3GC3A

Crystal structure of arrestin2s and clathrin
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
380
structure length
329
Chain Sequence
GTRVFKKASPNGKLTVYLGKRDFVDHIDLVEPVDGVVLVRRVYVTLTCAFRYGGLTFRKDLFVANVQSFPPKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLAKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGDVAVELPFTLMHPKPKDTNLIELDIVFEDFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an arrestin2-clathrin complex reveals a novel clathrin binding domain that modulates receptor trafficking.
pubmed doi rcsb
source organism Bos taurus
molecule tags Endocytosis
molecule keywords Beta-arrestin-1
total genus 62
structure length 329
sequence length 380
ec nomenclature
pdb deposition date 2009-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00339 Arrestin_N Arrestin (or S-antigen), N-terminal domain
A PF02752 Arrestin_C Arrestin (or S-antigen), C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.640 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3gc3A02
2.60.40.840 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3gc3A01
3GC3A 1ZSHA 5F0PB 1CF1A 4J2QA 4JQIA 4R7XA 3UGXA 4GEJA 2WTRA 5F0MB 3LHAA 4ZRGA 5F0LB 2FAUA 3UGUA 4LL1A 2R51A 4R7VA 4GFXA 4P2AA 1SUJA 2WTRB 5F0JB 4GEIA 4LL4A 3GD1C 3LH9A 1G4RA 1G4MA 1JSYA 3P2DA 1AYRA 3LH8A
chains in the Genus database with same CATH superfamily
3ZDXB 4AYSA 1BF5A 1BM3H 4XR8C 4G6JL 1H5BC 1ZT1A 4XPAH 4NX0A 2BVOB 4HJGB 3D25A 1G9NL 5GS2D 1I3UA 1N59A 4I13B 2XU9A 2WKGA 1D9KC 4JRXA 3W1ZA 2OJEB 3KBEA 4FCAA 4B9IA 1GL4B 4Y8AA 3HNSL 3TA3C 5A2BA 3BZFA 1BX2B 2EUVA 1DVUA 3DVGA 3T6WA 2YEZB 2NX5E 3MGOA 2VZSA 2WCGA 3UAJC 4GQ9H 1U8MB 3DSFL 4E5XG 25C8H 1C5CH 5C97A 5IMOB 4NJAL 5DXWA 2B16A 1EZVX 1GAFL 3PF2A 4M1CD 4HX1A 4OV6F 4H0HB 2BFVL 2W9EL 5CJOH 4WWID 4ODSL 4LEXH 2X9WA 1J88A 2DIJA 4HALA 4FKEA 4X4MA 2G2PA 3CUPB 4AG4H 1DQKA 2QLVB 5I15H 1VF5C 4XVTH 1TZGH 1MHEB 2MTAA 1JWMB 2J21A 1JYXA 5BUAA 5E6SB 4Y4FB 2ZT9C 3NTCH 3X1BA 4P5TC 2F19L 1HS6A 1E9OB 2GJ6B 4CVUA 4AEFA 3TASA 3NJXA 4V11A 3RX7A 2ADFL 3BQUC 3WKYA 3CVHB 4YHML 5C3IA 3W37A 4U1KA 2ORBL 2WXIA 3S37L 3AXLB 2X4PA 3O4LB 1JN6B 3HS0A 1U91A 3OR7A 2WQXA 3ZZSA 1H6FA 2Y9RT 2OMUB 2FJHA 4ODTH 2PW2B 2XA8L 1D5MA 1RK0A 4FS0A 5GS1A 3ECWA 3W9EA 2FGWH 5IV2A 3K2IA 3DBXB 4U2YA 1ZANL 5IOKA 3JBG7 2NY6B 3BD4A 3EO1B 1YAIA 3HUJF 3NESA 1KDIA 4FN0A 1ZE3C 1OWWA 3BWUF 3GO1H 5AG9A 3RPIB 1CXHA 3BYTA 1QPKA 4KI5E 1KY6A 1PD0A 1GOFA 1UD8A 4RESB 3V9CA 1K4DA 4YXLH 3LEXA 2WWKO 5EU7C 5B7EA 1PNDA 5D6DC 3T77A 3GSQB 2HTLD 2X88A 2ALAA 3U0WH 3S35X 1CGUA 4XCNA 1B0RB 2AQRA 3U6XA 3FO2B 3I2CH 5DJYA 3NFNA 3O3EB 2JJWA 3P2BA 4XXCA 5J5EA 3GKWL 4PCKA 1YZZA 1WBXA 3HOGA 5AYUL 2BM3A 4OLUH 4J3OF 1BQLL 1QA9A 1QBLL 4NJAH 2PWDA 1UB5B 1IC4L 3AC0A 4MDJA 3PU7A 2FSEB 3KYNB 1GW0A 3KZ8A 5ELIA 5BQDA 2EIZA 3VFTB 3F12A 5HY9B 2V37A 4UWQB 1AZZC 5E8PA 1JF1B 3US9A 3Q8BA 1J9SA 1DP0A 1XSJA 1R9FA 1UT2A 1I8MB 4G6AD 3QORB 1MJUL 1XB3A 4YHLH 2ICWJ 5EFIA 3VFNB 3QDJE 1FDLH 1PZ5A 1IO4C 3LKRA 2AGJH 4HOWA 1XH3A 2V3DA 2CH8A 3UJTH 5I1HH 3UBHA 1TTFA 2APTA 1D7BA 3K5SA 1INDH 1DEEB 4OCXH 5BXFA 2OK0H 4TLKA 4HUXB 4Z0BH 4Z7OE 3V6OC 5DVLA 4KQ4H 4GUQA 3S8GB 4B9PA 1LO0H 2HT3C 2PO6A 4TOYL 1AXTH 1CFVH 2E8YA 4EBQL 1FFNA 5ITBH 1E65A 1J87A 3LKNB 3H2PA 1MW0A 3V4VB 2O5XH 4YWGL 2J57A 3QIUB 5HHPA 1OD7A 2BVEA 3KEDA 2PW1B 1CFQA 3WTVA 3TTYA 1DBAL 2D31B 4Y19A 2P5WE 3B9KD 5T3ZH 4NIYE 3QUYB 3HE7B 3GZKA 4NZTL 3DJSA 5DJAB 4M1GH 3ZE0B 3OJVC 4TYUA 3NQKA 2CDFB 3PGCB 1W72H 1KV3A 5T8IA 3D3VE 2OMTA 1FFPA 3W9DB 3OG6B 1LDPH 4Z77B 2VMJA 1FYTB 3CXDH 1OAYL 1D3CA 2NZIA 2X70A 4PUBH 3BFOA 1YN7A 1DJZA 3Q2CA 1TSRA 2LVCA 3V4VA 1XGUA 3CFMA 2DH2A 1D5IL 5CO1A 2IBZX 5FA4A 2HRGA 2XRAH 3C6LC 4AENB 4FTDA 3MFFB 4NNPH 4F91B 1SJVA 2JTYA 2PF6A 1UADC 1L9OA 5CP7B 2NY3D 5IKCA 4FXTA 3MRBB 5IWLC 3HI1B 4FTVD 3FT4B 2CBOA 5INCA 4K5OA 1MHHA 4PB0L 3RUGF 3CFCL 4PJAB 4XP9L 5I9QC 4AL8L 1FG2B 3L5HA 1PGRB 3WS6A 1F3RB 1BFOB 5E8OB 3O4LD 3VQLA 43CAA 1S78C 5I19L 2GABA 5EZIH 5GXBB 2Y5QA 3ZIYA 2J25A 4O00A 1HKLL 3BPNB 1T0OA 5JXAH 2OZNA 3O4OC 3IE9A 1YPZE 2K6YA 5HY9A 2XUWA 1N5YL 4PBVC 3HEIB 4IM8A 1ETZA 2G2NA 1F41A 4LVEA 5IIEB 4CNIB 3T4AB 5FV1L 3SDDC 4NQSB 1I4FA 2ZONA 2CDGA 5JXAL 5DJXB 2WPGA 4O4YL 3ZSTA 4O2EB 4QR7A 4LSRH 1XCWA 4TNEA 2CJUH 4D9LH 2DL2A 3WY4A 5IMLB 2J1ZA 1KDJA 1XO8A 3CBKB 1SLWA 4FQXD 3U7YL 1ZHKB 3UDWA 4IU3A 2DLIA 2P44B 2PXYB 1TU2A 3LXCA 4R2GD 4YHOH 5AW2B 5H4YA 1ZTXH 3V4UL 5GRWA 1U3HD 2ED6A 1Q9OA 4MAUH 3QCUH 4W9CC 5KYUA 3DHPA 3L4UA 3JYBA 2V5RA 3AY4C 2DMGA 1SXZA 4RSYA 2HFFB 3UXFA 3WEAA 1T2QL 1TJGL 4A6YB 4DKEL 4POUB 2NMSA 1YQVL 2MIZA 3S37H 4OZGB 1O7VA 2Q9OA 3D39B 2UYLB 4G9FA 1NKOA 1WIOA 4QRFA 3D7PA 4DTGH 2YN5A 5KYWA 3BFWA 5TGBB 4HS3A 5AZEH 1P5UB 4KROD 2E4FA 3N40F 4H2CA 9PCYA 4Z7UE 5JW4Q 5KG9A 1FNEB 3HE7A 3QEHA 1FE8L 4FULA 1MREL 3L4CA 4QYOA 3ARFC 4ZFQA 4QJ3B 3X11A 4BFKA 4LRNL 1C08B 1RPKA 1Z2KA 2R1YB 5IY5B 2A6IB 4M1GL 4ZZKA 2HMID 4WK2B 5DHVH 1NMBL 2YSSB 5LNEA 4FI8A 3IDXL 1Q9OB 1KJVB 5A2LH 1A9VA 4KVPA 5GHWH 4R2GC 1JPFA 3AGVA 3LZFH 4UTBA 2UY6A 3RU8L 5DHMC 2X10A 4FQXC 1NQBA 1B0GA 1D7DA 4NZDA 1MF2H 3JTSA 1AQ8A 1F2QA 4BRJA 1AXSB 1YECH 1KCBA 2Z7UA 1NGQL 4PRHA 