3G6DL

Crystal structure of the complex between cnto607 fab and il-13
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
210
structure length
210
Chain Sequence
SYELTQPPSVSVAPGQTARISCSGDNIGGTFVSWYQQKPGQAPVLVIYDDNDRPSGIPERFSGSNSGNTATLTISGTQAEDEADYYCGTWDMVTNNVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Epitope mapping of anti-interleukin-13 neutralizing antibody CNTO607.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords CNTO607 Fab Light chain
total genus 42
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2009-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g6dL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g6dL01
2HFFB 3BISA 2J88H 1RK0B 2YMXH 4GAYB 4WFGD 5JHLL 2WBJA 1OAXL 4G6JH 3UJTL 1KELH 1M05B 4N90D 2EYTA 4F37K 1CLZL 1C08A 2DS4A 1W0WA 1TZGL 5F7FA 4JHWH 4D0CA 4EDWL 1H8SA 3EYVB 3HE6C 3IFPB 5DMKB 3QG6B 4L8SC 3EYOA 4MA1B 2X1WL 5E94B 2Q6WB 1EHXA 3V0WH 1XF1A 4U05A 2J4WH 4HXAH 4KJYA 4TSCL 4BH8B 1KGCE 2CO6B 4WTWA 1C1EL 4K23L 4F7TB 2X1PA 3QQ3A 3U7YH 1H15A 4ZFGH 1JZ4A 1U8HA 4HMDA 4WWKB 3SPVB 4YHOH 2IBZY 1ZWIA 5EPMB 5E2TL 5C0IB 5DZOA 4PGJA 4EIGB 1GXEA 3MRIA 2BHUA 5FECA 3DWTA 5I1LA 5MEQB 3TO4D 1G7PB 3VW3L 4E0RA 1FYHB 3FN0L 3PHQB 1S9WB 5E00A 2NTSP 1AIFA 2PTUA 3MNVB 2BRRH 5GIRB 1NFKA 1F3RB 1CG9B 3NOIA 2IGFH 5DC4B 3SY0A 4X80H 1KJ2B 4E42A 4HS8H 2X4TB 3NCYS 2Y23A 1P5UA 1WBYB 4XVUD 4ZFFA 4PGBA 4PJDF 3BE1L 1CDGA 2DQDH 2L7UA 2BNUB 3S34H 5HDOA 2NLJB 4KY1L 5B39B 2E7LC 3RPKA 2Y9RT 5EO9B 5KTEL 3VWJC 3EYVA 5IB3B 3AAZB 1KSRA 3EDKA 1XGRA 1M6OA 1F58L 3ESUF 4XNZB 2YD2A 1OF2A 2IAMB 2WINB 3FONB 3ZT7A 4LLQB 4Y16B 3ZE0E 4PR5B 1JRHL 1YPZB 2O26U 4GT7A 1TCMA 3PUCA 4R0LA 1JNHA 1D6EA 2R2BB 1IKNA 3QUZA 2NX5E 1HXMA 1IQWL 1MH5A 1TVBA 4NRXA 3LKSA 2GEEA 4MJIE 8FABB 4RQQA 3BEVB 5AWNL 4YHIB 3S37L 1QYGL 1IQDB 3FO2A 4BZ2H 1BVZA 1LO0H 4RRPA 2OZ4L 3NACH 3QDGD 1WC7A 4HGMA 3G6JF 4N0CC 3AREC 3GMOB 2RCSH 2G2RA 2I5YL 1EIBA 4OM1H 3FO1A 3MNWB 4H8WH 4PP1D 5K9JH 2R0WH 1IGCH 1X5KA 3WHXB 3V6FB 5FOBA 1N6QH 4DUWA 3AS1A 1D5BB 1WAAE 1LDPH 1MIML 1JE6A 2R29L 5LXGH 3GI8L 5ILTL 3BKYH 5IMMB 1OL0A 3TNMA 5JW4R 1H3PL 2ARJQ 4K94C 5DJCA 3B6SA 3G08B 2W59A 4U6XB 1NMCB 3DXAB 4ZUVA 1G6RB 1QFWL 4LHUA 4Z95H 2DDQL 3SPVA 3BKJL 4D2NA 3LDBB 3GI9H 3UX9B 1UJ3A 3LKOB 3VXMA 2O61A 3IF1B 3OKNA 4CUCA 1GSMA 1N4XL 1P1ZA 2VDNH 2R1XB 1GHFH 1F4WL 1TZGH 1U58B 2D0HA 1WBXA 1WFNA 3LHPL 4CNIB 3O6FB 1XGPA 4Y16A 4MNQE 1YQVL 3LRSB 1ZANH 4JZJC 1MCOL 3V5HB 5AD0B 3UDWC 3H3BC 4S1DD 2NZ9D 2J4WL 4HXAL 4F33A 4GW1B 5DI8B 2DQEH 3LEVH 3GJEA 2AJXL 4S1SL 4YHMH 2D7OA 1YEIH 3TYGL 3RL2B 3FRUB 4I3RH 4RSVA 3KS0J 35C8L 4NJ9L 3LN4B 3DHMA 3MJ8A 1FSKB 4KDVA 4K94L 1A3RL 2AJYH 5CKAA 1MAKA 4Z95L 4LU5L 1CFSB 4PRDA 2IQAB 4D9QE 1IFHH 4HPOH 3SDXB 3FQXB 1LD9B 4G6JL 1BGXL 4HWZB 3GSRA 1QKZL 2D7MA 4X9IA 2N56A 1D5IH 1SJVA 2MJWA 3SKMB 1A7QL 2IPTH 3O6FD 3VXPB 4WU7B 4G80A 4MDIB 1F3JA 4PJEE 3MRIB 4KI1A 1I9RL 3HG1B 3IGAA 4NKIL 4NT6B 1UEYA 3HE6D 3RAJH 4PRPB 2E5EA 3GO1H 5HYQB 3RA7H 4PJ7B 2H26B 4NQDE 4TVPL 4CL7A 5F1KC 4FQ2H 1HQ4A 4JHWL 1ZLVK 1K6QL 1Z0MA 4UAOB 5INDA 1R3JB 4R96B 1BQLH 4Y4FA 5F1NB 3OR6A 3GKWL 1AD9A 3DSFH 4UOW1 4IOIB 15C8L 3I02B 4I9WE 4LHUG 1S7RB 1OM3H 1I1AD 3WLWC 4HIJA 2X4OA 3ZE1E 1S3KH 1BWMA 3NIDF 2DJUA 1X9QA 3DYPA 1YMHB 1CFQB 3D1MC 3MA9L 4Y4FC 3L5WB 2X05A 2X7LB 4YHKL 3ARFA 1OSZB 5I1IL 1OVZA 2Z91B 4HKZA 3NIFE 5I30H 4GKSA 3IDGA 4LDLB 2FR4A 1HHKA 3LKOA 3AM8A 3O3AA 5E2TH 4N9GA 4G5ZL 5JDSA 5F9OL 4Q9RH 3QEHA 1D9KB 2CK0L 3SGJC 2CSPA 4HT1H 2CKNA 5GZND 3EOBA 5HHMD 3TESA 3MLUH 1RMFL 3ZHDA 1GVIA 1NAMB 1FNHA 5D6CA 1JV5B 3CSYA 4P49A 2A38A 3RJQB 1FRGH 2UWEE 3JV6A 3HCVA 3WNLA 1FN4B 1SYSA 1QFHA 4KKNA 3STLA 4ONGL 3MNZA 3RWIA 1NUGA 4WTZG 5FKAB 3VJ6A 1G9NC 3BE1H 4L4TA 1IJ9A 3WHXA 4F8QA 5EBMA 2C1PA 5H37H 1NAKH 1NL0H 3S34L 3ZE2F 1MAML 1OAKH 3LMJL 4IRZH 5D1ZA 3W2DL 4ZS6C 5KOVC 5C3LD 3MNWA 2XT1B 5EU4B 3F58H 5D8JL 5F7LB 3QIWC 1KEMH 2R1YB 1MF2L 3ZE2E 1C7SA 2FNBA 5DRZA 1FVCB 2XZCL 5J56B 2YEZA 2IALA 1ZA3A 3TJEL 1PYWB 1I7ZB 4XNYH 4LCYA 4CJ1A 3O41A 1T1YA 4Z78A 3HN3A 4GKNA 2I24N 3MLZH 3ZTJH 4L3AA 5K33A 3HNVL 4AG4L 3S36X 2UWEF 5JOPD 4NRXB 5DMYA 5SWSB 3ZHLA 4BZ2L 3GI9L 1F45A 3Q6FB 2F9BT 4WHTA 3MLPA 2XTJE 5I1EL 1AHWA 2A6IA 1D9KD 3QEUB 5GSVA 5MI0C 4HZLA 1LO5A 1DL7H 4LAQL 5I0ZA 2DF3A 4Z9KB 3LMJH 2Q20A 3WEXB 4OQTH 3QFJD 1IGCL 5C2UB 3GMNA 5T1KD 2GK0A 1HZHH 2IQ9H 3VGAB 4XWGL 2I60H 4XHJC 1F5WA 4XXCC 4QRQA 1FP5A 3T4AB 5ICYB 3GSNH 2DQGL 1RVFH 3KVQA 1OAZL 1UM4L 2BNUA 1U8PA 1NMAL 3AREA 3TFKD 4I3RL 5FK9B 5JQHC 1ULVA 3M1BB 4P9HH 1BD2E 4PJGF 3U46A 1R5WB 3UO1L 2D7QA 4V2BA 4XBEH 4XCEB 3EDFA 3FB6A 3BRDA 3OWEA 4XI5D 2W0KA 3TYFB 4ZTPH 2BC4A 3T4YA 3T0BA 4KTYA 2XWTA 1T5XA 5DDHA 1ZT4B 4NO0B 1I8KA 2AW2A 3W0WA 4GAJL 4JPWH 5H37G 1JVKA 4DUVA 4TUOA 2FRGP 5T5FH 3TPUA 1XGTA 3G6JE 4XPHL 4Y8AA 2XFXB 4PP2B 1Q1JH 2MQCA 3BHBB 4ZOAA 4JQVA 4R2GC 2ZUQC 4G6AC 4YR6A 3C2AL 3DX9A 1A6ZB 4P3CL 2V9QA 3SGKA 5JMRA 1ZA6A 4IIQB 4ODHH 4YR6B 2EDNA 2VLRA 5IGXL 1JGDA 4M1DL 3BHBA 4YXLH 5IFAL 4NO3A 3BD3A 3O3BB 4U0RC 3ROOA 4X6BB 3PWNA 1S7UB 5E4EC 1V05A 3FOMA 4JZOA 1T6VN 5BCAA 4Y4HD 4GG6B 1CGSL 4K3EL 4M3KB 3C5ZA 4X6FA 