3CIQA

A regulatable switch mediates self-association in an immunoglobulin fold
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
98
structure length
98
Chain Sequence
MIQRTPKIQVYSRFPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Beta-2-microglobulin
publication title A regulatable switch mediates self-association in an immunoglobulin fold.
pubmed rcsb
source organism Homo sapiens
total genus 15
structure length 98
sequence length 98
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2008-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ciqA00
4YXKH 5E5MB 4NQED 4YHMH 1MCQA 4Y1AE 4XP9L 2FJFB 1YMME 2XV6B 4PJ5E 3BP4B 1INQA 3MQIA 3RWIA 1NFKA 1FNSH 4YFDB 1OGAD 5LCVH 3T0XA 3Q5TA 1CU4H 4QHMA 5JXAL 3OB0H 4TULH 4X4ME 1NEZG 4ODTL 1QEWA 2UUDH 3H7LA 3TZVB 3WDIA 1UACL 4RMUA 2XOTA 1FNEA 3RVVC 3QJFA 3QDJA 2B8OT 5CMAB 4DN4L 1G7QB 4OCXL 4U6TA 4UZGA 4KGJA 5CSGA 3NFNA 1S7VA 4HC1L 4TSAH 3P9MB 2H2PD 1X5XA 5CJ8A 4G9FE 2GK0A 3JWOC 2NW2A 3TVMA 3RGVA 3VE0B 5C0DA 2FGWH 5T3ZL 3F5WB 4NO3A 5HHOE 4TNVK 4DAGH 1VSCA 5F7DA 4GUPB 3MX0A 1FC1A 3QFJE 5F88B 2AI0H 1CE1H 4PJHB 4PRBB 4RFOH 4Y5YC 1NPUA 4NC1C 3SE4A 1KNOB 2ZNXA 4LCYA 1WC7A 3CH8A 2VLJB 4P4RA 2F54D 4FQXB 4LQFL 5KTEL 3QUYD 4M1CD 3DVGB 4R26L 1ADQA 1NUDA 3D3VB 3QFDB 4ODVH 4U6VH 4CVXA 4EDXB 5E2TL 4N0YL 1LP9F 1LE5B 1F11B 4RWHA 1XF5B 5GRUH 1N6UA 3D69B 3KPRB 4OJFH 3I84A 3C6SB 3BYYA 4IEFB 1A8JH 4E5XA 4V2BA 1CD8A 3VRLE 4H1LG 2F58H 1Z0MA 4F7CB 1YPZF 3R0NA 4TSCL 4O4YL 3H9SD 2BSSB 2DQFA 3FO0L 1F45A 3M8OH 1CTNA 3N85L 4Z8FL 5K9KA 1GH7A 2Z31A 1FFPA 4L1HA 5C09D 3HNTH 4N8VA 2EIZB 3VH8A 4MJ6A 1X7QB 4YPJA 4TRPL 5I71B 4JQXC 2RCSH 3N9GH 2VAAA 2ZP0T 1J8KA 3GMQA 2X4UA 4HW6A 5D72H 5KS9F 3PWPB 1RMFL 4OZFA 5K9QI 3HCVA 2C9AA 4XCYB 5BV7B 3TIEA 4BFGA 4GBXB 1JN6B 3O6LH 1E0OB 5I1IH 2LU3A 2UYLA 1U8PB 4JVUA 5KZCD 4PJHE 2HH0L 4YO0B 1KIRA 5BQ7B 3L3OB 3W5NA 2VLJE 3FB8B 4NQCD 3AS0A 3MUGA 4MLSA 1BZQK 3HB3D 1AGFB 1UFUA 4P23B 3SO5A 1WBZA 2DQGL 4JKPL 2R39A 1T1ZB 2OMNA 1J0IA 3D3VE 1IKFH 3TO4B 3VFMA 2Q7NA 3HPLB 4IRJC 5FDWB 3RAJH 1AH1A 1MWAL 2KQNA 2PO6B 4H0GA 2R1WB 4JFHD 5FM8A 5BZDA 2XWBB 5FHAL 3T3MF 3QRGL 1CGSL 1P6AB 3KPRE 3U48A 5J89A 1MQKH 5IW6B 3EO0B 1XGPB 1NBVH 4XB7A 2WZPD 1NGPH 4I3SH 1U3HD 3OHXA 3QHFL 4H8WL 2X4SB 1U8LA 1Q94B 4JFYB 1KCUH 2F74B 1W8NA 4H0HB 3RUGB 5IB1B 4K55A 3CH1A 4LU5L 3EO1A 2E7BA 5M94B 1CDHA 2XICA 1IGIH 3DVNB 2F5BL 4KDVA 3GSNH 5E5RB 4XZUA 2YRLA 5CZVH 3KXFB 4KKCC 2C3GA 3MA9L 4KZEH 5DZNA 3JV6A 1JI1A 3PWPE 2QL1A 4GLRI 4BZ1H 1C5DA 4FNLL 5CINH 2CXGA 4AL8L 2DQEH 2IBZY 3OF6A 1NMAL 5EOQL 1W72H 1K6QL 1EGJA 3SCMB 3K7UA 1JPST 2UZYB 4J12A 1ZA6B 5INCB 4R7NB 1S5IL 1T2QL 3L5XH 1NFDA 4PJFA 1QHPA 4RAHA 3JV0A 4D0BA 2YUVA 4Y4HC 2D9CA 3QWRD 2IJ0C 4HGWA 1UZ6F 4QY8A 1TQCC 1GPOH 5GS1B 3QCTL 2VN7A 5IROC 4JFZH 3SKOB 1HIML 1XH3A 4LHJB 4X9FA 2VDNL 4PUBH 1FO0H 3QZWB 3MO1B 2J8OA 4Y5YA 4FG6D 1JMXA 3SDYL 3OTTA 3V0AC 4GW1A 1YY8A 4I77L 3LZFL 4JN1H 2EEAA 3P9LB 2BDNL 5DK0B 3UO1L 3GI8H 3HS0A 1DL7L 3X12A 1A4JB 5FOBA 4XHJD 1RUKH 3GMNA 4GQ9L 1QLEH 1KV3A 3ZT5A 3SDCA 2AJZB 4HGKC 4JFDB 3RUGE 1ACYL 3GEWB 3LS5H 3DIFA 2FX7H 3PV6A 4UTBL 3HNSL 4APQD 4NZDA 4YHLH 3BPNB 5EIVA 2JCCF 4N9GA 3KXFE 4HG4K 5J8OA 2NXZC 1OTUD 2EC8A 1T3FB 3O0RH 3G04A 3TBVB 5L2KA 1UH3A 3VFGH 4C83B 2P5WD 1U92B 3GBML 4QRTB 1SM3H 2WBJD 4HHAA 3MMEA 4M7ZC 1R5WB 1EHLL 1E6OL 4HJJL 4IIQB 5FO9B 1LDPH 5IT2H 2WLZA 4JQXA 1GGBL 3EZ8A 4NRXA 2J1KA 3V9FA 1AD0B 1G7JA 1LQSR 4LARL 1IQWH 1RI8A 4GLRH 4TTGA 1ZVSB 3NACH 4ZS6D 4KZDL 4XVTL 4KK6C 2JF1A 3MZTA 3NCJL 4NNXA 4LPXA 1IILE 3B2VH 3VFTA 3HR5B 2EDNA 4LLWB 3U30B 5DJ6B 3C5SA 5EU3A 2NR6D 3LDBC 2I07B 2PTUA 1R0AL 4OD1L 2HFEA 4RIRB 4MAYB 1I3UA 2NZIA 2AV1B 2NXYD 3LN4B 5ERWB 1JYWA 2W0FA 5FF6B 5EBWA 5FHBL 4I1NB 1KPRB 5EPMB 5ENWB 3IU4L 4QHUB 4JFDE 1S7XA 2YZ8A 3GHBL 3L3KB 4IRJA 1FZOB 1TVBA 3RL2A 4NQXA 3WIIL 3PIQA 5ESAA 4NNYB 1C1EH 3HZMB 5DZOA 1F00I 4TYUA 1ADQH 3HLAA 1ZLVH 5DRWB 2P4AB 3MODH 4N5EC 5B3JF 3RWCB 3C08H 3IDXH 3LB6C 5CJXC 3OKLB 1JWUA 5DMIL 3TEUA 4V1DB 4ESKA 3C8KB 3VFOA 1T6VN 5CLTA 5E2UH 2DLFH 4WW1A 5DZLA 2DMCA 1WAAF 2IBZX 3DV6B 1Y18B 4UDTB 1V3LA 2CK2A 1QKZL 1R5VA 3SKJH 3I9GH 4PJ7B 5DUML 3ZL4H 4WFEE 3ZTNL 3GJEA 4PRIA 2LABA 3BPOC 4ONHB 1G6RL 1U8MB 5CZXD 4ISVB 4PRHB 1IAMA 1WWWX 2IPUG 3CDFA 4XX1E 3SDXF 3L5WB 4L8CA 3O45A 4Z7UB 5I9QB 1OCWH 2DDQH 2EH8L 2EDRA 2ZOKB 3ZKNC 1SYSB 3PUCA 2PN5A 3MROB 4WRLA 2D7OA 3Q5OA 4DUVA 4HBCH 2NZ9C 3KPQB 3QPXL 1G7LA 1CICD 5D1ZC 2ZUQC 3MV7D 5F6IB 1P7KB 4OUUB 4H26A 4PYGA 4XWOC 3RWJA 1I7UA 4PGDB 3VXMD 4FQHB 4OZFH 2A6JA 2FSEB 3RVUC 1B4JH 5ALCL 4ZFOB 3A6CH 4BQ8A 2GJZB 12E8H 3TT3H 1OAXH 1BBJB 1RZIA 1IAOA 1PLGL 3QG6A 2NTFB 5EFIA 1TPXB 1ORSA 3KPMA 2DTML 4X6BA 3GI9H 4YHIA 5TDOB 2DI9A 3OGCA 4Y4HA 3IF1A 3OZ9L 3MV9A 4QXGL 4YJZL 3SY0B 1TZIA 4QOKB 3ORJA 3BEWB 3EOTH 5IROA 4NYLB 1NGWA 1T5XB 1F13A 4NKMB 1MRCH 1P4LA 3ZE2F 1U8OA 3ULSA 4UBDC 1UYWH 5DHYB 2IH3B 4MA3A 1BFVH 1KJ3L 2F15A 4V1DE 2GUOA 2X9WA 3UAJC 2EXWD 1VKXA 5F9WB 4AEIL 4F80A 4P3DA 2KDGA 3T1WA 3SGKC 4NZJA 2MCPL 5IKCA 2DQJL 1MIEL 3OR7B 4PJ7E 5ALBL 3CFBB 3W39B 4X7CC 5A2IH 1BD2A 3EGSB 4HFUL 2BNQD 