3GC3A

Crystal structure of arrestin2s and clathrin
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
380
structure length
329
Chain Sequence
GTRVFKKASPNGKLTVYLGKRDFVDHIDLVEPVDGVVLVRRVYVTLTCAFRYGGLTFRKDLFVANVQSFPPKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLAKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGDVAVELPFTLMHPKPKDTNLIELDIVFEDFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-arrestin-1
publication title Structure of an arrestin2-clathrin complex reveals a novel clathrin binding domain that modulates receptor trafficking.
pubmed doi rcsb
source organism Bos taurus
molecule tags Endocytosis
total genus 62
structure length 329
sequence length 380
ec nomenclature
pdb deposition date 2009-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00339 Arrestin_N Arrestin (or S-antigen), N-terminal domain
A PF02752 Arrestin_C Arrestin (or S-antigen), C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.640 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3gc3A02
2.60.40.840 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3gc3A01
2WTRA 3LH9A 4LL4A 3GD1C 4GEJA 1JSYA 2R51A 1CF1A 4GEIA 3LH8A 1SUJA 5F0PB 4R7XA 3LHAA 4R7VA 4J2QA 3UGXA 5F0MB 1G4RA 1G4MA 1ZSHA 4P2AA 2FAUA 2WTRB 5F0LB 4GFXA 4LL1A 1AYRA 3GC3A 3UGUA 4JQIA 5F0JB 4ZRGA 3P2DA
chains in the Genus database with same CATH superfamily
4K3DH 1ZWIA 3H85A 5DJDB 3TH3T 1Z66A 4G9FE 2C4XA 4MA3B 2W65B 4HGWA 1NCNA 3QJFA 1M7DB 4YSQA 1A47A 1PFOA 1OPGL 2RR3A 1NC4D 4BWWA 4DGYH 2PWGA 2FH8A 1RUKH 2XQYA 3ZKXC 4D9QE 1SJEA 2ZF8A 1FP5A 3P0VH 4DVRL 4IS6B 3Q3GB 4Z78A 5HHOB 2ROYA 2E3VA 4YH6A 2JWYA 3G5WA 1CR9H 3HIZA 3PNWA 4EZKA 3QH3A 1XVSA 4TOYL 5CN3A 3SYPA 1ZGLB 2AJXL 2UWEA 3ARZA 1OANA 3HFFA 1O6SB 4NKMB 4OZIA 1DBJL 5ABZA 4NQVB 3FU7B 3ULUC 3NN8A 3QDMA 5C6PB 2OMWA 1ASQA 4OZGB 1QX1A 1CJYA 4XCEB 3EH2A 4C4KO 3AXLA 2X3CA 2WBJB 3L3OA 2R51A 5CIPH 1NBYA 4FP8H 4OT1H 3UTPE 2WWOA 2CO3A 1OSEA 2MCAA 4LVHB 2QVKA 2RH0A 4H8QA 2JKRM 2APFA 1LHZA 4X9HA 4IU2B 4LQFH 5EZJB 3WUZA 1VGEH 3KPSD 2ORBH 1T03H 2BSEA 1H8OA 2VDOB 4HJSA 4EVNB 1R6VA 2YPKB 3P0GB 2VLLB 3RE0A 5LWYL 1CURA 3O3EB 3S5LA 3ZKNC 2YRLA 4DOHE 5E2VL 5ICXA 2G75B 5EZLA 2FO8A 1QBMH 2NXZD 1G9MC 4ONFH 4ZX5A 4QJ5B 4IDJH 4HMCA 4JM2C 5JNYA 1WIOA 2FEDC 4KJYB 1GZPB 5JOPE 5LNDA 4EDXB 2C1OA 1A6ZA 4Z0BL 2XQBL 3D3VA 1JPGB 2CK0L 2VLRD 4NZTL 5KW9L 3KDPB 4DESA 2J8OA 4YDKH 1MJ7L 4MB4A 2EEXA 3RL2A 4YE4L 5FM8A 4Q74A 3U0PB 4MD4A 2AS5M 3V6OE 3FFOA 3IMRA 4Q97A 3OKOB 1CGVA 3RA7L 3JWNH 5AKTA 3FB6A 4QJ4B 1RSYA 2Z7UA 2ITDB 4XWGH 4M3JA 2QTEA 1T2JA 5LDSA 3MRLA 2YD9A 5D8JH 2PCFB 4K7PL 2ED8A 8FABA 1M3IA 2VR7A 4ZUVA 3UGXA 1FNEA 4NCC2 1UG9A 2B5IC 4PRIB 5FW7A 2JKLA 1BAFH 1MPAL 3AT8A 3GZQA 3N50A 4YHYC 2D4DA 1IT9H 1KJ3H 3VFSB 5E2TH 5BV7B 3D52A 5L6YH 1HE7A 1HYSD 1TETL 3ZDXB 1WAPA 3ZO9A 3KS0J 1A3QA 4NQUA 1NUDA 4M6ML 5FYLD 1CFQA 2KDGA 3IDIB 4AK1A 3ARPA 4BYHA 5DRXB 4P23C 2BFGA 1IIIA 3U1PA 4F15B 5IMMB 4JG1L 1XL6A 4HSAC 5E6ID 1E5UI 4Y2LA 2MPAL 3OWEA 1DDHB 5BJTB 1FWXA 4QLRA 3U1SL 1NFDF 4HISA 12E8H 1YRKA 4YX2L 2OXGB 4G7QB 1MCEA 5JIMA 2DKUA 5DSCB 4AKQA 3NOIA 4O5LL 4UTAH 4MMXB 2OMVA 2FT8A 4JFYB 4ZPVA 4E41B 4BRVA 2CO1A 2VAAB 1ET7A 3HG1A 5GGUB 1RFDH 5A7BA 4NWUH 4CGUB 4RLDA 3ECUA 4ZQKB 4MS6A 4M5YL 4JKLA 3L4VA 3KPNB 4IBSA 3FSWA 5F7WC 4OLZH 1C5CH 5ALBL 4KKQA 4FQ2L 5C0RL 2EQDA 3NIFE 1F1DA 1Z3RA 1DVXA 1WTGT 3DX6B 4FJZA 5FHBL 4GG6F 1GJWA 5KBMA 2I7SA 1QFUH 2FL5B 3ZT5A 5KYUB 2VAJA 3QFJD 4LVOB 4DN3H 1KY6A 2CM6A 1NCAL 1WSST 1YEFL 4NZFA 1UD2A 4UCFA 3BT2L 2WBJC 4TSCL 2P24B 3MCYA 1OP3K 1IRAY 3GI8L 1BQHA 3HAEH 3QRLA 2V8MA 1DBMH 4ATWA 1CD9B 2GKIA 4MD0A 4DTGL 1FVEB 1O6VA 3BZEB 2CRYA 4LVHC 1MCSA 1SBSH 4KTEL 4OGZA 3GUTB 1EXHA 2E8ZA 2VE6B 2IV9A 4HUNB 3BZ4B 4XWOC 3NJLA 2UVFA 1NJ9A 2X88A 2F5AL 2JQMA 4FNPA 4ZRGA 2GSGB 3CDYA 4XP6L 1S5HA 3KYKL 5KSAA 2L7UA 3L5WB 1ND0B 1P5VB 3A6BL 2VDKH 5D1XD 3AS0A 3FTXA 4WUUD 5T3XE 2GIYA 3CSGA 1D5ZA 2FJFA 5K33A 5DJ6B 4OJFL 4UUJB 4IYKA 3O6FB 4RMUA 1XGQA 3MJGX 5E1AA 1I7UA 4DO6A 2W9EL 1ZRUA 1OP3H 3OPUA 1S9VB 1MFEL 5JW3L 4DERA 3KL3A 5KVEH 2BINA 2RFXA 2ZOLB 4ZS7H 1A7PH 1JGLH 1F45A 1RCYA 2XI9A 4FFVC 2CDEB 2OYKA 5IROD 2GCYA 3O6MH 4X5RA 1VJSA 4H1LH 1WFJA 3NEOA 2NX5B 3EYVA 4U1JA 5DDHB 1LQSR 2VZUA 2P5WB 4PJIB 5ANME 4I2XA 3THML 4B9FA 1VFAA 1UXSB 2NY3C 3EADA 3RX8A 2HTLC 2IG2L 2YRZA 3CFCH 1A4AA 5LBVA 2ZYSA 1H0DA 1A7BA 1FFNA 3FQRB 5AFAA 4NCDA 3UOAB 4TL4A 2F19L 2ARWA 1U3HB 1ZIAA 3EJYD 2BX5A 4DPRA 5F96L 1QSED 2EVFA 3JYCA 3S3PA 3SBWC 1FFQA 1JDDA 2NYYC 4NQDD 1DBBL 2X4UB 5CN1A 3EZJB 1HXMA 1ZK5A 3UDWC 1PIGA 4JLRB 4KQ3L 4WFED 5E1QA 1JPTH 3IPEA 4AQEA 5IJBC 1ZV9A 4NCC1 1H3GA 4PB9L 4UOW0 1F6AA 3VWKA 2QADD 4XC1L 3D2UD 1DLFL 2FGZA 1M71A 5EOCJ 3H9SA 1RU9L 4MZ2A 5BW7A 4HC1H 3QQDB 1SHMA 3L1OH 2H0JA 4ZMPA 2HJKA 4G80B 1VFBA 3TBWB 3QYMA 3HJEA 5L88H 1O5DT 4F15C 4ZYKA 4AJVA 1R34A 5DI8A 1JGDB 4AXWB 4HJJL 1BVKB 3L7EB 4M43L 1KIUB 1UCTA 2NR6C 4HQQL 1NCCL 3TBSB 4ZX6A 4B27A 1NCDH 1BVNP 2BLFA 3VXMB 3US9A 2GPZA 4I1RA 1N26A 1KLGB 3NRPA 3VYNA 1WQVT 3TJHC 1N8OE 3VJ6B 4EMZA 4NWTH 4WY7H 1JUFA 4XPAL 4ZDHA 1AD9A 1AXIB 5A2IH 1RZFL 5D70H 3VU2A 2B59A 3O0RH 3CZGA 4JJHA 4LPWA 3PREA 1AC6A 