5EFIB 1NLBH 2BZDA 4R4BA 5BO1L 3MLRH 1F4AA 2FDBP 1FJ1B 1J05A 1MVUA 2R4SH 4L29A 2GITB 2X10A 3F65A 4MZ2A 5EZOH 1BD2A 2AJXH 3RUGE 4PLKD 3KNBA 5IP4A 1ZHLB 4YIQB 1OAXH 3TIEB 3RY6C 4H0GA 1GOGA 3VXSE 5C0EA 4KMQA 4G43B 3LPFA 1A5FL 5ETUA 3AREB 5SV3A 1QPPA 2MQ3A 4NQCB 1IT9H 2IPTL 3MRBA 2VC2L 1DDHB 1NC4D 4IMLB 5AAWA 1QKZH 3QI9A 4OZHF 5ICYA 5ICZA 4Q58C 4MD4A 3QEQB 3NABL 5J6GA 3L3DB 3RVXD 4JB9L 3OKLA 1CD8A 5CLWA 1KCSL 1RZ8A 4DVBB 2HA1A 3L3OB 4NKDB 1JPSL 3BP7A 4P2RE 1LO5B 2O93L 4OUUA 1MPAH 3U7YL 3U4AA 3PABA 3RWJB 1MWAA 2N1KA 1OM3L 2NY7H 4X83A 4FP8H 1AR2A 4ZUTB 4RAUB 1U8QA 3D18A 3MJ9H 2O5XL 2ZUUA 1J88A 1E27A 3LKPA 4PD4J 1JUFA 3CD4A 5EN2B 2V5TA 5IVOA 4NO2A 3RTQB 5ISZD 2HVKB 1T7WA 3TIEA 3PWPA 5E4EB 3WKMH 1IAOA 3DHJA 4NO2B 1U93B 4EBQH 2BERA 4OJFH 4I18C 3T1FB 3MR9A 3HI6H 3O8XD 4Z7VB 3S4SB 1BD2B 4UDTB 2L0DA 5LWYH 5GISH 1J8HA 2H2PD 4JKKA 5EC2B 4X6FB 2IJ0C 5EFIA 3VDAA 1OGTA 3OR6B 5CZXD 5C09B 3LPGA 4WIQA 1CE6A 2VXVH 4NFCA 4Z5RA 1G9MC 2NY5L 2F15A 2R0KH 3ROOB 5K9QI 4RDQF 4UB0H 1IAKB 4N90E 1X7QA 3H2WA 4EDWH 1FLRH 4P23D 5BOPA 1ONQB 4MAUL 1FL6A 4MLIA 3HE7A 1NBYA 5CUSH 3Q3GA 2IC2A 4KKAC 5ALBH 4N1EA 2AEQL 4WHDA 2AAVA 1FORH 2AQ2A 1DUZA 2C7UB 2UZYB 2Z93A 4OZGB 1MHEA 2BP3A 2BK8A 3F58L 5D8JH 1QPXA 4MCZB 5DLMH 2PKDA 3UO1H 1FPTL 4Y1AD 4OM0H 3W2DH 5HHPA 3BH9B 1S5IL 3QPQD 1WTGT 4KI5C 1FZOB 4NZTL 4ZFOL 4QHMB 2VTFA 3IDGB 4CVXB 5I0DA 4R4BB 3G6AA 4LRIC 3GIZL 2X7LA 2I07B 5LGJB 5FHBL 2C7UA 4WI8A 3SDDB 3OF6A 1XAUA 3H7BB 2OZ4A 4WW1B 1YC8A 1E4KA 5T33L 3GMQB 3LKNA 3SGDH 3LDBC 5E2VH 1GOFA 1Z6JT 4ZS7L 5D7JA 4PY7A 5KS9B 4PPTA 4I2XA 1XGQB 1DQQB 2IEPA 4C56A 2D7NA 4HAGA 1P1ZB 2VN4A 4NO0D 2BNQB 3NTCH 4LAQH 2DAVA 1ZGLA 3HG1E 2IF7A 1N6QL 2BY0A 4XRCB 4FQCH 4NBXB 4XAKD 1P7KB 1AHWB 5FUOL 4M7ZB 4OCSH 1UYWL 1DQQA 3QEGH 3VFTA 3EYUH 3WD5L 4Y5YA 3V5DB 2AV7B 4JO3L 2GSGA 3QFJB 1UGNA 1OB1A 2YA0A 4HXBH 1GGIH 4ZXBD 3VXTA 3FZUD 4JDVB 2E6PA 2D7TH 2A83A 4DTGL 4ALAH 1YYMH 3HKFA 3SDDA 1LDSA 5KOMC 4AL8L 4UNVA 4H25A 1ZA3B 4NC1E 3DTXA 2ICWI 2DYPD 1DBKL 4ZSOE 5DRZB 3VG9C 3K7UA 2VB5A 5HGHB 1GHFL 1FNGB 3IYLW 3BP6A 3OGCA 3OKOB 3F12A 5GRXG 4QRQB 5C6WH 5HVWA 4GW1A 5DI8A 4OCYL 1WWAX 3D9AH 4WTZA 4U1JB 5MHSD 4O2FB 3RVTD 3SCMA 5BV7B 1GIGH 5E9DA 4JY4A 5IHUL 4H0IA 2I26N 4HWNA 5F96L 3WFEH 1UB5B 7FABL 1BQSA 4HZLB 1U8MB 3SEPA 4PRPE 5BQ7A 4NHCL 3DMMC 1OQOA 3C2AH 4JFED 5ILTH 5EUOB 1ROWA 5T1MB 1TVHB 3MLRL 3LKSB 1N6UA 3KYNA 1EV2E 1SJHA 3SDCA 5F9JB 4NZRL 3BUYA 5HDQH 4GKNB 2BNQE 2FL5B 4X5WB 5EU6B 3BSZL 4X9GA 3PQYA 1CL7I 1DR9A 5FDYA 1HHIA 1YNLL 3TV3L 3UDWA 2YEZB 4TNVF 3V7MA 3BZEB 3FCTA 5BO1H 5I76A 1FJ1A 4FS0A 4GKSB 1R5IA 3C6SB 3EHBD 3ARWA 4MX7B 1MY5A 3DSNA 1QA9A 3QIBA 2HVKA 4PJ5E 3IDIA 1PSKL 5IKCB 2BOBB 3U4EA 1K6QH 1S7RA 1B0GA 4DK3A 5FB8A 3CSBA 1KIPB 5CSZB 3IB4A 3DO7A 2VJXA 3CIQA 1BM3L 4JG0L 4X6DE 4BKLB 3MV7B 3FB5B 1FV1B 2V5YA 5CEYB 1T83C 5EU6E 1YEEL 4I4WA 1MFNA 1E4WH 4CADB 3HA0A 2YN3A 3RWIB 1YY9D 1MCWM 3E8UL 1IGJA 4H5SA 4XGZA 1CDBA 4PP2A 43C9B 1MLBB 5I1HH 1KCRH 5ALCL 4X7SL 1JK8A 4LP4A 5E00B 1S9WA 1JV5A 3WLBB 3QEQA 4NM8H 2D31A 5JR1L 3JV5A 1SJEB 5BRZE 3AU1B 4QY8A 4Y16D 1T5XB 1W0YT 2BSTB 3SKOA 1MCRA 3HAEB 3GSRB 5L2KD 4HPYL 4JFEE 3UYOD 1JJUA 4GQ9L 2F74B 1TZHA 4OJFL 2FJFB 3QCVH 1FBIH 3MRCA 1IM9A 3VFVB 1P84J 1J05B 1MVUB 4WUKL 3I02A 3SGEH 3WSQL 4Q9CA 3MRGA 5F1IB 4N9OB 5E94A 1MNUH 1XGRB 4QRTA 3L7EA 4K8RL 3T0EC 5GGRY 5E6IA 1TETL 2VDRH 4IHOA 4F33B 5F1NA 3MJ6A 5EO9A 4F3FA 2RHEA 5C6TH 4MB5A 1A6UL 4PJ8D 2Y07H 4ETYA 3JZ7A 3QHFH 4JRYA 3HRZB 2F5BH 3SDYL 3TH3T 1FL5A 4MAUH 5LAXB 3QEUA 3C6LA 4HHAA 3R06A 2QJDA 3BKMH 3WCYA 2EH7L 1ZV5A 4YFLF 5DK2A 2GFBA 1KEML 3VXPA 32C2A 3FRPG 2QSTA 4P59H 1G9NL 2G60L 1F11A 1JHTA 5D70H 5HJ3B 2UWEA 1OTSD 5DJXB 5GZOD 2JF1A 4DWHA 4Y4FD 2OXHA 2ORBH 3QHZL 3WLBA 1NUDA 5FYKU 4Z0XA 5D9SB 3RDTA 2GTWB 4APQD 1I1AA 1LEIB 2R1YA 3IRPX 1E6JH 1A6TB 3E1F1 3VI3E 4XVTH 4U1IA 5DJDA 5I8CB 1RK1A 1Q9LA 3LAFA 2FH6A 3KDMA 1JL8A 1CS6A 3X11A 4HIEA 3QXAB 3IVKA 4F7TA 5I1CL 3Q1SL 4IMKA 1E28A 2GJ6A 4F9PA 4MA8H 3KPMA 3MO1A 5IJKA 4X7EC 1JPTH 5HGAB 5IKCA 1CI5A 3RNQA 2OM5A 4HCRH 4KRLB 1M7XA 1K8DA 3PV6B 3MRKB 4H88L 1QOKA 3Q6GL 4ZDHA 1JYWA 4JG1H 1KTLB 1OGAB 2DQHL 2VLKD 1MWAH 4PJEF 2OX5A 3OAZH 3RZCA 3NPSB 4LPVA 4UQ3B 5ICXA 2GK2A 1KIRA 1GPOL 4QHLA 1IC4L 4NQSB 5BMFH 1V7NL 2J8UA 2KKQA 4QNPF 3UJJH 4AQOA 5GZOC 1MSPA 4FXLA 2NPLX 3S35L 4L4TD 2AGJH 3FO2B 5DJCB 4JHAL 2ZWLT 3BT2H 4GOSA 1HHJB 2J8UF 5C0RH 1MF2H 1A7PH 2Z8RA 4W4NA 4DKEL 1URLA 5ACLA 4ONFH 1HHGA 4HJ0D 4ZUWB 5E24E 3K2UL 3TJHD 3OB0H 3DVFA 1T4KB 3KPSE 3O9WA 1DSFH 4K7FB 2EDFA 1I9RH 3KPMB 2IQ9L 4KROD 4H1LG 2YWYA 3RI5F 4GUPB 2ZOKB 3BUTA 4HIEB 3WE6B 4XC3H 3OKOA 3CZFA 4JRXB 1KPRA 4ZSOA 2D9QB 3GKWH 2VDPH 3FT2A 1LK3H 3BPOB 4I0PD 1A6VL 5GJTL 4N8CL 4V2CB 1CXLA 3KPSB 4CGTA 4M9OA 4RGNC 1I75A 4D94A 4JAMB 2FX9H 1KCRL 3RKDC 5FYKH 5HGBA 1A1OB 5D7LA 3WNMA 1T1XA 4DZBB 4OLYH 4PJXB 1MFCH 5TFSL 3ULVD 3UJIH 1TMCB 1GC1L 4YHIA 5GIRA 3FL7A 2W07A 3DVGB 5SWZE 5IQ7L 4BSVA 4GAJH 5GRJL 2ED9A 4JPWL 3OAYK 3AB0C 4Y5YB 3FAXA 1WWBX 3R0NA 5E2UH 2BNRA 12E8H 4PV9B 2A73A 4LASH 4P2OC 3G9VA 4O58H 5C0IA 3DV4B 3SOBL 4X6CE 2VC2H 1JP5A 5J8OA 3ROLA 4NQSA 4YX2H 