5E2TH 2YD1A 3TIEB 3BQVA 3MLSH 3QULA 1ORSB 4MLIA 1FO0L 5FIEA 4ODUA 3QNXA 4OD3L 3ML8A 1LO0L 2AAVA 5JW4M 4ODHH 1EJOH 1H5BA 3NJMA 1RZKH 1LO2H 2A5UA 4NQEA 1XR8B 5KS9B 3RWFA 3TCLB 5J12C 1AQDA 5HD8C 4CBZA 1L7TL 3JV5A 3OHXB 3CLEH 5LBVA 3TLRA 4MA8H 5IGXL 1TJMA 4JVPA 4YZWA 4F8LA 1G0XA 3T0EB 1A6TB 1MPAL 3Q9QA 4LEOB 3MPCA 4XX5A 5DT1L 2P42B 4BSJA 1UD4A 5IB3B 5K1JA 2E7CA 1ND0A 4G6JH 5CZKA 2JMRA 4X9GA 1CYWA 3IDUA 2FX9H 3ZDYF 2XXFA 4KRMB 3B2UD 3KPSA 4HWEL 5DLLA 1J5OH 2HG5B 4DVBB 2ATPB 2XT1B 5EU6B 4FG0A 1PSKL 4LLQA 3VE0B 4MJHA 1G4RA 1LL1A 2F53B 3KPRD 2N0MA 3L7FA 1WJ3A 1QWNA 5DZPA 4LARH 1OTTC 4GNKB 3FYEB 1HZLA 2IPKA 1HJBC 5AVTB 1UA6L 3BQUD 4UIMA 5BVPL 4P46D 3P73B 4PJ5A 2J1YA 3CTTA 1MRFH 2V9RA 3B7SA 1XMEB 4BH7A 5CLZA 4NN7B 3QJFA 2HFGH 3V0EA 3MZGB 4JZJC 3B2MA 2UWEA 6PCYA 4PTUB 4KXDA 2EYTA 3QRGL 3S36H 3FN9A 4AT6A 3HNTL 4IEFA 5I0WA 2FIKA 3WXVL 1RIVL 3GSNH 3TH4T 2FK9A 4RQQB 5FW7A 5D70L 1NANH 3S35L 2ICWI 4YL9A 2SEBA 3AWEA 1W0WB 2LT9A 4BWWA 3TVMA 2Y0SA 1OT2A 1XAUA 5F0PB 4DO6A 2V2WA 4P2RD 4UIKL 4XAKD 1B90A 1MAMH 3BVDB 5JPNC 1CLZL 2A83B 1Q9WA 5HYSG 4A67A 1XCQB 3GSNA 3O6FC 3QCUL 1UB6A 1KGYE 2UZYA 4MZRA 4YQXL 4Z3TA 4ZG1A 1AGCA 4OKVA 3DLQR 3N41B 1DYZA 3KM2A 4BKTC 4OAWA 1L4IA 1ZTXL 4EDWH 5SWZB 3H3PH 5EUKA 4UOW1 5D2NE 2H45A 1U8HB 3F83A 5DC4B 3OC5A 3MV9A 1WEJL 1RJZB 1URIA 2BNQE 2KZKA 2PYFB 4UQ9A 2DKUA 3P9MB 1U6AL 1P84K 5F96L 1DQQA 2VXVH 4OCMC 1MFAH 3FTGA 3C5JA 1CLOH 5JHBA 2DJUA 1MIEH 2C7UB 4X2UA 3OSKA 4GRWH 5I75C 3DK2A 3SBQA 3RL2B 1T89C 2F61A 1LMIA 4PRAB 3FQXB 4F8QA 3GSNB 3IU3A 1LP9B 3LS4H 4UUJB 3MUGB 4AGQA 4X8JA 3VUAA 1O0VA 1BQHA 1UVQA 1U41A 5A2KH 1A7QL 4K5NA 1C5CL 4KV5E 4YNYB 4Z3HA 1W8NA 2EC8A 3S5LB 2Q86B 3S96B 4AZUA 3L3KA 4ONOA 4PPTA 1W0YT 2XHNA 3TBTA 1JV2B 5FYKE 4X98A 2ZX5A 4NOBA 5IFJA 2AEWA 4JFDB 2CO4A 4D3CL 1R3KA 1JVKA 5INCB 2LFEA 1FIGL 1Q0YL 2CXGA 3FT4A 1G6RA 5DA0B 2F74A 5GGUA 2QQLL 3DBXA 3H42L 3NACH 3VTTA 1AIZA 2Z1KA 3KLDA 4LHQB 2FH6A 2AXFA 1KJ2B 3JXAA 1MDAA 4MMXA 2DWSA 3TF7C 2FSDA 3O2WL 4HISA 3MSPA 1ZTXE 3DX1A 3ZL2A 4PRHD 4JCLA 4OLXL 4RGOH 3UMNA 4YX2L 1TUPA 5HDQL 1JZ3A 4L1HA 2D0FA 4TQEH 4MD4A 2MQ3A 3EDKA 4W6YB 4KO9A 4N8CL 2BSEA 2OZ4A 3PWUA 4I18B 3QPXH 4QDGA 4UT9A 4Z7AA 3RFZA 4XNQA 1QBML 3LHAA 2EADA 3K4AA 2CKBH 3NJNA 5F0LB 3SKMB 4JKWA 5JLZA 1GKEA 1KIRB 4P2OD 1M6OA 1AE6H 4GYBA 2FJSA 4HPYH 4XXWC 2EABA 1TVDA 1LK3H 2VN3A 3TWCL 4OFQA 2WTRB 2DQ6A 2XWDA 1X9LA 1WSST 3MOQA 2FJGB 3U82B 4QRRB 3AJ7A 1CGXA 4YDLC 2XZAL 4R2GB 2H26B 3BT0A 2ARWA 2R2EB 3U2JA 2DKMA 3CUPA 4JE4B 3VI4E 1FH5L 4WFFE 2HVJA 3G6JE 4PJDA 5D4QA 1GPOL 3X14A 4Y16C 4MMZB 3HIZA 4A7VA 3H7LA 1W0WA 2MNUA 2YRLA 3PQYB 2ZNWA 5LXVA 5HGDA 3V4VL 3FULA 4YAQA 4DKTA 4WWOA 3ALPA 1N6QL 1CGSH 3KHOA 3LRSB 4KRPD 5DJ8A 3U4KA 2BP0B 4ZQKB 1KTDB 1OTSD 1X9UA 1JF5A 3HPJA 5E00B 4QT5A 5HHQA 3DVFA 3L9EA 4JQIL 3RVWD 4CN1A 4E9SA 4TOYH 2R0ZL 1KCWA 7TAAA 4HCRH 3W57A 3UIYA 5ABAA 2NW3B 3EW3B 3OXSA 1ED3A 1UJ3C 1PDKA 2O6DA 3ZHKA 1XH3B 4LAQL 5IWLA 1DZBA 4UIMB 4YLBA 2IOIA 4U6HB 4GO8A 4UOJA 4XN4A 3UACA 4JG1L 4P2OC 3KVPA 1U93A 4HUCA 3P0YH 3FTGB 1SLXA 3VG0H 1YEFL 2EH8H 1AGFB 2VM3A 3O3AB 1XX9C 2CO3A 3GJFK 3GLDA 1EEUA 5JNYA 5J13C 1AC0A 1PW3A 4E68A 4OI8A 4X7SL 3VSUA 1IAII 3CPLB 2QVMA 3KHQA 5FF6B 1FWXA 3HFMH 2Y7QB 4QXTB 4UYPA 3WJLC 1URZA 3ARZA 3NH7H 4JPWL 2OKMA 2JLPA 3B9EA 1JPGB 1D9KD 2A9DA 3L95A 3VD4A 1F4AA 1XEUA 5CD5D 2VQ4A 1F18A 4KKBD 1QOKA 2AFNA 2TRYA 4I9WD 2ENJA 5C0JB 4AM0Q 1ICTA 4JO1H 1KEML 2I7OA 1QBLH 3UCRA 2DQDH 4D8PB 4ZUSA 1BF8A 3OG4B 5G5DA 3WSQH 1XGTB 3OJMB 2WLKA 4DGVL 2PR4H 2L04A 1HXYA 4P2QA 5FA3B 1F6AA 2QTVA 4K07A 3VFPA 4H1LA 2DM3A 1CD1B 4EVNA 1FL5A 4JM2C 4AENA 3OM3B 4JANB 3NCJL 4RGMC 1KWGA 2NY3B 2ZUUA 4WNJA 4L3ED 2HT4D 4FTVA 2CK0L 4WO4C 2JSFA 2UUDH 1WD8A 1RK1A 5IF0B 4K5PA 2Q87A 2CIKA 3DV6A 3VXQB 2VDOH 4NP4L 4ZUVA 1QSED 5ANMA 5IVXE 3UBXI 3B1UA 3QJZA 5B3JE 4LL1A 1JBJA 5CSZA 1FRGL 1LEGA 2ZJSH 4B9CA 1EA9C 1DVZA 1U91B 1P6AB 4MCZA 1XIWC 4ODTL 3LH9A 3SBWC 4Q14A 3ETBF 4H20L 1JNHA 3MNDA 2Q3XA 1YMME 4FHJA 1PG7X 2HP4A 3BD3A 4XBPB 3MYJA 4I4WB 4MRBA 1GJWA 1BG9A 2JKNA 3GXTA 1I82A 5IVXA 2FWOA 3B9KB 3O4LE 2H2SD 3E3QE 1P5UA 4K2UL 1I8LC 2ZX7A 1H3UA 2PWGA 1SXNA 4J7RA 2A99A 4FQ2L 2J1XA 1T0MA 4CU7A 4HU8A 4I0CC 3AG2B 3CCHB 1TVBB 1BVKA 2WQUA 1NWPA 2EE6A 2DWYA 3BKYL 2EP6A 3VI3A 4V1DD 5AVYB 3WYRA 1T0NA 3FUFA 3NJIA 5F71A 2NYKA 2D03L 3T1FA 4QRTB 3X1EA 4AQ8A 4Q6IC 2OXGA 3HCVA 1KGXA 4JFPB 4PRIA 4KROC 3FQTB 3MV7A 4JQXC 4OZFB 3M8OH 1QUNA 1S7UA 5AKVA 3IJSA 3VMNA 4ZNCD 1JI1A 5C6TH 2OULB 4WJ5B 2BDNH 5CD3A 3WXWH 1JD7A 3QUMH 1J11A 4KKLC 4K3EL 4O2EA 2NUTB 3OPUA 4WY7H 4BEIA 1G1YA 2LU4A 4QXUL 3CK0H 4PR5A 3QBTB 1TSHA 4QYAA 3GSXB 3KBHE 2V2XB 3L9YA 1PCSA 1T4WA 1PLCA 2GT9A 4GSXA 5D7EA 4HK0B 3ZU8A 4LU5H 2A9CA 1RUQH 2MMXA 1MIMH 3MRKA 3S5ZA 5MHSE 5AWNH 1TQBC 4DP8X 3ZKNC 3OB0K 4YL4A 5J3HD 3RY4A 1GA2A 1FVEB 4B97A 1ETJA 2CHNA 2R1YA 4BE5A 3D0VB 2XN9B 4OT1H 2OYMA 3T4YA 4DGIH 1PZ3A 4WI0A 1DVXA 4FKKA 2VDOL 1THCA 5D8JH 3WXVH 4K8RL 1DO5A 3LRSA 4NC2B 4QWWC 2A9NL 4D0CB 1D6VH 2V7HA 1MCWW 3NIFE 5HHXL 2XFXA 2WVSA 1AZUA 1YUHA 2VLLA 3LPGA 4YPGB 5TE7H 4AJ0A 2J43A 4TSAH 4ONFH 5CINH 1MRFL 4LK4A 5DEFB 2BVOA 4PJGE 4JFUA 2J55A 4ORGA 3V9FA 1ES0A 2YS4A 4Z7OB 