 3MR9B 2IH3B 4YHIA 2CMRH 2HFGL 3P4OB 3LQAL 3ARTA 4RQQB 2YK1H 3VYNA 3CFBA 1XF5B 1QP1A 1NDMA 5CIPB 1P7BA 4L3EA 2DMKA 2MTAA 4H8VA 2EDQA 2P1YA 1M2VA 1T7YA 1OCOB 5E1GA 3KVDD 3S3SA 4N6RB 3C6SB 1Z66A 4PP2A 3MLPA 4XXDA 3QS2A 1I7ZA 3J8F7 4BQ9A 4QHKJ 4M9PA 2F7OA 1ERNA 2WINB 4QOKD 1BX2B 1FZOB 2PCPB 4H1LG 2EH8H 2CLRA 5IB3B 4K3DL 2DMCA 4GKSB 5GSRB 1P4LB 2PN5A 4LF3B 2LE9A 1CGTA 3BP7B 1U8OA 5D71H 4PWHA 3NA9L 4OCYH 3S97C 4F9LC 3KCPB 4L1TA 5BOZG 1QFUH 5JUEH 3LH2L 2BFVH 3C09B 4BFJA 4WHTA 4UDTB 2XWDA 4WZ9A 3UTPD 5J0BA 4ALAC 3QRBA 3L16A 4DO4A 1XF1A 3T3ME 1PLBA 3PLYA 1GC1H 4U1NB 5EH1A 2DDQL 3UEQA 3DRTA 3P4MA 4HZLB 4KKNA 3JWNH 2XV6B 3IXAA 2QVFB 5E2WH 5B3NA 5JHAA 2FX7H 4M6ML 4XPAH 2YARA 4ONHA 1WP6A 4JHUA 2ARJB 4G8GD 5AVSB 1S8DA 3L81A 4I0PB 4PR5B 3W3BA 1XWVA 1R4XA 3PWPB 3ARYA 1TTAA 3MA7A 3BAKA 5HHQB 2BS9A 4JRWA 3NAAL 1PTZA 4WK4B 1AC6A 3INUL 4OF7A 3FT4A 4P59L 3MLUH 1JNNH 4WI2A 2E6PA 1GGCL 3ULSA 3CZGA 3HE7D 5I1EH 5CKAA 4NJ9H 5H37A 3GLEA 4C56D 1NMAL 5DHDA 4NENA 5F71A 5I17A 1JHKH 3UTZB 4DETA 1K5NA 1OAQH 3WD5H 1AMYA 3H7BA 1GSMA 5JA9A 1QRNE 1M6OA 2AJZB 1RQ5A 4LLVB 2X42A 2AQNA 1Z2KA 4HKXA 4IJTA 3KLAA 1URLA 2YKLL 1HNGA 1P5UC 4DEPC 5LQBL 1AGBB 1U6AH 4FRWA 4KVCH 4GG6F 4PJBA 4AJ0A 4X5XA 2IAND 4FCHA 4QHPA 3RDTD 1Y07A 4YDVB 5LKNA 2CQVA 3MRHB 1V55B 3OLIA 2VN7A 4HC1A 3ZYJA 4UM9B 2D0GA 1KJ2H 3U7YH 5MP6L 4OY9A 3BPNC 3RZCB 2X1PA 1I53A 3GBMH 1JOIA 3HMXA 3BEWA 1IBDA 3VD3A 3TYFB 3HLKA 4U1LA 4F27A 2X4OA 1NUFA 4PRAA 3VA6A 2AQRA 4GINA 3IWUA 1J9QA 1MCPL 2F7PA 3NCYP 5FM5O 1D9KB 2FX8L 2K3HA 3R8QA 3HPJA 5K5YA 3BT2L 3DURB 2CSPA 3FTZA 4FP8L 5JW4N 4XBGA 2A9MH 4MD0A 2L8AA 4Z7AA 3MUGA 1SM3L 2D7OA 1YEEH 5SWZA 3IXTA 4PRHE 1NGYB 2BC4B 4MNQD 2BRRH 4IGBA 2GJ6A 2ZCLL 3H9SE 5HHNB 4X6BA 1S2EA 2CHWA 2FT8A 4HHWA 5ESAB 3HVNA 3QFJE 3SD2A 1IO4C 1DDTA 2Q8AL 1PLAA 3MFFB 5GRJL 1DE4B 4BXSV 2MOGA 1K8IB 1E27A 4W9HC 1P5VB 1OD7A 5F70A 4WKZB 2EDEA 5CAYB 3BN3B 3OWRA 2WVVB 1A8ZA 2EABA 1F6FB 5ICYB 3U0PB 3N9GH 1E3FA 1HILA 1RULH 5IEHB 4Y5VC 3MI6A 4MB3A 4G42B 5GS1B 2R0WL 4FI8A 2OMVA 3JUYA 4U6XB 3DBXA 4P5KB 4N22A 4U1KB 5IB5A 3P9MA 3U7WL 2BJML 2GTQA 3UMNA 5A6IA 2X9YA 3H4FA 4X4XA 4FHKA 4FS0A 2XQYA 2DQUL 2GBTA 4I2XB 5HPOA 4P3DB 4MLIA 5FW6A 2NY6C 2PCYA 1MAML 1UYWH 2Y07L 4R4FH 2Q87A 3H7LA 3OF6A 3K80A 1KB3A 2NW3A 1NGQL 2DAVA 1HYSC 3ZN6A 5E8DL 5KYUB 4DNLA 4LU5L 4N4YB 3SBPA 2ADIA 5B38B 4N0FB 4G8IB 4HKZA 2NTFB 2YA0A 4G7RB 2AERT 2L0DA 2QGEA 4EDXA 3SE4C 1QW8A 3Q0HA 4KI5C 5IM7B 2DMGA 1BZEA 1BBDL 1F3DJ 4JRFA 1NCGA 1OOAA 2B16A 1QRND 3VRIA 2KUTA 5DMIL 3SCMD 3VG0L 3FO0H 3OX8B 3V4PA 3JWDL 3QQ3B 3MX0A 3V5HB 4NO0D 1G7JB 3HNTL 2OCFD 1IGFH 