1HSBB 4P5KB 3ARED 1A1MB 4XNXL 1SVCP 3QPXH 2MCG1 3Q48A 3BQUD 3B2UD 4KJPD 2BNQA 4X5XA 1Y18A 3TO4B 4MXVE 3CMOH 1KCUH 4ODTH 3UXFA 5KS9A 1ACYH 1A3LH 2X4RA 4FFVD 2ICEB 3MACH 4QGTA 4V1DE 4IOIA 3DROB 4GFTB 4MSWA 4PGBB 5EBLB 3ARGA 1E28B 2GJ6B 2X5PA 3E3QC 3QG6A 5JOPE 3RKDD 3QXAA 1K3IA 1LMKA 3EJJX 5ID1B 3C8DA 4KZDL 4MCYB 5FUCC 1VGEL 2OLDA 2IFFL 1KTDB 1SY6H 3RGHA 5IVXA 3IDNB 3OB8A 1R3LA 5J7CC 3VW3H 4LNRB 4KAQL 3LN5A 1NDGA 3DXAA 3QIWD 4ZUVB 4PV9A 1DQLL 1XF4A 3GNML 1BVKB 4FQ1L 4X7SH 4FQXA 3MOQA 4DEPB 1VFAA 1OSPL 3NIFF 4QXGH 3I2CH 4NWTH 3TZVB 4LLMB 4NKMA 4FABH 2DMKA 4WWKA 3VXNA 4JE4B 2DQFB 2X89D 4R3SA 4R4FH 1B0RB 4S1RH 4U6YB 5TDPB 3ZSTA 4HWUA 5DRWB 1JYNA 3CFEB 4PRDB 1G7HB 1RU9L 3PHOB 5C7XH 2AJVL 3IETA 4Y4KC 5I1CH 2X4UA 4JFOA 1HIML 1PEWA 3FKUS 4AH2B 4L4TE 2FB4L 2ZG1A 4FFZH 4QHNA 4Z6AT 4RA0C 1R0AL 5EOTA 3MXVH 4GAFB 5ENWB 5GGQH 3U7AA 1BAFH 3MV9D 5CGMA 4D0CB 3BGAA 3UTSB 3FO1B 1K2DB 4NPYA 1M7IB 3FB7B 3HC0A 1HILB 5DUBA 3NAAH 5IJVA 4XMPH 4Z7VA 1FGVL 5MENB 2ADIA 2EYSB 1UWGL 3JTTA 2Y6SD 3Q0HA 3WIIL 4MA3B 2HG5A 1TZHB 4LL9A 4W4OA 3H9SA 5JNYB 1A1NB 4WFFD 3GMPA 5I15L 3QQNA 2O61B 4G8GE 4OZFA 1XIWB 1H3UA 1T7YA 1JYXA 1KTRL 3BPCA 4CMHC 4JY5H 4DN4H 1AXTH 1OAUL 2Q87A 1IGIL 1GZQA 5AZ2H 3PL6B 1X3DA 3D0LB 5CCKH 2Y36L 4HCRA 5GSRA 4QRPE 4W4OC 1DLFL 1KEGL 3N06B 4NKDA 5I1JL 4PJHB 3HI5H 2NY0C 4MJ5B 1DBMH 3HUJF 4X9BA 3OKLB 1DCLA 4LLAA 2FEEL 1ITBB 3BWAA 4PB9L 5JORA 2WV3A 3T2PA 4JR9L 3QRGL 5TH2A 3RWHA 4OT1H 3V6FA 4I3SH 4GBXD 4MB4A 5AG9A 3TIDA 5CSZA 2OL3B 1NCWL 3EYFA 1QZ1A 2BOBA 2EKSB 4I8DA 2K3TA 2UZXB 4H25B 4HUKB 2J6EL 4JHZA 3GRWH 4K2UH 3IVKB 1P7HL 2J6EA 3HZKB 5J12B 3CPLB 4WI7A 3VXTB 4MX7A 3S88H 1AGEB 2VISB 1A6TA 5DD5H 3MNVA 4JFEB 3DUHA 4P23A 5DQDL 3MMEB 1RVFL 4WO4A 5CSGA 4ONFL 2Z31B 4L4VA 2DQUH 5ITBH 3RGVB 4G8GA 2VXSH 2FL5A 4X5WA 12E8L 4LCCC 1RJCA 1IGML 2HH0H 1FFOA 3PGCA 2UWEB 4KK8C 2Z92B 5CEXA 5EO0A 1HI6B 2NZ9C 4G7YH 4K55A 5DMGC 1YUHB 3HE6B 1LP9E 3TBWB 4OGAC 3EYQD 2GTZA 3CXHJ 4R97B 3O3EA 4MXQD 4M7KH 2C3GA 3T0WA 3VFUA 2HTKC 3KYMA 3B5TA 2BOCB 2HJLA 5DD6A 1JGUH 3EUUA 4MDJA 5JXAL 4OFPA 3TCLA 4JFPB 3NZ8B 1T80A 4BQ6A 2WM0A 1RZJC 3QAZB 5CJXC 4OLVH 2N7BA 3RQ3A 1W72L 4M48L 2BC4B 1J18A 4G3YH 3GZKA 5BZWA 1AC6A 3V6BR 4F7PA 2UYLB 4J12A 4C56D 2H9GA 5JHDA 2CUHA 1EEZA 2XWJA 3GMLB 3BP5B 5BZDB 4HX1B 1CTNA 1ZLWK 5E6YA 5AG8A 1EMTH 5T3ZH 2GSGB 4KTEL 4JFFE 2FZ3A 4WW2C 1YDPB 2ZUWA 1D5IL 1RURL 1FL6B 3UAJC 1G7PA 4TSAL 1JN6B 4Y0GA 3AXLB 3P0VH 3D2UA 5EPMA 4FFWD 1ZTXH 4LQFH 2DLHA 4GAGH 1UZ6E 4UUJA 4JVUA 2P47B 3L3IB 5GPRA 3DECA 4Z7NF 2NX5B 3QXWA 3SDDD 5ADOH 2ITCA 1YY8A 1LGVA 5E8OA 2DI9A 3ARPA 4MA1C 3FO9A 2MHAB 2DYPA 2P8LA 3MUHL 3L5XH 4XCCL 3H6JA 4FA8A 3ZO0A 5EUOF 5DRXB 1C5DA 4FTVD 1QHOA 4Z7WA 5J3HD 3O41B 2Q6WA 4Z78B 1CLOH 2DQEL 2EIZB 4BFBD 3T2QA 5E6ZA 5EN2A 2OMBA 1E27B 1MLCA 3VWKA 1OAQH 3GSWB 1RUQL 3U30C 1UFUA 4KDTC 4QHMA 4IDLA 4JFQA 1CD1B 3PNWA 5CJOL 4HFUL 4FQHA 1MHCB 3MRFB 3WS6A 3QRFM 2P44B 2HWZL 1OAUH 5EU6A 1OSPH 3SDXE 4XMLH 1KB5L 3KJ6H 3O2DA 3DYOA 3KPRD 3QIUD 5DMJB 4YUEL 3MQIA 1DQLH 3B3IA 4HDIA 4LF3A 1KEGH 1G6RH 5TE4H 3MLTA 3WUWG 4RMRA 2A77L 4UIKH 5J6GB 4NRZA 3HE7B 4PJIA 2D7PA 2DI7A 2LQRA 4JGJA 2WBKA 2HVJB 3NCYP 2VRAA 3RGVC 3V6OE 4HULB 2W60A 1QQDB 4FRWA 4F2MA 2VITA 5D5MF 5E2WH 3EDEA 3JV6B 4PJAF 3P9LB 5ELIA 4PREA 3VXQA 3BGMB 4NWUH 3VXME 1S7VB 3MXVL 1ADQA 1AQKH 2PW2A 1UWGH 2EXYD 5GRUL 3WNKA 4FFZL 2BY3A 5KSBF 4QRUA 3GBML 1YNTA 2YHGA 4JFQB 4MWFA 4Q2ZB 3GEWB 4MNQA 5BXFA 4WY7H 4MJIA 3UTQB 3IDYB 1ITCA 3IFOB 4U2YA 3ZMRA 4KV5E 1DANU 4Z7WB 2YPLA 4EI6B 1CYGA 4ZUSA 3ZKXC 2CLRB 3RY5A 2VDLH 2WP3O 1NC2D 4AG4H 3FO9B 2BVOA 4PJGB 5CP3H 5I1GH 4OGXH 1I7TA 2D2OA 4XRCA 4QWWC 4FFYL 4TVPD 2ESVB 4F58L 4NQEB 4ENEC 5L2KA 4WGVB 1T2QH 1NAML 4PRPA 3C5SA 5FXCH 3WKNA 1QLFA 1ACZA 4K8RH 3UROR 4ZD3H 4QTHB 1WFOA 5ANMA 1U42A 4DKFL 4ZPVA 2ATPB 2YRPA 4G80B 3K8MA 1IM9D 3CVIH 3IFLH 5I1DB 3K74B 1B4JH 4XCNB 3GUTB 4Y5XA 2VDQL 3TYFA 2XY1A 3MV9B 3HS0A 3KPPB 1A22B 1QUNA 2P7TA 1J8KA 3DX7B 3NCBB 1I8LA 3DX6A 3DI2B 5HHXL 5I73C 5E0QA 5BZWB 1OTSC 1PJ9A 2XKNB 1AXSB 4OFVA 5F7NC 1FIGH 4XP1L 3LQAH 4UT6H 5CBEA 1TTFA 5GRVK 1BFVH 4R7NB 3C5ZB 2Z35A 3MOAH 3QDME 2NXZD 1XF3B 5C0AA 3CVHB 3MFFA 3V5HA 2QHLA 3SDCC 1HOCA 2D0GA 2KH2B 2FIKA 1CD1A 1J0IA 3DRTB 3TZVC 3RWDB 3T09A 4O02H 4IOFC 1U8JA 4OAWA 1FE8L 3BN9D 5DQJA 4LRIA 3TBWA 2OTPA 5JW4M 3IF1A 4U33A 2O5ZH 5GS0H 3UTTB 1X5GA 1RD6A 3MRQA 2XFXA 1HH6A 3AY4C 2ZSVA 1P7QA 3NFSL 3I85A 1XGTB 2VZ1A 4D3CH 4TSCH 2F8VA 3MLXL 3MREA 5I73B 1AGDA 5A2KH 4KXZH 3UAJD 5HD8C 1YY8B 5E8OB 3TNMB 3UTSD 3WXVL 5DK3A 2DTSA 1CF8H 3IDMB 1J8HB 3BPLB 2QADD 4K3EH 4OF5A 5EUKA 5FYLL 1K8IA 4L9LA 5T3XH 4LSUL 3BEWB 4OSUL 5HBBA 2HKFH 3TPKA 4OQ1A 2OTUA 3RVWD 4DGIL 4J8RB 1AH1A 3BAEL 1S9YA 1JTPA 4M4RA 3W9EB 4MJ6A 2RBLA 4LIQE 1FO0B 5FYKD 2OQJB 4TN9A 3GSXB 3S3PA 1FFPA 2YPLE 2XG5A 1IC1A 4Y1AE 3RVVC 2NR6C 1W8NA 2WWKT 3FOLA 5T3ZL 5D2NE 5GS0L 2PW1B 4H1LB 1RZJL 2VLJA 2NXZB 2QSCL 1N5AB 2XTJC 1XGUB 3MYZA 1BJ8A 1BLNA 3NPSC 2VABA 4LPXA 3C6LC 1PVHA 4XP4H 4WFED 4XCFL 4P2OD 4XWOD 1N64L 1QEWB 5EO1B 2CR6A 2X2YA 3QI9B 3MUY1 3HZVA 4YPGA 4P5MA 2XPGA 2OP4L 1RJYB 1RUQH 4PRIB 4NNPL 