3EYVA 3RHWK 3GB7B 4MVBC 1RUPL 5I71B 3JWNC 1DSFH 1Z3GL 5I26A 3VSVA 5KSBE 12E8H 3QJSB 3D09A 3TP4A 3BIAX 1PAZA 4ANVA 1J8RA 5BOPA 2IQ9H 2DEWX 2VSDA 3GSVB 1GZPB 3V0IA 1YEDA 3Q3GB 3GBEA 1NIBA 2QVFB 5E5RB 4R0LA 2CUMA 2CHZA 3IF1A 2NY3C 1OARH 4QGTA 2BIIA 1E3FA 1JTOA 1CF1A 3LQAL 3QZPA 3TO4C 3ZSSA 1PEZA 3D4YA 3SGKC 1K6QL 3WL9A 5SWSD 2H9GA 2BFGA 2VR5A 5I8EB 2R29L 2VH5L 1O75A 2HJFA 3K5RA 3QDGE 4AW4A 2OSXA 4XRCA 4LLAA 2Y1ZA 3G6JB 3GYRA 5KW9H 2A4ZA 1BGXH 2BK8A 1G9EA 3I74A 2IWEA 2X4QA 5CGMA 4MMYA 3QQDA 3EJUA 4MFHA 5AB1A 1QBBA 1EJOL 1TLKA 1NMCB 4HU2A 3PQYD 4RLDA 5FGBA 3HRZB 5CBAA 2OJ1A 1OSYA 4U3XA 3RWCB 3VFOA 3ZT6A 4JR9H 1BMZA 3BAXA 2ITEA 4R0LB 2ZYSA 4JFVA 5AOZA 3OKMA 1E8XA 3BKMH 4MJIE 2E7LC 1GGIH 4OCNC 3CVHL 4MYPA 4DOHE 4CC1A 3PS6A 4LOVA 1S4IA 1HOCB 4ZO9A 3VH8B 5JORA 1KLUB 1BAGA 1WT5A 2VXTL 3D4CA 3A67H 5CAYB 4N8VB 5EIIB 1BJ1J 1RIHH 2P7TB 3GSOB 4JHZA 4D9RE 1RZGA 2BIPA 4YHPB 5MENA 3TO4B 2EZ0C 4J3XA 1EZUA 3RP1A 4NWUL 4F7CA 4L9LB 4LGPB 4DP9X 5M7QA 1TZ8A 2GHWB 3TPKA 4M7KL 2HRPL 4YVUA 4GMSH 2CDFA 1L5GA 1WGOA 2DYPB 3AADB 3DDGA 4P2RE 5HHMD 1IKNA 2QADB 4N8CH 2B2XH 3CDZB 2F7PA 3LNDA 2FUQA 1TFHA 4LO9A 2A9MH 3ARXA 3FRPG 4YX2H 4L1DA 3DXAB 4PJHF 4KY2A 1WBXB 1FF5A 1UOWA 2DQGH 2N1KA 4M5TA 5BZXA 4KY1H 4ZO6A 1MCWM 2WY3B 3K6FA 5CXPA 3RX8A 1D6EA 3DX3A 1SQ2N 1TTAA 2VAJA 3MLVH 1IEAB 5CEZD 4BCYA 4DERA 1D7CA 1KCUH 4ZUWB 4FHKA 4I3SL 5CJQL 4L9LA 4D3CH 3J7HA 3VXSD 4PCSA 4MVBD 1EPFA 2N1TE 2NY0B 3GSWB 5EBMB 4CKQA 1WDAA 3KPQA 2K1MA 3MA9L 4GQZA 3MLUH 1ZPUA 5F9DC 3TU6A 4PY8I 4TTDD 3JWNH 1T4KA 4AEHH 1XIWA 5JTWA 4QXGL 4UB0H 2O61B 3VRJB 3A67L 4FL4B 5C0BB 1FPTL 1UVQB 4M9PA 3L7FB 5KZCB 1PLBA 4W9LC 4AXWA 4NLAA 1A1OA 1ORQA 3PPSA 5KVEL 4GW1A 4HUKB 2OQJA 1J8HB 4J8QA 4RSVA 2VT0A 1U6AH 4Y2DA 1PLAA 3HE6A 3MRJA 3QIUD 4P2RB 1MI5D 2ZCKH 1BCIA 2ZPKL 1ZT4A 1UM4L 2Q2EB 2VGLM 3ILEA 1ED3B 3H9SA 4KO5A 4MNGB 1OP5K 4P5MA 4EAEA 3RZCD 3BHBA 1KJ2A 1DBML 2A83A 2F58L 2R2BA 1M7IB 1MLCA 2E7MA 2KZ1B 2W38A 3FCGA 1QSEE 2Y3NA 3DYPA 3Q13A 5I75B 3B6SB 1LXMA 2NW2B 4Z95H 4P5KB 3GFUA 4Y5YB 5KW9L 1F3DJ 4LKXB 1TEYA 1CLZH 4OKVB 1HZHH 1W6LA 2FBJL 3NCWA 4GXUM 1UQSB 4K3EH 3ZMRA 5TDNB 4IOSD 4BJLA 4F2MB 1JK9A 3APDA 4OF7A 2CQVA 1U3HB 3GSVA 2IPTH 5F9JB 3VW3H 4UOQA 4NO0B 3GWJA 4DOHB 2J6EH 4LGSB 4L8DA 4MMZA 1IQDB 2VAAB 4Z3FA 4XZ4A 2PNDA 4GRLC 3GXFA 2GTQA 3F7QA 2MHAB 3F7VA 1ILUA 2ZP9A 4GT7A 5I0VA 5HGDB 1KPVA 2I69A 3B7YA 3MLZH 1U8IA 4QIRA 2VB5A 1PU0A 4JKKA 3L2NA 4HA1A 4G6AC 1WTGT 5ACZA 2J2ZA 3SPJA 2AK4B 2Q8BH 3UAAA 5AOMA 4NUJB 3MUY1 2L7UA 4JM2A 3EG9A 2A6IA 1U58A 5C0RH 2D2OA 4DW2H 1UZ6E 4JLRA 4PS7A 4WNQA 4NRXB 4FI6A 5ANHA 3S4SB 3TXAA 4WSJA 4AUJA 4BA0A 3OB0H 1FSKC 1HHJA 4J39A 5HHXH 1CFVL 3W81A 4BGLA 4FYQA 3KL3A 4X5XB 4KHXH 2XN9A 4IK6A 2A4EA 2VDRL 3IK2A 4RISL 5JUEH 4BELD 4U3HA 1BV8A 1IJ9A 2F54B 4HPOL 4PJGB 2V2WB 1I7ZA 4OT1L 3DRQB 4KITB 3T4AA 1HOEA 3N1PC 4WO4D 4K23L 1GYUA 5FEBA 2Y2TA 4X50A 5EC1A 1OE3A 3MHZA 5JW5A 1YEGL 3DMMA 1C5BH 3MRPB 5ENWA 4JFQA 1N0LA 4AZ8A 2UY7A 2Y25A 4ELME 3ESUF 3QHFL 4ZXBC 3JWOL 3OKOA 4N0CD 1JMZA 3SGJC 1EGJL 4H7VA 4AYFA 3PV7A 3PCYA 4EIUA 5IHBA 1B0IA 4U6YB 5E9DD 4KJPC 1KT2B 5CEYA 1IBZA 3LXAA 4RWYH 1TZHB 3L3DA 5DD3H 5AW7B 1IZJA 3WN5A 1WHOA 1F6AB 1JHTB 3SDCD 2DQUL 3NZHH 3OAZH 1BD2D 2IH3B 3FDWA 3KNBB 3HS8A 3A0OA 1NBZB 5AYUH 2WIMA 3GKWH 1E2VA 4IQHA 1Q9KB 5GHWL 1X4XA 2VXSH 2V0AA 3KYOB 3OHXC 1FAKT 1LP9A 4ODWA 3VNZA 4LLQB 3GI9H 5I0XA 1CD9B 4JBSA 3BP6A 1WIUA 3NFSH 2YXMA 4OCYL 5GRZA 4CAGA 4ZNEA 2FB4H 3RTQA 3V55A 2H9GB 3D2UD 5ISZB 3EYOB 1AD0B 3GMNA 4QRAA 4EI6A 4N2NA 3FFCD 3SE3C 3RWDB 2VKXA 2HX7A 4HV8B 1IAIM 4TKWA 5CLYA 3H55A 2QGBA 5D2LE 4I4WA 2W95A 4AL8C 3S48A 1XSOA 4JCMA 5HYSA 3EXJA 2ZNXA 5GIRB 4OQ1A 5F8QC 1SEBA 5IW6A 3HC2A 1NMAH 1KELL 1KJ3H 1XGYH 4PB9H 3VRIA 1EUTA 4DN4H 3GGWA 5FS5A 1UUSA 2DLEA 3VWKD 5BV7L 4PV1C 4OUOA 4OGQC 5DQDH 3BWZA 1H6TA 5MERB 3J27A 5IJVB 1ZHKA 4OF8A 4K94C 4UI2A 3MRCB 3GJFA 1AXSA 4ZUTB 2DV6A 3EAKA 4WW1A 5D1QE 4ABQA 2EYRB 1ZA3A 1MQKL 2XN0A 5DHVB 1U8JA 3HLAB 4QRPA 4YFEA 4Z76B 5BS0B 1UKQA 1P84J 4ZSOE 3VMPA 1FORL 4GSRA 1WCBB 2VDNL 4OTXL 1RPUA 2EVGA 1DLHA 3WJMA 4RVBA 4Q6KA 3ZR6A 4UQIM 4N2LA 1S9VA 3CFEB 5B1CA 4X80L 1SEBB 3WAKA 5IW6B 4F5CE 4ZUSB 4U3SA 4OLWH 4C4KO 3N0PB 4X5LA 4KTYA 2K8QA 5IHUH 4TNFA 5CKGA 4Q9CA 3ZTEA 3DO7B 3BSZH 3MAWA 5KYNA 5IQLA 2VDQL 1U8OA 4JRXB 4M7JH 2VDOB 2VXUL 1GAFH 1BXAA 3ZDYB 1S8DA 4L8BA 4XB3A 5HJGA 4N8VG 3CDZA 2YQBA 5C09E 2Z8SA 4QTIL 3H4FA 4JJ5B 3LOWA 4DP6X 4HWZB 3WBDA 3TV8A 4HYTB 4PY8J 1I7ZB 1LDSA 7PCYA 2D3LA 4PJXF 4E9TA 1QR1A 3HI6H 4OZGF 3I9GH 2D7QA 2P4AB 4JPIB 4YSPA 2APWA 3KGUA 3C6SB 3S88L 5EU6A 3C5ZD 5J9PA 2EXTA 4ZXBB 3BAEL 3BGAA 3HAEH 3CV5A 3BLKA 4I0PB 3RJDA 1BWWA 1X5GA 3VFUB 1AS7A 2BXYA 5B22A 2VMEA 1V27A 4BZ2L 1KTLB 2CWRA 2LU3A 4PLJC 4E9YA 1CU4L 2QSCH 2GSGA 1U8IB 3SDDA 3R7RA 4L05A 4LASL 3CH1A 1VEMA 1PZSA 1AIFA 4TVUA 3P0YL 3RDJA 5DUML 3ZTNH 2H8PB 2VDKH 5IR1B 4RFOH 1IC1A 2DQHH 4GKZB 5AAPA 2F74B 5GGUB 1MAKA 1T3FB 1XTLA 1BLNA 2IVFC 1VESA 2YOAA 1B4TA 2VZOA 4BWUA 2R1XA 1KGJA 1NFDF 3PAYA 4GAJL 3MBXH 2HN7B 1BXXA 1H8SA 4K5LA 4JPIA 4AI7A 3NGBC 4UAHA 5GRVK 1T7ZA 4ETQA 5DQ9B 3WUZA 1T20A 1HAUA 3GEWB 4BXSV 5E95B 5JMOC 4JY4A 1XGUB 4LPVA 5BV7C 3KYNA 3KGSA 