3HBGA 1KJ3L 5FAAA 1YN7A 4XO5A 4ODHL 1HN1A 1YUHB 1HK6A 1ZV5A 2CLZB 4LQFH 4X7TB 4NEHB 1NTDA 4WUUA 2F5AH 2GIMA 2ED6A 2GSIB 1EZVY 3UABA 3K6IA 3HI1A 1GR7A 2G2RA 3MNVA 3QRFM 4HIHB 3WSQL 4B41A 5CEXB 3TGXA 1X6LA 4S0TD 4KAQL 3SE6A 4K5PA 4LP4A 4G59C 4ICXA 1KC5H 1NA8A 1S9KC 1TNMA 2QPSA 2VM3A 1YNKH 4TMPA 1HX0A 5AB9A 3OC8A 5JZ7D 3T2NL 1P1ZA 4LLMB 4X4YB 3TA4D 4DCQB 1XGUB 1MIEL 2ZKWA 4FADA 2L7JA 5IFAL 4Q9BA 4NI3A 3TBSA 1F1AA 4O2EA 2Z35B 2IPTH 4N24A 4PRHD 1CLOH 2X1OA 2GUOA 3CPLA 3PUCA 4KKPA 4XWGH 3TWCL 3WFHA 3H9SD 5IEKA 1OTTD 1T7WA 2OMZA 3BT0A 4ODBD 4IKJA 4JQXC 1RERA 2UWEA 2FUTA 5KBKA 1A1OA 1U58A 1I9IL 1UKQA 4OLVH 1ZGLB 1SMAA 3FW6A 3E3QC 1CDBA 1L4IA 4GBXA 3NRQA 6PCYA 4NKMB 4AE1A 4GEJA 3KEDA 3KPLB 3MYJB 2A6JB 2NXYB 3H9ZA 4DOHB 3LKRB 2PW1B 4PJDB 1WIPA 2PETA 3C5ZA 3RIFF 3BP5B 3F12B 4XT1C 2E6QA 5EORH 2EVJA 2DPKA 1IGCH 1NC2D 5IHHA 3WJJA 4S0HA 4HIIA 1O6VA 2EP6A 4JZOA 4GT7A 4S1RH 2X40A 3K0WA 4N90E 3QAZB 3HPLA 4Z7QB 1C7SA 1EVUA 4FXGA 1M6UA 4WTZG 3U1QA 4FD0A 2WXQA 5IWLA 3P69A 2NY4B 1YQVL 2BOCB 1AS8A 5E4OA 3HZMB 1E4WH 2A4EA 1T6WA 5HPMA 1KJ2B 4JPKL 1BMWA 1A4JB 2XDHA 4N1CA 1Q0YH 4XC3L 1TVDA 1EEUA 5KWYC 1WEJL 4ONGL 3HZKB 1RVFH 1XGPB 1QLEL 4L1LA 1MREH 4X98A 4YHKH 2ZUUA 1OALA 1BBJB 4PJ8B 5HHVH 2V9QA 4XB8A 1JERA 4CMMA 2GEEA 3I3EA 3V6ZA 3PV6A 4NP4L 3SE9H 1XF4B 2GJZA 1TVBA 1YEDA 1I1AA 2JKTM 3N43F 2EKJA 2RTTA 3PWNB 4PGCA 3ULVL 4N20A 3Q06A 1C7TA 5H8DA 3D39B 1T22B 3IJSB 2YAEA 3V5KA 5J13B 3NFSL 3X1NA 5B1KA 3G6AA 3L3KB 5BMFH 2FE0A 1A47A 4QXGH 3MMEA 4W4OC 2UZXA 4XP1L 1CBJA 3TA3A 4NUPA 5D1QE 2C9RA 4HUXB 1DJGA 5DJ2B 5E8OA 2FSEA 2NW2B 2J4WL 2PTTA 4UIKH 1G6VK 3D06A 4TLUA 2UYLB 3DHUA 4MMZB 2FGWH 1DBJH 2XTSA 3FRPA 3OKNA 3QXUA 1F11A 1CFVL 1DCLA 1KEML 2X4QA 3ARBA 4TQ8A 2ZCHL 4M8RA 3U1SL 1RZJH 4R2GC 4Y1TA 3DVNB 4I3RL 3CLFH 2P5WB 4IRSD 2HKHH 3PQYB 2YD4A 3T6XA 1BYNA 4YSRA 4FGMA 1FVEA 1XFPA 3OZ9L 1ZT7B 1SPDA 1EEZA 4HCIA 2OTPA 4I88A 5C09E 1KJVA 4S11A 3ZTNH 1DL7H 2E47A 2O1AA 3HE7C 4EN2A 1TJIL 5LGJA 2BVEA 3QWNA 4F80A 1THCA 1TZOA 2CRYA 2P80A 4XCFL 3U82B 1L9MA 4ZX3A 5J06A 1U4FA 3ZYIA 2RCSH 4FFZA 3VM7A 2QVTA 43C9B 1E4JA 1JBJA 5JMOC 4K5LA 3EF4A 1OPGH 3QO0B 1G7QB 5AAPA 1AACA 5I6XB 3LY6A 4A68A 1KCWA 4CN6A 3F58L 3EJZD 3VRLF 4PGEA 1T1YB 3SGDI 4L1SA 4HC1L 1ZT1A 1QUPA 4ZFGL 5T3XL 1KYOJ 1ZLUK 4F2ME 1J86A 4PRNA 4KJWC 4N8CH 3RDTC 2BSRB 3QA3B 4LKXA 1T2XA 1DQIA 3HMXL 3B37A 3HVDA 4N90D 1E50A 1R3IH 3T6WA 2A4ZA 1CDJA 1HHKB 5CEYB 5IUCA 2EC9U 3W0WB 1DQML 4WI6A 3ZY7A 2YXMA 3TN0B 1DUZB 2Q0ZX 2YPLE 3MA9L 3OXSB 1WH0A 3SE3C 35C8H 1GIGL 1HS6A 3FSOA 4E9LA 5EEVA 4ECNA 3BHBA 1MVUA 1A21A 1F4YL 1WWWX 4ABWA 5H94B 3KYNB 