3SJVD 1YEHH 5A2IH 1MH5B 1TVBB 3LZFL 5C70A 3ARZA 1EBAA 1FFRA 5GRVL 3MRMA 2YD1A 3ULVC 5IBTH 3O45B 4X6CB 3G6JA 3REVA 1RFDH 4RNRA 3TVMC 1CICD 4MD0B 4I0PA 5J9PB 1B2WH 1MREL 1RUAL 5FUCE 1OP5K 3QCUL 3PDOB 4KVNL 1T5WB 1PKQB 3CCHA 5EU4A 3MC0A 1KCLA 3FQWA 3G6DH 2C26A 1EAPB 5B39A 2SEBA 1I9JL 4DW2H 4JKPH 4F8TA 5HPOA 4JFYA 4P9HC 1CK0L 2F58H 2YD8A 2A77H 4L3CB 5FKPA 3SGKC 2C3VB 2BNRD 1Y0LA 4JM4L 1IEAA 1VEOA 4HIHB 4LSSL 4A6YL 1LO3L 4MDIA 2X4SB 4A6YA 2E27H 3MNZB 4NN5B 4P5TB 2BDNH 4UILH 5GGTH 2MTPA 3ARYA 5F3BA 5E7BA 2J7LA 4MQTB 4KHTL 4RBPH 3C5ZC 3HB3D 1SMOA 1IL1B 4P4KA 4S2SA 2XQBH 2V2XA 5E8NA 4BFGA 1WZ1H 5CINL 5IBLD 1XR9B 4X6DB 1JZ8A 5GRUH 3BH8B 5F3HB 4HIXH 5J89A 5CKGA 2ZSWA 4HS3B 1AP2A 3QQ3B 1MFAH 2YZ8A 1AC0A 4HWEL 4LEOB 4PJFA 4OD1L 3OAYH 3VXSD 1NFDF 2PXYA 4NUJA 1IM3A 2HFEA 4ORZC 3SN6N 4X4ZA 4PG9B 2ICEA 4D9QD 4JPKL 4DFHA 1CFNB 1KJ3L 4BQBA 5DWUL 3MRPA 1NGZB 5FEBA 5IK3A 3ZDYE 1FVEA 4DGYL 1VPOL 4DAGH 4C83B 2AK4A 4LPUA 4L8DA 3OV6A 2J8UE 4OD2A 3X3GH 2QR0A 5EIIB 1V7MH 1EA9C 4OCMC 4XNUH 2H26A 3J7HA 4U6HB 3V4UL 4P2RD 2NY3B 2ZJSH 5FM5O 4LOUC 3KLSA 3B6SB 4HAFA 1BFOB 4UV7L 7CGTA 3MCKB 1SYVB 2IFGA 1DN2A 4OLWL 4ESKA 3UJIL 1OCWL 1F2QA 3B5GA 1BX2A 2Y6SC 5DJAB 3SE3C 2EZ0C 3V6OC 3OKEB 1FGNL 4UDUA 3DBXA 4ONHB 2ENSA 1KXQE 1FNEA 4XZUB 5KSAC 3CFEA 4KROB 4S1DC 4BFEA 4GRWB 4X4YA 4ORGA 3LB6D 3P77A 1JZ7A 1UM6H 1SEBB 2G5BA 5DD3L 4I77L 3WFHA 1AFVH 3BYYA 4GMTL 3MJ7B 5CBAA 1DJSA 2B8OT 1IKFH 4EKXA 5A16A 5IIEA 3V6ZA 3OAZK 5AD0A 4HKJA 3IDNA 4OIIL 3WO4C 3RIFF 4P2CG 4LHUD 1AI1H 3MGTA 2FIRT 1BECA 5C9JB 4C83A 1MRCL 2R69H 2KQNA 2B7DT 1SYSB 2R1XA 1GGCH 1KOAA 1NGZA 3BEVA 1WLHA 3KYOA 4PJHE 2Z8SA 3PDGA 4PRHE 1QNZH 4HGKC 1S8DA 3N1QC 35C8H 4LHUB 1G6RA 2VQ1B 3NA9H 5IMKB 1S9XA 4GBXA 1AQDA 1TQBB 4OZHA 3O0RH 1Y18B 1ETZB 5J6HA 1C12A 4DCQB 4U3HA 4UQ3A 3ZKXB 3IFNL 3RL1A 3I50H 1Q9WB 4RA3A 4GBXB 3N9GL 4Z0BH 5L6YH 1F6LL 1KLUB 3C60A 3QWOB 1J0ZA 1HINL 2NLJA 3BRFA 4Q6IB 2OBGA 5FA4A 4FMFA 1KV3A 2DLFH 4LASL 4TNWF 1TDQA 3KJ4B 4YHYC 5CJ5A 1AD9B 2VAJA 3QWQB 1SMAA 4CVWA 3B9DA 4I0CC 3U83A 2WMPA 4PJBE 4WU5B 1G7LA 5C08E 4HF5L 4LDEB 3O4LA 1AR1D 4RFNB 5DHVB 2PCPB 4TVPE 2C3VA 5F8RC 1EHLL 3SE9L 1EZVX 2A6JB 5K9QG 3AC0A 5A16B 4OCRH 2VWEC 3H3PH 3IAQA 5EBWA 1Z9MA 4AJ0A 3O4LB 4NZDA 4LPCA 5FECB 1CL7L 1CGTA 3CFIC 3U79A 3VMOA 1QBLL 1IQDA 3DXAE 1UQSB 2P8PB 4E9LA 4K7PX 1BBDH 4B5EA 4XNZC 3A6BH 1AXIB 8FABA 3SBWA 4HBQA 2HT2C 4YNYA 4QYOB 5FA4B 4B0MM 4G5ZH 4JPIA 4PGCA 3ULSA 1F6AA 1RHHB 4YWGL 3NCEB 4JFDA 5EIVA 4M1GL 5SX5H 5CLTA 5TQ2L 4WEMB 4YEFA 3T2OA 1IGFL 4PBXA 3L7FB 1J1PL 3NN8A 1NGWB 4PJAA 5DD0H 2EKJA 3QFDB 4M43L 2EIBA 4WI3A 1FG2B 3WSQH 3MGAA 3SQOL 3LKQA 5EBGA 4KZEH 1BVLB 4A2LA 1LP9B 3QRGH 3S35X 2YPKB 1W72B 4D8PA 3KPNA 3MJ9A 2DOCA 2FEDC 5GGTL 2MSPA 3G5YA 5SX4I 5E99L 4OD2B 2V7NA 3X12A 2FBJL 2H2PC 2W91A 4MXWH 4XMKL 2DWEA 4QOKE 4PUBH 5FO9B 2HMIC 4P46B 4X9HA 4Y8DC 1NGXB 1RIUL 3DGCR 1OOAA 1JRHH 3I3DA 5IVXF 4UI2A 4PY8I 1MCCA 1N59B 1ZHNA 2P5EA 3NAAL 3QWRA 2V5SA 3G08A 4J3VA 4XX1G 2ZCHL 4U1GC 3P4LA 3REWA 3KDMB 4HUVA 1YPZE 5I6XC 3LEYH 2PR4H 1WIOA 4NJAL 2ADFL 3REWB 2V2XB 5E8NB 1QSED 2YUZA 1PGRB 1EPFA 1HEZA 3FB5A 1RIHL 4JO1L 4X6EB 4WI4A 5IW6B 5EZJA 4KK9C 5FFLA 5IM7A 5EDXA 1X5YA 4KJYB 4HUNB 2E9BA 1NDMA 1ZT7A 2WK2A 3GGWA 4KY1H 1TJGL 4ZD3L 3ZTNH 3P4NA 2RAMA 4JCMA 4K3HA 3SKJH 4LSQL 1CZ8H 2MKLC 1T0PB 4JY6B 2GQHA 4ZAKA 5CHNB 1U2CA 2EYRA 4ONOA 4PJ9B 3TA3D 1L7IL 4Y7MA 2VXTL 1U8IA 2FX7H 1JNLL 2CJUL 4XP9L 5B8CB 5C0GB 4GAYA 2Z35B 4EI5D 4JM2F 4P46D 4U1SA 3RBGA 1E0OB 2A9MH 5T1KA 4P23C 2EDOA 3QFDA 1FAIL 1TJHL 3BPOC 3G9AB 4WY7L 2B1AH 2WNGA 4UTAH 3RP1A 4ZAKC 3W39A 3B43A 1PKQE 1NSNH 1AGCA 1N6VA 3QUZB 1MAJA 4MD0A 1DFBL 3MODL 4O9HL 2AP2A 1MIEH 3CLFH 4D0DA 4RNRB 1R5VA 4LCWA 1YNKH 5FO7A 1TJGH 4OZGE 4QXUH 3INUL 4JFDE 4HWBL 5D7KD 4HS3A 1JBJA 3W9DB 1VENA 1ORSA 1OGAE 1IEHA 2PF6A 3QO0A 3SE8H 1OT2A 4CBPA 3K8LA 1UCBH 1OAYH 2YPLD 4I77H 5BVPL 4ZPVB 2R0WL 4K3JL 1Q0YL 2NW3B 3O2DL 1KYOK 1WSST 3ARVA 4Y4HB 4MQ7B 4YAQA 1A14L 2PCPA 5IB4B 3CSPA 3VFGH 4Q6YA 5FYLE 5HYSG 1R3HA 4LCUA 5C09E 4ODVL 2DQJH 4RDQG 2NY2C 1Z9LA 4PJ9D 1TZIA 2KBGA 5TF0A 3WIHA 2YRLA 3QZWG 1K9TA 5IQ7H 1FVDB 1G7IA 3VFTB 4YHOL 1YN7B 1OGAD 5D7IA 4QXTB 1P7KA 4HUUB 1I8IB 4XP1H 4PJ5A 3UZQA 1MCJA 1KJMB 4M93B 4HD9A 1JPST 3SE4C 3LSOB 3BQUC 3ZYIA 1G0DA 1NC2B 1HWGB 5HXMA 5LCVL 1BFVL 5DR5L 4YGVA 5EA0L 3VE0B 4Y2DD 3IFNH 3ZDZE 4S1QL 1UWEH 5E6IC 2AERT 1EH9A 4Z7WE 1S7VA 2KZ1B 5D6DC 1NGYB 3VFPA 4KRPD 1UXWB 5E56A 5C0DB 4P99A 2LV4A 4LLYB 1ZVHA 2DD8H 4H26B 4GRMA 1TVHA 3LEXA 5EORL 5K93A 3EYOB 4PTTB 4YC2C 1QFUH 4KK6C 1N7ML 2W0PA 4R8WL 3SE3A 4KKBC 5JXED 1BBDL 2DBLH 4GW5A 1A21A 4MD5B 3QUMB 4JM2A 2X70B 3S5LA 1RK0A 3MV8E 3NIGE 3NZHL 2AVGA 4XAWL 5HYSB 4R7NA 3BDXA 3F12B 1MJ7H 2VZ3A 4RISH 3LV3A 5EOCJ 1RUMH 3EO0B 3L3JB 1XH3B 2AEWA 4UNUA 2RFXA 4M7LT 5L0QC 1RUPH 3AM8C 3ZYZA 5CJOH 1PSKH 3CUPA 5AUMB 1BEYH 3GM8A 1B6UA 4O4YL 4XZUA 1EJ6A 2F5AH 3DBXB 2D03H 2B0SH 2CLVB 1QRND 2B2XL 4OFIA 1UXWA 3LS5L 3BMVA 2YD4A 5DRXA 3T2NH 1M4KA 1PQZA 2IAND 1A2YA 1MI5B 2A9NH 3EJZC 1MJ8H 2R8SH 2JIXB 1PQZB 1P4BH 4TRPH 1O0VA 5GGSB 3TBVB 2CO7B 5C2BH 3MR9B 4I3GA 4QLRA 5DHYA 3P73B 