3G6DL

Crystal structure of the complex between cnto607 fab and il-13
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
210
structure length
210
Chain Sequence
b'SYELTQPPSVSVAPGQTARISCSGDNIGGTFVSWYQQKPGQAPVLVIYDDNDRPSGIPERFSGSNSGNTATLTISGTQAEDEADYYCGTWDMVTNNVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CNTO607 Fab Light chain
publication title Epitope mapping of anti-interleukin-13 neutralizing antibody CNTO607.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 42
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2009-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g6dL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g6dL01
4JDVB 2ICWJ 2AJYL 3HI5L 1CFQB 2VXTH 2CK2A 1KF9B 4C59B 5E8PA 1FNSL 3KR3L 2HP4A 2GJ6E 3LPWA 4JO2H 3VW3L 1C5DA 1I3RB 4AEFA 2DBLH 4HBQA 3CU1A 2R4RL 3HZYA 2I9LA 2A1WL 5DD6B 3FHQA 5GJSL 5B8CB 2QQKL 2ZCHH 4UMGA 4D9QD 4LDLB 3L3IA 3PUCA 1JNLL 3BAEL 5E1AA 2X4PA 4NZRL 4KKBC 4Z18A 2CRMA 3EGSB 3VJ6A 4P2OC 3IB4A 2IBBA 3K81A 4LLWA 3PL6B 1FGVH 2WANA 8CGTA 2Q3AA 1ZKAA 4FFVC 3JSSA 4GKSA 2Q8AH 4OI7A 4NQSA 2H32A 3ZDYF 5EFIA 1DEEB 2JKXA 1A14H 3T77A 4BSWA 3FQUB 4EI5C 5KS9E 2Y5TA 1QKZH 4KK6C 1BBJA 1F4YH 2Y72A 4EDWH 1EA9C 1FO0H 5LGHH 4Z7NF 1QQDB 4HUKB 1A7BA 1N3NB 1O0VA 2ORBL 2GHWB 3FQTA 4LEOB 3IXAB 3ET9F 4O4YH 3DV6A 1UM4L 4UQ2A 1KUMA 4L8SC 1CQYA 3ZYJA 3V4VL 4FQIL 3FAWA 3N1GC 5FHBH 4K7FB 3QDJD 3Q3GA 4JVWA 2GYSA 1NAMB 5F9AC 4ODTL 5HDLA 2ITCA 2ICWB 1A1OA 3RWHA 5F1IB 4G8GB 5IR1A 4S0TD 3WIHL 1JTOA 1G7QB 4Z7OE 1D5BA 4QOKD 5ECJE 5K9KA 4XBEL 4R4FL 5CEZE 4PJEE 2Y06H 2AXHA 3WUWB 1T7ZA 2EXWC 3AVEA 1DTUA 4N5ED 1JV5A 5KVEH 1S9YB 3MRCA 4AIOA 1SJHA 3I6GA 2HJFB 1JPST 3D2UB 1UZ6F 4NO3B 1DLFH 4KHXH 2UZIH 4LQFH 1UWXK 3TWCL 1FCGA 3NFSH 3MOAL 4IS6A 1UCTA 4G8IB 1X3DA 2ED9A 3JV6B 1JMXA 2ADJA 3VWKA 5BQ7B 2YPLD 2NXYC 3HE6B 1G9EA 1XF5A 4HUXB 4X8XA 5IFJB 5ISZB 3WO4B 2B4CH 1AR2A 1EFXA 3BQUB 3KYNB 5JOFB 2C1OA 5J57B 4KJWC 1I9RH 1P84J 3TZVD 4X5WB 3S8WA 5AZEL 2XN9A 5IWLA 2VDNH 4NKIH 3QIUD 2OR9L 1TQCB 3V0AC 2G60H 3TJEL 3E2HB 2R1XA 5GS1C 4JKPH 3BPOC 4N9GA 3G5ZA 4HWZB 3MRBA 4PJ5E 3MLXL 5JW4R 4YHNB 4P3CH 1CL7H 4OCSL 4WTWA 1CLYH 2IANA 5I6XC 1MF2L 1BZ7B 2XA8L 5DURB 4Q9RH 2WW8A 3HE7A 3VGFA 1YYLL 3HAEH 1U8QB 2GK0B 3TYFB 4GG6F 2NY4C 1JNJA 4OCWL 3T2OA 4EUPA 1U8JA 1KIQB 4PJ7B 3C9NB 5EIVA 3DMMC 2ZWLT 3S5LG 1B88A 4X6FB 1Z9SA 1K4DB 1OPGL 4MQSB 5IVZB 4P4KB 3BGFC 5ESQB 1V7NL 4GT7A 2XTLA 3O6KL 1LO0L 4CMHB 1DN2A 2HVKB 1AGBA 1NBVL 4LHQB 3SY0B 4DN4L 1YEJH 4GMSL 1GGYA 5IHBA 2OJEB 4LLVA 4KK5C 4HUUA 3D9AH 4P5TD 3QZWB 5E56A 5JO5A 5KS9B 5D7JD 3MRJA 1BWWA 3HLAA 3W0WA 2W07A 4LGRB 4RAUA 5TDPB 2PCPA 1F58H 4AL8H 3H9HA 5DUPL 4YE4L 5KSBE 4HXBH 4LKXA 1ZT1B 2W0FB 1WT5A 5D1XC 3TA3B 3TCXA 4G8FB 3UPAA 2DICA 4FFWC 1YN6B 1OSPH 3S36X 1OGAD 1E0OB 3B2UD 4OI9A 1G7PA 3WSQL 3C5JA 4Z6AT 1S78C 1VACA 4D0BA 5GJTH 5HI4C 3WMSA 3UTPE 1X5KA 1A64A 2ZUSA 4HWEL 4BUHA 3VFOB 5D1ZC 1BEYL 1IC4H 1MJ7L 1PW3A 3V8OA 5FO7A 4LPYA 3KYAA 5L6YH 3UAJC 4JRXE 3HNVL 5E6IA 1GZQB 4PJEB 3RNKB 2OQJB 3WE6B 1UWEL 4GSDH 3ZKXC 1CR9L 1N2RA 4GKOA 2AJZA 3RPIA 2OBGA 2Z91A 4PJXF 1J05B 1GIGH 2R2EB 4P2OB 4KVCL 4LSDA 4HUVB 5FGBC 3U7WL 5F7EH 2R1WA 1DBJL 4K8RD 2NY2C 4G6FD 1CGSL 1U3HD 3U30C 3VFUB 2YD5A 4L9LA 2NY6C 4YFLI 3VGEA 3TPUB 4YXHH 1QBMH 2KZWA 2I24N 2P5ED 2UUDH 5CJBA 3RWIA 4EI5B 1HXYA 4L3CB 1JYVA 1GGCL 3G5YB 1KYOJ 3U0PA 5CHNA 1RHHB 4UU9A 2NY3C 4JPKH 3MYZA 5AYUL 3S4SG 4JRWA 1I85A 4PGBA 2P5WD 4PREB 3MCG1 3QNXB 5FF6A 3BPCA 1VSCA 1WWBX 3BD5A 4IOIB 3UJIH 3TEUA 1AKJA 3I75B 1Y0LA 3FONA 4K23L 2V17L 3STBA 5FYKE 1L7IL 1F6AB 4IMKC 4K7PX 4L8SB 3ZL4L 3TT1L 4PLJD 3BP5A 4ZSOE 5C0BB 5ELIA 1X4YA 5I8KH 1C16A 1WQVT 4P3DB 3T1FA 4LASL 4NWTH 1OP3K 4JPIB 1HH9A 2JIXA 4XVSH 3DXAA 2VDPH 3VXNB 1QFWM 3SDXB 2X4TB 1FBIH 2ZJSH 5FA4A 1FL3A 3IDJB 2HT4D 1HSAB 3MNVA 3Q5YA 1N7MH 1AE6H 3OHXA 1CE6A 2B0SH 3HMWL 4JO4L 5I8EB 2NCMA 3R0MA 4R90H 5EO0B 1HEZA 4F80A 4P46C 1ZEAL 3GJFB 4LLDB 2V5RA 4UT7H 3QCUL 4HEPG 4K3DH 2H6PA 5DQJB 4QF1A 2NX5D 3D3VD 3JBG7 5L2JB 4ZAKC 4Z7QF 4MZ2A 1FO0A 3C6LB 2CDEB 5J56B 1WWWX 3HRPA 5EBWB 2NXYB 4YXKH 4ZPVA 4HJGB 2JB6A 3NCFB 4OKVB 3CSYB 3EO9L 1P6AB 4I2XE 1KACB 4KK8D 3HNTL 3BRGC 1YC8A 2AJUH 1WGOA 2YD7A 4JY5H 2H1PL 2C9AA 1U8IB 2P7TB 3LCYA 3FQXA 1MQKH 2F5BL 3O9WA 4LSUL 1JWMA 4LARL 3PGFL 1PJ9A 1FL5B 5DSCA 3MGTB 3PHQA 3MNZA 2YD6A 5GS1B 4J4PA 4QXWA 3BPOB 3MUGA 3OX8A 5IEKB 3X13B 4NNYB 2VLME 1E6OH 3SDAC 5HDBF 4GS7B 4QWWC 3UBXG 3RTQA 1FYTD 4FQXC 3MRPB 3QDGD 1ITBB 5C9KA 3CH1B 4ONHA 1KIRA 4FQCH 3KJ6L 3U48A 1CD1A 3GSQB 4ZDHA 4G8EB 1CF8H 5E4IA 3L7EB 3VXMB 4UB0L 3I3DA 3BRDA 4K3EH 3S88L 3T65B 1SY6H 4GBXA 2HT2C 4MX7A 3E1F1 4J1UA 4Y5XC 3BGFB 5FECA 4F9PA 4HIIA 4K94C 2EO1A 1R3LA 2VQ1A 3OB8A 4F58L 4U3XA 5GGRB 4AEIL 2YPKA 1JRHH 4P2YA 5E99H 5F9WC 4PJ8C 2V6HA 4JPWH 1G6RB 1S8DA 5HHOD 1NCDL 4QXTA 2DM2A 5AAMA 4OD1H 4NYLB 2NTFA 4P4RA 4K3JL 4PJBF 4Q9BA 5DT1H 1TQBC 4PJCE 3VD5A 3L3GA 2FECL 1G9NC 4WTXA 1F45A 2PW1B 1LEGB 4WWKA 4APQC 5LWYL 5D1XB 1N0XL 4KUZL 1FFQA 2EH8H 4G6MH 1KEGH 3IU4H 3CFBB 3FZUC 3GMMA 4ZOAA 5DRWA 3PNWA 1DQDH 1MCHA 4OIAA 5C0DB 2OXGA 1QLRA 3HAEA 4N1EA 4ZTPL 3FRPG 