3LD8B 3NPZB 4OZHB 4PRHE 5J1SC 4LNVA 4K3DH 3VXNA 4JZNA 4U6HA 2FH8A 4UDUB 3O81A 4XC3H 4PJ9A 2UWEF 4Z7UE 3MLUL 2IG2H 1A6AA 1A1MB 1IGML 5HY9B 4PJDB 2ZCKL 4IDLA 5FECB 3BKCL 1HEZA 5TH2B 3WDJA 1EHNA 2J4WH 4WU7B 4K7PH 1SBSL 3HR6A 2E7CA 4R8WL 4P9HC 3IRPX 3KJ6L 1ZLUK 1KJMA 2OQJA 1EV2E 3DROA 4YR6B 3QUKB 4HIHB 3N0PB 1DQLH 5F9JB 3RVXD 3B6SB 4CJ1A 5IBLC 1Q0YH 4M61B 5I1DA 3JBG7 1EMTH 1FNAA 25C8L 2YPLB 1D5IL 5EU4A 2G60H 1BWWA 4QOKE 2AEWA 1GL4B 4ZUVA 2A6IB 3O6KL 5BW7C 4MJ5A 3JWOH 3QDGA 3O6MH 2OXGA 4HUMB 4LPVA 5JIPA 4E41B 2WANA 3BP7B 1F6LL 1A0QH 1GZQA 2X1QA 3D85A 5D71H 2Y5TB 3TC9A 2R69L 1RIHL 2BY3A 5D96B 4ODSL 4D3CL 4MJID 4PP2B 3UTZB 3SQOH 1RU9L 2ADGB 4RGNC 3V6FA 3LEXB 2BSRB 1E6JL 4X80L 4JCMA 4DGIH 1D5XA 4JPWL 3U7YL 1YUHA 3ARBB 4GAYA 1AY1H 4OZHE 3U6RA 2R29L 2NY0C 4MA1C 4YC2B 5E2JA 2BP3A 5CJXA 4NQDD 5D7LA 2DQIH 4X6EB 2JE8A 5EC2A 3T0BA 1QVOB 2QHRL 1WUNT 4MDIB 4PJDE 4YDKH 4XNYL 1BFSA 4P9MH 1YMHA 1B3JA 2BVUA 5T1LD 3O9WC 1K2DA 5CP3A 1HWGB 2DKSA 1MHPL 1XFPA 1VFAB 4DKEL 1A3RL 1J05A 2X4NB 4KMTL 3B83A 4NZUL 4WEBL 2D4FA 3S6CA 3P9WB 3SE8L 1BX2B 4HXBL 2J3SA 4D94A 1JFQL 1G1YA 5FGRA 3B8SA 3IJYB 4NO2B 3H6JA 5E8DH 3R8BB 1WGOA 3U4BH 4JQIH 3L5HA 3HI1A 2YPLE 4Y88A 1JUFB 3QIBC 4JM2A 1EXUA 1UM5H 3TN0D 1KEMH 5MEQA 2AJVL 4P48A 3ES6B 3TO2B 1BGXH 4LL9A 1U8NB 4E41E 1BAFL 4PB9H 4I5BA 3ULVD 1PKQA 5EUKB 4RWYH 3V79C 3P4MA 3EHBC 2VLKA 4NGHH 4PJCA 1XGRA 1IAKA 1I4FB 3QO0B 5GSRB 5F6HI 1CXFA 4UQ2A 4MWFA 5LGJA 5E4EB 3E8UH 5HGBA 3GMLA 5C9KA 5EA0H 3GRWL 2P46B 5T1DL 5JXEC 3K80A 4YDVA 2X7LA 1OAYL 5J3HD 3MUJA 1QRNA 5CJOL 3SDDD 3Q6GL 4JZOB 1GGYA 5CBAB 3VD5A 3QXDA 5JZ7D 1RZGA 4TVPD 1JNLH 5CWSB 4GAFB 3RRQA 4BKLA 3OX8B 5LQBH 1DSFL 5IBTL 3WD5H 4O2FA 3SGKA 1D6EA 1NCCL 1PFCA 1N59A 32C2B 4K3EL 1MHHA 1CFQB 1YNKH 4X0KB 5I6XB 4OD2B 2AJUH 2V2TB 1CZ8L 3NZ8A 4UNTA 4R7DA 2K9UA 2VKXA 3L6FA 3VCLA 1J1OH 3DYOA 1EA9C 5GRJL 4R0LC 4U3XA 2ADFL 4I0PB 2VE6A 2JELL 2XWJB 1QSEB 3LKNA 3S96A 4JFFB 5A43C 4JO2L 3V0VA 2NY3B 1T04B 3WSQH 2AXGB 4K3HA 1T7WA 2J88H 5I8OH 2HFGL 5KN5A 5D5MA 2CJUL 5BO1H 3O3UN 2X09A 1CF8L 2AJ3A 1MJ8H 3Q5YA 1DBJL 4F37F 3MGOB 2C7UB 1NGQH 4YXLL 3QEQD 3H9YA 3DMMC 4ONGL 5IB5A 4Z76B 3UBXA 1KPUA 1X5JA 4OV6F 4XPGH 2V9QA 3CK0H 3MCLH 1YNTA 3KYAA 2OXHA 3D39A 2ZNWA 3P77B 3UJTL 5HYQB 1C7SA 2ICCA 3NFSL 1YN7B 1MRFL 3DETD 3D0LB 4JZJB 1F3RB 3VXRD 5BW7A 3NPSC 5DJZA 1QFUL 1P4IL 3UTOA 4YEFA 2Z93B 5ACZA 5EIIB 2KH2B 4ZSOA 2GI7A 5T1MA 5EBLA 2IFFL 4WWKD 3BKYL 3WJJA 4LHQB 5E56A 5C0RL 4UV7H 4G9DA 4XGZB 2P8LA 1N0XL 3W81A 4O5LL 1FG2B 1S9XB 3F6LA 4Z9KB 4J4PC 2XNAB 3C2AL 3EDKA 4KQ3L 1F58H 3MRPB 3DV4B 1F2QA 1DUYB 1SMOA 2X89A 5HD8C 2GT9A 5KJRH 4LCWA 2ZCLH 4O51B 3ZYOA 3D25B 4WY7H 1P84K 1JRHH 4PB0H 4IHOB 4OFKA 1J0YA 1QSEE 3GSWB 4JFFE 1U6AH 4R2GD 1T1WB 3TJEH 4Z7NF 1I3GL 4Z77A 1O7VA 3O9WA 1K4CB 3QWOB 1FCCA 3G6DH 5IQ9B 3IXAB 5I73C 4JO1H 2PW2B 2GSIA 3NZHH 3CVHB 4S1SL 3BE1L 2DBLL 3U4AA 5E6IC 2JK5A 3HNVL 1EEUA 1I8IB 4L3AA 2R0KH 1RHFA 5I1AA 5IM7A 5D8JH 5HXMA 4PLKD 4AQOA 5I19L 1FPTH 2R2BA 3FT3A 5FV2A 5DRNB 3LQMA 1YEDA 3VGDA 1DBML 3QIBA 4EZMA 3FFCD 2DN7A 5H94A 1NAKH 4HWBA 3WXVH 1JIBA 1WFTA 4X6FA 5JHDD 4N8VG 1AO7A 4LLVB 4HPYL 1A5FH 2HFFB 5BS0A 2KBGA 1X5AA 4P2OB 3VH8G 4JFQA 3LV3B 2J7LA 1CVSC 2R2HA 4MB4A 5TFSL 1CE6A 4JGUA 3WE6B 5BV7L 4OM0H 2WUBH 4OZFG 2W9DH 4LKXB 1M7XA 1GVIA 2DQHL 5HI3D 4J1UA 3NA9H 2IEPA 1OOAA 2FO4B 3G5VB 1R6VA 5DC0A 3AB0B 5JXEA 2W91A 4XAWH 3CGTA 2PUQT 4BSWA 4LAJH 3S36H 3T65A 3DSNA 4XPTL 4PS4H 5GGTL 2VABA 4LLUB 4KI5D 3WV0A 2HWZL 2WP3T 4LCCA 5C0JA 1S7UA 2Q86B 3CDGB 3KYMB 4XXDA 5L9DL 4CMHB 2PXYC 4DVBA 3NIGE 5MENB 4EDWL 4KY1L 1FIGL 3BW9B 4K7PY 4FQ1H 2EDTA 4NNPL 5HHQA 4MNQD 2IWGA 3QNYA 3O6FD 2CLVB 4L3CA 4YAQA 5CP3H 4CBPA 4XBGA 4L9LA 4Z7VB 2E5EA 2X4PA 4HUUB 5HVHC 3BKMH 4X5WA 3C2SA 3FT4A 3MLYH 4HDIA 3OR6A 3MLZL 3MLWL 2RBLA 2XY2A 5I74C 4AIOA 3FQTA 3EUUA 1UB6A 1YEGL 3DHJA 4NZRL 4W6XB 4KDWA 1YY9C 5CD3A 4MNGB 1ZLUH 4JN2A 1RK1A 4HCRL 4Z7WA 2VDML 3QUXC 3VWKD 1B88A 4U33A 2Y23A 3WLBB 3DMMA 4YPGA 1YYLL 4HV8A 1AKJD 3D2UD 2EKJA 2VDRH 4NO0D 2LTQB 4F8TA 1T21B 1G9ML 2GTWA 3ZDZE 3UJJH 3MRQA 4OAWA 4CRPA 5E9DD 5HHXH 1PYWA 5DR5L 2YPVL 3D48R 4S2SA 2Y25A 4F7PB 1ULVA 2FLBT 4QCIA 3QB7C 3LKRB 4R97C 1CGYA 4H20L 2PETA 5AYQA 3ARED 4AEHL 1XF4B 1J12A 5DEFA 3C6LD 3NCYS 4Y5VC 5J7CC 1CGTA 2R1XA 5HHPA 3L5IA 1C7TA 3NN8B 3UTQA 1I1CA 5MENE 3FB6B 2YPKB 1PG7H 1MREH 4J4PA 4NZTH 3ARGB 2KZWA 3ROOA 4PGCA 3ME0A 4OF3A 4XVJH 1P9MC 3TLRA 4DN3H 4UINH 3ILPA 4JCLA 3SGJC 1D9KA 4Z0BH 4ZUUA 4Q97A 1VCAA 4YHNB 4Z7VE 1SEBB 2VL4A 5F8RC 1P7HL 3QIWD 2D31B 2Z91B 3HFMH 2YD5A 1IM9A 4XAKD 3U2SB 4JM4L 2KUTA 1Y6KR 2HT3D 4U1LA 4JY5H 5HYSA 4GG6F 2B2XL 5SX5K 4HPOH 3MRNB 5HTSA 1A14L 5HYFA 5F96H 1JK8A 4KVCL 4MNGE 2HTLD 3P4OA 3NFPA 5EG6C 1TNMA 4J3SA 4RAUB 1RZKL 1FL5B 1UC6A 1CLYH 5BMFL 3T0DA 2MCG1 4O2CB 4I18C 5C08D 4E0RB 5DJAB 5AG8A 5JPMA 5L2JA 4ZXBD 4NO5A 4P9HH 5EB9A 1P1ZA 5C6WH 4OGAC 3SDAC 2V6HA 1KEGH 2FBJH 5CJQH 3LQAH 1GAFL 3B5GA 4WNQB 3MYJB 1S9VA 1M6OB 3GJFK 3UEZA 2ADJB 4HIXL 1QFWI 3ARYA 2X9YA 3STLB 4U1KB 3AFLA 3CSBA 3P30H 2WMPA 5EUOB 2EC9T 3TF7C 5EOCH 1KC5H 4WI2A 4U0RB 1IGJA 2R2EB 3OL2A 4K7PX 