2Z7WA

Crystal structure of h2o2 treated cu,zn-sod
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
151
structure length
151
Chain Sequence
ATKAVCVLKGDGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAGPHFNPLSKKHGGPKDEERHVGDLGNVTADKNGVAIVDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTKTGNAGSRLACGVIGIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title Crystal structures of H2O2-treated Cu,Zn-superoxide dismutase
rcsb
molecule tags Oxidoreductase
total genus 34
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2007-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2z7wA00
2C9UA 1B4LA 2WKOF 2AQRA 2WKOA 4OJAA 1JK9A 3ECVA 2AQPA 4N3TA 3MNDA 3L9YA 1TO5A 1SDYA 2WYZA 1CB4A 1IB5A 1XSOA 2E46A 2XJLA 2AQNA 4B3EA 1SPDA 1PTZA 1IBBA 3KM2A 2C9SA 1IBDA 3K91A 1SXBA 1EJ8A 3KBEA 1KMGA 3KM1A 2AEOA 1P1VA 3ECUA 1XTLA 3GZQA 5KBLA 1L3NA 2WZ5A 3GTTA 1IBHA 3QQDB 3H2QA 3RE0A 1BZOA 2AF2A 2WZ6A 2K4WA 3PU7A 1SDAB 2ZKWA 1CBJA 1F1GA 3ECWA 1SXCA 1E9PB 1E9OA 3L9EA 1Q0EA 1E9QB 1N18A 1F18A 2GBUA 2Z7UA 3GQFA 2Z7YA 3KH4A 4A7GF 4A7GA 1QUPA 2ZKYA 2GBTA 1SOSA 1SXZA 3CQPA 4MCNA 4A7SA 1F1AA 1OALA 1N19A 2AQSA 2APSA 1RK7A 3KBFA 4BD4A 3T5WA 1EQWA 1AZVA 4A7UA 3F7LA 1BA9A 1U3NA 1DSWA 1MFMA 1OZTG 4A7TA 1B4TA 1HL4A 1TO4A 1OAJA 1HL5A 2VR8A 2JLPA 2JCWA 4U4IA 3H2PA 1COBA 2C9VA 2Q2LA 4OH2A 3KH3A 5KBKA 2WWOA 1SRDA 1SXAA 4BCYA 5KBMA 2GBVA 4L05A 3CE1A 1JK9B 3GTVA 2LU5A 1YAZA 1Z9NA 2VR7A 1PU0A 1YAIA 2Z7ZA 1OZUA 4N3UA 1UXMA 2AQQA 4A7VA 2ZKXA 4BCZA 1E9OB 1S4IA 1IBFA 1YSOA 2VR6A 2R27A 2ZOWA 4FF9A 2E47A 3GZOA 1XTMA 3HW7A 2NNXA 1Z9PA 3HOGA 1ESOA 1DO5A 3QQDA 2WYTA 3LTVA 3MKGA 3CQQA 3GZPA 5CU9A 1SXSA 1FUNA 1SXNA 3S0PA 1PZSA 2WZ0A 1OEZW 1F1DA 2AQTA 2WWNA 3SODB 3HFFA 1E9PA 1UXLA 1JCVA 3F7KA 2XJKA 4MCMA 2V0AA 2Z7WA 1E9QA 4A7QA 2SODB
chains in the Genus database with same CATH superfamily
5CSZA 3GB7B 3DSNB 1F6AB 4C59B 2D3LA 2IXQA 1V27A 3IXAA 5E51A 2BOBA 3VXOB 3ZDXE 5I16B 4QHNA 1AKJD 5FO9A 1DANT 1IGTA 3I75B 4H5SB 4BV1A 1AC0A 4JN1H 1CFQA 1HSAA 4ENEC 3BP4A 1XDTT 4PS4H 4R6UA 3S8WA 4XP1L 1HDMA 4WI8A 2MTAA 1I53A 4U7KA 2AEOA 3LDBC 3DARA 3V5DA 4ODSH 2CCLA 2DZEA 1D9KC 5ABAA 4A55A 2YXWA 2VRQA 1T1XB 2Y6SC 4WI4A 1C7SA 4NN6B 2F5BL 5L4IA 3MRJA 3VQMA 5KVEL 3SDCA 2DQHL 2AABH 4Q6YA 3FQWA 1N5YL 3DMMB 3H3PL 4PRPB 4D9QE 1TT6A 2F6AA 5FXCH 4QF1A 3L17A 1KYOJ 1SMOA 2G60L 3IWUA 2Z8SA 4P23D 1RJYA 5GRUL 2WKLA 4DO4A 4C8XA 5DC0A 2UXTA 1DJXA 4RFNB 3UIZA 3LB6C 1FNAA 4L2YA 4KU1A 1RL1A 1H15A 3CFEB 2YFOA 3H6JA 3V0VA 2A1WL 2N4IA 3D3VD 3GRWA 3TGXA 1ZVNA 4N9GB 3FQXA 1FLRL 4YHLH 1DCLA 2YA2A 4IYKA 3RDTB 3QPQC 3DLQR 1IKOP 1W6LA 1QRND 1O7DC 3JYBA 2K8QA 5AOKA 3IRPX 5I5RA 4JFFB 1F45A 4WI5A 1N64H 3QS3A 4JFPA 3SCMB 1AR2A 3HUJA 4MXWL 2CPUA 5DURD 4J2XA 2OKMA 3LRLA 2QSTA 5SX5H 4GUCA 1GSMA 4I13B 1FC2D 2ORBL 1IM3B 5TGBB 3D05A 3ETBF 1QBLH 2R9HC 4P4KD 3BFQG 3QRFM 3G5VA 1Q0YL 1YEFH 4ODWA 4XMLL 5DRNA 3BAIA 1X9UA 3KGUA 4S10A 3FCSB 2ZCHL 4UOW0 1WFNA 4M7LT 4KQ4L 3I50L 4HUKB 4BZYA 2I07B 3L4XA 3GI9H 4MXQC 1HH9B 2VIRA 4LIQH 1BXVA 5I1DA 3Q0HA 4F2FA 3EG9A 4F92B 5CKAA 1LEKB 1N59B 3RWEA 2C34A 4ONFL 4YDKH 2VDPB 1AQDB 2K3HA 5BRQA 3WUZA 1VFBA 2XYCA 1K4CB 2JB6A 4HGMA 2BHYA 2BVUA 3C9NB 3TEYA 2VB5A 3QXAA 1HINL 2R8SH 2PWEA 4X98A 3IFPA 1J1PH 4HWNA 4WI0A 1IAOA 4UTBA 4RBPH 1KB9K 1LO3H 3HLAA 5C6TL 3LMJH 4I18A 5FLVA 4BINA 3N3EA 4KV5F 5TE4L 4ZUSB 4YSEA 4M3HA 1TFHA 2VKXA 2PTVA 3ARGD 4XO3A 5L2KE 1D5XA 4NPYB 3D34A 2E46A 5JW4M 1G94A 4LKXB 5C0AA 3MRNA 1GSKA 4XVJL 1EJOL 3H2WA 4ZPVB 5KOMC 3QZWA 4OLZL 1NM4A 1D9KA 4QRRE 1NBVL 3CX5J 1GJIA 1DL7L 2VZUA 2Y2TA 5AVZB 1UWEH 4NOFA 5I1GH 2WXQA 1JBJA 2CHWA 2Z91A 3BOVA 4GIAA 4BFJA 3BZ4A 1HN1A 4R4BB 2WNXA 2HH0H 3D4CA 5D1QE 4WI3A 3CH1B 4PG2A 3VSVA 4OZGB 1KTLB 5CD5D 3SYQA 1ZEAL 3MRDA 4M43L 4AT6A 2WP3O 2AMGA 5DEZA 3ZUNC 2TRYA 6PCYA 1I8MA 2EO9A 5AKRA 3QJHA 3IU4L 4HJJH 4MAUL 4RQQA 1V05A 1Q0EA 3ULSA 4BKLA 5F7EH 4C58B 5AOIA 5C6PB 3ME0A 4MASA 4PREA 4N90E 5DUML 3TONA 3FSZA 5FWQA 3E6HB 1FSKB 4IBZA 4NUMA 1JFQH 1PCXA 4DN4H 1MKFA 3NP3A 5CN2A 5DEFA 3GINA 1CF8H 3HI5H 1A47A 3CDGA 2FEEI 3H7BB 2IWEA 3NA4A 4FXKA 4G9FB 1CFSB 3VI3A 3FO9A 1C1EL 1LP9E 2JKRM 5D6DA 1W9XA 3T0DA 3CVHA 4H13C 2FX8H 4JFHE 4ALAC 2D2CC 1MI5B 3RWJA 2YZ1A 3GMMA 4NDMA 4HHAB 4Y9EA 2WWMC 3V4VA 1E7UA 1WC7A 3US1A 4F8TA 4PJXE 4JDEB 2H6OA 3TH2T 5CLYA 2AGJH 2ZPKH 4NZFA 4F7CA 1XR9B 3BWAB 4J3WA 5HHME 3O6ML 2XZAL 1OP3K 4IKIA 2E86A 4YAQB 4LSUH 1TXKA 3K71A 4L3AA 2MRYA 3OAUL 2YPLD 3T0AA 4UV4L 3CSYB 1Z0MA 3K1KC 1ZA6B 1J5IA 1WAPA 2P5ED 3AFLA 3WIHA 1T0OA 1KJ2B 1YMMB 3L95A 4GMSL 4ZFFB 4ELKB 1TJXA 3QUMB 3HG1A 2KZKA 4QEGA 2D9CA 5FM4A 3M1OA 3EDKA 3B2MA 3IE4A 3KPSE 5BOPA 2QV2A 3DV4A 4E9TA 1HHHB 1H9VA 5DDHA 1H5BB 3L45A 4Z7NB 2G5BB 1JK9A 2VAAA 3M86A 3I9GH 4P46B 5BOJA 3G6JA 3QJOA 4YXKH 1TU2A 1CB4A 2DQFA 1M71A 4JFWA 3BH8A 5CP3A 2VJ8A 2LLGA 5DRXA 1RJLA 2J20A 4MA1C 1QUNA 3D08A 2H9GA 2P7TA 5B7EA 5L2JB 3UBGA 5LWYH 2D8KA 5SWQA 1HOCA 4HGWB 5IHLB 4HUVA 2YD9A 4M1GH 4WDIB 2BSDA 4MJIE 1NCDL 1OAZL 3SO3C 1CL7I 4MMYB 4APQD 1LD9A 3QZBA 3L5IA 4ZYKA 1AKPA 4IJ3B 5HI4C 4LCWA 1T1ZB 4TVPL 1RSYA 2VABB 5F1SA 3SPHA 5CZVL 