4NM8L 2BERA 2A83B 1WEJH 4TPRH 5D1ZB 3CFKB 3PP4L 3GI8H 1RJZA 2OCFD 2PXYC 3QCVL 4D9LH 1UWGL 4AG4L 4G6AD 3CFEB 4IRJD 4C4KO 5EWIL 3BO8B 3ZKXB 4OCYH 1RZFL 5B21A 3WFZA 1YC7A 1CTOA 3ULSA 4U1LB 1I7UB 2QHRL 2R1YB 3GJEB 4M7KH 3ISWA 2VL4A 5FGCE 3T0EC 5C0EB 4NT6B 3R06A 4K8RL 1LEKB 2VLKE 3ULUE 2BNQB 1R3IL 2G5BA 5CBAB 1AXTH 4RNRA 4AENA 4RIRA 3U30B 3C5ZB 3VD7A 1BIHA 2NY6B 1EH9A 4JREC 1A4JA 1XAUA 4PJGF 4YDKL 1C1EL 1SHMA 4KUCD 4Y2DD 3VXQA 3CC5A 5ILTL 3ROOA 5KG9B 2NY3B 2W60A 3BKCH 3QEUA 4OUUB 3PWPB 1XGQA 1UM6H 3O3AA 4M00A 1N0LA 2NYYD 5HYSG 1PZ5A 3TT3L 2QV2A 3C8HA 4PRPA 3X14B 5LKNA 4OF0A 2DKUA 5EU5A 5FYJE 1BWMA 3EFDH 4JFYB 3MLTB 4AIZB 2ICWI 3WS6A 5I18L 5GISH 1KOAA 2QR0B 4JVUA 4LVOC 4UINH 3VWJC 4HWUA 3V4PL 1R3KB 3UPRA 5D6DC 4RSVA 5JPNB 1S7XA 2CPCA 1MAMH 4YDLC 4L3EE 1S9WA 2MFNA 1W72H 1QP1A 4WHYG 4K3HA 4DAGH 4EOWH 1JZ3A 2R0KH 3D48R 4ENEC 4IIQA 4JM4L 1MIEL 4K9EH 4QXUH 3QNZB 3W39B 3B3IB 3OR7B 4U1HA 3DARA 3RVWD 4M6OH 4P46B 2O5ZH 2R0ZL 1G7IA 3H3PL 2PUQT 6FABH 3NCMA 3GBMH 5ESAA 3SGJA 3X11B 5HYJB 3KJ4C 2F5AL 4R6UA 4OGAC 2RR3A 3OAZH 2AK1H 4BYHA 1HK6A 4ZAKB 1B9ZA 1DDHA 1R5IA 2PR4L 4PPTA 4ZD3H 1QFUL 5A40E 3O6FD 5EO9A 2Z93A 3VRIA 2NW2B 5C0IA 2JB5H 4P2QE 4HMDA 5TDOB 1U91B 5A2KH 5I19L 3AREC 3QXUA 2NW3A 4ELMB 2GT9A 3SBWA 4JDVA 3LH2L 3BP6A 1CFQA 1A5FL 3WL9A 1HI6A 5HJ3B 3IF1A 4AIXA 3DVGB 1H15A 1S3KH 2P8LB 2HN7A 1B6DA 3SDAB 5IIEB 3EDEA 5JUEL 1YNTB 2VSDA 1JIBA 2V7HB 4FQXB 2E8YA 5B8CA 5SWSA 3LEVL 4R96A 5TH2B 1CG9A 4TSCH 3ILQD 2RGSA 4KI5C 4RA3A 1FZKA 2C3WA 5CJ8A 5CMAA 4GW5B 3HG1E 2AQ3A 2OL3B 3EGSA 3K46A 4OD2B 4N68A 4QCIA 1N59B 1JGLH 3D25B 3HRZA 4Y5XB 4ERSL 2JTDA 5I66B 2DTSA 1OAZL 1TZGH 3KPRA 4L4TE 4JO3L 4I3SH 3L5IA 5EU6A 1ZLSL 4YR6B 3RIFF 5D7SL 2C7UB 3RX5A 4PJ8B 3W9DA 1WBXA 5DC4B 5DD3L 4OT1L 4YFEA 4V1DB 2XZCL 4PV8B 3F6IA 3GMPB 1TQBB 1G84A 1U8NB 1QZ1A 4OGYL 5BV7L 3I9GL 2BSED 4APQB 1AI1H 4WHTB 5GIRB 1J8HA 1TJGH 2P42B 1CBVH 1NAMA 1NGWA 2J8UE 1FVEB 1KPRA 5JMRA 1UYWL 4WHDA 2Y6SC 4WFGD 2X9WA 4UBDD 5F1IA 4G8GA 1PX4A 2XTJB 2APTA 3O41A 5D7LE 1Q1JL 2IFFL 4Q7DA 1I7ZB 5F88A 1KEMH 2OLDA 2Y7QB 1F4XL 3DO7B 4EI6A 5C0NC 3MACH 4XNMA 1LK3H 2PXYB 2F53D 3IDMB 1SY6A 4F37F 3RP1A 4XNUH 3C8KA 1Y6NR 3KYKL 4JCLA 4XC3L 1QFOA 2VC2H 4ACPA 1GVIA 1A7QL 2HJFA 3H8NA 1WFOA 2KPNA 1WFNA 2KL6A 4HMEA 4MAUL 3ZE1F 4J3SA 1ES0B 3T0EB 3UJJH 4TVPH 3H7BB 1FFOA 2HH0L 3KXFA 4XCCH 1E27A 3K2UL 5MEOB 4KQ3H 1FL6B 2BSSB 5BZDB 2J3SA 4FQLH 5CLTA 1R3JA 1XF3B 3AU1B 1BVKB 1G9MC 4OZGA 4NFCA 4NIKB 1JPSL 3EYVB 3UCRA 1LK2A 2AEQL 3OAUL 3ZDZF 1IGIL 1ED3A 1ZTXL 4WTZG 3ARRA 3MO1B 5CBEA 2EYSB 1DBAH 3VFWA 2IPKB 4B0MM 3NCEB 3QWQB 4HULB 5KANI 3K7UA 3HCVA 1NKRA 4Y1AB 2GJ6A 2WINB 5FYKH 3N50A 1RZ8B 4GG8B 4LVOB 3VWJB 3GDBA 3QR2A 5FM4A 2WV3A 3LVEA 4KDTA 4JN1L 2VH5H 3DGGB 3FQWB 4ZNEE 5EULV 1U8QA 4FRWA 1SYVB 5IVXB 2GK0A 3GSWB 3OZ9H 4YDLB 4U7MA 3EYOB 4NBXB 2DIBA 1TTFA 5FYLD 3HZKA 3V5HB 4FP8L 4CVXA 1BJ1J 1DBBL 1UKTA 3HG1B 3MRRB 1QNZL 3JWOC 1E4XH 3LPFA 5IVZA 2QTEA 1MHPH 3BMVA 1JWSA 4U1MB 3QHFL 1KN2L 3IU3A 1BVZA 4FS0A 1MUJB 4ZXBD 2YN3A 4QRRE 1EXUB 4X7SL 3UDWA 1HSBB 1HINL 2V2WB 5I1JL 3G6DL 4XC1L 2GSGB 2FH8A 5IM7B 3MRFB 3QNYB 1WISA 3VFGL 3IVKA 1TNMA 1YJDC 4JVPA 2FJGA 1GJIA 3EYQD 3U9UB 4J3XA 4OCXH 5AG9A 1AD0B 3C09C 1TTGA 3AREB 1TZHB 1YEEH 1AFVL 3BW9B 5FCUH 1KB9J 1ZHBA 3KLAB 4POZC 2HLAB 1FDLL 2YSSA 4NWUL 1ZA3B 4LCIH 1NC4D 1IAOA 1MCRA 5GHWH 4FMFA 1HHKB 1TCMA 5T1KB 1Y18A 1RPQA 4KV5F 5MERA 1MFEL 1UACH 2VXQL 3SKNA 1FIGH 1BX2B 4QHKJ 2EIBA 5I1CL 1MRFL 1LE9B 1QO3B 3ZDYE 1X7QA 1X5ZA 3NCBB 3BVNB 4JO1H 5TDNB 4F57L 5C2BH 5D70H 3L5XH 4ZUSA 3WE6A 1U42A 1CIUA 4MJ2A 1BGXH 1ORSA 1CK0L 1VEPA 3GSUA 4JHWH 4GRLC 3REWA 3QIWA 2X7LA 4U7KA 1IEBB 1EO8H 1I9IH 2EDHA 2EEAA 1C12A 3S7GA 4RMUA 1CT8A 1I9EA 4I5BA 4MCYA 1P69B 1KC5H 2E6JA 3GNMH 1ACYL 5F70A 2YPVL 3TPUA 1K5NB 4WDIA 1SJEA 1R24A 4NC1C 3K2MC 3HC0B 3ARBC 4CGTA 1FAIL 3TH2T 2X1OA 2DQIH 3CFJA 4IOIA 4UTBH 1LP9B 2NMSA 5DF0A 1S7VB 3B6SB 1BM3L 4UV7L 5JIIA 4HGWB 4S1RH 3HPLB 1EJOH 1P4BL 4PJ5A 25C8H 3PV6B 1A6VL 1NL0H 2IAMC 5E0QA 1G0DA 1FZOB 3WNMA 1CGTA 3LRSA 4D2NA 3VXNA 2VIRA 5IMMA 4HWBH 3QHZH 4WUKL 4HS3B 3IDJA 3OXSA 3DX9A 1K6QL 5C9JB 4M43L 2D7TH 3E3QC 2X4QA 1U8MA 1UB6A 3L7FA 3OKKA 4M5YL 5JXAL 3SHSA 4PRHB 4NCC2 4CN4A 1RUKH 3CJJA 3MBED 1U8LA 3QXTA 3ARDD 3VXSD 3RUGE 4ODWB 1K8DA 3NFPB 3LKSB 3RL2B 4M1CD 2DLTA 2QQLH 3JWNC 3SE8L 4HT1L 4YDIH 1RU9H 1KULA 3JV4A 3HN3A 3PQYD 4N0FB 4XAWL 5HDOA 3MUZ1 3ULUH 2CDGB 4F7EA 4R4ND 3MREB 4OKVA 4BKLB 4PUBL 4NRXB 4AEEA 3ARFC 1U36A 3EUUA 5KW9H 2AXFB 2ICEB 2XWJB 2HFGH 5KSBA 4K55A 2C4XA 4RFEB 43CAB 4LSTH 2X1XR 1BIIA 5B3NA 3D0VB 3WN5C 3NA4A 5K9QI 1WZKA 4XBPA 4NNYA 1F11B 3HZMA 1BAFL 4PR5B 3U4AA 3VE0A 3A6CL 1T21A 4JZJC 4MJ5A 2E9IA 3X3GH 1UWXH 1K2DB 3ULVD 4JRXA 4RWHA 3QPXH 1NCCH 3E3QE 4G8EA 1T83C 1IILE 5MEPB 4R7DA 4XXDB 5FYLL 3DMMA 4CADB 3GM0A 3UYRL 4HX1B 4LVHC 4KHTH 3T65A 2XKSA 1OAUL 5HHNA 2KDGA 4FN0A 4DGYH 3MV01 2KKQA 3CU7A 1ONQB 1S9XA 1G7MA 2FBJL 2EICA 1UZ8B 3LQZA 4NO2B 3WFEH 4I18A 4EBQH 2E27H 2AJVL 3GK8L 3PGDA 3TVMD 4P2CG 1YYMH 4XNQA 1C08B 3IYLW 1YEIL 3GGWB 5EORH 3F12B 4M1GH 3RZCC 1IGCL 1ULVA 4LOUD 2ADGA 3L3JB 4NYLA 1AGDB 