4YAQB

Crystal structure of a computationally optimized pg9 mutant
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
214
structure length
214
Chain Sequence
SALTQPASVSGSPGQSITISCNGTSNDVGGYESVSWYQQHPGKAPKVVIYDVSKRPSGVSNRFSGSKSGNTASLTISGLQAEDEGDYYCKSLTSTRRRVFGTGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PG9_N100FY Fab heavy chain
publication title Redesigned HIV antibodies exhibit enhanced neutralizing potency and breadth.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 40
structure length 214
sequence length 214
chains with identical sequence L
ec nomenclature
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yaqB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yaqB02
4DN4L 3GBMH 5CUSH 2VO5A 1UKQA 3DV6B 4RBPK 3FONA 2IAMA 1RUMH 5D6DA 3IDYC 4ZDHA 1MREL 1VEPA 2E5EA 2JB5L 4XVUD 5GGUA 1ZT7A 2EIBA 1E4KA 3UPAA 4YBHA 4XPBH 5LGKA 1CYGA 3HRZB 2P44B 4KJWD 2V7HB 1RZJH 3C60B 4HKXB 3V4PH 2E9BA 5I1AB 5E08H 3LPWA 3RY6C 2D3VA 2ZSWB 1ZOXA 4OZFH 3CMOH 3T0EA 3S98A 4PJIA 5E1HB 4PR5A 5LQBL 1BM3L 2XT1B 3KDMB 4YHNA 3ZKSD 2XTJD 1YEIL 3BN9D 3BH8B 1R0AL 1CLOH 4AYFA 1JFQL 1KJMA 5DS8A 3ZE2E 1MPAH 3WXVH 3KXFA 2HFFB 2GI7A 4Y4HA 3ROOB 3AU1B 1AGDB 1YN6B 1JNLL 3O9WC 1MJUH 3GMPB 1FFQA 2XA8H 4PGBB 1T22B 4WHTB 3WIHH 3HA0A 4M6NL 3UZVB 3V0VB 4XWOC 3O0RL 5CP3A 4NN5B 1TITA 4M7LH 3ZSTA 1KN4H 4GQPH 4KC3B 4F37K 2LU4A 1JWSA 3HC4L 3VG9C 4C57C 2YMXH 3MGOA 4EI5D 1PKOA 5DK2A 2PYFA 4FQ2L 4RZCB 4JRXB 5A2FA 1M7DA 4W6YB 5CJ8A 2DAVA 15C8L 1A4JB 1NEZG 2FHBA 1NGQL 1FN4A 5H2BB 1QSFA 2E9IA 3BPNC 1JK8A 3F7RA 3RWJA 2AJ3B 2Z93B 3B83A 3IDIB 1T2JA 4JFYA 1CBVH 4HZAA 3S35X 4KRPD 1BIHA 3ZMRA 2NLJA 4E5XA 4P59H 4I4WB 5MI0B 1CZ8H 4NOBA 4R4NC 4U1MA 5I1LB 5F8RC 1DQML 1RUKH 5D1ZA 1AIFB 4OIAA 5C0DB 5I1JH 1F13A 4PGCB 3TV3H 1DCLA 4FXKA 1K4DA 1N0LA 2AQ2A 3LD8B 2F53A 3EYFB 4MA3A 4P3DB 1A7OH 4ONFL 2EE9A 5E2VH 1KTDA 3T4YB 1UXSA 3B9VA 1IGCL 3TWCH 2ICWJ 3MJ9H 