3KPSB 2UX6A 3E1F1 1OTSC 4WSGA 2GC4C 1VFUA 4I0KA 4FFVD 2Z92A 5JXAH 1JHTA 3LKPA 2FJFB 5D7LB 3K2UH 3ECBB 4O51A 1QNZH 2YA2A 1YY9D 5D2NB 4UOQA 4Y8DC 3MOBH 4APQD 2BY1A 4WNSA 4BFBD 1RUKH 4KMLB 2Z8VC 1D7CA 3QWRA 1TQTA 3T2OA 1CLZL 4YFLI 3BP4B 4IU2A 3CZLA 3VXRB 1AGDA 4DKFH 2CNYA 3UAEA 4HK0A 5EUOA 1I7UB 4WW1A 2P9RA 3BKMH 1E9OA 1JXJA 1S46A 4M6NL 2XKNA 4L4VB 3SE8L 3HRZA 3T8VA 1H5BC 4NKDB 4AL8L 4W9FC 2I9LA 3TO4A 4ELMA 3L7EA 1PY4A 4K8RC 3AM8A 5I1KH 5CD3B 4GG6B 2KLSA 1X7QB 4Z23A 4XNUH 1EHKB 4LSDA 3TVMA 2XV3A 4UT7L 5I1HL 2MFNA 1OD9A 3SDCB 1A6TA 4BK4A 3L5XL 2BVUA 3BC9A 4LASH 4ZW3A 4ZW7A 2WUCL 1FNSL 3ZQXA 2AEOA 1ACZA 4ES9A 3LPGA 3H8NA 1UJ3B 1Z32X 2WXGA 2OR7A 3FH7A 4A67A 3HZYA 4WO0A 4LCVA 5C09D 3UJJH 1P7HL 3EYUH 3IJEA 4G1MB 1T5WB 3L4TA 1YLBB 4YC2C 4XMVA 4ZYKB 2JCCA 1T5KA 4KITB 4TQIA 3CK0L 3HCVB 4KFMA 4H0LC 3UFIA 5GGVY 2Q9OA 3OKDB 4NN7C 3V4PL 4XOEA 4UQ2A 4XN5A 1N2RA 4UT6A 1INDL 2N56A 4ELDA 2ITDB 3SCMC 3L08A 4GKNB 1N0LB 1G0XA 2QSTA 5CSBA 3RVTD 4Z7OE 2Y72A 3U6XA 3F64A 3CTTA 3BPOC 4TNWK 5D1ZI 1KBPA 2ZKHL 2XTJD 1RIHH 1CDCA 4LEOA 2R2EB 3T2QA 4H2AA 1I85A 2F54A 4GP4B 4HEPG 4OGYL 4YXLL 1HXKA 1ID2A 4HK3N 1SVZA 2P5EA 2X4NB 4YZFF 4DTGL 4MRBA 4P4RA 3ROLA 1UXSA 5ECGA 1RK1A 1W72A 1KY7A 3ML9A 1NWPA 1GS6X 3M1CA 2YPLD 3CFCL 2BK8A 2VLRA 1E6OL 4KHTL 4XX1G 3EAKA 5EUKA 4BUGA 1FFPA 4LCYB 5CILL 2FATH 3KCWA 5CZXD 2J20A 5ACZB 4X9YA 3D12B 4R7DB 5SX5H 3RRQA 3DC0A 4YHZL 3N04A 3T3PE 5JQHC 3CFQA 4AM0Q 2O6EA 2WSDA 2G5BB 2WWKO 4NNYB 5A2FA 1B0GB 1V7NH 3FCGA 2X2JA 1O0VA 5IGXH 1DVYA 1WDAA 1SNRA 4S1SH 3JTSB 3UTSB 4R7VA 1OTTC 1IL1B 2X2UA 1BGXL 4MCYB 3QZWB 2HA1A 2IADA 4N1EA 3WG7B 5A2KH 2OMWB 2VL5A 4GEIA 4KZ0A 3G9VA 1KENH 1OCWL 1KIQB 1TVHB 5EU4B 2O5YH 2RJMA 3CH1A 4M4RB 1GYAA 4W93A 4GSDH 1OP5H 5HDQL 5KVFL 3QJFB 3B6SB 4NNXA 3QI9B 5JPMA 1WAPA 5GIRB 1OEZW 4IOIB 5D1ZA 3ARVA 3AQDA 3R0NA 5EMYA 3C08H 4BK5C 3W5MA 4G6AD 1S9XB 4NQUA 2IWFA 4KKAD 1PX8A 2AQ2A 4O5LH 2EUVA 4N2NA 2ZQKA 2J6WA 1SHSA 1DVFD 2ZUXA 1RSFA 3L3IA 3CFKA 2CJUH 1O7VA 5EC1A 3VG9B 3I3DA 3QIBA 1JZDC 2X89A 3ARDD 3AU0A 3GMRB 5CO1A 5JO5B 4KVNH 3NCBB 3BQUB 3TH3T 3C6LB 1USZA 4XNBA 5HGBB 3O41A 2B1AH 2X3BA 5DZVA 3UBFA 2YKKA 1CFSA 5EZIH 2ERJC 5JHDB 3QJTB 1JZFA 1KXTA 1QZNA 3EUDA 3HUJE 3QEQD 1YEGL 4H1LH 4OGQC 5DK3A 4NHCL 3ROOB 5I19L 2EVGA 1WA2X 4NHUA 3JV5A 3SGEH 1DHKA 4KI5F 1IEBB 5EO0A 3GHEH 1UCTA 4TULH 4ZFFB 2YQ2A 2H2SD 1PSKL 2VLKB 2LFGA 4FI6A 4YLCA 2A99A 1XGQA 4FYRA 2DJ4A 3NACL 5AW7B 5IMOA 4AMXA 1KELL 2H6UA 2BIOA 3WUWG 4M8QB 2QVIA 2YJLA 4JUSA 2KYIA 2VDQH 1IBHA 1RJLB 4ALAH 1IM9B 3UL4A 1JUFB 4OU3A 3MO1B 4I87A 2W95A 5TQ0H 2YZ8A 2FH8A 1O7DE 4PV9A 4HIXH 1YEJH 