2EYTA 3CUPB 1IGYB 2X4UB 3O2VH 1Q9LB 1OB1B 4WO4A 2W65A 3RI5K 3ZZ1A 3C09B 3QDME 2H9GB 4XNYL 5CKGA 1DBKL 4BQ6A 1KJMB 2X4RB 1KNOB 1H0DB 5DXWA 4ETYA 1JK8A 2V9TA 5FDWB 4JFEA 3DRQA 4WW1B 3TBSA 4NP4H 1LQSR 1DJSA 2XIDA 4ZSOA 3SDCC 3F7RA 2HFFA 5C0DA 4LRNL 3GSNH 3OR6A 2DI9A 1WFTA 1HH6A 1DQMH 1DR9A 3BE1H 2A83A 1T1XB 1IM9A 2H41A 5BVJA 1J1PL 2VKXA 3RWGA 5DVOA 3QPQC 4PRAB 3QDHA 4Y0GA 2N1KA 5HDQH 4XXCC 1TJHH 1YY8B 5SWZD 2VZOA 2CKBB 3IT8D 1FLTX 4RGOH 5F6HI 1IC5L 1QSED 4WFHE 4ZO8A 1ZHLA 2L7JA 4GRLB 3BEWA 3NZHL 2J4WH 1E4WL 3SCMD 2AI0L 4F15C 1JZ7A 2BNUB 3RWDA 5CBAA 3CFCH 4YHYC 4O9HL 4WCYH 3FT3A 2P45B 1FZJA 2FX9H 4OIBA 3KNBA 1G7HA 4UQ3A 5DD5H 1ZHNB 3PV7A 32C2B 4I2XA 3KAAA 5KG9A 2Y5EA 3IFPA 3BT2H 2FEEI 3ME0A 4KJQD 2VZTA 3MCKA 3ARBB 1KPVB 2J8HA 1EEYB 5T1DL 1YMME 1HNFA 3SDYH 3LEXB 1JJUA 4FXGB 4O2EA 4GG6B 5BZWA 3G6AB 4NOBA 5IB5B 4O2CB 5I75C 2YN5A 3MLTA 1I75A 1FNAA 1LDPH 3GIVB 3WFDL 4JG1L 2IAMB 5CEXB 5CILH 1GAFH 2IBZY 4NZTL 5ICYB 5HI5C 5JORA 3TH4T 2EDRA 3CDYA 4Y8AA 5D8JH 3EOBB 3RL1B 2A9NL 1JZ2A 5F7NC 2ZUVA 1XF1A 3MRIA 3QNZA 4YHOH 5TQ2H 5EB9A 4GRWE 2CK0H 1HKLL 3BH9A 4ZUTB 4G6KL 5ALCH 5C3LD 3STLA 4RFNC 1MY7A 2I60L 5DUBA 3X11A 5EH1A 5GS0D 5IB1A 5J11C 2P47B 4FFZL 3S96B 5EZIH 2H45A 1KJ2L 4OZHF 5F9JB 2NW2A 2V2TB 5JOPD 4KMLB 3RKPA 3ARFB 3WNKA 2BVYA 4PJCA 3QG7L 1OP3H 5JIKA 1WC7B 3MRNA 3U9PL 1QACA 1WAAF 2DQJL 4U7SA 5E9DD 4NKOA 3QDMB 4OLUL 3BZ4A 5F9OH 2IH1A 4OZFG 1D6VL 3HC4H 3MOBL 2VJXA 2VUYA 1Q9KA 4S1DC 2E6QA 2YD9A 3WN5B 4LRIA 5SX5K 5HJ3A 3UZQA 1WZ1L 3D69A 4UZGA 5CJXA 5I9QB 1GH7A 1BFSA 5FO9A 1PAMA 2JJTC 3WYRA 4LCYB 4HWBA 4D9QE 5I30L 5IIEA 2HTLC 4PRBB 5D7IE 4KJPC 1YNTA 3TO4A 3OKLB 3IJYB 1KTDB 3AS0A 4JZJB 2CLRB 4M62L 1S7SA 2Z0BA 3ULVL 5CGTA 5TE6H 2GI7A 2YUWA 2YRZA 4LEXL 5BXFA 2ZOLA 1GC1L 3ECBB 1EGJL 5JW4M 1KBGH 1PQZB 3QO1A 2EKJA 5DHVB 2VDLH 3QG6B 1ZT7B 4RWYH 1QRNB 3NA9H 3MRHB 4PJBE 1OAYL 4O51B 3CMGA 2MPAH 1SJXA 2VLJA 2VLKA 4HSQA 1FV1B 1CN4A 2YBRB 4L8DB 2WWMD 4UNUA 2YKLL 2P24B 4ZMAT 4JFZL 4M8VA 3VMPA 2AXGA 2HFTA 3TZVC 4PY7A 3RZCB 3IGAB 5ICZB 3QIUC 5I1AB 1JGUH 3BDYH 3OKYA 2G9HA 2FJFB 1AR1D 3AS1A 3QDJE 2EDNA 4APQA 1YMMB 3ZT5A 5C0JB 5JZ7D 4HPYL 4AT6A 1T1ZB 4RDQG 2ZG2A 4S1QL 4HKZB 3QEHA 3VFRA 5SV3A 2BOCB 1BD2B 3DUUB 4QOKE 2DDQH 1FVEA 3SDCB 1J1OH 5DC0A 3V5DB 1T0MB 2FD6L 4HS8L 4OM0L 1T7XA 2D3VA 2BVPB 1QSZA 4WEMB 5BOPA 1I7ZA 1JPFA 1X6NA 4PGDB 5DS8A 2ICCA 1UENA 1S5HB 3MLWL 4R0LC 4L3EA 1PSKH 1MCIA 1XGTA 3G08A 3GSVA 3QUMB 5BS0D 1LE5B 4JY4A 1A22B 1TXKA 3V7AE 5DMKA 3PIQA 3WEXA 1MAKA 2MCPL 4NJ9H 1F90H 2A9MH 3QUYA 1S7RA 1TITA 4P5TC 1MEXL 2YPLE 5I17B 2V2XB 5SWQA 5GS2D 5GRUL 1F6FB 3F7VB 4R7NA 3G9VA 5T33L 4WI4A 4A6YH 5I74C 4YHYB 4UUJB 4Y16A 3PWLA 2PTUA 5IBUG 2X1WL 1FL6A 4M5ZL 4H25A 5E5RB 4DKDC 4XBGB 1RZIA 4QY8B 3AU1A 5JPMB 4NQEB 3RWJB 4P2QA 1XIWD 2Q6WB 3KDMB 2A0LC 5F7YC 2R2BA 2QQNL 4WHYH 4Y4KD 1CVSC 2XWBB 4QNPF 3O2WH 5GGUA 3MCLL 2EYSA 1KCRL 1NSNH 1ZT4A 4XP9L 5I75B 2FNBA 2Z92A 4XHQA 3WUZA 1HZHH 4UNTA 1S7QB 3TBTA 1KJ3H 2FCBA 2WINA 4MDIB 4WI3A 2Y36H 2DTML 4NN7C 5KSAC 2PF6A 1CLOL 4HV8B 1A0QH 3CZFB 3VWJA 4FZEH 1A6ZA 1NGPL 4MJ6A 4MWFA 5FHAL 4FABL 1O7SA 3DNKA 3DI3B 5C0AD 4OM1L 5DJ2B 5JR1H 3BXNB 1KCSL 3U4EA 3S4SA 4QHKI 1M7XA 4KGJA 2X09A 2NY1C 3GSWA 3TIEA 1P53A 2YWZA 5EOQL 3V0VB 3QUZD 3S3SA 3TLRA 4K8RC 3HG1A 3MRRA 3PWNB 1IKNC 4R26H 4JZOB 2HVJA 1JWUA 3ULVF 1J10A 4PJBB 5DTFB 4RAVB 4HKXB 3PWVB 1DFBH 4RFNB 3LEYL 4PJ9D 2PW2B 4NQCD 1U2HA 4L4TA 4XPTH 4XT1C 5GS0L 2APBA 2Z35A 5J11B 3GSOA 2V2WA 1T7YA 3U36B 4LVNC 2XV6B 4NO0A 2Q86B 1IAIM 5GPRA 5K59E 1IE5A 1YEFL 4W68A 2WAHA 3BZEB 1AD0A 1YQVL 5LJYH 1VENA 4N0CD 1OGAE 3AREA 4XWGL 3MLRL 3FT2A 2BNRD 4P5KA 2AJYH 3HI5H 5DRZA 3P9LA 1P7KB 1U93B 1BVLA 5E00B 1W0WB 2J8UA 2B1AH 4M4RA 2DLIA 4L1DA 2HT4C 2R4RH 1XGYL 5D7LA 3TBWB 5DQDL 2NLJB 5ADOH 3V6OC 1YECL 5IW3A 5GRVK 3BAEH 5TDNA 3IDIB 4DK3A 2Q1EA 4PJGB 4ISVB 3F8UB 3T08A 5AAWA 3F7YB 5GGSB 2X40A 1EBPA 4MD5A 3EDFA 4F2MA 2CR6A 2P5EE 4IRZL 2UYLB 1MLCB 5DFVD 5C3TA 4I0PD 4KK8C 4P9HH 4LMQE 3BWUC 3R0NA 2J6EL 1XH3B 4HGKC 2P5WE 4AMKL 1J0IA 3T4AA 3TZVB 2DQFB 4WW2A 5H35B 3MR9B 4ZUWA 4GAGL 3BFOA 4KRMB 2ORBH 2X89A 3QIUB 4LLAA 4P57A 4XP5H 4W4OC 5L8KB 2NZ9D 2RAMA 3FRUA 4NNXB 1UM4H 3N06B 4YLQT 4YHZL 2HJLA 4H5SB 3D39D 1MELA 1S7VA 5EOCL 1ZS8B 1Z3GL 4L1HA 1S7WA 1PG7H 3TIDA 2CH8A 4ODTH 4ZO7A 5LAXB 4ONFL 4CVZB 2BOBB 3CPLA 3IAQA 3QFDB 2ZUUA 3WIHH 1CDHA 2D03H 5HVHC 3PL6D 2GTWB 4P48A 1QYGL 3WHXB 4ZNEA 3BOVA 4ZYKA 1KN4L 4JFQA 4R4FH 4CBPA 2UV3A 4F3FB 3GHEL 1FFRA 5E2WL 4M61A 4QHUB 5E4EC 5HYFA 3IAGC 1NCUA 1OLLA 1LILA 3VH8B 4XPFH 2NX5E 1U95B 3D3VE 5E2VL 3SOBL 2ZUXA 2R15A 5KN5B 1JNNH 3DX8B 2M26A 4GMTL 4EKXA 2CIKB 5DZNA 4LLMB 1PGRB 1OOAA 1LMKA 1NFDF 2C3XA 2F8OA 2B1HH 1OT2A 1FRGL 4QRRA 5C0CB 5E6ZA 1F3JA 5I1GL 1DLHB 4Q6IB 1XR8B 4XHJD 5ANMA 5I74B 1RK1B 2DLHA 4FTVB 5BV7C 3NH7L 4HAGA 5FXCH 5C0RL 4NRYB 3MNWA 5EOTB 3TV3H 1AGCB 4OBSA 2R2CA 4OGZA 4H1LH 2NPLX 4IOFD 2ATPB 3WIIL 3TF7C 3I2CL 1OGAB 5B22A 5L0QC 2GIYA 1KXVC 4R9HA 3TJEH 3DO3A 2BJML 5EUKB 3D0VA 4JM2F 1Y6MR 2DOCA 3KS0J 2R23B 4PJHE 2A6IA 3MLXH 1FYTE 1NGZA 2LV4A 1JI1A 3O45B 3QFJD 4OCSH 3QDGE 1NLDL 4H8WC 4LHUB 5DFTA 