3QPKA 2B0SL 1NGXA 2F5AL 3S5LG 4H8UA 4X6CF 4QXWA 5FHBL 2NYYC 5ICZA 1W72L 3O41A 4WW2A 4MWFB 4PI2A 1IFGA 5E6IC 1XL4A 2QSVA 2ZOKA 3EYSL 4N6RB 3S3PA 1KBVA 4YDNA 3B4NA 3M6DA 2EAEA 4OTXH 1G1CA 3LV3A 2P52A 3QFJA 1KTKE 2RH0A 4PH8A 1SNRA 4B5EA 4Z7VE 1JYNA 2D7OA 1MFDL 4HHWA 4K7PH 1WAEA 3WN6A 2FQGA 1HHKB 3GRBA 5FUCC 2BSRB 4OSUH 2I26N 3PXLA 2APSA 4FXKC 3C87A 1PG7W 2PUQT 2EXWC 3HB3D 4PIBA 3QCTH 3GPEA 2WM0A 3STLB 4FFZL 1W15A 4MYWB 1RK1B 3I02A 3ULAB 4J5VA 1D5RA 1E67A 3TT3L 3N50A 4RMWA 4YQXH 3BPLB 4RZKA 2EDEA 3S7GA 1F4HA 3TVMC 4BE6A 3L3OB 1FFRA 4FJYA 4WUUA 4Z0BL 4P04A 1RFDL 3I6GA 3CZEA 4LSVL 3LEVL 4CMMB 1ZGLP 1LGVA 1SEQL 4OLVL 2VIRB 3HZ3A 1W16A 2VJ8A 3MO1A 1OAQL 3SYQA 3TEXA 3GSNL 2XN1A 2SEBB 1LO4H 3T3PE 4KKZA 1CU4H 2CKBB 5KZCD 5IVXB 4S1RL 4MJIB 3MRLA 3N1MC 1HCVA 1ZD6A 1JV2A 3VFOB 2G5RA 2AABH 2OJZH 4ODUB 3DHMA 3ZBMA 4EF3A 2APBA 4P46C 4R7NA 4WCYL 2W88A 4M43L 5FUZL 2QMKA 1XGPA 2DWDA 1SY6H 2HKHH 4XMZA 5IT2H 5I5IA 3FUJA 1KCVL 2AQ1A 5C0AA 1LVEA 1MG2C 4MMXB 1VHPA 4F1ZA 5JHAA 5JPMC 1CQKA 3EADA 4CW1A 3UP1A 1ESOA 1D5BB 3VFWB 1KUMA 4EKXA 1JAEA 1SOQA 3WE6A 3AT0A 4P49A 5H94B 2X6BA 2R69A 1CDJA 3NPZB 4YHIB 3T0ED 4PJGA 1EGJH 1QSVA 4PRBA 1G7PB 2JV6A 1KZYA 4KKRA 4LOUD 3EBAA 3HMXH 4OZHB 1ZS8B 4Y2DC 4MXWL 4ELMA 1ZA3B 5G55A 2NUTA 1LILA 4WIQA 5KVDH 4W9KC 1W8EA 1DE4B 1XGTA 3HI1A 3QWQB 3S36X 2ZUTA 3V0WH 4R7NB 2HSIA 4GKLA 3V0FA 1CLYH 4RRPG 2UY7B 1FN4B 2P8PB 4PJAA 2DQIH 1MY5A 5F0JB 4L0YA 3CLEL 2A1WL 1DR9A 3PHAA 4Y9EA 1Y07A 4P9ML 3QQXA 3DX8A 2R0KL 2VCOA 4WU5B 2ZCHH 5CEZE 1CFNB 1RPQA 4FI7A 4M4RA 1NCWL 4XBGA 2OSLB 2DF3A 1KSRA 3ARFB 2RCSL 2HVKB 2JCCB 5FC9A 4FYSA 3W9DA 1TYEB 4KXZH 1T2XA 3MLPA 4XP5L 3CWGA 4YHMH 2VDRB 3QC6X 4NN5B 2QHRL 4W6WB 4JZOB 5AENA 1EDQA 2QADD 3LV3B 5EC2A 3MNWB 3CFIC 1S7WA 4MJ6A 3CFDB 2MNWA 1WFUA 1KBKA 3L5WA 4LP8A 2IDFA 3B3IA 5EF3A 4BFEA 1X6NA 1ITBB 3JWDH 4NKDB 4W9EC 2HFGL 5GZNA 5CBAB 1TG8A 3NFSL 2YAQA 4LLUB 4LEBA 4N2OA 1QI4A 4NC1E 2VR3A 2GAZA 1UFUA 5AOKA 1XCXA 4Y1AD 3TN0D 5J6HA 4F24A 1YQ2A 3ULVD 1MHEA 4F57L 2GITA 3A4DA 4ELMF 5T3XD 5MEQB 5JOFA 5I24A 2WXFA 2R1WB 2IADB 1SVBA 3APCA 3NCYS 3RWIB 1A4KB 1BFOA 4G8EB 43CAB 3Q8AA 2R69H 3LAFA 4ZW8A 1INQB 1Z5YD 4F9LA 5B39A 3GMQB 1V7MH 2PPEA 3O6KL 1JUFB 2WWKT 2PO6B 1HDMB 3OQ3B 5I30L 1JWSB 5FYLH 3WU1A 3L7EB 3VU1A 1KCSH 1EWHA 2C3HA 3QHZL 3ARED 3P3YA 3X1NA 1BBJA 2B4CH 3CXHJ 3FW6A 2Z31C 4PJFB 3QH3B 1Q8MA 15C8L 2X38A 3TPUB 2BP8A 3TBSB 2DN7A 1IGML 3FH7A 5IB1A 5BW7A 5EOCJ 5EOCL 5F7BA 4GG8B 5D7JB 1L7TH 5AVUB 4HIHB 3PL6C 3OB8A 1XZWA 3GUTA 3WIFA 4AYFB 5HHOE 2V4LA 2W0FB 1E43A 1RZKL 5JOPE 2FR4A 4KQ0A 3MV01 4LSTL 4DPRA 4XVUD 2CMRH 1KXTA 4AGOA 3TNMB 3K6DA 3SKOA 1JDDA 1U58B 2FATH 5F2FA 4CC4A 3AITA 4P4RB 1UKSA 5DR5H 2WXNA 1I1RA 1P4BL 4WUKH 4QWWD 1NUGA 4MJ4A 4JKMA 2D4DA 3WNNA 1U4FA 5LUMA 3QNYB 3RWJA 3NG5A 1ET5A 4X5PA 5J11B 4HUUA 5G4NA 3TO2A 3SDCA 1ZV2A 3VO0A 4XPFH 1UB6B 4MJ2A 4D94A 1XR8A 4MA1C 1AQHA 4XNUH 4ALAL 3KPQB 1U0QA 5JXEC 1X5XA 4BZ1H 1E2WA 3HG1A 3KBFA 4HPHA 5EUOA 3UZQA 1GGTA 1F97A 3A6BH 1PKQA 2R0LH 4LRNH 3K4DA 2JJTC 1LO4L 2X12A 2BMKB 3IPFA 2D8KA 1F4YL 3GBMH 3V8OA 4LSSH 3DMMD 1G0DA 4S0SD 1BA9A 1DQDL 1BEXA 1NCAL 4LCWA 4KY1L 1SFDA 5HHNB 2DTSA 5C0CB 3U0TA 4QCIA 1J9RA 3CSFA 1ZK5A 2X5PA 3Q0HA 4I8DA 4GFTB 3O8XD 1DCEA 4PUBL 1S7WB 4MJ6B 4RNRB 2BRQA 3WHXA 4JVUA 4NLHA 2WBJD 4N2GA 2VUYA 2BW5A 1ZLSH 2X3BA 3TA3A 4J2QA 4H88H 3INOA 4JG0L 4ODBD 5EBLB 4FQQA 4OZGE 5F9JA 4WFED 2CU9A 2ZF8A 2IALB 3P9LA 4ISVB 3ULUE 1VEOA 4ONGH 4U7MA 3CFJB 1GGCL 5DJXA 2A4CA 1OPGH 2Y36L 4MCMA 1HJCA 1QBAA 4B95C 4TV3A 4KROB 1RJYA 4APQB 4DO4A 3KNBA 4NCDA 1AQKL 3PHQB 2BIOA 4AQ8C 4X9IA 1O7DC 3IFNL 5L88L 1WCQA 4P05A 1A6TA 4KKCD 4ODWB 2EXWD 3HB3C 2WXRA 4NBYB 4S1DD 2Z65C 3ZGIA 3WFCH 3ARDD 2HTKC 2AV7B 3A4AA 3ZQ9A 1E28B 3QORC 2ZXEB 3SGDI 4I0PC 4HG4K 2J56A 4RWYL 2EYSB 2MPVA 3R8BB 4ONHA 1CT8B 2Z8WC 1ZKAA 3BKCH 3HUJE 4XP6H 2OQJB 4HCIA 3CH8A 5EZIL 5DZNA 4QRPE 1T03L 1MKFA 4WNSA 4Y9CA 3T2PA 4CKVX 1MRDL 2Q7NA 5KVGE 2VDKL 5DRZA 2B77A 5DUMH 2VH5H 3WG7B 5C0JA 4OFDA 1J5HA 4WHTA 5IM7B 3GMRA 4JEGB 3JV6B 1XBRA 4POZC 5JO5B 4K9EL 3FU0A 3A4EA 1HXYB 4YHNB 3BLBA 2FO1A 1FZMA 4N0YL 5GGVH 2XG5B 5GS1C 3O6KH 1Y18B 3VXUE 3D3VB 3GM8A 4KJQC 4X7CC 2E9WA 2OAAA 3UJIH 3N42B 5DZOA 2OMXA 3AGWA 2IQ9L 4JO2H 2WB1A 5DZAA 3LQZA 3VFSA 2V5YA 3VXTB 5GS0C 5A2AA 1DQIA 2AQNA 2JI2A 4NPKA 4MZIA 3IDNA 4IRJB 4J4PA 3ZDZF 2Y5TA 3L3GB 4PW3A 3D30A 2ZOKB 3ZE1E 1L7IL 2CG9X 1IFRA 2F1EA 1I3RA 3L9RA 4KK6D 3QFJE 3PNWB 3FOLA 1INEL 2E74C 4URTB 1AMXA 3ARQA 1LEIA 3MGTB 2IH3A 5HVHB 1EHXA 2XWXA 3PAVA 4YXKL 4NWTH 1RJCA 4NPJA 5AOIA 3PWPD 3HC3H 1NFDB 4IBQA 4FQJH 3ZZLA 4JM4L 2XA8H 1KBGL 3L4YA 3QQ4B 1QFPA 1EAPA 4MA7L 1A66A 1OCRB 3T9WA 4GKZA 2BCMA 3AACA 5GIRA 5DUBB 3WEXB 3FCTA 3V52L 2QELA 1RUQL 4IRZL 4EXPX 2MOGA 1GMEA 4HFUH 1F6FB 1T7VA 2X1WL 3CH1B 4MQXC 1EK3A 1U8LA 3FQTA 1J0YA 4OZFA 5CILH 5E1GA 4CJ0A 3ARTA 4R5TA 4G42A 4FRWA 1FUNA 1JXDA 2PR9A 1MZZA 2DQEH 4GAGL 3VA2C 5EORL 3P40A 5EEXA 4JY4B 1DQLH 3KDMB 1VFOA 2W80C 1PMYA 1ZT1B 4FCHA 2OTUB 1HYSD 2IDTA 3BHBB 3EJCA 4J27A 5A16A 3O8XA 4NQXA 4NRYB 3K1DA 1GZQB 3JQOB 1Y6NR 4LXFA 4C57C 4Q9RH 4LVNB 1A7PL 1FV1B 1AI1L 5SWQB 4ZDHB 4QHUA 3QQDB 2PPAA 4AC4A 4I2XE 2B1HL 1JHTA 4FG6C 