5KAQG 3LVEA 3BDYL 4HUUA 1IAOB 2YKLH 3MUGB 2YK1H 3FHQA 4NWUL 3TBYB 1I3RB 4LDOB 4NNYA 1XZ0B 4JZNA 3O4LE 5CP3A 5ESVA 3WL9B 2GIYA 1X4YA 2DQCH 4Q74A 1EEQA 1FAIH 4U1MA 4XC1L 1CICC 4NHUA 3PG2A 5FGBC 5HYSA 4C4KT 2H32B 2EE2A 4AEHL 5D7IE 4F7PB 5F8QC 2GKIA 3UPAA 2XI9A 2CXGA 1XGYL 3C87A 3KPLB 5BW7C 1RZGA 5BRZA 3BI9X 3BH9A 3L3DA 5GS2D 5K9KB 2EDYA 3WUWB 1ZK9A 4OT1L 4Y1AA 4EVNB 4O2EA 5AEAA 3KPOB 2AJZA 2VMFA 1DUZB 4TNWK 5HDBE 4Y19A 1BJ1J 3IDYC 3CXDH 3CK0L 4WI5A 4PRHD 3PP4L 5F89A 1NGYA 5EB9A 2HT3C 3BW9A 1QR1A 3K4AA 4R97C 4YIQA 4PG2A 1ZHLA 4UOJA 3VI3F 3HI1B 4LKCB 1T1WB 2PO6A 4XVUC 1HYSC 2Y1VA 4M4PA 2HRPH 5TE7L 4PRHB 1A4KA 3IT8D 1P2CB 5DJ0A 2VLME 5CD5D 1ED3B 4H20L 3QR2A 4AEHH 4Y2OA 5B8CA 4GG6A 2JCCF 4ZMAT 1U8IB 3ABZA 5LBSH 1N5YH 1SBBA 2J88L 1OGTB 1BOGA 4XX1E 2Y06H 1A4KB 1JFQL 5C86A 3G5ZA 1FZJB 1ZHKA 2ZPKH 2IANB 4LFHD 5DD1H 1MLCB 3VWKB 4DGVH 5T3ZD 5SV4A 2CUIA 4DKDC 1I3GL 4XVJH 1NLDL 3EFDL 1NCDH 3VFNA 3THML 3VRJA 2DTMH 4JPKH 3RGVD 4N0FB 1KULA 1MHHA 4NOBA 4EUPG 4P5MB 4H88H 4K7PH 3T0EB 1U3JA 1MQKH 1OT1A 2R1WA 1DVFA 3BWAB 4Z7VF 4YK4C 3AY4A 1IMHC 4LIQL 5HYJA 4DVBA 2DIAA 1LEKB 4NNXA 4M8QB 4NN6C 4DKAA 1TVDA 2CGRH 2OL3L 4QO1A 4IRJD 1TQBC 1R5VB 5F7YC 3U6RB 4K8RC 4NN7B 5KSUB 1EVTC 1J10A 1HSAB 3JUYA 2IPKB 5D2NA 4LFHG 2FO1A 3MLTB 4WWKC 3WHE0 5DVLA 1NGXA 3DETC 3I6LE 1AO7A 2JIXD 4IBLT 2XWJB 4OI7A 1XMWA 3P0VL 1EEZB 2MNUA 1EUTA 2V7HB 2JB6B 3H9SB 5JNYA 3TBYA 1JI1A 3S5LB 2X70A 2HG5B 3GMNB 5BS0A 3X12B 4J8RA 2WUBL 3PWUB 5I8EB 3AMLA 2JTDA 3PQYD 3VU2A 5JPMA 2CDGA 4ENED 1D5XA 2GCYB 1RZ7H 1Q9OA 1U36A 2P24B 4J23A 1KJVB 2ZUXA 5H94A 2HN7B 4YDKL 3SE9H 1WIPA 5CIPA 2FATH 1KC5L 3OL2A 1TNNA 4N0FA 3KYMB 3VFPB 3QIBD 3GMMA 1ZT7B 2CGRL 4WI6A 5C71A 3K3QA 3B9AA 4RWYH 3TGXA 3D39D 3O3EB 1H5BA 1F2XK 3U1SL 3ULSB 4KROC 2X4QA 1D5MA 1T04A 2YBRA 3T0ED 1LE5B 1FZJA 5GRJH 3TT3H 3RDTC 5DGQA 2Z92A 4TUKH 1I7RA 5JOFA 4HIXL 2VLKE 4ELKA 1AGBA 5T1DH 5EUOE 2DJ4A 1CQYA 4UOW0 2I25N 1ODAA 2VWEE 1IE5A 1TJIH 4YFDB 4WFHD 1RUML 3EJZD 4R4NC 5B4MD 3EIFA 3QHZH 1H9VA 5DJ2B 1FQ9C 3QEQD 3ES6B 3QDGB 3OAUL 1RUPL 2VISA 4WV1C 5DHVA 3DMMB 3VJ6B 4NQED 1RZKL 5KSUA 1UKQA 2AQ1A 3E2HC 4YDLC 3GSNB 1B88A 1P6FA 1OTTC 5DUMH 2YD9A 3OJVC 3GRWA 1FYTD 4LRNL 3W5NA 5LGHL 1W8OA 5E8DH 3SKNB 3ALWA 3ILPA 4QT5B 5C07B 5KTEH 1T7VA 2AJZB 1X4ZA 1MJ8L 4YFEA 5JORB 4Y1AB 3B2VH 2YKLL 3B9KC 4JFPA 3DNKA 3U7WH 4CN4A 3ZKMC 3RTQD 5F72S 3L9RB 5HHOD 4DCQA 4TRPL 1HSBA 3NN8B 2EC9U 4OTXH 5KW9H 2K1MA 3W5MA 4ODXB 1EGJH 1B4RA 1F6AB 1RHHA 3EDDA 4OB5L 2BVOB 4G9FA 3W11D 1F4YH 3I6KA 1FLTX 1J8HE 3MRLB 3NFNB 1QD0A 4OCLC 3DVGA 4OGYH 5ESVB 1HCFX 5T1KB 1QLRB 25C8L 5FCUL 3SE4A 3BQUB 1JWMB 2FJGA 2VLRE 4WRLA 3RI5K 5IVXE 1NH6A 4G8GB 3S5LG 4LCYB 1IGFH 2H1PH 3EFDH 1QSZA 2EDHA 1X5XA 1KPUA 4JAMA 5HGGS 5D93B 1NCBH 2FSEA 5SWSD 4FXGB 3QA3A 4YE4L 5E8PB 5F70A 1F3JB 3B8YA 3PGDB 3KLDA 3GJFA 1A6WL 5I71C 1NDMB 2PTTA 3UMTA 2FGWL 3NIGF 4ZODA 1EGJL 5EU3B 4ORGB 3FQXA 1TITA 3TIDB 3A67H 2QADB 1KYOJ 4LARL 4L4TB 4E41B 4F7CB 3QWOA 4ONHA 1OQXA 4QRRD 1JRHI 2CPCA 4U6VL 5J12C 4UTBH 1JWSA 4IOFD 1Q9WA 2ADFH 3B8SA 2NY6B 5ECJE 3KPLA 1DFBH 5FHBH 2JJSC 5CILH 4HUMB 2BVYA 5DVKA 2FX8H 2W65A 4LSTL 5I1JH 5IG7A 3JWDC 4NO5A 3BMWA 4QHUA 5E2UL 4GW5B 5ADPL 2V2TA 4YE4H 4O58L 1XGPB 5GS1A 2EDLA 4WV1B 3WL9A 1DUYB 1WT5A 4OZFB 4KTDL 1FZKB 4UU9A 4M7ZC 1QSFD 2M8XA 5FO9A 3KPQA 2DWEB 5DUPH 3MX0A 4ELME 4H8WC 3MGTB 2EECA 1F3DH 3GBNL 4QRRB 1EHAA 4JGUA 4YO0A 3RY4A 4KJQD 3SCMC 1QSEA 1S3KL 1WTLA 4XNMB 3S6CA 2XA8L 1T3FB 2LABA 3O3DA 3ILQC 2QQLH 3EAKA 3JWOL 4X4ME 5DO2C 1AP2B 3HAEH 1QRKA 4EXKA 2YRZA 5CJ8A 3CSGA 3K1KC 3ROLB 1TQCB 3TBTB 2YOCA 1VHPA 4C58B 3N1FC 2FHCA 1JF1A 3TEUA 5IEHB 4HUVB 1G7MB 2ICCA 4GBXC 1B90A 2A73B 4Z0XB 3QUML 1UCTA 2AXFA 5IFJB 5JW3L 1DBKH 5FYKE 4XHQA 4ZFOA 5IOPB 1U8KA 4JFFD 5EU3A 3G5VB 3QH3B 3VGDA 5K59E 2VQUA 1UB6A 3QEQE 5DJAA 3U0PB 5IMOB 1T03L 3MZGB 4FG6D 4W68A 3QULB 4EI5A 1IEAB 3K1DA 6CGTA 1T1XB 4TVSa 3HG1D 4KJPC 4YAQB 4J1UB 2V7NB 4YQXL 5LAXA 5AYUH 4BZ1L 1F97A 2DLEA 2YXFA 5CD3B 2CR3A 5IVXB 4L5FL 4JVPA 1I4FA 2AABL 1NCNA 2NZIA 4HC1H 4ERSL 5SWZA 2BSSA 2FBJH 3ULUC 2H8PA 4OLVL 4NN7C 3MOBH 4WO4C 4LEXH 5D7JC 5D1QC 3PXHA 1QBAA 1XCTB 4RGOL 1YEKL 4JO4H 2OTWA 4BK5A 5L2KE 3EOTH 2ZP0T 1M71A 2HTLC 5HYFA 4Z7OF 3X14A 4MXQC 3VA6A 1IM3B 1CFTB 1RULH 3HNTL 5FV1L 2GTZB 5F71A 4PGCB 1I3UA 4ZUWA 2AEPH 4YGVB 5T3XL 3VE0A 3OKNB 5FYLD 2VXQL 3A6CL 5DA4A 5T1LA 1YEFL 1UA6L 2B4CL 1KNOB 4EN3A 3FO0L 2Z0BA 1RZIA 3K0WA 1J1XL 3R1GH 4ZO8A 2YPVL 2KDGA 4MAYB 4AMKL 1ZHBA 2DQDL 2RJMA 3P4MA 5CCKL 3MRRA 2LVCA 4M1GH 2F54E 3SO3C 4J4PC 3N85L 3V4PL 3A6OA 3MV8D 1GZPA 5LCVH 2V17H 3EOYG 1FRGL 4Y4KD 2OK0H 1A47A 1TTUA 1KTLA 1OGAA 3D87B 4LEXL 5ESAA 1FNFA 4H1LA 1YJDC 3GSNA 1EFQA 3PV6A 2WSKA 4M62L 2E7HA 3TLRA 1A1OA 3HUJA 4WI9A 5GGRA 2VZOA 3QDGA 1JGVL 3PWJA 2NY0B 4XCFH 1GAFH 1D5ZA 3TO2B 3CH1B 3C08L 4L1DA 4RISL 5I1LB 5MEQA 2HLAB 3KPTA 4DZ8B 4ZO7A 5FCSH 2P5EE 4W81A 2CJUH 1ZWIB 4OFKA 4U1IB 4XP5H 1MFAL 4EN3B 3TJEH 5J11B 4KQ4L 5KVDH 4X4YB 3GMOA 1D5MB 3ARGC 5J0BA 1NEUA 2FX8L 3H42L 3MREB 1H5BB 1ZHNB 2ED8A 3IRZA 3PQYB 2E7MA 4NM4H 1XGYH 1YEJL 5JXEA 4LKXB 2IADB 4L8BB 4TUJB 5D1QA 2X42A 4M1CD 