4NKQB 4YXLL 4JFOA 1OW0A 4NN7B 5KSAB 3D2UD 4G6AC 3VGHA 1F00I 4IRJC 3O81A 4B50A 4MJIA 2DLFL 4LLYA 3LB6D 2DIAA 3I50L 2NY1B 4DFIA 1JF5A 5E8OB 2H8PB 3LD8C 4XXDA 3CFDB 4HH9B 1OPGH 4MA3B 3RGVB 2W92A 1Z5LA 5DJDA 3RA7L 5ISZD 4PJAE 1V7NH 1W0VB 3BMWA 3BQUD 4A6YA 2XT1B 1NBVH 4DN4H 4GMSH 4GRWH 4OFYD 1Q0YH 1M6OA 4Y2DC 4U1GC 1BFOA 4HS6B 3C5SB 1A2YB 3AS2A 5GRWA 1J87A 3UZVB 2P5WB 2FHBA 3LKPA 3SKOB 5DUPH 4C56A 4J8RA 4JZNA 4YE4H 1O5DT 1ZGLB 4KV5E 1CDIA 1MFDL 2H9GA 4X4ME 5IBLC 1EV2E 1LGVA 2AERT 4S1SL 1H0DA 4U6TA 5E8NB 5FDWA 1N4XH 5D2LF 3OJVC 4FG6C 2X4SA 3FCTB 3MX0A 4WV1B 4ZFOA 4M7LH 1BEYH 4P4KD 3EJZD 4KKAC 2OP4L 5J1AB 2GSIA 1U0QA 1U58B 1CS6A 2MKWA 3FJTA 4HK3J 1BJ8A 1LHZA 5J6HB 1R0AL 2FO4B 4HC1L 2ADIB 3H7LA 2YD1A 2FEDD 4UAOC 5DD0L 3G5XA 4LDEB 4JEGB 4E42B 5J6GB 4LLQA 3S35H 2NX5B 4U3CA 3RUGA 3VFMA 5FOBA 1CI5A 1CICC 4U1SA 3RWEA 3KPMB 1DBJH 1IBGH 3V6ZB 3O6FC 3TA3D 1VADA 3GMRA 2JJWA 3RAJL 2HMID 5DWUH 5D72L 3VXOA 1GGCH 2R29L 2APVA 4NHCL 1FFPB 3ZE2E 3FB7B 1ZHNA 5AYUH 3GMQA 3GI9H 2UZXB 3O4LA 4CW1A 1I1AA 1F3DJ 3T3MF 3U4BL 5IKCB 1RUPL 4K23H 1INEH 5CZVL 5EU3B 2JK5B 1WK0A 3CLEL 1EHAA 3TT1H 4MD4A 4O2CA 5CEZD 1P9MA 4LASH 4XMKL 2H26A 1JGEB 3EFFB 4KKBD 3U46A 4MHHI 3TN0D 4LCCC 1OTTD 5EA0L 1KTLA 4P2OD 5DVLA 3NCJL 3HPJB 2GTZA 1YEDA 4NKMA 1AD9B 2VNCA 3BKJH 4FFVD 2RIKA 3ILPA 1PD6A 1LO3L 2P8PB 3HMWH 1J0ZA 2OK0L 3NOIA 4GH7B 3UTSB 5E08L 1OAQL 3NPZB 3QWRA 4EI5D 4KK6D 3NAAL 4PJAB 1FVCB 3FN0L 4JGUA 3QCUH 4JG0L 3EO1B 2VXUL 3UTZA 2HFEA 2H2SC 4NZUH 5E8EB 2MHAB 5DRNB 1HQ4A 4J12A 3S96A 1TVHA 4LDOB 3HB3C 5C0BD 4NZDA 5BV7B 4RQQB 5C0GA 4KMTL 3HNTH 5ID1A 2XPGA 4LP5A 5IFAL 2X9YA 4Q0XL 2V9RA 4XMPL 3GB7A 3ARFA 3PDOA 2LFGA 1WC7A 4YBQD 4D3CL 3S36L 2W9DL 1A6UL 3NIGF 2F5BH 1MCQA 4LARH 5K93A 3PGFH 4GRMA 1DANT 2FGZA 4ELKA 2EXYD 4D9RD 4ZO6A 4BSVB 4YBLC 3VG9B 3U7YL 4RMVA 3WIHA 1A1NA 1EUTA 1EHLL 4PYHA 2EXWD 4LCYA 4HKBA 3VXUE 4PRBA 3RJDA 4LIQL 3EDKA 3IJYA 5D5MF 2VISA 1KG0B 3LSOA 1LO4L 2R56L 3WJJC 2FX8L 3OKNB 1QFHA 1WTLA 3C6LD 2Q20A 5DHVA 5K9OA 4OFIA 3H42L 5F1NB 2NXYD 3AS3A 5EZJB 1ZT7A 5DJCB 4HEME 1I8MA 2X1QA 5IGXH 1QBAA 1UJTA 4F58H 3SQOL 1Z2KA 1RUMH 1FZMB 4AEIH 5T5FL 4QRQA 3U0TA 2HRPL 2ESVE 4GQPH 4HHAA 1RIUL 2IGFL 4U1GB 2YUVA 3MODL 2YBRA 4L8DA 3F5WA 1NCDH 5LG1A 3KPTA 2P24A 4H1LA 3CLFL 2BMKB 4K3JH 3GSNB 1HCVA 2YWYA 3MV9D 5IB2A 5MEQB 1AJ7L 3FT4B 5C09E 1ZANL 4KUZH 4YHKH 4YDJB 3JV0A 3O3DA 5IMKA 2H2PC 2VKWA 5E6YA 1H5BC 3VFVA 2VSCA 3EZ8A 3CVIL 3ESVF 2EEDA 4KJYB 3VXMD 1NC2B 2A74A 2XKNB 4JFPA 3C60C 2C4FU 2X4NB 1FFNB 4NM4H 3OQ3B 4ZTPH 4NM8H 1DQJA 1XGUB 3G5VB 2BVPA 2F53E 5HD8C 4OIIL 5HI3C 3GSXA 2DIJA 3A6BH 1SYSA 4OD3L 5I1DB 4EXKA 1UXWB 1UWGH 5H8DA 2FBOJ 3F7PC 3IFNH 4KK5D 2AJXL 1NEZG 2MQ0A 5FUOL 1MFCH 1RZFH 4EUPG 2BSTB 4UAOB 1B0RA 4NQDB 3D0LB 2QHRH 1JF1A 1P4LA 1CICB 3QJHA 1S9VB 4RDQF 5A2IH 1R3IH 3N9GL 4WNQB 3KYOA 1T0NA 3O6FB 5D1XD 4EXPX 3C2SA 3CFIC 1JGDB 3EYQC 4FFWD 4G9DA 4UUJA 2MOVA 1MCWW 4KZDL 1I1YA 4YDKH 1C1EH 1I3GL 1MCDA 4KFZC 1A02N 1CDJA 3AAZB 3RY6C 3RWFA 1IGJB 5ILTH 3T0VA 1JFQL 4ALAL 1J5OL 3MV7B 1S78D 5L2KB 4MNGB 4HG4J 1U2CA 1B6UA 5EUOA 2DQEH 3CK0L 5D1ZD 3TT3H 1I9JL 1UH4A 4DVBB 3ARGD 3CDCA 1V7MH 2XZAL 3WFHB 4DFHA 4C83B 3OGCB 3IRPX 5CEZL 3F62A 3NMEA 4C58B 3CDFA 4BA8A 3V95A 3V4PH 1NGXB 2VERN 4LCCB 3QQ4A 3IJSA 3VXUB 5D7IA 5I1EH 4X4YA 3QAZB 4JJ5B 4G7VL 4XH2A 1Q9WA 3LIZH 5CZXD 2BNQD 1IT9H 2DMCA 3MRLA 5KVMC 1QVOB 3C5ZD 3QUKB 2OTWA 4JM4H 3TBYB 4WUUE 1MIEH 1MJ8H 1U3JA 2CXGA 3EJYC 3T04D 1RMFH 3S34H 2OR8A 1QR1B 4YHIA 3NCYS 4OZFH 3PWPD 3PWVA 2JF1A 1WUNT 2X5PA 2ESVB 5AWNL 2VDML 4WY7L 1N64L 1BQSA 4XCNB 4DCQB 2PR4H 3LKQA 4GKNA 1QFUH 5I0DA 4LNVA 4MA8H 4U1NA 4HW6A 4ORZC 2PYFA 4HDIA 3WDIA 2AK4A 2GAZA 3GSRA 2BSRB 2MSPA 4XI5D 1UJ3C 4PJIE 4MXWL 1JNHA 5C09B 1K4CB 3QDJA 4OFKA 1HYSC 5FK9B 1ZA6A 1UXSA 4FFYL 1A5FH 1XGRB 1PX3A 2LVCA 2O61B 1KLGB 2N7BA 4QOKA 3L3KB 3G6JE 1JN6B 3JWDC 3DIFB 4P46D 4MQXC 2V9QA 1CFSB 4BFGA 3FMGL 1T3FA 3NACL 4DZBA 4KAQH 3LEVH 2ZSWB 2DLEA 3ARDC 5ACZB 5HYJD 4WU7A 2HTKC 3KLDA 4KQ4L 4TUJA 2BCKA 4ZAKD 3EYUL 3L9RA 1R3HA 3P40A 4ERSH 4UIMB 1GGUA 1SBSL 3H9ZA 3D5OF 1P1ZA 5GGSA 4F8QA 5IW1B 5AD0B 2YPLA 2Q7YA 4LMQI 3GEWB 1S7UB 4JO3H 4B7LA 1CFBA 43C9A 1ZLSH 1QSVA 5E2JA 3RGHA 4YNYB 3BDBA 3QRGL 2AJ3B 5DD3H 4OT1H 3TZVA 3MR9A 5SX5H 3UC0L 4XX1E 4N0UE 2I27N 4Z7WA 3QIUA 3SDAD 3M17B 4OGYH 4QWWD 1K8IB 5C8JB 5B3JE 3DURA 4JB9L 4FQXD 4E41D 1WBZB 4R2GB 2AP2A 3LN4B 3P0YL 3U2SB 3Q6FB 1H5BB 2D4FA 3GMLA 1MCNA 5DMIL 4CMMB 5DEGB 1UYWH 1OTUC 4HKJB 3VDBA 3SGDI 1Z0NA 3C60B 5HYSB 3ULVC 1Q1JH 2IFFH 4XGZA 4IJ3C 4PGEA 4XCYB 1I8IB 1F4XH 2OTUB 1AXSB 5DDHA 4MYWB 1MQ8A 3VXSE 4R0LA 3CX2A 1JZ6A 2EDXA 3KYKH 1G6RL 1MRCL 4PJ8D 1KTRL 4WUUB 2FL5B 3VH8A 1XCQB 4NKDB 2VZVA 4OZHB 5D6CA 4V1DD 1U95A 1T89C 2DMBA 1T4KA 2A6DB 3NABL 3PQYE 3TVMC 1UVQB 4P5TA 1N5YL 5IMOA 4LLMA 3IFOB 4LOUC 5D7JA 5DEFA 5D1QC 1M7IA 3K2UH 1RZ7L 4WENB 1XR8A 2XRAL 3HE7D 2VL5B 3FZUD 4NUJA 4PYGA 2E7HA 1WITA 3L5WB 4X7EC 3OBAA 1WIPA 2IMNA 5FA3B 4JFFB 4U6XA 4PRNA 3Q0HA 2AVGA 1ND0B 5FYJU 1A4KA 2XTJD 3OAUH 4PJIB 3DUSA 1NDMA 2CGRL 2ERJC 1F5WA 4DUVA 1U6AH 3BESR 3O11B 4GKZB 1NC4B 4N1CA 3JTTB 2GJZA 4NHUB 3MJ9L 