1ADQA

Crystal structure of a human igm rheumatoid factor fab in complex with its autoantigen igg fc
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
206
structure length
206
Chain Sequence
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPQVQFNWYVDGVQVHNAKTKPREQQFNSTYRVVSVLTVLHQNWLDGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (immunoglobulin/autoantigen)
molecule keywords IGG4 REA FC
publication title Structure of human IgM rheumatoid factor Fab bound to its autoantigen IgG Fc reveals a novel topology of antibody-antigen interaction.
pubmed doi rcsb
total genus 33
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 1997-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1adqA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1adqA01
1KEGL 1I8IA 4ETYA 4HBQA 3TZVB 3LSOB 3EYVA 4XPTH 2F53E 3GIVB 1TDQA 1T0MA 4HIJA 3EDJA 3LS5H 1QSED 1G6VK 1EEUA 3WL9B 5EOQL 1MJ7L 3LV3B 1I75A 5CP7B 4NN6B 3RDTA 2C4FT 2PYEA 4EIGB 1OP5H 2XTJB 4NQEE 2ZG1A 4YHPA 4AL8L 4OB5H 2ICWI 2QSCH 4OKDA 4JRWA 3U0TA 4RIRA 1FVEB 2GFBB 2YD2A 3OKNB 4R3SA 4FHBD 2JB5L 3UJTH 3CXHK 4ZUTA 2XTJE 1KV3A 4YAQA 4GKZA 1ZHNB 2P5EA 4JVPA 4XXCA 2FB4H 3QNXA 4F9PA 2DM4A 3UYRL 5FB8A 3O8XB 2HFFB 1MCDA 4Z78A 3VH8A 1A0QH 4YWGH 1KCSL 3O2DA 4K3HA 4FQCH 1KENH 1WCBA 1LNUB 4P5MA 4X98A 3P0VL 2HKFH 2GJ6A 4IBLT 2IBBA 3HZKA 3MREA 5I1KL 4PGDA 1BZ9A 3G5XA 2UVEA 2ORBL 3MUGB 4GBXB 2VKWA 2BNRD 5F97E 4XC3L 4FQHA 4LLWB 4Y5YC 1HOCB 4KQ3H 1VERA 3MOAL 4XZUA 1H0DA 2V7HA 4GRWH 1AJ7L 1NFDA 4AH2A 5FUZH 2G2RB 1UEYA 2IBZY 4UNUA 4F33A 1S9VA 1BIIA 4LKXB 2NY5L 4XPGH 3TN0A 1H3PH 2X4OA 5ISZD 2DM3A 4PJ8A 3QHTC 4U1GB 43CAA 1FZOA 3AC0A 4LHUD 5F1IB 1YQVL 1G9EA 3FO0L 4S1SH 2EDWA 5J89A 2K7PA 1Z9LA 1X5LA 1S9YA 2AJZB 1FLRH 2EDTA 4CDHA 1YEIL 4C56B 5DD6B 2LFGA 4PRPB 3RHWF 1G9MC 5L88L 3L3OB 4OD2A 3TM6A 3BSZL 3TVMD 4LEOA 2HJKB 1CCZA 1R3HA 2X4UA 4GW4A 4OJFL 4C56E 4HEME 4ZFFB 5I18L 1NJ9B 4PRPE 3UZVB 1W8OA 5GJTH 3FFCE 1EO8L 3QQ4B 3MUZ1 1MRFH 2F58L 3KPSB 3RUGB 4LCWB 2MMXA 3CFDA 1QSVA 5FHBH 1RZ7H 4P2OB 1BREA 5HHMD 2ZP0T 4H5SB 3UBXA 4RZCA 2R2BB 4BUHA 3UCRA 3PABB 3QXAB 3RUGE 1BFOB 3STBA 5T1KA 4P5TB 3ZHDA 1QD0A 1QFPA 4QRTA 3RBGA 4JO2H 5F21B 4P9HC 1OGAD 3MBEB 1YA5A 4XHJC 5BOPA 1MELA 1BM3H 2Z91B 1JTPA 3M45A 2VXTH 4CAGA 4HBCL 4QTHB 1BX2A 3TBVA 4U6YA 1A6WH 1ROWA 1G7IA 15C8H 3LKNA 1N0LA 4M6NL 1YEEL 2H2SC 1CFSB 1GPOL 3LRHA 2LU4A 4JG0H 4KTEL 1MAML 3MJ8A 2C4XA 4L3EA 5C86A 1H3UA 4JM2C 1I3VA 3RX5A 1GXEA 2HRLA 3O3UN 2H3NB 2WQRA 4HZLA 1J0IA 1JGEA 4G7YH 3O41B 3RGVC 5CD3B 2Z31D 5IUSA 4LSRL 3LQZA 1IC4H 1DBJH 2A77H 4Y1AA 4L9LC 4JFPB 1AKJB 4LL9A 1ORQA 4XXDB 2EH8H 1UJTA 2B1HH 4KGJA 4H1LG 1CU4L 4AEHH 4OZIF 5C6TH 4UU9A 5JQ6H 4Y19A 4GQPH 4R4BB 4ZOEA 5FO8B 3PHOA 4OCWH 4OGXH 1TZGH 4I1NB 2X4RB 1KELH 4U0RB 3LKOA 1CFBA 1DBML 2CKBH 2B5IC 1LEKA 3FAWA 4GAJH 5C1MB 1K5NB 4ZFOA 4WEBH 3D87B 3RBSA 2HRPH 4Y2DC 3SE8H 4LASH 5F7YC 4LSUH 4QCIA 4FXGB 1UA6H 4PJFF 3WNOA 2R8SL 3MODL 5GGUA 2GCYA 3MGAA 1MCFA 5LG1A 4NPYB 2J3SA 3DVIA 4P9ML 3TO4B 2I07A 3NFPB 3RP1A 3PWNB 2EC9T 3UTTA 2QSTA 3I84A 3C8KB 4E41D 3SOBL 2D0HA 2PXYB 5KSBB 4HIEA 2QEJA 2P8PA 4ZFGL 1ETZB 3BX7C 1ZAGA 4FZEL 1XZ0B 1TITA 5DQJB 5KSBE 4UBDC 4F2MB 1BZ7B 4OLUL 5I1AA 3VFRA 1OP5K 4MJ5B 3VFOA 3EGSB 3ARQA 1IGML 4MVBD 3F7YB 3F65A 4ZS7H 4LPVA 4DVBB 2C1PA 4IRSA 3PL6A 4GXVL 2B0SH 2Z8VC 5KS9F 4L8SB 1CBVL 5TE4L 3T08A 1CWVA 1TTUA 2N1KA 2FIKB 5K9OA 1T04B 2OZ4H 4ERSH 4FQ1H 1AGFB 4Y5VC 3CJJA 4M02A 1ZHKA 5B4MC 4S1QH 2ZG3A 5JOFB 2QADC 4R7DB 5DHVB 1TJIL 3AROA 4DTGL 3TNNB 4OSUL 3FQNB 5SWZA 2Z8WC 4YR6A 4NGHL 4DN4H 4XBPA 1C5DB 4R26H 4G6FD 3UTOA 4OFDA 3HMXH 5BQ7B 3BP4B 4I18A 3IKCB 4R4NC 4K7PH 1YECH 2XQBH 1IKFL 1QTYT 1BBJA 3P9LA 4RX4D 2VB5A 5D70H 3GMLA 3QCVL 4L8DB 2DBLH 2DQHH 2XA8L 4KZDH 3D25A 4NM8L 1IM9B 4K8RL 4G8GB 4XPFH 3BH8A 1CI5A 5MENA 1YMMA 2WWKT 3DX8A 2PR4H 1RZIA 4FFZH 1XIWA 4NQUA 4JM2D 1FPTL 4WDIB 2V17L 2ZKHL 4G8GE 5TE6L 1DR9A 2EECA 1WICA 3JV6A 4HXAH 3X3FL 4LIQH 1W8NA 1FNHA 5SWSA 3RGVD 2BP3A 2EZ0C 1OGTB 1Z5LA 1RZFH 3N9GL 5EBLB 5C0IA 3NPSB 2NX5E 3EW3B 3O9WA 1A6UL 2YPLA 4EUPH 1NCUA 5F96H 1XR8B 3WMSA 3IDMA 1Q38A 1PSKH 3DBXB 4JAMA 1A7RH 3MLSL 5FF6B 5IQ9A 5ID1B 4HK3N 2KUTA 1CICA 1BJMA 4Q9QH 3GJFB 5F9WB 3VW3L 3LMJH 1EFXB 2BHZA 5CBEB 2VDRL 3TT3H 3GMOB 3QEUA 5KANG 2YHGA 2JIXB 2DWEA 4HUVB 5D93B 4JY6B 2OS7A 4P3CH 1IRAY 1K2DA 5IJKA 1WEJH 5CILL 1JI2A 2YRZA 2X4QA 5ILTL 4JREB 4BH8A 3ARSA 4M6ML 3STZB 2VDKH 1YY8A 3MRLB 1I7ZB 3CFEA 5I6XC 3E6HB 3IU4H 1ZVHA 4TUJB 4ETQB 5IKCA 4NQCE 4AIZA 3TPUA 1HHKA 2W1NA 3KPQB 4ODVH 1DANT 3HRZA 4DGYL 3BVNA 4JZNB 5SWQA 5IBUG 3P4OA 3ISWA 1DUYB 1FYTA 1Y6MR 4HV8B 4UV7L 5DFVC 3ZDYF 4ELMF 5I1GL 3J7HA 1S5HA 4UBDD 3RVTC 5J1SC 5JW3L 1WSST 4Q58C 3VFPB 4C54A 2BCKA 3T0DA 2AJXH 1A1MB 1B4JH 5DS8B 1KEML 1SY6H 4NJ9L 4QF1B 1JPST 4AT6A 3B3IA 4ZO6A 5EU6A 3WNLA 3ZL4H 1ULVA 4BQ6A 3S37H 3KPPA 3F62A 4CN4A 5C7XL 2YK1L 4LLVB 4YDJB 2HT4C 4JM2F 1SEBA 3ROOA 3QFJB 1HHHA 2WWMC 1H8NA 1QFWH 3H0TA 3CFCL 4HUNB 4JHZA 4O9HH 3T2OA 2FX7L 2MWCA 3Q6GL 3ECBA 1FCGA 1QNZL 2FNBA 1KJ2H 1BFTA 4PG2A 2OQJB 3QQ9C 1A22B 5B4MD 4ZMAT 2QADD 4RBPH 2DQTH 5E95B 3PHSA 1PDKA 3NGBB 