4Y5VA 3FT3B 5F9WB 3V8OA 1UWXK 2R56L 4OFYA 5E70A 3AFLA 4I5BA 4OD3H 5E2WL 1UACH 3G5YB 2ADIB 2DQIH 2RB8A 4PR5A 5F21B 4QHLB 2KPNA 4LLQA 3AMKA 4M1DH 2V2TB 4FQJL 4PGDA 2WANA 5C92A 4F3FB 3CVHH 4GXUM 2VLJB 4NZUL 2R29H 2XA3A 5FYJU 3FOLB 3STZB 5L9DH 4Z7OE 4PJAB 1HNGA 1PG7W 3S36H 2HTKD 1AD0B 1HH9B 1MCHA 5D7SH 3PGFH 4LCCA 2FJFA 4NM4L 4E41A 4E42B 3KR3H 4M8QA 4MMXC 3LIZH 1OD7A 5TDPA 1H3XA 2DQFA 3GUTA 5FOJA 2BSTA 4POYA 1KJ2H 3DURA 3VXUD 5GZNC 1CBVL 3RDTB 4KK8D 1UM6L 3IU3A 4MVBD 3IJSB 5DMGD 1CGWA 1IC5H 1X44A 5F6HJ 3V5KB 4XPFH 5CD5C 1ZXQA 4L4VD 3LY6A 4K7PL 2XV6B 4G8GD 1BPVA 4HWBH 2OR7A 2VLJE 2VH5H 1Y0LB 5FB8B 1YMMD 4LCIH 2FX9L 5ACMA 3DRTA 4LVNB 5F6IC 4KK6D 4XPGH 1RAMA 3OHXB 1U3HA 2YXMA 2BFVH 5IG7B 2DIBA 4YBHA 5DJYA 5JW3H 1C5CL 2EXWD 3IJYA 2PETA 1HKLL 4OZ4B 1A9BA 3L9RA 1CGUA 1OAQL 4LKCA 3VFVA 4OCWL 1A3QA 1KN4L 3UPRA 4ELMF 4EQ2A 4HFUH 5DEZA 1Q9KB 2AJUL 2DLFL 5L6YL 1Z3GL 1MRDL 3T0XA 3GB7B 4XNXH 4BYHA 5H8DA 2FHBA 2B0SL 2JE8A 3ARBB 3ARFD 4PJEB 4EZMA 5HHQA 4Z7UA 1G9ML 4Y19B 3TNNA 3HB3C 5CJBA 3DIFB 3RWGB 4YDKH 5KSBA 3OBAA 4JLRA 2ATPA 1HDMB 2V9RA 1MFEH 4NOFA 4X98A 4NQDA 5BVJB 2NMSA 1KPVA 1S7QB 1NBVL 2M26A 5DTFB 2CDEA 5CD3A 4YH6A 3HNSL 4Y19E 3OSKA 1NGQL 1BLNB 2UZIH 5F44A 3D2UD 2ZNXA 4K7PY 1V8HA 4KZDH 5E7FA 2LE9A 3C08H 3C8KA 3V2AR 4NHUB 3ZT6A 1DP0A 5KVEL 1LP9F 4IRSC 3PNWB 3KLAA 1UB6B 1QNZL 4GLRH 4KPHL 5JLZA 2WUCL 4UQ2B 4PV8A 1FO0H 4KXZI 2ZUVA 5FHAH 4AIZB 3FQRA 1CFVH 3KPSD 4RZCA 3O9WB 3QUXA 4U0QB 4FZ8L 5H2BA 3MROB 4HG4K 1MFBL 4M6AA 1G7MA 3FTGA 4U49A 2IBGA 2FEDD 5HYIA 1ZLWH 1IC7H 5C0BA 3U4BH 1BP3B 5I76B 2Z9TA 1K8IB 3NH7H 4AMKH 2AV7A 1E6JL 1MFEL 4J4PD 2OJEA 3SDAA 3R4DA 2X4PB 3EKCA 3QT2A 3VD3A 3ZKND 1ZLSL 2ID5A 3RIFK 5B3JE 4IM8A 5INCA 2VSCA 3EJYD 1AO7D 2OR9L 4MZ3A 4JFXA 2YA2A 5KVEH 2HFGL 2DLTA 3KPQB 4M5YL 4XPAL 2PW1A 1XGQA 5T3ZE 1FNSH 1GAFL 3CU7A 5HGAA 2NW2A 4EJ1C 1XCQA 3GSVA 5DJ2A 3PIQA 5TQ0H 3V6ZB 1JGVH 3ESVF 1HYSD 3O4OC 1QACA 1E4XL 5DVOA 4KHXL 4PRNB 1DE4B 5I15H 3L3HA 5HVGB 3PWVB 4HKXA 1S7WA 4U1KA 5JQ6H 3T3ME 5E1AB 1LDPL 4HH9B 1A0QH 1U9KA 4B50A 3BZDA 3ULUE 4XH2A 2VE6B 4X7TB 4TNVK 1PLGH 1XR9A 4X6DA 3BZ4A 4U1NB 2A6KA 1IL1A 5D71L 1L7TL 2HT4C 3BKYL 3T0EA 3JWDL 3MGOB 4MNQD 1GGBL 3MFGB 4GRMB 3OKEA 3JUZA 3TA3C 1LO4H 3H42H 3CC5B 3R8BB 4DQOL 2Y7QB 2LFGA 3IDXH 1J86A 4QWWD 1J1OL 2HKHL 4GRWH 1L9MA 4OLZL 1CVSC 3MCKA 1UXSA 2AKRB 2C9AA 4PJCB 1VCAA 3FFCA 4ZTOH 1CWVA 1U8JB 4PIRF 1BZ7B 1Z2KA 1WBZA 2Z8WC 4M7JL 3HPJB 1NKOA 4JFYB 4NQEA 4CW1A 3DV6B 3MA7A 1R3IL 1UH2A 5KG9B 4C56B 4YXHH 1ED3A 2FJGB 2V7HA 4X0KB 1JWMA 1I8KB 2VXUH 3P11H 5D1XD 4F80A 4LHQB 4OCSL 4IRJC 1EBPA 5I74C 5D7JB 1GOHA 1LWRA 3T1FA 3TN0D 2X4NB 4L3EA 3OPZH 3UTPD 3O2WH 3H7BA 2R2CA 3G6JB 4JRXD 4NGHL 3QJHB 4YDIL 3REVB 4DN3H 1H3PH 4LBEA 3UTQA 5HHOA 2E7CA 1Z3GH 1VERA 4Z7UF 5HHNA 4I18B 5FCUH 9CGTA 5F3HA 4G8FB 1MFDL 3SE8L 4ZTOL 3HR6A 3MRHA 3O2VH 2CIKA 2FGZA 3L6FA 4LSVL 4R90H 3VXQB 4TOYH 3UZVB 4PLNC 1D6VL 1NCDL 2GAZA 2P43B 43CAB 4Q6IC 1HZHL 2DTML 4PJHA 2MCPL 4KQ3L 4XPFL 4XVSH 1KIQB 1OARL 5ALCH 1KGCD 3WS3A 3JWOH 3D6GA 1NC4A 2FWOA 1KT2B 2L4OA 3UTOA 2G75A 5I1KL 2FGWH 4KGLA 3BPCB 1U92B 1Q94A 1I9IH 3O2WL 2DQUL 2QQNL 1QLEL 2DLGA 3O4OB 4QRPD 1Z0NA 3IS1X 2YPLB 2SEBB 5C0GA 4QOKA 3QUYC 4D0BB 3FQWB 3VFWA 4YGAB 3VCLA 2MFNA 1HE7A 4KTDH 3H9HA 3BZEA 1U8LB 2J2ZA 5LQBL 3F7VB 4EDXA 3RUGB 3ARFC 2NTFB 3MXWH 4BM7A 4U3CA 4ODUA 2EO9A 2ZSVB 2EC8A 4JO2L 1KB5B 1C5DB 5F89B 3P9LA 1DZBA 1DBJH 5IM7B 1UCBL 3H3KA 3E3QE 3QBTB 4HH8A 1HEZB 3KXFD 3RWJA 2JCCE 4U6YA 1A7OH 3BP4A 3DLQR 1QFUL 1YEDA 4JDTH 5IW1A 5C9KA 5JIIA 5K9KA 1U8OB 1UENA 4PJIE 1K4DB 2J3SA 2XNAB 1CXEA 1DN0B 3EO0A 1AY1H 2E9JA 3PWVA 4HKXB 2VIRA 5BV7L 4MNGB 1UH4A 3ILQD 1B9ZA 3CSYB 2CIKB 5KZCD 2LU7A 4C57C 3EOBB 4K3DL 1YDPA 4KHXH 3PIQB 5MEND 3BPNB 1FNGA 2NX5D 3GSVB 5LQBH 4G8FA 4RFOL 4CVUA 3HE7D 3GSQB 4BA8A 4HBCL 2IBBA 4QTIL 4UT9L 3UCRA 3EO9H 4NNYB 1A1NA 4RX4A 4G8IA 3PDDA 4MA3A 2UYLA 4NUGH 1BFSA 4L5FH 3ZYOA 4YFLI 2V17L 4PTUB 4WUKH 2OK0L 4JJ5B 3SKUD 5A2FA 4HC1L 3K8KA 2OXGA 4HC1A 1DVFB 3T4AA 2DWDB 5ANMB 1BF2A 3IDJA 4YQXH 4O00A 2CH8A 4PJCF 1QSVA 5BV7H 3VRIB 2XICA 2V9TA 3K4DA 4X6BA 1CLOL 1EO5A 2VUYA 3EOAB 5DEGB 3BGFC 1KN2H 3B9KA 5D7JD 5ID0B 3P9MA 2P46B 4GW4A 3PJSB 4MJ2A 1NJ9B 3QG7H 1UA6H 2NY0D 4XWGH 1JGLL 2XQYK 5C0ND 3ULVE 3CU1A 5JQ6L 4UIMA 2BMKB 2P4AB 4U0RB 1ADQH 4Y88A 1BOGB 3LKNB 4LCUB 5IQ9B 1DQJB 4WW1A 3C8KB 3H9SE 4YHLH 4Y4KB 5E2VL 5D72L 5D5ME 4NGHH 1T0MA 4KUZH 2C5DC 4UIKL 3T3PE 4HH9A 4P4KD 5A1AA 3K46A 1DBBH 2XRAL 4O51B 3VG0H 5IHLB 1KCKA 4MA7L 3BVNA 4R26L 2OYPA 5D1ZB 5C0JB 1WGOA 4WHYH 4OCXH 3ZKQD 2W0LA 3W9DA 3C09B 3GFUA 3CVHL 1XCQB 4U7KA 4R6UA 5ESQA 4K7FA 3CXDL 2W60B 3VFUB 4LCWB 3QNXA 3RIAF 1JPTL 3TO4A 2I27N 1P69B 2X40A 3W39B 4PJ7E 3HCVB 4G42A 5C08D 4XBPB 4TSBH 2BCKA 4GKZA 5H35B 2A1WH 4M7LH 5IF0A 4ZPTB 5DO2D 3S3SA 4IS6A 3KR3L 4BQ9A 1NAMA 1I7TB 3TA3B 2P5WA 1IGTA 1BMGA 3QUXC 2AQ3A 4WHTB 3OZ9L 3QUMH 3Q6FA 2G5RA 3D5OF 1TZIB 2Y06L 4JZNB 2VL5A 3CDCA 1OSZA 1AGEA 1MUJA 2F53E 1QHPA 2ZPKL 3SDCD 5C9JA 4F58H 1M7DB 4U1LB 4FQJH 4ZS7H 1IKFL 1BZQK 4ODBD 3MRJA 3WS6C 3TBSB 1DLHB 5D6DA 1WITA 4HIIA 2ENYA 1LK2B 3LH2L 1OLLA 4FN0A 4IJ3B 