2PO6D 2EDFA 4OCNC 4JFXA 3SGEH 1OTSC 2PXYD 2KBGA 2CJUL 5I76A 3GIZL 3FB8A 4PP1C 4OI8A 3ULVE 4BJLA 4G6JH 2EDDA 1MI5A 4TNVK 1JHTB 3T0ED 4MAYC 2OM5A 1UKSA 3FOMB 5F44A 1HILA 1QNZH 4PG2C 3NCCB 5T1MB 2ZZUT 1BREA 4NJAL 3UO1H 4AK1A 1IKNA 2YMXL 3BGMA 5I1KL 3FO2A 1U3HA 2VDRH 2OI9B 4PTUB 2VDQL 3LAFA 3QHFH 1KN2H 3RRQA 3GMOA 1DQQA 1RZJL 2BHYA 1MHCA 2P5EA 5CGYD 1J7VR 4LKCB 1UC6A 1HINH 5F7HA 1FG2A 5I1JH 5IESL 4PRIB 4YZFE 3VFGH 4R4BA 3T2NH 1KJVB 4EDXB 4NPYA 3T0AA 1Q0XL 5EIIB 5CCKL 4Y1AD 3SKOA 3MPCA 3BIAX 4L5FL 3MGOB 5KJRH 4XZUA 2XFXA 1UJ3B 5B4MC 5EN2A 4JKWA 3WO3B 5JHDB 4BFIB 1AIFA 4X6DE 4NWUH 1FDLH 3NZ8B 4ETQB 2BVOA 4YBHA 4B5EA 4TULL 1F2XK 1U8OB 4M6ML 4ZUUB 1HHIB 4DGIL 4U6YB 4LNRA 3WDHA 1JPGA 1G7JB 2G2RA 3FQNB 1UQSA 3FO9B 2ATKA 1MFEH 2VXQH 4D0DA 3WJLA 4UILL 5J13C 5I1CH 5SWZE 5DJZB 2VDOL 1U58A 3OTTA 1RI8A 3GZKA 3IXTA 3HUJF 3FB6B 1R5VB 1IEAB 1U9KA 3LS5L 4OSUL 4XWOD 3VD3A 1BPVA 4F57H 1QSEE 3ARDB 3VXSB 2IADB 1D6EB 2FYYB 2ADIA 5DLMH 1CK0H 5J12C 1WBYA 4OZFA 4MGXA 2H3NB 5HGAB 2NX5A 1MRDH 5AUMA 3D3VA 5GS0C 4FQ2L 4P23C 5KTEL 1B90A 1ETZA 3PQYB 3VA6A 3KPMA 3QA3B 3O4OB 3L95B 1S7TB 4ODSL 3AB0C 1KJ2B 4QRSB 5HHPA 4AH2B 5H94A 4JRYD 1ACYH 1IAKA 2JIXD 4MQTB 5TQ0L 2ZUTA 3CSBA 1OARL 1AH1A 4YO0A 4PS4L 5EC1B 2Z31B 1RJYB 2FIKA 1YN7A 4JDZA 1L9MA 4XPGL 5CJOH 3DBXA 1X6LA 5DI8B 5T1KD 3KWWA 2JCCF 4IM8A 2CSPA 5FKAA 2GITA 1FAIH 4X99B 5FV2A 4JKKA 2C3VA 2YA1A 4XP6L 4QTHA 1CE1L 1FLRL 4ODXB 5IBTH 1G7LA 2JK5A 1NMCC 1T80A 4LCWE 1P4BH 2WIIB 4KI5D 4PJHA 1FYTA 5INDA 3MA9L 5E03A 5HGDB 1RUQL 1JGEA 1TJIL 4NOFA 4XPAH 3EFFA 2OL3L 3QDGA 3CCHB 4M48L 3TNNB 3T3PF 2L7UA 1PLGL 4IJ3B 3HZVA 3BWAA 3EOAB 4WUKH 3MBXL 3MV8B 1AY1L 4H88L 1K6QH 3MRDB 3N85H 4M43H 5JW3L 3DSFH 3MJ7B 5DD1H 1OD7A 1GGTA 2P8PA 4LF3B 4WFFD 4M5YH 4X83A 5JDSB 1SEBB 2NY5C 3BSZL 3MGAA 4JN2A 4YAQA 3JXAA 5BMFL 3ES6A 2Z4QA 4A2MA 4PJAA 4XVJH 1VDGA 1TVBB 2WWMC 1TETL 4Y4HC 3MTRA 5CEYB 3TVMB 4HF5L 4DN3L 5HHOA 3SE8H 4HT1H 1G9NL 1YPZF 4MQ7A 3KPNB 4BK4A 4XAWH 5JOPE 2FEEL 4CNIA 5D1QB 3O0RL 3IDNA 3CDGB 4PD4K 2EDTA 3BISA 1D5ZA 1N8ZB 2VUOA 3OAYK 5E9DE 4YQXL 1KENL 4RQQA 3S37H 3OF6D 5JZ7C 5DJAB 2Y6SD 2A6KA 4LSRH 2ERJB 4KKNA 4X4MA 2V7NA 5HHMB 1I7TA 2RHEA 3CVHL 3QULB 2DQGL 3WHE1 1QSFB 5C0ND 3BGAA 2WIMA 5T3XH 3CSPA 5TF0A 4PRHD 5HPMA 1BAFH 2A6JB 4OLVL 3FQRA 3PWUB 3IKCA 5IG7A 4CDGC 1WSST 5F89B 3A6CH 4NCDA 4G43B 2PYEE 1QPXA 4IRJA 5IP4A 2HKFL 4JR9L 4MAYB 5I73C 4HUNB 3PABA 5FYLH 3UYRH 2XXCB 4H26B 1T5WB 1SEQL 4H0GA 1OAUH 3O6ML 5D71L 1UM5H 5BRZB 5FB8B 5EU4B 3WUWG 2FBJH 1JPTL 4DOHE 3OKMB 1M71B 3PGCA 4Y4FD 3SJVB 3NN8B 4M1DH 2OXHA 2P8MA 4WFED 4Y2DA 3VFTA 2AJVH 3DX6A 3DVFA 3GK8H 3NFNB 1XIWC 3MRGB 1YEIH 3MXVH 1CFNB 2D4DA 5AZ2L 2C3HA 5I71B 4Y8DC 4KXZH 3L3HB 4ZUVB 4EVNB 5A2FA 4QYOB 1GPOL 1KGCD 2IALA 4Y5YC 4CVWA 2RQ8A 3RNQA 1DBKH 1MREL 4XCEA 4QHNB 1DZBA 3UROR 1JHLL 4LCWB 3REVB 3VXRB 1T20A 5GGVL 3SKMA 1MWAB 3INUL 5GZOD 1RUAL 1FFNA 2NR6C 3DVNB 1QBLL 4FQ1L 5C6TH 5HYQB 5M7QA 5TGBB 5E24E 1J1PH 3QUZC 5BS0E 5J13B 2ZOKA 1UXWA 1NFDB 2BFVL 1LVEA 1D5MB 5IMLB 2O93L 1VFBB 2E9WA 1V05A 1OP9A 4FXKA 2VXTL 5J12B 1RFDL 2FZ3A 1NCBH 3TO2B 1HHHB 5T5NG 4P23B 1I8KA 2DBLL 5IW6B 1OSZB 2AI0H 3C6SA 2WUBL 4KH2A 1JI2A 4KK9D 1T5XB 2C1PA 3B83A 5E5MB 3AB0B 3K74B 2QSTA 3O6FA 3OG6B 4O9HH 4RFOH 3DROA 4JM2B 5ITFA 5KSVB 4N0CC 2OR7A 1B2WL 2VLRA 5E9DB 3MJ8B 4X6EA 1OF2A 5CWSA 3V5KA 4F7TA 1RZGB 3JTSA 3HI6L 4DUWA 2QJDA 2W9LA 2YD4A 3M07A 4QT5A 3KPSB 5C07B 1JCKA 1L9NA 2HJKB 4HUWB 35C8H 1T6VN 1VFOA 3QWOA 4LL9A 5F3HA 5HHQB 4HZLA 2X70B 1JGVL 1NMCB 4OV6F 1A14L 4G42B 4XPHL 4XP1L 5C0AE 3WFDH 4NSKA 1F4YL 1NQBA 1A9BA 2P4AB 3ARWA 4HIJB 4NZTH 1G6VK 2MCG1 4GRLD 2GKIA 5ID0A 5LGHL 4LU5L 1KT2A 1NEUA 1YUHB 5TJWK 1YEHH 2I07B 1L0YA 2XZZA 3H9SD 2PYEB 1OGTB 2WNGA 4Z76B 4U6HB 4NUGH 2A9NH 2GCYB 5ACLA 1GOGA 2WP3T 1A7NL 3IDYC 3U82B 1INQB 4GW4A 4I3GA 3GJFK 4JQVA 5F1OB 3EYFA 1CIDA 1HKLH 1A6TB 1KCLA 4NQCE 4I0PC 4TQEH 2C5DC 3K1KC 1QFWI 4OV5A 4Y4HB 3X17A 3ARBD 1EVTC 3NIGE 1BZ9B 1VEOA 3IJHB 2EDKA 4FFZH 1NBYA 4PTTA 1ZVSA 1MHHA 1IC1A 2QEJA 4XPBL 4E5XB 1VGKA 1HXMB 3TNMB 5D2LB 4KTEL 1GL4B 2BNRE 3QG7H 2IAMD 2KQNA 1KYOK 4OLUH 1DLFL 1MLBA 4KHXL 2UZIL 3QXDA 5D5ME 3DWTA 3VG0L 1D6VH 3NFSL 1G0XA 3EIFA 2ED7A 1WZ1H 1EAPA 5ERWB 3PL6C 5DJ8A 1O7VA 2DYPB 3BN9C 5T3ZH 3AMKA 2ZUWA 3L3KA 5I30H 1VCAA 2B4CL 4XRCA 2IMMA 2F53A 3B43A 3T4YA 5BS0B 4M62H 4WI5A 2V5YA 1I9RL 4KKLD 4M6NL 1AHWA 5I73B 2OK0H 1GC1H 1EGJH 3MC0A 2G60L 1XGPB 1EAJA 2VITA 4F7PB 3VFPB 2DQHL 4JKPL 2J5LC 4W4NA 4F7MA 1VESA 2Y23A 3FKUS 1LNUA 4X80H 1FORH 1AQDB 3N1MC 5BW7C 1BBDH 1G9ML 2J2ZA 3MRQB 4Y19D 3QDMD 3CZJA 3QO0B 3P4OB 1PKQE 2NY7H 2YKLH 4IOFC 1DCLA 4JFZH 4YH6A 1XIWB 2Y9RT 5BO1H 2QKIB 1GOHA 2FSEB 5IT2H 5AEAA 5HTSA 5ESVB 3L6FB 3N1FC 4URTB 3LDBB 3D39E 1H8NA 2NZIA 1IQDA 3P0VL 3AM8A 1F8TH 4DKAA 3KHQA 4WI2A 4Y5YB 2IH3A 1D5IL 3LOWA 4XCFH 3H0TB 1F3RB 2W91A 3AMLA 1Q8MA 3U2SA 4HPYH 3T8XA 3Q6FA 5EPMA 4EUPH 4S1QH 3VI3E 3QXAB 5INCA 3D9AL 2VYRE 1PY9A 2K9UA 3HNSH 5E1HB 3IETB 5EG6C 4CMMA 3W82A 4NDMA 3ROLA 5C0AB 3T1WA 4PRDB 3LB6C 4M7JL 1Z6JT 5F1SA 3LV3A 3WNNA 3JWOL 4I9WE 1KB5B 1QRND 3B5GA 1RAMA 1RHFA 5J4MA 3QUZB 5CD5D 2VDKL 