3H7BA 5GRYA 2HKHH 4ODUB 3P4NB 3P77B 5D2NB 3DSFH 1DDHA 1JTTA 2CMRL 2I26N 1J87A 3BXNB 4NC0B 4R8WL 4PB9L 1GOGA 2MHAB 4KKBC 5LCVH 5IIEA 1MHHA 4B5EA 3PJSA 4KMTH 2PTTB 3RL2B 2HMIC 4KQ4H 3MNZA 4JO1L 4JKLA 4EQ3A 1J12A 4Z7QE 5C0NC 2V9QA 2ZSVA 1V7ML 4GAGL 2DIAA 3A67H 2VNCA 2VLKA 2DI9A 3FB7B 3WXWH 1X5JA 2WBJD 3PWPB 5L9DH 3QIWD 3CUPB 5EIIB 3RKPA 1ZT1A 3NA4A 1KJVB 3OBAA 5D2LA 1INDH 5H2BA 4GAYA 3PWPE 2IAMC 5DYOB 2UV3A 1KOAA 4FXLA 1ZOXA 2EZ0D 4MLSA 3HR5B 3BGFC 5GS0C 3GHBH 1AY1L 3OKYA 4X7TA 5GQBA 3U30C 1FNEB 5C0RH 3DYOA 1HZHH 4NQTA 1JNLH 1HXMA 4DZBB 5H37G 1A4KA 3MX0A 4PJ5D 2W0FA 3ZKXB 3MV9B 4BZ2H 2HTLC 4KDVA 4U1IA 5IFJB 5T3XL 3TBWB 4MQ7A 5JIIA 2XY2A 4MLIA 2C3VB 4G5ZH 5I17A 5KOVC 2FX9H 3MV9E 2UY6A 1DLFL 5E7BA 5FUCC 1NBVH 1T7VA 2ERJB 1KLGA 2YUXA 3MRNA 4HMEA 2NMSA 4IDLA 3ZHKA 5DMIH 4OF0A 1KTDA 4FA8A 1RVFH 5TGBB 1UJ3B 4PJCF 3S34H 3B9KC 5L8LB 1WZKA 1C1EH 3OGCB 2B2XL 4RWYL 4YBQC 4MNGA 1MCWW 4I3RH 4HK3J 4J3OC 2F54D 1KLFA 3QRGH 4E42B 1VACA 1Q0XL 5TE7L 4JM4H 1FO0L 1A1OA 2JCCF 4LLMA 4MAUH 2HVJB 1KC5H 4U1KB 3O3BA 4F58H 5FA3B 3RVTD 1F3JB 4KROB 4NKOA 2YWZA 2KBGA 4M5YL 1UZ8A 3E3QC 1EAPA 4MAYC 1SEQH 3K8LA 4C4KT 1XGQB 4GMSH 4KZEH 1NC4A 4QXUH 3W11C 4LFHD 2OR8A 4PREB 4IRJC 1GOFA 1AQKH 1KCRL 1WT5C 5EPMA 4G80A 2CR6A 3VRIA 4JPWH 5DDHB 4WNQA 3E0GA 1UWEH 3HTLX 1IILE 4LMQE 3CFJB 5I1LB 1QEWA 1BZQK 2CQVA 4FRWA 1BOYA 5E5MA 3QQ9D 4XWGH 1EZVY 4I9WD 1U8PA 4PY8J 4RA0C 1TMCB 4GG8B 5IBTL 1XGRB 5HHQB 1QLFB 4BQ8A 4PJ9A 2VC2L 3QUZB 4WUUA 3G04B 3UJJH 4DKFL 2EYSA 4X7FC 4X4XA 1GGTA 5D72H 4F9LC 3EO0B 1NBYA 1BLNA 4KKBD 2AQ3A 4JFHE 3QH3A 2FGZA 1FZJA 3I6KB 4TPRH 3G9AB 2FEDC 4NUJA 2HMID 4ESKA 1NEZA 3LPGA 3LD8B 3QG7H 5B21A 1BQHG 4P3DA 5DRWA 4OCSH 1DBAH 4QXWA 1YNKH 2FEEI 3B5TA 1U8JA 4O02H 4PFEA 1ZLSL 3KYNB 1TENA 2J4WL 2RCSH 4WUKL 4YBLC 1IQWH 2ZCHH 1T83C 1A14L 4TUKH 3VXMB 1UACL 4YUEH 1FDLL 3QEGH 4FNLL 1KJMA 4DEPC 4GO6B 8FABA 5F7LB 4WTZG 2FJFB 4P57B 1EGJA 2OL3B 3VXME 3T77A 2IAMD 1XF4B 1N26A 3PWLA 1D5ZB 1JIBA 5HYJB 4G8IB 3BQUC 3SDXF 1NDGB 2OTUA 5GS0D 4PV8A 1OQOA 3AVEA 1IGFH 3DGGA 4GRLB 1R3LB 3ARUA 4Y4KC 2ZUSA 3FN0L 4WRLA 3Q2CA 5B22A 4N8VG 3U46B 4RBPK 3BPNB 4KU1A 1DFBH 3CXHJ 2J8UF 1GGUA 1MEXL 5FIEA 3ET9F 3BW9A 2R1YA 3HC0A 1G9NL 1RZJC 2XN9B 4WW1A 3BKJL 3ZT5A 5K9KB 3VFTA 2HTLD 2AP2A 2YMXL 2QQKL 5CJXA 4XMKL 3GMMA 3MROA 2JJTA 3T0WA 5ABDE 1P6AB 5GISH 1MCJA 5JNYB 4R4FL 1WBYB 1AGBA 4AIXA 5FM4A 1R3KA 3BYYA 3HC3H 1JWSA 5B3NA 1OSZB 3L3KA 4U1JB 5IHZA 2BRRH 4Z7UA 5CCKL 2B20A 1OHQA 2XWBB 1UQSB 3MLVL 2CIKB 1MFCH 4RFEB 4MSWB 5LGHL 3QWRA 3B9KD 5T3ZE 3KYKL 1MREL 1HNGA 4J3TA 1BQUA 2X1XR 5KZCB 4YBQD 4X9IA 5INCB 3TCLB 1T5XA 2EIDA 2IC2A 4OZGF 1J1XH 3F12B 5K93A 4HXBH 5DT1L 5GRJH 1NLBH 4PGJA 3GKZA 3KXFD 4HX1B 5IVXE 1G7PA 3LY6A 4WFED 1WITA 1A4JA 2WNGA 4WW2B 4ZUVA 4NRZB 1NBQA 2YRLA 4X6EB 3WFDH 5HYEA 1RK1A 4TQEL 4URTB 4HKBB 1NCWL 4MAYD 1ZEAL 3QIBC 4CBPA 3OKDB 4HIXH 3W11D 2GJZB 5LVEA 4OLZL 1A5FL 2BDNL 1UWXH 4IRJD 3VXUD 4ONOA 4M3JA 5C0BB 2WUBL 1HDMA 1A02N 5GGRB 3HLAB 1ACZA 3ZE2F 2W0PA 4FMFA 1HINH 4YHLH 5KSAB 1LO5A 4PJHB 4JR9L 5C0BE 1NCDH 5FYJD 4H1LA 3KLHC 3IDJA 3VFGH 5CMAA 1PZ5B 2BFVH 5IG7A 2NZ9C 4QOKB 2VAJA 3KJ6H 1KG0A 1I8IB 4WY7H 4G6JL 2AJSL 3BESR 3EYVB 3RL1A 1A3RH 3DYMA 1B0RA 4QTIL 1T0MB 1KCUH 2NTSP 4M7ZC 2Z0BA 1FSKB 4HIJB 3GMPA 2FO4A 1IEHA 3D85A 4I3SH 5FDYA 1AXIB 1CZ8H 4XVUD 5JZ7D 2P49B 4QGTA 1PX3A 3S97C 1YQ2A 5IB5A 3RDTB 4FABH 4KKLC 5IGXL 2PYEB 1WFUA 2FEDD 2DQDH 2BNQA 1X5KA 1FO0A 4XCCL 5DWUL 4YHPB 2HWZH 2EC8A 3U0TB 3FMGL 3QPXL 2PYEE 4RIRB 4R3SB 4U6VH 1NUNB 4ZUTB 3QNZA 4UAOC 4YAQB 1QLEL 4GKZB 2P5EB 3QNXB 4PJEA 5FB8B 2UWEF 4Z78B 2DQEH 3VH8B 3DX6A 3X3GH 2P5EE 1MFNA 3UDWC 3CIQA 3RU8L 4ALAL 3K74B 1F6AA 1WCBB 2GUOA 3E6FA 3BQUD 4P5MB 5EZIH 3Q48A 3MACH 1P4LA 3QHZL 4X98B 1RZGA 3H3PH 2GJ6B 3LEYH 3AREC 1WAAF 3B43A 3HZKB 3MREB 1FFRA 1L7IH 1IZJA 1W72A 1BZ9B 3NMEA 1OCWH 3G5XB 4PGDB 5DI8A 4XAKD 1KN2H 2ZUTA 4FQHB 2G5BA 3WLWC 3JVGA 1WISA 4Q9RH 1KXQE 4XZUB 2EO9A 1H0DB 2V7HB 3VGDA 1OLZA 1N5YL 3BUTA 2DTML 4EN3C 1NFDB 4AH2B 4D9QD 4PRHD 4F33B 1S9VB 1BIIB 1EX0A 3H2WA 4PP2A 4LGSB 2I25N 4PUBL 5KN5A 4L4JA 4ISVA 1NMCB 3TN0B 2X4OB 4PJ8B 1R3IL 2O5XH 43CAB 2MQCA 3C6SA 1FZOB 1J5OL 2JK5A 2AGJL 1SJXA 1KB9K 2YN3A 5GGQH 4APQC 1S9YB 5J12B 5BO1L 1FAIL 1L6ZA 3IS1X 2E9WA 4YJZL 4HPYL 1OAUH 4OD2B 4LEOB 5DLML 2YA2A 4LPXA 1J8HD 5E2VH 4D8PA 1R3HB 2X4UB 4GW4B 1U3HD 2KKQA 4RAHA 3ETBF 1UM5L 3OR6A 3O6KH 2MPAL 3CFDB 1C08A 2YEZA 1KN4H 1JVKA 3MTRA 4P2QE 5E7FA 3MLXL 2Q20A 1WIUA 3QIBD 3UBXB 3UYPA 4RZCB 3HHRB 3B6SA 4TSCH 1I9EA 5T1KB 2MJWA 2XICA 3C5ZA 5DJXA 4QRTB 3EAKA 4ZNCD 5EZOL 4LSQL 3WFBL 3OMZA 2IJ0C 2ICWJ 1BX2B 2KQMA 3TYFA 3KLHD 3BH9A 1GGCL 2DLFL 5FGSA 3TBVB 4U6YB 2NZ9D 2IGFH 4O58H 3T0XA 2NPLX 1G7IB 2DQCL 3LKNB 1YPZF 3LPFA 4XTRD 4PJAF 1L9MA 1JZ6A 5EUOF 2FB4L 4D94A 2C3XA 3VGFA 3MJ8B 3S35L 4TVPE 4L3EB 2NY1C 4UNTA 4XT1C 4JHWL 4NBXB 5D5MF 4QEGA 4HZLB 5D7SH 1JGEB 4KVNL 3WUZA 3MLYH 2ZCKL 3OPZH 4L3EE 3UTSA 4KWUA 5T5FH 5I19L 3HNSH 2ZJSH 3LQZB 5FYKU 4Y1AB 5JW4N 4KKLD 1OWRM 3MCLH 5IROC 2P7TA 1P5UA 4JFDA 1ORQB 3DVGA 3MJ9L 1HYRC 1XF5A 4L5FH 2YZ1A 3D9AL 4Y1AE 1PY4A 4UU9B 5JR1L 4G6KL 4Y19B 1ZKAA 3WXVH 