4MJHA 5DJ8B 4JEGB 3RNKA 1JMZA 5T1KB 5GS2D 4RMQA 1KYDA 4FTVB 5KAQF 5ESQB 4E9SA 4EXKA 1HIML 4LHJB 2XZCL 2E7CA 5E6UB 3I6SA 1N7MH 3Q1SH 3DMMD 3I3BA 3S36X 2E7MA 2XN9B 3FQRA 4ADJA 1SQMA 4NUGL 1NDGB 5E2TL 4XO9A 3MJWA 3QJHB 4FXKC 1S7TB 4IRSC 3SKNB 3T71A 2D0HA 5K9QI 2ZE0A 3SB3A 3H3KA 3PNWA 1YCSA 1JHLH 4YNYB 4ZOAA 1GMIA 2D03H 2NQCA 5KJRL 3T0VA 4PY8I 5C9JB 4KRNA 4P23A 3MRRA 4R4ND 1HESA 2OSYA 3HMWH 4FFZL 4XWOD 1ZE3H 5DD1L 5DZ9A 2AEPH 1TJXA 4K7PX 4L8SA 4LPCA 1I8LA 3DKHA 4BCXA 2WV3A 5KYNA 2WYTA 1UT9A 2FYYB 4JM2D 4X7SH 5TQ2H 1MCEA 1REIA 3C5JB 3AG4B 3PHQA 1U3HA 1MCCA 4DO5A 4FQHA 4ORGB 1PZUB 2ZXGA 1IBFA 1N8ZB 2C5DC 3QEUA 4WJ5B 2WD0A 3FFCE 3ULAB 5IF0A 3N43B 4APXB 3EJZC 5DVLA 4EOWL 4F57H 4YK4C 4P3CL 2ZD0A 4P5MB 3D30A 4ADGA 3IJ7A 1W9XA 5E1QA 3VGFA 2VLJA 4L9LA 3O3EB 5J3HD 2X28A 3D2UB 4Z3GA 3L3JA 4XBPA 2X9XA 3NVQA 1S9WB 4LSQH 2YEQA 5SWQA 4PIBA 4FTDA 2VXSH 4LHUG 5AW1B 5HGHB 2JK5A 3D4ZA 4JAMB 3ZT5A 2X9ZA 3MUZ1 2P26A 2QHRL 4AGNA 4HUUA 2F74A 1D6VH 1OAZH 4FJYA 1JFQL 2WCGA 4ANKA 4AQ1A 3B4NA 4MDJA 2X6MA 5HYSG 3BIKA 3QEGH 4M8VA 2JJTA 3OD3A 4HFWB 1Q94A 3QIWB 1OT1A 2O5ZL 4FQXB 5I71C 2DH2A 2I9TA 5BRZE 4P46D 1PD1A 1GAFL 4HJ0C 5EO9A 1CIDA 2D9QB 4FFVC 5CZRA 3FB8B 5K93A 5TD4A 4U4IA 3WFBH 5CFHA 4XPHL 1QFWH 5TDNB 3L7FB 5TJWK 3BZFA 5FX3A 3J2PA 3QUML 4NKOB 4YN3A 2IGFL 2XQ0A 4ONOA 5IOPB 2WWMD 2OI9C 1N5YH 4APQC 2CK2A 4BH8B 3MJ6A 4PJ9D 1OAKH 1WG3A 3H6JA 5C0DB 4UF7C 1V3LA 1VFMA 1RZKH 5KS9A 1I31A 2XWJA 2NXZD 1R6VA 1S4IA 3PWVA 4G80B 1G6RH 5IVZA 2BY3A 1S7SA 2BNRD 4LOVA 4YHPA 3RWJB 4EE2A 3DIDA 3U6RB 5F7LB 3DX9B 3T4AB 3OC5A 4MAUL 2FJSA 1PG7X 4ZUVB 3UTQA 1BA9A 2FDBP 2ESVB 4FQ1H 1HDMB 2EO7A 1HL5A 4YX2H 2IGTA 2K6YA 4E0RA 1T0NA 2PLTA 4BIKA 2A9NL 3EYQD 5EFIB 1G9NL 3A0OA 2BZCA 2V5MA 1GSKA 5GSVA 4EJ1C 3TONA 3BYYA 3FB6A 1CDUA 1KB9J 4WUKL 2ZT9C 4IJ3B 2OK0L 2IV8A 3C2AL 1EXGA 2A73B 2W80C 4G9FB 4JDTL 4GRMA 3UERA 4CSZA 3KHOA 4NXKA 2BIHA 5D6DC 5C0GB 1KTBA 3EFOB 1WBXB 3MROB 1JGVH 3IDGA 2F53B 3EBHA 3TCLA 4U6YB 3NCMA 4QCIB 3MV8B 1X7TA 2WLNA 4H1LB 2IMNA 2OSLB 3THML 2VKWA 5B22A 4GO6B 3HOGA 7FABL 4K9JA 4PB0H 4NUMA 3LQZA 3FB7B 4R96A 5IBTH 4M7JH 3KGRA 3NRFA 1QSFB 3EYOA 2FR4B 2RALA 5C0EA 5DS8B 4PWEA 2CG9X 1NDTA 2F0CA 3BOVA 4MA3A 5EZOL 5F3BA 4GXVH 5B1JC 4XOBA 2VR5A 3T77B 1CU4L 4PB9L 3OSVA 3TBWB 1JK9B 4BQCA 1UCBL 2XTJC 3BUYB 3CC1A 5IFJB 2GABA 4L2LA 1EFXD 3IGUA 5E1HB 3RWCA 5F9AC 1EZSA 2P8MB 5T1DL 4Y2DD 3GMOB 4KUZL 5HXMA 1QPKA 3DXAD 4M3KB 2WQ8A 1ORSB 3F5WA 3WMPA 1F13A 1WFIA 4U1JB 2EH7L 1CICC 1G7PA 1RH8A 1PX4A 3L9BA 4I3SL 3L2LA 4U05A 1T4KB 4U7KA 1XD0A 1Z9SB 4V1DA 1LEGA 3QWOA 1OXYA 1WVZA 1MUJB 4J2XA 5CJOH 1J9TA 