1F4WH 3IGKA 3V0FA 3G08A 3MODH 3TBWA 3V5HB 1ZT4B 2E6JA 5IVXF 2Q76B 3DA0A 3O2DA 5C7ZA 2ZUYA 1NMBH 4NQXA 3Q44A 4BFRA 3KMDA 4DKDC 4OJFL 4LOEA 2EYTA 4E41A 1NC4B 1F3RB 1U8JB 1CXLA 4Q8BA 1QI5A 1RZ7H 1L9NA 3Q9QA 4YZFF 3RTQC 1FFQA 3KYOA 1NSNH 1YNTF 2CHXA 1IU1A 4L8BB 4LHJB 1MWAL 3KYKL 5E4EB 4ZMPA 1IILE 3M45A 3BMVA 4PGBB 1RK1A 5K9KA 4JGJA 1T5XA 3QNYB 3PUCA 4GS7B 1JD7A 1YYML 1KY6A 4AMXA 3COOA 4WWKD 5AB1A 1TF4A 2YJLA 2YD0A 4N8PA 4M62L 1XH2A 2HLFD 5EU6D 3RZCA 1WSST 5I6XB 2VUKA 3C87A 5KN5A 3C12A 4FYTA 4TSBH 4F37F 4KQ0A 2MQCA 2RCSL 4EN3C 3LN9A 3T0WA 1U92A 4PJCA 1RJZA 1N5AB 2HXAA 5KTEH 2AJVL 1I7TA 1K2DA 2Y3NA 4KRLB 1NGYA 5E03A 3U9PL 3FBKA 1WFOA 2TRHA 3LXCA 4G8FA 4QY8A 3PGFL 5GRWA 4ANKA 3MR9A 1PU0A 5G55A 1MNNA 2Z7ZA 2DLIA 4F24A 1YEEL 2VM3A 2FNWA 5SX4H 5J0BA 1A1MA 4UIMA 2GT9A 3ATBA 4L8CA 3HI1A 5IQ9B 3MRQA 1HCZA 5ADPL 3IBOA 4PJ9B 5CR1A 2UYLA 1MCLA 5LBSL 2Q10A 1ZKAA 3KR3L 3UOAB 1JUFA 1BX2B 3LRHA 3N9GH 4IU3B 2OJZH 5DTFA 1D5BB 1ZK5A 2Y7OA 3MLZL 3TCXA 4LL9A 1E6OH 1U8MA 2H3XC 3AMLA 4S0TD 2XKNA 1U8QB 3NIDE 2OS7A 5ETUB 1T2QH 1OCWL 4G8AC 4HFUL 1WWWX 4TNFA 3NCJL 3NTCH 3V7MA 2V5TA 5EF0A 1KJVA 2OYMA 2RJMA 5I2IB 2X89A 3VYPA 1KCBA 3VACA 2K9UA 2ADIA 4AQEA 2HT2C 5FPIA 1LEIA 1NFIB 1S7TA 3CC5A 3H85A 1OTUC 3LCYA 3QUZA 5TE6H 1PTZA 3HG2A 3WFEL 3DX6B 1EFXA 2WO4A 3DDFA 4PJIF 4AYSA 3TEUA 1YVLA 3QEGH 5LO7A 1E30A 1TTBA 4FHJA 4DESA 4F7EB 4ZXBD 2R39A 1GXEA 5EBLB 3S37X 3ZDYF 4HS6B 1HL8A 4PQXA 3W82A 3ZLQC 3K1DA 4DPRA 3QSKB 1YCSA 5B21A 4Y2DB 5HY9A 1FDLL 3SDXF 4ELME 4FI6A 4EDXB 4RISL 4K5OA 1OT2A 1QSEB 4Q14A 3GMPB 4OZFG 4N4YB 4BK5A 1LDPL 2JCCF 5DZPA 5C07B 3RVTD 1OWRM 2YKKA 5DCCA 5IT2H 3TO4B 2GUYA 2H6UA 4IDJL 2HJFA 4AEFA 2YKLH 4PGDB 1Z9OA 1ZMYA 3BUQA 4F27A 2VLRB 3BPCB 4I5BB 4Y2OB 3R06A 3Q01A 3BAWA 2AJSH 4EOWH 3C60B 25C8H 3RWGB 5DS8A 4WCYH 2JB5H 3L13A 2E7CA 2ZXAA 4XNUL 4OF0A 4LLQA 3ILQC 1IAMA 4KI5E 3JQOB 3EYFA 4XN9A 1NCWL 5JLZA 5EWIH 1GGBL 2WIIA 3AAZA 1E5AA 3F62A 1TQBB 1OSPH 2IBZX 1XCQB 1Y07A 2WXKA 3AROA 3A4FA 4UOQA 1YEJL 3UJIL 2YHGA 2ADFL 3PFQA 3UYPA 3K0YA 2C9PA 3WJMA 1CLYH 4A6YB 2ZICA 1MHCB 1TG8A 5EOQL 5GS0D 1JWUB 5AOJA 3RU8L 4V1DE 2EE9A 2Q0ZX 2XPGB 4L1HA 4MRCA 4JQVC 1JGLL 4MMXC 4CBZA 3P77B 5GZOD 2R1YB 3P0VL 2WVSA 4TKWA 1ET5A 1DQMH 2HFTA 1R3JB 4OI9A 2E59A 1G7PA 2C7FA 1UYWH 4DETA 2LV4A 5A7EA 3UZEC 5C92A 4FABL 3P9MB 3WLBA 1P69B 4OCSH 5FV1L 2ZUQC 3SQBB 4HS8H 3D2TA 1P4BL 3RJDA 4FHKA 4KKPA 1I31A 4KX9A 2HKAA 4ONGL 2Y1YA 4Z3FA 4W6XB 3VE0A 4PJFA 1CLOH 1E43A 1R6VA 2A6KB 3GK8L 4ONHA 4ORZC 4PI2A 5BVPL 5I0DA 2Y7NA 5IMMA 3KEHA 4YEEA 5E6ZA 3UGEA 3C5ZB 1A6TB 2WGXA 2PP9A 1JHTA 4ICWA 4XPTH 5DWUH 3OHXC 5DK3A 2VLJB 5T8IA 1JZ4A 1R47A 4MA3B 3KEDA 2F1EA 4L1BA 4CVXA 3K46A 2Y4SA 4RFOL 4GBXB 5DZOA 3WO4C 5L4MA 3FF7A 5G2NA 2NYKA 4IOIA 3SGDI 4OLXH 2NY6C 5ALCH 3QAZC 3OKKA 4NO5B 4PB0H 1NCBL 5H37G 2XZQH 4MZ2A 4BFEA 1FVEA 4LESA 3P30H 4GT7A 1WCQA 2FSDA 3N44F 1YYLH 4LCYA 1IC5H 1X4XA 1BP3B 3UO1H 2J6EA 3MRKB 3BX7C 1USZA 2BP8B 2ZX6A 2Q87A 4R4FH 1GZHC 2AEPH 1VZIA 3RILA 1E9OA 1SEQL 1IEAB 3BKML 3UJJL 4AEHH 2IAAC 4BRJA 4NM4L 3S88H 4PWIA 3WL9B 3E1F1 3U0PA 1ET7A 3L3KA 3PWPD 4M8QA 3S36X 4ETYA 3TXAA 2P8MA 1SYSB 4OIIL 3N5AA 4G7RB 3IDUA 4RAVB 3KBFA 1WBYB 3MLRL 5EZPA 1CGSL 4M5ZL 3E2HC 5D1ZC 2ZD0A 2NW3A 5IOKA 3CVHL 4XRCB 4MX7B 4XX1G 1QQDA 3DSNA 3GB7A 4NENA 5EZIH 5EZOL 4Z77A 3UAJD 3VFTB 4HIJA 3T3MB 1FGVH 3ZE0B 3B2UD 4OFIA 5E00A 3V4VL 2QTVA 5IHUL 1AO7E 4G6KH 1AY1L 5BS0E 4NRXB 4H5SA 5C0EB 4EVNA 2EDTA 3QH3A 4RRPG 4RDBA 1PSKL 4JRYE 5J9PB 5TQ0H 1P0SE 5EFIA 2H8PB 1SQ2N 1N4XH 2HFEB 4DKEH 3B5GA 2ZUSA 4Q97A 4DGIH 1T1XA 2GW5A 3S97C 2IANE 3S6CA 2GC4C 3M07A 2VUOA 1X5LA 4JFXA 4UV7L 1OAKL 2A4CA 4GSDL 1HILB 4MMZC 2RQ8A 1YEWA 2AMUA 4U1IA 4FC3E 1SUJA 3C6EA 4HKZA 3ML8A 4HUWA 2X44D 3E9UA 4YDMA 5LG1A 2AJXL 1ZA3B 3FSWA 1I3UA 1ERNA 3ELQA 3GS7A 2X4SA 3QDMD 1E4KA 4Y1TA 3NPZB 3RWIA 2XJLA 1XF1A 4R3SA 1QPKA 3MUUA 5G5DA 3V8CA 4LOUD 1NEZA 1VFMA 1IE4A 1S7VB 2ESVA 1TO5A 2P5WD 2R0WH 1NUFA 1NPJA 3IPEA 4PRHE 4LRIC 1NLDH 5I18L 1JYVA 5SWSD 2W95A 3LS4H 3MUHL 4YHNA 1BEYL 4N86A 2BHFA 3EZJB 3KM2A 4OLWL 2E9GA 1KXTA 2IGLA 2YPKB 4JFFA 5HVGB 2GUOB 3FTYA 3LKPB 4DTGL 1LO0H 4W9EC 3MLVL 5C0JB 3ECUA 4G6AC 1ZDQA 3VD0A 4IMKA 5ACMA 1KCWA 1OF2B 5AW0B 2W94A 4U6HB 4MNGE 4HZLB 1EJ6A 3EYUL 3L3DA 1WBXB 3J07A 3O2DL 5K9OB 3T2LA 5ALBH 3U9UB 4L1TA 3QNFA 2YAPA 3FCSA 4QRSA 3WO3B 1P84J 4TNWF 4GEJA 3BO8B 4L5FH 2AEQL 2PNDA 3ENEA 2I07A 4OJDH 5DFWH 1L7TL 1HH9A 3N04A 2ICEA 4U0QB 1SBBA 3ULUH 4E0RA 1KLUA 1ETB1 3O6FC 3MOBL 3MI6A 3E1ZA 3MO1A 4L3ED 2EIZA 1L9TA 2OMUA 3T3PB 3Q8CA 4Z7WA 1JZ8A 3QWRD 4N1HB 4NS0A 1RUKL 1F8TL 7CGTA 1GY2A 1FH2A 1K4CA 5FHAL 5D1ZA 3OR6B 4G7VL 4NQCB 1AVAA 3ZE2F 4ABVA 2VQ4A 3PGCA 2Q8AH 3O6KH 4POYA 4YDLC 1CLCA 5EOCH 4QXUH 4ZUSA 2HJLB 4ODVL 1UOVA 3UDWC 1G4MA 4IGBD 4JVPA 2ZNWA 4LKXA 2LU5A 2AV7A 2D7MA 4WWID 1CG9A 2P9RA 4XMPH 32C2A 4ZPVA 2FWUA 5GGTA 4KXBA 3SGJC 1C5BH 4R2GD 4RMUA 2FO8A 5ELIA 1KELH 1AMYA 3GRBA 1EMTH 1M4KA 3NOIA 1RUML 2J6WA 4KKLD 4XO9A 1F3JB 1MHEA 4EJ1C 4FKHA 5A6LA 1JV2B 1E27B 1KJ2H 5E08H 3VW3H 1WV7T 5C09E 2XQBH 4HIEB 3WS6C 2DQJH 5LGYA 4XXWC 3CVIH 3W0WE 3RIAK 3LOWA 3QUMH 4UM9A 3EXLA 