4RRPA 2F54A 3V6FA 5TE4L 1OM3H 1DN0B 5EC2A 3J7HA 3VMNA 1OSPL 2MCPH 5HHXL 3RU8L 1P7QB 1ZVHA 4NQCB 4ZS7H 4N90D 1Q94B 1YJDL 3DX7B 1HNGA 1MEXH 2A6DA 4ZXBA 2DS4A 1IC4L 2WMPA 1DVFB 4BH8A 5T33H 1YMMD 1T2JA 2LVEA 5DQ9B 1B0GB 5FUZL 3OGOE 5T1LD 2EIZA 2DAVA 4M5ZH 2VL5A 3PG2A 3LHPH 1NLBL 3C2AL 2QSVA 3FB5A 2LTQC 4Z77B 5JIPA 5IQ7H 1IKFL 2YD2A 3X3FH 1BD2D 3SDCD 2BNRB 2BHUA 3KPPA 3MYJB 1KTKE 2RBLA 5L7XL 4PJIA 2E7LA 2QQNH 4LGSB 5D5MB 1NGYB 3QFJE 3MLYH 3MCLH 2IBZX 1IM3B 3ARZA 3QPQD 4XP9H 3HR5A 4HIEA 3EJZC 3MZTA 3A0OA 4YXHL 1QBML 4CMHC 2CKBL 3MRKA 1Z9LA 3G6JA 1CLOH 5GSVA 2EIDA 5MP6L 1NGPH 3LKOA 4FABH 1ZHKA 1U8HB 3JUZA 4OM1H 3NIFF 1KCSH 1JHTA 4X6BA 3S9DB 2D0GA 4YDVB 5ISZE 3UJIL 5EOQH 5H2BA 4ORGB 3IDYB 5LCVH 3LKRA 4MDJA 5I8KL 1AGEA 1B4RA 4NQED 4I0PB 4PTUA 3QI9D 1RD6A 1NFIA 3WLBB 5DJ0B 2HMIC 4XVSL 1H3TA 3EO0A 2VDPL 3EZJB 2FWOB 1Q9OA 1I4FB 1QLEL 5TF1H 2ILLA 4Z5RB 1FBIL 4JFDB 1YQ2A 1PKQB 3BKML 4R97C 4MNQB 5ADPH 3CXHK 5LGJA 5FDYA 3W81A 3BIKB 1Z0MA 2B0SL 2HLFC 5CIPB 5I8OH 3DSNA 4OAWA 2PTVA 5GRZA 4R90L 4N0UA 3L3DB 4PLNC 1FGNL 3D39B 3RPKA 2GW5A 1T03H 4Z7UF 4NNPL 4UT7L 1UT9A 4PJ7E 5F3BA 1NUDA 4K3DL 5HI5D 3QIWD 3TN0C 5KSUB 1OTTC 4G5ZL 5DA4A 5L88L 4X8JB 1C5CL 1HOCB 2QBWA 2LQRA 2WUCL 2EH7H 1FPTL 5DUML 3O3BA 1XGYH 2CDFB 1C8PA 5DK2B 5DJZA 5DQDH 4YWGL 4EQ2A 1FN4A 4JY5L 1G0YR 2Q76A 3VXPB 1YECH 3PJSB 2AEIT 1H3UA 3MBEA 1E4KC 3MMEA 1V3KA 1DSFH 4TSBL 1RIHL 1XF4A 3BUYB 4IRSA 2K7QA 3RVUD 12E8H 3DV4A 4Z95L 2J5LB 2OMNA 1UEMA 4QRUA 2EDEA 1FNLA 1E6OL 4YX2L 3VFSB 1EBAA 1WIUA 1MHEA 3QA3A 4OTXL 4W70A 3AC0A 4IRZH 1RY7B 1L6XA 4PP2A 1KJ2A 5A3IC 3KHOA 2CIIA 3KPLA 3X12A 2J6EH 5AYQA 1XF2A 4FQCL 3F65A 2CLZA 3BH8B 4HK3N 4EN3C 4YBQC 4S1DD 5FM5O 1OP5K 5MENA 2EC8A 3SE3A 4GAGH 4LSQL 1DUZA 4ZQKA 1HDMA 5DVMA 4XNXL 2EXYC 2HTLD 2F74B 4KJPD 7FABL 3QQ3B 4YHZH 5IBUB 3UTOA 4TNVF 3QFJB 5EOCH 4KVNL 4X5XA 3QIBC 2JJVA 1JRHL 4O58H 5E99L 3SPVB 3MA7B 4X0KB 1JVKA 4JPWL 2A38A 3G9AB 1AO7E 2V5MA 4H0HB 4OD1L 2X4OB 4QHLA 3M8OH 5DT1L 4CN6A 1EGJA 3C6LC 4MNHB 1QYGH 4UDTA 3DRTA 4ZOBA 1KN4H 4X98B 3UX9B 3E8UH 3GHEH 5F8QC 4L8CB 1XCTA 5E2WH 2HG5A 4G6ML 4JDTL 5FGSA 5JDSA 1MFNA 4OZ4A 4RMSA 1NMAH 1DQDL 4MZ3A 3SOBH 4HXAH 1I7RA 1NAKL 4MXVF 3EYSL 2F19L 4I48B 4WJ5B 4QEGA 5EBMA 3TVMA 5KZCB 1K85A 4MCZA 2IBGA 4ODVL 5C0BE 3BYYA 2VQTA 1BQLL 3RDTD 5I1GH 4P2RB 4PY8J 4GS7C 4GJTB 4L8BB 3D87B 1T1WA 5F7MC 2IQ9L 4UOJA 5C0RH 4MA7L 2YEZB 1DQLL 2LTQB 5IB4B 3SDXE 5E2UL 4HBCH 3WIIH 1NEZA 3I2CH 2EDWA 2DLGA 1LD9A 1PFCA 4M7KL 4D9RE 2VE6A 4P5MA 4X6DA 2R8SL 3D85B 1PBYA 4NN5C 4G7YH 1AXTL 3LKNB 4IOSD 3QUML 4NCC1 4U1JB 1NLDH 4JY6B 3VI4F 3LN5A 4YXLH 2R0LH 4LSPH 3ZDXF 3U6RA 3BKCL 5SWZA 1EUUA 2DLFH 4OF8A 2GQHA 1F2QA 3WNLA 1TZIA 4JAMB 3I50H 4LP4A 1QSEA 1ORQB 2A73A 4ZPTA 5C0CD 5IHZA 3K4AA 5JDJA 3VRJA 1NJ9B 3SCMA 4NRZA 4QRPB 2JJUA 1AGFB 4FTVD 3RA7H 5DHYB 1IQWH 1NCWL 1J0JA 1N5AA 4E9LA 5CJ5A 1QHOA 5GISL 4JFED 4AJ0A 5HY9B 2VR9A 4AQ1B 2A0LD 3NN8A 3WXWL 1F4WH 4OB5L 4F9LA 5LXGL 4IDJL 4CU6A 3NFNA 4R97B 4PV9B 3MV9E 1W72L 4D0CB 2DKMA 1LEIB 4X9GA 3B9EA 2R0KL 2AS5M 3ARGC 5EO1B 1W0YT 4LHUD 1MJJB 1OY3B 1U92B 3EOYG 3ZSSA 3P77A 3LQAC 4M6OL 5KSAD 2O5ZL 1MFDH 5DJYB 4NQXB 2XNAB 3QUXD 4GXVL 3VXME 4TUOB 4P49A 4HIXL 2FJHB 3MQIA 3TN0B 3MROB 2NY1D 4HMCA 3W9EB 4F33B 2AK1L 1D5XA 2CUMA 3O2DL 3UTTB 1B0WA 3B9DA 3P4NB 4ZD3L 2DN7A 2EDYA 1JTPA 1MCPH 15C8L 5CZXC 4J3UA 3RGVD 1AO7B 5IJKC 1NGQL 2JB5L 4M8QA 3C5ZC 2CMRL 5TGBA 4ESKA 1GZPA 3FO0H 2AV1A 1R0AH 2M2DA 4R8WL 2GFBA 2R2HA 2MJWA 4B41A 2ZKHH 4YHPB 5DD0H 1RZJC 5DMGD 5BJTB 5IHLB 4NZJA 2OX5A 1MCWM 5IROC 4OZGF 3SE4A 2JCCE 3VGDA 4GW1B 1T5XA 1NCAL 1RK0B 3P9MB 3RAJH 5GSRB 4M93C 4XI5C 3VFNA 5D72H 2EC9U 4MXQC 2W9EL 2R29H 3W11D 4EN3B 4NHCH 1PDKA 5E9DA 1MH5B 3SQBA 3QXWA 5IJVB 2FR4B 3QEQD 3FFDB 3U4BH 4KI1A 5ENWB 1RUPH 5IB3B 3IDGA 3WS3B 4R3SB 1FVDA 4L29B 2EYRA 3GHBL 4RGND 3ZKQD 3CLEH 1QA9A 4KPHH 3QIBB 1ZWIB 2BX5A 2DMKA 5T5NF 4XMKH 4FXLA 1TENA 4U1KA 5I8CB 1Y6KR 1J0KA 3M1BB 3BP7B 1YY9C 2ZG3A 3BX7C 3QXVA 4YIQB 4EIGB 5J8OA 1WVZA 2DWDA 2BNQE 1ADQL 1MCFA 1UFUA 3NCJH 5HVGB 3MXWL 5HGHA 4X6CA 2OSLB 1MVUA 5IEHB 5J3HC 2UVEA 3L3OA 4U6HA 2GCYA 1AI1L 4OQTL 2VLLA 1C7SA 1R5WB 4ZG1A 2IQAA 2MMXA 5E08H 3MJ6A 1OAQH 3PWPE 1INQA 4HFWB 4JQIL 5I16B 5A16B 4PG9A 4Y5VA 2RCSL 3VXTB 5CAYB 4JG0H 2BP3A 2XZQL 5MHSD 2VXUH 3UTQB 1L0QA 2J6EA 1CFTB 2COQA 1KV3A 1UG9A 1T04A 3QH3A 1KEML 3RY4A 4Z78A 4DW2H 4EIZC 4UTAH 4CU7A 3MV9B 1S5IL 1NAMH 3DETD 4EQ3A 4BFBD 2BHZA 4Q0XH 4XMPH 4GUPB 3F7QA 3EDDA 2ZSVA 4D3CH 1MCLA 4PFEA 3S36H 2W9DH 4X4XA 4EEEA 1N6VA 4Z7OF 3PWJA 3CNKA 5JNYB 3UJJL 5DC9B 5JQ6L 1SM3L 3OWEA 4NN5B 3HS0B 5IV2B 1RZKH 2GK2A 4XCCL 3U7YH 4JANB 2VLJD 1EHLH 3UTSD 4BH7B 4KQ3L 4ZFGL 5FKPA 4YEEA 4FQLL 4DZ8A 5HYJE 1U8KA 2WBJD 2MNUA 1P2CB 3B9KA 4LIQH 5CFHA 4MB4A 3GBLA 2FX8H 3HFML 4GAYB 1TCRB 1B4JL 1LO5A 5EBLB 4F7PA 4UDUA 2FHCA 2IC2A 4OBRA 5IF0A 2DQDL 2BXZA 4LSVL 4AQOA 4CRPA 2GUOB 1MCJA 1CYGA 3OAYH 4ELME 3SQOH 5ICXA 3JUYA 1UGNA 2JCCB 3NPSC 4Q2ZA 3HE7C 1A3LL 3I3EA 1NDGB 2HRPH 2VH5L 1RIUH 2IGFH 4FNLL 3HI1B 4X7TA 4E0RB 4NGHL 4U1IB 1DE4B 3RVXD 3U0WH 5C92A 3OZ9L 4Z0XB 4AM0B 2AQ1A 3P4LA 1J18A 3E6FB 1XIWA 2XTJC 