5GGRB 4KNSA 4HCGA 4U0RB 1JVLA 5AKRA 3N41F 1AYRA 1WT5C 2WKOF 3QT2A 4YC2C 2IDUA 2WQSA 4O2FA 5DYFA 3E9UA 2X42A 1HI6B 1AGEB 3VWKB 5I1IL 4PRBB 2W91A 4OM1L 4ZUWA 4B41A 3F12B 4YZFF 2Y24A 4KNTA 5F3HA 2K0RA 3MRIB 3QULB 5CZVL 2AABL 3GINA 2GY7B 1WZ1L 2G5UA 2ZXGA 1YN7B 4MS8C 1CFMA 1S9YB 1C5BL 1TEGA 5DJCB 5FM5O 1MI5B 1TZIB 1GSKA 2BNUB 2XXGA 4G43A 4XMPH 1XDTT 3JWNG 1LP9F 1QSEB 1G7IA 2VWEE 5D7IA 1LWJA 1G84A 4KX8A 1YEEL 4LKCB 2CLRA 3LRHA 4KFMA 2DW5A 4G9DB 5AW0B 5CFHA 3CX2A 3RIKA 1UH4A 3M1OA 1JRHH 3GBNH 4PJ7F 4J3OC 1RQ5A 2J6WA 5CZVH 1GZPA 4PYHA 3CDYA 5DFVD 4F20A 3LZLA 1N8OE 5GS0H 4FFYL 1OK0A 2NY5L 4CSSA 3PY9A 1H3TA 4BBWA 1C8PA 3I6LD 3JTTB 4ZMZA 4LNRB 4PJCA 2XWTB 1OV8A 3ISRA 3N2JA 4X6FA 2QGEA 1QW8A 5C6TL 5B4MD 5ITFB 3O11A 5BRZB 1OKEA 3BLPX 3U1PA 2XPYA 4DCQB 2C3GA 3BH9A 2DQCL 5BOJA 5FB8B 4L8SA 5FLVA 1FI8C 4R7VA 5I1AB 1ZXQA 3FQ4A 3BD5A 5D1XE 5I82A 2JF1A 4YSTA 1G9NC 3SYPA 1IM9B 1HIMH 4IEFB 3Q8CA 4JDEB 3VDAA 5ICXA 1BQKA 5F1IB 1UXSB 4AKQA 1CR9L 3BDYH 1RXLA 1E4HA 3CPLA 3LEYL 3K2UL 2F7QA 2KBGA 4P99A 4U6TA 3ARGC 4GQ9L 5C86A 4DPAX 2YUVA 1R24A 1J18A 2E7LA 1XQ4A 3BUQA 4TSBH 4J3OD 1NC4B 1URLA 1UACL 3RGHA 3SE8H 3LPPA 2MWCA 4Y2OB 1DJGA 2E6JA 1G5AA 3BGFC 4IRZH 1H15B 1QRNB 2ZPKH 2AKRA 4LEEA 3DV4A 3QAQA 4MA7H 1U8NA 1FZJB 4BFJA 4HK3J 1Z0MA 1KIQA 3PGFL 4KK8C 4L4TE 2IAMD 2IAMB 3EBGA 4LLDB 2Q7YB 5BNXD 4W9IC 1PX4A 2V2TB 3H6JA 5F1IA 3OAZK 1CD8A 5F7UA 4DGYL 5JHLL 3HI6L 3CZSA 5I18H 5J1AB 4BFNA 3BT2L 2H41A 4FNLH 1WFOA 3G08B 5CU5A 4NN7C 4AEIL 4GRLA 4WFEE 2F9BT 3GQFA 5C0DB 2PTVA 3AY2A 4NO3A 4LP5A 3RHWF 1C5DB 3T1WA 2F7IA 1EFQA 5JPMB 1ZK9A 2P8MA 3TT1H 3DHJA 3FU3A 2ZXQA 2G0KA 4MZ2A 5JZ7C 2DLFL 2HJLB 2JB5H 5DMJB 3U6RA 5TQ0H 3QUXC 1BSIA 3AREA 3KAAA 1FVCA 4FNLL 2IADA 3BT2H 1SUHA 4UV7L 1FZKA 1A0QH 1M71B 1FJ1A 1O6VA 3OF6D 2M26A 4FXGB 2LAAA 3NH7L 1MQKH 4GSDL 1UA7A 4L9LC 4KXZI 4V33A 1YDPA 3TEUA 2H6UA 5K9KB 3KL5A 1ZLVH 4WI6A 4P3CH 3NAAL 5D7IE 1QWHA 3ZLQC 4B7IA 4F7KA 4MAYD 3QS3A 4WI0B 5FO7A 5ID0B 1NPUA 3NDZE 1U21A 3C5XA 1NGPL 1UUNA 2EEXA 4FXLA 1A6UL 4ZS6D 5HJ3B 1LEKB 4XBMA 2B2XL 5AVZB 3FB6A 1DJIA 5FCUH 1KYAA 1E30A 3FB5A 3PWVA 4WK0B 2B9BA 2EO9A 4ZQTA 4YHPA 3IKCA 4ZMYA 5GS0D 4LQFL 4Z78A 5AAWA 4UQ2B 4HCRL 2YZ1A 2J73A 2HKAA 1VDGA 4WY7L 1A1MA 5C6WH 4ODVH 5ESAB 4GH7B 1TOXA 2KS0A 3QJVB 3IE4A 4P2QB 2XKSA 2BOCA 5FA3A 4P2QD 1ILSA 1MHHB 3IU4L 5KSBB 3DIDA 1YN6A 2VRKA 5DVOA 4HIJA 1VERA 3MV8A 3DDFA 1BG1A 2A6DB 2Z91B 1MLCB 1PQZA 1MIEL 5D1XB 3EDFA 3CSGA 3MJ9A 5TK2A 4WFGD 5ADOL 2DQCH 3FQXA 4YLQT 1KPRB 4ABUA 4R7DA 4HQQH 1MXGA 2CDEA 1MFCH 5IB4B 5C08E 5BV7B 5DUBA 3WEXA 3DYOA 2XC8A 1J9CT 3KLHD 4TUUA 4M5YL 1FFQA 3IKCB 4JR9L 4GQPH 2Y72A 3AB0B 4ZOAA 4J6RL 1A14L 1QX1A 3QUHA 4FFYH 1H3GA 3VACA 4ESKA 2OV0A 1SLUA 4Y1SA 4D0CA 1UWEL 4PWGA 3VFGL 2FH8A 4POYA 4HX1B 3GSRB 2Z6FA 1X5YA 4ZTPH 1JRHL 3NJHA 2VDNB 1FO0A 4RMTA 5LNDA 1KBBA 1U8KB 4JFFA 2BSCA 3BCDA 3BRDA 2KT6A 3PLYA 2K6ZA 4BFIA 1HINL 4IU2B 4JDZB 3GJFH 1MY7A 2VDQB 1HT6A 4R96B 3D8MA 2H2PD 4NM8H 4Y5XB 4PJXE 1DJHA 2V7NB 1DEDA 4P57A 3S36L 1NFIB 4FG6D 1X44A 4GY4A 2VDKB 3ARBA 5C8JB 3RFZB 1NCBH 5T3XH 4WEBH 3QIBB 1QNZL 4NJ9L 1CI3M 3NCJH 3SDDD 4L5FE 3MO1B 1RZGB 3U36A 2X4SB 4H8WC 4DPCX 2M1KA 1DDHB 2ESVA 4HIHA 5CD3B 3T4AC 3UZEC 3A22A 2R2EA 5EU6D 2OMUA 3G9VA 1ZHNA 5D96B 1JF6A 1ZVHA 2LFGA 4NBXB 1NCTA 4WJKB 4GG6F 2QQQA 3MV8D 4CDHA 2WINB 1QLRA 1WZAA 2QLYA 2OMVB 5DVMA 4R7XA 3MJ9H 3QZNA 4I2XB 4V2BA 2BCKA 2LW3A 2UZIH 2Y06H 5IEHA 4QEGA 1RMFH 1HHGA 4KKNA 2OTWB 3IS0X 1SXCA 3QFGA 3GHBL 3KPNA 2EH8L 1VACB 3OLEA 2NNFA 3T4YB 2AQTA 5FKPB 4BSVA 2WZPA 4S0HA 3TC9A 1R46A 3GMRB 1A7NL 4Q6IB 1OGTB 1W72B 2GB2A 4U0RC 1UWEH 2QPSA 3VI4F 5LBSH 4A7TA 2B14A 1G6RB 2AVGA 4L3FA 2IAND 1FO0H 1NCUA 1VZHA 2J5WA 1T21B 1Z6JT 3C9NA 3BAIA 1K3IA 4FDWA 3TH3T 2C1PA 2WXMA 1ZS2A 1UWYA 5K39B 1CFTA 1KF9B 3KWVA 4KK5C 1GTFA 5MI0B 3D69B 3HHMA 1P0SE 1TCRA 1EFXA 3V4VH 3MLWH 3X12B 3H2WA 1HHIA 1DVSA 3IDXH 3PDDA 1F11B 3FT0A 4NNYB 2HVKA 4LIQH 3GUFA 4WWNA 2Y5TB 3ARPA 4XC1L 2GK2A 3EO0A 1QSZA 3ETBJ 4JFPA 3L16A 5E9AA 3WNPA 1UHVA 1UWXH 1ZMYA 3WEOA 5E08L 2NNXA 3H8NA 4Y9FA 2A38A 5FW8A 1PYWB 4EUPH 1VSCA 4PGEB 3BI9X 5D5MF 3N1QC 5JQIB 2BVYA 2RFXB 5IBTL 5AZ2H 4GS7B 4X5WA 5FYJD 3BUYB 3DOSB 5ALCH 4I48B 5E94B 2LHAA 4ZFOB 2BNQA 4IS6B 1IBYA 1KZQA 3PWNB 2CKBL 4PWFA 5KG9B 1RP8A 1MCOH 2R7EB 5C1MB 4MD5B 3P0VL 5D5MB 4G42B 1NOLA 1IGCL 2CPUA 4WTZA 3NCFB 4NO5B 1WS7A 1A9BA 5FFOA 4HEPA 5B3SB 2IAMA 5JHLA 2QFPA 1NC2A 1G7IB 3DOHA 5D7IB 1VKXB 1KBPA 2HPTA 4P9MH 3KPOA 3NFNB 5E9DA 2K45A 3OLIA 1FRGH 1MFNA 4J12A 4MNQA 4BRVA 4ADIA 1OAZL 1Q9KA 4XCYA 5M94B 2EVIA 3WE6B 4NRZA 2XIBA 1JTTA 1TTGA 2IWGA 3QB7C 4GT0A 2MSPA 2VR7A 1IBGH 4HIPA 4JJOA 5C0DA 4OCRL 3HG5A 3RWHB 4ODXA 1F13A 2NW3A 1L6ZA 4A38A 3MX0B 1DO6A 1ECYA 5CU9A 1HEZA 2C26A 2V6HA 4N5ED 3AS3A 2Q6WA 1U95B 3KLLA 3VD0A 1I1AD 3V4PA 2E9JA 1NINA 1GGUA 4LCWE 3HHSB 2Y22A 4FQLH 4MSWB 4BCXA 3L1FA 4XI5D 1P7KA 3BWSA 1DL7H 4GW4B 1WA1X 5TFSH 2PTTA 2JTDA 4ZFGL 2ZD0A 3KH4A 1FQ9C 4L1SA 2RB8A 1KIPB 3LS4L 3ZYIA 1AG6A 2ZKWA 1QKZL 4O02A 1KN4H 2EEDA 4J28A 4F1SA 3PV6A 1HSBB 5DC9B 3X14B 1MG3C 1DQQB 2X9ZA 5FYKD 2ICEA 3SKOB 1AGDA 3SPGA 3WMPA 1NMBH 2ENPA 4X6DF 1RZ8B 1DBJL 2OJZL 2EDKA 2O4EA 2FBOJ 3OR7B 