4JPVL 1JJUA 1CF1A 3RWDB 1MFEL 5CZXC 5EZJA 4JRXB 3FBKA 1ZVYA 3EH2A 2YGPA 1T1WB 4LKCB 2PPEA 3MGOA 4LEXL 1FJ1A 5BRZD 5IV2A 2X6CA 1DJHA 1JXKA 3ILEA 2CO1A 4YFDB 2VABA 5GGVH 2Q6WA 3VE0B 3S36H 1AZBA 3CZJA 4ZDHB 4KO6A 5FGCB 3QIUA 4DT2A 2DI9A 4P9HL 1VRSA 1MHEA 2QBWA 2H1XA 2FNBA 4QUOA 4BELD 5I1DB 4N86A 5E0FA 2Y6TE 3EIFA 3ZT6A 1A7NL 1SDDA 1WAEA 4TRPH 3GSWB 1BHGA 4RCAA 5J6GB 2BMKA 1P5UB 3OGOE 4YDIH 4L0ZA 3N85L 4ES8A 2UZIH 1KCSH 3LNHA 4G8AC 5IJKC 4KKAC 5BV7C 2IAMD 1KYOK 3BI9X 4K7PH 5A2IH 4RAHA 1DVFC 1HH9B 3CDZB 3EUUA 3D9AL 4FFYA 2I24N 3DVFA 2A3TA 3ARDC 3HS0A 1J1OL 1UD3A 3NSDA 4I18C 2FD6H 4DESA 1GZHC 2AKRA 4AC2A 1OARH 4D0CB 4WWNA 2WQWA 5JPNA 4I85A 4XB7A 5DJXB 5AVWB 5MEQB 4L3EE 1J8HB 2VO5A 2OL3L 1ORQB 2WQVA 4JO3L 4MJ6B 5E5MA 5INDB 1MW3A 2VH5H 3X2QB 4Q0XH 3RB5A 5HYJE 3LZFL 2R69A 3MRNA 2H2SC 4QHUA 3FTXA 4UB0H 3TBBA 3WIIL 5F8QC 1AKJA 2HKFL 4ZW6A 1E2ZA 5DGRA 1HOEA 1CD1A 5GGTA 4ZMPA 4RMRA 4H4NA 1U8MA 3UBXG 2QR0A 4RWYL 3S3DB 3HG1A 4NIYE 4J3OG 3VXQB 2PYFB 43CAB 4XXWC 1BQ5A 1D5MA 4I77L 3KLHD 3D8MA 2BM3A 4GS7C 4PWKA 2QMJA 1FNGA 3N0PB 4OIIL 1BP3B 4KI1A 3HHRB 4Y5VB 3CBKB 1FNEB 3IFPA 1DVTA 3AS2A 1X9QA 2DEXX 4L05A 3Q48A 1MCKA 4S1QH 1XCWA 5DD3H 4Q9QH 1G6RB 1U3JA 1D6EA 5JHBA 5E99H 1F58L 4UQ3A 1NAKH 3VI4E 1EXHA 3L3OC 5CLWA 3BH9A 2X1QA 4NWUL 3DMMC 3RY4A 2C3GA 1IAMA 4B9FA 5D7JA 1ZHLA 4PN6A 1TFPA 1J1XL 5JDSA 3V4UL 2Q8BL 5HJ3B 3MVSA 4PMEA 1VPOL 4N9GB 4BFOA 3DVIA 4JY4A 4NZDA 4RFNB 2NY6B 3NABH 4OTXL 4KU1A 1FL3A 5DZOA 2WZ5A 4YQXL 4OSUL 3JVFC 1PG7H 4HYTB 2KDGA 3Q8EA 4BKLB 1FZMB 5TE6H 2L04A 1Q0EA 3MLRH 4R4NC 1DZBA 2H3KA 3IBOA 4PJAF 2FIKB 4PS8A 2KL6A 2AXWA 1IE4A 2EQDA 4B27A 4HUWA 4P57B 5FWRA 3B1UA 3L3GB 3MLVL 4XWOC 5BVJA 2BOBA 4GMSL 5ISZB 2K8MA 3NJHA 1IGYA 1Y7VA 2IMMA 2BP8B 2VDLL 4OZIA 4Y8AA 2H32B 4JM2C 3ZHNA 5A2LH 3QVAA 4EVNB 2AGJL 4PJBE 2M83A 1IKNC 3R0MA 3KBEA 3EYFA 4N2FA 4FHJA 5EBMA 5HY9B 2X3AA 4DUXA 4CADB 5CN3A 1HSBA 1KZYA 3EO0A 3H54A 2NNAA 4Y4FA 3KL0A 5F97E 1QFPA 2O5XH 2ZP8A 2BSBA 5BVPL 1FGNL 4EPSA 4JJOA 5JNYA 2YGVA 4LOFA 1JL8A 3ECQA 3EADA 2OJEA 3UTTB 5E08H 5C07B 4UINL 4LSRH 1V05A 4UV7L 4XNZC 4CGUB 3CGTA 4HZ1A 5DZJA 3QNZB 4ZAKC 3V5DA 3AREA 1MG2C 5I1AB 3RX5A 4L3ED 3KPNA 4OGAD 3FOLB 3WMSA 4D0DA 3QDJE 4MTMA 3LQAC 5KSUB 3AY4C 3US0A 1U8JB 4D3CL 4WDIA 2JJSA 4RA3A 3BQVA 4OFDA 3CNKA 4P04A 5GJSH 5L4FA 5F3HA 1DO6A 4JKNA 4NRZA 5IB1B 2WN3A 4R0LB 2G4EA 3WNJA 3V0EA 3P11L 4HCRH 4NPYB 1TITA 2WWMC 3RWGB 2EDTA 1JNLL 4NCC2 2YN5A 1F3JB 1F4AA 4PJ9C 5HHOA 4HJEA 2R23B 4FNLL 3IETB 3VXSA 5KN5B 2GQHA 3MKGA 1CC3A 1SVCP 2B2XL 2NXZC 3NCEB 5HTSA 2CUIA 1AQ8A 4J1UA 4G3YL 1CD8A 1U95B 2O26U 4K8RH 4JFYB 