1FIGH 2A2QT 1T83C 3CH1A 4DP9X 1KTLA 2CKBH 2NX5A 1JXGA 1FRGH 2YUVA 1ZSHA 1VF5C 3N50A 4QRUA 4NRZA 2GCYB 3CN1A 4WTZG 5JIIA 1XH3B 2XPZA 4ACPA 4M5YH 3INUL 2UVFA 1RUAL 3X3FH 4OAWB 3TFKC 1MIMH 3AQYA 4V2BA 2F8XC 1HVXA 4PPTA 3RWCB 4LRIA 4FZEL 4Y9FA 1EAQA 3E6HA 3L3HB 3LZRA 2X6CA 2V7NB 3E0GA 3ZKNC 4IM8A 4PWJA 5T5FH 5D9SA 5E2TH 4RGOL 1ZWIB 4M29A 1OHQA 5F70A 2PKDA 1NKGA 3KBPA 1QWUA 3HG3A 4MXVF 3LKSA 1CFSA 4BA8A 3A6BL 3K2KA 3CN4A 5EOTB 3WTWA 5D70L 4X6EB 4Z9KB 5KBLA 1XD0A 4KMQA 1YG9A 3EOAB 4UWQB 1BD2B 3D87B 3NDYE 1MI5A 1XMEB 3KVQA 3IDGA 3MAWA 3EOTH 1PDKA 2F15A 3CLEL 5DJDA 3MV8A 5TK2A 4MNHB 3RVVC 1SDAB 4FNPA 3BUYA 1BFSA 5LGJA 4YAQA 1XB6A 1E50A 2CDGA 5G4OA 3OXSB 5JR1L 1KGCD 5FF6B 3CSYA 4IRZH 4P3DB 1AGEA 4PJBA 4C83B 4A7SA 5LAPA 4DP1X 2CLZA 1R5WA 2VISA 3UG5A 4PJHA 1MJJA 3O6LL 2V2XA 5D2LF 1YMMA 5C0BB 2KDYA 5EA0H 5CCHE 4WW2F 1Y1UA 2WQAA 4ELKA 1U3NA 3FT3B 5DZJA 1FG2A 1F11B 2IDFA 1BZ9B 4HQQH 2DOCA 4LARL 3IK2A 1T6BX 3NEXA 4G80B 1H5BA 3G9VA 4YIQB 4GINA 2G5BA 4TTGA 4XP5L 3FKUS 4FTVE 3CZLA 1AI1H 5JIKA 4Q6IC 3SGJA 3V6FA 1FFPB 4LBAA 1IGMH 1NCOA 2CU9A 4XI5C 3KDMB 1VEMA 2APFA 2GQHA 4JZJC 1NKRA 2K70A 2Q8BH 3MBWB 4GYBA 1EGJH 3UZQA 1RZJL 4HGWA 3ARDB 4WDIA 4ORGB 5T1DL 3D25B 2AITA 3TIEA 3CCHA 5FYKU 4ZMOA 2EH8H 3BSHA 3AS3A 2VABA 3EKCA 1JHLH 3D30A 5ICXA 3ARRA 3V5HA 3ARFC 4XBPA 4FYRA 3RP1A 5BXFB 3QEQD 4BQ6A 3WELA 3MPCA 4ZSOB 5IVXE 3CBKB 1OARH 4L8BA 3GHBH 4MJ2A 3PHQB 3N41B 4AUUA 1BVNT 2IG2L 4XP1H 3FTGB 1VIWA 4OM0H 1ZV9A 4AMKH 3C6SB 5MEOB 3V52L 4YE4H 3CK0L 3SDCD 3T4AC 1S8DA 1J8HA 3PJSB 1A7RL 4NKOB 2DH3A 4H40A 3FC8A 4AH2B 4IIQC 1S46A 4KMLB 5G4MA 3POCA 2YMXL 1GGIH 4YDIH 5K69A 3CHRA 3LPOA 1SJXA 4I2XE 4PJ7B 4I0CC 4JM4L 2BS71 3FPXA 2XA8H 4X5WB 1N5AA 2BERA 2NY5H 2DJSA 2VM4A 3BEWA 3NEEA 5JORB 3AXLA 4QTFA 3S9DB 1CO1A 2I24N 4HPOL 5GS2H 5EORH 4GXFA 3VM7A 1KY7A 1PZ5B 3GLEA 4J4PA 3N1GC 4YH6A 3NJXA 2OR8A 3CDYA 5JQIB 4Y4HC 4V11A 5F6IC 2B14A 1FLRH 2CKNA 1JF5A 2BMKB 4GXVL 4HH9A 4XPHL 4AIZB 5KVMC 5IQ9A 2GAZB 2YD5A 4M6NH 4AC2A 4PJ9A 5DVKA 4QRQA 2EIDA 1F1AA 2XTJC 3F05A 2K3TA 4FJ6A 2PYED 2IH1A 1UGNA 1D5BA 3LEVH 4P9HL 4FNSA 2XV2A 4ZS7L 1ADQH 2E6QA 1T04B 2ERJB 1U8QA 1F0LA 4YNYA 5EEXA 5KUMA 4Z7QF 5J1SC 4YHIB 3SN6N 4HCRH 3T4YA 1MUJB 3RY6C 1B4TA 3QJFB 4M1CD 1WZAA 3OXRB 4L2LA 3FSAA 4PBXA 1UUSA 2F54B 3I6LE 4KQ4H 3I50H 1W2KT 1R19A 5HHVL 5HI5D 3FT9A 4A6YH 1NFIA 1OT1A 2X12A 4DUVA 3OQRA 2F7PA 3UP1A 2HPTA 1G7HB 4IQHA 3LRSA 4D0DB 3DX2A 3QE5A 5AAWC 5JHBA 1LO2L 3AMKA 1QR1B 4BH7B 4UMSA 5T3ZH 3TFBA 4ONFH 5I73C 4X8JB 3GS4A 1U8PB 3VU2A 1EPFA 5F7BA 1O9WA 4N25A 3SDDC 4MCYB 1P4UA 3BWZA 1XGYL 7TAAA 3Q5YA 3DOSB 4Z7VB 4F7EA 4LOFA 1UVQA 1QA9B 1FZKB 1QTSA 4E9SA 1NAMB 3SKUD 4P2OC 4P2RE 1OP3H 4AM0B 2DQGL 5AG8A 2OX5B 2XWBA 3MKGA 3OV6A 3R0NA 5FW8A 4X5LA 5DEGB 2TSAA 2L7QA 4X6CB 4J1UA 1F3DH 3V95A 1FHNA 4M4RA 4UTAA 2D7PA 1D5MB 4EDXA 3CLFL 1J5OH 3UIYA 1QSEA 3GMPA 3O4LA 1JIBA 3C6LA 3S3PA 1PD1A 1G5GA 3FCBA 3WFCL 3TO4A 1W16A 2D0GA 3DROB 3NIGF 4OLZH 3KD4A 1FYTA 4DK5A 2FR4B 4PGDA 4Z78B 1SDYA 2JCCE 1T66C 5E4IA 4IIQA 3OMNB 3PE9A 4QNPE 4I5BA 4Y2OA 1XZ0A 3QIWB 4J23A 3JWNE 4JG0L 2ZYSA 5K39A 1G9MC 4KROC 4OF3A 3WEOA 4EUPA 1LILA 3HR5B 1A1OA 1SFHA 5AZUA 1AHWC 1FCGA 2H32B 5I19L 4HCRA 2XV0A 1IGYB 2DMBA 3OHMB 1Y6KR 3T8XB 3KPQB 1XCQA 2BSBA 4PS3A 4MAUH 1NOLA 2FZ3A 2DD8L 1Z3GL 1EA9C 3RHWK 3X3GL 2ITDA 1I7ZA 2XFGB 1D7BA 4Y4HA 2ARJQ 1DBMH 4JL1A 4W1TA 5DUMH 2W65A 3ALWA 1F90H 1JWUA 4E2OA 5M7QA 2XPGA 5H35B 3D50A 1HS6A 3QFDB 2H0PA 2IOOA 2WQXA 3N42F 4P9MH 4HU2A 3R4DA 1X9RA 1C1EH 1T4KA 1UA6L 1O7VA 3ZT5A 2X3BA 3CD4A 4KDWA 3U25A 4LGPB 1MQKL 1IKFL 2R69H 3P9MA 3RY6A 4Z95H 4X4ME 1ITBB 2XN2A 5D2NE 2VR3A 2XX0A 4ZFZB 2ATPB 2ZCLL 2P49B 3HC4H 4FQJH 2MCAA 1J9RA 5DJ2A 2H2PD 1HL5A 4TVUA 3BUIA 3MRFB 4WU5B 5DJ0B 3RPKA 4G3YL 3RKDD 4I8DA 5IJDC 1QLFB 3BKYL 4AI7A 5KVGH 3OAUH 2XN9D 1YMHB 1XH0A 2V17H 4MA8L 5GGTL 1JK8B 2AK4B 2XLLA 3FTWA 1NANI 2VC2L 3HG1D 2PYFA 1KV3A 4N8VG 3WAJA 2W59A 2DQUH 5CEXB 1RK0B 5C0FB 2AW2A 3V9FA 4AEIL 3Q8AA 4NO5A 3VXME 2XIIA 3JWDC 3UX9B 1ZTMA 4BFFA 2YD3A 4PRIE 3S0PA 3MRKA 5A2IH 2CUMA 1R3IL 2YS4A 3U48A 4DN3H 4ANXA 1RZFH 4KO5A 5LLIC 5D7KE 1IEAA 3O0RH 2XETA 4DK6A 5KJRL 2R2HB 2GVYA 1CXEA 4U31A 3T2QA 4CADB 3U4BH 4DVBB 2OMBA 4DP0X 5D6CA 1TFPA 4D9RD 1A6UL 1YN7A 4R5VA 2MCPL 4XVSL 2X2JA 2YJQA 3SJVA 5HYJD 2B7DT 4GQ9H 5L4JA 1X4YA 4P5TC 4QJ3B 4E5XG 4G5ZL 1OAZH 4RAVA 3STBA 4B3EA 1MWOA 4NOBA 5FYJH 1BJ1J 5H2BA 2Q6WB 4TVPH 3VTMA 3K81A 1TITA 2C9SA 3WN5C 1H3VA 3ATAA 1MF2H 5TDPB 4QRBA 3WFHB 3FSOA 3BKJL 3RX7A 43CAA 4TPRL 2AZAA 3GDBA 3L5JA 2APWA 4PJGA 4XRCA 5AOZA 1NL0H 3UYOD 5GGSB 3R18A 5CCGE 1XSIA 3VA6A 3BLPX 2W60A 3GKWL 5C0EA 5CMAB 1TEFA 4P5SA 4Z8FL 4X9GA 2NUTA 5FYLL 2HRPL 5DHYB 5J9PA 3FUJA 2EEAA 4GQPH 5CFHA 3NG5A 3S3BB 1FVDB 3SDAB 2BH0A 2PPAA 3NQIA 4NHCH 3B4NA 3RZCD 1YYMH 3RI5K 4OVUA 3GUTB 2HFEA 4XCYA 1RIUL 4XVOA 5JYLA 4I85A 1QABA 4ZW7A 4DQOH 2DTSA 1KTCA 2JQAA 1PFOA 2BIHA 3S5LG 2JIXB 1IZJA 2XXGA 4YDVA 3D9AL 4FLRA 2G4GA 1KF9B 1OK8A 4QTIL 1VZHA 1XIWC 2RCSH 4TNEA 1VSCA 4QRPA 4EN3B 1TJHL 3KLQA 3OZ9L 3IFLL 3WXWH 1P7KB 4FQCL 3LY6A 2C7UB 3F7LA 5KSUB 3N1MC 2WV3A 1E90A 2X4UA 3KPMB 5A40E 