3GC3A

Crystal structure of arrestin2s and clathrin
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
380
structure length
329
Chain Sequence
GTRVFKKASPNGKLTVYLGKRDFVDHIDLVEPVDGVVLVRRVYVTLTCAFRYGGLTFRKDLFVANVQSFPPKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLAKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGDVAVELPFTLMHPKPKDTNLIELDIVFEDFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis
molecule keywords Beta-arrestin-1
publication title Structure of an arrestin2-clathrin complex reveals a novel clathrin binding domain that modulates receptor trafficking.
pubmed doi rcsb
source organism Bos taurus
total genus 62
structure length 329
sequence length 380
ec nomenclature
pdb deposition date 2009-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00339 Arrestin_N Arrestin (or S-antigen), N-terminal domain
A PF02752 Arrestin_C Arrestin (or S-antigen), C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.640 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3gc3A02
2.60.40.840 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3gc3A01
4GEJA 4R7XA 4GEIA 2FAUA 3GD1C 4P2AA 5F0PB 2R51A 1G4MA 1G4RA 5F0JB 5F0LB 4R7VA 3LHAA 1CF1A 1JSYA 4GFXA 4JQIA 2WTRB 1ZSHA 3UGXA 3LH8A 4LL4A 1SUJA 3LH9A 4J2QA 4ZRGA 5F0MB 1AYRA 4LL1A 3P2DA 2WTRA 3GC3A 3UGUA
chains in the Genus database with same CATH superfamily
3D05A 2A9NL 5DJ2A 3MROA 5EO0A 5EO1A 1IGYB 1LO4H 5AB2A 1KYUA 2XG5A 1G9NH 3HMWL 5F7NC 2AK4D 1WA1X 1SLUA 4B9YA 1U8IB 1XCQB 5EU3B 4OQ1A 4P4KD 5FW8A 5MENA 1PW3A 3MRJA 4OFQA 4PHXA 1S9KC 4K23H 4G6KH 4LIQH 4LKCA 5T5FL 3NYKA 2W9LA 1DJHA 4OGAC 2C8NA 3MBWB 2Q87A 5C6PB 1BG1A 3TEWA 4DCQB 1KYOJ 1FC1A 1D5MB 4N1EA 1LWHA 3AXIA 4ALAL 4F15B 3HE6C 1G7QB 3AB0B 1MWAA 1MFEL 4LEEA 2WKOF 5C3LD 4OD3L 2CGZA 1KTDA 3S4SA 1BD2B 5EBLA 4DH2A 3PQYD 4HBCL 4PSPA 1J88A 2DYPD 5A6IA 1YEKH 4WSKA 4ACPA 1PX8A 1UJ3A 1GGIL 2HFFA 3IXTB 4YHNA 3WIIL 1FNSH 1HOCB 4XT1C 1T1YB 43C9A 5ID0A 4IRJA 2VUOA 3VAEA 1MFUA 3EO9L 3TNMB 5KVMC 1AIFB 2R2BB 4FQJL 2TRHA 4H0HB 1AXSA 1RPKA 2Z4TA 3E6FA 5GHWH 5JW4N 3AUVA 3P73B 3FT3B 4QRAA 1GJWA 4GKLA 5DZNA 4XNZB 5TE4L 5KYYA 1WC7B 4KK8C 4Q58C 4A2LA 3L4CA 3ZUNC 4DN3L 4F8PA 4XXCA 4U3XA 4L18A 4ODUA 1DVXA 4XCYB 1C12B 5EC1A 2EABA 1IBZA 2F58H 4JFOB 2BZDA 1CBJA 1KGCD 1P6AB 3HAEH 4KO9A 4PVNA 5I71B 3O0RH 3PNWA 1JNHB 2GY5A 3IDYB 2LU3A 3I3EA 5JHLH 1VEOA 2A0LC 4CC4C 1BJ1J 1EGJA 2J56A 2R2EB 2XXCB 1XR9B 4BE6A 4HDIB 1JZ4A 1CS6A 4UDUA 1P5VB 5J6SA 1G7HA 2D3JA 4IDLA 3CAFA 4DKFH 4NT6B 4UT6A 5JO5A 4NENA 5CGMA 2EXWC 3UTSE 3CLEL 2C9PA 4I77L 4F3FA 2L7QA 2MCPL 4AQ1A 1OB1B 1DSFH 1JUFB 2I69A 3S35L 3CUPA 4K7PX 2CBOA 2XRAH 1X6NA 3PL6D 1X9LA 4MNGE 1ETA1 1N6UA 4ZOAA 4YIQB 3VFMB 4LB8A 1YJDH 2WP3T 2R7EB 3DLQR 5B1KA 1CLVA 2CO6A 4OCSH 1E7UA 3QEHA 1BX2B 2GTZB 5D7KE 1S7TB 2I07B 4PP2A 4N9OB 3QJHB 5EG6C 3ZDYF 3LIZH 3L9EA 3RFZB 2XSKA 4RQQB 5I30H 3NSCA 4TNWK 4F15C 1EHLH 2CG9X 3F7VB 1CD0A 2F54B 2F5AH 5HPOA 1KCVL 4Z7UA 3GXDA 4LLYA 1TPXC 4OLZL 5KSBE 3SGDI 2HLAB 2QVTA 2XZCL 3HRZB 1JF5A 2EICA 4P59H 5EB9A 3OJDA 3TPUA 2AKRA 3RVWD 3V79C 4XC3H 1GS7A 4HX1B 1FYTA 4I4WA 4EIUA 4B96A 4AMWA 1P1VA 3NCJH 1MF2L 4NPYB 4QGTA 2IJ0C 4PGCA 5HYSG 1NCUA 1NDGA 5E23A 1NCDH 2RA1A 4DGVH 5B1BB 3SE4A 5D70L 2QDVA 2IBZY 1QFHA 3FS9A 2X9ZA 1HQ4A 4KUCF 4WY7H 2FIRT 4XNZC 5D5MB 4X6DF 5IB1B 2VN3A 4UU9A 4EKJA 5ALBH 3UPAA 4QT5B 1EZUA 5AW1B 1HYSC 2KLTA 5FFGA 4O9HH 4BFOA 1QKZL 5ITFB 4JFDB 4CVZB 3UL4A 1B0GB 2VLJD 5FA4B 2UWEF 1CXKA 1FG2A 2ZSVB 3QDMA 4U6YB 1IUZA 3HJEA 1EDHA 4ADJA 5I71C 4E9WA 1NBYA 1KGUA 2N1TE 2B1OA 3IDYC 2GSIA 1KT2A 4L4VA 1NLDL 4PBXA 2X87A 2EH7H 3WOVA 3MRRB 4B53A 2DLTA 3ARFD 3DOSA 1XFPA 3X12A 4F1SA 3DYMA 1BM7A 4KRMB 3LS4H 2WLKA 5DJ0B 2PNDA 1LHZA 2F7IA 2VAJA 4FHKA 4HK0A 4JHWL 4P5MB 3GSVB 5AVTB 5SV3A 1UZGA 4WSJA 1ZLSL 4Y1SA 3MV9D 1A7NH 1CGYA 1A2YB 2YPLD 4PJ8B 3MRFA 3TFBA 1QLEB 5IF0B 4G8EA 4TSAH 5C86A 4ONFH 4PRBA 2AQPA 1QWNA 4NKMB 2NUTB 5EO9A 3UTTA 5B38A 3L3OB 4OZGA 4FE9A 2WXHA 4IEFA 4Z7WA 2P28B 1EFXA 4OSUH 3RFZC 1IBGL 3C6SA 1TITA 1U8PA 1D2PA 1ZIAA 2PF6A 2OSXA 4XNBA 1BMGA 2BIPA 1B9ZA 3GD1C 1G7MA 1ACYH 2OJZL 3EYOA 1GVIA 4FMKA 4WQOA 1BECA 3Q6FA 4QXGH 3BWAB 4NNPL 2CUHA 3AQZA 4UAOB 4R8WL 3VM5A 4Q9QH 1CICA 4GG6B 1Z6JT 1HDMA 4WFFE 1ECYA 3D08A 3QIBD 4BKLA 3Q13A 2CKBB 1I7TB 4K7PH 1YPZF 4NQXB 3KJ6L 1K8IA 3OC5A 3OKMB 4N2KA 1JZ2A 5AWNH 4MD4B 4PJDB 3ZYIA 4YHKL 2I9TB 2WCPA 2Y7NA 2NZ9D 1NFKA 4PRIE 5IW3A 3WHE0 1MCDA 3US0A 4S2SB 1LDPH 4XN8A 3S6CA 2JKSA 1KXQE 4M7LH 3MGAA 5LBVA 5EV7A 2H47C 1W2KT 1KJ2H 2IADB 2LAGB 4ZAKD 3LJ3A 3PFQA 3W11C 5KZCD 1R75A 3OB0K 3FCGA 1YEDA 1PKQA 3FRPG 4BSVA 1GKOA 2H41A 1XF2B 2NXZB 3GLEA 2DQTH 1H19A 1H3WM 1M6OA 3SOBL 3FU0A 2ENPA 5I6NA 4XPGH 5JLZB 4DGIH 5C09E 4M7LT 5ABAA 1OM3H 4AM0B 1OGAD 1UZ8B 1DZBA 2BHFA 2M83A 2ZXBA 2ZP0T 1NGYB 4MA1B 4NGHH 4JFFA 3V6ZB 2MPVA 4PJ8C 3SGDH 2Z92A 2ZOUA 3K5SA 2VDOH 4XHQA 2JXMA 2RQEA 2EDXA 2AGJH 3M1BA 2R1WA 2JMRA 4HPOL 5BS0A 3L3OC 5JPMC 5TQ2L 1TZHA 4DHLA 4OLWH 4PJIF 3WTVA 3U2IA 1NFIB 3OGCA 3JWOH 4B9CA 4FMFA 3KGSA 4FCHA 3MC0A 4IOSD 4QTIH 3X3FH 4KAQL 4CJ0A 2WVVB 1U8KB 1FNAA 4PRIB 1I8LA 2WKOA 4BH8A 1QBLL 2A73A 1E6OH 3ORJA 5CM1A 3CLFL 1EXUA 