3LN9A 5ERWB 3RX8A 4GLRI 5K9OA 5FDWB 4LVOB 5IBUB 5TJWK 3U0TB 4HJ0C 2PW2B 8CGTA 3LD8B 2W9EH 4MQXC 4N0YL 3FN3A 3TJHC 1RSFA 1MCSA 4FP8L 1QFPA 1ORSB 5FYKL 2APFA 5HTSA 2C1PB 4YHYB 2J8HA 2QBWA 4AT6B 4NQDB 5BVJA 1DVFC 3KLHC 4DFIA 1L9NA 3CZJA 4JFHD 1JPSH 5EIQA 4JO3H 1S9VB 1LEGB 3QZWB 3QI9C 1KF9B 1SEQL 5CJQL 1CBVH 3DUUB 3LD8C 2P8MA 5AAMA 1V3LA 2BVTA 5GJSL 3UTZA 4U1SB 4WGWB 2H9GB 1F42A 3L5IA 5JHDB 4QXUL 5L2JA 4R0LB 3WDIA 4LNRA 4XNQB 2J8UB 1VDGA 3ISWA 3JWNC 2GITA 4JPVH 4ZAKB 1R3KA 5TE4L 1NLDH 1XIWC 2AK4B 2K9UA 3QXDA 1MRFL 1T03H 2ZUQB 1YN6A 5BJTA 2LAAA 1CFBA 4M3JA 1ACYL 4LCIL 1GIGL 4ZXBB 3FOMB 4Y5VB 1NGQH 2UZIL 4OKDA 1N64H 2X4UB 2BVUA 2E3VA 2B5IC 3JSSA 2R9HC 5F7KC 1DBJL 4X6EA 5I30L 1SEQH 5KBNC 1R3JA 4XMKH 2EDTA 4TUKL 2JLLA 5DLML 5INDB 1A1MA 4QF1B 5DA0B 5CUSL 1N3NB 4FZ8H 1EFXB 1YEKH 5GS1C 3QDMD 5FO8B 4KQ4H 5D96C 1MRDH 2Q7YB 4PJXF 3V79C 1JN6A 5EBWB 4Y2DB 3MMEA 4P23B 4NUGL 3T1WA 2J5LC 4BSVB 1R3LB 4M03A 3HZMB 5BOZG 3HI5L 1WWWX 4NWTL 5HJ3A 4L4JA 5L0QB 4R4FL 4S1RL 1HWHB 1PZUB 4KUCF 1RZJH 3CFCH 3QB7C 3FB6B 5IMLB 2X4SA 1H3GA 3MRNA 1EVUA 5CEYA 4NKIH 5ESAB 3MV7A 2J8OA 3HMXA 4P0DA 4QTIH 4UT9H 4RMWA 3D48R 2ZKHH 3CH8A 3VXRB 1BQHG 4QGYA 3OXSB 2ZOLB 3ARDB 3RDTD 4CDHA 1Q8MA 3NCMA 5LG1A 1K4CB 4APQA 3KWWB 1U91B 2BY2A 1XF5A 1BQUA 4I1NB 3GJFH 1H8OA 4J3TA 1H3VA 1T0NB 1F8TL 4L8SB 1YN6B 4OF6A 1R0AH 3QNYB 3QXDB 1L0QA 2G2RB 4TPRH 2DM2A 2LAGB 2GJ6D 2HJLB 3WEXA 3LRSA 4RWYL 5J6HB 4PRIE 3O6FA 4POUB 4TSBL 5HPMB 1FNLA 1S9KC 4S11A 1LO2L 5IROC 4XNQA 3ULUF 5C07D 3PL6A 4NQDD 4CRPA 5TF1H 3FZUC 4ALAL 3B5HA 4GH7B 2WIIB 3MRMB 1YUHA 3HE6A 5F1OB 3JV4B 4ETQA 3ZDXF 3FT4A 3PP3H 2X41A 4F7MA 2H3NB 4HKBA 4LKXA 1TJHH 3VFRB 4LSRH 1OTUD 4GG6E 4P9MH 3TVMA 5KVDL 1P4LA 1I7ZA 4R26H 4L4VB 2Z31A 3LS5H 1NCBL 3B9EA 1J1OH 5IBUG 4HKJB 1FVCA 5J4MA 5CHNA 2XRAH 5CIPH 4JM4H 4KDTA 3BIBX 1M6OB 5GGUA 4MA7H 3QNYA 1TETH 1EO7A 1INDH 2IG2H 2GHWB 4CADA 3ZL4H 3HZKA 3RZWA 1NCUA 2Q76B 2HLAA 1VGKB 4TULH 2ZZUT 5HY9B 4XNUL 1JGEB 3M17A 4HSQA 3O9WD 1KIPA 3NTCL 3V9FA 1LE9B 4JFOB 4J4PA 1UM4H 4RCAA 1VEMA 3TBSA 1A9EB 2DQIL 5DFVD 5IHUH 4GQPH 4RGNB 4XBEL 4AIXA 2XKUA 1FNEB 4UTBL 5HVHC 1S9YB 4P9HL 2BSRA 3O81A 3W9EA 4HG4J 3ARSA 4JDVA 1JF1B 5IEHA 3HLAB 1I1AB 3H7LA 2CRZA 2Z8VC 5CJQH 3IDMA 4OSUH 2H32H 1RIVL 2OS7A 5KSVA 4MJ4A 4CJ0A 3ECBA 4CMMB 5IEKB 4ZAKD 1UH3A 1N3NA 1J11A 4F9LA 4B41A 5DD3H 1KELL 3INUH 4ETQB 2HH0L 1HHKB 3P30L 5DYOB 5D1ZD 4F15B 4P57A 1WV7T 1ZSDB 5DR5H 5DHVH 3JVGA 1YEEH 1U8MA 4FQXC 1DUYA 2EYSA 5DUPL 3QDMB 2JJTA 4KV5F 2DL9A 3D9AL 2X4OB 3LH2H 1I85C 2PNDA 1NBVH 1RJZA 4G6AD 3EFFB 5EU7C 1XF3A 3GBNH 2Q3ZA 5B39G 4PGEA 4MHHG 1A14H 4EIZC 3FMGL 4TTDC 3VGGA 5LXGL 2WWMC 1I9IL 5M95B 4M7JH 1FZOA 1SEBA 2G5BB 3EYSH 1V3MA 4Y16C 3BH8A 3VI4F 2EZ0D 2R39A 3L7FA 3DV4A 4PJBA 1M05A 3WO4B 5HSFA 3SDDC 4HPYH 3NA4A 4ZOCA 1T0MB 2WBJB 4AYFA 3VXRD 4JPIB 4NZRH 3FFCD 3ARGD 5IMLA 3TC9A 1OP5H 4UDUB 4WUUD 3I50L 4Y5XB 2NCMA 5IB2B 3DRQB 3QFJA 1YY9C 1I3GH 5GJSH 2LU3A 3U4BL 3O2VL 1ERNA 3K2UH 3Q5OA 2JB5L 4Z7UE 3GMRA 4AEEA 5D1XA 5KSAB 1NFDA 3OXRB 4HS8L 2VR9A 1R24A 2EH8L 3GJFK 4ACPA 4JFHE 3CFDB 1U41A 3DPBA 43C9A 2D9CA 4L3ED 4PJ8C 4WWKD 1B3JA 4JPVL 5ID1A 3LRGA 4WI2A 4HUWA 5IK3B 4ERSH 3V0VB 1MJJA 5ERWA 4I2XB 2ERJC 1IZKA 4GRWF 4ZOBA 3RWFA 3T8XA 4HUXB 5IFHL 1HNFA 1RJZB 4KAQH 4LGSB 1A7NH 5EU5A 2OL3H 4UILL 3NA9L 4ZNEA 3MUZ1 5I8KH 3C60B 4N8PA 5F7EL 4PJ8B 1NANH 2OR8A 3ARBC 2F74A 2M1KA 2R4SL 4CVXA 5MEOB 1T21B 1C1EH 1EO8L 4K23H 3VXMB 1WZ1L 4NCDA 2AEPL 3FCTB 1UJ3B 2HP4A 1RJYA 2APXA 3L1OH 5EULV 5HHPB 2R4RL 3VH8G 4YWGH 4F7EA 5C7XL 1YC7A 5J1SC 5IWLA 5CWSB 2IH3B 5IROA 5IEKA 2Z93B 2VLRD 3UTZB 4TVPH 4HQQH 2YR3A 3QCVL 3U9UB 1MFBH 2R23A 4GRLD 1MLBA 1ZVSA 5GGQL 1JWSB 1IGJB 4H5SB 4ZDHB 2E6JA 3VA2C 2PYEB 5EC1A 1YEDB 1ZEAH 3VFSB 4OZFH 3RIAK 4ODSL 1PX3A 5FF6A 1BOYA 3TH4T 5I1EH 1CE1L 3NGBB 1B0GB 5F7EH 5ETUB 1RJLB 2Y07L 4NQTA 3VXMD 4XHJD 4O2FA 3SCMB 2VLKB 4XXDB 1QRNA 1ZLUK 3BVNB 4XP5L 2JKXA 3I75B 1EUUA 1SY6L 5K9OB 4O51A 3RUGA 2ERJB 3SJVB 1RV6X 1WT5C 5F9OH 5EWIH 3P77B 3H9HB 1FFNA 1XEDA 3C9NA 1LEIA 3PXJA 1OW0C 2GTWA 2QSQA 3WIHL 2DN7A 4LAJH 5F93C 1AGDB 4RAVA 2GT9B 5B3JF 3O45A 4Z7QE 4XB7A 1JUFB 3PE9A 3RJDA 1OB1B 1BX2B 5TF1L 4NFDA 4PRIA 1QYGH 4RAUA 4P9ML 4ODSH 4OF8A 1MFDH 4M6MH 3DO3A 3TP4A 2NX5A 5C8JB 2F19L 3EOAA 5JW5A 2AI0H 4XCYB 5LGHH 1KG0A 1X5HA 4U6HA 1KIQA 5GS0D 1UVQB 2COQA 4FQCL 3SGDI 4Z8FL 2J6EH 4LSVH 1HOCB 2IAMA 2WINA 4R90L 3VRIA 3MFFB 3HPLA 3CVHA 4IRSA 4QXWA 4L8DB 5J1TC 1XGUA 4IHOB 2VDMH 4X7CC 2DWDA 4M62H 3VDBA 4WCYH 2XWTB 5I71B 3KWWA 1Z9SA 2IMNA 1CN4A 2IPKA 4HX1A 1QRNE 3TYGH 3LQZB 5K9JL 3GMLA 3BN9C 2W1NA 4NJ9H 1CR9H 4G8IB 4BH7B 3LCYA 1R3IH 2YC1B 4H20H 4OM0L 1ZGLP 1YZZA 4LU5H 3HNVH 4OLYL 4K8RD 4PJFF 5FK9A 4OGYL 3T65B 3BRGC 4G6KH 4XCNA 1HCVA 2NXYD 3ES6A 2PYFB 3BEWA 4P2QE 1FIGL 4M6ML 5FM8A 3B9KD 1SJEA 1UZ8A 4W70A 5EZOL 3V5DA 1MJUL 2PXYC 4EUPH 3QDGE 1P5VA 1NQBA 1F4WH 3CNKA 3NPZB 5GRWA 2YWZA 2Y5EA 4FQQA 4YDIH 2BOCA 1IAIM 3P30H 3BIKB 1U8OA 5T5NG 3Q3GB 3MLSL 3WYRA 1NEZA 1N4XH 5IW1B 5E2JA 3QSKB 4WFFE 3GSNL 3T08A 2X4QB 1T22B 3M07A 4PJGA 3DO7B 4N8VA 5CZVL 2VDNL 1P53A 2BSED 4PY7B 1P4IL 1CICB 2Y7QA 3FJTA 