4ORGA 4NM4H 2QQLL 4QYAA 1E28B 3ZXAC 3BAEL 3KPSE 2IADB 3A47A 3SDAB 1SXBA 4NP4H 1CD1B 2Y2WA 3BVNA 3NYKA 4YO0A 1HXYB 3WFZA 4CVWA 5I1DB 6FABL 3WNNA 3QT2A 4IEFB 2DLFL 1ADQH 1EQWA 2EDOA 3V5HA 1DFBH 3ARDA 2AABL 4RMQA 5E8EB 2W0PA 2IDUA 2GIMA 1TTFA 4TN9A 5IB5A 5GSRA 2K6ZA 4N2HA 4NNYB 2HKHL 3O8XB 4KK9D 2Z1KA 1NFDA 1MHHA 4BXSV 2VLRE 4F2EA 3EF7A 5C0AA 2YN5A 4L8CB 3DGGA 1R24A 1NLBH 2YMXH 1YEJH 2DIJA 3GXIA 3PJSA 5F89A 1Z9MA 3PGCA 3G5ZB 4ELME 3F5WA 3O2WL 1QATA 3UTSB 2HWZH 3HI1B 3N55A 2X4RA 4BH8A 2E7DA 3IXAB 3JVGC 4XN4A 3ZSSA 1TJIL 3STZB 4JQIL 4JM4H 3ZTEA 1CGXA 4GG6A 1MHCA 3FH5A 5GRUL 2DDQH 2D3JA 1BBDH 1Z9NA 1KCVH 3D4CA 4JB9H 4JFZH 4TVPH 1PU0A 3DJTA 3FFCB 4A67A 3FJTA 2VSMB 3LQZB 4XOBA 3O6FC 3QA3B 2OMTA 4KK6C 3VXSB 4MA8L 2MKWA 3ZKSD 5I19L 1X4YA 5I1JH 3F05A 1C5BL 3EBIA 5DHDA 3VMNA 5JXEA 3MXVH 1OAZH 2B14A 5FYLE 5L2JA 3CN1A 3AG4B 5EF1A 1JNLL 1ZTXH 2WXRA 2D03L 2RCSH 4EZMA 5K9QI 3AB0B 1LE9B 2Y69B 4Z95L 3MMEA 2NT1A 4X98B 4PD4J 3PXJA 5DJ0B 1RZ7L 1WEJH 1DQQB 2KZWA 3EG9A 1AI1H 3O2DA 2BVOB 3AFLA 5CIPB 3TJPA 1FZMA 1U3HC 5C0JB 4Z0XB 3IPFA 1ZT1A 1E3XA 2Q1EA 4KY1H 4OD2A 2G60H 3LNFA 3DOSB 4CC1A 4XPTL 3VFWB 1XSKA 5CD5D 3GBML 1XF2A 1E5ZA 1JHLL 3MBWA 1KPVA 2K3HA 3RBGA 1HHJA 4A55A 4ERSH 5CGMA 2JV6A 3CFEB 2HUEA 5CSZB 1OCCB 3GO1L 1INEL 1VENA 2K7QA 2X2JA 1I8KB 5IFHL 1ACYH 4NYLB 4JR9H 3I6SA 1LLAA 2MTAA 5FCSH 2XT1B 3UFIA 2FAUA 4E9SA 3GDBA 4Z77B 1U58B 5C0IA 1XIWA 2KBGA 2R0ZL 3C60A 3DVIA 2DJUA 1MY5A 3QFJE 3T0ED 4AX3A 1NOFA 2GSIA 2RQEA 2GJZA 1WISA 1VZGA 1FPTL 3IDGA 2P44B 1XR8A 1C08A 2PR4H 3KNBA 5BPPA 1Q90A 3BD5A 1MRDL 1YEIH 4X42A 4TUUA 5FUZL 4E2OA 4UM9D 4LRIC 4HIXL 1Y6NR 3MOBL 1UYWL 4Z7NB 3EYSL 4HFUL 3WU1A 3VD9A 2P8MA 5CEYA 2XU9A 2W0KA 5DRZA 1OAUH 1RVFL 2R2HA 1A3ZA 3LNGA 3QJZA 2NSXA 2Z34A 4MMYB 2SEBB 1UJ3B 1TJGH 3MJ7B 5D1XE 1UJTA 2FTAA 4WUUE 4ZMLA 3O2DL 1MW1A 1I1FB 1D6VH 3TO4A 5A16A 4N3UA 4HETA 5SWZB 3LZPA 1P4BH 1ZHKA 5ETUA 4K9EC 1OTTD 4MQ7B 1AZBA 4S2SA 1KLFA 3O8XC 3FYEB 1FIGH 2JELL 4HKJB 1JCKA 2XJKA 4ZFOB 1KT2B 2BP8A 1EZVY 4B3VA 3QIWA 4LDLB 2W5PA 2WWNA 4UNTA 1X5JA 4AZ8A 4ZO6A 4H40A 3VGDA 1SOKA 4UDUB 2Q0ZX 3E1ZA 1T3FA 2VDRB 3M88A 1DL7L 1ZLSL 2B0SL 1QFHA 3MCLH 4Q2ZB 3TT3L 4L8SB 3KL0A 4U6VL 4UOZA 2Y36H 1HFUA 4KFZC 2PXYA 3Q48A 3TPUA 3Q6GH 1FNAA 1A6VH 1Q8MA 1XB6A 4K3JL 4J3TA 5AB2A 2J12B 2X9YA 4JG0L 1QSEE 1E9PA 3IU4L 4QGTA 4LPYA 1HL8A 3K91A 4N0FA 4NQDE 1P4IH 3MRJB 4IGBB 4NQQA 5F7KC 5LQBH 2O30A 1ZVSB 4WFEE 3QEHA 5J1SC 4IKKA 1TMCB 2F74A 1CFNB 4DGUA 1I8MA 5H37A 3RFRA 1U93B 2IH9A 4FEIA 1OPGH 3ETTA 3DRQB 4WWPA 1ODUA 3CBRA 4DVRH 3WIIL 1A6AA 2FO4A 2P8LB 2AC0A 1U9KA 3LPOA 2VABB 5K93A 2X4TA 1TTAA 1OGTB 2WYZA 1K2DA 3GBNL 2CDFA 3TASA 4TOYH 1FL3B 5F1KC 3V0FA 1HWHB 2AJXH 1XH3A 2VR8A 4I85A 3AAZA 1CLVA 5T1JA 2ALAA 4GXFA 1DBJH 2N7AA 3N40F 2XZZA 2BZDA 5HI4C 1YC7A 1ZXKA 3W38A 2BSTA 4G6ML 1J86A 3DK2A 4JRXB 4JY4B 1KSRA 3HAEB 5MEPB 4AQ1B 1XH0A 2FYVA 5ALCL 5F9JB 1TENA 3SKMB 2DMHA 1ITCA 3MHZA 1B6DA 1P6AB 1QPXA 4DP9X 2IPTL 1I8IA 2YD2A 4GIPD 2XQYK 1OP5K 2NNAB 1LXMA 2R0KL 4L1HA 3QZLA 2WSDA 4PRBA 1BF8A 1COBA 3KYOB 4MMZA 2EUWA 3ARSA 4AIZA 5B7EA 4S1RH 5LWYH 1X6NA 5EU7C 1G7JA 2YN3A 4GNKB 5E2VH 3LRMA 4MQXD 2EO1A 3OLEA 4JREB 1H3VA 4NSKA 4ZNCD 1V5JA 5FC9A 4NC1C 5IWLA 3BXNB 4EZLA 2ICWB 4C83A 4EQ3A 1RI8A 3CQQA 3ZYIA 4PCTA 1PCSA 4AUUA 4Z0BH 2XQBH 3D4ZA 3NESA 2CK0H 4H1LB 4LCWB 4NZTH 5KW9H 4M7KL 2P45B 3L9RB 2JCCF 3D69A 4XNDA 1MJ7H 1ZSDA 1TFPA 3FSVA 4YE4H 1WZMA 1NAKL 3IEAA 4K15A 3FUNA 3JWNC 3TO2B 3GC3A 1CQKA 2ZOTA 4RGND 1LEIA 2GJJA 1U8JA 3RA7H 2VM3A 3JWNG 1UWYA 2VOTA 1OZUA 4X9YA 4PGCB 5LDUA 4Z7VB 4Z3GA 3Q5OA 5AKSA 2G0LA 2LU4A 1UJ3C 3QWQB 5CU9A 4GIAA 1RUPL 1FL5B 3FN0L 1H8NA 1NICA 5JIHA 2GJ6B 5I1CL 3B2PA 4R7DA 5CP7B 1E4WL 4XGZA 2Q8AH 3HCVA 4KI5C 4OZ4B 4XB7A 3SDCD 5JZ7C 2FEEI 5DC0A 1MPAH 2B16A 3SKNA 1NANI 3N43B 4D9LL 1G4MA 2LVEA 3SBPA 3O4LA 4EXPX 4XNQB 1F11B 2ARJB 3MRMA 4JFVA 3KYMA 2FZ3A 2NYZA 4PBXA 2WO2B 1TETH 1SM3L 1PKQA 1AGCB 2M1KA 5MERA 2ZWKA 4M6MH 3ZYZA 1BFOB 2E7CA 3JZ7A 2EKSA 1MQ8A 5D4HA 3HZMA 3T0AA 4HIIA 3ARFA 4DFHA 4L8SC 5I75C 4JG1H 2X9WA 1E4KA 2AQRA 2MPAH 3BLBA 2BSBA 2PW1A 1KBKA 4R5TA 3U1SH 1MLBB 1L4IA 2HFFA 5F0LB 1AQDA 4YX2H 2YK1H 4JQVA 4WK0B 3KBPA 5IB1B 1FLRL 1YHPA 4FQXD 1EUUA 5I16B 2O93L 4RIRA 4ZOCA 1QABA 3KGTA 3IVKA 1EXUA 1MN4A 4BGDA 5I6LA 4P4KC 3LD8B 4M5YH 5IR1B 5E24E 3LN5B 3B9AA 4POYA 3VGBA 5DF0A 3DA0A 4MNGE 5ALBH 2BOLA 5C0RH 2PKDA 4FQ2H 1WBXA 4F7EB 4RSVA 1MH5B 3L45A 3T0EE 3IMBA 3JSSA 5DJYA 5FHBH 2HH0L 3OXRB 4DGWC 3MLWL 1GVIA 3NA4A 4N26A 1ZMYA 2P1YA 2KQNA 3P9LA 5A6LA 1T7ZA 4G6KL 3CFJB 1NCAH 3BMWA 3F04A 4XVOA 1IGYB 1OW0C 4N86A 1QNIA 1GZHC 1R9FA 3MRIA 1IGJB 3BT2H 1KGJA 3EO0B 1JVKA 2CE6A 4G7VL 4AQ1C 2R56L 3M1BA 5DJ8B 3J2PA 4GOSA 3HAEG 1A14L 3FN3A 4G7RB 3DJRA 4U6YB 5BZWB 7TAAA 3E38A 4DTGH 5GS2D 3CZLA 1D5BB 4KTEH 2E4FA 1MCDA 1BF5A 3G5XA 1VFUA 5G55A 1XTLA 1W16A 4PRNB 4G8EA 4Z7UE 3ARBB 2F5AH 3U36B 4NAJA 1C16B 3V4PA 5C0ND 4XP6H 4Y5VA 3KYKH 3NQIA 1ZHLB 2ENQA 1IC1A 1XEUA 2H1LM 3P3TA 4RFEB 3I9AA 3VFVB 2BZCA 1V7ML 3VXRB 2QPUA 2KERA 2NOYA 2YGQA 3MV11 4KNTA 4O4YH 4AYFB 4F92B 1NCHA 4JREC 2KI6A 2EKJA 3BP6A 4NN7B 2HT2D 1DEEA 2PTUA 2W9EH 1FJ1A 4QHLB 1MFEH 2H41A 5JW3H 5IHBA 5F0MB 