1FVCA 2AV1B 3EYVB 2GUOB 4UAOC 3P54A 4AKOA 2P5ED 4R0LA 2F8IA 1B0IA 5CHNB 2DQUH 3S3BB 3QRGL 4Y1AE 2WLIA 4FFTA 1BF2A 1ET5A 1SFDA 1AP2A 4NUMA 4X5RA 1EHAA 2ALAA 3H9SD 1MY5A 2APFA 5BQDA 4HJJL 3MRIB 4GKSB 4P2AA 5C0IA 4JJOA 4F7CA 1TTUA 3CVIL 1LNUB 1F1DA 3BUYA 2YAHA 3GBEA 4L0PB 5KVFH 2J8UF 4XMZA 4JREB 4E41B 1OCZB 4YDVA 1KDIA 5DC0A 1VKXA 2CRYA 4PH8A 4K9JA 4X7FC 3SKJL 2KDGA 4DOHB 2OLDA 4ANKA 4UM9A 3KGUA 3AWEA 5TGBB 3THML 4LL1A 2NXZC 4NPKA 4M5TA 1AG6A 3QUXA 3O8XB 5FCUL 4ES9A 3VSUA 5HGHA 2QVMA 2FSEA 3ARBA 5E7FA 2IMNA 1FDLH 2BC4A 2PO6A 3DSNA 2IIJA 5A43C 1CZ8L 3KXFA 5I1DB 2A6IB 4G7VH 2Z3FA 5DK3A 3VD4A 3MI6A 1UFGA 4C83A 1XO8A 1KEML 4MA1C 2WTRB 4JM2B 3ZKXB 3B3BA 1I7UB 1JN6A 4L1LA 3VXME 3MTRA 3VSTA 1R5VB 1LP9E 5IB5B 2AJ3B 2Z31D 4KKPA 1TCMA 4XPBL 3MA7A 2VQTA 4NDMA 4CKQA 4L23A 2HKHL 4GMTH 4DN4L 4ELMB 3RVTD 3B2VL 4HJEA 3CH1A 4L8BA 2ZJSH 4R9HA 2GJRA 4Z3JA 2Y7QB 2EECA 1MW2A 4YXHH 3PP4L 3PWVA 3X1BA 2JK5A 4GUPA 3K6DA 1QNZH 4W81A 3ZKND 1LO5B 3IDMA 3NZHH 2RGSA 3X1GA 3O2DL 1EEYB 2XIDA 4N2MA 4Z7VB 3WNIA 4EXPX 1P53A 1TZ8A 4OUUB 3VX1A 3NSXA 3KWUA 5HYJB 3U2JA 4MXWL 1NPUA 2FHFA 1HC1A 4WU5A 3N41B 5FYJD 3VI3E 2VJ0A 3JWDC 4RRPG 2YLHA 4X6DA 3W9DB 2OMVA 2RMNA 1Z9OA 3V6OA 5E6ID 2HT4D 1AY1L 1T04A 4ZO6A 4JREC 1SHWA 4XRCA 1AGCA 4YHYB 4FEIA 1DVYA 1AH1A 4FLSA 2YC1B 1ZA3B 4WU7A 3VXMB 2V9RA 2UWEA 3N55A 4DPRA 3CZFB 1KBPA 2QSQA 1ZK9A 3DO4A 3VFSA 5A1AA 4LPXA 3O8XC 2ZCHH 4MMXA 4W70A 3TASA 1V7ML 1E6JH 3TT3H 2AXGA 4N0CC 4HALA 3V0JA 2WNWA 3PAVA 1A14L 2FNBA 4PG9B 1HHGB 2AVFA 4XX5A 3NQIA 4PGDA 1A5FL 5HHOA 4MQSB 1QR4A 4LSQL 1KENL 4DEPB 1MCWW 4YDLB 4I13B 5DFAA 2JE8A 3BGMA 4L8DA 3WO3B 3B1TA 3ZKXC 4JM2C 4U2ZA 2ZX7A 2IAND 2NT0A 1I3GL 3M6DA 1Q1PA 2V5RA 4JRLA 2QT6A 4TF4A 1T4KA 3O4LA 3D2UA 3QDJB 1AXIB 3F7RA 2DEWX 3H2WA 4P48A 5HGDB 5K9QG 2PPFA 4LHUD 4P2QE 5EZLA 2HAZA 3HAEB 2QBWA 3SD2A 2YZ1A 3FK3A 3FFCB 4P04A 1CPUA 2R4SL 4KMTH 3N1QC 1PD6A 4X0KB 2X0UA 1MVYA 5K93A 5IFJB 4WHTA 1G9HA 1BQSA 5H4YA 2YD9A 4CADB 2BY3A 3VI3B 1AZBA 3G08B 1O9WA 1UACH 5DMKB 5CJOH 4Q0XH 1ADQH 2E3VA 3KPSA 3MR9A 1H0DB 5SWQB 3TA3B 2XZAH 1G9NC 2ENQA 5DFTA 3U6XS 4M6NH 4WWKA 5KSVA 4EI6A 5HPMB 3FT9A 1BQHA 1KF9B 2UXVA 2CKBL 2ITFA 4N3UA 3AGVA 1YPZA 1ANUA 4M1GL 4ZQTA 1JGIA 2VTFA 1S9XB 1JZIA 4ONHB 1NGZB 2ZIDA 1QI3A 4X6EA 2ZXGA 1GY2A 1NJ9B 3DXAB 2AEQL 5BOZG 2WQVA 3LRMA 4R7DB 5EEXA 2HRLA 3MX0A 4Y4HD 5LCVL 1L9PA 5HI3C 1KIUB 4PD4J 4YHYC 1RULL 2W60A 4X80L 3WN5A 2IQAA 1ZT1B 4WGVB 5DJXA 3RX7A 5JIQA 3G6JB 2DRUA 1UM6L 3SD5A 3MLWL 5IHHA 1YY8A 5D7EA 5GRVL 3NAAH 2VZ1A 4TSCL 2WN2A 3HUJB 3PPSA 1UGKA 3C5ZB 3RL2A 4WFHE 3PYCA 4RA3A 1VENA 3VFWA 2V0AA 4D3CH 1JGLL 4KJQD 5DWUL 4W6XB 1VFBA 1HH9B 4YC2B 3U1QA 3EJZC 1UEYA 5DD5H 4ZZFA 3U25A 1GR7A 4DEPC 3ARVA 4YDLC 5ICUA 3IS0X 4LCWE 4JLRB 1HHIB 3WHXA 4F7EB 4LSRH 1F8TL 3HW7A 2R56L 2M8XA 3MV8D 3Q3GB 2BJML 5T3ZD 4TNWF 5JHDB 5EORL 3RPBA 2DJMA 2QPFA 3RU8H 4WO0A 4W9IC 1FFNB 1MI5E 5AW2B 3BZDA 4QJ5B 3F7QA 4PJIA 5BXFA 4FABL 4ZTOL 2VDQL 4DGYH 5GZOD 3CSFA 4I7ZC 3T1WA 1CTNA 1MVUA 4KRNA 3D4YA 1DCLA 2DH2A 3QDGE 1IM3B 1AOHA 5HHPB 3C5JA 3TA3C 2OX5A 3TOPA 2XFXB 3W9EA 1SXNA 3WKNA 1W0YT 2VDNH 3E38A 4DPBX 5B1CA 2OQJB 5AZUA 5J6HB 1OAZL 1G6RH 2VQ1B 5KN5A 3EJQA 2O5XH 2O6EA 3UYPA 4MZRA 4DO5A 2WGXA 5T1KB 1I31A 4PWKA 1YJDC 3QEQA 1XCTA 5ABDE 3REVB 1R24A 2B4CL 5DK0B 4JPIA 3BVTA 4FNLH 4O02A 3RLSA 4OLUH 3K2IA 5D4JA 4PGJA 5I1GH 5D6CB 4IMLA 3TT1H 1KCUH 4DP4X 3V4VL 1M05B 2X4PA 2JCCF 3QQDA 2BVPB 5H94A 4P23B 2CLZB 5KVDE 2J8UA 3DTXB 1S7SB 4FL4C 3STZA 3WO4B 3ZDXF 1GHFL 4PJCF 4WWNA 4BM7A 2H6PB 2NW3A 1E50A 3HC3H 4Y4KD 1GYCA 2ZCLL 3GXFA 3MJ9L 3DUHA 4K3HA 3KBHE 1A1NA 4HJ0D 1URIA 4MJIE 1TCRB 1AR1D 1T22A 4XP5L 2XWDA 2R0LL 2VL4A 3C5ZC 4M56A 5KS9F 1RY7B 2QPUA 3NOIA 3WTYA 4HF5H 2BCMA 3ISWA 3U79A 2BO0A 2QELA 4IMKA 5DWPA 4D9RD 3EJSA 1MI5B 2BWIA 1RJLA 3T5WA 5GS0L 1G1CA 3H55A 2VRKA 1AGEA 4I0PB 1UB5A 2J88L 4FTVD 4UYPA 1SMDA 4ETQB 4L8SA 4Z0BH 5I1IL 2B1AL 4FKEA 1YY9C 1QYGH 1ROCA 1K4DB 3LV3A 4B7IA 2FWSA 1ZHNB 1O5PA 3B83A 5A40E 1EEQA 3GUTB 4IJTA 1QHPA 1KB5A 1KJ2B 4KRPD 4H44C 4HUMB 3TJEH 2E7BA 3SQBA 4LDLB 5FUZL 2G2NA 4MS8C 5JIDA 1UWGH 4ABVA 5I8OH 4M6AA 1IGMH 5I6XB 2X3AA 1GTNA 5IZ7A 4GKNB 5DZ9A 5E08H 2Q3ZA 1S3KH 2K7PA 3KPPA 1A65A 2Y07H 5ESAB 4NAMA 3UAJA 4G3YH 4JDZA 5ESQA 3L16A 3RJOA 2ZXQA 3KYMA 3VA6A 1OAKL 4ZNEE 4FHBD 2FJFB 2BIQA 1ESOA 5KVFE 4PJXE 3V5HB 3T65B 1UTDA 5E99L 5FWQA 4MBRA 4WAFA 5E5LA 4RH4A 1OPOA 1DHKA 5HVFB 3D3VD 3EJUA 1LO4L 3G6AB 4OAWB 2K0RA 4YBLC 1WFNA 5GZNA 5HD8D 5AD0A 3W0WE 2VDOB 4HCRH 5DHMC 3VWJA 2GK0B 4KHTH 1IGJB 4PV9B 4GO8A 1WEJL 4A2DA 1FGNH 4NM8L 5HGAA 1A6AA 2CDGA 2VB5A 5GGSA 5KEZA 4NNXB 2OA9A 3L13A 2OR8A 2XLLA 1L4IA 1FF5A 5AB1A 2XV3A 3ZRFC 5IQLA 2LU7A 4P23C 3VXRD 2H26B 2HJFA 2SODB 4JDVB 5GGRA 3WO4C 4I89A 1J1XH 1K9TA 2CM5A 1D9KB 3GMLB 2A6DA 3TBYB 4ODWA 3LRGA 3QJVB 5I1CH 5EOCH 2H4EA 3CDGB 2Q10A 2ZPKL 1XGQA 5ICXB 1I9IH 3K7UA 4H8QA 3LPFA 2FATL 3H7BB 5TDNA 3N1FC 3M7FB 5LKNA 4HYTB 1P7QB 2YEQA 3VXQA 1RLWA 4AENA 5FO7B 5DD1H 1X44A 4YR6B 1WO2A 1ZT4B 2EEDA 5E00A 5CLWA 1NCWH 4I0PC 4BRVA 3L3DA 1EEUA 4ZOCA 1KCRL 2CMRL 4HMDA 1KZQA 2VRAA 3IXAB 5I1LB 1N2RB 3IGUA 1U8NA 3C60A 4QXTB 1AQHA 3KL5A 3OAYK 1RKRA 1U0QA 1Z3GL 1Q9OA 1KC5H 