1U8MA 3PHOB 3UTPE 5D1ZD 3CDYA 3V6OC 2Z8SA 4LSTL 3FQTA 1QYGL 1KT2A 1U0QA 3OB8A 1AGEA 3LKOB 1NGPH 1LEKB 2XZZA 1TNMA 4ZFOB 3FHAA 2BVEA 1TCRA 2AABL 2EEBA 2X4NA 2XA3A 4LVNB 4QCIB 4XPGL 1H3PL 5GGVY 3TH3T 5GGUB 2GCYB 12E8L 2G9HA 3DO3A 4X9BA 1FFQA 5IW1A 3JZ7A 4J2XA 2I07B 4Y4HA 5IT2L 1LK3L 3DNKA 3VD3A 5F1SA 3ARED 5BS0A 3UTTB 1TETL 5E8EA 5CSZA 1FRGL 1N0XH 4NKIL 4RMWA 3WNPA 4HIEB 5IEKA 3O3AA 2X70A 4F3FA 3DUUA 4X9GA 3WLWD 2P8PB 3UTTE 3UROR 4DOHE 2NW2A 2RB8A 3FTGA 4K07A 5GJTL 4H26A 2YA1A 2VZVA 1K9TA 3ZE1F 3QDJD 2UUDH 5I1AB 2Q8BL 5EO9A 4Z7WE 3VFRB 1KULA 1BAFL 1MCHA 3HAEA 4QRPD 3VFOB 5D7JC 1QBMH 2VDOL 1ZGLA 2C1PB 2FL5A 4IRSB 3PL6B 1F02I 4RAVA 4JO2L 4APQD 4X80H 4RAUA 2NY2B 3T65A 5FO9A 5EB9A 4I0PC 5C0AA 1VFOA 3TNMA 4AZ8A 1Y6NR 1OOAA 5K9OB 1CTNA 1YEJH 4ONGH 4U6XA 2XZCH 2IPUK 4UT6H 1ZHKB 2Y72A 3MOBH 2XRAH 4NFDA 3WFZA 3QI9C 4GS7C 2VABA 1IBGL 4R0LA 1GHFL 5GJSL 4IIQA 5IK3A 4L4TD 5SWZB 3ARGC 4YR6B 4XBPB 5DHVH 2G60L 4QRRD 2OP4L 4I18B 1UWGL 4RGNE 1E4XI 5E4IA 3LN4A 1BBJB 1KIUA 3P9LB 5EZLA 3GZKA 3SJVE 5H35A 4LPCA 4AEHL 3GMLB 3D25B 4OGXL 2NXZC 4U7SA 5HI3C 4CGTA 3BH8B 5EORH 5MENB 1YMMB 3DX8B 7FABH 1KELL 1RZIB 1SBSH 5J1TC 4NC2B 1R5IA 1ZANH 1XIWB 3NABH 3WYRA 2L7UA 2NY1D 4WEBL 2DD8H 1D9KA 2HRPL 3HI1A 5MENE 1YMME 3JV6B 3D39A 3KHQA 1UA6L 1ES0A 2D7PA 5SWSB 1T03L 1Z5LB 3SDDC 2F5AH 1BJ1H 1JGVL 1GGBH 3BUYA 4NFCA 5C0IB 1BWMA 2NQCA 3O9WB 5SWSE 2YPLB 5D7IA 3IDMB 4JAMB 3MV7A 5IQ9B 1TPXC 1CICB 3TWCH 3U2SA 3QEUB 3GRWL 1PAMA 4M6OL 4OCNC 1J0ZA 2DWEB 2QBWA 4N5ED 1K2DB 3GJFH 1QSFA 4DZ8A 4UIKH 3LKPA 2X4QB 4PTUA 3RVXC 4RISL 4U0QB 4BH8B 2IADA 5IB3A 1MCEA 1YY8B 5H94A 5E8PA 4CVWA 3CFEB 5AD0A 1LEGA 3WDIA 1Q72H 2AS5M 3EDFA 5IKCB 4AIZB 3TPUB 1HHKB 1HEZA 4ORGA 5DQDH 4LFHG 3HRZB 5C0GA 3QB7C 4G9DA 3WDJA 3BVNB 3PNWA 5SWQB 2CJUH 3KR3H 4OCMC 3P4OB 2X1PA 4YK4B 1FYTB 3ILPA 1IFHH 3ARWA 4DN3H 2R2CA 4J4PA 2ICWA 1S5HB 4GLRI 4NT6A 4ELME 4OLWL 3ZDYE 5HPOA 2BCKB 1BJ8A 3KLDA 3BP5A 4JO3H 1F6FB 4XVTL 5CP3A 4PJDA 1G9ML 2L7JA 5D7JD 3PXHA 4R26L 4AT6B 5M94B 3B3IB 3MJ9A 5E2UL 5EU6B 3S3JA 1UB5A 3KPPB 3CGTA 1M05A 3HMXL 2R2EA 1SEBB 5CUSH 1T2XA 3ROOB 2IH1A 4HWEL 3SQBA 5BXFA 1HHHB 4MJID 1F13A 1BQHA 4I0PD 5EU6E 4X0KA 3H0TB 2FHCA 5I76A 4L4VA 4IDJH 3ECBB 3QFDA 4PJIE 4GKNA 2OMBA 4M4RA 4YDIH 5DUPL 3ZTJG 4I2XA 5TPWH 3T04D 3O6FC 2PR4L 4XBEL 2A6DA 4WTZA 4P9HL 3H7BB 1H3TA 1F3DJ 2BNRA 1DDHB 2IANA 3OF6D 1RIHL 4HXAL 3AU1A 2X10A 3V8CA 3ARGD 3T0EA 2A6KA 1CL7I 1U42A 2F19L 5IIEB 1RZFL 1MHHB 4LSSH 2OI9B 2NY3D 3RWHA 2R39A 2J2ZA 3O2WL 3PJSB 1KGCD 2VSCA 3HNVH 3BPOC 3MNZB 3HE6C 5ISZA 4OCYH 4OZIA 2UUDK 2ZSVB 2GAZA 1MCKA 3DX9A 4KRPB 4Q9QL 4MQSB 1Z9MA 5L2KE 4RNRA 4U1SA 1X44A 2VLKB 2NXZD 1CL7H 3LMJL 4KXZI 4MXVF 2ZUVA 4X7SH 4W68A 3V2AR 5GIRA 5JPMA 2N7AA 1ZT1B 5B39A 5CEYA 3TVMA 3BD5A 1U8KA 4WVRA 4ODTH 5D2LB 5H2BB 4P3CL 4GAYB 4LCIL 4PJFA 1YEKL 2ILLA 5KVEH 2PYFA 3GUTA 3VXSD 1QOKA 5D2LE 2ARJA 3SDDD 1PLGH 4X7TB 4IJ3C 2VDKL 1IARB 3Q3GA 4ZAKC 2DQUH 3VGHA 3L9RA 4KMLB 4ENEC 2FD6L 1HXMB 3TC9A 1A4KB 2ESVA 3TJEL 2W0FB 3RWEA 3WFEL 3WSQH 1IKNC 2C7UA 1OGAA 1LE5A 4U1IB 3A6BH 4P99A 2Q3ZA 4W4OC 5A2FA 4MQ7B 1WV7T 4WTXA 5DVLA 3MLZL 2D31A 4WGWB 5I17B 1I8MA 2XWTA 2K3TA 1KLGB 3MRNB 1JZ8A 1B4JL 1QKZH 4KY1L 1KTDB 1AE6H 4YE4H 5CZVH 1BECA 2KH2B 3HE7C 1OAKH 1A9EA 1HQ4A 3S37L 4LVEA 5KS9A 1FBIH 4MNGB 3GJEA 1VACB 4XPBL 1A1OB 5I16A 4GW1A 4LLMB 5IB2A 4Z8FH 3O3BB 5L0QB 1LHZA 3U4BH 4NKOB 5EU3A 1Q9WA 5DA0B 2HKHL 1UZ8B 3OR7A 3T2PA 1EAPB 5I1EH 5ESQA 2WMPA 1NC4B 4TRPH 4FZ8H 3ZDXE 5DJ8A 3O4OB 3LEXA 3ZTNL 1KLUA 5HHNA 2X4SA 1MLCA 5EPMB 1ITBB 4G80B 3K1KC 2VXUL 2BXYA 5LCVL 1DUZA 3VRIB 5JA8B 2E7MA 3N1GC 3NCYP 4WNQB 4B7LA 3FL7A 4E5XA 2XYCA 1ADQH 3ARVA 1IAKA 3GSOA 4HW6A 2WUCL 1M4KA 5DC4B 4A6YL 3MGOA 2DL9A 1ZTXH 1QEWB 3GRWA 1XGYL 4H25A 3GJFK 3ZT6A 4WIQA 5C07E 5E5MB 2IMMA 4M1DL 1U8PB 3O6FD 4XNXL 5DD5L 2IPUG 4PRDA 4M48H 2F8VA 4E41A 4PJ9B 4WUUB 1A2YA 3C2AH 3SQOH 3WHXA 3RI5K 2EYSB 5E6IC 1M1SA 2Y6SD 4X4XB 4Y5YA 1NBYB 1BLNB 4XMPH 3OJVC 4KI5E 3LVEA 4PLJC 1CN4A 1QBLH 3GHBL 3QH3B 1FZJB 1FE8H 3GKWH 4PV9A 3MRRA 4NUJB 5C0RL 4HF5H 3BFOA 1NEZB 1J0YA 4YNYA 3HE6D 3S36H 4P3DB 4QYOA 3CXDL 5DRWB 3L3JA 4HQQL 4PRAA 1OSPL 2NCMA 3OKEA 5MEPA 3O2VL 1U8JB 3A6CL 4BZ2L 4HH9A 1F97A 2DM7A 4KJWC 2YA0A 2D4DA 4XPAH 5DVMA 3KNBA 4KTDH 1T20A 1KJMB 8FABB 4EDXA 3IRZA 2J1KA 5CEZD 1YYML 4NQDD 1F4WH 1MCNA 5DEGA 2I5YL 4MA7H 1VPOL 3ULUC 3T77B 3OQ3B 1C5CH 3Q6FA 5DMIL 3HMXA 3PWLB 4NO5A 2VDMH 2DKMA 2OTUB 2FECI 2Q76A 4PV8B 4F37K 3DGGB 2VXQL 4ZAKD 3D2UD 4C55A 2H41A 4N9OB 2OL3H 3WJLC 1HI6A 4W6XB 1MCRA 4ENED 2D2OA 3L5IA 3BW9B 2R1YB 3AFLA 3HC0B 1ZK9A 1W0WA 1B9ZA 4WW1B 5D7LD 2IPTL 4FFVC 3VFTB 5L6YH 4ZO9A 3GMMB 3MROB 3IRPX 1KC5L 4GQ9L 4F58L 1AGBB 2DLTA 3WLBA 1R3KB 1LEIA 1JWSB 2FRGP 3L3KB 1YJDC 5IHZB 5LJYH 1SVZA 4GMSL 4POZC 4Z7UB 4EI6A 3VI3F 3VRLE 4NHUA 3TPKA 4OUUA 1ZHLA 3HE7D 4BELD 2I27N 4E0RA 2YD6A 1FIGH 4O4YH 2VN7A 4Z7UE 4JM2A 2V7NA 5I75B 4LDEB 1S3KH 5LXGH 5GPRA 1JWMA 1T5XB 3D3VA 4OM0H 5FAAA 4Z7OF 2VLJE 4U1LA 3HUJF 1CE1H 2V9RA 5F6HI 1XGTA 3CSYA 5DJCA 4JRYA 2CLVA 3N06B 3RJQB 3O6ML 2YD7A 3C6LA 4AQOA 1G7PB 4L9LA 1V3KA 2VLMD 4DCQA 1XH3A 1A4JB 4ZUVB 1A1NA 1OVZA 