3RWHA 4F93B 4TUOA 2P49B 4NQTA 2RB8A 1EHXA 4AYDC 5HYSB 3R0NA 2FIKA 3EYUL 4CSSA 4BFKA 3KPQB 1U8KA 5EC1A 4PM1A 5I1AB 1U91A 1UT1A 5DRWA 2MCG1 1LVEA 4M5TA 2WQRA 3IU3B 2LLNA 1TEFA 1FHNA 3JV6A 1DSYA 1I8LC 1TJHL 2IG2H 1KLUA 1NDMA 3RGVA 3DURA 4G72B 1HDMA 3I85A 4JFPA 3LIZA 1K8DA 1NCGA 4PJGF 1HNYA 1QHPA 2F19H 4X7DC 4N8UA 4HOWA 1IAII 1B4TA 4FMVA 1A7OL 4N0UA 5F96H 2M8XA 3IE4A 4QKTA 2SODB 2ZD0A 1RXLA 4QTHB 3SJVA 1DBBH 3U0TA 4YHKL 4GUQA 3U7AA 1ML0A 5DQJB 4XMPH 2GYSA 3ME0A 4PB9H 3LRLA 2JCCA 5I8OL 2C3VB 2VXSL 4XC1H 2VQ1A 1DLFH 1RU9H 2PPCA 2ATAA 2Y1VA 4M1CD 1E6JL 2XVBA 2BM3A 4HHAA 3BQVA 4IOIA 3U4EB 3VGAB 4FADA 4AT6B 4RETB 4AH2B 2EDLA 3TF4A 1UB5A 4GQQA 4H26A 1RULH 5B39A 3LHAA 1PX3A 2R9HC 4PJ7F 4BKTC 1OAKL 4HJJH 5KBDA 4M43H 5D5ME 5IHZA 2MQGA 1NCCH 1XTMA 2DL9A 4YDLB 2A6IB 4P2YA 3WKYA 5F7EL 4A38A 1YMMB 4R7NB 5GGRY 2O6DA 2QQQA 5FIEA 1WC7B 5DEJA 4XPAH 4LCYB 1RZFH 4DK5A 2F7QA 5DRNA 2YAOA 4DPAX 1JHTA 1WFMA 2PPFA 4L05A 2B3IA 5GRVK 4KKAD 4GLRI 2HT4C 2QQLH 2VZ3A 4IRJD 3BAEH 2FQEA 2XWCA 3V8CA 4XODA 3LD8C 6FABH 2ZX8A 4J3SA 1IM3A 4NO2B 3UTTA 1ZLVK 5IY5B 4ZTEA 1HINL 2DLFH 3CUPA 2KS0A 1CIUA 3O45B 2AABH 1XF3B 3QIUC 1PNDA 3NABL 3LH2L 3G04A 4M61A 4HEMA 2C5DC 2HKHH 3FAWA 1QRNA 3X12A 3SE9L 1AR1D 3BD3A 4QRRD 4AE0A 4X0KA 2J5WA 1GPOL 1PW3A 1IGCL 4HK0B 3GZKA 4JDZA 1R4XA 5IP4A 2Q10A 4NQXB 4ISVA 5C7ZA 4Z7QB 4RGNE 1JXKA 5GZOC 4KKLD 3DPBB 3O2WH 1OVZA 1P0SE 1I75A 2XA3A 3OD3A 3SKUD 2ESVA 4MAYB 2FUQA 4XAKD 3UEZA 2I60L 1WHPA 4X7EC 2YD3A 3ARBC 1ZS8A 3CTTA 5IJDC 1A4KA 5ES4B 1TJIH 4BCZA 4JQIH 1NFIB 4YFLI 3BW9A 4I3GA 4H0LC 5GRUH 4GRWB 4F5CA 4OLYL 1UVQB 3LXUX 1LP9B 3I3EA 2XICA 3T65B 2H47C 1MG3C 2RTTA 4NN7C 3D39A 3IKCA 5I17B 3BWZA 4YPGB 1EEZA 1ZA6B 4MA8H 5I19H 4B97A 1T6BX 3BH8B 3VXTB 1K8IB 1FFTB 2CK2A 1C5BH 5M95B 5IJCC 3D34A 3FB5B 3Q5YA 2UY7A 1N59B 2NUTB 4UQCA 3FO9B 1GMIA 1JNLH 5CEXB 5HYSG 3OQ3B 1INDL 3B8SA 5GSVA 3R1GL 1LEKA 4R4ND 3PGFH 5HVWA 4Z95H 1S9WA 4G6FB 2XTJB 1HQ4B 2FEEL 2QGBA 1GYVA 1RZ7H 5DHYB 2EDMA 2FQDA 5BVPL 3RTQA 2AQQA 3IAPA 4OFDA 1CICB 1P2CA 4KJPC 4ZW5A 5FECA 4YAQA 2Y6TE 1QP1A 2HYMA 4XPTH 3GBMH 5EUOF 1JHLH 4B9ZA 4W4NA 3F62A 5DMYA 4FDWA 3GIVB 4HF5L 5IEHA 3BRFA 2QEJA 2WZAA 3PWPD 3V95A 3EYQC 3VGHA 3CHOA 1BD2B 4MCMA 4KXAA 2AZAA 4M8QA 4XP4L 4Y2NA 3T3PF 3WFCL 4KZEL 4KRNA 4CADB 4LHUA 5IFHH 4N9GB 2Y07L 3C6LB 3MLVL 2BNQD 5E00A 5I1GL 4XRCB 4K7FB 5CLWA 1AIZA 4J6IA 1VACA 2GG1A 1V54B 2WBXA 4GW1A 4PG9A 2D73A 3SOTA 2ILLA 1ZWIB 5I24A 1F8TL 5KSBF 4E68A 3RUGF 2H0FA 1HT6A 4LOFA 4PJGA 3M46A 3WEOA 3L3KA 1FYHB 1FPTH 3APDA 4N2AA 1Q9OA 5AOJA 3QJFB 4S1QL 4QRPA 5B4MD 3GMNA 4MDJA 4WO4B 1SJEB 2YO3A 4WHDA 1BZ7A 1MRDH 3QORA 4Z78B 4QHKJ 4OKDA 1IIKA 3HKZA 2EDXA 5FUZH 3BOVA 3PNWB 4Q6IA 3PAUA 3QH3B 4HIXH 4A39A 5I74B 2UWEB 3MOBH 1UYWH 3Q9PA 5CBEB 3PV6A 3ESMA 3EYSH 4HFUH 4I0CC 4OZIB 3G6JF 1T1YA 5CSGA 2DWXA 2VXVL 2AAVA 1RVFH 3LYRA 3NN8B 3QDMB 5ABAA 4Z76A 4OM1L 2AQ1A 4KJWC 3AXLB 3O2DH 4Y1SA 5I9QC 3L3OB 3ESOA 2VUKA 2Y72A 4DKFL 1NBYB 1Z0NA 4PJ7A 3I75A 4Y1AA 4YBHA 3VFOA 4NLAA 5B38A 3BWUC 3VTMA 3DRTA 3PXLA 5IQMA 4ZXBB 5IQLA 4R5VA 2QZQA 4OLVL 2X2HA 4K8RL 3O3DA 1DO5A 4L37B 1MSPA 4MZRA 1JK8A 1RPQA 2QMKA 1WS7A 1CVRA 2WBKA 5A3ID 3RZCA 1WUNT 1TU2A 3S5LB 3RDTD 2QPDB 4DZ8A 3FB8B 1KTRL 5EZLB 5ICXB 1DL7H 1WAAF 1BX2A 1ZLSH 4DW2L 1A1OA 1YG9A 3TT3H 5JNYB 4U6VH 1M3JA 2YAQA 1CI3M 2I69A 3IRZA 3L16A 2C1OB 2CA4A 1A6ZB 1MI5A 2HP4A 3QNZB 4K3JH 4AL8L 4PJ8D 4JG0H 3LH8A 4U1HB 4AYMC 1KTKE 1CCZA 2YPLD 4IBYA 2EYRA 2FR4A 2PTTA 3MFGB 3RL2B 1MFMA 2HG5A 2FX9L 4K55A 4MD4B 1T5WA 2WKOF 1KCWA 5IG7B 3KD4A 5CZKA 5EBLB 5F93C 3FB6B 3SCMB 2FRGP 2PYEA 1JD7A 1T1WA 4QXUL 3MRLB 2VLKA 5T1KA 3WIIH 8FABB 3HHSA 5D1QC 1BDYA 3DVNA 1Q72L 2XWTA 3E7JA 4ZUVB 5GGVH 1WD8A 1DVFA 5CEZD 2ERJB 5DJCA 4XI5D 1PDKA 1AO7A 1FNEB 2E76C 1UHVA 2QVFB 1IAIL 1JDCA 4NI6A 3F7RA 5KBLA 1H8LA 3L1EA 4P04A 2XTJC 3MA7A 3MQIA 5DVKA 5HJGA 2P5ED 4NQCA 3DX1A 1CICC 1OL0A 2Q7YA 4G8FA 3QEQA 2VN5A 4X7CC 1TQCB 5ALCH 3HB3D 3EXLA 3QS2A 1CFQB 3STLA 2E7HA 3DXAD 4HLZH 5FXCH 1JWSA 2K78A 4IRSB 4FQQA 4JVPA 3MV9A 3SZ6A 2YAMA 2Y3NA 4Q9BA 4ZAKD 2IPTH 3S88L 3SPVB 1J8RA 2R0KH 1GXEA 2X4PA 1XAKA 3L4TA 1YEKL 2GTWB 3C6LC 1IKNC 3HE6C 4AUJA 4JEGB 4LOUC 5C09D 3BDYL 1J48A 2OMVB 3LVEA 1TQTA 4YBLB 2WLYA 3HG1B 1MF2H 4U7SA 5T5NG 4QRRE 3LEXA 1AKJA 1G6VK 1VLXA 3QRFM 1EHAA 4TLTA 5GGTL 5H37H 5EUOA 4JM0A 1LK3L 4WO4C 3BKML 2O72A 1IKFH 5KWYC 1E2VA 3UPAA 2BPBA 4RAUA 2XQYG 3Q8AA 5CS7A 4DSYA 4WU5A 4ELKA 3T5WA 1NAKH 3T6QC 1YNLL 5KS9E 3PWLA 5F7LB 4XAKE 4M03A 4HCFA 1QBBA 1ZLDA 5I74C 5AZUA 4E9TA 2XN0A 3QUZA 1Z3GL 3FU0A 4YXLL 4IK6A 5HI3D 4AC4A 5DZJA 3E3QC 4TTDD 1RUPH 4JZOA 2EICA 3FN0H 3L3OC 2IANA 1QA9A 5I1CH 5KSBA 1EEUA 3RUGA 3WAKA 1D3CA 1E4WH 1KPUA 3VSTA 4Y0GA 4RESB 4LVEA 1X5KA 4MD0B 5CD3A 4URTB 4M29A 4M93B 1DVYA 4D9LH 4ZXBC 4N24A 3X11A 1LYQA 2W07A 5IUSA 3TONA 4DO4A 4WNSA 2VZOA 1KUMA 3X3GL 1L9NA 1S5HB 1XWVA 2EINB 4FJ6A 5KSAB 5K9KA 1SM3H 5AD0A 2ZXEB 3FHQA 2JH2A 1ZV5A 2WXHA 2FJFB 3S5LG 5KBPA 5EBGA 4JE4B 1UB6A 3G6JA 4JQXC 4BFNA 4Z7AA 2MNWA 2QV2A 1BREA 4G6JL 1XGQB 2UZPA 5E1AB 1I7UB 4AEEA 1TQUA 1O7VA 3S48A 1N18A 3HC0A 2RFXB 3H53A 4IMLA 3QYCA 4U05A 3HBQA 4U3XA 1Z32X 1PNCA 5B1BB 1JNHA 5JOFA 4I0PB 1FA4A 1FLRH 