3DRTB 3PJLA 1F56A 2VZUA 2D0HA 4JFQA 1E2VA 2IH8A 1R5WA 1HZLA 2CAKA 4RGMB 5E5MA 4M6OH 3MRBA 5MEND 3TVMA 2YPVH 4JE4B 4AC4A 2WLZA 5JYLA 3W0WB 3DVFA 3HPJB 2ISDA 2J44A 3EIFA 1Z3RA 4NRXB 3KH4A 1J0HA 2BY0A 1U3ZA 1HHJA 4RWHA 5IBLC 4MNHB 4IDJL 1XGTA 2F8OA 3GHBH 4Q4EA 5CWSA 2X4OA 3PHSA 2CJSA 3C5SA 4DESA 1IM9A 4F7KA 3SDCB 2EEXA 4OZIB 4NQCA 1JV5B 2V6HA 3WS6A 3P3UA 1E3FA 3GT6A 3CPUA 2MH4A 3IGKA 2AJUL 4CGTA 5EZOH 1DTUA 4DO4A 3FFDB 2CJUH 3DX8B 3KYNA 4ZPTA 1RUAL 1P4LA 3FUJA 5D1QB 3RDJA 3FCSA 4IRJD 1BJ8A 3WIFA 1T5XB 3FT4A 4A2GA 4LARL 1QEXA 1ETB1 3CSYB 1UXSB 5I28A 1NBVH 3JWOC 1JZHA 1S7RB 2AXFA 3GMOB 1CLYL 2UXGA 1KGYE 1KN2H 1EPFA 1J0YA 2DM7A 3MLYH 4Y4FB 1EHLL 3STLA 1JERA 1X5JA 2YN3A 4BSWA 1AVAA 1D9KC 4RMRA 5HI4C 2K70A 5I66A 4OY9A 4M7JL 2EDYA 2CR6A 1JI2A 1E4XI 2JIXB 2UY6B 4IU3B 3TV3H 4GG8B 3JTTA 2P80A 5GISH 3WKYA 5DD6A 4BQBA 4N25A 1MEXH 5HVWA 1NPNA 3NCJL 3UAEA 1AG0A 3GQFA 4YBHA 5A6LA 1KZYA 3ESOA 5IW1A 4HEMA 5T1LA 4F8OA 3S9DB 3QIUA 3O0LA 4IKLA 3ASOB 4MB5A 3ZY7A 4V1DA 2JKJA 4AT6B 4M7ZB 5LG6A 4O9HL 4Q4IA 4RGMC 2VMFA 3BVNB 1TVBB 3FQXA 1OSZA 1P6WA 5EC2A 4PGEB 2EDRA 1I1RA 2V7NA 2F74A 1XF5A 3SDXE 2V2XB 3OAZH 1BLNA 1YN7B 4A37A 4BZ1H 4PRPB 2PCXA 3TZVB 3UZQB 2A9DA 3WDIA 2G9HA 5TPWL 2J6WA 4OCXH 3KDPB 4Z95H 4LCCB 1XL4A 2NY4B 4LESA 4Q2ZB 3SDCC 4DETA 1KBWA 1H8SA 2IF7A 5DJ6B 3TCTA 4Z7AA 2NNAB 4N2HA 4G6FB 3LS4L 4O2EA 2ATKB 3V0DA 5EWIL 1PSKH 3TH4T 2KZKA 5IVXB 4UQAA 5DJDA 2YBRA 3AQDA 2EYSA 4ZOEA 2ED7A 5IESH 4GH7B 1ZVSB 5D1QC 1FYTD 4AE0A 1A7NL 1FJ1A 4L4TB 5IROA 4Z5RA 1L9QA 4RMWA 4XPHL 5E1AA 3CCHA 2CXGA 2ZWLT 4UOW0 3VI4F 4PJBF 2FEJA 3BPCB 4GOSA 1QPKA 2R15A 1FFOB 2V5YA 2J1WA 3D69B 1ZLUK 5L2JA 2VW6A 2PWEA 5I76A 2HTKD 1VZGA 2EC9U 4OJCA 1ZEAH 4MDIA 5DUBA 5E95B 5ID1B 2IPUG 4FXGB 2JCCA 8CGTA 5JIIA 4Y4FC 4OZFH 3OTTA 3T2NL 4C4KO 4E9SA 4ATWA 1IBFA 1UB6A 1C8QA 1XZ0A 1BHGA 4KK6C 2BHYA 4PWFA 4L9LB 1PX3A 4PJCA 4I1PA 3MRQB 3GI9L 1MREH 4BSJA 5I15H 1YNTB 5JQ6H 4APXB 1I4FB 2CQVA 1KNOB 2QMKA 1KXTB 1KY7A 3HC0B 3KLKA 3ZR6A 1WUNT 2JKTM 2R9HD 3X3GL 5KS9A 3COOA 2VL5B 3FNKA 4BFFA 3TJHC 1I7ZB 2Q86B 1RZKL 1FNGB 3FCTA 3KYKH 1DBAH 4FQCH 2E5EA 1N9PA 1A6PA 1MW0A 4LHQB 1EJOH 4JRYA 1TFPA 1JZJA 3OKDB 3QJFA 3FTGB 4GW4A 3TTYA 1LDPL 3JYCA 4M7ZC 3TO4A 3BUPA 4OQTL 5G55A 3QPXH 4M7LL 4PAZA 1ZD6A 1CDGA 3NSJA 5E2WH 3WDHA 1QR1A 3HVNA 5GJTL 3TTSA 2CDEA 1A4JB 1N59A 3ZL1A 5IT2L 3NG5A 3AWFA 2Y69B 1OOAA 3UTTD 3APDA 1TTFA 1DVUA 3RVXD 5F7EH 3TZVC 3AXLA 4AKPA 5HHNB 4B27A 1YN6B 1EFXD 3UC2A 1KPUA 3DOHA 5F1IB 4FQLH 4ZG1A 3HAEG 3DGGB 2ZOKA 2E9WA 2IGFH 3VH8B 1IGIL 4LCCC 3ZVVA 2NY4C 2XKNA 3P4NA 3V0VA 1N8ZB 1RSFA 1U6AH 3LMJL 2O6DA 3V0FA 2B1HH 3IVKA 1QLFB 3FU7A 2Y7LA 2I7OA 2IEPA 3MUGB 5KVDL 1JNNH 2DLGA 1CICD 1OE3A 1RK7A 3F7LA 5AW3B 4EI5D 1MRDH 3FH5A 2P7TA 1E4XH 2K78A 1GS8A 5D7LE 2VDOL 2K45A 3LZQA 2X40A 4YE4H 1D7BA 2DJ4A 1KLGB 2ZP8A 4GRWF 5IB3B 4M1CC 4S1RL 3AAZB 4FXGC 3ZU8A 1XHHA 5CAYB 1DJXA 1UJTA 3W2DH 1HESA 3FT0A 1UWYA 4KROD 4UINH 4TOYL 3UPRB 4R4FL 5TE7L 4X8XA 3R0MA 4Z77B 2DWDA 4WTXA 1IEBB 4L9LC 4XHJC 3WELA 4DQOL 1DUZB 1F86A 2R51A 2OZ4L 4TVPD 4Z7QF 2VDNB 3FUFA 1EWHA 5F0LB 4CN4A 4WZ9A 1IAKA 3L7EA 5DR5H 1G6RB 3ZX1A 3T8VA 4JPQA 3REWB 5GXBB 4K3GA 4LSUH 3H9HA 1ZXQA 4WI0A 4G83A 2VXQH 3DV6B 3PUCA 4PP1D 3G3LA 3AZUA 1UC6A 2CK0H 1HQRB 3V6FB 2BFVH 2YLKA 3CFNA 4LSPL 2P52A 5CXPA 5GGTA 5C07E 1RZJL 4ZX6A 4WW1A 4JFFD 5KVFL 2FWOA 2NW2B 2VDKL 2VLKE 4OF7A 1LEGB 3ULVH 4MKMA 1Q0YL 3WN6A 3E1ZA 5D7IE 1CE6A 4KHXH 1AGBA 5BS0D 3CK0L 3K4AA 5TH2B 3U4BH 1X5LA 2C7UB 2RD0A 4JRXB 2PABA 4RNRB 4N68A 3ZE2E 2NR6C 3T3PE 2J6EL 5KBKA 2ZT9C 3WY2A 2PKDA 1MVFA 1RUQH 3JTSB 2Y5TB 2Y6TE 1JV2A 2F6AA 2VC2L 4NAJA 3I85A 3SCMA 1N19A 2ICEA 3APMA 2DQFB 4AEFA 1ZE3H 5ICYA 1WDAA 1NBZB 1T6VN 1LE5A 4G5ZH 4JFEA 4HSAC 3FTSA 3D52A 3CTTA 3OKEB 1MAKA 5KAQG 4ODSH 1JGDB 5GRVK 4EBQH 3GS7A 4L37A 1USQA 1B9KA 2D7OA 3T0EE 2YKLH 3L7FA 5DFVC 2QVFB 3M8OH 3HKFA 2ZNWA 4KZEH 5EU6E 4GMTL 1RIUL 4MKTA 1TZGL 4JO1H 4YHOH 1P69B 3FT2B 3QEUB 2HMID 4X5XB 5IMMB 2V5TA 4Q7DA 2JELL 5FUCC 3WJJA 1B0RA 3C08L 5DC2A 3N1GC 5C07B 2ZJSL 1VLXA 3KWXA 2F7OA 3IE4A 1INDL 1NZRA 1RZFH 3BKJL 3SB3A 3VWKA 2VLKB 1REIA 1OWRM 2YGNA 3HBZA 4JZNA 4LAJH 4UM9D 4PWHA 3NZHL 1K6QL 5D7IB 3QUXD 2A83A 5CBEA 4X4MA 1RJYB 3TEZA 4HMEA 3EO0B 4RSYA 3ARBD 4HAFA 2FO1A 4IRZA 1DJGA 2PO6D 2QGEA 3EW3B 4C56A 3KXFD 3VQ2C 2HRHA 3BWUF 1S78C 2OMXB 2YQGA 4BYHA 1E9PA 1FL6B 4WF7A 5DMGC 3G04A 3NIGF 5MHSE 4HJGA 3T2PA 1NTDA 4AVKA 4Z7OB 3QQNA 1W16A 1OPGL 4TULH 3N1PC 5SWZA 4NUQA 3KR3L 3BD3A 3ZDZB 3G9AB 3I75B 3OKOA 1NDMA 5D7HA 3GRBA 1AE6H 4XAKE 1R3LA 2GJ6B 4S1SH 3QO1B 2W9EH 1OK8A 1M42A 3FQRB 4P9HL 2BSRA 2ZCHL 5KTEL 3EBGA 3MO1A 3T6QC 4K5NA 4PJFB 2XT1B 2KPNA 4P5SA 3A23A 3NCBB 4JY5H 2X9YA 3WJMA 5A2BA 3ECBA 1XGRA 5IJDC 5DA4A 1JTTA 3AS3A 4FQXB 4WFGE 2WXLA 5BRZE 1PZDA 1TYEB 2NYZA 3HZKA 5TFSH 2B08A 4JAMB 1AGDB 3Q5TA 1P2CA 5BVPH 5IJKC 3HG1A 1MH5B 3U1PA 3VI4A 3IU3B 4P2CG 1UM5H 3UC0L 2NNCA 2XA3A 2V17H 4PJBA 2PPEA 4FRWA 1BCIA 3V4PH 3MNMA 3Q5OA 3ROOA 3T9WA 1AOZA 4EOWH 1DVTA 2R0WL 2P24A 4NC2B 3V95A 1YO4A 3ALPA 1BFTA 4JG0H 5BW7C 3QW9A 4YUEL 3GMRB 4PJ6A 2GCYB 4L5FH 5EIIG 1GL4B 1A66A 3BH8B 3A4DA 2X7LA 1EJ8A 3GKWH 2FJHA 3B4NA 1QUNB 3AQYA 3T0VA 