3RG1C 5F1KC 1U3HC 1W2KT 3QUZA 1KB5H 1SBSL 1CE1L 3HS9A 1M2OA 3IN0A 4ZFFB 4XAWH 4UT7H 3QG6A 1S7QB 5GQBA 1OAQH 1GS7A 4NN6C 4YSOA 5L7XH 5I17B 2DJMA 1FVDB 4OZFH 1MUJA 3R1GH 4LCUA 1PX8A 4PJEA 3KPMB 4TPRH 5JIQA 2YD0A 5CILL 3SD5A 4JFWA 2MQCA 3TFBA 3RTQD 1F56A 3D0LB 1UATA 1SMOA 4QTHA 5TE4L 1D5IH 2BOCB 1NGPH 4TRPL 1NLBH 4KPHH 4NQEB 2A6JA 4FG4A 3D12B 3QSKB 3NAAH 4C56A 3QCTL 1DQDH 2GTZB 4UTCA 3UG4A 2MCMA 2I9TA 1XH1A 5DWPA 3DPDA 5CGTA 5C07A 5LCVA 3KVQA 2F0CA 1EHLH 1YEKH 2B15A 4K9EC 1FYTA 5ANME 3P3SA 3FYIB 4AMWA 4KZDL 4HFWA 1Z9OA 1ERNA 3OXRA 3RZCA 1TFPA 3K71A 2CUAA 4LSRL 7CGTA 1WAAA 2NT1A 3VWJB 4ZNEE 4WKXA 1GY1A 3U6XS 2NUPB 4KAQH 4KVNH 3A3YB 3NQIA 5DMIL 5CCKH 2F1AA 1DBAH 2DLFH 3NZ8A 3HE6D 2E27H 4NM4L 2Z35A 4D8PA 3KYMA 4Q6IA 1KIRA 3TCTA 1OQXA 2JK5B 5J1TC 2B0SH 2F5AH 4KQ3L 4XOAA 5DLML 2APFA 5DHYB 1M9SA 1AE6L 5JDSB 3VDCA 4BQ9A 1JFHA 2YMXL 5TGBA 4HJGA 1BIHA 5ETUB 1P1VA 3WFHB 3WIFB 5CN3A 3UJIL 3TJHC 2W60B 1X7SA 4PJBF 2JCCF 4MBRA 4DGYH 1BFSA 4LLWB 3W82A 4IDJH 5B38B 1G1OA 2VWEC 4RGOL 4N2BA 4DGIL 4P4KB 3TA4D 1HI6A 3IDIA 1CDYA 3VTAA 1YYLH 3MOAL 1V05A 4WI8A 3RY6A 3MZTA 3O3BA 5I1HL 2BZDA 2AGJL 5ICYB 3VU2A 3AMKA 2KDGA 3HC4L 3ZDZE 1BZ8A 3PJLA 5FGRA 3P77A 4MJ5A 4BFBD 4RDBA 2O6PA 4K5MA 1BYNA 2YC1B 2X3AA 1JGUH 4G1EA 4P9HH 3ZK0A 1RZ7L 2XJLA 3Q7JA 1ZV9A 2W0PA 1HK6A 2ESVB 3RVTD 2GJ6E 2OW7A 4G7VH 2XN9E 3I9GL 3W11C 4DAGL 2DLTA 4L3CB 4F7MA 4HMEA 4BQ8A 2RAMA 4ELMB 3MJ8A 4LVOC 2H7WA 4P2YA 4HBQA 1FLRH 1IT9H 3LEYH 4LDLB 5D7JC 4I9WE 1NUFA 4JX0A 4UDUA 4HKJB 2ZAHA 3FONA 3LX9A 3O6ML 3P4OA 2WYHA 4EDXB 5FPIA 2UXVA 2VQ1B 4N0FB 4R4NC 4XN9A 4K9JA 4IK7A 3GMOA 3O9WA 3K46A 1JDCA 5ITFA 4R5VA 5E9DB 1S9KC 2RHEA 4IOSA 1QO3A 5D1XC 2HLAA 4B0MM 1YUKB 2PO6C 1JNLH 4K3DH 4YXLL 2HTLC 4OGXH 5DYOB 1DJWA 3WCYA 4HS8L 1JN6A 1GYVA 2R0WL 1XD0A 3JVFC 3O4LA 5BJTB 3ZKMD 3M88A 1MREH 2IQAA 1QTSA 1RSYA 3MUUA 3W5MA 3MRMB 3B1TA 3H3PL 2O5XL 2OL3A 4GAGH 4AQAA 4S0TD 5I0YA 3BVUA 4QYOB 2ZWKA 2YK1L 3MNWA 4MQTB 1A6ZB 3X11B 3D9AL 3F6LA 3U46A 2AXJA 4Y2DD 5F88A 4ZX3A 1SMDA 3TJEL 3ABMB 3IFPA 5C3TA 2MCG1 1PZAA 1KJ3L 1XGYL 3PDGA 2WBKA 4FLHA 3G9AB 3DUUA 4PB9L 2KZWA 1SYSA 2PP7A 1ZA6A 2KHAA 3RIFK 2JB6A 5JR1H 5F7DB 4PWEA 1DLFL 1LWRA 3TCXA 3N5AA 2ZJSL 5FECA 3HC3L 4KI5D 3QDAA 4Y4FD 2NQ3A 5C70A 3KMDA 4WENB 3MBEA 3WJJA 1F4YH 4HIJB 1QABA 4NP4H 3PUCA 4U31A 3EZ8A 3FQYA 4Y9GA 4Z77A 2JIXD 3FPYA 3IT8D 2IANE 3OBAA 3QXUA 4LAJH 4P2QE 2C9RA 1U8MA 3QNXB 1SDDB 2YFOA 4U4BA 4YHYB 3MR9A 4UILH 1AR1D 1FGNH 5DS8A 5A2CA 1I9IH 1UH2A 2QBWA 1SOKA 1K8DB 1UT1A 2D7MA 4OZHE 1NCOA 4AYEC 4PTTA 2VN7A 4CUCA 4Z6AT 2IWFA 4RMSA 5KBPA 3ARDA 3GXNA 4OIFA 5I1IH 5T1JA 4NQCE 1MUJB 2HT4C 3AAZB 3DGGA 4L29A 1IVTA 3FQRB 1CC3A 2P5WA 3LH8A 5BZZA 1T2JA 1PG7L 5K9OB 3B5TA 5FYJE 1N8ZA 4E0RA 2Z9TA 4YXHH 3O6MH 3ULVL 2Y3AA 2AXGA 5I6NA 4M1CC 4LLMA 1M1XB 1RUKL 2E7BA 2MPAH 5KBDA 3MBWA 1P4IH 2X0UA 4HWEH 3V9EA 3KPOB 5BOZG 4OM0L 4G8IA 1I9IL 4WCYH 3LIUA 4TNWK 4RFEA 3FSAA 2HG5A 5CSGA 4DVBA 1ZWIB 3DI3B 4K9EH 4PJDF 2WNWA 1EHNA 2RQ8A 4Z3IA 2O30A 1Q94B 4YE4L 2XQYG 2WLLB 2ZKHL 4CADB 1QPXA 4N25A 4PU2A 4N1CA 1WG3A 5I16B 1PL3A 1H3XA 3QI9A 4KXCA 4CC0A 1GVIA 5JR1L 2R15A 1QI5A 4IKJA 4P59H 3X3FL 1Z7JA 1GYAA 3W2DL 4KHXL 5D5ME 4LCWD 3BKCL 4XP6L 2ADGA 4P46B 1JZ6A 3NCYP 1KPVB 1EO8L 2BY2A 4KMLB 3BMWA 3W3BA 4YHYC 1MCEA 2BSRA 4NQVA 3RPIA 3RWCA 3D9AH 1NFIA 5KEZA 4LSPH 5JHMA 3H9HA 4LPUA 2ADFH 1EFXB 4YXKH 4PGDB 1Z5LB 2ADIB 4JFTA 1MCPH 3OGOE 1IAOA 2EDDA 4GEJA 4FGMA 2YFNA 5AVRB 4KX9A 4KRPC 5HDBF 5C7XH 1FFTB 3AU0A 4QO1B 2E7HA 4U1HB 5AUMA 5I8CB 8FABA 1MJ8L 2P3YA 3OV6A 3JZ7A 1NGZB 5DRWB 2ATKA 2VUOA 4D9QE 3C2AL 5GJTH 4NSKB 1OPOA 4B3VA 4U1KB 3GRWL 4HXAH 2WIIA 3MNVA 2CLVA 1XEDA 2X2IA 3PHOB 3G5XB 4ICWA 3MV7D 4Y4HC 3AM8A 3W39B 4ERSH 3MJ8B 3QUYD 5HDRA 3FTWA 3UGXA 3BH9B 5F93C 3DSFH 4ZOEA 4JGNA 3LXUX 1S7RA 5C07E 3FOLB 3KL0A 2OTWA 5F9WB 3OZKA 4LCCC 1NMCC 2BHZA 3AXHA 1BQSA 5HYFA 3V6FA 3LKOA 5T1LD 5EO1B 4KKAC 1JGVH 2I27N 3T5WA 5KJRL 3U4AA 2R1XB 1INDL 3HPLA 3RNKB 5KVMC 3LN4A 3GKZA 1AHMA 5D93B 3U9UB 2ZKMX 3PQYE 32C2B 4RETB 3Q05A 4IRZA 5KTEL 3NFPA 3TYFA 4YH6A 1G9NH 4QRUB 1CLYL 1R47A 4AIZB 2XWJB 1JZHA 5K33A 5B1JC 4LCIL 5FUCE 4DO5A 3MOAH 5D2NB 2P1YA 1E9QB 1XT5A 4JN2A 4FQCH 4FTVE 4HT1L 3S0PA 3VCLB 4ZI8A 3MC0A 3O8XC 4YSUA 3CXFA 1JZEA 2WVVA 4PMFA 5EZLA 1FPTH 1KN4L 4E9QA 2YWZA 4ZJ9A 2D73A 4HS6A 4QJ4B 3BVXA 5IQOA 4P4KD 1RULL 1R3HB 3FO2A 5DJYB 2Y6SC 5I71C 4O02B 1EEYB 1MCJA 4JRWA 5L88H 2XBDA 2GJPA 3MA9H 3T8MA 5EZJB 1CGYA 5GZND 1S8DB 2E27L 2XZCH 3E2HC 4L8BB 3MMEB 4BFFA 1P4LA 2WLYA 4N90E 2HKHL 4S2SB 2CLZA 3C6LB 3LJ3A 1RUAH 2VDMB 3OLGA 3UPRB 3ZOAA 3P54A 4KAQL 3LXBA 5IFAH 1A7RL 1VPOL 2GUOA 1O7SA 4I3SH 1QD0A 3L3JB 1NCCL 3L13A 1KGCD 4FQQB 3SKUD 4ADJA 3DPBB 3REWB 4LCYA 1QRND 5CLWA 2BNRE 4DKFH 1CUOA 4G1EB 1N9PA 1RJLA 4JGUA 4N8UA 3ULUC 5L4IA 3IJSB 4OZGA 3QHZH 4XTRC 3PG2A 1YNTA 1VB9A 4P2OB 1XH0A 5G4OA 5B21A 2IO5A 4WVRA 4JFZL 5G5DB 2X6MA 4L2LA 4RGNE 4HLZG 4AVIA 3RIAF 1WPCA 5LN8A 2OZ4H 3P0VH 1MCOL 5CF3A 4CVXA 3W0WD 4EPSA 3BN3B 3QEQB 4PJ9D 5B1KA 1SJMA 2C7FA 4PJFF 3FT2A 1LDPL 4NAJA 5DGRA 2IWKA 1ACYL 3OX8A 3GBML 4G7YH 1ZLWH 1NZRA 1LM8V 2JCCE 3D69A 1TQUA 5BVJB 3GXIA 3TV3H 1I9RH 4N3UA 4YJZL 1JFQL 3O2DH 4Q97A 3LZRA 