5SWZD 3UC0L 4XP4L 1IGTB 2HMIC 4JDZA 4K23H 4FQ2H 3ZDYE 3TA3D 2C4FT 2Y5EA 3KS0H 1NFIB 3WS6C 3LIZH 5DF0A 1YC7A 3IU3B 4UOJA 3T0WA 1GGCL 3GDBA 1A7PH 1B2WH 5IB3A 4M02A 2G5BB 4X4ZA 3U0TB 2JIXD 1BWMA 3M07A 4PR5A 1KG0B 5E6YA 3RWEB 1FVEA 1KB5A 4HIJB 5EZLB 5F1NA 3ARFA 3IS1X 4EOWH 2P43B 4LKCA 3GSNB 2Q76A 3DX7A 2QQNL 4PG9B 5LG1A 3VXOA 1UB5A 3O4OB 4M43H 1L7IH 5DEGB 3LEYL 3TPKA 4PYHA 2AJYL 1A6TB 5J11C 1BMGA 3VFNA 1JWSA 3RTQC 1B90A 1IT9L 1PJ9A 2YK1L 3HZYB 5IG7A 3P3YA 1HOCB 2SEBA 3L9RB 1FZMB 1HZHL 3ECBB 3S3PA 3BEVB 5TQ2H 5ICYA 4Y16D 1EO5A 1IC5H 3SJVD 1CFNA 1NUGA 3MJ9L 3CFCH 5IUSA 3BPLB 4L29A 1MJJA 2HYMA 1LP9A 3MRDA 4P4KC 1HHKB 4F3FB 4PGJA 3O4LA 1Q9WA 2XKNA 4G42B 1MFAH 4U6XA 3WEXB 5IMOB 3QAZB 3QUXA 4G9FD 4EI5C 3KPLA 3GJFA 5EUOE 1H5BB 4EKXA 1QTYT 2ATKA 3K3QA 4HWBH 1FO0B 2D7NA 3VXUA 4N9OB 4OZGB 4DEPB 5I66B 2P49B 1JGDA 1OAQH 4QWWD 2H26B 3PNWB 4NQUA 4XC1L 2EIDA 5TF0A 1ZVYA 3U1SL 1MEXL 5GGUB 4HMEA 2X4TB 4Q0XH 4ZFOL 3K4DA 3B2UC 2R9HD 1K8DB 3DVIA 4RMQA 3FQXA 4G5ZL 4ZUWA 3BH9A 4JFEB 5KS9A 2ED8A 4Y5VA 1YEJL 2HRPL 1IFHL 2YA1A 3ARDA 1X6NA 4YIQA 2OTWA 5KSAB 4TUOB 2YKLL 1ZSDB 1ZLSH 2XI9A 4K9EH 3VXSD 1P9MA 4G8IB 4K8RD 4QRRA 1C5BH 3SGJA 5DS8A 4YDJB 4OF5A 1ONQB 1EAPB 2ED9A 5HGAB 5IFHH 3C87A 2M26A 2IADA 2V7HA 2IANB 1JGVL 3PXJA 1OQXA 4XMKL 3ULVF 3BO8B 5E24E 1ZLWK 1CD9B 1PG7W 1IEAA 1MLCA 3QUMA 2R8SH 3BFOA 4MJ4A 4DZ8B 3FN9A 3QJFB 5T3XH 1IL1A 1OTTC 1I1YA 1WIPA 1Y0LA 4LDLB 4YHPA 4P59H 4HJGA 4OI7A 1D7FA 4G6AC 1FLRH 1S7QA 4K3JH 4L4VB 5A16B 4KROD 4GG8A 3HTLX 4GMSL 3ARXA 1DANT 2XZAH 3RWGA 4D2NA 3EYSL 2NW2B 1SYVB 3TVMB 3G08A 2FHFA 4YZFE 3MLTA 4MXQD 4O2EA 5FYLH 4LIQH 3H0TA 3SDAA 4OZGE 3A6OA 1ZVHA 3EYOA 3QH3B 2AABL 4PP1C 1ZT7B 1KPVA 4Q9QH 3VD9A 1FVCB 1D5MA 4FQCL 2FJHA 4HKBB 2I9LB 2BC4B 3BWUC 3BXNA 4FQXD 1I1FA 2R1YA 3RQ3A 5IWLC 1WC7B 3VGHA 3O2DA 5JPNB 3Q2CA 1ZTXL 4KK8C 1JPFA 5HYJD 4LHUA 3M1BA 4MQXD 1I1AC 1HDMA 3D3VD 2ZUUA 5F1IB 4JFEE 2FX9H 3TV3H 35C8H 1YN6B 3WS6A 3EJZD 2BJML 1HCVA 3DO3A 3UTSA 1S7TB 3BIBX 4P46C 3F7QA 3LHPL 3KPRD 3QDJD 1U95A 4J2XA 2VMFA 1RZ8B 3GSQA 4JO4L 2FCBA 4PJEB 4E5XB 1CK0H 2A9NH 4EQ2A 3DURB 1JPSL 3BWAB 3CPLA 3MXWL 5FKAA 1ZWIA 4WEMB 5KANI 4UOW0 3V8CA 2IQ9L 2DQFB 3RGVD 1MNUH 2IANE 5DUBA 43CAA 5C7XL 5C6PB 1S78C 5K9KB 1YEKL 2AW2A 1EIBA 2NY2C 1FFPB 3PGFL 4LBEB 1M7IB 1TIUA 1GCFA 4XPBH 2XTJC 1KCRH 1HXYA 2CRMA 4RGMB 5JORB 3RTQA 3VWJB 3MLSL 3MRCB 4OF0A 5TQ0L 1QG3A 4PBWD 3O8XC 2Z8SA 4L4VE 2VAAB 3PWPD 1SJVA 3I75A 4G6JL 2QADB 3RU8H 1JHTB 1H3TA 3R4DA 1KIUA 3BISA 1G9EA 1T20B 3TIEB 4E42B 5IMMA 3AS3A 4WHTA 3U9PL 5DO2D 3TNNB 4XNUH 4X5XA 2Z8RA 1I9IL 1XGQB 4CDHA 1AGEA 5ACLA 4P4KA 4M9PA 4G6ML 4GKNA 5LVEA 2JCCA 3BAEH 1NC4A 4PTTB 4RNRB 5CAYB 1CCZA 3LVEA 4EI5A 4LGRB 1N64H 3MUGB 3VA2C 3ZKMD 1C08A 1CGVA 2YUWA 3QQ9C 5AYUH 3TT1H 2FD6H 4XP1H 4DZBA 3DX8B 5J13B 2E7HA 4K71C 4PIRF 3HA0A 5CBEB 2Z31D 5F93C 2WIMA 4UV4L 2APWA 4CNIA 1HH9A 5C0GB 4J7RA 3HMXL 3X3GL 4XNXL 1UQSA 2APBA 2R0ZL 1ES0B 1MCCA 4PJEE 5DLMH 4YEEA 5GJSH 4HK3N 2V2WB 1G6VK 1S7WA 1CS6A 3DRQA 5I1GH 4ZYKB 4Z95H 1DZBA 2EDDA 4X7SL 2YEZA 4ZAKD 2DOCA 4L5FL 2EDBA 2BHZA 1DDHB 1KB5H 5DQJB 2FO1A 3MOAH 4FXKA 1QA9A 3V52H 3EO1B 1TQBC 3AMLA 1KYOK 1TVHB 3KXFD 5DFTA 4GXUM 5C0AA 3WJLC 2BNRB 1QACA 1A2YA 3IS0X 2YRZA 7FABH 1MCSA 2EE3A 3JV6B 4R9HA 3WFZA 1UVQB 1CFTB 1K9TA 4GXUN 4GRLB 2GTZA 4PTUB 5ID0A 3IDYB 4GMTH 5SX5H 3BH8B 1C5DB 3S36X 1S5HA 2YUXA 3WN5C 2B1HH 5CSZB 1BEYL 3ALPA 1RULH 5M95B 3R06A 1Z9SA 1DLHB 4FFVC 5TJWK 5DVOA 2BCKB 5J12C 2VXUL 1BJ1H 4NDMB 1T1YA 4NCC1 1FAKT 4LGPB 1AGDA 2DMBA 5MERB 5KSVA 5FEBA 5DD1L 2WIIA 4LFHG 3QIUC 3CC5B 2DMKA 1WAAA 2JB6A 4HGWB 2XG5A 2AV7A 1N4XL 3P0VH 1IKNC 2HKFH 2J6EL 5GZOC 1NBYB 1YQVL 1NGZB 1W0VB 1UA6H 3SKMB 5GGVL 4KRLB 3S3JA 5J0BA 3MTRA 4LDEB 6FABL 1CXEA 2CIIB 4OKVA 4OI8A 1CG9B 1XR9A 1MHEA 3X12B 2N56A 4XP5H 5F3BB 1I8LC 3GMNB 4R4BB 3UBXG 1U3YA 3T77A 3GMMB 3NCEB 4YLQT 3SDCB 4X83A 3CXHK 5GJTH 2JJWA 2A77H 4P46A 5IJVA 4Y2DA 3QRFM 3RVVD 3DHMA 2EIBA 3OF6D 1RZJH 3RY5A 5F1SA 3EFFA 5AUMA 2W07A 2E9WA 2NW3B 2BNRE 3EOAB 2Z35A 1YEFH 3DXAB 4YHOH 5D7IB 1NCWH 3T4AA 4N90D 5SWQB 4N68A 5L2KB 4UILH 5ABDE 5TDPA 3VXPB 1YEEL 3B9VA 5IGXH 1LO3H 3HPJA 3PHOA 4XPHL 5HHVL 1RVFH 4JQVC 1WIUA 3VG0L 4OLWH 3SGEI 5E99L 3C8HA 4LVHC 2PNDA 4UT9H 4YE4L 1YECH 2ED7A 1PG7X 3O8XA 3G6JB 6CGTA 1XF3A 1PSKH 1G9NC 1ROWA 1FGVH 1TJGH 2YOCA 4L3EB 4HGMA 5J6HB 4JY6B 3D0VA 5DJCB 3INUH 5AZEL 3P2TA 2EYRA 2OS7A 1FH5H 5GRXG 1E4XH 1B4RA 3CVHL 1F4WL 4Q74A 5BRZB 2UWEA 2ICEA 2ZUSA 3FN0L 1VEMA 5B39A 2IPTH 5GS0L 4ODHL 4RGOL 3UYRH 1NLBH 1S7XB 4MQSB 4XCNA 1KF9B 3TYFA 4YHZL 1XF2B 3PIQB 2P24B 4YDIH 2P1YA 5JA9A 4R4NC 1JTTA 3MRGB 4JG1H 4U7SA 5FCSH 2CSPA 3K2UL 4IRSC 2DIAA 4NM4L 1UT9A 1CQKA 4GSDH 3DXAE 1A3LL 5FGCB 5D7IE 2H6PA 4D9QE 1OSPH 4LSPL 5L2KE 4P5TA 5IV2A 3HC4H 1R5VB 3TIDA 2FECI 3STBA 3GJEB 4X98A 5D2NB 4IMLA 5CP7A 5EWIH 2Q8BH 3T0EC 1K4DB 2VZ1A 3KPTA 4JJ5A 4KJPC 2XRAH 1FGNH 4UU9A 4QNPF 3WJLA 4NN6B 3GM8A 3G6JE 3CDCA 4YXKL 3E3QC 3D6GA 4MXWL 4YHML 1T1XA 5T1KD 2IBGA 4L3EE 1ZLWH 5EOTB 5GS2D 2CUMA 1AI1H 1NAMA 2IMMA 2EDLA 4IRJD 1FP5A 5DD0L 3WN5A 1KT2A 5LCVL 1CU4L 4GO6B 5L6YH 1Q9OA 4LSTL 