1WHOA 3EYVB 4U1JB 3HW7A 3GT6A 1UFGA 3PWPE 5HVFB 4I2XB 4OZHB 1VFAB 3SCMC 4M1DL 4LMQI 1EWHA 5TQ0L 5CZXD 1FFNB 2BNQE 2B9BA 4GRLA 3BLKA 4RNRA 1JGEA 1WAAA 1PD6A 5TDNA 3GBEA 2HH0H 5L4IA 3MLWH 1OT2A 1HXMB 4OQTA 1X5XA 4G6KH 1M1SA 1IAKA 4AQEB 3QJOA 3FUKA 3PNRB 1JNJA 2IOIA 2CUHA 1F6AB 1CT8A 3E1F1 2E86A 3F8UB 3L1FA 4JO8A 1AS8A 1OCWL 3VWKB 1P84K 3H9SB 4UQ9A 1TQCC 5KSVA 2R56H 1I1YA 4KWUA 2WKOA 2HJKB 1VFBB 4IRSC 4OFQA 2YAEA 3R7RA 1EFQA 4N1EA 3AY4A 3EF4A 4NAQA 3TBVA 4ZYKB 3HS8A 1TG8A 5DI8B 1J8HA 5HHVL 2VXQA 4I13B 3UIYA 1QFWM 4RA0C 4APQD 3PWJA 4JFDA 3D3VD 1Y1DA 4P4RA 4X99A 1XFPA 4B95C 1QUNB 5FYJU 5B3SB 1JUFB 3BQUC 4ZDHB 3QDGD 1I1CA 5DLLA 5L8KB 1U8OA 1EJ6A 2B59B 4YBLC 4ORGB 3QUKA 1VPOL 1YNKL 2WLLA 3SGKC 4PBDA 4TYUA 1OK0A 4NUGL 4G7SB 4EDWL 3OWRA 4YO0B 3BVNB 3C6EA 2DBLL 3GSWA 3GMPA 5SV4A 5EU3A 1N0XL 3ARED 4FOMA 3PF2A 4Y4HD 1E8WA 1FVDA 2FECI 1OM9A 2OR8A 3ARDB 2CJ3A 4H7VA 4KITB 4HUWA 1TSRA 3NP4A 3NVQA 3SDXF 2BIMA 5IB5B 1G9NL 5GSRB 1Y07A 3U7WL 1TJHH 5D7JD 1L0QA 4GXVL 4G9DA 1NFDB 1MHHB 3FK3A 4J6RL 4HUXA 5AVTB 4B5EA 5D2LE 4X4XA 1USZA 4ODBD 3VWJA 3CN3A 5I8KL 2YPLE 1P9MA 1R24B 3R18A 1U4EA 3KCPA 1A7OH 4LLYA 3PJSB 5F89B 5F7YC 2HAZA 2ZXAA 3PGCB 1LD9A 1ZVYA 3RFZA 3F5WB 4YHKH 5DZLA 2J1ZA 4U1MA 3ILEA 1BQHG 5MI0C 4M93C 3OMZA 2X4RB 4BH8B 2EIJB 2D3LA 4ANXA 1WBZA 5GGSA 5I8OH 4C59B 1SOXA 2FGWL 2NW2A 2VXSH 4FFZA 2VXQL 2IWEA 3V4PH 5CEZE 1E6JH 1MHCB 2XIIA 4LB8A 3HMXA 4DETA 2OS7A 1BF2A 3QNYA 1NL0H 1W8OA 3MRRA 1D9KA 4PS8A 1BVNT 2XTSA 1A0QL 1KBVA 4EF3A 2R29A 3Q06A 1OAKH 2P5EE 3L2NA 4DIXA 3T04D 3FDWA 1I1AA 5F7EH 4ZZFA 4PWEA 3ISYA 5GJTL 1W72L 4B96A 1TFHA 5L2JB 3DXAE 4FLSA 3FTUA 3KGRA 4I0PC 3DBXA 3HKFA 4PG2A 1TZ8A 2H3NA 2MNUA 2AITA 3BO8A 5D6CA 5GS3A 3MMEB 2JKWA 2ZAIA 3BAYA 3EO1A 4CN1A 4JFED 1QHQA 4PJFF 1D7DA 1OV8A 2R15A 4BFEA 2PR9A 4Y88A 1LP9E 4HAKA 4B60A 1HINH 3GSNA 1FZMB 4N0CD 5C09E 1ZT1B 4F7PB 5A40E 4P5RA 3NABH 4U6TA 3KVDD 4BFOA 1OE3A 4AQ8A 3LH2H 1KJMA 1KPVB 5CZRA 3QDJA 5AKVA 1HHJB 4MJIA 1Y0LA 2YS4A 4M62L 3TXAA 3SE9H 2ZCZA 4FKEA 1FG2B 4OCRL 2CWRA 1PEZA 3O0LA 3KYAA 3VWKC 3ZHLA 3E8UL 1GPOH 3OMNB 1ZEAL 3GINA 1IGCH 5BW7C 3C9NB 4PI0A 1X44A 5M7QA 1VCAA 5H8DA 1MZYA 5DQ9A 4MS8D 2AQPA 1XIWB 2YEQA 3C60B 3MR9A 3CZNA 3RX7A 3FU9A 4FFWC 3LKSB 3HMXL 2GSIB 1XQ4A 2I60H 2OK0L 3X3FL 2YGVA 5E6ZA 2JNZA 1U2HA 2YD1A 3FTVA 3IDGB 5KN5B 3CVCA 3ZT6A 3HEIB 5I6XB 3QYNA 3CE1A 5ICZB 3BX7C 3WYRA 3QXVA 2HMIC 4OLYH 4CBPA 5F71A 1QQDA 3GD1C 1JPSL 1XL4A 1Z9PA 2CHZA 1CDJA 2AW2A 4MTMA 4FXGA 1FQ9C 4KDTA 2P8MB 5CEYB 5DRZB 4YL4A 3DO4A 3O3AA 5AVZB 1QI5A 1KV7A 2A6KA 4EEEA 3MLUL 3PHSA 1B4JL 3SYOA 4ALAL 5FEBA 4I7ZC 3TO4B 3ETSA 5A16B 1R5IB 3ARDC 4JFFB 5DURB 1ZLEA 2Z0BA 1FDLH 5LAXA 1INDH 5CINL 4MCNA 4I88A 1KBGL 1ROCA 5ETUB 5E8DL 5ISZA 2AJYL 4S2SB 5FOBA 1KLFB 3RRQA 5BVPH 3H56A 1NANH 3V5KA 3ECBA 2LFGA 2BP8B 4NS0A 4YN3A 3AQXA 3EH4B 3QIWB 4FTVD 4UQDA 2X89A 1QSFA 4XN1A 1V05A 4L1TA 3F7VB 1S7VA 1YPZF 4PP2A 2VYRE 4RVBA 2B1HH 4K3GA 4JPSA 2QHLA 1ULVA 1KB5A 1T3FB 3WNKA 2CCWA 1H3WM 4HF5H 4PWGA 1EFXD 2P7TA 4UYPA 3BC9A 5DD0L 3VQMA 2XBTA 2B15A 2PXYB 4HD9A 1J9TA 1PLGL 4XP4H 4KZEH 3WFCH 2X6AA 1KB9K 2Y07H 4HWZA 1PD1A 2VLJD 1E9PB 2C4FU 3D18A 5I0VA 3MLVH 5I1GH 4N0FB 1IFGA 5F3BB 1EEYA 3WGUB 3C6SA 3FT2A 3MA9L 3R0MA 3QEHB 2EXSA 2DLHA 1MJ8L 3OKDA 2F74B 3A22A 1I8MB 4RMSA 5TDPB 2XN9A 3SDDA 3ULVL 5JXEC 4GO8A 2YPVL 2YUWA 4PWJA 4S1QH 3LVTA 4C57C 3VXNB 2J55A 3U4AA 1AFVL 4MXVF 2XX0A 3QXWA 1A6AB 1GCYA 2FO4B 3ZIMA 3WLWD 1CIDA 1NMBL 1UA3A 2X4TB 1K2DB 4AGMA 2VSKB 3IN0A 1XH3B 4KJQC 1NBZB 3AAZB 1F5WA 3D3VE 3V5DA 1N9PA 1T80A 5LJYH 3IDUA 3GTTA 4LFHG 2VXVH 2AJUL 5C0AD 5JXAL 1M6UA 1NEUA 3LS5H 4OM1H 1NPNA 2ZICA 2AQ2A 3LNIA 3ARTA 4M5SA 4IOSA 2HA1A 3QDGE 2X0WA 3FW6A 1I4FA 1FVCA 3BSZA 5I0ZA 1EBAA 3VH8A 5K59E 3A6CL 5DZNA 5DFWH 5GRYA 1UC6A 2I32A 3HOGA 1CXEA 1KB5L 5K1JA 3ZKQD 3QDAA 2NT0A 5CLXA 3GRBA 4OLVH 5ANHA 4K8RH 2Q9OA 5IB2A 3DV4A 4LSVL 2W38A 3DX0A 2OV0A 4AIZB 5DMGD 4NOBA 1G7JB 3VA2C 4DGVL 2NY3D 5J3HC 3EHBD 1ZPUA 2HTLD 4DKEL 4OGQC 4R83A 1XIWC 2E7LC 3C60C 4KQ0A 4Z3EA 1NINA 3MLSL 4DW2H 1QHOA 3CHQA 4NSKB 4PJFA 1YYLL 2YAFA 4H8WL 3MBEA 5FO8B 4C83B 1U8QA 2C7FA 2G30A 3AG2B 3BN9D 3LTVA 5D1ZD 2RA1A 3EFFA 4FNUA 5E8PA 4AL8H 4G42A 2F0CA 5I6XC 2FHBA 5HHQA 4MHHI 4S10A 1I9IL 4R97B 4OV6F 1QYGL 4F9PC 1ZSDB 5B1JA 4ZPTA 2FX9H 4A68A 3T6XA 3LXBA 5IB4A 2FECL 4Q9CA 1LEIB 1U8JB 2YIHA 1YMHA 3B8YA 4AMXA 2CJTA 1CLCA 2A0LD 2CLRB 2WXOA 2QZ5A 1DVZA 3AC0A 3JT0A 5I1KL 1I1RA 4QXUH 1F13A 1SOQA 2DWEA 2WJ7A 5FB8A 1JYNA 1BAWA 1CMOA 1DDTA 3HI5L 3QJRB 4WNJA 4R84A 1Q72H 3TO4C 1T89A 2AJZA 5SX4H 4R7DB 4XGZB 1IAIH 3RDJA 2C1PA 3QG7L 3BSZL 3U46A 1PX4A 4TUJA 3TVMD 5CCKL 1MCOH 1AQKL 1MIEL 1T7WA 2DMBA 3O4LB 4PP1D 3MRMB 2F53D 2F8VA 5FFGA 2HG0A 3KYMB 2FZ3B 3QIWC 4JDVA 4NIYE 5FAAA 3RVUD 3U6XS 3OJMB 1UWXK 1PKQB 4G8GD 4LNRB 1S9YB 2GI7A 4G59C 4P9HL 5F6HJ 5MERB 1E27A 4ZFGL 3NIGF 3OKNA 4HIIB 4KX9A 3CC5A 2H26B 2WTRA 3QBTB 5L7XL 2J1KA 1CFSA 1OAJA 2FWUA 2OMXA 2WCPA 4JFEE 3RKPA 4F57H 3S88H 4B7IA 4G43B 2OZNA 1A6UL 1AJ7L 2X10A 1YEKH 3K8LA 2X9XA 2PW1B 1KENL 5F7DA 2ZJSL 2HFFB 3BGFB 2YBGA 1AQDB 3EO9L 5I0DA 4L29A 3BDYH 1WUZA 2H6PA 3GLDA 5C08D 1LWRA 4OJYA 5TH2A 2QLYA 2OSXA 3ZQWA 5DHXB 3LRHA 