1ZGLA 5T3XH 1ZS8A 3ARPA 3WD5L 3R7RA 3BZEA 5E9NA 4XN4A 2CRIA 2EC9T 5F93C 2GSMB 4ESKA 1OTSC 1T0OA 3QQ9D 4MD0B 5E9DA 3FZUC 4KX7A 3S96A 5CEZH 1UEMA 1YEFH 3VG9C 3DECA 3Q1EA 4RGNE 2A2QT 4GUCA 1RZ8A 4KKRA 1K5WA 4FNQA 3FN9A 5EU5A 4OLEA 1KOAA 1BVOA 5IIEA 3OM3B 3O6MH 5I82A 2HKAA 4FS0A 5CD3A 5GS3A 4LRIC 5F3HA 1JF6A 5HYSA 4GAGH 2ZF9A 4MAUH 3KDMB 3WLBB 1XGUA 2G3NA 2W8CA 4U3HA 5JW5A 4F7PB 1DLFL 3MAWA 2Z64C 3D2UD 2GAZA 3TNNA 1T1XA 2AABH 4KK9C 4MD5B 5FHBH 5JQHC 1JXGA 4CSTA 3S88H 4XX1E 1DBJH 1U95A 4XNQB 2DLHA 5FUOL 3GLDA 3GLZA 3GI8H 3O3EA 2YPKB 4R26H 4Y7MA 2BK8A 5DUPL 4D3CL 2VLRA 4HD9A 2ITDA 4N2GA 3KVQA 3RYMA 4R5VA 4Y5YA 3KPSD 4D9QE 3ABZA 4XMKH 4FQXC 5ISZE 3EF4A 1H15A 4WI5A 1AACA 2VWEC 3GDCA 3QUZB 1Q8MA 4UIMA 1M7UA 4WWKD 5AFAA 3JT0A 2WINA 4YJZL 4UM8A 5J3HD 1HKFA 2X0VA 3LH9A 4ZSOA 1KTCA 5IEKB 5JW4R 3QUHA 3AM8A 4YVUA 3WNKA 5B8CB 1GYWA 2J3SA 4NC1E 1E9QB 1BIIB 1BYOA 4B9GA 3LY6A 4O58H 3N85H 3LS5H 1P5UA 4P3WA 5F7WC 4EDWH 2C3WA 1EAPA 5A3ID 3EBIA 4OZ4A 3VXTA 2C3VA 3KPMA 5AOZA 5IJVA 3NEXA 2A4EA 1M6UA 3RPIB 2VDNL 4OT1H 4NWTL 4Z23A 3QJQB 4XMPL 4YSEA 1BBJA 4OBRA 2R23B 4WW2C 3RX5A 1QW9A 1E30A 1N5AB 4O51A 5T1DH 1Q4NX 1YEWA 2O5XL 4FKHA 1M7DB 4PS4L 1MFDL 1DJZA 4FNLL 1UD5A 4HIHB 4OLUL 5LGYA 3UH8A 1N6QH 4KZCA 1QZNA 3SYOA 4AH2B 4QKTA 4XVSH 4MYPA 2NY5L 4PRHB 1HXYA 2FEEL 3APNA 4G8FB 4FQQA 4NQEE 4OZFB 4QF1A 5FS5A 3VTTA 3EOAB 3GM0A 2WWOA 3PF2A 2V7HB 4KO5A 3QR2A 4N2BA 2YK1H 1IGFH 2FUQA 1YDPB 4WFFD 2DDQH 1CLZL 2MHAA 5CGBA 5ERWA 3PAZA 1XXFC 4EAEA 1N10A 1K4CA 1OGSA 3MDJA 2GUYA 2E9GA 2V3EA 4OCWH 5IV2A 1VZHA 4GXVL 4XC1H 2X6UA 4JGNA 4LPVA 5LN4A 1RUPL 1Q1JH 1C7TA 1Q90A 3FRPA 3ZGHA 2DPKA 4AYSA 1ZJAA 2XVGA 3WEOA 2I25N 5DA0B 3BDBA 5D7JD 3CV5A 1L0QA 4YHIA 5L9DL 1E27A 3QUZC 3CVHA 3RQ3A 1X5KA 4KDTA 2A3TA 2L04A 5IR1A 4AG4L 5JW3H 3PHOA 4IKIA 4F7MB 2BOBB 2ZAIA 1B2YA 3TJEL 5KSUA 1T0NB 1FLRL 2V5MA 1JYXA 3HI1A 1F2XK 1TVHB 5B8CC 5G4MA 2IFGA 3FTUA 1CDHA 5LAXA 1X5MA 4AUUA 5CZRA 1OD7A 4URKA 1Q0XL 5HJ3B 5GGUB 3ZMNA 4QRRE 4QYOB 5A2IH 4U1LA 1SYSB 3AY2A 2WUCH 3WKQA 3ZR5A 3HNVL 3FU6A 3GZQA 2WXKA 4QRUB 1DJWA 1KBGL 1R3HB 2E6PA 2WQSA 4JPKH 1VEPA 3QYNA 3SY0B 5IGXH 3RL1B 1LEIA 4A55A 1QI5A 2X89A 4ENZA 2HN7A 3U9UB 3TLRA 5G2NA 3RWFB 5GS0D 5G4NA 4NKOB 2FX9L 4PMFA 5FYLE 5HDBE 1NAKH 5I0YA 4KHTL 5GSVB 4R7NA 5CD5C 4X6CB 2OL3A 4I3GA 3QWRD 4NO0D 2EDNA 3MLXH 3DX3A 5I8CB 5DRNA 2MNWA 2MPAH 1N4XH 2AZUA 2XPGB 3OZ9H 3SKNA 1TJGH 2PYEB 3D06A 3HN5A 4YDZA 2V2TB 3BP6B 1RURL 4XI5D 3OKLA 1GOGA 1AJ7L 4DK3A 3IFPA 4QRQA 5LDUA 4G59C 1GYAA 2XQBL 3VGDA 3EGDA 4NXSA 1JP5A 5F3BA 2IPKB 3MBEB 2AQQA 2X1QA 4GIPD 4YDIH 3NIDE 3NCFB 2PWGA 5DT1L 5I8EB 5D5MF 1QO3A 3ABGA 3RDTB 4JN2A 4K3JL 4P2YA 3UAJD 1ZHBA 1XF4B 1YEEL 1HILB 2BSTB 3K71A 3GTVA 4LHJB 3OAUH 1E90A 4WJG3 3VH8G 1DLHA 3O6FB 2BP8A 2WTPA 4LOEA 3MCKB 2MTPA 4JM4L 1GIGH 4GT7A 4LPTA 1TETH 3RWCA 1J5HA 1AANA 3FB6A 5GZND 4LSTL 4XCCL 1JZDC 4XPAH 2WGNB 3QS3A 1PFOA 3MOBL 3VWJD 4M6OL 4XNUL 3NFSH 5I0WA 4KJWC 4IBLT 3D85A 4E9XA 4F7TB 4NYLA 1J18A 5EF0A 5JHAA 1IC5H 3QXUA 5D72H 1N0XH 1RP8A 1S5IH 1EBPA 4LCIL 1SOKA 5F1SA 3MJ6A 3DROA 3QUMA 3S8WA 2DI9A 3FO9A 2QVKA 4Z3HA 5DURB 4F5CA 1V8HA 2IG2H 4PJ7E 1E5ZA 5B7MA 1SUHA 2FGZA 4KKCC 3RUGE 1SUJA 1K8DA 2N56A 1SJVA 2QPEB 3ECUA 2ZWKA 4DAGL 1MSPA 1WCBA 3JVFC 5MEOB 1DEEB 1CXEA 1QPPA 2VCOA 4DKEH 1QSFA 1XGPB 2BZCA 4AWJC 3HE6A 2JCWA 1YAIA 4NRZB 3U0PB 3NP4A 3WFHB 3KLAB 2XN9A 2B2XL 4CKVX 2NX5A 3WFCL 1IQDB 2BVEA 3QPQD 1NBVL 4WNQB 3BRFA 2Z8SA 4P2RB 4GG6F 3H4FA 4UB0H 3HZYB 4D8PB 5LGKA 4UQ2A 1T7YA 2EDKA 4JDEA 3II1A 1UXWA 1FYHB 4JHUA 3L4ZA 1OQOA 3MBEC 2A38A 2CWRA 4PJDF 4ZXBC 3TBSA 3MOAH 3TVMD 3ZSSA 3QFJB 4X8CA 1BAFL 2PN5A 5D7SL 5JPNB 1NGQL 4N22A 3MRDA 3PWNB 5IHUL 1UXLA 3IDXH 4ZFGH 2DMGA 2ZOLA 3RDTC 4IU2A 3BKYL 4WUUA 1NBCA 3DBSA 3HNSH 4S0HA 2CIIA 4HIXH 1SM3H 2HJKA 3GK8H 1BFVL 4HPYH 4NQCD 3RWGB 3O6FC 4JQIH 2W80C 1SLWA 4L1SA 4QRPE 3KH3A 1IAIM 5FGSA 1R3IH 4LLDA 3DETC 1C16B 1GZQA 4KQ3H 3RY4A 2H45A 5DQJA 3D1MC 4Q9BA 3WEXB 5J8OA 2CLRA 4HGWB 4L29A 1KCSL 4XB8A 3ULVC 4KO7A 4NQSB 4CC4A 4KGLA 3F5WB 2FNWA 4ZDHB 2CBMA 1V7NH 3QFGA 3G5XA 2AI0L 4HHWA 2VERN 2WXGA 5KG9A 2MCAA 2WO4A 5CEZE 3WY4A 1QFWM 4NI6A 1SHSA 4GT0A 3BEVA 2QTEA 3S5ZA 2ZKHH 3HI5L 2UZIL 1FV1B 4AEHL 1T6BX 3N91A 1IGYA 2OS7A 3IDUA 3ZYJA 5FA3B 3X17A 2WC7A 5JTWA 3VA2C 1U8IA 1TF4A 5LNEA 1XCQA 5EU3A 4EQ3A 2R1YB 3KBPA 2Y3AA 3HZVB 3GRWL 5CU5A 3GS4A 5HGBB 2BS71 4Z8FH 4ZFQA 6FABH 1ZE3C 1EX0A 1MCFA 2ITEA 3DNKA 4G80B 4DP0X 3SGKC 4X4YB 4FQPA 4K5LA 4DCQA 1G0YR 1D5MA 1NFDE 3Q2NA 5GQBA 2O5YL 1MCEA 1G7QA 3SE9L 3V4PB 1BD2A 4F24A 1INEL 1IEAB 3H42L 4KTEH 5FV1L 2GPZA 2Y36L 2K9UA 4XXWC 1ZEAL 5T1LD 3DSFH 3QIUD 1OAXH 3B9EA 1CR9H 1MCQA 3IXTA 4V1DD 4W9GC 3ARGD 1T1YA 3BKCL 2EYTB 5C0AB 3PABB 3N04A 4ZFZB 4NKDB 3TNMA 3EYFB 1JMZA 4UV4H 2KMWA 3ZHDA 1AIFA 4XGZB 2R2BA 1LK2B 2UVEA 4FNTA 3KZ8A 4J6RL 2FIKB 3UG3A 5F7AA 4MQXD 1EV2E 1E0OB 3FT3A 4WNSA 4XVTL 3SDDB 3OLGA 3FQYA 5CP3A 1WC7A 2Y3NA 4DKTA 3AABA 4UNUA 2NY7L 5E7BA 5D2LE 1QNIA 3F65A 4R3SB 4W9DC 1GYUA 1ULVA 4Q97A 3QA3B 5JR1L 2VDPH 4OB5L 1C12A 4XCYA 1ID2A 4GW1B 2ADJB 3CSGA 3NSDA 4J28A 2NDGA 4JFOA 3QR0A 1R17A 4OIIH 1ZPLA 1NANI 2JQMA 3UTPD 5C1MB 2APSA 2P5WE 3NCYP 3S3JA 1T7XA 3STBA 