4YBQC 4ZFZB 4X7FC 2NY5C 4L4TA 3UTTA 5BRZE 1NCAH 1MI5D 1A7NH 1EEYA 5DGRA 1UWGL 3NGBC 1N8ZA 3OGCB 4MCZB 3QIUA 1WCQA 1Y6MR 1YJDL 4LRIC 2FZ3A 1TZIB 1G7HA 5IMKB 3ISWA 1NDGA 3WNKA 1IKNA 4PRID 5EC1A 1LEGB 2VLMD 4CVWA 4PJBB 3QQ3A 1CL7L 2J8UB 4PRDA 1P4LB 1KIPB 2PYFA 5JIHA 4HKJA 1FBIL 4RAVB 4KKCD 3EOBB 2OP4H 4NKQB 4HXAL 1VADA 2CDGA 5FGCE 5C3LD 1KJ2A 4U7MA 1II4E 3UYOD 1VKXB 1CE1L 4OBSA 2BFVL 1J8HB 4FMKA 1ZANH 4F37K 1UENA 3MRHB 1F6AA 4LF3A 3HAEH 5D2NE 1BOGA 2RFXB 3CUPA 4S11A 5J4MA 2KKQA 4JAMB 1TZGH 4OQTA 4PJIB 4JZNB 1GC1C 4ODVL 4U6VL 3S34H 3CIQA 4PJ9B 3RZCB 3WFHA 3WIHL 3I3DA 3T1FB 4HUXA 4OGYH 3MRFA 2D7QA 5F7WC 4AMKH 4KUZH 3ZSSA 4I4WA 4Y19D 5GHWH 2I9TB 1X5HA 2IAMB 4Y4HD 3MV9D 2BSTB 1F4XH 5IVXF 1IAIH 4OJFL 3OB8A 5EZJA 2HVJA 1U8HB 4IRZH 5I17B 5MEOA 2F58L 2W59A 2L0DA 4EVNA 5C71A 3H9SA 4JQVA 3UJIH 3WFCL 1WFOA 3C9NA 1KJMB 3K1KC 2WBJC 4RCAA 1XMWA 5KW9L 3QDMA 1WZMA 1L7TL 3TWCH 1AXSA 3HNTL 3WS3A 2E7MA 3MLVL 4QXTB 4LPWA 5JDSA 2NX5B 4PJGB 2R4SH 3P0YL 2CK0L 2Z4QB 3LN5A 4O02L 3VJ6A 1KN4H 2F8OA 1LGVA 1M71B 4ZUVB 2QJDA 3OPZL 1BD2D 2X4OA 2X6MA 5D72L 4P3CL 5HYSG 4PJBE 3BP6A 5A2LH 4O58L 2J8UE 5HPMA 3BVNA 1JL8A 4FRWA 4LSSL 3D85B 3I50H 4PD4K 5I2IA 3DOSA 4IOSD 2E8ZA 2NXZD 1IGCH 1WFUA 2ESVB 1JV5A 1GIGH 3VRLF 2RHEA 3QEUA 4H25A 5KVMC 2MKWA 4G80A 2FDBP 2C3HA 2BVPA 1J8HE 3ARBD 3TBSB 5KSBF 4MD5B 4GAYB 1S3KL 2NY4B 1WJ3A 1AXTL 3WNMA 4PJIE 4HLZH 1IKFL 4HMDA 1MCKA 4IRSA 3QSKB 4UIMA 2YWYA 3EDDA 2E27H 4ZNEE 2A74A 1YEHH 2B1AL 1K2DB 2QQQA 3NIFE 1MJUL 1UXSB 8FABB 3HC3H 5K9OB 1U3HA 1XR8B 2HJFA 4PPTA 1NBVL 2I60H 3F6IA 1NGPL 2FL5A 4I3SL 1E28A 4HZLA 3QDGD 2O61B 3T0EA 5IW1A 4YWGH 4GXVL 3T2OA 1KCUL 3IFOB 2H3NA 4PJHF 3KPPA 3PABB 5C0CB 4U1IB 1PZ5A 5EBGA 3GSNL 2NX5E 4PJGE 3SBWC 2IALA 5EBMB 4JM2B 3FQNB 3ZE0F 4KZEL 4LLQB 3VDBA 1CICC 4XWGH 5CIPB 1UJTA 4X4YA 1BFTA 1AQKH 5DJDB 1N2RA 3GMRA 5D6DA 1N5AB 4BZ1L 4N5ED 2ZG1A 2EDJA 4JVWA 3LB6D 5CINL 1KLUB 3BYTA 2DQEL 1IAKB 5D7LD 2ESVE 2H9GA 1QSFB 3PF2A 4GRMA 3L3GB 1AJ7H 5FA4B 1FE8H 4LRIA 4M7KL 3F7VA 3MACH 4WFHE 5LGJB 1KCVH 3KPOA 3AMKA 3L7EA 3GMPA 3L5XL 3GMLB 4LASL 2HG5A 4Z7QE 5C6TH 1QRNB 1QFWM 4MHHI 3CCHA 2E6PA 1UM4H 1LDSA 1HI6B 4NM8H 3S5LA 1GPOL 4OCWL 1MCPH 4YGAB 2A73A 4RA3A 4G7VH 2EZ0C 1C12A 2CKBA 2YC1B 1DVFC 3ZKND 2XKUA 3MV8B 5C0EA 3E2HB 1FO0L 2NZ9D 5D1ZD 2JJTC 3RPKA 5E8NA 3T09A 1MHHB 4XPAH 43C9B 1MUJA 4XB8A 4XWOD 2YD2A 5DA4A 5KG9A 1XIWB 3RVUD 1QLEL 2VZVA 1GOHA 3MFFA 1R3IL 3GSXB 3VXTB 4B7LA 5C0CE 1L9MA 5E00B 5TE7H 2VLKD 4YHLL 2G75B 4PRPB 3I6LE 4C59B 2GITB 1XT5A 5KN5B 2AK4A 4U0QB 2GFBA 1FL6B 2JJSC 3AXLA 3QJHB 5J1AA 1T5WA 4EN3B 2PYEA 3O0RL 1T2JA 5ICZA 4AG4H 3MJ7B 3VFGL 1CFSB 1I9RL 2WBJA 1NAMH 1KPUB 3L3DB 4M6OH 4U3CA 4UBDD 3VI4F 5ESVA 4M1DH 4XMPH 2BNUA 3D39B 2H1PH 1QSFE 5T5NF 3UAJD 5DJ8B 1OF2B 4RX4D 1BIHA 3QULA 1NCBL 5FYJH 2PCPA 1SJHA 1LDPL 2DJ4A 3DBXB 3RUGF 3FQUA 1GGIL 1CDIA 4OM1H 4QTIH 5DJZB 1LEKB 1IQWL 1QRNE 5TE6H 1RIVH 4U6YA 1ZGLM 4LFHD 3OXRA 3DGCR 4X7TA 1DQMH 4AEEA 1WZ1L 4DTGH 2J2ZA 4NUJA 4G9DB 1WISA 2P8LB 4WO4B 1O7SA 3MRJA 1MVUA 2BVEA 3KPNB 3MV8E 5FYKU 4QHNA 5D93C 3MREA 1JHKH 1U91B 4CMMA 3B43A 4JG0H 5JNYA 2UVFA 3P4NA 5IHUL 2NY6C 3I02A 3UZEA 5JLZA 5EORH 3U79A 2R15A 4QRPA 4EXKA 4KJWC 5E5UB 3H2WA 1T03H 3B9KB 1AP2B 1C1EL 5IBLD 4XP6L 3ZKXC 4OQTH 4LHUG 4PRPE 4LCUB 3HE6C 5HGDA 2XWTA 2CIKA 1HKLH 4X8JB 2F53A 3IDXL 4FQJL 4FTVB 4Q58C 2A6DA 2QR0A 2OJEB 5AG9A 4G43A 2I5YL 3FQRA 4NP4H 1A6UH 1EFXB 2JK5B 3PL6B 5EO0A 3BSZH 4CW1B 1ED3A 3ZL4L 4NN7B 5MEPA 4Q6IC 3CFKB 2WWKT 4LEOB 3D39E 2GW5A 1BQHA 3SBWA 5I1CH 5EZOL 1VPOL 3PGCA 4NKOB 3NABH 4JREC 5IR1A 4C4KT 3OV6A 2L4OA 3Q6FB 2P7TA 2YXMA 4MA8H 1RIUH 1T4KA 4YHKL 2X89D 1CICA 3MV7A 1WSST 5DXWA 4G6KH 2NY0D 2VUOA 3EJYC 1FORL 4I8DA 5T33H 3ULUE 4MD0B 1R3KB 3DO7A 2EDEA 4AENB 5A1AA 5JOPD 3KLAB 4H8WC 3EYFB 5C2BH 4GG6A 3A6CL 3O9WD 12E8L 3O3EA 3PP3K 1HHGB 1OAXL 1XGUA 4J1UB 4M7JH 5DURD 1OP5K 3GI9L 4OLXH 3ROLA 1NDMA 2WQRA 1HSAB 3R1GL 4DW2H 3T65B 5ID1A 1S9WA 2PR4H 1TNNA 3RIAF 5IVZB 5BOPA 1Z5LB 4PG2C 4RSVA 4NQSA 4LCCB 1S7UB 1DVFA 5J3HC 3GGWA 1K8IB 1S8DB 5JW4R 1ZMYA 4P57B 2P5EB 2JJTA 4YHYB 3FOMB 3IDJB 4FTVE 3SKNA 1BFVL 5TDNB 4ZTPL 1U9KA 3QIBD 4XNZB 4JHWL 5JHLL 4L3CB 3QHZH 4YBLB 2B7DT 4ODWA 1OW0C 4DGVL 1K5NB 4L9LB 4EXPX 5BVJB 1AO7D 3O3AA 4WCYL 5BS0D 4JDTH 2XACC 5E7BA 3O2WH 1MHCA 3LOWA 4W81A 3FT4B 4YGVB 1T7VA 4HC1A 2VXSH 3EHBD 4TUJB 4UAOC 3HAEG 3BUYB 5ETUA 2VDQL 4OGXH 3WMSA 1K3IA 2H8PB 3PP4L 5JO5B 2MNUA 4XC3L 3W0WB 4WENB 1KXQE 2IG2L 3NCCB 2PW1B 4YDLB 3WO4C 3QXWA 3QCUL 5E08L 2CRIA 2JJSA 4G8GA 1RK1B 2OJZH 4XHQA 4ONFL 3I85A 4Z7WB 5JXED 3BZFA 1J18A 1D5BA 2DAVA 4MXVF 4NRZA 3JTTA 1VERA 3C8DA 1UXWA 1ERNA 1ZGLB 1WZLA 3MRRB 1U8IA 3IVKA 1BFOA 4TPRH 1V05A 1P4BH 1KTLA 3QXTA 2DQDH 1V7MH 2IQAA 3KYNA 5CLWA 1TJIL 3C60B 4S2SB 5LAXA 1I7RA 1GJIA 4OLZH 1UM6H 4NN5C 2G60L 3QNXB 5I8EB 1U2CA 4YK4B 3QQ4A 2IPKA 3BRDA 2AXHA 3G6AB 4Z7UF 2GCYA 3O6ML 2VWEC 3UTQB 1DEEB 2EEBA 1M7DA 4LRNL 1A0QL 2P5EE 3MNWA 1Q1JH 3W11C 3S4SA 2CKBH 1QO3A 2VL5A 5HDQH 3HUJB 3SQOL 3HRZA 3IDNA 5FYLD 5IHLB 3T3PF 1D9KB 3ZO0A 5HYEA 1JZ3A 3QA3A 5D7SH 2ATPB 2W9EL 3IGAA 3IJSB 4BQCA 2RJMA 