1HQRA 4KKNA 4YDZA 4Q8BA 4RIRB 2AXFA 2NZ1A 5I5MA 1BQKA 1NWOA 3GHPA 4HCIA 3TZVC 1EXUB 5FGCE 2WQVA 3CFDA 2FEJA 1Z5YD 5GGTH 1YPZA 5H37G 4EIZC 4PGDB 1LK3H 1Q4NX 1ZIBA 2P43B 3BKMH 3KPRA 1QI3A 3RPKA 3RWDB 5HHXL 2NY5L 2K8MA 1WBXB 3HN8A 1KFAL 1CE1L 2F8OA 2YAHA 4JHUA 1YNLH 5DTFA 5ABDE 4ILDA 3ZTNL 4JHVA 5FLVA 4WNQA 3B43A 2IVFC 3P9LB 3GQFA 2PWFA 4HKZA 4YXLH 1DQKA 4PY8J 5LGYA 5AVXB 3K1DA 4ODWA 1TTRA 1UXWA 2Z92A 3MRIB 1EHLL 1DJYA 1NKRA 4BWUA 5HI5C 3LZNA 2QFRA 1N64L 1FE8L 5INCB 5LG6A 3VACA 3TEZA 3V4LA 3M1BB 3ZTCC 3OMIB 2AJ3A 1J5OL 4W68A 4V1DA 1P7HL 2NXYB 3G5XB 3OQRA 4ZX3A 3NIFF 2Q3XA 4G8EB 3FHAA 2WLJA 1F42A 1RUAL 2F1BA 4HIPA 5AVVB 3X3GH 3V4PB 4Y5VB 1IQWL 4M4PA 3Q6FA 2G4GA 4ODTL 3GKWL 2VB5A 3IYLW 2DYPD 1UEYA 1WFIA 1BAGA 4TPRL 3R8QA 1CK0L 3UC2A 3QJUB 4HHGA 4DHLA 4CL7A 4Y5XA 3WG7B 3BP6B 4G6JH 2Q2LA 5T1LD 2XY1A 1DEEB 5IWLC 3UBHA 1A02N 3C5JB 1G87A 4G9FA 1FJ1B 2Z35A 2YA1A 3EFDL 1OKEA 4FTVE 5ITFA 2Z31A 3RWHB 4TUOB 4CMMA 3K46A 2ICES 2FIKB 1H3UA 4KO9A 1CWVA 1U8KB 3DJ9A 4R97C 1U91B 2ICEC 4JRYA 5DRWB 5EC1B 5FUCE 3REWA 2C9PA 2BSCA 2VITA 3OF6A 1V3JA 3GXTA 3FUMA 3HBGA 5D55A 4QOKD 1A7QL 5K9QG 1J1XL 3DO7A 2DTML 3JV6B 4KXDA 2R4RH 4EKJA 1KLUB 1NDMB 3DTXB 1FH5L 3RGVB 3CSTA 3DURB 2VLJE 5TQ0H 4JFPB 1K8DB 2AK4A 4OZFH 2CDGB 1I9JL 1VEPA 1JCVA 1OSZA 4N0UB 4ZTPL 4CN6A 1R3IH 2O5ZL 1KTBA 2FLBT 3FUFA 4X7TA 5DJ2A 3SJVB 1P53A 4DPBX 3SPHA 3U0TB 4CC4C 1OWRM 4PJEE 5AL0A 2KZ1B 4BFBD 3B9VA 3P77B 4BCXA 4DO5A 3ME0B 2YQ3A 2QT6A 2JCCB 2V8LA 1OCWH 3W57A 2VQ1B 4FULA 1AQ8A 2IOOA 3TBTA 4WHCA 1ZPLA 4IOIB 1BW8A 1QFPA 1BQSA 4WO0A 3Q8CA 3C09B 1UB5B 4KRLB 5A2KH 4H26B 4LESA 5B39B 4JGJA 1NFDE 1P7QA 2VW6A 2I27N 5HHVH 3VA6A 5C0AE 4R7LA 4PV8A 4OTXL 1E4KC 1WA1X 2WD0A 2FSDA 4AOFA 5B8CA 1CUOA 5DHMC 2BY0A 1GMEA 2BRRL 3GSUA 5B1AB 3BGFC 1HL4A 3DECA 1UTDA 5KOVC 2A6JA 3GZPA 1TZOA 1M7IA 3S8GB 1JOIA 5DRNB 1JHTB 4L23A 2JJUA 1U3ZA 1JTPA 4Y9CA 2Z4QA 4XOAA 1YNKH 1H5BC 3U48A 1A9BA 2EDQA 4NUGH 4EDWH 4GG6E 1KWGA 3FQNA 2DBLH 4Y19B 1IM3B 2WQSA 3MRCA 3UTTB 4N5ED 3CUPB 1N0XH 4AJ0A 5GZND 5ECGA 4S1DC 5KVGE 1IBGL 2G3NA 3RQ3A 4M61B 1G9NH 3U7WH 5FF6A 4UOQA 4GXVH 1QRNB 4Q0XL 4JRLA 3X12B 5GGQL 2Q7NA 1G6RA 2WVVA 2ZNWA 3O3BA 2R2EA 1F4WL 4HAGA 4YLBA 5AW4B 3SZKC 4AJWA 1S4IA 3Q43A 4JDZB 1TQSA 2GY7B 3ZSTA 2ITEA 5F3HB 5J57B 4ISVB 4W6YB 4EUPA 6TAAA 3ARFD 1KIRA 4NQSA 2ESVB 4RAVA 5F7BA 4NUJA 2NXYC 3RWFA 1KN2H 1UZ6E 3N41B 1ZS8B 2IXQA 2X2YA 3RY6A 4FG6D 1A4KB 1T0MA 2F9BT 4Y5VC 2FGWH 2VXQH 3QNXA 4HFWB 1BMZA 3BW9B 1O9VA 5CKGA 5IMLA 5KVFE 2IF7A 2DM3A 5DHVH 1H19A 2YXVA 1F3JB 3MNDA 1WFNA 2ZYRA 3GBLA 5F8QC 1OM3H 1A0QH 3D39B 3IKCB 1OZTG 3HZ3A 3V4VL 4J3OD 1EEZB 1JF1A 1AGBA 1U8LA 1YECH 3C2SA 2AQNA 4WW2F 4ELMF 2K9FB 4GW5A 2ZF9A 2UY7B 5GJTH 1W72H 2HVJA 1NBVL 4XO5A 2ATKA 1URIA 4UTBA 4LEEA 2EECA 4LLUA 4BELD 3IMVA 2WVTA 4OLUL 3CFMA 4PRHD 2A38A 5GSVB 4AUYA 4XZUA 1LEKB 3QE5A 1A9VA 1S9WB 4OW6A 3RTQB 3RWJA 5FV1L 2WVSA 4AGNA 1P2CB 5FECB 4YAQB 2HT3C 3BWSA 3GUFA 4JY6A 4OIIL 5C08E 4MZ3A 3UP1A 1MOEA 2RALA 1ADWA 1RHFA 2X4NA 2CIIB 2WXGA 1GJIA 1KXVA 3V0EA 1SYSA 4FGMA 4I48B 4FQ1L 3WKMH 1HJBC 5IEHB 1U33A 2QR0A 4W9ZA 4PWKA 4M62H 2QHRL 3EJQA 5HYJA 1PZAA 3HN5A 3NA9L 1F1GA 4OCRH 4HUUA 2V9UA 4M8QB 2BVQB 1JZDC 5SWQA 5FGRA 3B83A 5JQHC 1ZEAH 4AGOA 4LHUB 5B7MA 1S3KH 4NM8L 3IDJA 2W88A 1FUNA 5E00B 3S5ZA 1TZHA 2X4OA 3C09C 1CDYA 2V37A 1VACB 5KYXA 4PG9B 4GW1B 1VIWA 2YBRB 1I3UA 4XAWL 1BQUA 2VZTA 3HMXH 1EA9C 5CR8A 4CVZA 2VMEA 5HJDA 5B39G 1IJNA 4PJGB 3X3FH 2OK0H 3MPCA 3L3KB 4L5FE 1BLIA 1Q9OB 2VMDA 4PBVC 1GW6A 1MUJA 2WY3B 4QRPB 4BE6A 5H4YA 1L3WA 3EDDA 3AQDA 3GMNB 4MDJB 3CFIC 4PGZA 3KGUA 4QRQA 4W93A 3V0WL 1BZ7B 5IEKA 3OM3B 4XXCA 1KCUL 1JPSH 3KJ6L 4Q6IB 2BS8A 2ZX7A 5LBGA 2BY2A 3PV6B 5ANMA 1FHGA 3RGVD 2NPLX 3T4YA 3NRFA 3CLEL 1UD8A 3UZQA 2H2SD 1T1YB 1VCBC 4ZUWA 4BJLA 2ZXGA 5K1NA 4A2FA 4ES8A 3LXAA 1ORSA 3MLUH 3OZKA 4A37A 1B4JH 5H2BA 3GJFH 1D7CA 2Z7ZA 4L3CA 1MAML 4ALAH 3WTWA 4U3HA 5KUMA 2CCLA 5CINH 3I75B 4Y1AB 4CSZA 2VDQL 3VFOB 4YJZL 1HTYA 4JO2L 4DP1X 1BWWA 5J11B 2YJQA 3DRTB 2KUTA 5E8DH 2AJYH 3P2DA 3Q2CA 1T1ZA 3HLAA 2ZOKA 5FKPA 3DX3A 1MCHA 5BRZD 4XMWA 2P80A 3PWNA 3GHBL 1JK8B 4XB8A 3ULSA 1T0NA 4P5SA 1A7RL 1TU2B 1YAIA 4KKBD 1JZHA 1U4FA 1UADC 4QOKE 4P4KD 3HZVA 1U36A 2MQ0A 1BX2B 2LR4A 5DMKA 5FS5A 3LZLA 5LCVL 5IV2B 2LABA 2FLMA 1PLGH 2H4EA 4LP4A 4GW4A 3KEDA 5I23A 4CN4A 1SEBA 3ZIYA 1I9RL 1J87A 2EYRB 2FR4B 2PTTB 1HKFA 2YEVB 4WFFD 3L1GA 3CBKB 3MA9H 2CUMA 2HG5B 2C7UB 1T5WB 1MJ8H 5BO0D 2WBWB 3EJSA 3DROA 1F58L 2PYEB 3ULVH 3LIUA 2YPVH 1WWAX 1T1WB 3KPSA 1AMYA 1AFVH 2F1AA 5T1KB 3HHSB 4NJAL 3DVNB 2XWTB 1DVFB 4KXZH 1GGTA 5DJCB 5C07D 1PDKB 1AO7B 2DQIL 4LIQE 2AGJH 3OXSA 3W37A 1UOKA 5T5FA 4H8PA 3I9IA 2XVGA 2GFBB 1E8XA 1J12A 5DVOA 1PCXA 3MA7B 5IKCA 3G6DL 3I50L 3SYAA 3RTQC 3GXDA 2AJUH 5JXAH 4NQCB 4MA7L 3EXJA 4NO3A 4R2GB 3WO4C 2Q7YB 3QEQB 5AAWC 2VLRA 4TNWF 4CJ1A 3STLB 3AITA 3P4MA 3LKPA 1JWSB 3CX2A 3MV9B 4K8RC 3T4AA 1ZHBA 4WW2A 4ELMA 1KB5H 1G7PA 2JTYA 1JF5A 1S7TB 3QUMA 4N4YB 2X4PB 2Q87A 4LSVH 3GSXA 3TIDA 4CVXA 1U8MB 4JY5L 5AZ2L 4X6CE 2EADA 4OD3L 4DGVH 4LHUG 5ECJE 3MLSH 4QTIL 4Z7OF 5I8CB 1YYLH 4RGMB 4H8WH 4RGOL 4AL8C 1T4WA 3LEXB 4K94L 1UWEH 1AKJB 1PKQE 3D30A 3NCMA 4J3XA 4DK3A 