4ABUA 1V3KA 3NVQA 2R2EA 1XR9A 1IL1B 1D6VL 3NZUA 4HDIA 3BEWB 5F8RC 4P8QA 1MCPL 1P5VA 3P4OB 4JDTH 4WI3A 1G7PB 4YNYA 2GJJA 4AJVA 4NT6A 2AK1L 3FH8A 3WFEL 1MG2C 3S36L 3S98A 1OB1A 2JKRM 3ZO9A 1JUFA 4JM2F 3BC9A 4E9YA 4W93A 3VW3H 3Q5YA 1VFMA 3N06B 5DQDL 4YIQA 1WISA 1N12A 3VFMA 1S7UB 2R7EA 4WTWA 2EDTA 5FGBC 3T3MB 4YHZH 1JFQH 1BX2A 2HWZL 2GTZA 4HH9B 4QOKA 2IGTA 2I07A 4ELMF 3MUHL 3QJHA 1RU9H 2MRYA 5L2KE 1IZKA 1MRDL 3KM2A 3RFZA 4RQQA 5CIPH 1SDYA 5JA9A 3F7VA 3MNVB 4ZMYA 2XVBA 5ITBL 2F54A 4YBQC 4IBQA 4OUOA 3HTLX 3KLLA 3OHXB 12E8L 2HLAA 3QWQB 4MXQC 4BZ2H 5K9OB 5D2LB 1XDTT 3O11B 3P3SA 5AW4B 3QDGD 3TJPA 4W9ZA 2JB6B 4WEUD 3C2AH 4LLVB 2DIEA 1QRKA 4HX1A 4OCNC 4Z7VF 3MACH 4TVSa 3TO4D 1CK0L 4YSCA 3PNRB 3ZE1E 1QEWB 3ZMEA 2LLNA 5EU4B 2D8KA 4NPYA 5I6OA 2YGVA 1JZ3A 4N0UE 1FZMB 3BUIA 1JRHL 1G5AA 2E8YA 3BIKB 1NIDA 1E4HA 3N41F 3SDDC 2CUIA 4K9EL 5D5MA 1RUMH 5IB1A 2XJKA 5KJ4A 4QT5A 2W91A 1TNMA 3PP3K 1TEFA 3UIZA 1MOEA 2JJUA 3DO3A 5IOKA 1E8XA 4JFDA 3FF7A 2WIIB 2XZQL 4CVZA 4B60A 1B0GA 1QRNB 5FA4A 4BCZA 2ZSVA 4U6YA 1G1KA 1HT6A 1QSZA 5F0MB 2VITB 1I9JL 4YFLI 3SJVB 1SYVB 5AZ2H 5A2CA 1KLUB 2X3CA 3BE1L 5J7CC 3P3TA 1LD9B 1M71B 1NUGA 4FP8H 3ZBMA 4C8XA 1P4IL 1A4CA 5C08E 2UXFA 3BN9D 3MRRA 4QJ4B 3F7PC 3VD1A 3X11A 4XMLH 2BVTA 3CWGA 5DJ0A 5HVGB 1QPXA 3CMOL 4AW7A 3GBMH 3SZKC 3WY1A 2DBJA 5FYLL 4P5MA 1MFBH 1GW0A 2OTPA 3GSVA 3L3GB 3Q9QA 3VFGH 4PI0A 1A2YA 4PJ8A 5F7DB 1TJMA 4Z78B 3EH1A 4BCYA 1F3RB 1RUQL 5T33L 2XVKA 3KYAA 4FDWA 4J4PC 4CU7A 5IF0A 4UILH 4HC1H 4JKMA 4NKMA 4I9WD 5JPMA 3L3OA 4RESB 2IO5A 3FONB 3RVVC 4GRLB 1XB8A 3BO8B 4DVRL 1IGTA 4HOMA 5HHQB 2CK2A 4N2AA 4APQC 2Y6SC 2XKSA 1NCAH 3VI3F 3OHXC 4RGOH 1LWRA 2RB8A 2IQ9L 3P77B 2VN4A 4WTZG 3QSKB 2OXHA 3BWAA 3M7OA 4HG4J 4XMTA 3C6EA 3DV4B 1JDCA 4GG6A 2O6FA 3FCUB 1I7TA 4JG1L 3Q0HA 4NQXA 4OZFG 5L4JA 4ZTEA 2NCEA 4PJDA 1ACZA 1NANH 1XTLA 2NPLX 1E7VA 3DRQB 4IBZA 4O2CB 5B22A 3VGGA 4B0MM 2NCMA 2I9TA 4YLCA 1N5YH 1JDAA 1NEZB 4S2SA 1OTUC 3ZHKA 3ZPDA 2WNKA 1T66D 1JOIA 1F4XH 4URTB 1BBDH 1I1FB 5DUMH 4XVJL 1BZQK 1S9VB 1CDIA 4LRNH 2IADA 1L9SA 1T7WA 3G6JF 4PJGE 1YMME 5AVSB 2KH2B 2QQQA 2WSKA 1EMTL 2X2UA 3VD0A 5DYOB 1PQZB 3WCYA 1XF2A 3HUJF 2AJVH 4JFED 2Z7WA 4HK3N 3EYUL 4LSSH 4D9LH 3RA7H 2Q7AA 4TRPH 5E0FA 1AE6L 3IFLL 3W56A 2MJWA 5J4MA 1WT5C 3TYGH 1GXEA 3MVSA 1SEBB 4AM0A 1UZ8A 2A9MH 4WO4B 3WS3B 1BEYL 1NGYA 3V6ZA 3WIHH 5I1KL 2BW4A 3TIEB 1LQBC 3IRCA 4KZDH 2LVEA 5CZVH 1BQLH 2AQRA 1COBA 3VWKD 3BZFB 3ARTA 2DBLL 1UATA 1XB6A 4GRLC 1R4XA 1NFIA 1DDTA 5ACZB 2WVVA 1U8KA 3PGCB 1UM5L 2I60H 4Z7NE 3IJHA 3A4EA 4P5RA 4KUZL 2NUPB 2GUOA 3EYVA 1KXQA 3CU7A 1R3KB 4PJ5E 4XP9L 4AI7A 3SIKA 3SE8L 1F18A 4JG0L 5CHNA 2OXGB 5KAQF 3Q8EA 4KX8A 3S8GB 1YMMB 4Z3TA 3CFBA 3V8OA 4H1LH 5SWZD 4BEIA 2XYCA 3PGFH 1I53A 3LQZB 4JHAL 5B7FA 4HIJB 5IFHH 3C8KB 1ZK5A 3MRIA 4KI5E 1JIBA 4GKSA 5FYKD 3U82B 4ZPVB 2Q2EB 5GRJH 4LU5L 1E5YA 4ORZC 5CEZL 1U8MB 4ZMWA 1MNUL 1OL0A 3IJEB 2GABA 1J8HE 2GBAA 4Y2NA 2H2PD 1M57B 4E41A 3SBWC 3H54A 3OR7B 2P44B 1YNLH 1YMHB 3O6ML 3TURA 4MZ3A 3VVVA 4BD4A 3BVWA 4BXVA 5I1EH 5TGBA 5EA0L 3RIAK 3VFUB 1JGVH 4YWGH 1F1AA 3O8XA 3HG1D 3G5YA 1G1OA 4MCZB 1WVZA 2ATPB 1RLBA 3NP3A 3QNXA 1ZRUA 2R69A 4LVEA 2DKMA 4U1IB 4OU3A 5FHBL 5I1DA 4ZS6C 1MRFL 2A6IA 4ZYKB 4CL7A 1XCXA 4FFYA 2ROXA 4WO4C 5SV4A 1OAUH 5EUOB 4PUBL 2J55A 2WTRA 4JM2A 1I7UA 5I8KL 2FBJH 2NYYC 1NAMH 1R5VA 1A7RH 5IB5A 5FIEA 3SDYL 4M48L 2AJ3A 2K3TA 4HS3B 2KZBA 3T2OA 4OLVH 1CJYA 5AW9B 2ODHA 4OV6F 4ELMA 1UD3A 2FQDA 4BCXA 1U36A 1F2QA 2KKQA 3QO0A 1ODUA 2DLIA 4NO2B 1NCCL 2BZ7A 2WUBH 5FYJU 3UG4A 4PGEA 5LUMA 3INOA 2Y7QA 3BDYH 1ZDQA 2P4AB 3JV0A 5K5YA 2A77L 5F9JB 3GSWB 3OD3A 1J8HB 4KJYA 1QASA 1SEQH 2EUXA 2YD1A 2OTWB 1QBAA 5TDPB 1BYNA 1LO5A 2H8PB 1N68A 4XP4H 1EEYA 4Z7VA 1IC0A 2XTJC 5A16B 4OUUA 3INUL 2HT2C 5DMIH 3RWJB 1Z5LB 4ADIA 5HYJA 4Y19D 1YVLA 4PRAB 4XXDB 4XE0A 1KUMA 3KL0A 3FTZA 4OVVA 2BNQB 3FQNB 3K1DA 2WLLB 4OF6A 2HT3C 3W9DA 2BNRE 4FYRA 3ZHFA 1KWKA 1ZSDB 3PJSB 2C1OB 5C3IA 5IOPB 2VLRD 5CMAB 2FD6L 3UJIH 1DL7L 2YC1A 1ZA3A 4BA8A 4EIBA 2H3KA 3LRKA 4PCSA 3B7RL 4U4BA 3ML9A 3F12B 1DQLL 1M3JA 3IDIB 2KQNA 2EE2A 3FB7B 1MCRA 3B7UX 4EZMA 4FZ8H 1HEJC 2RJMA 5AW7B 4D8OA 1AFVH 2AJSL 4HV8B 4PG9A 1Z9SB 4P99A 1A3LH 1Z66A 1ZTXE 4QXUH 2QV2A 2EVJA 4CC1A 1K2DB 1Q72L 2X3BA 1MCNA 1YHPA 1CIUA 3D33A 4W9LC 1Z5YD 4G8GE 3QVAA 3UX9B 2DQJH 1FWXA 5IHZB 1VEMA 3HG0A 5GGVY 3T71A 2VDPB 3QDJA 5HGDA 2K4AA 4LVNC 3WU1A 1DUYA 3HAEA 3FFCA 5I1JL 1HU8A 4KKQA 3FSVA 1IC4H 5CLZA 1ACXA 1CE1H 4UT9H 4X0KA 4TQPA 5JHLA 1UADC 1KTRL 5IFJA 5D6DC 5IEHB 3PHQA 3G08A 5DMKA 1J9QA 1DO5A 4OZIF 2BNRB 1H0DA 1HCFX 4Q56A 5SWQA 3TA3A 3U0TB 2V5SA 1MW3A 4Y9BA 4ZO8A 3EH3B 2XKUA 2R4RL 3MLVH 4Y5XB 4MNQE 5HPMA 1TQUA 3JV6B 2E27H 5I2IB 4Z0XB 4PJHE 4AMKH 3X1NA 4HWBL 1PF3A 1S9XA 4ONHA 2NY1D 3TV8A 1MAJA 1NGZA 4IOFC 5J13B 5D7LD 1NJ9A 5MP6L 3DXAA 4JY4B 3LIZA 4R7DA 3IKKA 5CIPB 1J0JA 1J05B 5KJRL 4KDWA 1KIUA 3UTOA 4P2OB 3RY6A 2PWDA 1PIFA 3EDFA 3S3PA 3MRLB 1ITBB 1ZT1A 1HTYA 4Y2DD 4ELDA 4PEEA 3G6JA 2A74B 2LT9A 5B4MC 4DO6A 1FAIL 3MCLH 4ONGL 5I24A 1MPAL 1AQKL 4KITB 1O6SB 1TJGL 5M95B 1JF1B 2R0KL 3HUJA 1EZSA 5FHAH 1JHTB 1H5BB 3C5ZA 2LGNA 5DRXB 1T2QH 2EO9A 4PJAE 1N3NB 1HH9A 2IDTA 4A39A 5FLUA 4WCYL 