4OSUH 3DMMD 4M6AA 5T3XE 3GBLA 1MFEH 4XPFH 2AEPH 1I3VA 2ITCA 4QRQA 5D7KD 4NCDA 5LWYH 4ZMAT 1MFNA 3HE6A 5DJYA 4XT1C 3W0WE 3LRSA 5FB8A 4NRYB 1A9BA 4KRPB 4HLZG 2DQIL 4YDKL 4Z7WE 3DGGA 1FFOA 3KPSA 4AH2A 3QXVA 4JFOA 3PWVB 4Z5RA 2G9HB 1LILA 3NTCH 5IK3B 1G7PB 3NH7H 4Q6IA 1I7TB 4MGXA 3VG9B 5JPMB 2N1KA 4ZPTA 3O11B 4U1JA 3CAFA 5TGBA 1BVKB 4N0UA 1FNGB 2FLRT 4J4PD 4ZDHB 3W9EB 4B5EA 4QHKJ 4ZS7L 1I7ZA 2Y36L 5C0IB 4RISL 3PWNA 2VIRA 5IEHA 1MWAA 2O5YH 2BOCA 5HD8D 4JQIL 3U4BL 1A6PA 4ZOCA 5SX4I 2ENSA 4QLRA 1IGJB 5I75B 2EECA 2ICWJ 3S3SA 1UM5L 1WTLA 4DKFL 1AHWC 1IM9D 1BGXL 2V2XA 4M93C 5FUZH 3V4PH 5DRZA 4PB9L 4PJDF 4P2RB 1WFNA 1KBGL 1DN2A 3CZJA 4JRYD 1AE6L 4PR5B 3HUJE 3LKQA 4BH8B 3U46B 1TZHB 2HRLA 3ARFB 1IZKA 3H9HB 4LNRB 5E6ID 4UB0L 4UT7L 5SWSB 4LLMA 4I3RL 1W0YT 4D9RD 2MJWA 2ARJB 3BN3B 3E8UL 5GGRB 2Q76B 5EA0L 3RNQA 4ZFGL 3DX7B 1A9EB 3SDDA 3GHEH 4HK0A 1LD9A 5B39G 3J8F7 2FWOB 1T66C 4UT6L 3PQYD 1OAZL 3O3BA 3REWB 1JWSB 3HE7B 5GGQH 4RDQF 5IG7B 4WI9A 5DJXB 5LQBL 2SEBB 2ITDB 5C86A 1D6VL 3WD5L 1OW0A 1ZHKA 3VFUB 4XMLH 2Y06L 4MA7H 4KUCD 1DQDL 1YNKL 1U41A 4X7EC 4X6CA 5EU6B 1DP0A 5FO8B 2GHWB 2AJUL 3PDGA 3ZDXE 3ZKQD 5F9OH 2YXFA 4UMGA 5MI0B 5F7MC 3BKJL 2VC2H 3ZHLA 5I0ZA 2ZJSH 3PDDA 1L9NA 4ZFFA 2CO7B 4UQ3B 4WUUB 3MCKA 4FFZH 3JXAA 2CPCA 5DFVC 3BDYH 5HDLA 3GSUA 3JZ7A 4ZUTB 5GISH 3IXTB 1YPZB 5I8OL 4CGTA 3FT2B 1SJXA 5DFWH 1T0NA 1TXKA 2WV3A 2VLLA 3GSOA 1MJ8L 3MBEC 2PXYD 2D7TL 1KOAA 3S9DB 4P2RE 1C5CL 1M05A 1NUNB 5IMLB 1WWBX 4IJ3B 3MLXH 5K93A 5SX4H 4Q2ZB 2YR3A 4KJQC 4HZAA 5FM4A 5SWSE 4PLNC 3VXRA 5CEXA 5I1EH 4HS3A 4LCIH 4EUPA 4KXZI 5FYKD 4QGTA 1AFVH 1KCKA 4S1DD 5FO7B 3AC0A 4LLYB 3ARDB 1W2KT 4HUVA 2Y4SA 3PDOB 2C5DC 1HXMA 4XXCC 3FRUB 4XP9H 3P11L 5L8KB 1G7IA 2C3WA 2NY1B 5IBUG 4UV7L 2CRZA 4ORGB 4S1RH 3O4LD 3MNZA 2HLAA 5EU7E 2YMXL 3QUXD 1HQ4A 4NKDA 3OJDB 2BSED 5E03A 4R90H 1F58L 4H0IA 4LDOB 3LKOA 1UACH 5DD6B 5EU6E 5KJRL 3GUTB 3VXUD 4G8EB 5I16A 1IC7H 3RGHA 4PFEA 1IEAB 4WY7L 4OFVA 4PRAA 2V7NB 5IB4A 3LSOA 1VB9A 1Y0LB 4HC1H 3K8LA 4PJ8B 4JJHA 3M17A 3JV4A 5HJ3A 4WU5A 1N5YL 1U6AL 1S7QB 1A7QH 4L8BB 4WUUE 3TJEL 4C56B 4LAQH 3CSYA 1WK0A 4GG8B 4HUWB 1YPZE 5ITFA 4JO1L 1ZA3B 2EDKA 3MLTB 5T5FH 2XQBL 1RJLB 3D18B 3QI9C 1EPFA 3CXDL 3ZLQC 5E8PA 1KPVB 2VDOL 3WHE1 5KOVC 1D5MB 4Y5XC 2FJHB 1U3ZA 2XZQH 1CWVA 1FPTL 4IOIB 1VFBA 1FZJB 1I8MA 4KJYB 1PKOA 1FFNA 1JPFB 1KLGB 4LHUB 1M1SA 2QKIB 4MDJA 5E2TH 3DRTA 4YBHA 2YSSA 3TPUB 3OKYA 8CGTA 4N0YH 1NAKL 3WXVL 4MMXC 2Q6WB 5JHDA 2DJUA 3PP3H 3HZKB 5C0BA 4PBVC 5FKPB 3UTSB 5CHNA 1OP5H 3A6BL 3O41A 3FJTA 1OTSC 4RQQB 3HI6L 1TITA 1X5ZA 1J5OH 1EUTA 3G5XB 4M5ZH 5E1AA 4OM0L 3U9UA 3TBYA 3DX6B 4QT5A 5F9AC 3N85H 3O2VL 5FYJU 3T4YB 1CXKA 5GIRB 1G7MB 3V6BR 2KPNA 1A7RL 4XAWL 4OGAD 1F3JB 3SDAD 1GSMA 1OM3H 2KL6A 3S36L 3GB7B 2CLZB 4PS4L 4TRPH 3PWUA 4Y7MA 3VWJD 3OBAA 4L8SA 4DK3A 1BZ9A 1E4WL 1MFCL 3T3ME 4DCQA 1QLFA 4XRCA 1RMFH 4C56E 1FVDB 1WV7T 4MNQA 4F7TA 1Z2KA 2MHAB 3EZJB 5D7JB 1AD9B 1GZPA 4RMWA 3MUY1 4U1SB 2HMID 3BESR 3GKZA 2R56L 2DWDB 1UZ8B 2HH0H 4X5XB 5DJ2B 4ZPVA 4MD4B 1QR1A 3BKML 5C92A 1E27B 4GKNB 4H1LH 1NC4B 5HI5C 5FUOH 1DUZB 1TCMA 4JKPH 2DLGA 5D1QB 3KWWA 3ILQC 1MWAH 1U8JA 2CGRL 3VWKA 1CN4A 3GK8L 3IDGB 3JTSA 3QRGH 3JWNC 3OKEA 1DQQA 1CGSH 1T0MA 3NIGF 2DI8A 3BQUB 1AKJA 3E6FB 4Y4KB 3UTSE 3VMOA 2RQ8A 5JIIA 3D2UA 2PTTA 4NO0A 1FNHA 4H8WH 3ULVH 5DRXB 5I8CB 1O5DT 3HAEB 2LVEA 1ORQA 1FQ9C 1UH4A 3I2CL 4LU5H 3V6OE 4XH2B 1RUQH 1A21A 4I48B 1GHFH 4WW2B 5FK9A 1OP9A 3V5DA 2R9HC 4LOUC 5DQDH 2F5BH 4HT1H 4HQQL 4FXKB 1I9JH 1QHOA 4XXCA 5D1XC 4Y4FC 2E9JA 4P4KD 3TBTA 3MA9H 4EI6A 2NPLX 5ESQB 5FGBC 3F58H 2UZIL 3MBXL 1A2YB 4HFWA 1MREL 3LKSB 4EI5D 1AGCA 2ZUTA 4GRLD 4NT6A 2FR4B 4NZTL 4HEME 4FNLH 4LPYA 3CNKA 4XVJL 4AL8H 3S5LG 2GTZB 3U7WL 5ID0B 4DN3L 1R3JB 3OKOA 3UXFA 1MAML 4UINL 2K3TA 2EE9A 4BELD 5EOQH 1NMAH 1K6QH 3MRLA 1DBKH 3QIWA 2DYPD 4D0DB 1I8KA 1S5IH 3T8XA 3TZVC 3ZDZF 2QQKH 2FEEI 1T1YB 2E6QA 3B2UD 7CGTA 5KSVB 1OWWA 3X14A 3QCTH 1Q9LB 5ICXA 5BCAA 5DUPL 4X6DF 5H2BA 4WFFE 2AV7B 2VDNH 3SGDI 1HSBB 3QI9A 4LSDA 4QO1A 5GSVA 5SV3A 1R3LB 4K94H 3RY4A 4Y5XA 4ZXBA 4MXQC 3LZFH 2MPAH 4WIQA 2ORBL 2AKRB 3SDXB 3UO1H 1EBPA 1KEGL 1PX4A 4FOMA 4OKVB 5C0AD 5CJQL 3LQAL 4S0SD 1OWRM 3T08A 4GH7B 1MCDA 2C1OB 3LQZA 1CXIA 4FQXC 2VR9A 4Z7VF 5EO9B 3HNSH 3T77B 1A6ZA 3P30L 1PBYA 2WK2A 3KR3L 5L7XL 3IFPA 4AT6A 4Y2DB 4EUPH 5JW5A 2VN4A 3FONB 1OTTD 4FQ2L 2VZTA 3QHTC 2VDKL 4EQ3A 2ID5A 2AK1L 2W9LA 3H7BA 3RWHB 1KTDB 3TFKC 4G6AD 3QEGH 4JPVL 4FMFA 1L0YA 1B2WL 1HHJA 2JIXA 3GBMH 3ULUL 1QBBA 2P8MB 3U7AA 2VDPL 4F15B 3PG2A 1RJYA 4ORZC 1E6OH 2V9RA 1X5KA 5CILL 5JTWA 3C5JB 2A83B 3KYOA 4HJJH 4JRXB 4X9GA 3KAAA 4PP1D 4EOWL 4KK5C 5CS7A 4N0FB 1GGBH 4MQTB 4LARH 3WFBH 4KK8D 4Y1AA 1L7IL 3WDHA 1WBXB 4ODUB 1YMMA 1I1AD 5I71C 2BVOA 4PJ5A 1MIML 3NCJH 1F02I 3ZKSD 1JYNA 3R8QA 1T7YA 5C07D 4Y16A 3HC0B 2EYRB 4HEPG 4J3WA 3I6GA 2QEJA 5BV7C 4F8QA 1R0AH 5TQ2L 5DK2B 1N3NA 4GBXC 2P48B 4P46D 4JB9H 1IC5L 4F58L 1ND0A 4CN4A 5B38A 1YEIL 3SDXE 1J10A 3GRWA 4PV9A 1NMBL 2UWEB 3E6HA 4UI2A 1QZ1A 5IIEA 2BOBA 3ZHDA 1TTUA 1Y6NR 3FKUS 4GKZB 3SO3B 5B39B 4W68A 4JO3H 3V0WL 3WIIH 4QTHA 1V5JA 4G9FA 