1W0VA 3LEXA 5A16B 4A7QA 3KPQA 4B60A 2JE8A 2WO4A 3LPOA 5LCVA 3MNZA 2MHAB 4XNQA 1CE6A 5EBLB 1X5FA 3A4EA 3BKJH 1DCEA 1TZIB 3U83A 3WHXA 5L8KB 3L3HB 4AQ8A 1EEYA 1NCWH 3EYQC 3QZNA 3RFZA 5CR1A 5AL8A 3Q2LA 4DQOH 2Z0BA 1X5YA 32C2B 4HWZB 5DURD 5T33L 1AD9A 4UQAA 1OLLA 3UYRL 1M7DA 2YPVH 1O6SB 3FQWB 3IMBA 2NDGA 2F7QA 4LMQE 4IDJH 3AUWB 1LXMA 1CR9L 4Q7DA 2FHFA 3PS6A 4OZFG 4CDGC 2FAUA 1R3LB 3ZLQC 1JGIA 4HETA 4Z76B 4MVBC 4A6YH 1KGYE 4TLSA 2BINA 3GSUA 2CAKA 3MLWH 5DTFB 2V7HB 5LBGA 3VWKA 5E6IA 4LCIL 2EDJA 4ISVA 3HS9A 1NMCB 4CA4A 1CCZA 1P69B 2H1LM 3K5RA 4JFPA 3QRGL 4HFUL 4PRIB 1CXHA 1DJSA 1JRHI 4OQ1A 4X5PA 3ARWA 1PKOA 4HDIB 5DMKA 3ZTJG 2X4TA 2O6FA 3OXRB 3T4YB 1VESA 2FJUB 1KACB 4WUUE 3OR7A 5C8JA 3OKOA 2AJVH 5A2AA 4NQSB 2P24A 3L1OH 5T3XD 2EYRA 3FUNA 4PJEA 3MOAH 3DPBA 1OANA 5AUMB 4DK6A 4Y2DC 1AQHA 1LL1A 3UO8B 1S7XA 2CKNA 1MJ7L 5F9JA 4NAQA 5GZOC 4PI0A 2AZAA 3O6LH 4G7VL 1JZ8A 4PS4L 4BWWA 4JFFA 1GZQB 4R2GB 4P07A 4OT1H 4PWGA 2DJMA 5DVOA 1XCQA 4MDIA 3LCYA 1XH3A 3GMLB 4H0IA 4TVPH 2EDHA 3QDJD 4KO5A 4PRBA 4EKXA 4IGBD 5EOQL 1EDHA 3SKMA 2P8PB 4Y5XC 3MLYH 1FFOB 4NKIH 1EMTH 4QRUA 3UG4A 4NM8H 3S3BB 1AD0A 2ADGA 2BNUA 3HE7B 3WAJA 4PJ5B 4A1RA 1N6QH 1BVKA 5C7XL 2XN2A 5FIEA 5IBUG 5TE7H 5EU5B 4N2KA 4UOZA 2OMTB 4ONFH 3LKOB 1I3RB 3GJFK 3F7KA 1GMEA 4KZEH 2Z64C 1QPXA 5E00A 1SXZA 1M7IA 1JSYA 1M7XA 1NGXB 2AXFB 1UM6H 5F8RC 2QQLH 4ZFQA 3RHWF 5LJYH 3NH7L 1DVQA 2X70B 1KEGL 3B7YA 2SODB 3T1WA 4PIRF 2P44B 4RDQG 3ULUL 4LBAA 2IAMC 4FFYL 4GYBA 3AQXA 1JYVA 3TEWA 2IANB 3RDTB 2B0SL 2GBVA 4KH2A 1JZ6A 1JGEB 4TSCL 5HHXL 3PWJA 3OQ3B 3OTTA 4PJIF 1JTPA 4LVOC 3DO7B 3L95B 2APBA 3ARFA 3OF6D 3SZKC 3NT0A 3KJ6L 5EOTB 5T1MB 4FNPA 3PNRB 4X42A 4KMTH 1DQJA 4Y0GA 4XO3A 5D2LA 3VMPA 2BS8A 1YEHL 4ABQA 4ERSL 3H3BC 3FUMA 3GKZA 2GK0A 3LHPH 1FNAA 3B3IB 3L9RB 2R69L 3GWJA 3EJSA 4FLSA 2ZOLA 3ISRA 1RP9A 2Z65C 1HXYB 1HI6B 1BQLL 1RKRA 3OHXC 4NFBA 2XV0A 3PP4L 1KGWA 1OHZA 4O4YL 3NCXA 2IC2A 2WXJA 3O8XB 1DJYA 3VI3A 4PY7B 5CP7A 5AB2A 5DJYA 2DYSB 2JIXA 2DWEB 4MNQB 4R7XA 3UP6A 4QRPA 1IQWH 4NQCA 3U9PL 4TV3A 2IQ9L 5FO2A 5CZKA 3W9EB 2NPLX 5I1GL 4NCC1 2MQGA 3HR6A 1MCQA 4N0CD 3SDYH 4BQBA 2B08A 4HWUA 5CP3A 4F2FA 3KLHC 1MCFA 4WUUD 3IB4A 3GMNA 2H0PA 2XPGB 3ATDA 4WI5A 4HT1L 4H26B 1MIMH 2EDDA 3A6OA 3L6FB 4AQEA 3VDBA 2IVFC 2FL5B 3ZK0A 3VD5A 3UZQA 3VXTB 1XX9C 4E5XB 1RU9H 4JO2L 1A3RH 3CVHH 1H5BB 3QXAB 2RA1A 2VZSA 1T6BX 2VLME 3KDMA 4YSDA 4M6OH 2YD9A 1W6LA 4U1SA 2AAAA 3ZKXC 2GY7B 4FQ2L 4W9DC 4Y19A 1WZMA 2CUAA 2HVJB 4FMVA 2F61A 3LKNA 4LLYB 4M1DL 2A77L 2K8QA 2ZAHA 4DVBA 1KB9K 3DSFH 1SEQH 3O6KH 4DGYH 3IJHA 2G5RA 3PHOB 5DR5H 3A4FA 1CDHA 1KB5H 1TFHA 