5E6YA 1I7TB 1VFAA 2KDYA 2EIBA 1GZHC 1NA8A 2BX5A 2JXMA 3IWUA 4FE9A 2F6AA 4F33B 4PJHE 4XP4L 5J6GA 2OMTB 1H8NA 3O81A 4NZRL 4WZ9A 3AG1B 4UQ2A 2LV4A 3P02A 4Y2OA 4TULL 4PP2B 5KANG 3OAUL 1S7XA 3EFDL 4NERA 4FQ1L 5FUOH 5JO5A 1K5NA 4HGWB 2MEJB 3F64A 1XAKA 3HVDA 4R9HA 1ROCA 4KGLA 3RWGB 2OP4H 4MZ3A 5EH1A 4J3OG 5E7BA 25C8L 5LQBH 1DL7L 3EDDA 3EGXA 2NZ9C 4IMKA 3EUDA 3QPQC 5BO0D 4Q2ZA 1HHGB 2F5BL 2CDEB 4QHNB 4U05A 4L23A 7FABL 1ADQH 3B9KC 4AIZA 3VGAB 2OSLA 3OZ9L 3QHFH 4KRNA 2ZOWA 1U8CA 2HTKD 2FX8L 1IGMH 1Z9SB 4ALAC 4MNQB 4RMVA 2XLLA 2P48B 1CICB 4YE4H 5HPMB 2YMTA 5IMKB 1KV7A 1I3RB 1E4XH 3L9RB 1OSPH 3VE0A 1K6QH 3WKNA 3MRQA 2WQ8A 1OAXH 1RZJH 3P4MA 3QIWB 3P11H 5CGYC 2JKRM 5DK0A 2N7BA 3PFQA 4TSCL 1RMFL 2H32B 3KXFD 2ZOLB 1MELA 2A3TA 5GSRA 5FGCB 2VDRH 3RILA 4YR6B 4FNTA 3ESPA 1EMTL 4GRWE 2IDCA 4MX7B 5DK2B 2F5BH 5DS1A 1OP5H 3MXWL 4Y9BA 5DI8A 5TE6H 4E0RB 2IFGA 1CGWA 3CFKA 3IDMB 2EH7L 3RJOA 5K9OA 3OJ2C 1GSMA 2OMZB 3D51A 4EI5A 3V8CA 2E4TA 5L9DL 2GITB 3MBWB 5L2KA 2WO4A 4OW6A 5DHEA 1QZ1A 2WLIB 4YHKH 4OLUL 1OCWL 1U8CB 2HG0A 2VDQH 2ZWNA 3QFJD 3HPLB 3NBNA 3U2SB 1IILE 3BPCA 1KTJA 1WISA 3MLRH 4N6RA 4TULH 3U9WA 4B9FA 2UXTA 2JK5A 2Q3AA 4Z7UA 1QNZH 4NJ9H 2QSQA 2VN5A 3BEVA 2FIRT 3ESOA 2WUCL 1A47A 4KNUA 3U36B 5H35A 2ED8A 4WTWA 5K5YA 5I5JA 2GFBA 2FAUA 4AK1A 3BQUB 2XVLA 5D7LB 1HSAB 3T3PF 3ZRCC 5L4FA 1MEXH 4HSQA 4BUHA 1UENA 2X9YA 1GIGH 4N1EA 2RR3A 2FGWL 2DWEB 3KPRB 1FIEA 5DURD 2IC2A 5HGGS 5CM1A 4NO2A 5FO8B 3ZL1A 1UXWA 4PW4A 2NY0D 3QPQD 3F5WB 3IMTA 1PFOA 1BECA 3IXTA 4HZLA 2NQCA 2H8PA 3ATEA 2P5EB 2W94A 3MODH 3MV7B 1QG3A 3WJJC 1Z5LA 1J1OH 3V0JA 4I3RL 5F70A 3KPNB 4M6ML 4IBYA 4K71C 4EUPA 1SUJA 3MCLH 4YO0B 1DVFA 5GRYA 2HN7A 3FS9A 4Y4HA 4Y5VA 3I6SA 4XB7A 4G8AC 2C5DC 2NCMA 1UJ3A 4P2RA 2ZUVA 1TZGL 3PABB 4NQDB 2H3NA 2R2HB 5DYOA 1H3VA 3WKPA 3VB9A 1RVFH 1B3JA 1NC4A 1TQCC 4P2OA 1B2YA 3MLTA 1Z3RA 2X6AA 5BQ7B 2BSED 3ATAA 3G6JA 1DFBL 3WFEL 3GI8H 3DJTA 4LESA 5KJ7E 4U6YA 3VXRA 3BKYH 2QQNL 5JQHC 4B9JA 2OYLA 3GSQA 2Y7NA 1JGDB 1MVFA 5JHDB 3LCYA 4P4KC 4AGNA 4JRLA 1J1XL 4LCWB 3S6CA 3LKQB 1BQUA 3I50L 2YKLH 1V3LA 5EO0B 1V54B 1PFCA 2XQYA 4PAZA 5FK9B 3SKJH 1T1YA 3HUJB 4Y7MA 3ZZ1A 5D1ZC 3N6YA 3UP6A 2FSEA 3KJ6H 1LK2B 3F3HA 3EYQD 1YEGH 4AYDC 1NEZG 2DTML 3ZUCA 1BIIA 1S3RA 1TNMA 3KGRA 1CVRA 2VMDA 4LNRA 4PJCB 5DUJA 2EZ0D 3PDOB 3PWJB 5JQ6L 4GG6E 1C7TA 3Q48A 2NTFA 3VD1A 4MASA 3D0LA 4GXFA 4QTHB 2WVVB 4Z7VF 4PP1C 3U30C 1X7TA 1Q1PA 3S88H 3C09C 1C1EL 1FG9C 2C9QA 1NJ9A 2GK0A 4GG8A 5HYSB 3BRFA 4GG6A 5I6KA 3F6IA 1VKXA 3UO8B 2JH2A 2BNRB 3CU1A 3MV9B 4IKLA 2X4RB 2FECL 4H26B 1DVTA 4Z7QF 3MV11 4PJBB 5IQ7H 4X9HA 3TT1L 4FQXB 2G3NA 4ELDA 4HOXA 1MFDH 2OSYA 3QFDB 3SY0A 2Z8RA 3SDXA 1U2HA 3MV9D 4HXBL 1GTNA 3G5VA 1CWVA 1S9WA 3KW7A 1NSNH 1OGAE 2IDSA 3HVNA 2MQ0A 4HUVA 1BD2A 3WJMB 5K9QI 2VXQA 4NN6B 1ZLUH 1UM6L 1JUFA 3Q1SL 3QJRB 1G6RL 5C08D 2WUBH 4NCC2 3V4LA 1BMWA 43C9B 1P5UC 4NN5C 1NC4D 1PKQB 1ORSA 1LD9A 1OB1A 1UEMA 4FOMA 5ALBL 3IVKB 2C9VA 4OLYL 1AY1H 1NAML 2WXGA 3FB8A 4XPTH 4WAFA 5ESVB 4K71B 1DBKH 5PCYA 4TRPH 1UFGA 4DEUA 3VH8G 1JTPA 1T04A 4HJEA 2H2SC 1F3DH 1YJDC 4G8GE 4JG1H 4NGHH 1THAA 4Y4HD 1IBDA 3EGSB 1AHWA 4X0KA 3EYFA 1DVFD 4HVBA 3AQXA 4Z7NE 3NA9L 1C7SA 4RFOL 5C9JB 3K0YA 1DUZA 1I85C 5KUMA 2KLTA 2CKNA 3T09A 2ZP0T 2Y2WA 3VFUA 1UCBL 2OXHA 4PRNB 5J6GB 2V3EA 5EB9A 4YPJA 3P30L 1QLFA 2BY0A 4PJ5D 3U4EB 2R51A 3N40P 4P46A 1XF1A 3L3GA 1OF2B 2K7QA 4ZMVA 1CGSL 1U8HA 5BMFL 1PCXA 4HJJH 4JZOA 5KVEH 4Y2DB 4DEPC 4ZFOL 5LAXB 4JO4H 4DK3A 2DI7A 4UV7H 5IB3A 2CBQA 3NJKA 3MRPA 4X6EB 3ZYZA 4AZ8B 3IRZA 3KCWA 5C0EA 2WXQA 2HT2C 4PD4K 5C0GA 1XVSA 3L1OL 5EEYA 3IDJA 3QJOA 1DSFL 1HILA 1EAJA 1RUPH 2H32H 2XWZA 4QOKE 3UMTA 3JVGA 4BFRA 1G7JB 5EWIH 5SX4H 3IJEB 4M02A 3F04A 2F7RA 3OZLA 1AR1C 4W9HC 3RWEB 3VWJA 5DF0A 4ELKB 1I1YA 4Y1AE 5CJBA 2LTQC 1JYVA 2AXFB 5BRZE 3G04B 4KKQA 3TBBA 4JCWA 3QPXL 4X99A 1A4KA 3UZQB 3REWA 3H2QA 2A9NH 3C08L 1X5KA 2WP3O 4LRIC 3VXUB 3GO1L 5KBLA 3TM6A 3QUXB 4OF5A 4Y16D 3RPBA 4G71B 5DHYA 1KIQB 2YPLA 4TL4A 4F9PC 5AYQA 3NJFA 1A7OL 3QIWC 4KKLD 4JREB 3TBCA 1GOHA 1F86A 2H0JA 3GHPA 2QKIA 4KBPA 4PGJA 3RDTA 1CO1A 4HH8A 3HZMB 3KM1A 2AJ3A 3ZY7A 4PVLA 4M7ZB 4GW5B 3KJ6L 3L3OC 4EI5B 3BWUC 2NYYD 1NMAL 2YPLE 5I76B 5DVKA 5A6MA 1N68A 1SDYA 4O58L 1U30A 3MNMA 2YK1H 3RKDC 1KN2L 1CTNA 1RJYB 4APQA 4QXUH 2OMWB 1UXSA 1SVZA 5IBTH 3UBXG 5FO9B 3EFFA 4H8WL 1OHZA 3I6GB 3SJVE 3BEWA 3TTSA 1OB0A 3ZX1A 1IJNA 3EXLA 2Q8BL 3OLDA 3QARA 3SGKA 4OGYL 2Q8AL 2DQTH 1WH0A 3ULUH 4JGMA 1LO5B 3QUYC 4HSAC 4LIQL 1ID2A 1HQRA 4MNGE 3BGFB 1JSYA 4NIKB 3RI5F 3FBKA 3MJ7B 5IR1A 4IIQA 1AI1H 5FGBC 4Q9RL 2GEEA 4C47A 1XF3B 1J48A 1V7NH 3EJSA 5FYJU 1NCNA 3Q06A 1GGYA 2AQQA 2EYSA 3L5XL 5CZXD 3ZDYE 1CDCA 4JHAL 4JFYB 1U3HA 3LKSB 4OD2A 2EDOA 4KDTA 3KJ4C 4RFEB 5DJ8B 5HYQA 1FVEA 2FHCA 2NDFA 4Z7WE 1ADQA 2UY6B 4PRNA 3N9GH 5E24E 2XI9A 4AKPA 1M6UA 4AOFA 5IB5B 4GP5B 1BAFL 2COVD 4MCZB 4DT2A 1WAAF 2K78A 3GTTA 1S9WB 4A39A 3BAWA 3WIHH 3TEYA 3MYJB 2X09A 1WC7B 1A3RH 5MHSD 3GSWA 2M83A 3UBXA 4HBCH 1T7WA 4HPOH 5IEKB 4A2MA 2P26A 2FHFA 3IDNB 2WYTA 4XVJL 1S3KL 4XMPL 3QCVL 1IGYA 4U1LA 1TKWA 2AMGA 4XNYL 4A55A 4UU9B 4ZOBA 3BH4A 5IEHB 1CL7H 1YCSA 1ZEAH 1WLHA 1RK7A 1F5WA 1YDPB 4Y5XC 1Z66A 