1TFHA 5C70A 3RHWK 3ARGB 1A8JH 1BMGA 4E41E 4Y4KA 1E4XL 2PO6C 4CVUA 1AJ7H 1B3JA 5DYOA 4K7PH 2YC1A 2CO7B 1ZANH 1DEDA 2DBJA 1M7DA 3WXVL 4MD0A 4PJDE 5FV1L 3QXAA 2VXVL 1FE8L 2IG2H 2DWEB 2BVQB 2ARWA 5IK3A 3HR6A 1JHKL 4C55A 3BP4A 1FH5L 1HHJA 4LFHG 4RISH 3RY5A 1U8PB 2BC4A 1RULL 2QQQA 3F6LA 4DEPC 1YDPB 4ZTOL 4OD3H 2AKRA 1YPZB 3K4DA 2D31B 5FCUL 4KDWA 1DN0A 1G1YA 4V1DE 2AJXH 1BOGB 4XMLH 5E8PB 5FUOH 5JW4Q 5CGYC 4AYFA 4PJ9A 4NQCA 5C08D 1Q94A 3RKDD 3DX7A 5DGRA 4FHBD 3THML 2D0FA 2UWEA 3QQNA 5KSBF 3GRWL 3HZYB 3N9GH 4JLRA 2VABA 4MS8D 5IBLD 1PEWA 3L3IB 4KZDH 1I3GH 4JO1L 4YHLL 4M93B 5E1AB 2XTJE 2X4PB 1GXEA 4Z77A 4ALAH 3LRGA 1J5OH 1NC2D 5DJXB 4FG6D 2BNRA 1HQRA 4JHWL 4LLWB 3CK0H 1I9JH 4LK4A 8FABA 4KKAD 1ROWA 1RJLA 4GKSB 1Q72H 2XZAH 1SMAA 3ZYIA 1IAMA 2H32B 4L9LC 2YR3A 3GNML 2B7DT 5CEZH 3T77B 4BSWB 3K8KA 3DLQR 3OJDA 2Y5TB 1BBJB 4LCUA 4TTGA 2BXYA 3T0EE 2VWEC 4XWOC 2AGJH 5E94A 5CS7A 1M05A 3OG4B 4NQDD 1I85C 2FO1A 4NQVA 3KVQA 4HC1A 1CICD 3AXLA 4GQ9L 2DQIL 3DV6B 4DTGL 4UQ2B 4ORGA 5CJQL 3Q3GB 4S1RL 4H20H 5IOPA 3ALWA 1T1YA 3FOLA 25C8L 1NL0L 1HKFA 1YNKL 2ITCB 2ITDB 3MV7D 5L2KD 1A1OB 3RWHB 3WD5L 5IR1B 5KOMC 3PXHA 4RBPK 2XQBH 5K9KB 1I4FA 5AWNH 2VDMH 3O3UN 1N64H 4HWBL 4WY7H 4Y1AE 5DJ6B 3DYPA 2DQUL 3P9WB 2RJMA 4U6VH 1I3RA 4XVTL 1A7PL 5DD6A 1JV5B 1VEMA 1RUKL 1IFHL 1QPPA 4E41B 5KVFL 3I6GB 5IVXE 4MXWH 5K9JH 2QSCH 3VXUD 2E9JA 4QXGL 2YXFA 4IS6B 3R4DA 1GGIL 4JQXA 4FFYH 2ADJB 4PJDB 3VWKB 1RU9L 1ITCA 3ZMRA 3PL6A 1XF5B 1F13A 5A1AA 2VWEE 2Y25A 1EFXB 3GJFH 1EVUA 1XZ0B 2C1OB 5KW9L 1DEEA 1WZMA 3K3QA 4NFBA 3FQUA 4IHOB 4RMWA 3BJLA 2XN9B 2H2SD 3O9WC 1S9KC 1GGBH 2ESVD 3BEVB 3K1DA 1FP5A 3CMOL 4J4PC 5DGQA 3QEGL 3RVVC 4O5LH 1QQDA 4N9GB 1N3NA 3MRBB 5JTWA 3HB3D 4LEOA 3IXAA 5CSGA 2IANB 1SBSH 4JRYE 3GKWL 3NPSB 3HE7B 5C09D 4K7FA 1KLFA 4MJ4A 3SDDD 4N8VB 1U8JB 5IHUL 2ICWA 1DL7L 5JHLL 4CDHA 4PY8I 3A67L 3ALPA 1NCNA 3UC0H 4GBXC 3W5NA 1G7QA 2EDQA 3CVHB 5IVOA 2PO6B 4H8WL 4F9PC 3S3JA 3OPZH 4KI5E 4OLZL 1AGBB 5I1LB 3P0YH 1J12A 3QFJA 3WUWA 2B4CC 4LLVB 3WFEL 1S9YA 5DMIH 3SPVA 4EBQL 3D2UA 2YK1L 5JO5B 4NO3A 1X44A 1YYML 3FL7A 3MRJB 2CXKA 3HLAB 3W0WB 5LVEA 6CGTA 4G8IA 4M7LT 4RAUB 2PCPB 3JV6A 3H9HB 4WFFE 5J89A 3O2VL 2B2XH 4LKXB 4WWKC 5BQ7A 1X9QA 4DEPB 3HE6A 4OKDA 4HUXA 3C08H 5IFJA 5ISZA 3KGRA 3Q1SL 2DJ4A 4Z9KB 1G6RH 1MRCH 4YC2C 3BQUA 2E8ZA 3KYNA 5JOFA 1G7PB 1MCSA 4O2FB 3BPNC 3C5JB 1C7TA 1I8LC 4Y4FC 1VACB 2D7OA 4KRPC 3NABH 4X5WA 4OFYA 3WIFB 1LP9E 1NANI 4PJCF 3GSNL 1N5YH 3EJJX 4I48A 2BK8A 5DK3A 4CUCA 3O8XD 3AY4C 5FO7B 4HWZA 3UMTA 1RZ7H 4R2GD 1LWRA 3N0PB 4YHNA 1M4KA 2XRAH 5E6IB 2H2PD 2YRLA 5I1HL 1BZ7A 1EJ6A 1N2RB 2YEZA 5F96L 3RPIB 5FO8B 2Z91B 2VXSH 4PJFE 4H1LG 3C60D 2CGRH 3IAPA 3TYFA 2R1WB 1KIQA 4PJ7A 3C9NA 5HD8D 5HI3D 3MJ9H 1C5BL 4PRHE 5GZOC 4RMRA 3EHBD 4X6FA 1K4DA 4L9LB 2CJUH 3W5MA 4P4KA 5ESQA 3RWIB 1A3RH 4WUUD 2FX9L 1HXYB 2OYPA 3OJ2C 5CHNB 4UU9B 2HVKA 3SY0A 5F7KC 3ZKMC 3FFCD 2OJEA 2BY0A 3SO5A 4PGBB 3QZWA 1MFBL 3BPCB 5C7XL 3ULUF 5KS9A 4C56D 1AKJB 3FONB 3SDYL 2ZPKL 5J06A 1BQUA 2R9HC 4DKFL 3QBTB 5TDPA 3WS6C 2CO6B 3BP5B 4KK9C 1C16B 3WKML 5I1KH 1ZT1A 2W0FA 3TA3A 2VDQH 1TDQA 4G8FA 5D93C 4JRYB 1HH9B 4WFEE 2JIXB 1YN6A 4JFFD 3DXAB 2OJZL 1GAFL 4Z7UE 5FA4B 1FL3B 5IESH 3MNVB 4X4ZA 1OT1A 5D96B 3OHXB 2W38A 2W0PA 4D0CA 1KGCE 1CXEA 3VFOA 2EKSB 1CCZA 5CCKH 4OF6A 1HEZB 1QUNA 3IS0X 3PHSA 1MJJA 1WJ3A 3W2DL 4TUKH 2H6PB 1GZQA 2SEBB 3CD4A 4PJEA 3RNKA 4QF1B 2OQJA 3MLVH 4TUOA 2PETA 3K8LA 4H0IA 3TN0A 1EO7A 1J05A 2R2EA 1J1XL 1FO0B 4P2OA 1L4IA 1IAII 4Z7NE 2ZUYA 5BVPL 1CGUA 4HUVA 1ZGLP 4ZPVB 2JB6B 5E8DL 2J12B 1UB5B 3EJYD 4OLWH 2VDOH 3VFUA 4BZ2L 4MLIA 3LS5H 4OSUH 4EI5A 4L3CA 3G5YA 3O9WB 1RHHA 5DSCB 3PHQB 4PRID 2DJUA 3MNZB 1BF8A 2EE3A 3GMNB 3OX8B 1HWGB 3QJFB 1AQKH 4PREA 1BFTA 3QNXA 4MMZC 5E2TL 5KTEH 3O6LL 1DBMH 2D2OA 2Q8BL 1NCTA 3I75A 3RTQB 1T22B 4HQQH 4ODSH 1F6AA 4L8SA 4GW1A 3TH3T 4LPCA 1RK0A 5JHDD 5TQ0H 5C0BA 1KIRB 1OARH 4P3DA 4PS4H 1CD1B 4JPIA 1HYSD 2XKUA 4ZDHB 1UZ6E 3RFZC 1KBGL 2VDLL 3H6JA 4PGJA 4BQ8A 4I4WB 4LPVA 3SDXA 4GBXB 4RWYL 2X4TA 2ZCLL 4GXUM 4MX7B 4PJFB 1FIEA 1HSAA 5FECB 4MQXD 3VD9A 4HIIB 3QWRD 2VQ1B 1R3LB 4XP6H 2MPAL 1CE1H 5I8EA 4L29A 3WFBL 2N4IA 1X5LA 2YPKB 3VDCA 5EO0A 2LAGB 2HTKD 3GJFA 3MA9H 1RUQH 3G04B 2ZP0T 4QXTB 1TJIH 4LLDA 3H9SE 2OL3H 4KKLC 4YIQA 3AUVA 4M48H 5DQJA 2NTFB 4P4RB 5C1MB 4WVRA 1PLGH 3L3GB 5L2JA 5EIQA 1AY1H 1BFVH 4G80B 4H88H 4K94H 3C6LA 4WWKB 2APXA 2CDEA 5EBWA 4HJGA 3CSYA 4NC1E 2XOTA 3AFLA 3GMMB 5FUCC 2YXMA 4OLXH 4YC2B 2Z31D 3PNWB 5DR5H 3BPNB 1U8IA 4Y4FB 3VXTA 2P7TA 1OP5H 1QLRB 3HAEB 4KRPB 3V7AG 1TETH 4DN3H 4GG6E 1G9NH 1FL5A 1MJUL 4Z7UB 3MGTA 1CLZL 5GS1A 5IEKA 1RJZB 3X13A 3O0RH 5I9QC 5CUSL 5FYJH 1PSKL 4YQXH 1H8OA 1KENH 1L7TL 1HYRC 2J8UF 4OLEA 1LO2L 3MRPA 4UOW0 4NJ9L 1OTUD 4MLSA 1H8SA 3CH1A 1F42A 1F90L 2A9ML 4GLRI 3GSQA 3R06B 1BQHB 3L7EA 2APWA 3MV8D 2DQGH 3VXMA 2G5BB 5JA9A 4RNRB 4AENB 1QOKA 4RIRB 1X5HA 3ZT7A 5IV2A 1A4JB 1QFPA 1WIOA 2CRYA 5CD5C 1J88A 4JFHD 5GGRA 5D7KD 4EJ1C 5C86A 3CC5B 1T7VA 4L4VD 2W60B 1WZLA 5DHXB 2D9CA 3QEUB 1XGQB 1ODAA 3SEPA 3O3AB 2WZPD 1CGVA 1G6RA 5J7CC 4JR9H 1PZ5B 3DHJA 4G3YH 4PRPB 3DYOA 3O2WL 5EU5B 