1IGCL 4FTVE 5GSRA 1IL1A 4GKOA 1RK1B 4WFGD 2AV1A 5JUEH 2VWEE 1KB9J 3WDHA 2NY7H 3CD4A 2RAMA 4NWUH 3L5XL 3CVHL 3GBMH 1HDMB 4LVOC 2VL4A 4WI3A 5E2TH 1KYOK 4TOYH 4NO2A 5B8CC 5C09D 3DV6A 2AXGA 1TQBC 4M9OA 1CDGA 4JB9H 4Y2DA 1LO5B 3MV8A 3C5SA 1R5WA 5IBLC 4H1LB 1QFHA 1FLTX 3IDJB 1WZLA 5AZ2L 5CMAB 5IG7B 1ED3A 3VDAA 1F4YL 2R69L 4WTWA 1KG0B 4DJMA 1JPSH 1IQWL 5CJ8A 2KZWA 3RL1B 1B0RB 1N2RA 5EU7C 3GMPB 2FO4B 2W92A 2ITDA 4R97B 4M7KH 3D85B 1KBGL 3F7VA 4KRMB 2H32H 4NHCL 1AFVH 3DHJA 1UKQA 4WI6A 5IB5B 1IGFL 4OV5A 3THML 5IFHL 2BNQB 1FO0B 4CVZA 2W9EL 5D8JH 1KJ2A 4ZD3L 2CK0H 1UFUA 2VDQL 4CNIA 2PO6C 2BNQE 1FL6A 3ORJA 4U33A 3QNZB 4KJWD 5CS7A 5GS0L 1MJUL 2OXHA 4PJEB 3FT2A 3MUJA 1FYHB 3O3EA 5GGVL 3FB8A 1RU9L 3DX6B 3ULUD 3R06A 5L8JB 3ULVC 4LPTA 4ZNEE 4Y5VA 3DTXA 4X7DC 1F6AB 2GUOB 1VGEL 3E6FB 1BMGA 1Z9OA 4PJCA 3LDBC 2KL6A 1VHPA 1L7TL 1P4LB 1RZGB 1CXLA 2APVA 1A7NH 2X42A 2EDFA 5E9DA 4P23C 4DVRL 3QO1A 3W9EA 1W72B 5DI8B 5I1IL 1OLLA 3BPLC 4W6YB 3TEUA 2G5BB 3B8YA 2Y36L 3K4AA 5JLZA 2FX8L 5DJAA 4J3SA 3IFNL 2LAGB 2VXSL 4HCRH 4DKDC 4PP2B 5KN5B 4ISVB 4POZD 4KHTH 3TF7C 3C6SB 4KV5F 3L3GA 4K94H 2JK5B 1IAIM 2VZ1A 3QIUD 4CMHC 1I9RH 1M7XA 4JE4B 2VLRE 3MRFA 4YHLL 4M3KB 1NCDL 4Q6YA 4K71B 1YJDH 4FQJL 3IDUA 4QNPF 4D8PB 1RIUH 3KJ6L 5IM7A 1YY9C 1T0PB 1A3RL 5KW9H 1RJCA 5MERA 1W0VA 3OR6B 4D9LH 1MFBL 1KCUL 2XKUA 1C08B 3RZCA 2YEZB 3V0WL 4WFFD 4YXHH 4OT1L 3B6SB 4PJ7F 4EOWL 4V1DD 5FYJL 4I3SL 4JEGB 1CLOL 4KHXL 3C5ZB 5DJXB 2XTJC 2LU3A 4FABL 5IFAL 3ULUF 5IB4A 5F1NA 2WW8A 4NWTL 5IBLD 3L3IA 3TYFB 1H3WM 3BH9B 3C09B 5TJWK 2VUOA 3KJ4B 5C0EA 2GHWB 2YKLH 2F54A 4H0GA 3VWKC 3MXWH 5BMFH 4LHJB 2C5DC 1UCBH 4HFUL 2QQLL 1IAII 1EVUA 2YXMA 1IQDA 2QHRL 3UTSB 3RWCA 4OZHA 4DW2H 1J18A 3PQYA 2CD0A 5FK9A 4WO4C 4GXUM 2P7TB 3H3PL 4JFDB 1X5ZA 3DVGB 4GBXC 2J8UA 3WV0A 1XF5B 3BIBX 1MRCH 5SX5K 4DGVH 5JIPA 4PRHE 4KPHL 2VZTA 4BH7A 4NO3A 1IAIH 1U8MB 4JFDE 1LILA 5IBUB 4RGOH 2R0WH 3FQTB 4QY8A 4Q9RL 1KT2B 4P59L 1AGEB 1CIDA 3NIGF 4TNVK 1KFAL 3ARFC 4PBVC 1KTKE 4PRID 4U1GC 4J3VA 1RK0A 1TCRB 2X4NB 3ULVD 4DK6A 1RZJL 1OTSC 1KPUA 2G9HB 3I6LE 1QACA 3U7WL 1T1WA 3HI5L 2M26A 4P2RD 3SO5A 4OCRH 1GGIH 4FQIL 2WM0A 5IW1B 3ARDC 3LHPH 5DXWA 4Y4HB 4G7VH 4LLAA 2FBJL 1QRKA 1NUGA 4P23D 5BS0B 4BUGA 5E8EB 5CSZB 3TYGH 4XNYH 5FKPA 3H42H 5DK2A 5FYKE 5IEKB 3O3AB 3G6JF 1JHLL 2X70B 4F3FB 3DUUB 3DO7A 2NW2B 5SV3A 1RUAL 3FTGB 2RBLA 4H26B 3REVA 1KEGH 3O4LD 4KTYA 1X6NA 3FOMA 2DJ4A 5T1LA 2Y1VA 3UPCA 3QWOA 5EO9B 4WFHD 3J8F7 3NTCL 2Y5TA 4YGAB 3HAEB 4TYUA 2P5WD 3IS0X 5FYLE 4L8BA 1ZGLB 2FL5B 3ESUF 4RAVB 2LQRA 4RAUB 3T65B 4Z7NE 5EOQH 4MXWL 1MJ7H 5FO9B 1MHPL 3K81A 2EIBA 2F53D 2IAMA 5C0AB 1H9VA 3NFSL 1ONQA 4JVUA 1ZLUH 1LDSA 3TNMB 2J88L 1FG9C 4U6XB 2IGFL 4H88L 1H3XA 3HZYA 1AGCA 4MNHA 1I7RA 4NQVA 4YPJA 5C0AE 1YY9D 1CVSC 3S96A 4P48A 5DA4A 2JB5H 4OF7A 3C08L 2AXJA 3K0WA 2VABB 4UIMA 4R0LB 4ACPA 5KG9A 2IG2L 4NQED 4IIQB 5IK3B 3UYRH 1VFAA 1JZ7A 3MLYL 4HUUA 5CJOH 4CADA 3GBNL 1EEZA 2XTJD 1KCSH 4LPYA 4JHAL 5MEOA 4OGZA 5FFLA 3JV5A 4RRPA 5E8NA 3LN4B 1D5MA 3ULVF 4L5FL 5EZLB 4FXKA 1QA9A 5H35B 5HDLA 4EEEA 3WXVL 5I1KH 3B9KA 1P69B 4U0RC 4G9FE 3VI4F 4I77L 3SE4C 4QXGL 3O8XD 2NR6D 2O5ZL 1MFAL 1C5BL 4XC3H 5J57B 1J8KA 1R5IB 2BSSA 1EJ6A 4KRNA 4WWKC 5I74B 3MOAH 1JCKA 3CCHA 4Z7VA 1D9KB 3HI1B 1AJ7H 3D39B 1ES0B 5CLTA 3U0WL 3TO4C 2NY5H 5F44A 1ERNA 1AR1C 2VUYA 3BUYB 4I13B 4MAYA 1WAAA 1YN7A 3MFGB 3NIDF 4GBXD 5D7IB 3F6IA 4WHYH 5LKNA 1U3ZA 4F8QA 1S7SA 4TSBL 1B90A 1MAKA 4IRJA 3MV7B 5FCSH 5ICYA 1WT5A 4QHUA 1PD6A 3BSZH 5D7IE 3U2SB 4LRNL 4PBXA 4OJFH 5I18H 1MIML 4HUXA 5KVGL 4MA8H 3TV3L 1A7PL 3SEPA 1QSFB 2F58H 4DZ8B 3QAZC 3LKPB 4PTUB 1EHXA 1QBML 2MOVA 1PYWA 1X5HA 2IADB 1OTSD 5F8RC 4L8SC 3VGGA 4L8CA 2MQ3A 3HI6L 5IB3B 2OK0L 5H94B 4C56D 5E8PB 5DD0L 3LQAC 1QSFE 1LEGB 4X80L 3ARDD 5AD0B 4PRPD 5CIPH 4R6UA 3FFCD 3VD4A 3KPTA 2MNUA 5ICXA 4ORGB 1HEZB 3EZJB 4F9LA 4YC2B 5C0GB 2EXYC 4G9DB 4ODHL 3PNWB 2VQ1A 4X83A 3IF1A 1AP2A 1E4KA 4HBCH 4ONGL 2ZUQB 2W65A 4YHML 4UT6L 1RD6A 3ILPB 4M1CC 4LP4A 43C9A 3MMEA 2YD8A 4IS6A 5EN2A 3MOBL 2XRAL 4P2OD 2ICWB 4N1HB 4M6NH 3NCJH 4NT6B 3MBXH 4IOIA 4KTEH 1MAMH 1A7OH 3BP5B 1N6UA 1D6VL 4PJDB 4UQ2A 1T83A 3MBED 1V7NL 1JWUA 2YZ8A 5F7EL 2X40A 1QR4A 2E7LC 4N1EA 1UB5B 4NQXA 1M05B 2R2EB 2OJZH 1KTRL 4LSRH 4OBSA 5BXFB 2IH1B 4WI7A 2R9HD 1BQHB 2V2WA 1EUTA 4X0KB 1P1ZA 4Q0XH 3BQUA 5I76B 4L4VB 2PETA 3D18A 3QFDB 5CKAA 4CRPA 3N1FC 4U49A 4GKNB 4JFXA 4JO4L 1CU4H 4Y4KA 1YPZA 4I2XB 4PJAA 1AXTL 5EUOA 4L4VE 2A6DB 4GRWE 2P42B 1E4XL 5GS2H 1UXWA 4I2XE 2UY7A 2BNRB 2DD8L 3W39A 1DBMH 5HHOA 2E5EA 2IANB 3AU1B 4CDGC 3FQUA 3T0EB 5A2KH 2X09A 2VL5A 2A6KB 4U3XA 1EHNA 2R8SH 4RFNB 3MODH 2ADGA 2IANE 3RWHB 2HVKA 1MFEH 3T0EE 1I3RA 5F88A 3IT8D 4P9MH 4XNUH 5ISZB 1A47A 4OZIB 3VA6A 2GAZB 1C16A 3AAZA 2BJMH 2A74A 3DX9B 4NNXA 4ZG1A 4RNRB 4U1SB 1FNLA 4PTTA 1MY5A 4DFHA 3GSRA 4JZOA 3C87A 5GIRB 5JPMB 3S4SA 5B39B 1UYWH 5CEYB 3TVMB 1U8KB 4AQ1B 4FZEH 1J8HA 4PJFB 4XVSL 5ECJE 2AXFA 3I3BA 3I50L 2PYFB 3RUGF 3GUTB 1ZLUK 3TO4D 3I75A 3CDFA 2ARJB 3DXAA 1JUFA 1AR1D 3ARTA 4WGVB 3UX9B 1IGMH 3Q3GB 2X1WL 2YD5A 4GXVH 1EEQA 2PXYD 5ICZA 4RGMB 4NNPH 2OMNA 2ESVB 5DQDL 1CBVH 2A9NL 