1KCVL 2H2PD 3GDBA 4YO0A 4AW4A 3Q6FA 4Z78B 5EC2A 3BUPA 1F6AA 2IBZX 1M57B 4PAZA 5CSZA 5L2KB 1RURH 5I76A 4XX1E 2WKOF 4CKQA 4GBXD 3ZZSA 3KMDA 4PY8J 2WYIA 3WKNA 1XXDC 2LLLA 2P7TB 4KUCD 4MRCA 3S5LA 4DUWA 4R3SA 3MTRA 1S3KL 3CIAA 5DJ0B 3C5ZD 1IBGL 5C08A 3DK0A 1JZ7A 1XR8B 5AAMC 1S7RB 2WXOA 3SCMB 1UA6L 3F62A 3WY4A 5FLVA 1L7TL 4UUJA 1E9QA 4TVSa 4JZJA 3V52H 4OGXL 3QO1B 2OQJB 3TIDB 1JFHA 2VXTL 3LEYL 1WSST 5FECA 3VSQA 3BPOB 2OMNA 3FO9A 1IQDB 2GIXA 4HSCX 5E7FA 1TTRA 1CK0H 3IS1X 2OCCB 4QHNB 3S88H 3VFOB 3GJFA 3L4XA 2ADFL 1OZTG 1F4XL 4KKRA 4XXCC 3FU8A 3HNVL 4RAUB 3JV4A 4Z3TA 4QXTA 2V2WA 1XSKA 2DY2A 4OJFH 3KYKL 4G8FA 5ESVA 4KRLB 1I8MA 5E70A 5I66B 1L9OA 4FFTA 2ZIDA 1KT2B 2AAVA 4Z6AT 5KG9B 4O9HL 4RMVA 4GI8A 4OGAC 4PJGA 3EGDA 1E67A 3PF2A 2QT6A 2O5NA 2I60H 3DGGA 2IH1B 1DJXA 2OJ1A 1LNUA 3AU1A 1SFDA 2ZNWA 1JNHB 1I1AD 3FOMA 1HQRA 2BSTA 4GAJL 3UCRA 4AH2A 5J9PA 4ZMTA 3COOA 4PJAB 1M42A 2EEDA 1PGRB 2J88L 2HLAB 2HRPH 2VZ1A 4O58L 1PEZA 5EUOE 2VXUH 5TH2B 4R5XA 3ULVC 4PJFA 3TV8A 1ZSHA 3NSCA 4JGNA 3WIFB 4X5LA 5F7FA 2SEBB 4ELME 1BCIA 5LCVL 4XTRC 4NGHH 3ZMRA 4D0BB 4C83B 3SPIA 3BCFA 1HJCA 1NC2B 1N0XL 3ARBD 4V11A 3EYSH 1FAKT 2AXGB 1HHHB 1M56B 1PIGA 2VLMD 2XFXA 1FZKB 4QYOB 4AGQA 2XWBB 3FRUA 4YGAB 2Z7UA 3NK4A 5A2CA 4WGKA 4BGDA 5EBWA 3UP1A 3LN9A 3GMQB 3ZE0E 4N2EA 4HVBA 5C3LD 1TEYA 2F1AA 2VZUA 3AGWA 3HFFA 1U92A 2EXSA 5EU3B 1XCXA 2H6PA 3K7UA 3O2VH 5AEAA 4U4BA 4X99B 2JCCE 1BVLB 1E8XA 2P80D 2V37A 4F33B 1FRGH 5ID0B 3DX0A 1DJZA 2XXGA 4YIQB 2HJFA 3ILPA 1NCDL 3CG8A 1KPRA 2WPGA 2DD8H 4XCCH 2VTFA 1QTYT 1X3DA 2AQSA 2WXIA 3WUWB 5ENWA 3ZTDC 1LDPH 3IU3B 3NCWA 1QSEA 4JZNB 4X6FB 5D96C 4Z7IA 4OZGE 1MOEA 2PCFA 3CN1A 3KW7A 4RNRB 3V0AC 4AQAB 4JLRB 4M62H 2CK0H 1IIIA 1OE2A 3WE1A 3TBTA 3P40A 5I82A 4AGOA 2HN7B 3I85A 4PBXA 4ZMAT 3NG5A 2AK4B 4DP8X 1LE5A 1JDDA 3OBAA 3D25A 5DHEA 1FCCA 5AALA 1JPTL 2EEAA 2FIRT 3MACL 2F54E 2AK1L 5ECJE 5JOPE 1R3JA 4H13C 3NPSC 3H9HB 3QQDB 3MV9B 5FKAB 1XT5A 5AG8A 2P5EE 3CHRA 3IDJA 3DJRA 5H4ZA 5BRPA 2FX9H 4KXAA 5FHAL 1FDLH 5DRZA 4P4KA 1UQSA 2AJ3A 4YXKH 1JZ4A 4GP5B 2E27H 1QATA 2VZOA 1AQDB 2ZAGA 1HZHH 1XB8A 2Y2YA 1CLYL 2B9AA 1H3PL 3EGSA 1PZDA 3CVHB 1MNUH 4X5QA 3DIFA 1L9PA 2DICA 3U48A 1T20B 4FXKB 3IYLW 4IRSB 3IKKA 4YPGB 5DZLA 3KG5A 4AKOA 5AD0A 4IGBC 5AWNL 4FXTA 1MELA 2DW5A 4EEEA 4YDNA 1NAMH 5BJTB 2F58L 4IRZH 1IILE 2R2BB 3DYMA 8FABA 1RHFA 5C6WH 4OD3H 3BZEB 3PGFH 2IOMA 3DLQR 2WC7A 1KB5B 4OB5L 1JRHL 3RJOA 1JWMB 1C12A 1ROCA 4FA8A 1MI5E 3WS6A 4FC3E 4W9CC 2E3VA 2MWCA 1AXSB 4G43A 3B2DC 4F7TB 1SJEB 4G6KL 3EFFB 1RFDL 3RZWA 4Y1AA 5J6HA 3REWB 2R1YA 5FOBB 5BV7H 3TO4D 2CDFA 4F9PA 4MD4B 1AH1A 2RACA 