2Y5TB 3QNZB 5FKPB 5H4YA 1KSRA 2R0KH 3SO5A 1QLRB 2JLPA 1QPXA 1YEEH 3EDFA 5D1QC 3GJEB 1S7VA 1A7PH 3STZB 5DJCA 1MJUH 5FA4A 1E4WH 2YEZA 2GHZA 1HX0A 1JFHA 1G7IA 3K4ZA 1XGQB 2L7UA 4HAFA 1UCBH 2X2IA 4YWGL 4B7LA 4H8WC 3L4VA 5GXBB 4RFEA 1SVZA 2CO6A 3UTTE 3CHPA 1KBBA 2OTUA 1L9RA 4NNPL 4POZC 1TDQA 5HHOB 3MLZH 2VN7A 2KLTA 4B9JA 1QI4A 4XH2B 4YBQC 4NWUL 2VDQB 4P3CH 1KCSH 1T7YA 3GSNB 3ZE1F 1OF2A 1OCWH 3GBLA 3ULVD 4HFUH 2X89D 3NCJH 2WJ5A 3ZN6A 3VFVA 4HMEA 4ZO9A 5LNDA 1I85A 1WBXA 3L08A 2NXZC 3TF7C 3U9UA 3AQXA 4PP1D 3LIZA 3QUZD 4Q58C 1FAIH 4H0GA 1UENA 3KHOA 4TM9A 4K3JL 4NUJB 3NAAL 4U1JB 1EFXD 2XJKA 4QUOA 3DHJA 5ECGA 2F7QA 1KPVB 5E9DB 4EKXA 1NDTA 4P5TA 1NAKL 3EJZC 4XGZB 3OR7B 1AZZC 2AQPA 3F5WA 1BCIA 5D7JB 3QWQB 4DGYL 4GSRA 5C71A 1FN4B 3WN5A 4BK4A 3OR6A 3SDYH 1CU4H 1EEYB 2VRAA 5EHFA 3FFCE 1A3RH 4YDNA 4Y16C 1KLFA 2D4DA 4R84A 2NTFA 1EJ8A 1PJWA 4KH9A 2DV6A 4TNVF 2QV4A 3FQTB 4HT1L 3F64A 3KYNB 2PCPA 1BVKB 3HB3D 1NGXB 2HJLA 5DU7A 2MJWA 2J21A 2XWJA 1YNLL 4XNXL 4UQ9A 5FYKE 1CICA 2CCVA 4IDJH 3PAVA 5EO0A 43C9B 1LTXA 4XNYL 3B5HA 2VXSL 4XPBL 3D2UB 1F3JA 1KTDB 3KH4A 1BFTA 1JV2A 5LAXA 4TOYH 1SHXA 1I1RA 4XNUH 3X14B 4AYID 4JGMA 2KLSA 4HKXA 1LK3L 1XR8A 2Y1VA 1HESA 5ESAB 3W9EB 4JB9L 4X4ZA 2A6JB 1IFGA 2IDTA 3D48R 7PAZA 3HBZA 2JH2A 4X80L 1YEJH 4TUKL 5DO2C 3UROR 1NIBA 3Q3GB 4GP8B 3KLKA 2H1LM 3IETA 4ICXA 3CHOA 3RWCA 2JKSA 5HHXH 3IDYC 3JVGA 3AWGA 4QHUB 4X99B 4MMXB 1JGLH 4U6XB 4X42A 4ISVB 5JZ7D 1GC1C 4ZUTB 1AQKL 3NBNA 5AYUL 1NFDB 5CCKL 2XTLA 1NCCH 4JFEB 1MCWW 3TLRA 1HEZA 2UX6A 3X1BA 2N59A 5J4MA 2DM7A 4HBCL 4P48A 2FWOA 1PKQE 3A4AA 3RUGF 4KRNA 5E23A 2ZUQB 3QARA 3EOAA 3BGMB 4K4KA 1CFNB 1BD2A 1H8NA 4M8RA 5BW7A 3BDYH 1P4BH 4MXVE 4PP2B 3WE6B 4PJ8A 1A9BB 1CYWA 3P0YL 3X1EA 4HZ1A 2XG5B 4Z1PA 2KPWA 2MSPA 2NUPB 3HN3A 4K9EL 3CSGA 2FO4A 4K8RL 4NNXA 4BUQA 3GK8H 5I74B 5BVPH 2A74C 5CJXC 5HJGA 5IMLB 1VACA 1T1WA 5E24E 2K8MA 3VXSB 1CJYA 3AUWB 6TAAA 4MJ5A 2PTUA 3OHXB 1CVSC 1OOAA 4QAWA 4H0IA 4G1EB 3UEQA 4K55A 4RZCB 5AVYB 1L0XA 4P3DA 2P26A 4PJEB 3ZMRA 3QZNA 1AOZA 1FCCA 3D0VB 3D39B 5EU4A 3WO4B 4RFOH 4PLKD 4P59L 1PG7W 1TZGL 4N0UB 2VITA 1NUDA 4UT6H 3QAZB 1D2OA 4OV6F 3W9DA 5MENB 1D6EA 5IJVB 3KLHC 5GRJL 1QRNE 1F11A 2A3TA 3V7AE 1DVZA 3FONB 3RB5A 3TYFB 1AR1C 3QRGL 1M9SA 3M8OL 4Y5XB 3NGBC 3DJSA 1E28B 3UC0L 1IQWL 2ADJB 4Y9CA 1RULH 4YIQA 5LXVA 3OL2A 1SEQH 3UJJH 2WNGA 2F18A 2R1WA 4NKQB 4NM4H 4Y5YA 1IJNA 1N0XL 2W0FA 1P2CB 3KDMA 4NZRL 1W72B 4KDVA 5AZ2H 3VXQB 1THAA 2B3IA 1RZKC 5D8JL 3MBWA 2MQ3A 3TJPA 5ECJE 3EJUA 35C8H 4JFUA 4L4TB 1BGXH 1TVHB 3E9TA 1LWJA 3MLRH 5CLZA 5B8CC 4CU8A 2C5DC 2DMCA 1C5DB 2WVVB 3HMXA 5JPMC 3GBEA 5JUEL 5KVFH 3V4LA 5DZNA 4DPBX 1M6UA 1SQMA 4ZZKA 3TN0C 2ZCKH 3QZPA 1DJYA 2HUEA 1BFVH 4OJEH 5GJSH 2K9FB 4JPVH 4U6VL 2K7PA 1JWSA 3VX1A 1OPGL 2W8CA 5F1NB 5BXFA 1FFOA 5IHUH 1M9WA 4F2MB 2I9TB 2APBA 3WAKA 2ALWA 2AJZB 3BH9B 4GI9A 4S0SD 4E68A 1TCMA 2B3RA 1GZPB 2F7RA 1PSKH 2AJ3B 3PHQA 2X6VA 4L8SC 1GMEA 3BVDB 5F9OH 4JG9A 4C4KO 1IT9L 2NY4C 4POUB 5FIEA 4HGKC 3C6SA 3MRBB 5MEOA 3D4GA 4ODTL 2XXMB 4OZFB 3MRMB 4PRPD 1CTNA 2ID5A 4BZ1A 1I7UB 2JJSC 1OD7A 2CO3A 3L5WB 3NJFA 3QQNA 4WK0B 5E6YA 4AH2A 1XCWA 4HDIB 3EO0A 3U9WA 3U7WL 3VGEA 4XB3A 4GKNB 4XHQA 2HTLC 3ETBJ 1YNTB 2AJXH 3LZFH 2I27N 1DVTA 2DJ4A 3II2A 3BVTA 3CPLA 4F7PB 1OXYA 2XZCH 3V10A 3IDXL 3T2NH 1L9QA 1GHFH 2PW2B 1SYVB 3F7RA 1W80A 1N7MH 1U8KA 3F12B 1ZTXL 3O4OC 5TFSH 5GGSY 4IBVA 1DQLL 2B8OT 5TDOB 3B2VL 3QC6X 4AIZA 1UZ8B 4JFFD 4BEIA 1CL7H 3ZZ1A 2GAZA 2FL5B 3ZYIA 3SCMD 2WLMA 4RX4A 4X5XB 4JN2B 2AQRA 3ZKMD 5BRPA 4PRAB 1NIFA 4YO0B 3ECQA 4OGZA 5AFAA 1G9ML 5AUMA 2AQNA 1B0RB 4QXTA 3D85A 3QWOA 4L0PB 1T04A 4LSSL 4JMXA 4HJ0D 2H32H 3EYUH 4YHIA 2Y25A 3Q1SH 4JHVA 1MUJA 1PYWB 3N0PB 3QJFA 5BJTA 3GSOA 2CIKB 2F54A 4NKDB 2WXNA 3G5XA 4NWTL 2AEQH 3MNVA 4Y9BA 1WGVA 1WAAA 1L7TH 1J48A 3AACA 3HHMA 4XVTH 3O6FB 2BY0A 2VZ3A 1ZY9A 2RA1A 2ED6A 4WI6A 4WZ9A 3BIAX 1QR1A 2CR6A 4AL8H 2VDRB 3ATEA 1T0NA 1U8PA 4WUUB 1ZLUK 3C5XA 1URZA 1YEHL 1DQTA 4JX0A 4TS6A 2VJXA 4Z7VA 3DOSA 2YPLE 3DVGA 4G7VH 4L4VB 1QA9A 5JPMA 3T6QC 1RFDL 4X0KA 1QUPA 4FQPA 5E0FA 1KIPA 1Q1JL 2D03H 1NAMA 1OF0A 1HCYA 3KGTA 4ALAH 4AM0A 2B15A 1G9HA 4RGMB 1KULA 1MCWM 1CGXA 3BQUC 1HNYA 5E2VL 3TT1L 4X6CA 5DT1L 3MOAL 5EDSA 1MSPA 1GTNA 1X6LA 1WZMA 1A7QH 2DYPA 3EBGA 4AQAA 1E2VA 4ODVH 1S9WA 4PV8A 2W81C 5DSCB 5I76A 3SSGA 2Z65C 2VERN 3EGDB 5DD1L 5ISZB 1SJMA 2P52A 1BQ5A 4WHTA 3QUKB 2O1AA 2UY6A 2YRLA 2WQSA 4PY8I 3DROA 2KS0A 2EDDA 2ZX5A 1VLXA 4DP6X 2WQVA 5ENWB 2PPDA 2JJSA 5E1AB 3DJZA 2RALA 3QIWA 4LNVA 4UM9D 5C0CE 5ITFB 1YO4A 3HN8A 5H94B 3SDXB 4UZSA 2NX5D 1SZNA 2BIIA 2HAZA 2HRGA 1A9EB 4OD2B 2R2EA 3HR5A 5MERB 4FCAA 3DJ9A 4FQQB 4Y5VB 4KK8C 3H4FA 3JWDL 1FL6A 4JG1L 1S5IL 4K94C 2IGFH 2NYYD 4LDLB 1VGEH 1MW3A 3KPQA 3L2NA 4CGUB 2DQIH 2VDLB 5JXED 5EC2B 1JPSL 1KBKA 2CK2A 3GZPA 1FL3A 3LIZL 1PZSA 3L9RB 2CLVB 3LPPA 4FZEH 4NRYB 4RWHA 3LPGA 3GBDA 5AQ0A 4Y1SA 1K3ZA 5I1JL 4G9FD 1PAZA 3QFDA 3TVMB 1UKSA 2CNZA 1RZGA 5F7AA 1HL9A 2VW7A 1VCAA 1ZDSA 3BH4A 2Z3FA 3L1OL 4OLUL 2BWDA 1MI5D 4GG6B 3A6BH 4U2YA 4DZ8B 1IB5A 2RFXB 4U1GB 5D70H 4KHXH 5AYTA 3UEZA 3AREC 2CK0L 4NM8H 1V5JA 1PZ3A 1DN0A 