5TE4H 2V9TA 3RWEB 2C7UB 1OGAB 3KR3L 1LE5B 4XB8A 2ESVE 4DN3L 3EO1A 2D31B 4QRQA 1U3JA 5ESVA 3JWDC 1I8MB 2CIIA 2XWTB 1O5DT 2ICEA 1TJIH 2DTSA 1A8JH 1WF5A 3GGWA 3MRPA 4DTGH 3HN3A 4OSUH 2IFFL 1F42A 5DJZA 3RVWD 1A9EB 3FOLA 4QGYA 1HQ4B 4NGHH 5KS9B 2ZUWA 2Z92A 1MCLA 3QZWA 2CKNA 3GJEB 4LK4A 5JXAL 1IKFH 1LVEA 5HGHA 1U8NA 5I16B 4GW1B 1XGPA 5INDA 4NZRH 5IB2B 3NGBC 3IJYA 3JUZA 3QCVH 3A0OA 4UI2A 2XA8H 1U2HA 1OAYL 4NM8H 3W2DL 5EU3B 1Q9WB 1J88A 4JDZA 3OR7B 4U7MA 5ESQB 4FFWD 3EO9H 2ZUXA 5DJ8B 1P2CA 4QRSA 1FPTH 5C08A 3LEXB 2V17H 2ZKHH 1KLUB 5TE6H 5HHNB 2VMFA 1JGUH 3VRJA 2X4SB 1MLCB 3S9DB 1DUZB 3FO9A 3N9GH 3DSNA 4PGZA 4E5XB 1IAKB 3UDWA 3GSOB 3NACL 2VN4A 4XP1L 3W0WA 1IM9D 1A6UH 3MGOB 4G8GD 5F7NC 4H25B 5F70A 3UPRA 3MLSH 5HI4C 3VXRE 3K1DA 2YOCA 3O11A 5BV7C 3AREA 4I48A 5KSBF 5A1AA 4PRDB 2NX5D 3R4DA 1S7QA 4OCLC 4E41B 1A2YB 1NKRA 2VDRH 3WHXB 4J6RL 2QHLA 1ZLWH 4Y5YB 3VD9A 1KYOJ 5KJRH 2EXWC 1FFOA 4EN3A 1PLGL 5ILTH 1B0GA 4PV9B 3MRRB 4M6MH 1YZZA 2P47B 2WQ8A 3ZKXC 4YNYB 1KACB 4NP4H 2FJHA 4QYOB 1A6TA 3L3JB 4LGPB 3R8QA 4PRAB 5EA0H 5FUOL 1ZLVH 3OKEB 5MEPB 1MVFA 4NN5C 1FL5A 4UZGA 4APQA 4HH9B 4DGYH 4NZTL 1DEEA 2C1OA 1BQSA 2ERJC 4WCYL 3B9DA 3KNBB 1OTUC 1T20B 4QT5A 5ALBL 4EDXB 4NSKA 2APXA 3V95A 4UV7H 5I1GH 3V6BR 5DEGB 3V7MA 1TFHA 4UOW0 4NQCD 5JW3H 1QKZL 4JFEE 3Q6FB 3ZKMC 2HLFC 1KIRA 5AAMA 4DUVA 4XP4L 4YE4L 4NO5B 4JRXA 1T2QL 3BKYH 1NEUA 1CLYH 4G6ML 2Q76B 1NMAL 1OAKL 4NJ9H 5DUML 2NY4C 4G43A 5JMOC 1HI6B 4MA1C 2Y9RT 1B2WL 3B9VA 4L4TA 1NSNH 3PDOA 2YK1H 3D5OF 1LD9A 1A21A 1CXFA 4MZ2A 1W0WB 2VE6A 2C4FU 3O3DA 1TVHA 3QULA 4QRRA 1IVLA 4HD9A 4Y8DC 5DZOA 2ED7A 3CFCH 5ESAA 4HUKB 1MCOH 5CGTA 1QNZH 3DI3B 3WLBB 5MI0C 3U4BL 1LEIB 4NZUL 4RFOL 3MCG1 2Q8AL 5I1EL 1QR1A 4EI6B 4KK6C 4TRPL 4UDTA 3LEVL 4KVCH 4LIQE 4NHUB 4XP6L 2VITA 4OUUB 1ZHLB 1A6PA 3VI3E 4PB9H 4E0RB 1BVLA 3EYOA 2V7NB 1U8IA 4JM2B 3X17A 5ITFA 3WO4B 1JWMB 3D3VB 4K9EC 4U1LB 1XGTB 3IB4A 3CSYB 3MLTA 5DJCB 4JRYB 2CLVB 5E2JA 4JO1H 4J3XA 5JTWA 4Z7OE 4NOBA 3C6LB 1NC2A 4L9LB 3D3VE 4X6DA 1SYSA 5IROA 3GEWB 3VXTA 4DCQB 1XH3B 4HGKC 4GAGH 1A1NB 1CDIA 4JRYE 5GSRB 2R29L 5LQBL 3RWIA 1IL1B 2AV1B 1SJHA 4P5KA 5E8DL 4FQQA 4KK8C 4NJAH 3V6OA 1U9KA 4HKJA 2JTDA 4JFYA 2FR4A 3LB6C 1VA9A 2W9DL 1Q0YH 2B5IB 3PV7A 4NO2B 3DV6B 4LQ1A 2AXGB 4Y2DB 1AY1H 1DVFC 3MV8B 3C5SB 4K23L 1T80A 1R5WB 3X11A 2B1AL 1CXHA 1CLZL 1JFQL 5HD8C 4NQDE 5J1AA 1ED3B 3BO8A 3PWPD 2X7LA 4DAGL 3MV8E 3MV11 5HI4D 3U82B 4Y89A 4KTDL 4FQLL 3HMWH 3B5GA 1WGOA 5T3XH 1N2RB 4H1LH 2B8OT 3KYAA 3IKKA 1AO7E 2ITDB 3BWAA 4KKNA 1ZHBA 3F7VB 5JDSA 3QDGE 2PCPA 4GRLC 4DWHA 1BEYH 4OI8A 3LIZL 1HSBA 3BPNC 3D6GA 4OV5B 3B2VL 4U3HA 1MWAL 4ZSOA 3OKLA 2CDFA 5KSUA 5HYSG 4CVZB 1A9BA 2B2XH 3MV9D 4RWYH 1ZT7A 1KJ2B 5D7JA 4K7FA 5CEZL 1GC1C 4UOW1 2UZYB 4JANA 3U1SH 5GZOD 2AJVL 3DYPA 4CNIB 3SGJC 1FL6B 1E6JL 1EXUA 1OQXA 3FRUA 2AK4A 5TE7H 5L6YL 2FECL 1CXEA 1FO0H 1NAML 1RUQL 1OTUD 4MJIA 2ZZUT 4I0PA 3FT2B 3O3EB 4I8DA 1SQ2N 3FB8B 5GS1C 3SDCC 4UNVA 2UYLA 1JN6A 1X3DA 4KRLB 1IE5A 3R06B 4Y5VB 3ZKMD 2HLFD 3DTXB 1AGDA 4M5YH 1QPPA 4PJCB 3QI9A 2X9WA 1FIGL 4O4YL 1KCRH 2AERT 4ZQKA 3L7EA 5E9DB 5EDXA 4OM0L 4Z7QF 5F6HJ 3QO1B 4TN9A 3W9EB 2X9YA 1CE1L 1INEL 1BGXH 1P4IL 3S5LG 5E9DE 3PF2A 3EHBD 1CGSL 4KROD 5JLZB 1OL0A 5DJAB 1TNNA 2Y07L 5C6PB 5IBTH 1LO4H 5FV1L 4UQ3A 3MRCA 4LMQI 4KK6D 5TDPA 1T66C 5C6WH 4XC1L 3L3GB 4TTDC 5D71H 3SCMC 4HLZG 3KPRE 2FGWL 3CX2A 3IDIA 1U36A 3I3EA 2YRPA 1PG7H 2D9QB 3BPCA 3MRFB 2A0LC 1ZMYA 5HYIA 2HG5A 3LKQA 1RPQA 3WD5L 1U3YA 1UVQA 3SDDA 3DWTA 1O7VA 1JYVA 3RY6C 3PGCA 5IM7B 2EC9U 2UZXB 4F57L 3CLFL 3QUZD 5BZDA 2J4WH 4JFHD 2OSLA 5MERB 1W0VB 1X4ZA 1NCAH 4WUKH 1MLBA 1A14H 3PUCA 1UACH 3RZCB 1FDLH 4FNLH 3UAJC 4M7KL 3NA9L 4KK8D 3H3KA 4K9EH 3RDTC 3FONA 4Y16C 3QXWA 4LVHC 1EBPA 4U2YA 1DVFD 5IB4B 5F1NB 3HG1A 3L3IB 3E8UL 6FABL 1J10A 3FN0H 2IQAA 5MP6H 5HD8D 4AG4H 3VXMD 2ZUUA 4YGVA 5I6XB 5KANI 5C0EB 4CJ0A 3BKJH 2GSIA 2QR0A 4WENB 4HEPG 4IHOA 2F54B 5EO1A 5FHAL 2YMXH 2ED9A 4XMKH 1EO7A 3V9FA 1WWAX 3HPLA 1BVKA 4R4FH 4CUCA 3SGKC 3RX7A 1CGYA 2J12B 4NKMA 1IQDB 5EOTA 4GRLD 5IJVA 4JQIL 3RWCB 3CSGA 4LSVL 4OZHB 4NC1E 1ZGLM 3PQYB 1XAUA 5GGTL 4GXUN 5FK9B 3MLVH 1TQCC 4OZHE 2FZ3A 2J8UB 3KYKH 1MREH 5BRZA 5BVPH 1HIML 1Q9LA 3PQYE 3QYCA 4BH7B 1FNFA 4NO3B 3ULUL 4TULH 2YPKA 4JPVL 4WI4A 4R2GB 1E4WL 5DT1H 1HKLL 4QY8B 1HYSC 1JMZA 2F5BL 4P46C 3BGMA 3T4YA 3VFVA 5T3ZD 4YH6A 4HCRL 1RK0B 1NL0H 5T33H 4UB0H 1GC1H 4TQEH 5DC0A 4EQ2A 5IMMA 1NCWH 3RY4A 2ADJA 1KPUB 1UM6H 1ZEAH 3O6FA 5KZCD 1CGXA 1T1WB 4OF3A 3D1MC 1A5FH 1FFPA 2BDNH 3HCVA 2NXYB 1QRNA 2R0KL 4OI9A 2WUBH 4MNQA 4PJBE 3SBWC 1R0AL 5FKPB 1X6LA 1YJDL 5DK2B 5JOPE 1YUHA 3DO7B 4EI5C 1ZA3A 3LOWA 2Q87A 4FN0A 3REVB 5FOBA 3HE6A 1X5GA 4Q97A 4G6JH 1DN0A 1HHGA 2AJSH 3FOMB 4Y2OA 5T1LB 2CXGA 5TQ0L 3QWOB 2Y5TB 5C0BD 1G6RH 1JV5A 5E70A 3T1WA 1MWAA 4L8BB 5EZJA 1T66D 4YHKH 3SCMD 4AEIL 1F8TH 3ES6A 2X1OA 5KSAD 3QEHA 3UMTA 5HGGS 2HN7A 2Q7NA 2PF6A 1INQA 3EYQC 2IAMB 4UV4L 4DUWA 5BW7C 2LAAA 1NGYA 1ONQB 3BGFB 4XCCH 5DWUH 1NAMA 2WINA 3HZYB 3EDKA 3U30B 1AGCB 4MNHB 3D2UA 1I7RB 1P84K 4NQVB 3L1OL 3FMGH 3OKMA 3QPXH 4HKXA 5B38A 1DANU 3QDME 3S96B 4OIAA 2DKUA 5HBBA 2GYSA 1FHGA 