5IVXA 4U1HA 4P23C 1TTFA 1S78D 2YRPA 3TO4C 5HHOA 1BQHG 4Q9RL 3RPIB 2OI9B 3MR9B 2XTJD 5DMKB 3BZDA 3WNOA 2PO6C 4EBQL 3QFJA 4I9WD 2GJ6D 3O8XD 5BJTB 3FHQA 1QFWL 3ZTNH 3REVA 1KTKE 1IGYB 5IF0B 4P5TB 5IB2A 1AQDA 1V7NL 3TIDB 3UCRA 5KVDH 5MP6L 4Q0XL 4OLYL 3QUZB 4F57L 3G5ZA 4JRXE 4BM7A 2X4QB 5D1XA 5CP7B 5HHMD 5EDXA 1P2CB 1RK0A 1T80A 2EH8H 3MYZA 4JJ5B 4QHKI 3GSVA 4H88L 3CMOL 3QPQD 3ZE2E 1IC4H 5E5MA 3FL7A 4NQEB 1NGXB 3CD4A 1TCRB 5EUOF 4K9EL 4XCEB 3BP4A 1ZHBB 2DWEB 3QQ9D 1AGBB 5BXFB 3L3HB 1C5BL 1FG9C 1OGAB 4DFIA 2D03L 5ALCH 1G9MC 1MY7A 1FJ1B 3GKWH 3GIZL 1N6QH 1PLGH 3SQBA 4K7FA 2XA3A 2RGSA 2DTMH 1WWAX 3FMGH 2UWEE 4QXGH 3DECA 5CMAA 3SCMC 3PWJB 1G7QA 4M7LT 5T3XL 1QBLL 5C8JB 3BD3A 1OPGH 2FRGP 4P59L 5IBUB 2FZ3B 4HUNB 4Y0GA 3T0VA 1NCDL 2NTSP 3FTGA 5GGSB 4GW4B 3F5WA 5GS1C 1F2XK 4PRDB 2MKLC 2BRRL 4M00A 5EU5B 1QNZL 5DDHB 4LLDA 4HKJB 5F88A 2OZ4L 4F2MB 4PJHA 4PRBA 3TCXA 1KNOA 2MCPH 1F97A 2DQJH 4Q9QL 4G6FB 2VLJA 5ALBH 4YNYB 4FQXA 1PVHA 2F54B 4ODXB 3IJHB 4YUEL 1FV1B 3QNZB 3OKNB 5HYJA 3DVGA 4KUCF 3D3VA 3QFDA 3QUYB 1TDQA 4EDXA 3RX8A 1BOGB 3CUPB 3KLSA 4EJ1C 2FX8H 5CGYC 4FFVD 4NUGL 1LE5A 2ZCKH 3BPNC 4L4TD 3BKCH 3UTTD 1RZKC 3MRFB 5FYJD 1F11A 2Q3ZA 4Z18A 1XF5A 2IAMD 3KPRA 2VISB 3CSPA 4NQEE 5DMYA 4HG4J 3C6SA 4H5SB 1JYXA 5E2VH 3V7AG 3QO1A 1MAJA 3QIUD 1OGTB 4F7CA 5CEZE 1CK0L 2A9NL 4I3GA 3FFDB 2BSSA 3OXSA 1OGAE 2ZOLB 5MEOB 4OZGF 3BDBA 4Z78A 5GZOD 4KK9D 3BZEB 3BJ91 4FN0A 4LSRH 1H3GA 25C8H 1R5IB 5C09B 1VGKB 4IIQC 2EIZA 2XQYK 2VJXA 1BLNA 5GQBA 1X7QA 1LK3L 1OAKH 3S97C 3O6KH 1MFDH 3JUYA 3PWPA 3ARSA 1FRGH 1OT1A 4WTZA 1SJEA 4P2CG 4XCYA 1KFAL 3B9AA 2OBGA 2VR4A 4GBXA 1JN6A 5FM5M 4A6YB 3ARQA 2FATH 1RU9H 3K2MC 1U8PA 3U30C 2C1PB 2ESVD 1TJHH 4YO0A 4W6YB 5BQ7A 3L3OA 4JPWH 1UEMA 5KZCB 1JV5B 3FB8A 4MAYC 5GGTA 2LAGB 4NC0B 1U0QA 4NKIL 4NQCB 2F54E 1MH5B 3F65A 3WFEH 3X13A 4JPIB 4P23A 2R29H 2NY4D 1T1ZA 3TO4A 1EJOH 5I15L 5AYUL 3TT1L 2FD6L 2R1WA 1DE4B 4CU6A 2QHRH 1JNNH 2XN9B 4M48H 2XWBA 4XNYH 3QDMD 3WUWB 3FO1B 5IW6A 3Q3GA 3DYMA 4KDTC 1XGPA 2A74B 2ZSVB 4B50A 4NZUH 5JOEA 4WEBH 2X4SA 1Q94A 4JFYA 1U3HB 2F74A 1ACZA 3RUGA 1JGUH 1HHHB 5GJSL 1GOGA 5IB1A 9CGTA 4ZAKA 5I1GL 4Z95L 3F7RA 1QP1A 2FJGB 4HCRA 1B0GB 4HIEA 5C09E 3MOAL 3S7GA 3V52L 3I6LD 3HG1D 3QXAB 5ILTL 3KXFA 4ELMB 2VB5A 1PZ5B 5I9QC 5L0QB 2XFXA 1XGTB 4HH8A 3QEHB 1TFHA 1A6VL 4ZUSB 4U1MB 4Z0XA 1BAFH 7FABL 3RIAK 1BM3L 5F6IC 1H8SA 5KSUB 4X4YB 1ZS8A 5MHSD 3KJ4B 4R4ND 4RFEA 3SEPA 1RUAH 3KHOA 3ZT6A 2AQ3A 4I2XB 2Z92B 4XI5C 1INDH 3VA6A 3SCMA 4IRSD 1P7QB 3M45A 2MSPA 2B1HL 4PJEF 3FOLB 1DCLA 4U1GB 3LCYA 2H32H 1QYGH 5INCA 4R7NA 1SY6L 1TPXC 2YD3A 4NQCE 3GMOA 3GRWH 5T1DH 3ARRA 2AJXL 2XY1A 1PZUB 3TNMA 5CJOH 3Q6GH 4BK4A 3OKDB 4Q9CA 5GS1A 3FO9B 1YDPB 3T0ED 1B0RB 1OD7A 4KJPD 2XN9E 2A73B 2J8HA 3QZWA 3MO1A 4JFHE 5IFAL 5IBTH 5ECJE 4LQ1A 1NCCH 3BT2H 2GY7B 2HN7A 2X1WL 4K3EH 5E2WL 3CFEB 1JZ5A 4TSBH 5DK0A 1BQLH 1BECA 1A4JA 4YFLI 1CZ8H 1NKOA 2GAZB 3MRBB 1J0JA 5F9WC 1RAMA 1RFDL 3KVQA 5CFHA 1XIWD 2AJZA 4JFDA 4XP5L 2BERA 1EH9A 2ADFH 4M62L 2R0WH 2JELH 3LD8C 3CMGA 4YBQD 4APQB 2G2RA 2NY7L 4JO2H 3IAPA 4AJ0A 5GJTL 3OG6B 1CIDA 4ELME 3BP5B 1MCHA 3TJHC 1RZJL 4OLUH 4QRSB 5AWNH 3V6ZB 4EUPG 4D9LH 1DBJH 1MAKA 2HLFD 1YEFL 4YXLH 1T7ZA 3TBVA 3HI5L 1QFOA 1JNJA 4Y2OA 1U92A 1NCWL 4QRTA 4K8RH 5I8KL 2P5WB 1R5WA 3UJTH 4I2XE 4UILL 1LNUB 3NFSH 3S8WA 4A2LA 4IIQA 2A38A 1MRFH 1JJUA 1RVFL 1RUML 5FO9A 5HDOA 4D0CB 3NIDE 1QPXA 4Z7NE 1QFUH 2VTFA 1P4IH 1AD0A 1YECL 4F33B 1RQ5A 3DUSB 1V3JA 4W4OC 1ZVSA 1PAMA 1PSKL 1MRDL 1OSZB 2IFFH 4HUKB 1Q72H 3BKYH 5C0RH 4M5YL 5FDYA 1WVZA 3HR5A 3FB5B 4O5LH 3OXRB 5DJ6A 1OT2A 4WO4D 4NUJB 2I07A 3C2AH 4KQ3H 4RIRA 4MAYA 2W60B 3MJGX 4OTXL 1FH5L 5IHBA 2AV1A 4YQXL 1U8QB 5D96C 1E4XL 3LN4A 3RJDA 5ERWA 2Y1VA 2Y07H 2NXYB 3K0WA 1CR9H 1KPRA 3U83A 5EPMA 5ENWA 2AK4D 4S1QH 4QHUA 1Q9KA 2GSGA 3L3KA 1FZOA 4ZQKB 5DEZA 2PYED 3ARBC 1U42A 4X5LA 1AIFB 4CADB 3HZMA 5JLZB 4MMZC 4OV5B 5DRWA 4YC2C 4YDIL 2FGZA 1WT5C 3RWCA 3IFNH 4FQQB 3BRFA 3RDTB 4A2MA 3OKLA 4JG1L 4KDTA 4V1DA 3B9EA 1MCWM 3C8KA 4ETQB 3HMWL 4QRUB 3BE1H 3MJ9A 1Y18A 4GSDL 4UDTA 3HNVH 4YX2L 4B41A 1EFXD 3IKCB 4PJ7A 2F8XC 3KGRA 1KSRA 3PL6D 3FQRB 1OSPL 2P5WE 4ONHA 5I19H 5LGKA 2HVKB 1U8MA 5DD3L 4ISVA 3X3FL 2WINB 3L5WA 4Z7UA 2ERJB 3SKUD 4GW5B 4O9HL 5EWIL 4WI8A 3DPBA 2E8YA 5DTFA 4BQ6A 1BQHB 2OTUB 1SYSA 5JMOC 1FGNL 2BMKB 3MROA 3ABZA 5IR1B 1LE9A 3KPQA 1F4YL 2B5IB 2P7TB 1RSFA 5TPWL 3CX5J 1P7KA 4HPYH 5T1KA 1JZ2A 1ZT1B 5KOMC 2A6KB 3EYVB 1SVCP 2AEIT 1EUUA 1AI1L 5TFSH 2FSEA 4QRPD 3VXMB 5BV7H 4ZFOA 3DX9A 2GJZA 1BBJA 4LVOB 5EOCJ 2I25N 5L6YL 2NTFA 5TDOA 3DUUB 1MF2L 1MI5A 5EO1A 2F53D 1NCAL 3SY0A 3KS0J 4WV1B 5F71A 3BGFB 4QOKA 2CLRB 3BEWA 3HN3A 1HILA 5E4EC 1D5ZB 2WP3O 4PV8B 4NYLA 4KTEL 2E9IA 1S9WB 1T5XA 5L9DH 5FCUL 4NKMA 5ITBH 4DKAA 2I27N 4EDWH 1FIGH 4PRNB 4X99B 4NNPH 4CL7A 2VSDA 2V5YA 5DGQA 2IH3A 3G6JF 4KQ4L 2P5ED 5F7EH 5F7NC 4QGYA 3KNBB 1BZ7B 1H0DB 1YYML 4GFTB 1NC2D 3OR7A 3CFBA 3W39A 4ODWB 5I6XC 3GZKA 4N8CH 2BVQB 4ZOBA 5BZWB 3MLWH 3U36B 1NMCB 2BNQB 3PV7A 3VGFA 1YEGH 4NZRH 4LVNB 3VD7A 1A1MA 3GM0A 4I0PC 3W0WD 1TZGL 3D9AL 5HY9A 3O3DB 3S34L 4PJDA 4HCRH 4KKNA 