1ZANL 4PJ8C 2AEQH 4C4KO 4RNRA 3FQXA 1W8OA 3I9GL 1J0ZA 3S5LA 4S1QL 1KNOA 1OY3B 5C0BA 3BJLA 4X8JB 4M7ZC 4J2XA 5D7IE 3H42H 4NJAL 4DKFL 4F7MA 1R5WA 1MY7A 5C0CB 3WDJA 5EN2B 5J11C 5DK0A 4JPIA 2VZUA 1HH6B 1F8TH 1RZFH 1UM4H 2Z35A 3ME0A 4GBXC 4F3FA 1FNAA 3QXUA 4UT6H 1S9YA 2R29H 3TM6A 5GPRA 4QRPB 1NGYB 4LGRB 2MSPA 2ARJA 3WFEH 4QHLB 3IDXL 1M7IB 1UM5H 2RGSA 3VH8G 1JZ7A 5MENA 4MNGA 2ATPA 1FH5L 4Y4FC 3MV9D 5JORA 3OMZA 4TUKL 1TZIA 1F2QA 3DTXB 2B1AL 2A9NH 3CH8A 4K94C 4ORGA 2XWTB 3PL6A 5F89B 4YXKH 3IDNB 4KK9D 3BUTA 3CFEA 1IEBA 2P48B 4B7IA 4X83A 1GZQB 1JF5A 3FMGL 5E2TL 5INDB 2DIJA 1JUFB 5HGGS 3OKDB 1Z0MA 5I75C 4ISVA 2N1KA 3PQYD 4WFFE 1K8DB 4YHIA 3UO1L 1OAUH 2PO6A 2XQYK 4UNUA 3OHXB 4XAKE 3DVGB 3ARGB 4JY4A 2SEBA 4ZSOA 3MRCB 5EDXA 5ISZE 2KUTA 5HDOA 3RWIA 2V6HA 5TE6L 1EUTA 5DMGC 4AG4L 1AJ7H 1UB6B 3EFFB 4TYUA 1NSNH 2WQRA 5HGBB 4Z78B 3KPRE 3QEQD 3SKOB 2FO4B 1E27A 4G6MH 5BMFL 4PRPA 3C08L 2N56A 4IIQA 4G42A 3ULSA 3D69A 4NCC1 3W9EB 5B8CC 2BCKA 3ILQC 4R7DA 1XR8B 3PF2A 3L7EB 2E6JA 4GRLD 1ES0B 3EZ8A 1PSKH 5B4MD 1UC6A 3WKML 1Z6JT 4WV1B 3KLHC 4F8TA 2FD6H 4MS8D 4NHUB 3LV3A 1KIPA 4LKXB 1NANH 1MI5D 2YUVA 4LARH 1RZKC 4NRYA 2EDOA 2H26B 4JDTL 1J18A 3VWJD 1DE4A 4TUJA 3QG6B 3R06A 4U6YA 5TPWH 3VXNB 1IAOB 1IFHL 4ZFOB 4G8GA 4C56B 1MCIA 4UTBH 3F12B 3GIVB 2YPLD 2I07A 5FHBH 4JO2H 4WFGD 4N90D 5TGBA 3ES6A 4X6CE 4RIRB 3LS5H 4Y19A 1G9MH 4PJEB 3ZZ1A 5KVGL 4M5YL 3CJJA 4Z7UE 4YFLI 3ZHLA 1MFAH 2NXZC 5T1MA 5HI3C 3LQMA 3RGVB 1KC5L 2X4QA 2UVFA 5MERA 1QSVA 1VADB 3FRUA 1NFIA 1WZLA 2P8MB 2PTUA 3H9SD 1CE1H 2G5RA 3UTTE 1G6RB 2X4NA 2VC2H 1AXIB 2WWKO 2AXGA 4L4VE 1C1EL 2YWYA 3MACH 3HE6B 1T5WB 4KTDH 5EULV 5JOPD 1KJ2B 2OX5A 4M1DL 2ESVD 2YPKB 3VXOA 4BQ6A 4CUCA 4OKVB 2G2RA 3T1FA 5ICXB 2W60A 1X6LA 1A21A 2VOTA 2FO1A 2Y06L 3WO4C 3D85D 5CWSA 3W39A 1FGVL 4QWWC 3HE7B 2ERJC 2X44D 3ILPA 4BSWA 12E8H 3QFDB 2DMCA 1EO8L 3F7VB 2HG5B 3CLEH 1NDGA 2HTLC 3EJYC 2X40A 1XF3B 4HS6A 4HUUB 