2FR4B 3WFDL 4NUGH 3E7JA 3MJWA 3NDZE 1PTZA 4JLRA 1HHIA 4HGMA 4F7EA 4YMPA 3FSAA 3ATAA 2VNCA 4G1MB 1W72L 2NNRA 3VG0H 3BYTA 3P2BA 3Q3GA 3QDHA 4X50A 2QQKL 4P05A 4AQ8C 5JHDA 2YD4A 1P4BH 4UMSA 2YD3A 3HLAB 5ETUB 1FFNA 2G2RB 3ZKMC 3R19A 2PYFB 3FULA 2X89D 5C0CE 1AYOA 4ORGA 2P47B 3FSOA 1URZA 1C5CH 4JVPA 4WWPA 2FTAA 2N4IA 3K6OA 2OYKA 1IM3A 5HHPA 1CFSB 2CIKB 2IH3B 2XU9A 2AK4E 2HB0A 2XFXA 1B88A 2EDEA 4PREB 5JA8B 1G43A 2VJXA 4ZX3A 4S11A 2K9FB 2HX7A 5IVXF 1GZPB 3CC5B 2VXVL 3QUKB 4Y9EA 2OQJA 1N0XL 5J6HA 4FG6D 4UTCA 5ADPL 2VQ1A 1BVNT 2JJWA 5K1VA 3BAKA 5HDWA 4FNUA 3FPXA 2JQAA 4PY8J 5T1KA 3GIZH 5KBLA 2VSDA 1SMAA 4NBYB 5DK0A 1R19A 5J13C 2HPOA 1G0DA 5KSAD 1R47A 2AEPL 4O2FB 5D6CA 1YEHH 2FHCA 2CHZA 1M05A 3PDOB 4HEPA 4P23A 5E2UL 2CLZA 4P2OC 3CDZB 3GSNL 2DQHL 2GHWB 3PQYE 3DTXA 1S7SA 2H6PA 1B6DA 2A74C 3IPBA 1YNTF 4M43H 3TO2A 2PMZA 4UIKL 3E6HB 3MRKB 5EPMB 3AFLA 5C6TH 1WZKA 3TCXA 1H5BC 4PPTA 5KW9H 1EO7A 2I27N 3BMWA 4FF9A 1DQQB 1W0WB 4KRLB 3BVXA 1PLGH 4ODXB 3VDBA 4U7SA 4FXLA 4I0PA 1JPTH 3BT2H 3IJYB 4GY4A 4HXAH 4RAUB 3D85D 4ETQA 2GEQA 1LM8V 4JFTA 5C9JB 5I6MA 1WFJA 2ZWYA 1K4DA 3CN4A 1YZZA 2C5DC 1ZHNA 1GOFA 4KC3B 5F9OL 5D2NB 1IKOP 1KGCE 2WXIA 4HIXL 1R46A 3GUTA 3SOTA 1KJ2A 2F8VA 1RVFL 3L5XH 3ML8A 3ZZ1A 3HNTH 4X7TB 4NIYE 4LCUB 3D30A 5KOMC 4H8HA 1RZIB 4I18C 4ODBD 4F9PC 5KVEE 4GKNA 4OGAD 4JGMA 3L2NA 3DX4A 1U3NA 3NIFE 1OARL 5JOFB 5ESAA 1HIMH 4B9KC 3HE6D 4OCYH 1BWMA 1MNNA 2XN9D 3V5HA 3T65A 4NZJA 1BJ1H 2NX5D 3ULUH 4XOEA 5GGSY 2AP2A 3ZJAA 2VR7A 1RP9A 4K2UH 2FQGA 4OAWA 3G6AA 2J8OA 1BP3B 1GPOL 1QFOA 1UWEL 2O5NA 4JKLA 5GGRY 1ZVHA 3SKOB 2GK0A 5CR1A 1IGJA 3BXNB 4PV9A 4TPRH 3TBTB 1WZAA 4OZHB 5C2BH 5EIIA 4NNXA 3BZ4B 1QW8A 3OB0H 3LXBA 4YSRA 1GOHA 4YQXL 4Y1TA 2QPDB 4WUUD 3ELAT 4JDVA 4KK8D 2COQA 4XPTH 1D9KA 3GMLA 1NEZG 3AADB 4MX7B 3TBYA 1YQVL 2HVJA 5GRXG 1X5FA 5L7XH 4KTEL 1QSEB 1J5OH 5CCGE 4I3RL 1JSYA 3N40F 5ICXA 1CXLA 4N20A 4UV7L 5T8IA 3H7BA 1HKLH 1TMQA 1P7QA 4H1LB 4UI2A 2PPAA 5FGCE 2DY2A 2X4NB 5FO7A 2A0LD 2G60H 4YR6A 1ZT4A 4UV4L 5I1LA 3IXAA 4ZD3H 2GT9A 1N2RA 1TT6A 1FO0A 3LQAH 4QXTA 5AYTA 5EDXA 4AZ8B 1K5NA 3FU5A 3NCYS 1DP0A 2EXWD 3DRTA 2A1WH 2Y22A 5D2NC 2PTUA 5KYUB 1CG9A 2MKLC 4RVBA 5DJCB 5KOVC 2EILB 1NGWB 3OKNB 4PBDA 4H0GA 2H0FA 3BLKA 1S7WB 4LBEB 3TYFB 4Z7IA 3HPJA 2XUWA 3LKOB 3VMOA 5HHVH 1NEPA 2GG1A 5IBTL 3WL9B 1EZVX 3GSUB 1D5XB 1ASOA 5I19L 1JL8A 1A7OL 1MHPL 4MNHA 1KDJA 5D8JL 4J3OH 3ARDB 2ADIB 1R33A 1WJ3A 3SDCA 3RX8A 4OZIA 4KVPA 1BD2D 3MV9E 1JV5A 4JDTL 3GMNA 2VUYA 4FLOA 1FC2D 2YPLE 4NM4H 2GK2A 1L9RA 4N90D 4R83A 3FFDA 4N2DA 1XQ4A 3DX8A 3E3QE 3RI5K 3NA4A 4P3DB 5ISZD 4HUVB 5D1QA 3SDAD 1NAMB 3ETTA 4LGPB 1F42A 4WJKB 2V33A 4TSBH 2FHBA 2HTLC 3CSYA 3ZL4L 4QXWA 4ODTH 3GMOA 3LHPH 3VU2A 5ILTL 3HE7D 3MZTA 1ZTXL 4Y4FA 2QQLL 4X6FB 3KPLB 4OJAA 1HYSD 1KACB 2P45B 3CDYA 2VLJB 1TDQA 4N0FB 2OSLB 2JIXA 2UY6A 3BVUA 3SODB 4BZ2L 2J4WL 1PNDA 4IU3A 3SBPA 4YZFE 4GG8A 2W5PA 2Y25A 4QHMB 4XO5A 4Z3FA 4C56D 3B2XA 2FE0A 5D7IF 5ANME 3MACL 3TCLB 3ARFB 4CVXB 1GGUA 2DF3A 4HQQH 5JORB 3VSQA 2VABB 2JTDA 1AZNA 3PHAA 1T7ZA 4H88H 2Z7UA 2Q8AH 2PTVA 3E80A 1U3HB 2VO5A 1RUKL 2V2WB 3GUFA 4MXVF 3MV9B 4OGQC 3H4HA 4Z7OF 3HA0A 4AT6A 2YPLB 2F19H 2BXZA 2CNYA 3BVNA 3ZDZF 1TVBA 5DTFB 3C8DA 3PXLA 1A6WL 1O9ZA 2ZP9A 4HJTA 4AVHA 2P9RA 2DWEB 2WHVA 4CAGA 1EEZB 2IAMD 4ODHH 5DRWA 2V2XA 3TEYA 3U6RB 1YN7A 3R1GL 1YYCA 4PRPA 4QOKD 3BKML 3P2DA 2WPGA 3TZVA 5SWSB 5D71L 3UZQA 5JXAH 2FGWH 4CMMB 9CGTA 4F91B 3ARDC 2Q9OA 4PJFF 2FX7L 1OGAE 4AY0A 4LCCA 2NLJB 2F54D 1S4IA 5DJ6A 2V37A 2NNAA 3FW6A 3S3SA 1JNLH 1PEWA 2ATKA 1EVTC 5AG9A 1Z0MA 1NOFA 2DQIL 3FQUB 4M5YL 1TMCB 5IVXA 4UOZA 1XBRA 3OMNB 4K4KA 3QIBB 1ZVSA 2X2JA 4L4TA 4GQ9H 3UJJL 1AQ8A 3GIVB 2EQDA 3POCA 3BPCA 4HKXA 3G5VB 1Z2KA 3D69A 3K0WA 4JUSA 5DF0A 4UILL 3Q6GL 4MJHA 4YPJA 2C4FU 4XCEB 2JB5L 2FSDA 3G7TA 3GMQB 2HFGH 2BIIA 1CFVL 2CR0A 2EH8H 4UQ9A 4XMUA 4DQAA 3FH7A 2ERJB 1UWFA 3ZOAA 4FXGA 4L3CB 2VR4A 3QNYA 2P5EE 5IVZB 3IAQA 1ADQA 4L9LA 3IGFA 4JFDD 3MRQA 3D25B 3W11D 5CBAB 2ZUQC 1YNTA 3GTTA 4APXA 1I4FA 1BXUA 2DQMA 1GY1A 1KNOA 1KXTA 2YA1A 3HC0A 3VYNA 4UTAH 1T4WA 2RR3A 3H9SE 5FV2A 1M3IA 4WW2F 2VL5A 4JPVL 3LCYA 3BFQG 2CSPA 1I7ZA 2Q86A 1SXZA 3D50A 3QXAB 3KCWA 5ENWB 7PCYA 3VE0B 1OKEA 3UP6A 5TQ0H 5GRUH 3BPOB 1W0VA 4NPJA 3RWHB 3QJXA 1U3HC 3OKDA 1OGAB 5IM7B 3FTGA 4FNPA 4ATTA 5I75B 3RZCB 4LOUD 3SYCA 4PJ8D 3MGOA 3MUZ1 1AO7B 2WWKO 4UQ3A 5B39B 1NCTA 1KULA 1A4JA 1KIPB 1Q0EA 4FD0A 3MRCB 2N3JA 1OE1A 2WWMC 3DX7B 4A68A 1WAAF 5D96B 5C0BB 4M29A 2N7SA 3S35X 3FOLB 5HHNA 4OV5A 4QNPE 2XOTA 4BQCA 1YN6A 1YEGH 4LSSL 5F1IA 1IE4A 1JJUA 3I6KA 3DGGA 3R4RA 2OFQA 3RA7L 4MQTB 1P4UA 3VH8A 5I26A 2NR6A 1D5IL 2JJSC 1XV8A 1CTOA 1N8ZA 2ESVB 1Y6KR 4ES8A 3TYGL 3WGUB 1QLFA 2HRPL 1ONQB 3MUGA 1IJ9A 4L3AA 4PBVC 1O7DC 3AQXA 3WE6B 3IWVA 3RWIB 1DBBH 4F33B 4FYSA 3OJVC 4XZ4A 4PLJC 5IBUB 1UCBH 2CRZA 5L4FA 1F6LL 2GJPA 1OSPL 5CJ8A 5E8DL 5BOJA 2Y5QA 2AANA 4LNRB 5F88B 4I3SH 4KZDL 2HH0H 2VSCA 1KLGA 3ESVF 1AR2A 2I26N 2A9NH 5IB3A 2ERJC 3CGTA 3AAZA 2PWHA 2RCSL 3HMWH 4ZBJA 3GO1L 5E9AA 4FCAA 3UPRA 2XVLA 5AAPA 4U3SB 1TJXA 3JSSA 3DWTA 1DBKH 1IAII 4Z77A 1WWWX 3HMXL 1IEBA 4JO4L 4AGMA 2YEVB 3BAIA 1DUZA 2ZX5A 1W6LA 5HHME 3IRZA 1ZGLM 4RFOL 