3HAEA 4QRUA 3CMGA 3FQ1A 1IKNC 5DEZA 4BXVA 5GS2H 5E99L 5A3IC 1RLBA 1LQSR 1N70A 4WHYH 4XN1A 4RX4A 2BY3A 5F7MC 1RCYA 3FO1B 3VGHA 2G9HA 5T1MB 3S5YA 4J3BA 5DC2A 5TE7L 1SPDA 4XCFH 3E7JA 4UINL 1KENL 1KCUL 1CL7L 2A74A 1KXVA 2GUOB 3FRUA 3A6OA 1EMTH 3G5XA 4K8RH 1IB5A 4M61A 2C1PB 2EE0A 2AITA 2VDLB 4M7LL 3LPWA 3G5YA 3FUKA 2NXYB 3MROA 4G7QB 4OCLC 1ULVA 1M1XA 1H0DA 2DM2A 3N42F 3ZO0A 3ECQA 4YDJA 3LMJL 5JHDE 5LKNA 2R1WA 2A77H 4Y19B 2OX5B 1BAFH 1QO3B 4XPBH 1DBBL 5EOTB 4Z95L 4WV1C 5DS2A 1RAMA 4GRWB 1GY2A 2FYYB 4OV5A 4R97B 5IBLC 4LNVA 1U8QA 7FABH 3FHEA 2AJSH 4JRYE 4JUTA 5DRZB 3TBVA 3GTVA 4P8QA 5D7SH 4PV8A 4I3GA 4Y5VC 4IDLA 4JN2B 2NLJB 4XAWL 4Y19D 5TDPA 4GW1B 3VJ6A 2X44D 2RJMA 4IRSC 3OC8A 1IVLA 4FABL 4P5TB 2F53E 3MKKA 2AEIT 5LGYA 3FUMA 3IJYB 3L3HA 3OKDB 5TJWK 5CBEB 1RV6X 3AWGA 1VGEL 4HUVB 1H8LA 4DETA 5EIIA 4MXQC 1B88A 2DWXA 5JOPD 1OL0A 3BUDA 4KVCH 5BQ7A 4AYGA 4FP8H 3DNKA 4NZRH 1XR9A 1YEJH 1G7MB 3KXFB 2DIAA 1I1CA 2BRRL 4PRIB 4IKIA 3WNJA 4BKLA 5E4EC 4ZFGH 3H7BA 2NY6D 3AXLA 1MJJA 3B9DA 3MLUL 5B3NA 3JV0A 5C0FA 3ATBA 1GC1H 4FNQA 4AH2B 1L0PA 4H88L 5E6UB 3X1FA 1T5WB 4RAVB 4K2UH 2JQAA 3FCBA 4D9RD 3MRRA 3VXNA 3WUWA 3IAGC 4OJFL 3EFFB 1VZIA 4JFEB 1DQJA 3RL1A 4G9DA 4ZS7L 3RVVC 4OGZA 5IEKA 3PWVB 2H0EA 3N04A 1LEGB 1D9KB 1BQRA 3PDOA 1G7PA 2X1PA 4ZXBD 3VD3A 3IETB 1PZ2A 4YBLB 1MQ8A 5IF0A 2CDGB 3EF7A 2EDMA 2H0FA 4XN2A 4G2AA 1YO4A 3QQ4A 3TZVD 3DBSA 3CFTA 4OF0A 1JPSH 5IUCA 1NAMB 4FD0A 2R8SH 3SE6A 2BIHA 1GW6A 4IJ3B 4JRXD 5PAZA 3TOPA 4OZIA 4BZ1L 5IFAL 5IZ7A 2J88L 2H6PA 1C16A 1I7UA 3IAQA 4WU5A 5HHMB 5ESQA 5AZ2L 1W80A 2XZCL 4F7PA 2O72A 2H32A 3VRLF 2NR6C 5LBGA 5KWYC 3UTPE 1MCCA 3DYMA 3B8YA 4DEWA 1RIHL 1ZHBB 2KERA 1H6EA 1I8UA 4NT6A 3U2SA 1I8KA 3RDTC 4I1RA 2WP3T 4ZMPA 1AVAA 2CMRL 3LRGA 4O2FB 4L8SB 4AY0A 4OIIH 4A7GA 5IJKC 1D6VL 1RIUH 4P07A 2F53A 3TFKD 4HS6B 2HJKA 4MNGA 4IBSA 2LU5A 1RHHA 1EVTC 4J6IA 3MTXA 1QFWH 4XNMA 2Y7LA 4F7TA 3CFCH 4OZHF 3CSYB 5CJ5A 2WNXA 4C83B 15C8H 3RQ3A 3ZHNA 2QZ5A 4G6FB 1YEFH 1YYMH 2QTEA 3KPTA 5DD0L 3R7QA 3V5DA 4U0QB 3QXDA 4BHUA 5A2FA 3KLSA 3ILQC 2QT6A 1PVHA 4LLYA 5F3FA 5HGBA 5I30H 4TUJA 4GG6B 3O3EA 4KTEL 5E6ZA 1JHKL 3HJEA 4HAGA 1TTUA 3BIBX 1DBBH 4NO0A 1JGVL 2OI9B 2WJ7A 4M6OH 5LWYL 2EDHA 2FVNA 4UIKH 3DTUB 4G6KH 4P5RA 4ENEC 1KC5L 3GMQA 4TM9A 5IW3A 1QSEA 5F7LB 5EEUA 1CFQB 2RIKA 1R34A 1I3GL 1XMWA 2C3WA 1A1MB 4UV4H 4AYID 5D70H 3TIEA 2IGTA 3V6BR 3ZKND 4JZNB 2NY5C 1A4JB 5GJTL 2VLKB 3L6FB 4JY6B 4RMUA 2HJLA 3U6RB 1OGAB 1AOHA 5IG7B 1XBDA 1YMMB 2OL3H 4W68A 2NXZD 4WHYG 4A6YH 4GKSA 3VG9C 4IBLT 1E6OL 3BRGC 2W81C 5J7CC 5ECGA 4ZBJA 1HWWA 2J72A 3OMZA 3Q01A 4FQIL 5T1DL 5DVPA 4CSTA 2QQKH 2F7OA 3MBEC 3E8UH 3TX4A 4TUKL 3IWVA 1UGNA 2C1OA 2NR6D 2NY5H 1OP4A 3QDHA 5I73B 2E6QA 2WYIA 1D9KA 3HBQA 4XMKH 3HZVA 5I0DA 1Y1DA 3CLFH 2WZAA 2GSGB 3QO1A 4IRJA 1O6TA 2UXGA 5E2VL 4MCYA 4HG4J 2RCSH 1J5CA 3MYZA 3O9WD 1NEPA 1OLLA 1VFBB 3KLAB 1K4CA 1VGKB 3NIFB 2JJUA 3P1VA 3WNLA 4WGKA 4EN3C 5HDQH 3F2LA 2Y1YA 4LFHG 5E4AA 1VFMA 3VFPB 1H3PL 5TK4A 3WS3B 4LDOB 4PJXB 1W0VB 2X7LB 4BQ6A 2L0DA 2X1XR 4IHOA 3PP4L 5ACMA 5JQ6H 5I1DA 3ZL4H 5K59E 4WGWB 1IC0A 3CVBA 1CLVA 3MUHL 5DJ6A 5FR3A 4MB1A 1JMXA 2NNAA 2CLRB 2D9CA 2E0PA 2Q5BA 3ABZA 4JFFE 5SV4A 1G7MA 2GJ6D 3WN5B 5C08B 5IHWA 1B3IA 3T3PB 2QADC 1RZKC 3BWAB 4HH9B 1BIIB 2EDQA 4R26H 5LAPA 3LH2L 3MGOB 2VLRD 3APNA 3ROOA 2D0GA 2VDML 4U1JB 1FLTX 2JFCA 4X5RA 1NEUA 3ZTDC 1OIOA 4DGVH 1SJHA 4LL4A 1FZJA 4WI4A 2ODHA 5CP3H 2UV3A 4F93B 2EINB 4WWPA 4G82A 1YPZA 5JIDA 2O6EA 3PIQB 4UQCA 5CEXA 2J3SA 5EU5A 3U25A 2EUXA 1TLMA 2X89A 4N87A 4PY7B 5CNHA 1XGZA 4QLWA 2VC2H 3DX9B 3WHE1 1GZQA 4BV1A 4V2CB 1MH5A 3S8WA 5GSVA 4P48A 5EOQL 1A9BB 2FJGA 2J1WA 3RYMA 1Q72H 1NL0L 4G6MH 5EIVA 3VRIB 2EQDA 4DPBX 5AVSB 3FT2B 3KYKH 4KDTC 3S8FB 1B4JH 1OCCB 4YEEA 3V5KB 1JCKA 4IRSA 1J8HA 1WZKA 4DUVA 3SZ6A 3T3ME 4KX7A 4PJAF 3T71A 1GS8A 1VFAB 3BXNA 4M6MH 2DQEL 4HGMA 3LEVH 3MRGA 5DGQA 2FBRA 2QMJA 5BZWA 5CEZH 5CR1A 3DJ9A 4R97C 5CR8A 3HKFA 2EUWA 5C07D 3D39E 1DJYA 5KYYA 3C60A 3REVB 1DQML 1O6SA 4OFIA 3A21A 3K72A 4C56D 2R0ZH 1SQMA 1WFMA 4P5TA 2VSKB 5TH2B 2JIXB 2YPLD 4OD1H 3MA7A 3D85D 4HIXH 1P7KB 1U9KA 1RJLB 5DFWH 3EJYD 4CA4A 5I1JL 3CN1A 3BE1H 4S11A 3MQIA 1SBBA 2NXYC 1M56B 2HCZX 3NIDB 3TZVB 3M1BB 4N86A 5K39A 2X4RA 1KB9K 2YD2A 3DKHA 1A0QL 3ESMA 4JFDA 1PZCA 3MACH 4MA3A 3ZGHA 2CO2A 3AM8C 1E4WH 3VWJD 2PCFB 1YNLH 3FF7A 3S37X 4N0RA 4XPGL 4MTMA 3T6ZA 3US0A 2P43B 3RVXD 1AAJA 3QUZD 1P1ZA 5L6YL 5F7WC 2DQFA 3ZHLA 1IRAY 4XCEA 1A1NA 1OTUD 5BVPH 2GUYA 4BZ2A 1VADA 3BMVA 4GP8B 2EVFA 1S7QA 4YS4A 4L37A 4OGAD 2ROYA 2YN3A 1KOAA 1PZDA 1L9MA 2HX9A 3V0VB 1P2CB 2I85A 5E2WL 1KCVH 4JK0D 5CGBA 5I1DB 1QVOB 3CZUB 1YHPA 2M2DA 5TQ2L 4U3CA 5D7KE 3RGVA 5JLZB 1S46A 3N43B 1A7BA 3P9LB 4ISVA 3D0AA 2OYKA 2D3NA 3K74B 3QEGH 4XO3A 5HHOB 5HYQB 2WN3A 3II2A 2FR4B 1A4AA 4XBGB 1OHQA 2X1OA 5DMKB 3CDCA 1T3FA 1KGWA 4M8UA 5DUPL 4UNTA 3EGDA 3VYNA 3N1GC 4YSQA 2GSIA 4PW9A 4X0KB 1CCZA 3RGBA 4GXVL 3TESA 3RL2A 2GCYB 3VFRA 1MFBL 4FFVD 1H9VA 4PG2C 3K6SA 1IAIH 1OZUA 4N2MA 3CFBB 4PI0A 1B9KA 3F84A 3BIKB 1YAZA 3LNEA 1TEFA 1E3ZA 4NZ8A 5I1GH 1HEZB 1TNNA 2LU7A 3UAEA 3UJJL 2GKIA 4JQIH 5B1BB 3TBTB 2A6KA 1TT6A 2PTUA 2N0KA 3BEWB 4ZW6A 5ALBH 4Q4EA 4JG9A