3NIDE 3QSKB 1ZGLM 2XFGB 4ORZC 1MJJA 2WZ0A 1FAIL 3FT1A 3GDCA 3V6ZA 4DT2A 1I9IH 3E6HA 4RAUB 2ED9A 4W9FC 5EIVA 4YOKA 1SF5A 4WU5B 4ELKB 3C5ZC 4Q6IC 1EX0A 4FN0A 3PL6D 2XN1A 3PWLB 6CGTA 3D07A 1X4XA 3PABA 3T3PB 3L2LA 1JWUA 3QUZB 1MIMH 3ZL1A 4OZFB 2BH0A 3EJJX 4XPBL 5T5FL 4HW6A 4XHQA 3TT1L 2PUQT 3WEAA 1EEQA 1JS4A 3A24A 5DZ9A 5GS0D 5I1KH 3HS0A 3HI5H 4JZOB 3E0GA 4IM8A 1SXSA 5E0FA 3S37X 4EN3B 5IOKA 9PCYA 1JXFA 2PYFA 1QA9B 3TGXA 5KSBB 5KYNA 3RUGB 1B9ZA 1KPUB 1J5DA 1D5XA 3QIBC 5J11C 3HNTL 1A64A 1MJUL 2WNWA 3BSZH 5CD3B 1R1CA 4AKOA 4CRPA 1FNGA 3M7FB 3HZYA 3X11B 4ZQTA 2W07B 5CCKH 5B38G 1MIEH 4NAMA 3KJ4B 5EB9A 2W92A 3QUML 3FF7A 1T4KA 5K9KB 4PRHE 3PDDA 5IVOA 4P9HH 5AD0B 5JIPA 3FH8A 1MXDA 3F7QA 4F7CA 4ZFGH 2GBUA 5L7XH 1W8NA 1UB6B 2DD8L 3G6JB 3KBFA 5H35B 3AS1A 5FYKU 3QFJA 3NCJH 2YAPA 2KDYA 3D0LA 2Y5QA 2DI8A 1DVUA 1A6UH 1AJ7H 1Y6MR 3HC0B 1BHGA 3HA0A 2EO9A 4UQ3A 3VQLA 1KENH 1MLCA 2HB0A 3LMJL 3QORD 3EO9H 4A2MA 5TPWL 2MEJB 1L3NA 5KYYA 1JNHB 3QZBA 2HN7A 3BUDA 3APNA 4I18A 1S7WA 3NCYS 5C9JB 1OQXA 2C4FT 4UZGA 5FYLL 4X50A 1RK1A 2V9RA 4UT7H 1SY6A 1EK3A 2JJSA 1AXSA 3L54A 4JPIA 5IK3A 2WOBA 1NMAL 5DU7A 5FCUH 1AYOA 3BUIA 3V52L 3JV5A 2FSEA 1XCQA 2D3VA 2K1MA 5HHXH 2NY5H 2DM2A 4RNRB 1KFAH 1CE1H 1DVFC 5D1XA 4X5XA 3VG0L 2JIXD 1H3XA 3LQAL 2H3XC 3LPPA 4NQED 5AVYB 3ROLB 3ZTNH 3V0AC 3RGBA 4OUUB 5AUMB 3PV7A 1R3JA 5CGYD 1RV6X 4AV0A 4PSRA 4OI7A 1NKOA 1G1KA 4WWKD 1RSFA 3MCG1 1HKLL 2QGCA 2HLFD 1CT8B 1BZOA 2CAKA 4R2GC 2R39A 5TF1L 4CU7A 3BP7A 3S2AA 4OI8A 5DO2C 3JVFC 3I6KA 3VRLE 1N64H 3RZCD 1IFHL 1FE8H 1HJCA 5KZCD 2Q3AA 5KSVB 4PJ5D 4BKLB 1I1YB 1YY9C 3QS3A 3HFML 3LRSA 3IK2A 1YJDL 1J5OH 2ISDA 4XO3A 1J9CT 1OPOA 1HEJC 4OM0L 3TBVB 1L6PA 3CSFA 4LCVA 3DSFL 1XGTA 1U8CA 1RUAH 1X5ZA 1MI5D 3PWJB 4JFDB 3GM0A 1YEGL 4P4RB 2J8HA 2KT6A 3HVDA 4PN6A 1KTLA 4ODTH 3GKWH 4XBGB 3ZTJG 3AJ7A 4YMPA 1AZZC 1OAXL 4HCRA 4L18A 1QSEA 4ZMNA 5BZXA 4TPRH 1DJZA 5F7NC 4NQDA 4LK4A 5IFJA 3IS1X 3Q1EA 4RGMC 5BRZE 4X4ME 3QUKB 3GGWA 1TO4A 1DN2A 2WLLB 3VI4E 1XF1A 1CLYL 1TYEB 5KVDE 1NFKA 1W72B 3EFDH 3GNML 1SY6L 4KQ4L 4OH2A 1LNUA 2VLKD 3GMPB 3D2UA 3KCWA 1N7ML 1AR2A 1ED3A 1X3DA 3UG3A 1ZDSA 4Z7UF 1FVDB 1QI4A 4TQ8A 5KBNC 1AQHA 1J9RA 2YD8A 2D7TL 4HUWB 1A7QH 1J1XH 2DWYA 3L3GA 4WHTA 2DTMH 3U9WA 4EO5A 4I3RL 4K5PA 3ULAB 4G9DB 1FH5H 1GZQA 1CQYA 3FUJA 3VWJB 2CO7A 2PPDA 4FTDA 5D96B 4HIHB 1AD0A 1I9JH 2W8CA 2ZZUT 3FZUC 4WFFE 3WFEL 2EE3A 4EN3C 3R8BB 3KCPB 4ZTPH 4LLYB 2P42B 1DQML 2O5ZH 1G5AA 1LD9B 1AXTL 5HYEA 3RFZB 4GSRA 4U1MB 2XY2A 2FWSA 3KJ4C 1BFVL 1WBZB 5DVLA 5GGSB 3S4SA 3WLBA 3DARA 2NW2B 4ZMXA 3NACL 2VQUA 5C07E 1MFVA 1JG9A 3RB7A 4U1GB 3CH1A 3QNYB 4LF3A 1SDAB 1UM6L 2WZPA 2X09A 2WAQA 2WB1A 3K2MC 3MRRB 1PD0A 3DI2B 3LN4A 1LWJA 5AYUL 2ICWJ 3CIQA 2B9AA 3EUDA 1SN2A 2V6HA 4OTXH 5E2UL 2HVBA 4WV1A 1I1AB 1XCWA 1L9RA 2E9IA 5F9OL 3PUUA 3AACA 5C0DA 4ODHL 2P5PA 2VDOL 4JZNA 2HFGL 1G7HA 4BKSC 4FFYL 3RVXC 4ABVA 2H3NB 3O41A 4X0NA 3BO8B 2R2BA 4MLIA 4PREB 5D6CB 3EO1B 3QPQC 1K5NA 3PP4L 4F5CE 1X9UA 1NFAA 1U3NA 4IU3A 3UBGA 3GSNB 3JUYA 2IAND 3OG6B 5D5MF 3ZVVA 4BZ1A 2XACC 5TE7L 1G9NC 2VDML 1KJMB 4CJ0A 4XTRC 1IBGH 3ESUF 3O6LL 3QDJB 4XN5A 4YZFF 1TDQA 4MJIB 1ERNA 1Y0LB 2LU7A 4Q0XH 5GGQH 1A5FL 3ELAT 4QDGA 1RZ8B 1DVSA 1F4WH 2COQA 4DUVA 2ZUXA 1PL3A 2JLPA 3DDFA 4F2ME 1MVUB 1OB1A 3MR9B 1NZRA 3IGFA 3S37L 2B4CL 2UYLB 3AY4C 3W56A 2UZIL 1HK6A 3BFQG 5DQDH 3H3KA 5D1QD 2QVMA 3AS3A 1V10A 2X2IA 1QRKA 1XGYH 2DQHL 2CHXA 1PY9A 4U1LA 5BV7L 1T6WA 3B9KD 4O9HL 3TA4D 1QQDB 3QDHA 2OULB 3FFDA 3ZRCC 5JA8B 2ICCA 3G9AB 4LEOA 2Q76A 3V4VH 3RVTD 4HV8A 5E1IA 3M6DA 1KIPA 2J20A 2AV1B 4G2AA 5IBTH 4XO9A 5A7EA 5EEWA 2ZWZA 1YEEL 3O3AB 3DX9B 4L1BA 4GRLD 3UYOD 4ELDA 3MNWA 1NBVH 3REVA 3V0GA 3HPLA 4IBLT 4WK4B 4OLUH 4MNGA 3IMSA 5LAXB 1NCWL 3QULA 5LVEA 4HOXA 1J0KA 4BZ1L 2EVIA 3AGVA 4MBRA 4TSBL 1MDAA 1M57B 5BNXD 5FOBB 5ISZB 3NDYE 4HU8A 3MV8A 1HESA 5JA9A 2V7HA 3RWEA 3SE3A 3VWJC 4MB1A 3P4NA 3ECBB 4A7QA 1FYTD 5D96C 4OIIH 1QSFB 4LOVA 1EAPB 4XO8A 2EC9U 1S7VB 4PP2B 1T2XA 3FCSA 1NQBA 3WTUA 2MNJB 3K5SA 3RFZC 4QXGL 1KB5B 5DMIL 4UM9A 2H6OA 5DJZA 4IRZL 2P7TB 3VXUD 3II1A 1B2YA 1J8HD 1KZQA 2QHRH 2YGNA 3INOA 1UD3A 1BSIA 1T04B 1RPKA 3D0VA 4Z7UA 5T1MB 2UX7A 4HWZB 4NM8H 4PJ7E 3PWVA 4TLKA 3VXQA 4NQEE 3OMAB 3SDXB 4RA3A 4JJ5A 4U1GC 2DI9A 4OFIA 3C6SB 4XAWH 1QNZL 2WNKA 1E9QA 1DANU 2XNAA 2GJRA 3OKDB 3P11L 4ODUB 3BVWA 3KPLA 1AHWC 2EDHA 2PN5A 3BPOB 4UMSA 5EEXA 1I1AC 3QWNA 4LO9A 4UT6A 3G5YA 4AV5A 5DCCA 2C9QA 4P2CG 4PJ5E 3V0WH 2Y1YA 4NO5A 5EEZA 1KCUH 3KJ6H 2G2RA 2V17H 2XXMB 4PG2C 4AENA 1U6AL 3LJ3A 3NP3A 3AGWA 3EH5B 3TWCL 4XP5L 1DJHA 1E67A 32C2A 1ZLWH 1MI5E 2VZSA 2E8YA 3LNDA 1H9DA 3V5DB 4GEJA 4Z3TA 3CLEH 1MCLA 1E8YA 4ALAC 2RAMA 1DJIA 1QOKA 5DYFA 1JVOA 1MAMH 3JTSA 3ZX1A 4K71C 1I4FB 2WW8A 1FVCB 1BLNA 1NWPA 1S8DA 4P3WA 3VH8B 2FE0A 4AQ8C 1MQKL 3APCA 4XH2A 5E4AA 6PCYA 1ACZA 4JO2H 1GJUA 1T22B 4KK8D 2Y23A 2A7BA 3SY6A 4MVBC 2NY1D 1WGOA 2VLKE 3SD5A 2IV8A 1T1XA 5DK0A 3DV4B 4KRPC 1BIHA 5G2NA 5IB2B 3GHBH 2FO1A 1PQZA 4PS3A 2J6EA 1A66A 1PZSA 4YK4B 4Y2OA 1A7RH 2HZHA 2B3RA 3FYIB 3H9YA 4KO7A 5C1MB 1D9KD 2JKTM 3IB4A 3RL1A 3C5SA 4PJFB 1MWAA 3DMMD 1OT4A 2N1KA 1QR4A 5EOTA 3MBEB 5LCVH 3GBDA 1U8QB 4C4BA 4GINA 5D5MA 