2FATL 4BJLA 4N8CH 4EI6A 3QUYB 4Z18A 4NZUH 3RGVA 5I1AB 4GMSL 2NNAA 3OF6D 3RRQA 5JPNA 2FEEI 2VO5A 3W0WB 5L9DL 4U1NA 1IFHL 4HPOL 1EEUA 1R3KB 3FMGH 4YDJB 3ARQA 3G04A 1EZVY 5LGKA 1RURH 3T4YB 4JJ5A 1VACB 2XWBB 1CT8A 1MCIA 3I75A 4LSUH 1A4JA 1KCVH 2VSDA 1KXVC 4FFVC 3DX6B 4Q9RL 5TDNB 5HYJD 4K9EL 3MLVH 3ET9F 4KK5C 5F1SA 1CD9B 3BPLC 3KYNB 3NFPA 4WHYG 5I75C 4Y2DC 2IPUG 4WEUD 3CX5K 2PO6C 3IXAA 3D25A 1F4HA 3G5XA 1MWAB 2P5WD 5JO5A 3L5XL 1UWEL 4XCCH 1PAMA 4M43H 3BD4A 5C0FB 1T20B 5IV2A 2FYYB 3LKRB 4OI9A 4R7DA 3RA7L 1MHPH 1JYVA 4FQ2L 5DUML 1ZT1B 5EORH 1RZFH 3U9UA 4ZUUB 5JXAH 1VKXB 4JO2H 5BS0D 1KG0B 3MACL 3OG4B 5C0FA 5IV2B 5E8DL 5I8KL 4MQXD 5GSVB 3MRHB 1N0LA 1MHCA 2IBZX 1D9KA 1G1CA 4FQHB 3UTPE 4KKAD 5JR1H 5IFHH 3CGTA 4LVEA 1AE6L 2Q3AA 3O3AB 3D85A 4LVHB 1CFVL 2BFVL 3ARUA 4XAWH 1FO0A 3QUKB 1MJ7L 1C5CH 2NY3C 5FHAL 5KW9L 4KJQC 3SCMD 1MUJB 2P5WE 1WVZA 4ZYKA 3QCUH 1EMTL 3UTSE 2AXGA 3D39A 1CCZA 4KTEH 5JLZB 4YDJA 4MNQB 2VDRL 4RMVA 1VFMA 4YC2B 5F88A 3CDYA 1HHIB 5C6TL 1A2YB 5LVEA 2ITCB 4NSKA 4MJID 4D0BA 5F7MC 3JXAA 4OUUB 2BX5A 1RZFL 2ZUYA 2DD8L 1RQ5A 5F7WC 3TZVD 4JRWA 4PREB 4NO3B 5CGTA 1WBZB 2NY4C 4ZPTA 5DJ8B 1F90H 1Q94B 3HI1A 1MAMH 1QFWI 4X4XB 2ILLA 1DBML 3W0WD 1P4BL 3BW9B 5ICZB 1QR1B 5GGVY 3SO5A 5LJYH 4G6FD 1KIUA 4JR9H 4EEEA 1A7RH 1PW3A 2EDEA 4Q7DA 3WJLA 3L3JA 1OCWH 1A6WH 5BZDA 4J3WA 4JY4B 1LD9A 1VFAB 2XQBL 1NAKL 1NL0L 2QV2A 1XF4B 5TDOA 4PFEA 1UZ8B 1AKJD 2MMXA 4QCIB 4KPHH 1KTDA 3VWKC 4NKQB 4PJAE 2UV3A 3WMSA 3Q1SH 3K4ZA 5GGSY 2YC1A 1DE4A 5BV7C 2X9WA 3C5ZD 1EGJA 2L7JA 4L3EB 1H3WM 5DD6B 2ESVD 2F19H 4LLYA 3PWNB 3ELAT 2DL2A 2OMNA 2WP3T 3RVVD 3OKDB 1FCGA 3J8F7 1NBYB 2HJFA 3CFCL 4LMQI 4G9FD 1VFOA 5D7LE 1U6AH 3LRHA 3CVIL 1XZ0A 4HGWA 1ONQA 3SDXF 5DSCB 1WZKA 5ID0A 4X5XB 3NVQA 4MS8C 2ZNWA 1MOEA 2CMRH 4FZEH 3WFBH 3OGOE 3GBLA 3L3IA 4I3SL 5TPWL 1W72H 4M48H 3OMZA 2HFGH 4PJ7A 6FABL 1J87A 2AGJL 3BKML 4KDWA 1BJMA 4PG2C 1F8TH 4U6XA 4P4RA 4GJTB 5D7IF 4WO4B 5I17B 4P59L 4PJ7F 3KLHD 2CLRA 4X4MA 3WO3B 4UDTA 4JQXC 1RZKC 3AS2A 2CLVA 4D9RE 3S35H 3L3KB 2BSRB 1IEBA 4JRXE 2I07A 5LGJA 3UBXI 2DLIA 4KRMB 4X6DF 5AUMA 4AIZA 3VH8B 3WHE1 1JMXA 4XTRC 3I6GA 2JJVA 3X13B 1XH3A 1G7QB 3UBXB 3JV0A 2DKMA 1HXYA 3ZE1F 2CXKA 2CMRL 4FZEL 3WFBL 3PWPD 3OKYA 3T3PF 3TCLB 1WAAA 4XC3L 2CUMA 3CK0H 3CDGB 4DQOH 3HZYB 4OLZH 3RNKB 2NW2B 1UVQA 4DOHE 5BS0E 1ZTXL 4P2YA 4AQ1B 4V1DD 5GSRB 1UADC 4ZQKA 1CF8L 1H8NA 4JLRB 4ODHL 4UAOC 2MQ0A 3VFSA 5CZVH 1YMME 3IFLL 3G5XB 1UJ3C 3VFRA 4NC1C 3TNNB 4Z7UB 1Z5LB 1OW0A 1QSFA 4H26A 5DJ8A 3BD5A 3FB8A 3C8HA 3T0AA 1X5IA 2OSLB 1I8LC 5KANG 2HTLD 4JO4L 2EIDA 3JVGC 5LBSL 4NQCE 1KCVL 2DDQH 2C4XA 2D0FA 1MCPL 1AR1C 3IS0X 5IUSA 1VADB 1HYRC 1S7SB 4S0TD 2I9TB 3ULUD 1DBAL 1KIRB 3KXFB 2EDJA 1OF2B 1IGYB 3C9NB 3RZCB 1T21A 2YSSA 2DBJA 4OZFG 2EDKA 3QDJB 3CFKA 1CFQA 4RGNE 5IVZA 1T0NA 3X17A 1T89C 2KZWA 2IH1B 1A5FH 2VLKA 4XXDA 1QFWM 2WLZA 3BPNC 4UQ2A 1REIA 1CICA 3QDAA 3TO2A 1H3TA 4HUXA 1SQ2N 1JGDB 5C0AE 1KB9K 3L5HA 2ARJA 1F90L 3GSUB 3SQBA 3I3BA 5EG6C 1PY4A 3DSFL 1WZLA 3PABB 1B0RA 1LK3L 2PYEA 4TOYL 1EDQA 1NEZB 1T2JA 1HQ4B 3BIKA 2B39A 3ZDYF 5MERA 2LVEA 5HD8D 3U9PL 5MP6H 3HG1A 3IGAB 1S7QA 3MBED 3L6FB 4NT6A 4YBLC 2ITDA 4UBDC 4HS6A 4IMKC 3WXVH 1NMBH 2UVFA 4FNLL 5L8KB 1QSFE 5FO8A 4NO0A 2FZ3B 1CL7H 3SKMA 4GXVH 1L6XA 5JDSB 1DDHA 1RZIB 3HE7C 4NQCA 1IKNC 3QUZC 4HT1L 1H15B 2PUQT 3GMPB 1O7VA 1RPQA 2GFBB 5DK2B 2GSIB 3ARFB 2AJVH 1J7VR 3L5WA 2VR4A 4ZO6A 2HFTA 5I1GL 4B7LA 3UPRB 2OZ4H 3NACL 4M93C 2XWBA 3OAUH 5LWYL 4IDJH 4NZJA 4LSPH 3BO8A 4YUEH 1PBYA 5E5MA 4OZ4A 4LSSH 4A6YH 2H45A 1MJJB 4G9FE 5D7LD 4ZXBA 2QL1A 4ZNEE 5IB1B 2E27L 4YHNA 1FLRL 2VXVL 4OI8A 5T1LD 2KL6A 1EEYB 1INDL 2BSSB 5IB1A 1QVOB 4DJMA 4BUGA 3MRGB 5F1IA 1JHKH 4UINH 5E5MB 1OP3H 3CFDA 2AEQH 3ULVF 3KS0H 3IETB 2C1OB 4FHBD 1Q0XH 2IMMA 1J9CT 2VKWA 4WNQB 5EWIL 2QLVB 4XXCA 1T66D 2P8MB 5KAQF 5KSBE 5HHVL 2RQ8A 1Q72L 3SKOB 4XT1C 2IADA 3GHEH 4L8BA 5FM4A 3OB0K 5DURB 4FQQB 3L95A 4M5ZH 2VN7A 3PV7A 4CU8A 4PJXA 5J13C 5D7LB 4DZBA 3LEYL 4JFEA 4PJBB 1FFNB 2ZCKH 3QNZA 3L1OL 2BVQB 4HMCA 2H1PL 2QQKH 4AEIH 1XR8B 4WUUB 3TH2T 2F5BL 3SDYH 3ZSSA 1UACL 3PHSA 4LLUB 4I13B 5JA8B 4YO0B 1JGEA 3M17B 1IC5L 4N0UA 5D7KE 5HY9A 1WFTA 4Q6IA 1GYAA 1LQSR 4LSQH 1T4KA 1MCOH 2CKBB 2IH1A 3DXAD 3QIWA 3S88L 4CU7A 5EC1B 1U58A 3STLB 3L5JA 5EH1A 4U7MA 5KANI 4X5LA 1FGNH 4OFYD 6FABH 3DOSA 1XF2B 3RPIB 2YPKA 2X89A 1S7SA 2EYTB 4OZHB 2BXZA 2E6QA 2HKFL 3ARRA 4QHUB 1P4LB 1FDLL 1YPZF 3DYMA 3ECBB 3BSZH 4CMMA 1C5BH 4F7EB 3W11C 4GG6F 5FUOH 2JJSA 3FB8B 5ICXB 1PLGL 1T1ZA 4XBPA 4TUJA 5D1QB 2QQKL 5AZ2L 5CEZE 3H9ZA 3V52H 4KGJA 1YNKL 5FGBA 4GXUN 1GGBH 5H2BB 3JTTB 4WJ5B 4RAVB 3RNQB 5HHMB 3MODH 4O9HH 4OKVB 1YEGH 3BKCH 2YD3A 4UNTA 3R8QA 5A2JH 4F57L 4NRYB 4J3OC 4NPYB 5E9DB 1XCTA 1INEL 4XPBH 4P3CH 4ZSOB 4X6CF 4HUWB 4DAGL 2LU4A 3TN0C 4JKMA 1HXYB 1BM3H 4RFNC 2AI0L 3LQAC 2AJSL 5LKNA 1GGUA 5FA3B 1NCWH 1NMAH 5E8PA 1RUKH 1V7NH 3X13A 2AK4E 5HHME 1UWXH 4LARH 5HYQA 4NRYA 1DLHA 3GSOA 1N8ZB 1WBYA 2F53B 3JBG7 2R2EA 5FF6B 4P3DB 2VXUL 3HR5B 3BGFB 1JPGB 5E6ID 5AYQA 4ODVH 3VD9A 3U1SH 1AGFB 2H3NA 4HKBB 4Z7QF 5IMOA 4IRSD 2DIJA 2Q8BL 3ARBA 4PJEA 1EO8H 4JRYD 5HDQL