3SQOL 2X4TB 5EU6E 3W3BA 3G6DH 4D3CL 4LVHC 4ZFZA 2ATPA 5F9WB 2QSQA 3CLEH 3X1FA 5L7XL 1D2PA 1E7VA 1KMGA 3GSUB 3ZDZE 3MBEC 2LAGB 3WKMH 3GZQA 1X9LA 3MRFA 5DJ0A 3A3YB 3NPSB 3R7QA 4P2CG 4UOZA 4JY6B 1QLFA 1KWGA 3MX0B 5HPOA 3EYSH 1YMHA 4P5KA 1TMQA 5AZEH 4ZG1A 1BREA 4YHML 4B5ZA 3VXUB 2YPVL 1YMMD 1ZHKA 2AK4A 1X5YA 1AGCB 2I9LA 3OJDB 3PJNA 2CO7B 3UG3A 3O6LH 2OI9C 2OULB 4L1SA 3QUXC 5FM5M 5CEXA 4XN7A 3ROOB 1UQSB 1WH0A 5DA0B 5I1IH 3QDJA 4DCQB 5IIEB 1MEXL 4P46D 1ZLSL 2WVUA 3RNKA 3EW3B 4B5EA 4F7MA 5FECB 4FHBD 5CEYB 4XP5H 2NDFA 2VLKB 4FYQA 3S4SG 2IPTL 3TH4T 2L0DA 1ET8A 4XPFL 1ZS8B 3ARBB 2OZ4L 3O41A 4CADA 5IB3B 2VSDA 4HIHB 5F7DB 4IMLB 2G2RB 1UZ6E 3HHSA 2NQ3A 4HMCA 4OY9A 3DNKA 5KS9E 2RAMA 5IBLC 5FCUL 3WDJA 1A7NL 4KX8A 2EH7L 1BLNB 3G5ZB 3GSNH 2XBDA 4LLYB 3WFHA 1BG1A 4RMQA 4F33A 1HWHB 1GZQB 4TYUA 4FF9A 3O2VH 3MXWL 4WO4B 1A22B 5DJ6B 1IC7H 2OP4L 5JMRA 1DJHA 3TIDA 3MREB 3A23A 4QRTB 4WI2A 1WQVT 4O4YL 1E5UI 3MC0A 1UJ3C 4J3OG 3SDAA 3T4AB 2XWCA 3V52H 2DLHA 2BP3A 5EPMB 3LKOB 3GUTA 2VL5A 1ID2A 4YBHA 1OQOA 2G0KA 1G87A 1QEWB 2LOEA 2WO3B 3KAAA 4HJ1A 3DX9B 4QTHB 4IOFD 4WLCA 5K1NA 1E3XA 4ZD3H 2QQKL 2YFNA 1QZNA 3VGAB 4KGLA 4ES9A 5MEPA 1JPGA 4N2OA 1RZ8A 4XNMA 1QFWI 4J4PD 1NDMB 5J6HB 1VB9A 1MZYA 4HPOH 3B6SB 2GY7B 1TR7A 1OP5K 1LMKA 1E8ZA 2BO0A 2D7NA 3HNTL 4JO2L 4V33A 5BRZB 5EBMB 3X13A 3E7JA 3FB6A 4PJ9D 2OFQA 5EIQA 3GJEA 1KCLA 5F6IB 4FQXA 5AKTA 3PABB 3QEUB 2IADA 2BFVH 5AWNL 2Z31C 3HBQA 4R4NC 1XGQA 3NACL 4HIIB 2ZKWA 2XTJB 6PAZA 4AG4H 2PP7A 2FSEB 2VSCA 4Z7UF 3PWLB 2P8LA 1S7UA 3HNSL 5HHOA 1H6EA 4ZS7H 5EF1A 4XH2A 4IHOB 4UIKL 3EBIA 2K6ZA 1TETH 3FB8A 4UNUA 3GSNA 2AK1L 4CMHB 2LVEA 3W2DL 3O8XC 3OZKA 3QIUC 3L1GA 1RJCA 3O9WC 2DWTA 2DAVA 3QUYC 2H47C 5PAZA 4F5CE 4GAFB 3WKPA 3ZYZA 3LH2H 4NUJA 3OPUA 4U1JA 4GW4B 1AGFB 2AJYH 3DJRA 1GOHA 1F56A 1YEIL 1KPVA 1S9YB 4H0HB 1LO2H 2HT4D 3GS0A 3MU3A 4W6WB 5J13C 2J25A 1S9VA 2ICWJ 3FRUA 2ZIDA 1GC1L 3DYOA 5I73B 4MGXA 4LF3A 2C3XA 2B2XL 3I6GB 3NJJA 4OCNC 4IEFB 3VWJB 4KZEH 4BZ1L 3PWJB 5EEUA 1NINA 2BSTA 2V5RA 2IDQA 3D6GA 1NGPH 3S48A 3QT2A 4CC4C 3W5MA 2ENQA 4Y2DD 2VDOB 4K8RD 2WLNA 5E8OA 2BY1A 2DQGH 3KWWA 4DAGH 1B0GA 3BFWA 4HEPG 5FCSH 3SZ6A 1QSED 3KPRB 3WXVH 3O4LD 3ETSA 3C6LD 5IESH 2KH2B 3FQUA 1DVXA 4NYLA 1O0VA 3CLFH 3HKZA 3K2UL 1FJ1B 3TO4D 1OL0A 5J06A 5IQ7L 4PRDA 2G2NA 2J8UE 1MCSA 1FYTD 2QZ5A 3S2CA 1MELA 2C26A 4ODHL 4UQIM 2ZX9A 3WFCH 3JWOC 3N43B 4JDTL 1IL1B 4KKZA 2ZWSA 4BH8A 4KO6A 4K5PA 5JHDE 2EACA 1INDL 3PP4L 4XNBA 5CHNB 3D2UA 1FZJA 5B22A 5IHHA 3HS0C 2HYMA 3U0WH 1KTDA 2OLDA 4B27A 1XCXA 4B53A 4JFQA 4IKJA 4P2QA 3P3UA 5T1LB 1O5PA 3X14A 3INOA 4NJAL 3CDZA 3PHAA 3PWPE 2EDNA 3W9EA 3P40A 3AU1B 2BJML 5E8EB 3TP4A 1JNNL 5I19H 4KY1L 1TVDA 3CFKB 1IBBA 2FWLB 3VFGH 5LN8A 3S5ZA 4MDIA 1IBDA 1J1OL 4G8GB 3MJ8A 3X3GH 4WFHD 4OKVB 2Z0BA 2YWYA 4NGHH 3X2QB 2PWFA 3NFPA 5T3ZD 1MPAL 5EUOF 4QYOB 4PYHA 2G3NA 1W72H 3LQAC 5DD5L 1RZKL 1Z32X 4X99A 1S78D 4ISVA 4DFIA 4ZX5A 4ZUTA 2J2ZB 3FUFA 4YSOA 4JHBA 3FQ2A 2AXWA 4JFDB 5ANHA 2P3YA 1MQKH 4KJYA 5D93B 5KSBE 2ED7A 2R2CA 5JDSB 2C4FT 3APCA 3MCLL 4EZLA 3QIUA 3RL2B 1CFNA 3O9WA 4PUBH 5TF0A 3WLWD 1J1XL 5ACLA 4JO5A 4RMSA 4LSTL 1NFKA 3P54A 3WNLA 5IMOA 1A9BA 1D3CA 1KBGH 4J39A 3TT3L 3C5ZD 1DVFB 2EEFA 5AD0A 5IMLA 4JHAL 2XQYK 2CH8A 1EAJA 2NNCA 5BUPA 3BKYH 4H2AA 4JAMB 3L48A 4N2FA 3QDME 4S0HA 2Q3AA 4G1EA 4GBXD 2CBPA 2UX7A 2GJJA 4JO1L 2KQMA 3D39A 3UTOA 4PRBA 2NNAA 2P5WE 5SV3A 5FX3A 2JSFA 3QI9C 2IAMB 3FBQA 5SWSE 4TF4A 3EUUA 4AEIH 4EI6B 1NCNA 4NI3A 2BNQB 3PF2A 5B7MA 5MENA 5IJVA 2NY2B 3QCVL 4N3UA 4NAQA 1AHMA 1AS8A 3LD8C 4ATWA 4RIRB 1KXVC 3FT0A 4HFWA 4Y5XA 4TQEH 3QJXA 2IFGA 1R3IH 1YPZF 1BJ8A 1K72A 5DHMC 2N0MA 4UU9B 5KYWA 5IB4A 3Q06A 2W0PA 3SB3A 3SJVD 3DO3A 3HS0A 4XNZB 3VXQA 1A6UH 4FKEA 1PQZB 3MLWL 4OT1L 4QXGL 3JTSB 4XVSH 4KTDL 3V4PA 2EVFA 1O9ZA 4OCLC 3IDJA 2GBAA 4OZHF 2DKMA 4G5ZH 5BO1L 2FLRT 3VD9A 2WBKA 3GSQA 4BFNA 1Q8MA 1OTSD 3DVIA 1WITA 4L3EE 1XGPB 1K8IB 2WVVA 1A25A 5KBNC 3M6DA 3BKJH 4J27A 3LHPH 5ICZB 4PD4K 3CXDH 4YJZL 1IVLA 3D51A 2X4PA 5HHPB 4YL4A 2JJUA 3GMQB 3NSFA 5F1NA 3W39B 3D0LB 4GQQA 1C8QA 3PDOA 4H1LG 3FUMA 3IYLW 1PKOA 1S7XA 2H6PB 2BSSB 3CFBB 3KJ6L 3VSUA 1Q94B 1TJGL 1GZPA 3GGWA 3U46A 4AGQA 3QB7C 2AJ3A 1GRWA 4GAJH 4WJ5B 2X9YA 2D7TL 3ZDWA 4F1ZA 2VXQA 2V37A 3MRBA 4HP5A 1RIUH 4OZFA 4X4XB 3MRMA 1DBAL 2VDRH 5IVXA 3VU1A 1LM8V 8FABA 5L2KB 5K5YA 3ARUA 5FB8B 2DWYA 1IARB 4PVMA 3NABL 3LS5L 3EH3B 3WGVB 3UJTL 2ZAHA 2ZOTA 3DUUA 5J6GB 3LNIA 3JZ7A 2H0JA 1HAUA 5IEKA 1YNTA 2YAMA 4DEPB 5D7IF 4KVPA 5D7SL 4F7PA 4ZNCD 4HJEA 1ACZA 3KG5A 3JWNC 3EO9H 4N0FB 1WJ3A 3DWTA 2B0SH 4P05A 4DUXA 1RV6X 1EQWA 3L3JB 5D1QB 5H37H 3F12A 4WNSA 2JKXA 3TA4D 1XXDC 4EF3A 5TDOA 3BQVA 1UZ8A 2V5MA 2Z8RA 5FYJD 2WHVA 3N1FC 3FCTB 1EHAA 5C8JB 3AG1B 2H2SC 2BRQA 3V0GA 4JN2A 5J7CC 3UGXA 3MSPA 2WBJC 2WW8A 2HT3C 4PRAA 4NNPH 3VXRA 2ZJSH 3SZKC 2NW2A 4KVCH 1WFUA 4Y4KC 3MLSH 3BPNB 4TLKA 1B0RA 5I23A 2YRZA 3DX1A 3THMH 1CFBA 3DXAB 3WIFB 1EEUA 5DMIH 2Q5BA 4MHHG 4K94L 1M2VB 4Q89A 4LLVB 5IHWA 2OA9A 2FBOJ 4YPJA 1WIUA 2VDLH 5D96C 1VKXB 1LP9B 3RA7L 3U83A 3NAAH 3ISWA 4CSSA 2WXHA 1EV2E 3U1SL 2FD6H 3H0TB 5D2NC 2RHEA 4QKTA 4F7KA 