2DYPA 5EN3A 2BSSA 1O9VA 3GKWH 5C6TH 4AL8C 4ZTOL 3SGJA 4XNYH 1E65A 3OMAB 1MCWW 2DKUA 4PV8B 3TVMD 4W1TA 1UH4A 1ZIBA 3WN6A 2E56A 3AWEA 4XVSL 2CO2A 5LB1A 5ILTH 3NSFA 1ED3A 4YGVA 3K91A 3WDIA 2XNAB 4MWFA 1OGAA 3ZZQA 1K72A 3PWLB 4FQCL 4J3OH 3EH1A 4MFHA 4NS0A 1G7IB 1VADB 1A9BA 3GUFA 3M86A 4YHOL 5TGBA 4IQHA 1Z0MA 5I15L 3IGFA 3ARSA 1DLFH 5FUOL 5I71B 2OXGA 5TPWL 3RL2A 4ETYA 3KWXA 1XMWA 2IBGA 1N8OE 3OGCA 1QRKA 1RUAL 3F00A 4HUMB 5D72H 5C0RL 3APCA 2ARJQ 5DJCB 3U79A 4JDZA 1HEJC 5I0DA 3B1TA 2JKSA 4ACTA 3B56A 5AB0A 2QZ5A 2OI9B 1ZLVK 2C9AA 2VZVA 1UD2A 2XG5A 4NC1E 5DXWA 5D8JL 3WLBA 2YLHA 4YSOA 3TH4T 4GKZA 3BSZA 4N0CC 3EF7A 1DDHB 2QSVA 2C9UA 3BKCL 3MJ8B 1EAPB 3B2XA 5DRNB 2M26A 4Y9CA 2AABH 2F54D 5CMAA 4AENB 4MJ2A 5JOPD 2APVA 1U2CA 1QTPA 1YQ2A 2FLBT 3DJZA 1M1XB 2Y06L 2P5ED 3MRBA 2V9RA 3BW9A 1RHHA 4K23L 2CIKA 1ZEAH 4PRPE 3R1GH 5DFWH 4N2AA 2DRUA 4R26H 5EA0H 1L0PA 5E8NB 2VLRD 1R5IA 1N67A 3X11A 4JGJA 1F3DH 3GSOB 3SJVA 2J6EH 1UG9A 4QRRB 4XMLL 4L8BA 5LXGH 1EO5A 3K71B 3OB0K 5CLTA 4PGJA 1OCCB 3IKCA 2LLGA 5ERWA 5DJ6B 4WIQA 1Z7JA 1LMKA 3KS0J 5T5NG 4PJIB 1TJMA 2WUBL 3N91A 1JG9A 2HG5A 3LIZH 4GSUA 1QSVA 5KBPA 2H2PC 1BF2A 3GO1H 1CGSL 4URTB 3RA7H 5C09B 2CE6A 3EH3B 3FSAA 5ETUB 3U7AA 5TDOA 4GBXC 2FB4H 5CJBA 4HJGB 3ZO9A 4RDQF 1M71B 2ATPA 4UIMA 4DKEL 4KNSA 3HBQA 4PBDA 2OR9L 3VJ6B 2FEDD 4PD4J 3MCKA 1AIFB 4QHLA 3UZVB 5EDSA 2ZX7A 4HKBB 4PLOB 2CGYA 3AADB 5D1ZD 5TE4H 2AJSL 1K4DA 3TEXA 1ZWIA 2CKBA 2VLJE 3WJJC 2W9DH 1HL9A 1IAOA 1JPSH 2B59A 3CFJA 2V2XA 3CFEA 5DHVH 4KZCA 2UXTA 2F8VA 5MERA 4QKTA 3TF4A 2BVYA 4N0UE 4M3HA 4FZ8L 4KTDL 1UB5A 3S48A 2XTJB 4FXGC 5IJDC 2H1PL 3QIBD 3IFNL 2NOYA 2IWKA 2ZCZA 4N2CA 5DZPA 1GGBH 3GINA 1FGVH 2BNQA 1YMMA 2FQEA 3GJEA 2NNFA 5DLLA 2ZUYA 2CHNA 2J3SA 3AS3A 3RL1B 2NY0D 5FO8B 1CICB 5CHNA 2XWCA 25C8L 3EFDL 1OP3K 4ENED 1JI2A 1U8NA 2MQ0A 3LQAH 3STBA 1AHWA 2YPLB 1J1PL 3U9UB 3REVB 2NY7H 1LE9B 4IKKA 5E94B 4IBQA 4M5YL 4DAGL 1NBVL 1BOGB 4WNQB 4UAOC 2UZYA 2VLLA 2JKXA 2DBJA 2GAZB 1ZLDA 2F15A 3DI2B 3TTYA 4XCEA 3WGUB 1FO0A 4CBPA 6CGTA 3QQXA 4UCFA 3EHBD 1BVNT 5E2UL 1I3GL 5AZ2L 4PCTA 1I1AC 3OPUA 4K3DH 2K7QA 4OI7A 4JKMA 3X17A 5DHYB 5KVEL 2F9BT 3NA9H 3GLDA 5IW1A 5F7NC 1NAMB 3LH2H 2G75A 3D0LA 4AJVA 4K9EC 4A2DA 3SDAA 3DRQA 3QULA 3VTTA 3U4EA 2KHAA 3LHAA 2PABA 3TA3C 2DDQH 1IAIM 3MV01 2Z31A 1Z3RA 2JJVA 3I6LE 3X12A 3JTTA 4F7EA 4M29A 4M6MH 3VFWB 3GFUA 3DV4A 5AOKA 4B3EA 1HWHB 3ARBC 5HSFA 1IIKA 4M5ZH 3V0GA 3VXPA 5BV7B 4OFKA 1TKWA 1A0QL 1DVFB 1USQA 2Z34A 4KXZI 3NAAH 3ARDB 4K2UL 2HH0L 3INUH 4I18B 1ZLWK 2IH8A 4QO1B 3SN6N 1GGCH 2ICEA 4AX3A 4YSTA 2AMUA 2KPNA 2IJ0C 1EFQA 3MRCB 4P23D 1HSAB