5EU6E 1BQUA 1IGFH 3FOLB 1NKOA 4HWEH 4KRLB 1MCOL 2AI0L 4J4PA 2ICWI 1S5HB 4XMPH 4ONGL 5D7KE 2QADC 4KHXL 4NNPL 1YEFL 2X70B 2ZJSL 4K8RL 4WI3A 5IWLC 3OB0H 5HHMB 1CTNA 5CZXC 1RJLA 3S9DB 1DUYB 3BWUC 3U7YH 3S37X 5L8JB 4OD3L 2CH8A 4YXLL 4LPCA 5DGQA 4LLDA 5F3BA 4WDIB 3QEUB 2DBLL 5C0JB 5DLML 7FABL 5D71L 4CN6A 4RWYH 2X4TA 3MROA 3KLDA 2GUOB 1FFRA 3GRWH 2EDYA 3GGWB 3L3HB 3OB0K 3IGAA 4LLWB 1UB5B 3BP4B 5EUKB 2HFGH 3VFVA 4JE4B 1FZOB 3MLZH 4OCWL 4HS3B 4ZUSA 2R0WL 3F7QA 5HHOE 1W72L 3RWDB 4TUOA 1U42A 1CL7L 1FJ1B 3MODH 5T3XE 1QA9A 1HDMA 4D0DA 4EUPG 4NQDE 3BIAX 4WTWA 3PWPB 4MD5B 5HBBA 1IKFL 4JO3H 4PBVC 4U3HA 4CMHB 1A6VL 2ITCA 5C09A 3GO1L 5KG9B 2DQEH 4PLKC 1AQKH 3BXNB 2HWZH 3FO2B 1JGVH 1G6RH 2FGWH 4MZ3A 4OQ1A 1MRCH 4G8FB 4GUPB 5JPNA 5HHNB 3CFCL 1OOAA 3WUWB 5C0AA 2R2HA 5SWZE 3CVIL 3O4OB 3OKNB 2IQ9H 3QDGD 1I8LA 3TCLA 4DUVA 4FG6D 3P0VL 4JRYB 1F4YL 2HT2C 5FF6B 1I1RA 1N59A 3ARZA 4PUBH 3V4UH 2ADIA 4KMLB 3HNVL 4WW2B 3I02B 2V5MA 5E0QA 4Z7WA 3T2QA 4HIXL 4G6KH 1VACA 3O8XC 3QIBB 5DA0B 1J05B 4QRUA 4HC1A 4OLEA 3KVQA 4DEPC 2WWMD 3MJ7B 4QHUA 3S4SB 3HUJB 2COQA 5T3ZL 5JTWA 3MXWL 5E8PB 4DAGL 2X9WA 3MV7A 5KANG 1FRGL 1UM6H 3R8QA 3LKPB 1XR9A 3WFBL 1I8IA 1JPTL 4O2EB 4HEPG 1PX4A 4UT7H 4YHMH 3QG7H 1MH5A 4Z7WF 4NP4L 4QXWA 5HHPA 1TNNA 1HQ4A 2A0LD 3DETD 2A77H 2HJLA 4FMKA 1SJHA 1H15A 5FOBB 3HPJA 4OB5L 1AGEA 1XIWC 2VABA 3V95A 3WL9A 1VKXB 5EO0A 3OR7A 3DO7A 1LO4L 1MJJA 1Q38A 5FGBA 4QGTA 3NTCL 3QPQC 1ZLUH 5IBLC 3V8OA 3U0TA 1ZGLP 5KTEH 1G9NC 4RRPA 1ZHBB 2V5YA 3SDCA 2A9ML 3TESA 5ESVB 5C07E 3Q2CA 4GW5A 4QY8A 3NBNA 3VGAB 4EN3C 1S7RB 4UQ3A 1YMHA 4GAJL 4UB0H 2JJSA 1WZMA 5B38A 2A83B 4JREC 1BJ1H 5L2KD 2HH0H 2EO9A 2MPAL 4X7DC 5EBWA 2HMIC 4LSSL 4QHNA 1YYLH 1ZLUK 4JQVA 3QXWA 4HUXA 4Y2DA 5GGSB 3IDYB 4ONHA 1E4JA 3THML 4LGPB 4PGEA 1GCFA 1IQWH 1XGRA 4K9EC 5IKCB 1H8NA 3X14A 2OJZH 1CICC 1KFAH 2ZCKL 4IOIA 1ZHKB 4LVOC 3Q1SH 3BEWA 3U0PB 4PJAE 1LO3L 2IALB 3GSRB 1SYSA 4P2RE 2GK0B 