1QLEH 4UIMB 5KG9B 5JXEA 3AB0B 5D7LA 3UAJD 1IKNA 2EE9A 4JFFA 5IESL 5BCAA 1G0XA 1VFAB 4W4OA 3RDTD 3IAGC 4HUUB 5HI5C 2PYED 4CADB 1EEZB 3RU8H 2YBRA 1U95A 1IGYA 5MEOB 1O7SA 2MSPA 2HJLA 3IFLL 3QHZH 5E8NB 1MSPA 1UKTA 4MDJA 1D5MB 4XP5L 2ED8A 4FXKB 1QA9B 5E6ZA 3HE7A 1IAIL 5TDNA 2P5ED 3B9KB 1YEGL 5IVXF 4J3UA 5LAXA 4M61A 3BGAA 2BSSB 4LVNC 4N8PA 1M7DA 3CCHB 4Z7VB 1N5YH 2DTMH 3CU1A 2IBGA 3U4EA 1UKSA 4HZAA 6CGTA 3PE9A 4PUBH 1U8QA 1J5OH 3L3HA 2F8XC 3QUKA 4MAYB 1YN7B 1HH6A 1PGRB 5BO1H 1S7SB 4IRJB 1DQQA 4HPYH 5ICYB 3OX8A 4QHUB 1TTGA 3ULVL 2YUVA 5TF1L 5I1DA 1GAFL 4PJHF 5C09A 5IVNA 3ILQC 1HYSD 2WZPD 3QR2A 4P46D 4HUXB 5D1QC 3ALWA 4M8QA 2H32A 2Y4SA 4OGYL 2R4RL 1UM5H 1JTOA 1I1RA 2MPAH 5CJQL 1G7QA 1PYWB 3MLXH 5L2JA 4L8CB 4JDTL 4HDIA 2YUWA 5DJ2A 2Z31C 5FV2A 4N0YL 1OPGH 3MA7A 5E6IA 5ICXB 5EZOH 4LSQH 5F6IC 3L6FA 3WFBH 4P2QD 2VQ1B 3IF1B 1AP2B 3TA3C 4XCFL 2W65B 1H3GA 2AEIT 1GGCH 3KPOA 2DLFH 4EI5D 43C9B 3ARBC 3SKNA 3MMEB 4HS6A 4IS6B 5EN2B 2DQCH 1HK6A 2YD1A 1V3LA 4RGNC 4IOIB 3S35H 4JHWH 5GGTA 5T1KD 3VU2A 4YBLB 4UQ2B 3BISA 1ZSDA 3OZ9L 5CJOL 1JWUB 4I18C 4LHQB 3JWOC 4DEPB 2BY1A 5HYFA 4KVNH 1BHGA 2ZCKH 3FO2A 1UC6A 4NQXB 5I19H 3V5DA 3H9SA 4ZXBC 3EYQD 4PLKC 2OR9L 5CP3H 4TVPD 2V2WB 2P45B 1FNAA 4RQQA 3VJ6A 4YHYC 1P1ZB 3L5WA 4R96A 3BQUB 3KS0H 2A1WL 5A16A 3MJ9H 3CFKA 3MJ7A 3D18B 1YNLL 3G5ZA 4JFXB 3D9AH 1XIWC 4Y4KB 1YPZB 3L95A 5JR1H 25C8H 4G6KH 4L3ED 4PJAB 5I73C 5EUOB 3WJLA 3MRIA 1OM3L 4HCRA 4ZODA 4LSTH 4U1HA 1QYGH 4XMLL 1WFTA 1UXWB 3W39B 5DZNA 4CVUA 5HHOB 1SBBA 1OP9A 3FQUB 1NFDF 4Y1AD 5EWIL 2VL5B 5HI5D 2AABH 1BIHA 2A38A 3UTPD 3W82A 1IM3A 5HHOE 2ADGB 4MVBC 2HVKB 5E5UB 4YFEA 12E8H 2DM2A 1B6DA 1I3RB 1K4CA 5F88B 5FO7A 1CICC 2BVOA 2X5PA 5IT2H 1LK3H 3QJHA 4PG9A 5EIVA 1C16B 3AAZB 4HWBH 2A74B 4NNXB 1TETH 4N1CA 5AZEL 1N3NA 4PTTB 1FRGH 4NKIH 5C9JA 3GSRB 3VFUA 1MOEA 4JZOB 3CSPA 3S4SB 1F2QA 4YHOL 5ADOH 3QXTA 1KUMA 1J8HB 4MA8L 1MVUA 2EKJA 2QQNL 3MFFA 4Q6IA 2AXFB 2Q8BH 1I1AA 1BAFH 3I75B 3BRGC 3DXAB 1SYVA 1JUFB 1NUDA 1HWHB 2VDOH 3UTTD 3KPSE 5EH1A 4LCWE 5D1XA 5L7XH 5ICZB 2WLZA 3H9HA 3DXAE 3RY5A 4OV6F 1DQLL 4M1GL 3G6JA 4B50A 4OCXH 5B8CA 3PP3K 3DX7A 3ILQD 1CDYA 4YPGA 3EO1B 4QRQB 1NFIA 5ESVB 5D1QD 1EMTL 2CIIB 3NCJL 1SMAA 4X9HA 2ID5A 2ICEB 3MBXL 3UP1A 3GGWB 3MRPB 3FHQA 1A7OL 1U91A 1IBGH 4IRSD 3DMMC 1GHFH 5GJSH 1OT2A 4WI2A 5DJZB 1VESA 3FOLB 3QDAA 4X6CA 4ODBD 3RWFA 4XH2A 4ONHA 1EH9A 2OJZL 1T7ZA 2Z92B 2G60H 3QZWB 2O93L 1FH5L 1GJIA 2OP4H 4H0IA 1CFVL 5JW4M 1UWGH 4Q0XL 3TA3D 5HGHB 1U8NB 1WK0A 4KK5C 1XGPB 5INDB 5J6GA 3IJYB 3ARBD 3I9GL 4NO0D 4J8RA 5F7KC 4RGND 4JDZB 3WFCL 2FYYA 3TP4A 1CLCA 2QKIA 2PO6A 1SJEA 1P2CB 1TZIA 4QRSB 5C08B 4UAOB 4BKLA 3SJVD 3VRJB 1JGLL 3PXJA 4OF8A 2ADFL 2X89D 3FO9B 4LAJH 1E27A 1J1PL 1T03H 4PRIA 5C08E 1OW0C 1MFEL 4ZXBD 1JGVH 2J5LC 4UDUA 5HYSA 4PLKD 4XNZB 1MFDL 3MUHL 4XNUL 3S6CA 3W0WB 5MEND 1YMMD 2BJML 3AY4C 4N0RA 4HSQA 3UPRB 1N64L 1XIWD 1W0YT 5FCUL 4U1NA 5E5RB 1PBYA 3O11B 3W0WE 3JWOH 3BZEA 4YFLF 3AREB 1P7QA 2OXGA 4I48B 2P8LA 4P23A 1P5VA 3QPQC 4NZJA 1S7QB 1UYWL 5SWSD 3GRWH 4M6OH 4Z7WF 4U2ZA 3BRFA 5IOPA 4BSVA 2NY0C 5DGRA 3GM0A 1OD9A 1FFOB 4EN3B 1KXTB 4RISH 5CBAA 1B0GB 5J8OA 3RHWK 1CICD 3NH7L 2FJHB 2P5WA 4LGRB 1A6TB 4NNPL 2Q6WA 3WIHH 5I30H 1X5XA 4FFYL 4U31A 1P7KA 1FL5B 4APQB 2VDNL 3S88L 2ICES 1DEEB 2C1OB 2YN5A 1F90L 4QT5B 4NSKB 1NQBA 1YEHL 4F15C 2OJEA 3FAXA 2OTPA 3MRMA 4OLWH 2APWA 1IEBA 1NGQH 1KIRB 4JRXB 2DMKA 4FMKA 1CG9A 4V2BA 4N0UA 4XVTH 1G9MH 3RIFF 1T7XA 1UT9A 4JY5H 4G43B 5E2UH 4NQEA 3WUWA 4L4TB 4JRXE 1MI5A 4MB4A 3PDOB 5EU4A 1LD9B 1BD2A 2NY6C 5DEFA 2VE6B 4HWEH 1Q9KA 3O3DB 1TVHB 3EYFA 5BZWA 2JKXA 3QULB 4QRRB 5DGQA 3BZFA 4K3EL 5ESAB 4NZRL 2XXMB 2YC1A 1X7QA 5KBNC 2ZG2A 5HXMA 3RNQA 2B4CL 1BFVH 5DUPH 3LQAL 2WBJC 3QIWC 1LMKA 3ZDZE 4XBEH 1QR1B 4P9HH 3EO9L 5EU6D 3DMMD 4UDTB 1R5VA 1BQLL 3N85H 2VITB 1JGUL 1RIHH 3VWKA 4LOUD 2AQ2A 4P2YA 5J56B 2NY1B 1BVLB 3EYOB 1U8IB 5ITFB 3VXNA 4C83A 2CSPA 2F19H 4LBEA 4AY0A 2EE6A 3V6ZA 3O2WH 3MLTB 2PKDA 1XGUA 3BN9C 4EZMA 4ODXA 4KK5D 1NC2B 1F3DH 1RZ8A 4X6DB 4WO4A 1SYSB 3VXTB 1UM4L 4KDTC 1W2KT 1PEWA 3WN5C 3RWIB 4M62L 4RDQG 1SJHB 4P5KB 4FQQB 1R24A 4HKJB 3T3PF 4Q2ZA 3QT2A 4QWWD 5KJRL 4JFYB 5CIPA 2FR4B 4LCUA 4X4MA 3CVIL 3V0VA 4LCIH 1YEKH 2CDEA 5L2KD 3ARFA 5E94A 3RWDA 4P4KA 4ONFL 3X11B 5E56A 4GG6A 4ZTOL 4NP4L 4PB0L 3IJHA 4BZ1H 4PBWD 3TT1L 5EA0L 4NKQB 5J1AB 2WWKO 2FD6H 3REWA 3BO8B 2X7LB 3TJEH 4Z9KB 3ARDA 1MPAH 3FFCA 4LEXL 3WFEH 4TTGA 1OT1A 1UCTA 3GNML 5K9JL 2E7BA 3QPQD 2WLYA 3EOBA 2MKLC 2NZIA 3MLZH 1Q8MA 4HLJA 1EHLH 3BWAB 4D0DA 1ZHBB 5JDSB 2PCPB 3EDDA 3CLEH 2NY0D 1CTOA 4L3AA 3BKYL 1WVZA 1CLYL 1G1CA 4KY1H 1HSBB 3HKFA 2ZCLL 3OKLB 2CDFB 4ZSOB 5KSUB 5F9JA 4JGJA 1NSNL 4ZDHA 1A9BB 1ZT7B 5D7JB 4K7FB 4POUB 4JANB 3WKML 4ZSOE 4PJIF 1EXUB 4YXKL 1NCBL 1VFUA 3EOAA 3FRUB 4XPBH 2AK4B 1S9XA 1MCOL 3BDBA 3TIDA 4MJIB 3I3DA 3QFJE 1H5BC 4I0PB 3UO1L 4U7KA 2UYLB 1JN6B 2AK4E 3GK8L 3VFWA 2EYTA 4AJ0A 2W9LA 2FIRT 1AGDB 2K1MA 4KVCL 4AIOA 4HC1L 3QI9B 4GS7B 1WZMA 3ZTNH 4MB3A 4XVJL 4K8RD 5D2NE 2VXUH 4ZQKB 3P0YL 3F8UB 3L7EB 4ZPTA 2WIMA 3JWDL 1H8SA 1GZQA 2HYMA 2NY6D 3PDDA 4M43L 4OD1L 3M1BA 3V6FA 2WUCH 1SHMA 4A6YH 