4GOSA 3X11B 5TH2A 4OGYL 4Y19A 1BQSA 2NY3C 1RV6X 4AMKL 4KUZL 4RMVA 5GHWL 2D7MA 4WWID 4OCYL 2FECL 2R4RH 1F4XL 3JTTB 1UXWB 4WUKL 3LN9A 3MPCA 2EZ0D 3GSRB 4G3YH 3QUKA 1H15B 4POUB 4YR6A 3VXME 4HIHA 1MY5A 1DVFD 4CN6A 3KLDA 3V2AR 5F9JA 4P5KB 2YHGA 4M61A 5I30L 2X70B 4QXUH 1NEZB 2YPLA 3VFPB 3C60D 4W4OA 2LV4A 4H20H 5LAXB 2AGJH 3H9ZA 4JZJC 4AEHH 2R4SL 4FZEH 3FRPA 2A6IA 1H8OA 4NWUH 1I9EA 3QQ4B 4J8RB 4GKSA 4E41A 3R0MA 3BP7A 3MGTB 2Y5TA 3SPVB 5IOPA 5EZIH 4OCRL 4PP2A 3UTZA 2ADGA 3LEXA 1NLDH 4MJIB 4DK6A 5T3ZD 1QO3B 1IGCL 1GXEA 3CZFB 4G8GD 3HRZB 3QWQB 3IDNB 1VENA 5HVFB 1JGEA 3ARBA 4GAJH 1VFOA 4OD3L 2BNQE 1P84J 3BX7C 4ALAL 3AU1B 2ITCB 5DWUL 1A14H 3RWDB 5F70A 2FYYB 3DYPA 2W65B 4OKDA 4X6EA 4NQDB 1QVOA 4MDIA 5FB8B 4M3JA 3LMJH 5T1LB 1VFAA 1EGJH 1REIA 2QLVB 4PJBF 2X4NA 1QQDA 2J8UF 2EYTB 1BX2A 4IM8A 5DSCB 1GAFH 5J6GB 4U1JB 5IQ7L 4H1LB 1NQBA 5GS0C 1J0HA 2A9ML 5JW3H 3BUTA 1NBZB 3IJYA 4N0UB 3G9VA 1YA5A 4NO2A 3VRIB 4X9IA 3AAZB 3LS4L 1A1OB 3RKDC 3AS2A 1JUFA 2BOCB 4MS8C 3UC0H 3BGMA 5F72S 3KDMA 4JLRB 1CLOL 2NY6D 3HMXA 1I3RA 3TO2A 3TN0B 4PJIF 1U8NA 5E8EB 4KJWD 1I75A 1ZEAH 4DVRL 5CJ5A 4XCFH 5EUKA 3ZT7A 1AQKL 2D0GA 4P2OC 3HE6D 1NL0H 2CDFB 1I4FA 3QO0A 5GSRA 3OMZA 4G7YH 4MJIE 3NIFF 1T89C 3QT2A 5F3HB 5DYOB 4QF1A 3KPSD 5DC4B 3WLWC 1FE8L 4JR9L 3AB0C 5EN2B 3MACL 2QQNH 4LLMB 5B38G 4JZOA 4AM0A 3RNQB 3P73B 2AJYH 5CBAA 3SDDB 4HK0B 1JGLH 5INDA 3U0WL 1OY3B 4NM8L 4RFNB 4NQDE 4CMHC 4PJGF 5HGHB 1MCPL 2R0LH 1S9YB 3OX8A 2WUCH 1VFMA 1HZHH 4WDIB 4EIZC 3V4UL 32C2A 5D1ZA 1B9ZA 1CFQA 5H35B 4X0KA 3CX5K 4OD2A 2V2TA 1X5FA 4OFIA 4ELKB 3EJYD 2ADIB 2ZSWB 4WFGD 4N0UE 1QSEA 5C9JA 1G1CA 4JFFA 1YJDC 3TBWB 3OKMB 1T04A 2AXGA 5HDBE 5I1LB 4ZO9A 5I1JL 1NGYB 2J6EA 2W0PA 3F7YB 4HIIB 4NPYA 3MCKB 3RWFB 2L7JA 1INEL 3OJVC 3K74B 4Z7QF 2NMSA 1DFBH 1N7ML 2C7UA 1NANI 5A3IC 2EDWA 4XC1H 4HS6B 5SV4A 3QEQB 5GS2H 2ZPKH 5CEZL 3U1SH 4AG4L 1MEXH 3ULVE 3P77A 5HYQA 1JRHI 1KELL 2EXYC 1M05B 4BSVA 2LTQC 4M6OL 1YN7A 2YD4A 2XXCB 1OVZA 5CUSL 3D0LA 2OLDA 2Q7YB 4G5ZH 5BVPH 4RX4A 2C3VA 3MNVB 4PREB 2HRPH 3BGAA 5GS3A 3VFRB 3MXVL 3VXRB 5CEXB 5AD0B 4EUPB 1VGEL 1WWCA 3UTPD 2HJLB 4QTIL 2YKLH 4B53A 4XGZA 4WWKB 5TE6L 1RIVL 1FG2A 1T2XA 4DTGL 3KYKL 4TVPE 1S9XA 4FXGA 2ZWLT 2XNAA 4NIKB 3ARGC 3MRPA 1U93B 2HLAB 3DV4A 1DUYA 4NKDB 4P2QD 1JGVH 5D2LF 4XMKH 4O51A 3D25A 3S37H 1RJZA 2OL3B 4OFYD 4IHOA 4MVBC 4MCYA 1JYVA 3B9DA 1MFBL 1MOEA 3GSWA 2AERT 1CVRA 1T1WA 3LSOB 4HH9B 4M9OA 3QWOA 1K4CA 4GMSH 4R2GB 2XTLA 3JV4B 5HJ3B 5IQ9A 2HTKD 4OQTL 1JWMA 2OK0L 4G8FB 4MX7B 2PW2A 2AVGA 4ZD3L 3L3JA 3VXQB 1FSKB 1C16B 4TQEL 2EKSB 2AXJA 4BUHA 5HYIA 2AABH 2WQ8A 1BJ1J 1A4KB 1I8IA 2VZ3A 4FQCH 4NFCA 2DD8L 5JQ6L 3QEQE 4NP4L 1A6UL 3ETBF 3BSZL 1QPPA 3V95A 3Q0HA 1JE6A 4OB5L 1ZTXH 1U8KB 4OLVL 3W11D 5LKNA 2W1NA 5DRNA 4KRMB 4IBLT 3HZVB 1EK3A 3PWLB 1ZXQA 5I1CL 1CLCA 3FFCB 1NANH 3NABL 3IFLH 2VLRB 3VXRE 1WTGT 5TF1L 1PY9A 4HSQA 3N50A 4U0RC 4LLVA 2X42A 1LO0L 2CD0A 3UZQA 4P2OA 5ANMB 4MNHB 3CFDB 5CHNB 5JUEH 4JO4H 2C26A 3JV5A 2AXFB 5B8CB 3WE6A 3FZUC 1T89A 4M1GH 3IDIA 4LKXA 4WTZG 3MXWH 4A6YL 2FO4A 3G5VA 5L88L 2DQTL 2D2OA 5CEYB 1EVUA 4M7JL 5C7XH 3PGFH 5DJ0B 1TVDA 3GBNL 4LLUA 4X6DA 4OLXL 2P47B 2Q86A 2PR4L 3CDGA 3KYMA 4L9DA 1GGTA 5MENA 5E1HB 5D6CB 1RZFH 1EO8L 2DQUL 3BW9A 3O4OC 4R96B 1Z3GL 4L8SB 2V17L 3W2DL 2H45A 2QSVA 1UJ3B 1ZK9A 4KKAC 3W5MA 2AQ2A 4JEGB 2CLVA 1RUPL 3P0GB 3O6FB 1KCSH 2HJKA 3U9PH 1ZV5A 3L7FB 1CFBA 1EERB 4FZ8L 4OUOA 4WI5A 4Z7VA 3ULUF 4HUUA 1ODAA 3BN9C 5J9PA 3IETB 2AQ1A 1TMCB 4GJTB 5C0BD 2F5AL 1KIQB 5T5NG 4JDTL 4P5MB 3O2WL 2IH1B 1FYTB 3BPLC 1HINH 2VXSL 4WJ5B 2D9QB 3C5ZB 3TP4A 5CZKA 3F62A 1S7SB 2HAZA 1RY7B 4MNGA 4MQ7B 3EKCA 3FFCE 2VLRE 3QAZC 2BVYA 4Q9BA 1H5BC 4JGMA 3WLBA 4FFYH 3VWKB 2OJZL 1LO2H 1N6VA 4IS6B 4ENEC 4UV4H 4Y4KD 3BQUD 1VESA 3MRMB 3HMXH 5ANME 5HVGB 4XNXH 4HJ0C 4IOFC 4BFIB 1AKJB 1T66D 2EYSB 2R0ZH 3D2UB 1T21A 4DEPC 2XQYG 3P40A 4AIZB 4TPRL 3UYPA 3MRIB 2NYYC 3CX2A 1P4BL 1IZJA 4R3SB 3N1GC 3T2NH 2NLJB 2R23B 4N5UA 4L5FH 2WAHA 4F7PA 5E9DB 2DQDL 1V7ML 3WIHA 3VFVB 1IM3B 2JB5L 3LKRA 3C09B 3D1MC 2J5LB 3A0OA 1HQRB 1XF4A 3JWDL 4OLZL 3AREB 3F8UB 3C6LB 4PJXB 4R0LA 3NN8A 4KI5E 2A1WH 3FB6A 2YPKA 4S1DC 2LFGA 5KSAC 1KGCD 3ARGA 3QP3A 4PGBB 2YUZA 4HFWB 1BVLB 3V5KB 3SOBL 5DFVD 5JW4M 3UBXI 1R3HB 2CR6A 2FB4H 4U1NB 4PLJD 1ZT4B 5HDQL 4YHNA 1SEBA 3QZWG 2YBRB 2D31A 5JW4N 2Z91A 3MBED 3LKPB 2FIKB 3U2SA 3QIWB 5DA0B 2VXUH 4ZO6A 4LPTA 3FAXA 4OZIB 2ICWB 3AUVA 1XZ0A 3T8XB 2AEPL 1FYTE 3MRNA 3FQWA 5CCKL 5DD1H 4OCSL 2BHYA 4M8QB 1HKFA 4KJQD 1XGYL 3T0AA 2PTVA 4RAUA 3X14B 4HWEH 1FL5A 5J06A 3U4EB 4PGEB 4O2CA 3H42L 1LVEA 4E0RA 2J6EH 1YQVH 2RB8A 4NJ9L 1CDJA 4KHTL 3TVMC 5C08B 1UKQA 3ZYIA 4LPCA 5GGVH 3NTCL 5DQ9B 4RA0C 4UTAL 3OWEA 3PGDB 4ZXBB 6FABH 1CD1B 1RURL 3IKKA 4WNQA 3PHQB 2AP2A 4OZ4B 4NQVB 1M6OA 2EE2A 4BH7B 2ADJA 3N1MC 1CT8B 2D7PA 3GIVA 3STLA 1RHHB 1FL3B 4TVSa 1FZKB 5E9DE 4J6RL 5EUOA 2QQLL 4F7MB 2R2EA 4XX1G 2DF3A 3HRPA 4CVZB 4HF5L 1IGTA 3BJLA 5ADOL 5SWZB 5I76B 2O93L 1NFIA 3N06B 2Z0BA 3IFPB 4PJXE 4AT6B 3IU3A 3TA3B 3EDEA 2F19L 4QYOB 4FS0A 4MZ2A 3U0TA 2G5BA 5C0NC 4K07A 4LSUL 4DQOH 2JIXB 4MAUL 4HWUA 3RWEA 