1CYXA 2CXKA 3Q5TA 5E8PB 4G42B 4WSGA 3SDYL 1PS3A 4N8PA 4BFFA 3VMPA 3CQFA 5HHQB 4L9LA 1P69B 2DKSA 1I9RH 2OI9B 3OB8A 4UT6L 1RQ5A 2QKIA 4PIBA 1GSMA 2DN7A 4PJ9D 4ZPTB 3EDJA 4UANA 3NCWA 3GSOA 4PWHA 2WYIA 3OZLA 3ULVC 5ACLA 2GB2A 1YMHB 3ZR6A 3MLZL 3P30L 2C3GA 3FU6A 4KDTC 1F58H 4D0BA 1R46A 1NIDA 3Q0HA 4ZT1A 4Y9EA 1N6UA 3AG1B 2DWEB 1F02I 4AG4L 5FB8B 3TBBA 2UVEA 3ARXA 1NGPL 2IQ9L 4NJAH 1N0LA 1T7YA 3QO0B 3MKGA 4UAHA 5JTWA 2AJZB 3G08A 1UEMA 2DQIH 4CAGA 3PGDA 2C1PB 3CDGA 4LT7A 4HJIA 2EDYA 3U46B 3FL7A 4TUJB 2EDRA 5KAQF 3ZN6A 1BVLA 3H4FA 3G6DH 5EUOE 2NY2B 3BQUD 4QPEA 2E9BA 2FCBA 4JDVB 4Z3JA 3VW3L 2NQCA 2N3JA 3HUJE 1RH8A 4J2XA 1UOWA 1XO8A 4R7VA 3VFTA 1E27B 3U25A 2NSMA 2WTRB 3CC5B 3F64A 4BSVB 4TNVF 5JW4M 1CFSB 2FLRT 2OMXB 2WXJA 4KROD 5C0CD 2DIEA 4UBDD 4N1HB 4H8HA 3TH2T 3LKOA 4KKPA 5AG9A 2OPCA 2IANE 2C3XA 1MWOA 2KYIA 5AZ2H 1GY2A 3IXTA 2OMYA 5F7DB 4BEIA 4F1ZA 4OD3H 1KYOJ 4L29B 2H6PB 2ZKHL 4H8WC 4KO6A 3IAGC 5TH2B 2AXGA 4JPQA 4QTIH 4GQZA 3MGOA 4WFHD 5I71B 1G7IA 4RGOH 3BI9X 3LV3A 2XWJA 2W91A 4K94H 3BPOC 3HC2A 2IBZY 3CFDB 4U31A 4DH2A 3F65A 3FTYA 4GBXD 4P2RB 4DF9A 1YPZB 1PYWA 1UQSB 3H7BA 4E5XA 1FAIH 3KPRB 2OXHA 4A7UA 5HY9A 3EKCA 1A8ZA 4PJXB 4U1KA 5A6MA 2XSKA 5DTFB 4ZW8A 3UYPA 4WNQB 1YN7A 4WKXA 5D4QA 4P5TA 5D1QE 4KU1A 3ABKB 4HKZB 4KY2A 5AW5B 5T5FH 4XPBH 3TT1H 2YMOA 3PCYA 1ROWA 4BV1A 1UXWB 2JKNA 3QUXD 2VR5A 1J11A 2OTUA 1RZJL 4GUCA 5L2KD 2DQUL 2F7PA 4ZOBA 3LX9A 3U2IA 4YS4A 2AJ3B 5IB3A 1TO5A 3HNTH 1MJUH 2UZYB 2NNXA 2BHUA 2VL5B 3HE7D 3VH8G 5A2FA 3OR6A 4I9XA 1P1VA 1MW2A 1ICTA 5KS9F 4P9HC 3GLZA 3QUMH 3OGOE 3Q6FB 2BWIA 4YK4C 4TULL 5DD3L 4N6QA 2VQTA 5EN2A 2IMMA 4GT0A 4JKKA 1OTSC 3WNOA 4AC2A 4BRJA 3H42L 3LKNA 4MNQD 2DD8H 4Y5XB 4XHJD 5IJVA 3MBEC 2XN9D 3SDDD 1RIVL 3PPSA 1FYTE 4G9FB 2Z35B 4ZOAA 3W11C 4BHUI 3OAZH 4XN7A 4CDGC 5EDSA 4NBYB 2Z31B 5ITFB 2QSCL 2Z0UA 2E46A 4PD4K 4CMMB 3H6AA 3LMJH 1EJOL 2OI9C 4RH4A 5TPWH 2IALA 5DS8A 4XR8C 4YEEA 5D7KD 4X5WA 1QFWL 3REWB 3BAXA 3VXUE 1J8HE 2VITB 4YFDB 5TD4A 1NA8A 3CDFA 3N1GC 5FYLH 5CAYB 2D0GA 3CFNA 1Q0YH 3DO7B 5LUMA 1IEAA 2VDNH 4N6RA 4RZCA 1NMAH 3QZMA 3IF1A 2MHAB 1JZ6A 1G0XA 3RYMA 3VNYA 2NY5C 1WT5A 4H44C 4ETYA 4X9GA 1S3RA 4ABWA 3V52H 3FMGL 2X1WL 3BWAA 5E5MB 1XGRA 2X0UA 4UOJA 5C7XL 5DJXB 1D6EA 1OSZB 3VG0H 3LQAH 5DJ2B 1OGAD 1P4UA 4X7TB 1FZKA 4FFTA 4IHBA 4POZD 4L8BA 2P47B 2CGRL 4R8WH 2J6WA 1HKLH 2NY2C 3RWIA 4B0MM 5TF1H 1KB3A 1LMIA 3MGTA 2R59A 4RMVA 1IFHH 2L04A 3CSYA 3M1CA 1DFXA 5C6WH 1U3YA 3BKJL 4PPTA 3HFMH 1SJXA 1YJDH 4HA1A 3NJGA 1DP0A 1Q0EA 3MV7D 3P9WB 1RZPA 2O6EA 1P7QB 4OGAC 4OM0H 3RY4A 4DOHB 2GUYA 1YCSA 4HD5A 3DSFH 2A83B 2XQ0A 1M7UA 4I77L 4P07A 4PV8B 5AW3B 5B8CB 3SPIA 1YEGH 5IVZB 4FABH 2EXYC 1W8EA 4Z7WE 1RAMA 3GSUB 1JFQL 3L7FA 4XNAA 2OJ1A 1HSBA 1OAXH 4MAZA 3Q05A 2A6JB 1M7IB 1DZ0A 5ESVA 2X3AA 5I71C 4A6YL 3DETD 2J73A 4PLNC 2Z4QB 2VDRL 2L4OA 1HHIA 2AKRA 3UJJL 3ZUNC 3NCCB 5KEZA 3ZHDA 2E47A 5JMRA 1CLYH 4BQ9A 1ZVHA 3L4UA 2JKSA 3GNMH 3OHXC 1SY6H 4KQ4H 2A73A 3IJ8A 5CCHE 3FQNB 4M6NH 1GOHA 1SYVA 4GRMA 5BS0D 5IJKA 1IAMA 4N8CH 1N7MH 1W9XA 4GSDL 4Y4FD 4FJYA 5CN2A 4NZJA 2PO6D 4YL9A 1FFOA 2MSPA 2YOAA 4JANA 2D7TH 4CKVX 3T6ZA 4HJ1A 1DO6A 3K74B 2HTKD 5FF6B 4I3RH 4YQXH 3GHEL 2WVVB 2DW5A 3BUPA 1L6ZA 3O3BB 2R2EB 2IGLA 2ZXDA 3BVTA 1ASPA 4PH8A 3WFEH 2W59A 1DQMH 4ONGL 1AXTH 1CL7H 3SKJL 1MAKA 2XIDA 1WIPA 2XFXB 4TNWK 1KIRB 4NQSB 1NGQL 4RAVB 4NUJB 4ONHA 3RWFB 4IRJA 4TS6A 2QKSA 3SPCA 3UERA 1RKRA 4PRDA 2Q7AA 2IXQB 3KPOA 1BFVH 5D6DA 3LDBB 3D4GA 1BPVA 3H4HA 3QNXB 3NACH 4ENEC 5IMLB 2BO0A 2H8PB 4JVUA 3V0HA 3VUAA 1ZAGA 1YQVL 1YO4A 2VW4A 4GQRA 5GRZA 5D2LF 5TFSL 4YHPA 2X4SA 1UM6H 4RBPH 4ZTOL 4QT5A 1NIAA 4K9JA 4Y5XC 5DEZA 4BIKA 5AYUH 5ICYA 1FNHA 1JF1B 1AGBB 4NN5B 1U8LB 4GI6A 2EIBA 5E2UH 5I28A 2XWBA 5INDA 3GI9L 5F9OH 2ADFH 2Z31C 4Y2DB 4GW5B 4AKPA 2D31A 2HVJB 4XVUC 4ZX4A 2KMWA 3Q9QA 4OFVA 4ODHH 5TF0A 4LLUB 2VDOH 4H25A 2HFGH 3C2AL 3RIFF 4FFYH 1RZKL 2WWKT 4X6FA 3NIFB 4YWGL 2D7MA 5C0CE 4J4PA 4XZUB 4J1UA 1JZIA 5KS9A 2BNRD 1W6LA 3RHWF 3S36X 5IIEA 3KLHC 4PJHE 3PP4H 3RWJB 3B7TA 4H5SA 3ZE0F 3VDAA 1EJFA 1NCBL 4JN2A 15C8L 1PG7X 1CC3A 1QW9A 4JY6B 3IFPA 1R0AL 2O5YL 4WFHE 1GGBH 5TE7H 2YQGA 2X4NB 2VDMH 4V1DD 1SYSB 3O6LH 1K5WA 1XF5A 3WEBA 2QR0B 5HGAA 5L8JB 4RSYA 4HKXB 4LL9A 4JFQA 5HD8D 1A5FH 2GHZA 4HUUB 4FG0A 5SWQB 4DP7X 4QYOB 3MO1A 3CZSA 1XSJA 1X5MA 4PJ6A 5BZDA 2WCSA 3IDJB 3SKOA 3TNNA 2RBLA 4BBWA 4R0LA 1TZHB 2X4OB 5IQ9A 5KYXB 3D0AA 3S37H 2B4CH 1HEHC 2UZIH 3ZHKA 4CVZB 2AJVL 3H0TB 2OJZL 5B8CC 4BHUA 3II2A 4WJ5A 4P3CL 1MUJB 4GMTL 4WEEA 5L2KE 2DQHH 3SGEH 3WS3A 3WFHB 3FH7A 2EXWC 4QRQB 3L1OL 4XVJL 5HXMA 2H1PL 3ENEA 5IBLD 3UBXI 4JRYD 4GSUA 5IEKB 4XOEA 2YRBA 1TTGA 3OF6D 3O9WD 1CZ8L 3NCBB 2JTDA 2WXQA 4JKPL 4NPKA 4PR5A 5FYKE 4FLHA 3V6OC 3PWPA 5ANMB 1CDGA 2CPUA 3UZQB 3T4YB 3WS6A 4KV5F 2X87A 2AK4D 1CU4L 4ZUWB 1DBAL 1T20A 4PJCF 1ZJBA 3ILDA 4EI5D 4HIJA 5H2BB 1IZJA 4L3CB 4NWTL 1ET5A 2BNQA 1W0YT 2MJWA 4ZG1A 4PLKC 1NCWH 1SDDA 5DMJB 4BZ1H 2XN9E 4PJAE 1EO7A 4TSBH 4NM4L 4HJGA 3ZO0A 1OTUC 1T1ZB 2PCPA 2ZOKB 3HLAB 5FKPB 3IBEA 3K6SA 4YSDA 3RLSA 4N2NA 1WA2X 1NC4B 3DYPA 3ULSB 3L4ZA 1KXQE 4L9DA 1T0NB 5D7KE 5ADOL 2FNWA 2YQBA 3TZVD 4FYSA 4QXGH 5DMIH 4PV1C 3CFTA 1Q9WA 4EUPG 