1YNKL 3U6RA 3ML9A 3BT2H 3VD2A 4NQCD 3KJ4B 1JNLL 4HOMA 1YY9C 3OB0K 3ZTDC 4FMFA 4G9DB 2E27L 2X6AA 4N0RA 4F9LC 2WLYA 5HHMB 3OGCB 4Z76B 1BIHA 3LXBA 1KGCE 4Y16B 3TBYB 2K6WA 5CD3B 1P7QA 3K5RA 5J1TC 4D7BA 4N3TA 4U4BA 2EAEA 3J7HA 3CVBA 3ESMA 3J27A 2J4WH 3RGVA 4CVUA 4XBGA 2QPSA 1HKFA 2J1KA 2AQ2A 4N8VB 1ASPA 3CVDA 3BZEB 5DO8A 1XF3B 4HT1H 1KYUA 4GRLB 5A16A 2JJTA 4NQUA 3BWSA 3H8NA 4JJHA 5IBTL 5DSCA 5J56B 3DJTA 1BVOA 4PJDE 4PJIA 3EGDA 5ISZA 3RPIA 1P6AB 4XNXH 2JKLA 3QUKA 4WI7A 2Q3XA 2JKWA 4LEOA 4MAYC 1FVCB 4XNYH 4OZIE 4YSPA 2FX7L 5ENWA 1B6DA 5DK2B 4YSUA 3GHEL 2WUBH 4EDWH 4Z7OE 5BO0D 3VQLA 5H94A 4QLRA 3SDXA 1AZRA 5HGHA 2DLEA 4OD2A 4JB9H 2JCCA 4FQQA 2YRBA 3X12B 4E5XB 3P4OB 2R4SL 3DO4A 1U30A 1JF6A 4OCRH 4X80H 1CYGA 1H8LA 4TUKH 4WGVB 4RWYH 5D7LA 2PLTA 5EC2A 4EQ2A 2MHAA 2VL4A 2EABA 3C09C 1IC4L 5LHDA 1YRKA 4CVZA 3H9SB 4UCFA 3L9RA 2ICWA 4NRYA 4XC3H 5CGYC 2FHBA 5GGQH 3ZZSA 1NCHA 2ZXDA 2P8PB 3HMWL 3QEQE 1NH6A 5E5MB 3RNQA 1NGWA 4DIXA 4X8GA 4LSRL 3T1WA 5CCKH 2ENSA 2N7SA 1RURH 1WWBX 4FG6C 2ADGB 4XC1L 4Y4KA 4CU6A 1GYVA 5ID0B 1BD2D 5F71A 1PPIA 4I87A 4KKCD 1UWGL 3OQ3B 2RFXA 3HNVH 4JM2C 4HS3B 4PJ8D 4JR9H 3V5KB 2LTQC 4EIZC 5I8KL 3VFWB 3H3BC 2ARJB 5JNYA 3FPYA 3FFOA 4F57L 4JRXA 1I9JH 4XCNA 3S5LB 1KGIA 3C75A 2OMZA 3FU0A 4GIOA 5T1JA 3GSUA 4R0LC 2YIHA 4PTTB 3N42B 1AC6A 1ESOA 5GHWL 2QADB 3BW9B 3EGXA 1AE6L 4JY6A 3MA7A 4KJWC 1OTTD 4I3SH 3MX0A 3B34A 1T89C 5CKGA 4DH2A 2I7OA 5I82A 3B37A 3VXUA 2G4EA 4XPAH 3HRPA 3K5SA 5FFOA 4GRMB 1ZIBA 3HFFA 2CO7A 2WK2A 5DWPA 3GO1H 4WKZB 1S9XB 2CRMA 2M8XA 4D94A 1I8AA 2QVKA 4GI6A 1AG0A 3HUJE 4LLDB 4TQIA 3EJYC 1WTGT 3NFSL 2E9BA 1T3FB 5IQNA 3CC1A 3DOHA 3QCTH 2PYEE 2WYZA 4JJ5A 5C0ND 1G6VK 1NBCA 5HI3C 3UC0H 3I9PA 2Y36L 5FECA 3KS0J 2I60L 4NN7C 2BVTA 3UPRA 5T3XH 3VXMA 3FUNA 3NIDB 1UADC 3DO7B 4BDVB 1N0XH 2W1NA 5J11C 3VDAA 1ZS8A 4JQIA 4PRIA 3ARDD 4P57B 2DS4A 1UB6B 1B90A 1UEYA 5D8JH 2V2WA 5D5MB 1F58L 4BHUI 4OQTL 2Z92B 1NCGA 1YZZA 2UVEA 2XNAA 2DF3A 3TBTB 1FH5H 2HZHA 4G1MB 2WXPA 2DQTL 4G42A 4GIPD 4QJ4B 3UYRL 1CE6B 5IFAL 3WFDH 3TN0B 1BLNA 3G5ZA 3WTVA 2HJKB 3SD5A 2D7QA 4B0MM 2P24B 2QQNL 3B9KC 1A64A 4B95C 3TEZA 3HPJB 3A5VA 4Y4FB 4WO4A 4LCCC 2XWXA 1KTBA 5DJ6A 1IO4C 5FO7A 3GSWB 1ASOA 1PCSA 1ZLUH 3ZGIA 2L04A 1TKWB 3MREA 4BD4A 2AEIT 1SGKA 1UWXK 4QRTA 3ZXAC 1NANH 2NY4B 4N0CD 4O02B 2F7IA 4WSGA 4CN1A 1TJIH 2W38A 3BAEL 4YSDA 1FZOA 5I0ZA 4RAUA 1OAJA 2AKRA 4PBWD 2YAHA 1B88A 3BWUC 5GGRB 2X9ZA 4XXCA 4OZGF 1Q38A 2RTTA 4JANA 2Y23A 2W9DL 3CV5A 3T2OA 5AB9A 5TDNB 4L05A 3UP6A 2GJ6B 1CD1B 3QRBA 2L8AA 2EIKB 1SOKA 4OTXL 5CBAA 4FLOA 4JZOB 1NDMA 4ADGA 1X5FA 5SV4A 4CKVX 2BP5M 3B6SA 1WEJH 4R90H 1X5KA 3D4YA 3ULUF 3B7TA 5DHVA 3M1BB 2M1KA 3BLBA 3MYZA 4YUEL 5JTWA 2FWSA 5C0IB 2NNRA 1ZT7A 1ZTXH 2V9QA 2OSWA 5EBMA 4RX4D 2EO1A 3JWOL 3QEUA 4LIQE 3L7FA 1TPXC 1JZHA 4WHCA 2CHNA 2QKIC 1W0WA 1CXIA 3V4PL 3OSKA 3D85D 4ZAKC 1A0QH 2BOCA 2FSEA 3SQRA 1TSRA 1V3KA 3B9VA 5E56A 1G9MH 1ONQA 1S9KC 2DEXX 1N70A 3VI3E 4IHOA 4PB9L 5FDWA 2WINB 2AXGA 2QGCA 1M1XB 4HETA 2F54D 2ZAIA 5A3ID 4MVBD 2QLVB 5I30L 4K2UL 3UTTA 4J7RA 1HNFA 2PXYA 3MYJB 1DDHA 3WHXB 5ADOL 4ZFQA 1AANA 4PLNC 4I0PB 4GW4A 2ZSVB 4HPYL 3RX5A 1AGFA 3VRJA 4WSJA 3DTXA 3FFDB 3SPCA 2F0CA 1JDCA 1KGWA 2VXTL 3IJEB 3VMNA 3NYKA 3LQAL 1I4FB 1UT1A 1BM3L 1S9YA 4AY0A 1S7RB 2X42A 3MLXH 4LFHD 5D7EA 3ZHDA 1L3NA 2VXQL 2JV6A 3VNZA 1NDGB 2UZYA 4ZOBA 2N1TE 3VWJA 2NZ1A 3MUJA 5DR5L 3PWJA 5LCVA 2BVQB 1RFDH 4K7FB 2XV6B 3ZL2A 3L7EB 2DMHA 4P23C 4XMKL 1KBWA 3GXTA 1ZPLA 4LAQL 3ECWA 2JQZA 3HG1E 4Z7NF 3TT1H 3KPRA 5E2VH 5DT1H 1Q0XL 1YQ2A 4WEBL 2DQEH 2OJ1A 1OB1A 3N2JA 1F4XL 2QHRH 3FSVA 3WKNA 4MQXD 1KBPA 1BOGB 3ECBB 3L5XH 1U95B 3G6JE 4ZRGA 4LLWB 1AGBA 3V4UH 5EO9B 3QIWD 4EZKA 1DUYA 3DIVA 4X6FB 4HD5A 3S96A 5BZDB 5DZLA 1KYDA 1JG9A 3EH4B 4YGVB 4A7TA 5BV7B 2I85A 4OZ4B 4NN5C 2VCOA 3VJ6B 4L23A 2HFGL 4GP5B 1COBA 3CLWA 3Q8BA 4HKJB 3N55A 4NZTL 2ZX7A 4P4KC 4UNTA 1JGEA 4D9RE 1LHZA 2Z9TA 3NP4A 1G1CA 4UT9H 5E8EA 4JG1H 5D1XB 1CUOA 5IVOA 1Z9NA 2ZKHL 3L3OB 3HE6B 5SX4I 3SE4C 1V54B 4RMWA 4S1QH 4Z0XB 3S34L 4E41E 2BNUB 4AKQA 2J5LC 4DKFL 3UTQA 3D69A 2DB8A 3K8KA 4GPVA 5AVXB 4QYOA 2CDEA 1Z5LA 4UOJA 1AD0A 4G59C 4X8XA 4CAGA 5CEZD 5DMGD 3DX8B 4L8DB 1DBJH 4YXHL 2WLIB 1KB5L 3D09A 3ZT6A 4YXLL 3L1OH 2JELH 2WWNA 3BN9C 1KZYA 4OLUH 4YEFA 5JO5A 4MDJB 3WCYA 4JFDA 1VAHA 4JRYB 2KERA 1P6WA 1R4XA 2OMXA 3AREB 4ANVA 1KN2H 4K3EL 3IVKA 1DEDA 5I8EA 2WLZA 4G2AA 4LGRB 3RL2A 3ARGC 4LVHB 4D3CH 3RY4A 2IANB 5L7XH 4XNDA 3MBEB 3CBJB 1XSOA 4AGOA 5C9JB 1MCJA 1PKQA 5EIVA 4L3FA 5DYFA 3DURA 1NBYA 2EIMB 2AK4D 4PY8J 2Z1KA 3HCVA 1BDYA 1QYGH 2YPVH 5CNHA 3DI3B 2N01B 2OI9B 1J05B 2HWZL 1RIHH 1ZSDA 4P23A 3ZGHA 3QUXB 3JZYA 4H8QA 2IAMA 1OP5H 2WZ6A 5CD5C 2BCKA 5IQOA 4H88L 4PRHB 1QTPA 2IWGA 4EI6A 2BNQA 3SKNB 2IOIA 4OFKA 1MEXH 5FW6A 4RIRA 4AQ1B 3D3VA 3NMEA 4NZDA 4XN5A 2JKIS 2EXYC 2XVBA 2LQRA 1S5HA 3DIFB 3UGUA 3V0JA 1CDUA 3ULVE 1JGUH 2HN7A 1QRNA 5KEZA 1SF3A 3MNWB 3NJGA 2OZ4H 2YAEA 1IE5A 1E0OB 1K6QH 5D2LA 1O6VA 4RMTA 4WW2A 3JTSA 3EXJA 3QFJB 2IJ0C 2APTA 2VH5L 5CSBA 3WJJA 4H8WH 4NNYA 3V6OA 1P5VB 1U8IA 4M1DL 1QTYT 4P4KA 2PMZA 3CFTA 1T03H 3DRTA 3MV9B 3JTTB 4GMTL 2X4RA 