4WU5A 2EDRA 1XGYH 3V4UL 5I71C 3UJIL 1Q94A 1JF1A 1NC4D 4M1DH 4XNXH 4LLQA 5DD5H 4UQ3B 3TLRA 3MRCB 1K8IA 4NJAL 2NXZB 4HJ0C 4IMKC 5TDPB 5JHDA 3SE4A 5JA9A 2DICA 3G5YA 1HILA 2EICA 4UILL 1B6UA 5D2LF 3ZSSA 1S7TA 1Q0YL 3IDIB 1IC5L 4WWKA 5C07D 2RR3A 3LQMA 3I2CH 3BPCB 4PIRF 2GKIA 4F7EA 4PJGA 2HG5B 3LKQB 4LDLB 1VDGA 3DI2B 5ENWA 1UVQB 1EEYA 3SDDB 4GT7A 3BN9D 3CXDH 3PGCB 1VEPA 3MXVL 4HQQH 1OSPH 1LO0L 1BFSA 3BYTA 3O2VH 5C0DA 3A6CH 3IGAA 4KI5D 2GT9A 5BZDB 2VERN 2OSLB 3HMWL 4R97C 1HSAA 1MLBB 5FEBA 4K3JL 1TPXB 3IFOA 1YYMH 4J3WA 3FONB 1BEYL 2I5YH 2OLDA 1VPOH 5T1DL 5HGBA 4Y5XC 3ELAT 3TO2A 1GZPA 5DR5L 1UG9A 3QJFA 2P1YA 5BV7L 3HG1B 2VXQH 4M93B 4PD4K 4KJQC 2IQAB 5E00A 1P84J 3U1SL 3JWNC 3GSQA 4YGVB 1X5FA 3T0AA 3HG1E 4Y8AA 2LU7A 1JK8A 1JF6A 1X9QA 3ALPA 2GSIB 2IPTH 2QR0B 1MCCA 4IHOB 4ZO7A 5EO1B 3AMKA 3VMNA 4PS4H 4GQ9H 3HPLB 1BVKB 2JJSC 3ZDXF 4NKMB 5EOTB 1V05A 5IJVB 1S9WA 1MH5A 1T89C 4N68A 3U7AA 2IALA 3R0MA 4GRMA 1S7WA 2VXVH 1IGIL 3QEQA 4RMVA 1MQ8A 2FZ3B 4XAWL 1WBXA 5BRZB 5TFSH 5TQ2H 1WZ1L 1Q9LB 3K4DA 3GM8A 5GHWH 5DO2C 3JVGC 1BGXL 3KPLA 2YPKB 3EFDH 3M8OL 2E7LA 1KCKA 4EBQH 5BRZE 1RY7B 3O6MH 3BGMB 3T4YB 4P0DA 3VFVB 1FVCA 1JE6A 1I8LC 3L3DA 1BVZA 1KXVC 4IMLA 3WS6C 4PY7A 4GW5A 1MRDL 1LO4L 4UTBL 2IEPA 1IGCH 1VADA 4X8JA 2VLJD 3AS2A 1YEFL 5IMMB 1AIFA 5J11C 2ADJB 1I9JH 3O6FB 4KI5F 5GS3A 5D71L 5AG8A 4XX1E 2NX5A 2SEBA 3UBXG 1FFPB 4GUPA 3HCVB 4XVUC 4BSJA 5JZ7C 1PG7L 3L5XH 1QRNB 3CVHH 4MNQB 4HK0A 4FTVD 3V7AE 4LQFL 1JHKH 3PWUA 2WP3T 2BVQA 4KK9C 5CWSA 3K8MA 5GRUL 1QRNE 1YUHB 4MNQE 5DVOA 5AZ2H 5A40E 4NN7C 1ZA3B 5F89A 1F4YH 2R69H 3IDNA 4BA8A 3HE6B 5FOBB 4C4KO 5KAQF 1DN0B 1NCAL 1HHGB 4OZFG 1P7HL 4M7LL 4MB5A 2BOBA 2R0ZL 3CMGA 3CFIC 4JPIA 1C8PA 3ZTJH 4K9EL 4HJ0D 1JV5B 1MWAB 5EZJB 3V4VL 4B7IA 1KBGH 1CDJA 3ES6B 5FM5M 3QEHB 4NHCH 1Z0NA 2HN7B 1CT8A 4NQCA 3RWGA 1INQB 4ZOCA 5DZLA 3BZDA 3RIAF 3THMH 4C57C 5IFHH 4K3GA 1NGYB 4MJ6A 5MP6L 3VG9C 3KJ4C 4K7PX 1F4AA 2EDXA 1NAMB 2EYRA 4AG4L 2W07A 5HYJE 2W9EH 2WINB 3OGOE 4ZD3H 3D2UB 5GRWA 5FGRA 3OKMB 5B38B 4HKXB 4LHUG 2VDQH 2VH5L 1EJOL 1PFCA 3D85D 2VSDA 5GZNC 3O6LL 5GS0H 1MJUH 4M5ZL 1RURL 4HC1A 5D7LB 2XN9E 4JFFB 5GGVH 1RU9H 3VRLF 1U2CA 3B83A 3KDMA 4H8WC 4YBHA 2BNQD 1QQDA 1BPVA 2YBRB 4JFFE 1U95B 4Z7UF 1VGEH 1IGYB 1GVIA 2CRYA 4MZ3A 3AM8C 1L7TH 2HJLB 2ZUYA 4MDJB 5FOJA 4KJQD 2XIDA 5BVPL 1G7MA 3HE7B 3FT3A 5TDNB 3ZKQD 4DVRH 2XQYG 4TULL 4N90E 5LAXB 4M61B 5I1IH 1ORSA 4POYA 3INUL 3MRDA 3VMOA 2Y36H 4X99A 5DMGC 1U3HC 3U0PA 4PJXA 2FX8H 5T33L 1NL0L 5F1OB 2CR3A 5F71A 1I85C 2ATPA 3SGEI 4UB0L 3SPVA 5I9QC 3IFNH 2VXSH 3JUYA 1GC1L 3U4EB 2JJUA 3HFML 5HDOA 3MV01 1UM6L 5GGSY 2D7QA 3E2HB 1JYXA 3DUHA 1U8QB 2AAVA 5FGBA 1LP9A 3C8DA 3L3HB 3QUKB 5CINH 5IHUL 1F45A 5KVMC 1HH6B 2O5YL 3SKMA 2VOTA 1DQQB 5DO2D 5EBWA 3SGEH 3OX8B 5J0BA 5E99L 1LO3H 5I1DB 5DTFA 4FQJH 5C09B 5JIHA 2DI8A 4XHQA 5F1KC 4PJHE 5D6CA 3CC5A 4M8QB 2H32B 4XTRC 2WANA 2DQGL 1EPFA 2H6PA 2VLRD 2CLZA 4QOKE 5AYUL 1MFBH 1RZKC 1DZBA 1G7QB 1G6RL 4JFZL 3V0WH 5C0CA 4FQXA 5L2JB 4YHKL 3DVNA 2E7CA 4HDIB 4OT1H 4EOWH 1F8TL 5FYJH 4XBGA 5D96B 2N7BA 5DJ2B 2FWOA 1CLOH 2AJ3A 4KHXH 3MA7B 5E6IB 1NCCL 3UYOD 3S37X 1MQKL 5IFAH 3GMRA 5IV2A 3EJZC 1EA9C 3L6FB 4KK9D 4HS3A 4UUJA 4NWTH 2E27H 1AD9A 3KPOB 3FQXA 3GSUA 3SKNB 4HS6B 5D1ZC 3U4AA 4BJLA 2X4PA 4DUXA 5DMYA 3FKUS 1D5BA 1EVTC 4LARH 5DD1L 3MGTA 4X7EC 3C5ZD 1T1ZA 4PJEF 3SE9L 1ZSDB 3Q5OA 4M9PA 4HFUH 3GDBA 4F8TA 2QQLH 2D7TL 3RIAK 1YN6A 3FO2B 2QHRH 3G6DL 1FN4A 3V5DB 3H9SB 2FATL 2PW1A 4H20L 3G6AA 3NPZB 4N0CC 3W9DA 3ZKSD 1FFNA 3IDXL 2H2PD 4RA3A 1DN2A 4RQQB 3VJ6B 3L5WB 4R96B 1C7SA 5A16B 3H9SE 1IJ9A 3CFKB 3MJ7B 5AUMA 3G5ZB 4KPHH 3L95B 4MD5A 4X8XA 3MRIB 4Y4FA 4UINL 1B88A 2GJ6E 1D9KC 3TBSA 4U1HB 3VWJC 5GZND 4GMTL 3DECA 4P59H 4GH7B 4U6TA 3UTSD 5EUKA 3MRHA 1KFAH 4PRNA 1LE9A 4ZPVA 2E6PA 3BMVA 1E4JA 3DRTA 4K3DL 4JFDD 1DP0A 4Z0BH 1IM3B 2E6QA 1NFDE 4QO1A 1RZJH 2LTQC 3U7WH 4LCCC 1D6EA 3HI5H 1CDUA 1K4CB 2EDNA 4FQIH 5FO7B 2BVOB 3X12A 1WUNT 3QJHB 2XKNA 4PG9B 3O2DL 1DQDL 2FBJH 1A7QL 2HH0H 3QA3A 1MHEA 3MLRL 1X5AA 1N3NB 5C9JB 2AJUH 3BN3B 3VFUB 1N5AA 4AMKL 3I6LD 1GGYA 1T21A 1JHLH 1RUAH 5DMGD 1N7ML 3RJDA 4NRYA 1MVUB 4OLYL 2VIRA 4YDLC 2PTUA 5KVDH 3MFFB 4Q6IB 5F7HA 2V2TA 1I1AB 5FYKD 3NTCH 4MX7A 1L0YA 1SYVB 3K8KA 3S7GA 5D1XB 3RTQA 1DBKL 1OPGL 2XWJA 3H9HB 4NCC1 3RFZC 1TZHA 4MXWH 4HUMB 3GFUA 4J23A 5DJYA 1MHPH 3RA7L 4JZJA 3G6JB 4J4PC 3H7LA 1CD1A 4LVOB 3NFSH 2XZAL 5B8CB 3DX7B 3DUSA 2J88H 5FYLD 1EV2E 1TQBB 4K55A 4GKSA 4P49A 3T0VA 4YPGB 1DVFA 4H88H 1AR2A 1NFIB 1DJSA 5ELIA 1MNUL 1KCVL 3TESA 3KS0J 3C08H 2I9TA 1U91B 2IPKA 2HA1A 5J13C 1FJ1A 2IG2H 5IVZA 1K6QL 5KSVA 1V3JA 4XP9H 5DRZA 3BP7A 4X6CB 2F74A 4XH2B 3RWFB 4ONHB 2MCPL 2AV7A 5C0AD 3GBNH 3FB6A 4JHAH 1MCPH 5EU7E 4X6CE 3EJZD 3BWUC 5I66A 2LE9A 3Q0HA 5J6GB 3MR9A 5B3JE 25C8L 4J8RB 4I77H 4EXPX 2M2DA 4QXGH 3ZE0E 4U4BA 1DQJA 3PGDA 5CZKA 2O5ZH 1MFAH 1C5BH 3T0EC 2FYYB 4Y19E 1J11A 2QKIB 2PO6B 2W0LA 1SJEB 3FRPG 1TZIB 4BKLB 3CZFA 1T3FA 4N5EC 5LGKA 2GK0A 4G9FD 4HKZA 3U0WH 1JMXA 3SDCA 5GS1A 1E27B 1XEDA 4PRIB 4ORZC 5GRZA 4UDUB 5HYSB 2NYYC 4N0CD 5AEAA 1NCTA 5IP4A 5C92A 3FFDA 1DL7H 3QCUL 3V0AC 4S1DC 3SO3C 4ZS6C 