2X1OA 3MLTA 1RK0A 4N2CA 5DMKB 3OG4B 3NGBB 3RY6C 1D2OA 4FG4A 2CO6A 4UV4L 4GW4B 3OZ9L 3WE6A 3LDBC 4LP8A 4XMVA 5IT2L 1E2ZA 1SEBB 2IPUK 4PAZA 3ASNB 5I76B 4O02A 1OGAE 3QXUA 4DQOL 4M02A 4O2FA 3MUZ1 2CR0A 5F9WC 1QNZH 3P11H 2OSWA 2EIEA 4JL2A 2APXA 2WQ8A 4C56A 1GC1L 4NN5C 4GP5B 4ZMZA 3DROB 1HS6A 4OCNC 5BOZG 4Y2DC 3KPSB 2CZNA 4Y16A 3UTOA 3FTGA 4JB9L 3NZUA 1ZKAA 2YZ1A 3MV7E 3RDTA 3R4DA 2D8KA 3AQYA 4WU7B 1U6AH 5AQ0A 3OXSB 1AZRA 1O7SA 3MUHL 2NXZB 3TWCH 3WJJC 3EGSA 1RJCA 5E99L 5I2IA 2WP3T 3E2HB 5IKCB 3OAYK 4AVIA 4P0DA 1VHPA 1SUHA 3RTLA 4NO3B 1IGIL 4PJ8A 5D2LA 2VLRB 1C1EH 3B1TA 4PI2A 3PIQA 5JQ6H 2YPLA 2L0DA 3QXAA 2F2HA 3MOAL 2CR3A 1A6PA 2H32A 1E43A 3KXFA 1MQKH 3P4MB 3LRKA 3LKPB 3WO3B 1JL8A 1M2VB 4Q7DA 4OIFA 3A23A 2CLZA 3T4AB 4WW2B 4ELMB 1G7PB 1GS7A 1WEJL 1RK7A 3LB6C 3QUMB 5BS0E 1CVSC 3KVQA 3GSXB 4GKOA 1WJ3A 4CVXB 3G5VA 4PRAA 1O9WA 3KPMA 3ATAA 5A2BA 1K4CA 3OAYH 5GGVY 2EH7L 1T66D 2HPOA 2GVYA 3HRPA 2W60A 2J4WL 2E7MA 3HMWH 4L4TD 3B37A 3HHRB 3S98A 3MXWL 2XWXA 2VLMD 3KGSA 4E42A 5K59F 1J0YA 2P5EA 3SDYH 1KC5L 4GP4B 4X7SL 3DX4A 1MJJB 3WJLA 4UT6H 3V6ZB 1U8NB 4UT9A 3DXAA 4QRTA 4Z8FL 1MY7A 1UOVA 2VDNB 1HVXA 1M1XA 2PW2A 3PABB 4ZAKA 1JWUB 3P30H 1D5IL 4P2OD 4P05A 5E6IB 2VC2B 2VZVA 5FM5M 4AG4H 5D2NE 1NGPH 2K45A 2IQ9H 3NJFA 2HJLA 3WKNA 4FQHA 2JF1A 5IVNA 4G5AA 5DR5L 4YBQC 2LLGA 3E9TA 3N0PB 1D5XB 1HILA 1EIBA 1GA2A 2A6DA 1BA9A 1PLAA 3L3DA 2R27A 5HYJD 1FNGB 2CKNA 2WXLA 3D2TA 3HZYB 5T3ZD 1T21A 3LS4H 3QZWA 1H15B 4LOEA 3MRKA 4MXWL 2CBTA 2Z9TA 3GJEA 3VW3H 1T4KB 4WIQA 3LKRA 5CFHA 5JHLL 3TN0A 3B56A 1UATA 1PG7L 5LN4A 5IQNA 3ZUCA 2BNRE 3KBHE 2NLJA 5CEZL 1KG0A 5EC2A 5IW3A 3NT0A 3QFJB 3NGBC 2IGTA 4PJCA 4ATTA 3BKCL 3D08A 3D0LB 3GMQA 3TIEA 5LAPA 4HZAA 3T2QA 3UGUA 3KLDA 4UQ3B 2CIKA 4H2AA 3GSQA 2J57A 1A3LL 1MLCB 1KFGA 1P4LA 2FBRA 2FQFA 4L8DB 3UBXA 4ZMTA 5FO2A 4V1DE 5KYYB 2OSYA 2HN7B 4I18B 2ZKHH 4TKWA 1S7WB 1YQ2A 5EBMA 4K94C 3MCLL 4MXVE 4KO5A 5JW4Q 5E1HB 3WKQA 4JPIB 1AXSB 1G7QA 2Y4SA 3NEXA 4M7LT 4K5OA 4POUB 1ACCA 1F3RB 3ZDZE 5HSFA 1MFBL 1CE6A 2FSEB 4PW9A 4XN8A 1XCQB 4LDCA 1U95A 1MHEB 5HPMB 1P4IL 5D1XB 5LQBL 4X5XB 2J5LB 4WUUB 1HU8A 2NXZC 1MCKA 1SLVA 2ZYIA 1R3JB 3QI9C 1XEDA 2RQ8A 1BM7A 2J44A 3WY3A 5E7BA 3CZFA 3LZFL 4ENZA 4L3AA 4OCYL 1VDGA 2P80D 5FO9A 4BUGA 5E2JA 3EOAA 3BP7B 2DJ4A 4JRYE 5AEAA 1RZJH 1WBYA 1WH0A 2CBMA 2DQUH 2HX8A 2DL2A 5FHAL 3BZFA 1J05A 3LRSB 3WXWL 2CJUL 2ATPA 4L0ZA 3T4AC 4WW2C 4KDVA 2C9VA 4ETQA 2CJSA 5C0BA 4F7TA 2AK4E 4LLQA 2VSDA 2H1XA 3MRGA 3DBSA 3T2LA 4GSXA 4TULH 1KTLB 2XIBA 5DD3H 2R0WL 3DV6A 1A4BA 1SNRA 5FDWB 4XPHH 4EIUA 1QSEB 1IGML 4X6BB 1KACB 2NTSP 4F8QA 3H42H 1GYAA 4NQDB 2E9GA 2UUDK 1VZIA 5IFJB 3TS8A 2M2DA 3CPUA 1CXIA 4KUZL 3CMOL 5DS2A 3GGWB 3WN5A 3F7YA 1KGCD 1RIVH 1TR7A 2PP8A 4HGKC 4UZSA 3TV3L 1BEXA 3TA3D 4XBPA 2QSCH 1AHKA 3BZDA 1LNUB 1NAMA 2QADB 3D2UB 4S1RL 1IGFH 1HYSC 1EJOH 1KYUA 1WF5A 1ED3B 1MCWW 1YVLA 2XYBA 1KGUA 2D7OA 1QFWH 4WTQA 4FS0A 4ICXA 1I7ZA 1UD5A 4KFMA 3WEMA 3F00A 1U8HA 3Q8FA 3L3GB 3K3QA 4WHTB 3MNZA 3N5AA 3NSJA 5E6IC 5ICUA 4ZD3L 4APQA 1GZQB 1JI2A 1FFPA 2JJVA 2UUDH 3FMGH 1LJMA 4F3FA 1AD0B 3LQAC 1OB0A 3K71A 2VDMB 1KPRA 1I7RA 2K6YA 1IM9D 2O5NA 5C7XH 1Y6KR 3KPPA 3D48R 1HH9A 3GSVA 3QDGA 3QUYD 2I25N 2W0LA 1IQDA 1DCEA 3EAKA 1RY7B 4X4YA 1Z6JT 1UT9A 2CGRH 4UWQB 2IMNA 2E6PA 3B9DA 3ZYOA 3NIGE 3S4SB 1YZZA 3ERXA 3WLBB 5FA3A 4JGNA 2NY4D 4L2LA 2E27L 1YJDC 3AREA 1T7XA 5CLTA 2RIKA 4Y4HA 4QRBA 5J6HB 3BKJH 3PS6A 2AJSL 2Q8AL 3CH1B 4LF3B 5HDOA 5G4MA 3K4DA 1NMCB 3LN4B 4LCUA 3GMMA 4I77H 5D7JA 4LSPL 2OA9A 2LAAA 4WV1B 2KZBA 4C8XA 3D8MA 1HE8A 4PJEF 5DA0B 5C0DB 1JFQH 4JZNB 1NAML 4I18C 4QXWA 4HJTA 5DFAA 5DEFA 3O41B 3SGDI 2LAGB 2FJGA 3B6SA 4A6YH 1Z1WA 2VDRH 2JJSC 3UJJH 2R2BB 3CXDH 3BPCA 5GS2H 3MVSA 1AOZA 1U8IA 4TSAH 1OF0A 5B3NA 4TQHA 4GSDH 4IU3B 4FI8A 4N25A 1DQDL 1CB4A 4QHMA 2YK1L 4K0OA 4HALA 5D1XC 4GXUM 2J5LC 3IJYB 5I1EL 4U6HA 5JW5A 4RQQA 3MJWA 4L4TE 4ZFQA 3DTDA 1JSYA 2VLME 3N0AA 3TNMA 3IJSA 43CAA 2CUAA 1F6LL 3GHEH 2WWMC 2CG9X 1XXFC 4AM0A 4UV7L 1AS7A 3CQPA 4QEGA 5D1ZI 5A6IA 2X42A 3FT0A 4F24A 5IROC 4ONGH 4LE8A 3SKJH 1OB1B 2BXYA 2NY0D 3LZOA 5DZVA 4HUVA 3PG2A 1TIUA 1NGQH 5TGBA 4ZMAT 2GUOA 4U1NB 1J88A 5CU5A 3KYNA 3US1A 4BCYA 4AQZA 4GPVA 1XT5A 4JFEA 2WGXA 4YHOL 3GS4A 4TNVK 3TFBA 4U1LB 2XBDA 1DE4B 3EJYC 1TLKA 3BH4A 1E4HA 1YQVH 3NCEB 4GI9A 5TFSH 4R9HA 3FFDB 4ZTOH 5HYJE 4DFIA 3CHSA 5T3ZE 1SJMA 1QSVA 2Q76B 1D5MA 3EW3B 3TPKA 4HV8B 4PFEA 1KIPB 1CDHA 1E0OB 2Y7LA 4M00A 3VFRA 3GI9H 1J1OH 3O3UN 4IKIA 1S7UA 1N3NA 2ZXCA 2QADC 3HG3A 2BS9A 4N0RA 3MNWB 3MROA 1PAZA 3REVB 4MQSB 3HPLB 1UZ6F 2NMSA 3C2AH 4O4YL 4MNGB 4AV4A 1RZKH 2A9NL 3QULB 4YWGH 1OWWA 2XCMC 5CP3A 3T0EB 1GTNA 2X7LA 3BN3B 5DD1L 5IGXL 2IQAB 3MV8B 3WNMA 2UX6A 1F4AA 3OC5A 2V7HB 3RWEB 1NGXA 1IB5A 1NCBH 15C8H 1ZHNA 1E2WA 3SPJA 1J10A 1R0AH 2OFQA 2O5YH 1NM9A 3C75A 3POCA 1JZGA 3FCSB 4RWYL 4PVBA 2A4EA 3B2XA 1W0WA 4UM9B 3T2OA 1SVCP 2WLIA 3F6LA 2HFTA 5CJ5A 4LLMA 3SOBL 2OSLA 2AEPL 4ZW6A 3RU8L 4CA4A 3NPZB 3L5HA 3D0VB 3FCBA 4Z7UB 2WXKA 3C5ZD 2DKMA 5J12B 2PWDA 3PWVB 4P23A 3S4SG 2B4CC 3VI3E 3X2QB 3M17A 3SO3B 4Z5RB 3CFKA 1PG7W 4G3YL 1NMCC 2IFFL 1X5IA 2N56A 4LSTL 5JO5B 2GC7C 4R6UA 2AJVH 4XMPL 3DHUA 2OJZH 2K0RA 4KK9C