4JRYA 3BMVA 2JLLA 5EZLA 5FXCH 5HHVH 1UWXK 3T2QA 3VFWA 4GS7B 3MCG1 1A7BA 4M7LL 5E6IA 3KLHD 3GSNA 5DI8B 2O5ZH 3QI9D 2EDQA 2FNBA 1IBGH 5IHZB 4YE4H 2O26U 4WVRA 4XAKE 4OZIE 5LXGH 5DEGA 1E4KC 1A6TA 5ISZD 4MZ3A 3VDAA 3GHEL 2N4IA 1P5VA 1BREA 4RGMC 3PQYA 3U0PB 3HZYA 3VWJC 1A1NB 4FQPA 5C1MB 3RFZC 3L9RA 1FZMA 3ECBA 2Q8AL 5C0FB 4NOBA 3BEVA 2QADC 3EDJA 1FDLH 4Y16B 5C08E 2F9BT 1F4WH 2APFA 2X5PA 3EO9H 4MA7L 3SJVB 2VITA 2H32B 2VOTA 4MSWB 3FN0H 1OTSD 1QLRB 3IDMB 4F7EB 5GS0H 4RGOH 4PV9B 1HHKA 4F3FA 3SN6N 3E6HB 5F9OL 1EX0A 5F7KC 2BOBB 3OKKB 3HUJF 4G42A 2YWZA 1AXIB 1IQDB 1CDCA 3WEXA 3JUZA 2APVA 3ZE1E 4C57C 1H5BA 5FUCE 5IVXB 2Y7QB 3CLEH 1FO0A 1OLZA 3BDYL 5DHVA 5SWZE 3FN3A 1V8HA 4OZGA 4JDVB 2ZUWA 4FXLA 5J13C 5I66A 4NM4H 1A3LH 2H26A 3PNWA 4OT1H 2PXYA 3BHBB 5GPRA 1X5LA 4LSPH 4Y1AD 1LEIB 2X4TA 3REVB 1BJMA 1YMMD 4PJ5D 4N0CD 3WHXA 1K8DA 3I3EA 2GYSA 3DTXB 4JFEA 1PEZA 4JFPA 2B4CL 3ZDXF 1L0QA 2CDEB 2QTEA 5I1EL 4M6MH 1RK0B 1W72B 4ERSL 1AFVL 5KSAA 2EEDA 4TUOA 1WBYA 5HI5D 1KYOJ 1ZSDA 2LU7A 4MXWH 1NEUA 3HKFA 5E94B 3MOBL 4G8IA 3TYGH 1JF1A 4DFHA 3VXSB 1JNHB 5CEZD 3IAQA 4YDJA 2OSLA 4S1RL 5DD0H 1ONQA 4W4NA 3ILQD 5DD5L 1EAPA 2DLEA 5HGAA 1EZVY 4GRLC 4PJAB 2GY5A 4LSTH 3IDYC 2VR5A 4PY7B 5KSBB 4R90L 3SJVE 2AEQH 2IANA 5HHOD 3BO8A 4K7FB 4DZ8A 1UWGH 4KHXH 3RBGA 3QFJD 1IC7L 1OARL 2EDOA 2OMBA 1UG9A 1YJDH 4JANB 4J3OC 1JHLL 2H41A 4U05A 4HX1B 4K3GA 3G5YB 4L4VA 5A16A 3H3PH 2E9BA 2CMRH 5IVXE 1CL7H 4KROB 1A7QL 3FB7B 1F8TH 1SYVA 4LAQL 4LOUD 3FTGB 3TCLB 3RNKB 1HH6B 4HWNA 4FQLL 5D1XD 1FBIH 4Y4FD 1MCJA 3EYUH 3QH3A 4AY0A 5DMGC 1ZT7A 4HXAH 4LLDB 1FVCA 5T5FL 1IEBA 1ZHNB 3K8KA 4HKBA 5I18H 1NJ9B 2YD9A 4G6FD 4POZC 1DN0B 2DIJA 2I9LA 1JVKA 2BC4A 2BFVH 3EYQC 5JPNA 4BA8A 1HCFX 2XZQL 4OF7A 2BK8A 5HYJB 5F1IA 2ENYA 1INQB 3RWIB 4PY8J 4Y89A 1YN6A 1MLBA 3SDCC 3WIHH 4QHMB 3CXHJ 3A67H 3VGGA 1XCQA 2DIBA 2X4RA 1S7TA 3TZVD 1QEWB 3WNNA 4WTXA 4RDQG 3CU1A 1FNEB 1RZ8A 3QDJB 4GRWF 3FRPG 3VXSE 4PJEA 5HGGS 3QO1B 1SEQL 2YZ1A 2W0LA 5HI4C 3DURA 5F6HJ 3UDWC 1J5OL 3BWAA 4XNQA 3NFNB 1S7VB 3WFCH 4M5ZL 3K8MA 4I18A 4PJAE 3OXSB 2GK0B 5KSBE 1KB9K 3QYCA 4Z78B 5KW9H 1RZ7H 2EH7L 3RGVB 1DR9A 1L7TH 5C0DB 4LBEA 1M7IA 1E4KA 4NO3B 3MLVH 5F7DB 4NCC2 4OF8A 1OM3L 2APTA 2CK0H 3P0YH 5JORA 4O02H 3VWJA 1BLNB 3MRCA 4OFDA 4XCCL 2VLJD 4LSVH 3OPZH 4LCYB 4P3CH 4P4RB 4J3VA 4ZG1A 2EE6A 1JHTA 4O58H 1SJEB 5CD5D 1T20A 4LSSH 4FP8L 1CQYA 4E42A 1G0YR 4X6CF 4PGZA 3S37X 3MFGB 3TNNA 4CVXB 3Q1SH 1XGQA 1MCOL 1JP5A 1DQJA 3QBTB 4XNMA 3W9DA 3ZTJH 1J1XH 1U2HA 4KKBC 3TFKD 3NVQA 4PTTA 4RNRA 5AZ2H 4YXHL 2VXVH 4N1EA 5FUOL 1S3KH 3X13B 1AXTH 2B39A 5HYJE 1CD0A 3ZE0E 3OAUL 3DX8A 4KK5D 2XN9D 3L1OH 2OYPA 3RX5A 5CBEA 5A2KH 5DC9B 4UNVA 3VGAB 2X9XA 2Z31B 5C0GA 2B1AH 1MJUH 3QDJE 1ES0A 1EZVX 4N8VB 1X6LA 3Q3GB 4CN1A 3VH8B 1G0XA 4MJ6B 2V2WA 3QQNA 3SE3C 4ZYKA 3ULVL 1I1RA 4GXVH 3GMQB 2X4UB 2B0SL 3I3BA 4OZFB 1DDHA 4ZAKB 3HCVB 5DQJA 2XZZA 4GBXD 2VQTA 1RUQL 3VMNA 1IGFL 5D2NC 3QG7L 1GHFL 3TM6A 5DQDL 1TVHA 4HIEB 4HT1L 4FQIL 1I9JL 2UYLB 1J0ZA 2BNRA 4NN6C 1CFVH 2XFXB 4LSQH 1EDQA 3QPQC 1KIRB 5GGVY 3F58L 2IFGA 1UVQA 1LHZA 1CFTA 4P23D 4GRLA 4PTUA 4Z0XB 1KN2H 3BH8A 4NHUA 4TVPL 3TO4D 1ZS8B 1WBZB 3LPWA 4RFEB 2ZUYA 3VFMB 1CI5A 2Z8WC 5CSZA 2PO6D 1GRWA 4N1CA 1P7QD 3RI5F 2DYPA 1DLHA 2YS4A 3NAAH 1DBKL 4M7KH 5BZDB 1AC0A 1UKTA 2BCKA 3GNMH 4NDMA 2HKHL 4BFBD 2DLIA 1Z9LA 5MERA 2QQKL 3GMOB 4LASH 4OFPA 3CC5A 2VRAA 3TNMB 5F1OB 3OHXB 1J11A 1U8LB 4OCWH 1NBYA 3CH1B 4POYA 1NGZA 1W0VA 4HMCA 3SKMA 1DQTA 5DHVH 3VI4E 5TE4L 5ADPH 4K94L 2CIIA 2HN7B 4J3XA 1QBAA 4XZUB 1CG9A 2MPAL 2IBBA 3NCYP 5F3BA 4NJAL 4R4BA 4RZCA 4QHLA 2GEEA 3GMMA 2VH5H 1UGNA 1R3IH 4UIKL 1R24A 4L8DA 5K33A 1X5IA 2HP4A 2G2RB 3ESVF 1YNLL 2H2SD 4KMQA 3B3IA 5FYKH 3SCMD 4PJ9C 3RZCC 4TTDC 1UWXH 2NW3A 1MCBA 3EOAA 2VDLH 3DXAA 3UDWA 1E4XI 5D7IA 4RMRA 5SWQA 2IAMC 15C8H 1QFHA 3QEGL 1NFDB 4PJFB 4D0BB 1I9RH 4KAQL 3NMEA 1AR1C 1CXLA 3VXPA 4F9PC 2D4DA 4QY8B 4AQ1B 2APXA 3GJFH 4Z6AT 2VNCA 1XH3B 2NQCA 2Z9TA 4KK9C 1NCBH 2FHBA 2XA8L 4Y5YB 1J1PH 3BZ4A 3G6JA 2OL3L 3ARZA 1QSZA 5IWLA 1GGIH 2K7QA 4NSKA 4GW1B 1YY8B 3WFBL 4L3EA 1I1AA 2OR9H 4WW2F 3HS0B 4JY6A 5J6HA 5FOBB 4JFDD 1OB1A 5DJCA 4AYFA 1WZ1H 3D5OF 4J3UA 5CGYD 5C07A 5DT1H 3DIFB 3PV6B 3CLFL 3MA7A 5BRZA 4PD4J 1FFQA 4JB9L 3MZGB 4N9GB 3WIFA 1F90H 2FEEL 4KPHL 4JE4B 1EO7A 2EO1A 4GAGH 5IHUH 4HKZA 3I6KA 1Q9KB 2GSGB 3CVIL 3G04B 4JO3L 4WFED 2VO5A 1XF2A 2P24A 2NY4C 4XP6H 2O5XH 3MRGA 4HHAB 3MMEB 3RDTD 4OF6A 4FQJH 1HWHB 3OAZK 2GJ6A 2I5YH 2YN3A 3SE3A 3QUMH 5D70L 1NFDE 4PJFE 4NRXB 4N90E 1G7JB 2WWKO 4BZ2L 3FO2A 5GRVL 5D2NA 3N1PC 3DSFL 1FAIL 5KAQF 5KVDL 4OQ1A 4NNXB 1KJVA 3TH3T 1K4DA 3MLRH 1JZ8A 1HHIA 4MB3A 5EZOH 3VFTB 1VPOH 4C4KO 3C5SB 1OAUH 5EU3B 4MAYD 3EDFA 5DTFB 2ZCHH 4NC1E 1QOKA 2HFEB 4YHKH 5B4MC 2HA1A 1IC4L 1LE9B 1FIEA 3UZVB 2W0FB 5EOTA 5EBWB 5T1KB 3W82A 1FORH 4JM2C 4XBEL 3O2DH 4IRJB 1LK2A 4LK4A 3ZMRA 1TVBB 3RL2B 4NQXB 4TUKH 5ESAB 4ZFZA 3DX9B 4R4FH 3UPRA 4KTYA 4WTWA 3GKWL 3HLAB 5IVOA 1N6QL 2CUIA 2Z8VC 4V1DD 1MI5B 4MCZA 5EO1B 1JWUB 3FMGL 3VFOB 3R1GH 2BXZA 5IMKA 4WW1B 1HILB 3VFSA 1OPGL 3THML 4MXVE 1LEGA 3PJSA 4PJBA 1IAII 4PRIB 2J8UA