5T5FH 4AX3A 2JSFA 3H3KA 1CXIA 1G6RA 2KT6A 1OQXA 3Q05A 3REWA 2NXZD 4ALAH 3C6LB 1SFHA 3KL3A 3CFCL 1MFEH 3DV6A 3NZ8A 2WKLA 5FYJE 3TEUA 5LWYL 3D39A 5KVEL 2BVQB 1E8ZA 1HQRA 3BPOC 5DVMA 3V6FA 5IFHL 3ISYA 2H1PL 4N1CA 4HBCH 3BESR 2DJUA 4MSWB 5FM8A 1GGIH 2QGCA 3WIIH 1SF5A 4OKDA 5AOIA 1RJCA 5I75C 3RZCC 2NW2A 1A1MB 3EO9H 3SPCA 3D0VB 3OSKA 2TRYA 1LEGA 4FQJH 2HRGA 3GINA 2Z31B 1DSYA 4IS6B 5D96C 3DHPA 4S1DC 3AVEA 3NRFA 5TH2A 4LF3B 5TE4H 2C7UA 4M93B 4JRXA 4OD2B 3PDDA 4RNRA 3T2QA 4DN3H 4LT7A 2WAQA 1KGWA 4OH2A 1H9DA 1O6VA 4GW5A 1OALA 2WBKA 3WG7B 3CSBA 5C6WH 5I0DA 4DF9A 3JTSA 2Y5TA 4YEFA 1EQWA 1BGXL 1HJCA 5JMOC 2DQFA 2DQDL 3EG9B 1OAUL 5CJ5A 1X9RA 3FQ4A 3BPLB 2B9AA 4PGBB 4QRPD 2NY6B 2DLFL 3OKEA 5IJKA 2CXKA 3F00A 1EGJH 5DVOA 5HDLA 4XBEH 1JGDA 1L6ZA 2IVFC 3U36B 4X9YA 2E0PA 4HFWB 3HR6A 5TD4A 2APVA 3CLEH 4I77H 1L9MA 4BZYA 5JW4M 3FT2A 3QEUA 3S35H 3TIDB 5BW7A 4X5XA 3UYRL 5IMMA 1H3TA 3CPLB 1SDDB 4WV1B 3BRDA 2WNXA 3B2UD 4ZTPL 2WVTA 5DEJA 4E41D 3BDYL 2QHRH 2OYLA 3U4AA 3DUUA 3DPBB 3KE0A 1RJZB 4XMWA 4BGDA 2BRRL 4AVJA 2HVKB 3C6LC 4HCRA 3MUY1 3O8XD 2ZKMX 1HWWA 3CG8A 1A7PL 1JPEA 4JB9L 4KVNL 5E2VL 1KCVH 1RJYA 1T5KA 2IC2A 1INQB 4N0CD 4L3EE 3EO0A 4OLZH 4X6CF 3IK2A 2XZCH 4PJ9D 1OCOB 3DA0A 1HS6A 4XN7A 4TQEL 3U4EB 1C8PA 2OMXA 4JW3A 1FL6A 1OO2A 5HI5C 2WWKT 1N67A 4YLBA 2IANB 4CDHA 4N8CL 3LZLA 4JM2D 4LRIA 5IVOA 5I74B 4EN3B 1MF2H 5LXGL 5D4IA 1DN2A 5HDOA 3MA9L 3FN3A 4MFHA 3I75A 4LHUB 2F5BL 4LFHG 2OSWA 3D8MA 4A38A 2H0PA 5D70H 4FAAB 1CIDA 1G7LB 2GJ6A 1F41A 3NPSB 3QO1A 3NN8B 1H8NA 3FQRA 3U0WL 5IHBA 5F2FA 2GSGB 3WXVH 1QVOB 4AYDC 4MGXA 2WZ6A 4PJFA 2FT6A 1QKZH 1PS3A 3SE6A 4OI8A 5K39B 1R9FA 1A3LL 1MAML 1AD9B 1A9BB 4X99B 3MV8E 4PGZA 4FQXA 3F6LA 4KXCA 5T3ZE 1IAIH 3VM7A 1A3RL 3BPLC 4TNGA 4JAMA 3H85A 1AGDA 1NLDH 4W1TA 3MRPB 2NY6C 3NCCB 4JNXA 2E59A 4UTBL 4HWNA 4IBTA 4EVNB 3ULVF 3IU3A 1W8NA 3NABL 4N85A 1S7QB 2YPVA 4JN1L 4CC0A 5HYJD 1SY6L 4LASL 1C9SA 4AYFB 2H32H 5DSCA 1Q94B 4JHWH 3LRSB 3FAXA 2XBTA 3WNOA 4AV0A 1ZLSH 4PJEE 3KWTA 3SPHA 1SN0A 4PRDB 5BMFH 4MA7H 1S9YB 3S37L 2WQRA 3GMRA 5B7EA 1FCCA 3TBWB 2MOVA 3BH8A 5HI3D 4ABWA 1MCIA 4EXKA 5KANI 1AZRA 3ULUC 5IMOB 4MLIA 2C4FT 5IB2B 4YHPB 2DQ6A 4JY6B 5E1HB 3S34L 1TQBB 2J7LA 4EKXA 1HNFA 2Y7SA 5DDHB 3W81A 2EIEA 1MJ7L 1IBGH 3QJOA 4LLWB 4MD0A 3AC0A 4WW2A 4PVMA 3OAYH 4E2OA 3N44B 1GZHC 3F01A 2YD8A 2OJZH 3WSQL 3L45A 2JQZA 4ICWA 4BV1A 1IIKA 4WI2A 4H1LG 4NNPH 3CVBA 3EJZD 3WDJA 2BSSB 4XNMA 1U8QB 2WOYA 2QEJA 2I7SA 2KHAA 3BQUB 5I74C 4EN3C 4MAYB 3KDMA 3WLBA 1AI1L 2W38A 3UGEA 3SEPA 3J8F7 1PJ9A 2EDOA 2IDCA 2BFGA 3KWWB 4QHUB 3GSRB 4F7PA 1X3DA 4MCYB 4YHKH 4QMEA 2L0DA 2CD0A 4MD5A 2MTAA 1WAAA 1HK6A 3NPSC 3FHEA 3QHFL 2J21A 4NKIL 3FFCD 4XNQA 2L8AA 3CHQA 4FTVE 2YPKA 4YFDB 3B2MA 4Y0GA 1THAA 4J1UB 1HXMB 3AG1B 4DFIA 1XGYL 1XX9C 3LQAC 3TA3D 1FCGA 3SPJA 4FI6A 3D6GA 2FCBA 4HUCA 3ATEA 3JWNH 3QUZA 1FH5H 3SOBH 3BJLA 5IEKA 2F53E 3HZMA 5IQ7L 3MBXL 2DMBA 4FQIL 3OPZL 3WTWA 4BZ1A 2W95A 3DXAD 3HIZA 5B8CA 3ZIYA 3QIWD 1KBVA 4PR5B 1E9QA 1BIIA 3FQWB 3G5ZB 3L4WA 3T6VA 2EDLA 5GS2H 3IU4L 4J3OC 3C87A 5CEYB 1Q9KB 3QZNA 4LL9A 4ICXA 1VESA 4YZWA 4BRJA 3D3VE 3CXHK 3JTBA 4KOBA 5IQ9B 4GSDL 4Y4KB 4HPOH 4YDKL 1HX0A 1FQ9C 3RPIA 1PGRB 1TQBC 2ICCA 1AR1B 3EO1B 2XV6B 2FAUA 2YEZB 5C0GB 2N7BA 3BW9B 2R23A 3X2QB 1N5AA 4BFNA 3C5ZD 5I23A 4KAQH 4WTZA 5JNYB 4YDNA 1M7DA 4JCLA 5LJYH 1QBLH 1PZAA 5INCB 2WXNA 3CLFH 5GS1B 2DKUA 3RZWA 3VFVB 4HIHA 2B0SL 3VXRE 4NHUB 4AH2A 2XQ0A 1YY9D 4PRHA 1A1OB 3Q8CA 4G8FA 3QRGH 4GAYB 3BQUC 3HS8A 4OZFA 4ZQKB 3KJ4B 1MJ8L 2EIKB 4MAYC 1A4AA 1CF8L 4TN9A 3EOAA 4PG2C 1BQRA 5E56A 4S0TD 3EFFB 2V7HA 4NQUA 3L2MA 3L48A 3ZT6A 1YDPA 5IQMA 4HJJH 2G75B 2GI0A 5JHDD 4RRPM 3IMSA 1HHKB 4OFVA 4DP9X 2DYSB 4MS8D 1ZJBA 2BRQA 3CVIH 4OFIA 2WIMA 3B34A 3ZKSD 2BVOB 2DMHA 1XH1A 2WXMA 1X7QB 2YSTA 1IM3D 4GKZB 5AB9A 5DS1A 3SKJH 1O0VA 2NXYC 1RHFA 3V6BR 1MFCL 1ZLUH 5MENE 3LNFA 4JHZA 4H25A 3AS0A 1EJFA 5A2AA 1AS7A 3N0PB 4AQZA 4F7MA 1VERA 2BOBA 1NIAA 3HCVB 3EJTA 5B1JC 1T0NA 3GBNH 4WRLA 3QG6B 4I48B 1TVHA 1XT5A 2XWEA 3CZLA 5FYJL 2VDMH 5IUCA 1KEMH 1NC4B 3DKHA 4J12A 2I24N 2E7LC 3V7AG 5HJ3A 5GGUA 1FN4B 3AWGA 4QYOA 3MJ8B 4P23D 1SYSA 5JUEL 2ARJQ 2EEBA 2WZ5A 3KS0J 4MMZB 2Q1EA 3CZUB 4QRUA 2FBRA 5AVXB 4I2XB 4XPBH 3FBKA 1KIRA 4HJ0C 3SY0A 2BDNL 3T3MF 1AR1C 1LILA 2HKHH 3RL1A 1RIHL 4N6QA 2I32A 2ENYA 3B2VH 4FFWC 4GYBA 2FEDC 3U9UA 4X9HA 2WM0A 3RWFA 1R0AL 4KFMA 3QH3B 1FRGL 1J5CA 4Z3EA 5GSVA 1G6VK 4TUOB 5GS1C 3KPNB 4X6CA 3PP4H 4I0PD 1MZYA 2VISB 4N9GB 1B0WA 2VKWA 2Y1YA 3CNKA 4WK2B 5D2LF 2OK0H 4YDJB 3N6YA 2PYEA 1I3RB 3O2DH 3KJ4C 5BJTB 2V2TA 3BP6A 2PCYA 2YAQA 2WQ8A 1V27A 3B9DA 4XPTL 5FCSH 3EFDL 1UOLA 5MENB 1VDGA 2IPKA 3MBEA 4ZXBA 1TU2B 5B39G 2BSDA 5I8EA 5LDSA 3KGTA 1Z0NA 1EAOA 1AY1H 2OSYA 2VXQA 3RDTA 3VYPA 5IBLD 1XF4A 4ZX5A 1HILA 2BSTA 2Q8BL 4TMPA 5EFIB 4ZD3L 3A6BL 3US1A 1O7VA 3RNQB 3O6FA 3RP1A 2YKKA 3MCKA 3LPWA 3LKSB 4JGJA 4ZS7L 3V0EA 1ORSB 2A1WL 1UJ3B 4EI0A 1V7MH 2F7RA 1SXAA 2IWKA 3BVDB 3FUEA 3CDFA 3Q1SL 1DBML 3QRFM 3VGFA 1A14H 2OMZB 3J7HA 1VACA 1A5FH 2WAHA 4F7TA 4LSQH 1HSBA 1KENH 4WSGA 4Y8AA 5EU7C 2VQUA 3J27A 4QRTB 3QCTH 3A6OA 4AUJA 1GGBL 5LG1A 4Z7UE 3T08A 1I3GH 4R7LA 3PPEA 1MN4A 2EDDA 4U31A 4XTRD 