1KIQA 3LDBB 4PLNC 4HWBL 5IVXA 4XPHH 1NGXA 1WC7A 4TSBH 4EKXA 1DQML 4OFKA 2VR9A 4U1NB 3BZEB 2EDLA 1P7QB 4LRIA 3VXPA 4BFBD 2P8LB 4P23B 1D9KD 1G6RA 3VWJD 4WWID 5CFHA 4LRNH 4PGEA 5GRVL 5ADOL 1UH2A 3BPLB 3BHBA 1J0HA 1MIMH 5KVGH 4UT7L 5IOPB 4BSVB 2CPCA 3TV3H 1ZVYA 1A7PH 1DQTA 3RQ3A 4LU5H 2FH6A 5CBAB 4Z7NF 3HA0A 3HI6H 1T1YA 2OK0H 1D5XA 5L7XL 3FQRA 5DD0H 2XXCB 4HPOL 2P5WB 1RHFA 2Q6WB 4WI8A 3VGAC 1I9IL 3SCMA 1I7TA 1P7KB 4OCXL 1QFUH 2EDHA 1L4IA 4CMMA 5I15H 4CMHB 4ODHH 3PHQA 1RUPH 1JGDA 4YHMH 1QSFD 1GRWA 2OJEB 2GITA 3MRMB 3RY6A 2BSRA 1IEBB 3SDAC 3OB0H 4AM0A 1VCAA 1CG9B 2ZOLA 4N0UB 2P43B 1D6VH 3MYJA 2ZOKA 1V7NH 5F7EH 4MQTB 4NQEB 3WO3B 3WUWB 1MI5B 3C8HA 4YHNA 2DAVA 2NY3C 5EU4B 5SWZE 4N0UE 1BD2B 2ICCA 5DEFB 4Y16A 3RKDD 1Q9KB 2DLGA 3EYFB 2W91A 5BZWB 4J4PD 4BFEA 1MI5E 1P4BH 3BZFB 1KB5H 2YC1B 4OM1L 1AI1L 1X7QB 2V5YA 1BD2E 3RNQB 3GMNA 4JO4H 5HPMA 1CGWA 1S7XA 1AXTH 2PW2A 4XGZA 4O00A 4U05A 2VDPL 2D03L 2APTA 1E4XH 3MYZA 1R5VB 4LCYA 5KVFL 4YQXL 3VWKB 1CR9L 1URLA 3VXNB 4C83B 5DJ6A 4LBEB 3SGKA 4L4VD 3A6OA 4CU8A 1JYWA 3V6ZB 3WBDA 1XGUB 3QDHA 4ODXB 5I8KL 1NEZG 3QUYA 1RZ8B 4WO4B 5D7IF 3JWOL 2YPLE 5KAQG 2IAND 4FP8L 1RUKL 3T0ED 2HFGH 1HCFX 3NFNA 1R24B 32C2A 4EVNA 2CO6B 1M71A 4Q2ZB 5CIPB 4LCUB 3V0VB 5EOCJ 4P46A 2CDEB 4XVSH 4OAWA 4DFIA 1ODAA 3T3PE 4TSAL 3ARFB 3I50H 5E94B 3RWDB 3LZFH 4P4KB 1F4XH 3ZYIA 5F7MC 2NYYD 1QBAA 2AEPH 1NBZA 4X4ME 4BSWA 4GG6B 2APBA 3IJHB 4S1DD 3WIHL 5I30L 4ZS6D 1QSEA 2CUHA 3REWB 3KGRA 4TUOA 2A9NH 3ARDB 4GG6E 4ZUUA 1TJHL 4NOFA 3FFCB 1REIA 1MCSA 4O51A 5EOCL 1FC1A 5LBSL 3P4MA 2VKXA 3SBWA 3U6RA 3EOBB 2D0GA 4P2QA 4D0DB 2BMKA 2DQIL 1F2XK 1EHAA 3EFFA 2FCBA 4EI5A 1NGQL 5FA4A 4HJJH 1FYTE 3S98A 5F72S 4PD4J 3QCTL 2IFFH 4JY5L 2ESVD 4PJDF 1CK0L 1QLRA 5F9JB 4ZDHB 3JTTA 4GLRH 4Q7DA 1JNNL 5JXAH 3EOAB 1PZUB 1UZ6E 3FN3A 3BAEL 1S9XB 4ZOBA 3MCKA 3TIDB 2H26A 1BFVL 1FNSL 4GRWF 5BW7A 4OZFA 1F6LL 1G0DA 3ZT7A 2C3WA 2YR3A 1OAYH 2AJYL 4KAQL 3T2QA 3VFWB 2QSQA 3W2DH 5GXBB 2EYTB 4OI7A 3SDAD 1WIPA 1UH4A 3N85L 3WO4C 3MLUL 2Y6SC 4Z5RA 3F7QA 3NAAL 3C2SA 4KKAC 1ZV5A 3OTTA 2V6HA 3DARA 4HWBA 4OTXL 3K2UL 4ZPTB 1M7IA 3BDYL 3BT2L 3C6LC 3IDGA 1GZQB 4N8VA 3VD7A 3M1BB 1J0JA 3NACH 3V6FB 4XP1H 3U9PL 3DRQA 4LHUA 4WU5B 1JRHL 3AXLA 2PTVA 3K3QA 1Q94B 1KPRA 1QHOA 3F7RA 1JF1B 3B4NA 5ACLA 4LLQB 5EBMA 4DQOH 1K8IB 1SM3L 1Y18A 5JHDB 2VLKE 4JFOA 3N0PB 3G5YB 4J6RH 1HILB 1S7TB 4WWKB 3BDXA 5K9QI 3DJ9A 4XCEA 5CAYB 1HQRA 3VXRD 5JHDE 3LAFA 4QKXB 4F7EB 4PJGB 5LGJA 4KXZH 1XF3A 3CMOH 4BZ1L 1BF8A 3ARRA 5ENWB 2YSSA 1EEYB 4MA3A 1T7WA 3NCYS 5CSGA 3S3SA 4PJGE 5FUOH 3TGXA 3OB0K 1MPAL 5C0DB 3IGAB 2GT9B 5HHXL 1HSAB 2DQJL 4N8CL 3U7YL 2DYPD 4NZTH 5ALBH 4WCYH 4Z7WA 3GO1H 1EHLL 3CK0L 4R7NA 3W5NA 2R56L 3IFOB 5GSVA 2FSEA 3DROA 3V52L 5K59E 3CLEL 2EDQA 2VQUA 5HGBB 4OQTL 2BY2A 5HVHC 2EH7L 3TO2B 2R1WA 5D1QA 1GZPB 1S7RA 3VFSA 3NZHL 4XP4H 1T2QH 1KIPA 3QJFB 1BOGA 4G6MH 1NMAH 3QAZB 1I7UA 1P6FA 5DUMH 5E00B 5HYQA 4M7LT 1B2WH 3GSQB 5C70A 4JFED 2AW2A 1PVHA 2Z31A 3WIIL 1JK8B 5DURD 4MNGE 5DHXB 3WNMA 1JNJA 1L0QA 2GSGA 4RMUA 1D5IL 2P8MA 2HTKC 1A64A 3PP4L 4GSDH 3TA3A 1MF2L 5BVJA 4JN1L 4NZUH 4RFOH 1ZE3C 1S9WB 5C2BH 1MH5B 4PYGA 5EU5A 2Q8AH 3ARBA 4NO0A 4MD0A 3V4PL 1DLHA 4JQXC 2IALB 3AS1A 1PKQA 3LEVH 1E0OB 4GRMB 2RFXA 4XP6H 1S7WB 1Y0LA 5EBGA 3QEQB 4UOJA 3EYUL 4QRUA 1KPVA 1WBXB 2ZSWA 2ZPKL 3SJVA 5EC1A 4XHJD 3QEQE 2DB8A 3KPLB 4M7JL 2X89A 1X4YA 1NUFA 4HT1L 1OAZL 5JIKA 4ZXBA 2J8HA 2D0FA 5IMLA 1FVCB 1Z0MA 3L3DB 4IMLB 4PY7B 4GW5B 3H9ZA 2H2SD 4X8JB 1VADB 1ZS8A 2R29H 5E4EC 5LQBH 3WHE0 5AG9A 3C60C 2R4SH 1AIFB 5CHNA 5E8DH 2BSED 3ABZA 5GRXG 1FORL 5DQ9A 2NX5B 2SEBB 3P2TA 3D3VD 4GUPB 3QUML 4KKAD 2Z93A 3WIHA 2W9DH 4WUUE 1F58L 1QFWM 3I2CL 4HK0B 5C2UB 4JRYD 2XZQL 2GK2A 4MCZA 3C6LD 3PWUB 2BVQB 3EYSL 5CWSB 4K23H 1FIEA 2B1AH 3TCXA 5CLWA 4OD3L 3DLQR 3FT4A 1CLZH 1S5IL 1JFQH 5HGAA 4OQ1A 3ME0A 5F89B 3RZCC 3NCBB 3IDNB 4DAGH 4MWFA 1ZXQA 5JDJA 1A6AA 5T5NF 4LSPL 1VKXA 2BOBB 5HVWA 4FQLH 4JPIB 3OV6A 2EDDA 2GJJA 3CH1A 1NLDL 1MIEL 1YC7A 3F58H 2Y06L 1CDCA 3GI8L 4JKKA 4Y2DD 4EDWL 1CD8A 1MAJA 3BMWA 3MV8D 1V8HA 2P4AB 3Q5TA 3LIZH 2D3VA 1CT8B 4NQCB 3RWGB 4J7RA 3DPBA 2AXHA 3B2VH 1MWAH 4MJ6B 5IQ7L 1U41A 5F7DA 1AHWC 1RJLA 1AO7D 2J6EH 2EYRB 1DTUA 4KUZL 5CEZH 1OAQH 3VXQA 3QDGD 2AJVH 4HHAA 4OLVL 2OYPA 1U92A 4NC1C 1E6JH 5E08L 4ELMA 4PS4L 5HDQL 4OFYD 1NAMH 1RUQH 4RWHA 5D7KE 3OXSA 4NM4L 2WIIA 4RX4A 3NCMA 3KDMB 3DIFA 3CH8A 5ID0A 1Y6KR 1QFWI 2J7LA 1QQDB 2QSVA 2VXVL 4U6HA 1EGJL 4OKVA 2Y23A 4AEFA 3I85A 4MHHG 2DIBA 3DMMA 3QIUC 2CUMA 5TFSL 5TQ2L 4R2GC 5JO5A 1G7MB 3G08A 5GHWL 2R0LL 1N4XL 1IAOA 1MY7A 3T3MF 3FT3B 4JGMA 4PJIA 2NTFA 3EFDL 2G75A 3RGVA 1RMFL 1INEH 4EBQL 1ORSB 1P4IH 3MRDB 4G8FA 1AD0A 2K7QA 1CGSH 2VDLH 4X99B 2HTKD 3AMLA 3U0PB 4ELKA 4PJXB 2LVEA 4U3CA 5SX5H 4M00A 3SY0A 4YFDB 2ATPB 3SPVB 2Y07H 1S7VA 3EOYG 1NDMA 5A2LH 2NXYC 1I9JL 4PJXE 4LAQL 5E9DD 3HAEG 2D7MA 4XC1H 5C8JA 1LP9B 2FGWH 5ADPL 3SKMB 1JHKL 5F3BA 3NN8A 5EBWB 3WHE1 4R4ND 1LP9E 3LN9A 4ODSL 5C0FA 2GIYA 5L2KA 1J9CT 35C8H 5DTFB 3WD5H 2J8OA 2UZIL 3ARPA 5H8DA 4OFIA 1OW0A 4WEMB 1J1OL 2DJUA 3KPRD 2H8PA 4JDVA 1MHCA 5D6CB 3CC5B 4QHKI 5ALCL 2YWYA 3FN9A 4F57H