1XFPA 1QFWL 5D1QD 5FUCE 1NSNL 1SEQH 3O6MH 5D71H 3U79A 2VZUA 4WW2F 4Y19E 2PW1A 1LEGA 4OGXL 1RVFH 5D1XA 2Y36L 3JVGC 5D93B 3VH8G 4KDTC 3UPRB 3CFBA 4FZEL 1MCOH 3AGVA 1S7XB 4ZFOL 5HHMD 1NUFA 3F58L 1ZAGA 1S9WB 4AM0A 1QSFD 5AZ2H 4PJXE 4X9IA 1OTSD 1N6UA 4NBZB 3I6KB 3ARVA 3QP3A 5D1ZA 1IGML 2VN4A 3CFKA 3ARGA 3MV11 3K80A 4U1HB 4C54A 1U3YA 3MJ9A 4KGLA 1GPOH 1G7IB 2FRGP 4PP1D 4J3OC 2XICA 1KCVH 3CFEA 4O02L 4F37K 3UDWC 3MLSL 4MAYD 3BO8A 1BOYA 1JHLH 4JGJA 1QRNE 2W0KA 5GGVH 4Z0BH 4U1LA 1DDHB 1R5IB 1I7UA 3INUH 1A3QA 3GJEA 2R1YA 3H9SB 5EO9B 2Z93B 5C0EA 4NT6A 5FGBA 3VRIB 1LEKA 1QBLH 2BNQA 5BRZD 5GGQH 4YEFA 3C5ZA 3SJVD 3BZFB 2X9XA 4JHAL 2R4SL 2GT9B 2FLBT 4FZ8H 4N90E 3BP6B 1BOGA 1OVZA 3QI9C 3WL9B 1HI6B 4OUUA 3IF1B 3PWPA 5B39B 1H15B 5JLZB 2AEPL 1RFDH 5SX4I 2HN7B 1MPAH 2B1AL 5IROA 2BY3A 2WUBH 3X14A 2F15A 1F4HA 5JXED 4IMKA 4JFYA 5B4MD 2QHLA 4AIZA 5SWSB 4R96B 1BD2E 4K9EC 1CG9B 5ADOL 3H9YA 2QR0A 3V4UL 1FZKB 2E7MA 1B2WH 4LCWD 5CMAB 3VXRD 1T6WA 1R3KA 4ZOCA 2WP3O 5DJXA 5JPNA 5DVNA 3QIWC 3HI6H 4QCIB 1HHGB 3HRZB 3JWDL 4N0YH 4KTDL 4Z7QE 3P11L 5I15H 3ZYZA 4PD4J 3KPRB 5E95B 1JGVH 3W39A 5EU6B 3B3IA 3OR7A 2QADB 4P9HL 4P46A 3W9DB 1WBXB 2ARJB 4XPHH 4HWNA 4XP1H 2Z8SA 3K8MA 5HYJA 4LU5H 4KRLB 3BJ91 4WI9A 1NH6A 4P23D 4XP5L 3RVUC 4ZAKA 1BJ1H 4I3RH 1QG3A 2ZG1A 4OFPA 2AK4D 1A7NH 3VGGA 1J8HB 4NQEE 1OCWL 5HDBE 3ZE0F 1X5YA 2N56A 5TDOA 4JM2D 1U91A 1PG7L 2ZNWA 1NGWB 2C3GA 1EFQA 3P30L 4Y19B 3GBNL 1KPRB 2ITDA 4ELMA 3RHWF 3U1SH 3O41B 3T2QA 2D03L 2Y07L 1T66D 4M9PA 5F88B 5GXBB 3KPSD 2UY7A 4YPJA 3DVGA 2HRLA 4XPBH 5C07D 3V0WH 1I1FB 4EI6B 2P8LA 5DJ6A 4XNMB 1A7RL 1WTGT 3LMJH 4NO5B 2MWCA 4UT6L 3SDAA 4PJXB 4KTEH 3C8KB 4XNZC 5J1TC 2V7HA 4FQXA 1FNEB 1NMBH 4XPFL 4E41A 5TH2A 1JNNL 2K7PA 3VG0H 4FQHB 1YNLL 2PYED 1FFOB 1D9KD 4GW5A 2HT3C 4OUOA 2OL3A 4PJDA 3KXFB 2B1HL 4OD2A 1E27B 2NQCA 1IGFH 1FAKT 5J1SC 3PP3K 1N59A 3D25A 4Y5XA 5D4QA 1R3JB 5GS3A 5I66A 2X44D 3RUGF 3TV3L 1XZ0A 2PTTB 3Q2CA 4OZGB 1GOFA 1LK2B 4YR6A 2C7UA 4M6NH 4IHOA 4Y4HD 4PJ8A 1ED3B 4Q9CA 2MTPA 2ICES 2EDOA 2F8XC 3BEVA 4V1DA 5CBEB 4PB0H 5B38B 4DQOH 3VFWB 4PV8A 2DQHH 4U33A 2DM4A 3GMPA 5EZOH 1U8NA 4YGVB 3HCVB 2GJ6B 2WBKA 5ABDE 1KIPB 3RDTC 4F8TA 1G9MH 2ED8A 4WHTA 4W6XB 5GIRA 3UZEA 5T1LB 1CDGA 5D9SB 2YZ8A 4KROC 4N8VA 4DKEL 3HZKB 4HLJA 5CP7B 4CVXB 4LSSH 2UY6A 2DYPD 1JZ5A 1JZ8A 2X05A 3CVHA 2Y7QA 4OJFL 5HGGS 2PO6A 3P0VH 3TM6A 3DO7A 1JWSB 2PXYA 1D5IH 5I1IL 3IDMA 3IU3B 5I1LA 1FNFA 1PVHA 4I18C 1P5UA 4PJGE 1Q0YL 4LAQH 5KVGH 3B8YA 1ZVYA 3TJHD 3OMZA 3IVKB 1TIUA 4JCMA 3N1QC 5JA8B 2A77L 4M7JH 5TPWL 1ES0A 3JWOH 3T0EA 2FJGB 1EX0A 3H7BA 2FLRT 1RURH 4WO4C 4Q6IC 2BRRH 2VDKH 5TE4H 5MEOA 2BSSA 1ZHBB 5BZDA 1NUGA 2YSSB 4W6YB 4DGVL 3VA2C 1XF3A 1BVKA 4N8CH 1EZVY 5HHXH 4RMTA 3RU8H 3QI9B 3LZFH 1IAOB 4O2FA 2OMBA 1N4XL 2I26N 3EYVA 4XB7A 4ZFZB 1YJDH 1KELH 1Y18B 4RAHA 3WIFA 3HC3L 5MERB 3MO1A 4M7LL 3WV0A 3SKNB 3DHMA 4PLOB 1W72B 1OAXH 2IPKA 2HKHH 3ARYA 2GJJA 3P2TA 5FUZH 3B2VL 5F7UA 1X7QB 4Y1AA 1RZ8A 1MI5D 4OQ1A 1NLBH 3C2AH 3MFGB 4GG8A 2FGWL 4ZUSB 3V79C 1IKFH 3L1OL 1ORSB 3J8F7 3RWCB 1MWAL 3QUXC 4X9HA 3GSUB 3DGGA 5D6DA 5FO8A 3FQWA 1OWWA 4TVPE 3S35L 3REWB 3QIWB 2X7LB 1SYVA 3I6LE 5IVXA 5L7XH 3BRFA 2NR6D 3NVQA 2WWKT 1C12B 3EYOA 1IBGL 5HYEA 4YUEL 1CT8B 4I5BB 4MCYB 3V5HA 3RGVC 5JW4N 3V6BR 3HMXL 3H3KA 1KCKA 2CKBH 4WDIB 5DWUL 1SJEB 4U1MA 1R24B 2G5RA 4HD9A 1P7QD 5MP6H 4J2XA 1MUJA 3GI9L 2E3VA 4JGMA 5C0CE 1EXUA 1VGEL 2MKLC 1HSBA 1CL7I 5IM7A 3R8BB 1BLNB 2GSGA 3CFJB 1DVFD 3MRFA 3QNYA 4FTVE 2Z8WC 4HGMA 5DMGC 1I1CA 2M1KA 1INEL 3NTCL 2CQVA 4JFEE 3U9UA 1TMCB 4QTIH 4PJ5B 2XG4A 1TZHA 3BW9A 1I3UA 4JRYA 3KLAA 2HLAA 3LRSB 5JMOC 4X9BA 3W11C 1ZA3A 2VIRB 1QLEH 1FNSH 5IMMB 3KR3H 3BKJL 3BKMH 1HIML 3OXSB 3DX9B 4WV1C 3VW3H 1HHKA 4D94A 5T1KA 5I0ZA 2X4QB 1U8MB 5AG8A 1UB6B 2ARJQ 3L7FB 3OKKB 1QR4A 3WFCL 4XNZB 2EKSA 2A1WH 1BX2A 4TSAL 1U41A 1U8LB 2O5YL 4RGNC 5GJSH 2QQKH 1LE9A 2LABA 1FGNH 1K8DB 1QO3A 4NNPH 1JNLH 3BVNA 2Q7NA 2SEBA 4NZRH 1FJ1B 2ADFL 4HG4K 4NZUL 1A6AB 4G5ZH 3D18B 5L88H 1BHGA 4KZEL 3JV4B 2BDNL 1C5CH 2WUCH 1FPTH 4F7EB 1IEBA 4AEHL 2NY5L 2ZCKL 2MQCA 5DUMH 4GRWF 1UB5A 4YWGH 4LGPB 5KSBB 5KVDL 1K5NA 4RBPH 4TSBH 1RIHH 4JFDD 5JQHC 1BIIB 5DRXB 4MNQD 4LRIC 4HLZG 5CJXC 4Z95H 4ODHL 3GMNA 3HC0A 4XBPB 3QJFA 4RX4D 4Z7VF 4YX2H 3HZMB 1LP9A 4OTXH 3RDTB 5I6XB 3V4VH 4FQIH 1T22A 3B6SA 5EUOF 3TO4C 3VE0B 3SKJL 4HGWA 1T21B 3DETC 4MJ5B 4WI6A 3HPLA 3PV6A 1JYWA 3OF6A 4JRXB 4HJ0D 2IJ0C 2NY4B 4KROB 1FZOA 4ODBD 3QEQE 4R7DB 3DMMB 3RIAK 4LSQH 4UV4L 3ZE1E 4I4WA 1EHNA 3BN9D 4XBEH 3PHOB 4RGNE 4XNXH 5HHNB 4PJFA 4HS3A 5D7IF 4I9WD 3V6OE 5C9JA 1S9XB 7FABH 5IGXL 1VB9A 1G7MB 2EE6A 1RUML 3ULUC 4KVNH 3LQZB 4PRHA 4I18B 3EOTL 1IL1B 2WBJC 1EPFA 3SE9L 3CX5J 3BHBB 3PGDB 4ODWA 3NFPA 1H3XA 3MUHL 4XNQB 5DHVH 3G04A 3TWCH 3LKSA 3RL2A 2IF7A 3MOAH 1IC7L 2ADGB 3ZDZE 2EYTB 1E28B 2BY1A 4WO4B 4ZS6C 2W65B 4N0FA 5IFHL 4G80A 2IPUK 2CDGA 3CIQA 3ZLQC 4JDTH 3MREA 4YHKL 4BKLA 1KXTB 4NRXA 5MHSE 1JK8B 1OAKL 4JFEB 4UT9L 3DRQB 3TBSB 2AXFA 2ICEA 2XWJA 4ZSOB 4G9FD 4RFEA 4Y4FA 1I8LA 2HFFB 5AZEH 1NAKH 43CAA 3OR6B 3EYSH 1HH6B 2F19H 2OR9H 4NM4L 2IWGA 3RVXC 1MVFA 4DJMA 2LAAA 1IM9B