1D9KD 5HI4D 4MMZC 5H2BB 5J56B 1FYTE 1F4YL 1S2EA 2VXSL 2R4SH 3SYAA 3PNWB 5KYWB 1CT8A 4AIOA 4NX0A 3SGKA 1DEEA 5MEOA 4OM0L 4ZZKA 4QY8B 1P7QD 2H9GB 4IQHA 4R2GD 2E47A 1T89C 1XGPA 3GJEB 1AQDB 4NRZA 3U0PA 3WFHA 1A8ZA 5GGVH 2C3HA 3KLAA 4KQ0A 2BLFA 3CJJA 3MV7B 1D5ZB 2FLRT 3OBAA 1IQDA 2JFCA 4I9XA 4WNQA 7FABL 4XXWA 1CGVA 5ECGA 2QADB 4P2RA 1JHLL 5CFAA 2CO7B 4L2LA 4KXAA 5AVYB 3QDME 4D8PA 1S8DB 3N3EA 2FT7A 4M1GH 4F37K 3RKPA 3D0LB 5T3ZL 1PZSA 5GRWA 3GBDA 4L4VE 5I5MA 2AEQH 2KS0A 3QFJA 2X2YA 4ONOA 1OP3H 3V10A 3PWNA 5LCVH 4ALAC 2MQCA 3IFNL 2VLLB 3K1KC 4G9FA 4NOFA 2X4RB 2G5UA 5EBMB 2R0ZL 4V33A 1MXDA 1RULH 4X80H 4PRNA 3N2JA 3SDCD 2W07A 3QCVL 3MLWH 3RWGA 5CJBA 4JCMA 4TSCH 1NIEA 4J8QA 4X0NA 1BXAA 1C16A 1CYGA 2Y2TA 3PWLB 5H37G 4U1NB 3WEXA 4HGWA 2F19L 3UTTE 3FFOA 5D1QD 1EVUA 4NQSA 1UKTA 1JGLH 4OZGE 5DWUH 3WNLA 3F5WA 4ZDHA 4Z7WE 1X6LA 1SBSL 2R29L 3QQ4B 1WPCA 2OP4H 4ANWA 4ZFFB 4XO3A 3ZE0E 1I1CA 5LVEA 3N1MC 5DHYB 3GXNA 2KQMA 1TJIL 1FV1A 3LH8A 3PFUA 2QZQA 1F8TH 5BZWA 2R1XB 3WBDA 4Y4FD 3P0YH 3FUNA 3DJTA 5F96L 2BJMH 4LCVA 2R1YA 5D4HA 5HBBA 4N1HB 4JQXC 2G4EA 3CQFA 3HZVA 4KK6D 5EORH 4AGNA 5HGBA 4F2MB 1FG2B 1XEDA 5F21B 3F7KA 2JIXD 3ILQC 5FGBA 4L05A 4LPYA 4ZTOH 2VDQH 4FABH 4G80A 4JFHD 4X4YA 2LAAA 4HAGA 1L9NA 2DM2A 3TJHD 3CVDA 2D3LA 4MVBC 3V4PA 2VGLM 4TUUA 4MJ2A 2FYVA 2OJ1A 2H32B 5FGRA 1IEAA 1VFUA 5E24E 3FOMB 1OAZH 2QADC 4TVPE 1CVSC 3I9IA 4FFZL 3W1ZA 1JVKA 1NKGA 1UUNA 2EYTA 1PKQE 5C0AA 1N6VA 3PABA 4F8QA 1PZUB 4NKDA 3EYFA 2B4CH 1I7RB 1K3ZA 4NZDA 4G8EB 4XGZA 3LX9A 4JFSA 1LK2A 4NCDA 2ICWJ 3DX6B 3WFZA 2FIKA 3V4VH 2PR4H 1BXXA 3MHZA 4LQFL 4Z7WB 4UTAL 4PRPD 3SDDA 2VT0A 1BZEA 3TZVD 4ZFOL 1QMUA 1J7VR 4MHHI 4MJJA 5CUSH 2KLSA 2PPCA 3M46A 4JVWA 1GHFH 3ASWA 2VO8A 4R3SA 2MQGA 3BN3B 2NY4D 3T6ZA 3QA3A 2ZCLH 4WHCA 3QUGA 3MJ9H 1BVLB 3Q6FB 4JFFE 3BWUC 5GRUL 4G6FD 1IBHA 2ADJA 4GW1A 5K9JL 1O5DT 3NJLA 4QD2E 3L2LA 4Z18A 2IOMA 2R0LH 4P5KB 5A6MA 1SHXA 3HC2A 4EI5B 3GDBA 2ADYA 1RHHA 4G11A 5BS0E 4L4TD 1AZVA 5GS0H 1IL1A 3HN8A 3BEWA 2J88H 2FQEA 3P4OA 3BUTA 5I1IH 1G7PA 2B1AH 2HTKC 3AGWA 4BKSC 2YUXA 4DP5X 1W15A 3QARA 2ZG1A 2J8HA 5EUOF 1YEGL 4U1GB 4KROB 3L4TA 3QRBA 3I9AA 3EFOB 3IMUA 2WLNA 4I1NB 3AROA 3QJTB 4J3OG 3MLUL 4J4PA 1S7UA 4KPHH 4NJ9L 5EZJB 5TDOA 3VFNB 1M53A 3L3HB 4HH9A 1RCYA 3VQMA 1JHKL 1F3JB 1F4WH 2WZAA 2Z1KA 4QWWC 1WCQA 4X5WB 5D1XB 3VFRB 4L1DA 4APQA 2XPYA 3MNVA 1OAKH 2VR9A 1WD9A 3OHXA 1VJSA 3S5YA 5E99H 3RIFF 2H0EA 5K9OA 3O11A 2DICA 5H35B 2JB6A 2AQ2A 3HI6L 4LLVA 1UM4L 4JFFB 2G5RA 4P49A 1CI3M 2XQYK 4PWEA 1DBKL 5EU4A 5MI0B 1QBML 1BM3L 2XWZA 3OV6A 1WEJH 4NM8H 2NY2B 4AGLA 1MFNA 5T1JA 3BIKA 2VR5A 3QAQA 1UQSB 3IGAB 1A7BA 2IH1B 4PJ7A 3TN0B 3BPNB 4JFZL 3KXFE 1WITA 4F92B 2NR6D 1MWAL 2EE0A 3QQXA 2LW3A 2WIIA 4TLSA 2ZPKH 1H3UA 1QRNA 4M3HA 4OLXH 1T21B 5F0JB 4R0LB 3VFPB 3SJVA 2FATH 5FW7A 3ZTJH 4EI5C 4RMUA 1SYVA 5AUMB 3CMGA 3JUYA 1DR9A 1KLUA 4A7UA 1LD9A 5DVNA 4KV5F 4U1HB 2WZPA 2VDLH 5L8LB 2Z1PA 1KCRH 2CMRH 1GCFA 3ZDYE 2XG4B 4IK6A 4JPWL 5EZIL 2EDJA 1WT5A 5DFVD 4HFUH 1Z3GH 2HLFC 3H53A 3ME0B 4LPCA 4U1GC 4KROC 3L3GA 5I1AB 4X8JB 2VDRL 3U6XA 1Z7JA 4JFPB 5J1SC 4R90L 2QSVA 3F83A 1GGYA 4QCIA 1WZ1H 8FABB 3H3PL 3K8MA 3P9LB 2BWDA 2XFGB 3JWNC 4O4YL 4X42A 5PAZA 3FONA 2J20A 4GRLA 4EZJA 5D1XC 1FE8L 3KHOA 3BO8A 5AOJA 1K85A 4IDJH 1G1YA 1CGWA 1OCWL 2XETA 4JX0A 5D1ZI 5HHQA 2P49B 1EGJL 2YMTA 1KN4L 4XBEL 4J3XA 3D39D 2M26A 4L9DA 4X6DE 2PO6B 3P77A 3KXFB 4OW6A 3V6OE 2DH3A 1NMCB 2VDMB 2AJUH 3LPPA 5E70A 1KTJA 4NWUL 4UT6L 4AJ0A 4C83B 1S78D 3FN0L 3DV4A 4X7DC 3IETB 1RUAH 4HS6A 5HXMA 3ARXA 2UWEE 4X83A 2D31A 5MI0C 3ZN6A 5C8JA 2HSIA 1GSKA 5M94B 2F08A 4ZUUB 2NY2C 1M1XB 3ECWA 3S3CB 1G9ML 1F3DJ 1ORQB 2QHRL 4LARH 1BVKB 2NNXA 3G6DL 4AJWA 4O2CA 1VCAA 5G4OA 4DJMA 2R2HB 3ZIMA 1CLYH 2N1KA 2X05A 3RTQB 4BHUI 4DKAA 4NFBA 3IBOA 1NEZA 3TN0C 3O3BA 3BPNC 2QFPA 4JRXD 3AB0C 5HHOE 3VXPA 5B3JE 3CH1B 5E4OA 1I1FA 3MLZH 1S9VA 3HLKA 3GMMB 4M7JH 4WKXA 5DJ8A 4ZW8A 4LLAA 3II2A 4Y2OB 2IOIA 4FEMA 3SBWA 4WUKH 1DFBL 1E3XA 3H56A 5SX4I 3RJDA 5DYOA 1PQZA 3O4LE 2G5BB 3JV4B 3SO5A 2R27A 1FPTL 4ZW3A 4XB3A 1B3IA 7PAZA 4M9OA 4WJ5B 1MQKL 2XACC 4IIQB 4AYBA 3BCFA 1MKFA 3L4VA 2ZCZA 4KTDH 3ZYZA 1SEBA 1OLLA 5I9QB 3II3A 5TE6L 4R97B 4WO4A 1BVZA 3WS3A 4F2FA 2VM4A 3KPSE 2BMKB 2OMVB 4ZUTB 3WXVL 3P30L 4K3EL 3TIEA 3UTSB 5IQNA 3P11L 2CHDA 2GFBA 1TQSA 2B16A 3A6CL 4JQVC 2L3BA 2WQAA 3MRGB 4X2UA 3V4UL 4MNGB 3ATFA 3BZFA 4DNLA 1YPZE 1IAIL 3HG4A 5HDQL 1S6NA 1OTSD 5TPWH 4JK0D 3FZUD 1KYOK 3NT0A 5FYKU 2KUTA 5CGTA 5ACZA 5L4IA 1CDCA 5HJDA 4PGDB 5EWIH 2QDWA 1QFWL 1NMCC 2NUPA 2P48B 1B90A 4M3JA 3O9WB 4HK3J 4IRSB 5BMFL 5KSBB 4IM8A 4MA7L 1ILUA 2ODIA 4XPHH 3UOAB 4MCNA 3LQZA 3VTAA 2O6PA 4XBPB 5E0QA 1CDUA 4HIJA 3C8KA 3K6FA 4KK9D 4OVUA 2FK9A 1DJSA 3GJFK 3RTQC 1NCBH 4AGPA 1T03L 2HG0A 1G7JB 3T2NH 3FHQA 4UCFA 1U8MA 4G6AD 2YUWA 3IJEA 1I3VA 3LZFL 3BFOA 3K0YA 1OSEA 3GI9H 3HRZC 3KPSB 3T09A 3VD9A 1UD6A 2K6WA 3BAWA 4N2FA 2DM3A 5DZLA 3OR7A 4MBOA 1YMHA 4FQXD 2NSXA 5DHDA 1FHNA 4TKWA 3X3GH 5DZVA 3DHMA 1AHKA 6CGTA 3KBEA 1RZKH 1OLZA 2CBQA 3K6NA 1X5YA 4A2MA 4IIQC 4MCZA 4M5ZL 4PJIE 1QATA 5ALCL 2HP4A 1FL5B 2ATPA 2CHWA 3U46B 3T0BA 4U1IA 2XI9A 1M4KA 5I9QC 4ZYKA 4R97C 3SBRA 1B4TA 2UYLB 1PPIA</