3NK3A 1XGPA 1K8IA 1BQLH 4X9BA 1WF5A 9CGTA 1P4LB 2DWEB 2WTRA 4B9IA 3FU7B 1L6ZA 1WRFA 3CXHJ 2EDYA 2YEQA 1YECH 3D0LA 3GXDA 1IEBB 4MSWB 3U0TA 3SBRA 3TA3A 2M83A 1IBFA 1MJ8L 3NIFE 3SDAD 1Q94A 2VR6A 4KXAA 4NERA 1UJ3B 4WJ5A 4ETQA 3HOGA 1H3PH 4LPWA 1KC5L 1I7RB 5F3HB 2JIXD 4X4XA 4Y19B 5JIMA 5D71H 1J7VR 4DSYA 1JYWA 3QQ4B 2GFBA 3TNNB 5JW3L 4PLJD 3K2IA 3QGVA 4UILH 2FH6A 3CZNA 4WFGD 2QQKH 2HMID 2CGRH 1G6RB 5AW6B 3AY4A 2X1QA 4HWEL 4PMFA 2J12B 3V6BR 4CDGC 4FQXD 1CT8B 4N0FA 4OB5L 1DTUA 3HNTH 1W8OA 2V9TA 3W0WB 5A1AA 5FGBC 2EC9T 4HK3N 2DQCL 3DECA 2TSBA 4Z3TA 3J2PA 4U3HA 5EU3A 3LN4A 4APQC 2Z31B 5DRZB 4JQIL 1HHJB 3FCTA 5AWNH 3C5SA 5HHOD 2W9EH 2MKLC 2XSKA 3ESUF 5AVTB 1IIKA 1UACH 4YC2B 2FBJL 1I1AB 1SLVA 4ZT1A 4EI0A 3A4DA 1B3IA 1YEGH 4JKNA 1RLBA 5KUKA 4JFOA 3DXAA 3OG6B 5F72S 1M2VA 3UZVB 5CP7B 4LLVA 5GGRY 4JY5L 1I1YB 1JCKA 2NTSP 2WXIA 3KPPA 5F88B 2CA4A 1I8KB 2XWTA 4JLRB 2Y07L 1WT5C 1E6JH 3P2BA 3EFDL 5E9DD 3EH1A 4TV3A 4FE9A 4PJFE 2R56H 3L8QA 4WWKC 4BXVA 1YEIH 1KT2B 2H1PH 4N6RA 5D7JD 4EXKA 5J13B 3VG9C 1HQRA 2HLFC 2GITB 2ZXBA 2BRRH 1M05B 2WLJA 2NZ9D 2K78A 1NWOA 2B2XH 4JREB 5CJOL 4U7SA 1V8HA 3RY5A 2NXYB 4G9DA 4MD4A 3GMOA 5DA4A 1U93A 4OD1L 4W9CC 5I9QC 1WVZA 4BSJA 2YXFA 5F7UA 4A2FA 3V6ZA 4L3CB 2ZF9A 4IRSB 3O3UN 2RD0A 4N8VA 1Q72L 3BZEA 1XF3A 1HXYA 5C7XL 1JE6A 2CIIA 4GRLA 1BPVA 2BVPB 1DBKL 5AVRB 1BVLB 1RMFH 3UMNA 3PP3K 4TLTA 3UTPD 1HJBC 3D2UD 1K3IA 2P5EA 2JI2A 1MLCB 1ORSB 4KDTC 3VFPA 1INDH 3FO2A 3NJLA 4P2QD 2IWKA 2EEDA 5ESQB 2JK5B 1QX1A 5FHBL 3S4SB 2EDHA 5JOFA 4FTVB 1X5ZA 2DIJA 2NNFA 1S7WA 3FQNB 3KVDD 5L6YH 5IW1B 1I8IB 4ZFOL 4Z0BL 2OCCB 1NPUA 2JF1A 3GT6A 3T3MF 3P73B 1U58A 3B9AA 3NN8B 1VPOL 4KY1H 2X88A 1TVBA 3X12A 1RUPH 4E5XA 4HIXL 2A0LD 4YHZH 2PF6A 3R0MA 3QCUL 5F2FA 1T22B 1MFDL 4HJGB 2DTMH 4M5SA 3CFNA 1MCPL 4G43B 5BVJB 5FS5A 3WE1A 4HC1A 5EDXA 3EBHA 1RHHB 3DVNB 1I1CA 3MRLA 1ZE3H 5EF3A 1LO4L 3DK0A 2P8PA 4JFED 1JZEA 5E5MA 3B7RL 4ZNEE 4ZTPL 1A4CA 2W5PA 1T7XA 4ZXBC 5EV7A 4ZOAA 1QATA 2VR5A 4BE6A 1KGXA 2ITCB 2ADGA 5ID0A 3MUY1 3WNKA 3A24A 1CR9L 4JO4H 4HS3A 5LCVL 3ZYOA 4CNIB 4PRPE 1KPRB 5I5JA 3VFWA 1OP9A 2ARJA 1J1XH 3GSVA 1U33A 3K3QA 4GRWE 5LQBH 3RVTC 3VXSD 5CZRA 4KO9A 5DJXB 3O11A 1YN6B 3TT3H 1UD6A 5F7WC 2DLFL 3MRCB 3BHBB 2XVGA 4JHAH 4NC1E 4PTTA 3CFCL 1TUPA 5CJBA 5EU6A 5C86A 3D39D 3VRLF 4FFZL 1CD9B 1HKLH 4A2LA 4WRLA 2CDFA 5EEWA 1BLIA 3MUGB 1NCAL 4GRMA 5B1JC 5MEND 4AJ0A 2X9XA 2Q20A 5E2WL 2H26A 1JXFA 2E7BA 1UM5H 2YC1A 1S9XA 3M7FB 3N85H 4JFFE 5FYKL 1I3GH 1HHIB 3OAWA 2R0ZL 2ROXA 3H2PA 3PQYA 5IHBA 5FGRA 1T3FA 4L9LA 3W1ZA 1N0LB 5F6HJ 6FABL 2EJ1A 3KGRA 2XT1B 5IB5A 1BVNP 2Y6TE 3WY4A 5M95B 2ZTBA 4NSKB 2MCG1 5GS0C 3WG7B 1G1KA 3BSGA 5DUBA 4A7VA 2J57A 3G6AA 2X6UA 4KTEL 2GSGB 5GZOC 2HLAB 5F9DC 15C8L 3CUPB 3GXPA 4LVEA 1FL5B 2EDKA 4I77L 4OT1H 1J0HA 4QXGH 2IQ9L 3IMTA 1SHSA 4NQEA 3B7YA 1A6ZB 1ES0B 3ARSA 1CZ8H 4Z7WE 2E4TA 1KCVH 1IBGL 1CE6A 5D4IA 4Q9RL 1D5RA 2X1WL 2HJKA 2X6MA 5FOJA 3HI6L 4Q4EA 3TBVA 2WBXA 3VA2C 4PV9A 3B83A 4DKTA 4Y4FA 1B4LA 2DLTA 2GJPA 5DFVD 3KJ6H 5GISL 3MUZ1 3L4WA 3L9YA 3GSWA 3OB0H 4M7JL 2WCPA 1OAYL 1N2RA 1UM6L 1BQHG 4TVSa 1BAFL 1Z9SB 5BZWB 3WSQL 3HAEA 4P2RB 5C70A 2BHUA 1SF5A 4PGCB 1SPDA 4ZDHA 1EDQA 4TUOB 1OIOA 4K73A 4O02A 4FNUA 4U6YB 4YX2L 4KK9D 4ZBJA 4LCUB 4NJ9L 5L88H 2QBWA 4LPXA 3RFZA 4KX7A 3BGFB 3HZVA 2RGSA 5B4MD 2FDBP 1DSFH 1KN4H 1U2YA 2R7EA 3QXDB 4RESB 2DH2A 4TTDD 1MIEL 3QORB 4XOEA 1MFCL 4YGAB 2K7QA 5E8PA 2YA1A 5EO1B 2VXUH 5TDNA 1S6NA 3OPZH 1CD1A 3PU7A 1L7IL 1NCUA 2K0RA 4JZOA 2NX5E 2VGLM 4J6RH 1NC2B 4I1RA 5CGTA 4XAWL 2XKUA 4BWUA 3H42H 4KHTH 2WUCL 5IVZA 1BIIB 2HG5B 4K71C 1OW0C 2J88L 3HZYB 4BWTA 3VXRD 1A14H 3LKRA 2V9RA 5DUJA 4G6AD 2OMWB 4GG8B 1NGZB 2YD8A 3QQXA 4M7KL 3ZL4H 2Z6FA 5BV7H 2O6CA 1NJ9B 1IBYA 2YD4A 4BFIA 4S2SA 1ETZB 3IDIB 12E8L 3US9A 4FFYA 4G9FE 1OOWA 4PVNA 3UAJC 4M61B 4NO0B 1R9FA 4LP4A 3B2UC 2X4NA 4K94H 3IDMA 1M1XA 4XB8A 2JI3A 4R8WL 1VRSA 4BK8A 4HVBA 3C5JA 3QO0A 1MI5E 2DBLL 3REWA 5D96B 2G75B 1MREL 2DKSA 2AC0A 2EXTA 5T1KB 3RA7H 5TQ2L 3MV8E 1LJMA 1TZOA 5GGVY 3ZVVA 2L7JA 4CNIA 4ZMZA 4FXGA 4IBWA 1QSFB 4Z7UB 5KOVC 2OXHA 4MDRA 3IJEA 4W9HC 5D2NB 2M26A 1I4FA 2ZOKB 1S7RA 4U3SB 4LK4A 1OAQL 5KG9A 2IH3A 3FMGH 1FZMB 1NDGA 1HH6A 1R3KB 4ZW6A 5BNXD 2E27H 5I17A 2GHWB 5F1KC 1AS6A 1KDJA 1KIQB 3RGVD 3SE3C 3U36B 1SY6A 4PJHE 3IB4A 1YMME 4ODUA 1UURA 3L3GB 2AQTA 4JE0A 2VLLA 1T1YA 5EIIG 5ISZD 2V8MA 3NSCA 3GXIA 3O3BA 1DEEB 4B97A 1ZVSA 1T6VN 4KRMB 1YQVL 2D4FA 4LOUC 5IUCA 1KEGH 3HG5A 3ECBA 4R97C 3WUWG 3SE8L 2XC8A 3MRRB 3ZSTA 1U95A 1BBJB 4O5LL 4GQZA 2N0KA 4LLMA 4LLWA 1EHNA 3WMSA 1E8XA 5EO9A 5INCB 2BSRB 3K74B 4X6FA 1NLBL 1TEYA 2C1PA 4OD3L 5JA8B 2QMKA 3MRHA 4H20L 4JO3L 1XF4B 4OZ4A 3D12B 3VJ6A 1MW2A 1DLHB 1DQQA 1JERA 4HG4J 1LNUB 3L1EA 2FO1A 2EYRB 5FEBA 3Q8FA 5JHAA 1L0YA 1KB3A 5D1XA 1HJCA 5J1AA 2R4SH 3ASWA 3PAZA 1A3LL 3PG2A 3L3OA 2WQ8A 1NMAH 2QVTA 7FABL 3FO0L 3N41F 5GS1A 4W4NA 3PWPA 3FK3A 1IC4H 5IOPB 3OKMB 1AJ7L 2R0LL 4LSDA 4Y89A 3U7YL 1MCOL 2DJUA 3TVMD 5I6KA 2BP0B 3GSXB 2XXCB 2PW1B 2QHLA 3HMWH 4OF6A 1BEXA 2ZP0T 4H1LB 4ZO6A 2DBJA 3L81A 1DR9A 4AX3A 3DX8A 4FG2A 4TQ8A 4LSRH 5DMYA 2WLIA 1TZAA 1XCTA 3IXTB 3SYCA 1YEDB 3MRIB 2LU4A 5DJAA 3DTDA 4PJ7F 1SNRA 5EBGA 1UWGH 4JM2B 4KNUA 4W9IC 4Y2LA 3JVFC 4KPHH 4IRJB 2ZYHA 3M1CA 3DHPA 3MROA 1UWXH 4KRPC 4OUUB 1UD3A 3RIFK 1FO0B 4NHUB 3QJVB 4UUJB 1KENL 1AXSB 3B1TA 5EUOB 4IGBC 2UZIH 5EC1B 3QULA 4D0CA 1ZHBA 4FQLL 4KK5D 2GJZB 1EO7A 4QCIA 3QPXL 5GHWH 3VXUD 1YAIA 5I6MA 4GAGL 1YDPB 1AE6H 2WSPA 2MOGA 4KKLC 4CN4A 1HI6A 4DP8X 3HPLA 5AEAA 1OLZA 1DLFL 5GJTL 4AYBA 3DGDA 4X5QA 1JZ7A 3K2MC 5AW4B 3W38A 5TH2B 1QSZA 1I8UA 2QQQA 2YUXA 3RUGA 2OSLA 3U4KA 2J8HA 2IQAA 4CSPA 3SE3A 2WWKO 3HZKB 1JZ6A 1N6QL 5CN1A 1EZLA 1GKEA 1JNHB 2MPAL 3PWUB 4Z3EA 1OAUL 3ZTNL 5EZJA 3QDMA 2H3NB 2NSXA 3BPOC 2VW6A 2GEEA 3SOBH 5GSRB 2JKNA 3SYAA 3QJRB 2WMPB 1PX8A 4JFZH 2VLKD 4IU2A 5GGVH 3A21A 4AQ1A 2P5WA 2O5NA 3UTZB 3RYMA 1HSBB 1V3LA 3U2SA 1JOIA 2I60H 4HYTB 3AM8A 4NN7B 3ARBD 4JBSA 4OIBA 1HFUA 4MD5B 4WW1A 4YK4B 2CBTA 5AW5B 2VDNL 1FNSL 1UM4H 3MNWA 3CGTA 4L37B 1CE1L 4HC1L 3U4EB 7PCYA 3NFNB 4OQTH 3BE1H 3QFJA 1FNLA 3F7PC 1O7SA 1TQSA 2Y1ZA 3FT4B 1ILUA 5KYXA 4GKSA 5E6IB 4PJ5A 1BMZA 3JTTA 4WNQA 2IGTA 3UYRH 4XP9L 3BAXA 1UT2A 3H53A 4LQ1A 3GPEA 4WO4D 5JMOC 2DWEA 1DUZA 3EYQD 3B9KB 3FU7A 2QQNH 2EDXA 1JRHL 2IMNA 4KGJA 3P11H 5B1KA 4MA7H 2ZF8A 3ARPA 3HE7A 5TF1L 4MSWA 3RIAF 5CBEA 5BOZG 5FFLA 3FFCB 2MNUA 4OZHB 1QSEE 4X6BB 2Z64C 3O4LE 3QDGB 2CLRB 2BY2A 4RSYA 5DK0A 4MS8C 5F96H 4A7GF 3GJFA 1DVUA 5CINH 1AP2B 3BAEH 2JKTM 1DFBL 4FD0A 4Y19A 1FYTE 3D07A 1RERA 1MHPH 2HKHL 3QQ4A 3IU3A 1XXFC 2DQDL 4M6OL 1CGTA 1XGRA 5HGBB 4PN6A 1C12A 4HXAL 2OTPA 1DP0A 3JUZA 3EHBB 5JXAL 1G6RA 5J12C 2O26U 2IMMA 1NCTA 5L9DL 3DOIA 5T3XD 2KUTA 3TBCA 4FFWD 3MGOB 3QZMA 4YHOL 5FUZH 4I3RH 5BRZD 1JWMB 4A2EA 1MFEL 3FQ1A 1EDHA 3IJ7A 4NFCA 1AZUA 4X4KA 1DN2A 4JW3A 3VFSB 1LWRA 4LSVL 5KYYB 4XP4L 1RH8A 1ZT1A 1AQ8A 2OL3B 1N3NA 4I89A 1JL8A 4WFHE 1RY7B 2QKIB 3LV3B 2C3VB 2AI0L 2J73A 4N2DA 5I1CL 5HPMA 2WAQA 1ZAGA 4U1SB 2ISDA 1I1AA 4W93A 2V3FA 4G72B 4G8IB 3CHXA 1Z1WA 3K6FA 3UACA 3K6NA 4QOKB 3MN8A 5CP7A 2A83B 1UT9A 4FQ1L 3OX8A 5TPWL 5F88A 5ITBL 1I8KA 1RHFA 4JLRA 4XCFL 4YR6B 3VB9A 3QDHA 1CDJA 1CI3M 4IKNA 5ESVB 1U42A 4HPYH 3SDCC 2DWDA 3QYMA 2BS9A 3EYVB 4M6ML 1CGUA 1OKEA 2DM2A 2GIYA 4RNRA 4M48L 1KG0A 2EDLA 2YGNA 3VWJD 4CA4A 4NKMB 2A77L 1T2XA 2Q86B 3T77A 2ZZUT 3AADB 1MFBH 2PCYA 2XIBA 3T04D 1OHZA 1S3KH 3BKCL 3MNMA 5DR5H 3KPRD 5DLLA 1VDGA 5A2FA 5KSVB 1OGAB 4J3OH 5C0RH 2D7OA 5AG9A 4N0YH 5I71B 4L3CA 5EZLB 3MMEA 4WHYG 2G3ZA 4IRSA 1R46A 1MQ8A 1Q0XH 1FBIL 2E7MA 1WD8A 1Z7JA 1F4XH 3P3SA 2BVPA 3O3EB 4YHPB 1BVLA 4EI5A 5MHSE 4BBWA 4DJMA 1FNEB 1D5ZA 2NY0B 1CBVH 1M1SA 5JQ6H 4J6IA 1ORSA 1KIUB 1JGIA 5IFJB 3WIIH 3MGAA 1CGVA 3LNEA 1AGDB 2X7LA 5ESQA 2BIMA 5DURB 3S4SA 5LDUA 1QLEL 3SJVE 2HFGH 4FZ8H 2VXVL 3G04B 3WENA 4Y2NA 1HAWA 2OJEB 5IW1A 1I8IA 2ZOLB 4JJOA 4M1CC 3VXPB 2WIMA 3D18B 3P73A 4Q9BA 5IR1A 3NN8A 4G8GD 4FFYL 1OD9A 2OAAA 5HYEA 4G5AA 4QDGA 2R23B 4PJGE 1E42A 3RWDB 5GS0L 4HJGA 1DQIA 3HKFA 1OM9A 3S34H 1LE9B 4W9DC 3U6XA 3ZE0E 4G43A 3BJLA 4HUXB 2X4OA 4N2IA 1E67A 3LN5A 3SY0B 2O72A 2X4QA 1RHHA 4NCDA 4LPVA 1QWNA 3DVNA 3C8KB 3BI9X 1ACYH 2OMNA 1A7OL 4JFDD 1G9NC 1Y18B 4G6JH 4UAOC 2FJUB 2QPDB 4I18C 4AGLA 4YXLH 3LEYH 4FQHB 1F42A 1L6PA 3KPLB 3QEQA 3NSJA 4ZUWA 1U21A 1UCTA 3U1QA 1SY6L 5IV2B 3ARGB 4JZNB 1DVFD 3VMOA 4QRPE 2WBWB 2OR9H 4E36A 4PAZA 1U91B 3MRCA 1CIDA 1BYOA 3AB0B 3BHBA 3F7VB 4O51B 3ECVA 4KNQA 3GIVB 3SE9L 5K59F 3HC0B 2LE9A 1A66A 3UTSB 3LEXB 3CMOL 4PG2C 1IM9A 2YSSA 2IAMD 2Y5EA 1P5UB 2E3VA 5C2BL 4YDJB 3MUGA 1B2WH 2BNQD 2EC8A 2NY2D 4OM1L 1AZNA 3FU3A 2FH8A 4GKZA 2VZ1A 3B3IB 2AS5M 1JGVH 4H88H 1AXTL 4KOBA 1MLBA 4BFBD 1DZ0A 1UA3A 3VFNA 3S35L 4XNQB 5FOBB 2K45A 2DY2A 1KPUB 3QXVA 4IIZA 1SJHA 3HRZB 4C4BA 4B9KC 3FB7B 3JWNH 4NSKA 3RVUC 3WNOA 2ZG3A 4HWBH 2XFXB 1H3GA 1U8OB 3OKEB 2A73B 1X7QB 3AZUA 4FXKC 2E9IA 2PYEA 2I26N 5C08B 5D6DC 4XHJD 2O61A 1VESA 1PG7L 1FL5A 2VDKB 1MFAH 2IPKB 4DZBA 5ANMB 5BUGA 2BDNH 2IBZY 2VH5H 2WXLA 3H4HA 3CZFB 1WLHA 3QAQA 5KSAB 3T3PE 5EBWB 4UZGA 4U0RC 4JPKH 1AXIB 3T5WA 4AIEA 2D9QB 4YQXL 4ZTOL 2K1MA 2FT8A 3QG6A 1XGUB 1MRFH 4NQCE 2H2PC 3B2PA 5IG7A 3TA3D 3A6CL 5DC9B 3ARYA 1FC1A 3IKKA 3RKDC 4K7PL 4X7SH 2A9AA 5I1LA 4M4PA 4LVNC 3IS1X 4HJUA 1K85A 5BZWA 1KTJA 2QVMA 2VDML 3IJYA 4BCXA 4PGCA 3ASOB 3X11A 4TUOA 2OMYB 1WA2X 3MCG1 5L2KD 3BD3A 3GMLB 4LCUA 3OKOB 1AIZA 3FQYA 1B4JL 2ENPA 3MA9L 3RHWF 1J8KA 3FUHA 3GM8A 4ZMLA 1FV1B 3FH8A 1DBBL 4ZO8A 4WJG3 4WUKH 2NY7L 4PTUB 5DYOB 2NNXA 4NKIL 4P99A 4WWNA 3SKMB 5I1EL 4GW1B 3PP3H 1ORQB 4PY7B 1HZLA 5K1VA 1MY7A 4P0DA 4P4RB 2XDHA 2EXWD 3EFOA 4KMTH 2A9NL 4HWEH 2QSCH 4OLYL 5C0CB 2XZZA 1G7LA 4D8PB 5C0DB 4WNJA 1NC2A 2R1XB 2DQCH 4KQ3H 1DDTA 2BOLA 3BPLC 4GOSA 2OCJA 1NFDF 4OUOA 3AU0A 3TPUA 4GSXA 4DFHA 4GG8A 1UD2A 3OF6A 3ES6B 3V8OA 3DXAD 1VADB 5HGAB 1T21B 3IDIA 4IOSA 3MZTA 3E8UH 2GABA 2DL2A 2ZP8A 1R3HA 4KKBD 5E2UL 3UCQA 3Q43A 5IMKA 1WA1X 3S37H 1ZANL 1BD2E 4P5MA 2CUHA 2OMVA 5E6UB 1U3YA 1J5DA 1JN6A 4DVRL 4WY7L 3OKDA 2O5XL 2WLLB 5B1AB 3I85A 2O6FA 1OPOA 5E94A 3RZCC 3BIKB 4KBPA 4WWKB 4PJEF 1QSFA 4Z7UA 4WU7A 3Q2NA 4HXBL 3CDCA 4F3FA 4H1LH 5HHMD 4U3SA 4FNLL 2EICA 2J8OA 3NZ8B 4AZ8B 1IUZA 1S2EA 2HKFL 3ZDZB 1OGTB 4Y16D 1FZMA 1XVSA 5CJOH