4XP1L 2H1PH 4ACPA 5F1IB 2EZ0C 1VFOA 5IG7A 1A5FH 2IQAA 1CK0H 4M1GL 3U6RA 3P77A 2XPGB 4JY5H 4NKOB 2IMMA 1D3CA 1S9XA 1T6VN 3HB3C 4J1UA 4JPVL 5FYKU 3NCYP 3TBVA 2A6IB 5DHYA 2VDQL 3MJ6A 2D03L 4D8PB 4KMTL 4JFEE 3KLSA 4KV5E 1BX2B 3O9WB 4PJ7E 3OJ2C 1I7UA 3V7MA 3LEYH 3ARFD 5KN5A 1I4FA 4TNWF 5E5MB 5ID0B 3LQZA 1IL1B 2FL5A 4GRWE 3S7GA 5F3HA 1WZ1L 2D4FA 2JIXA 3VG9B 3QFJA 1AXTL 1MY5A 3MRDB 1KIRA 1WBXB 3ZL4H 5IVXA 1TFHA 3F6LA 4PRNA 2UZIL 1NBZA 3BPNB 4DVRH 2F54B 3WS3A 2J7LA 1PG7W 1U91B 3RVTD 3MLUL 1VPOL 3MYJB 1C12A 2Y36L 3VXSB 1NAMB 3MLTA 2QV2A 5FXCH 4WWKC 1KB9K 4MXQD 3ZT5A 2ATKB 3DX8A 5BV7C 4RX4D 4AH2B 4JZJC 1J8HB 1U8KA 5CILH 3TNNA 2B4CL 3TH2T 2APBA 4KU1A 4AENA 1JYWA 2HKFH 3A6BH 2WP3O 4JG0H 2YKLL 4WFEE 4G9FA 3D39E 5F96L 3RI5F 1UXWA 5IVXF 1HOCA 4YHYC 4ERSL 4QNPE 4G43B 2P24B 3G08B 4ZFZA 2XFXB 3CUPA 5IHZA 3TIDA 3BP5B 3TJEH 1CT8B 2RAMA 4P2CG 1QRND 4OBSA 3NGBC 1EGJH 2R0KH 4KZDL 4LP4A 1Y6KR 3L3KA 4JM2F 4FS0A 5CIPA 5ADOL 3HFMH 1J12A 3WIIH 1FLRH 1R24B 1G0YR 4P46A 4TPRH 5D4QA 1JPSL 1X5YA 1HINH 5EO1A 1ZGLA 5D7JD 1UYWL 4HEME 2ENYA 3DUSA 2FBJL 5JXED 3WFDH 3SKMA 1NC2B 4PLJD 5ABDE 1GL4B 2NY1D 1JWMB 3J7HA 5GGVY 3D6GA 2BDNL 3D3VB 4M7ZB 1OSZA 1LEIA 4RAVB 1KLFA 1WC7A 1YMMA 4ZQKA 3OJMB 1NLBH 2OTWA 4H20L 3JV4A 2ZG1A 1IM3B 5IIEA 1T7WA 1OLLA 3O2DL 4X98B 3ARFA 4PY8J 1P6AB 5J11B 1Q1JL 1TJGH 4J8RB 1OAYH 4LHUD 2J88H 1X5FA 3ZE0E 1S78C 4GBXB 3G5YB 5E8OA 2ZNWA 1HHIA 3IF1B 3GSNB 2FECI 1KGCE 3QAZC 3BAEL 5GS0H 1RJYB 4Y4FB 4OLUH 1MHPL 2VRAA 4MAYA 1N0XL 4W4OC 2QL1A 3S36X 5DJXB 1U41A 4WO4A 1YY9C 4GO6B 3VXQB 5MEOA 1OARL 1UVQB 2CIKA 4OCRL 2V17H 1RVFH 2CLZB 4HIEB 4WI2A 3IJHA 3SDAC 4PRBB 1OM3H 1P5UA 1LNUA 2R4SL 1MHEB 1OP9A 2F5BL 4NO0D 4NZUL 4LCIL 4JRXE 2HT3C 5I75B 35C8L 3RHWK 1TQCC 1XF2B 4AQ1B 4NSKA 1OT1A 3EOTH 2VH5L 1X7QB 4P23D 1DBAH 1RUAH 1FFPB 2NY5C 4FXGA 1WEJL 1GIGL 3CK0L 5L88L 1T0NB 2DYPA 2IAMC 2K9UA 3L3DB 4GKSB 4GXUN 4D9LH 4X4XB 1NAMH 3OQ3B 2MQCA 3GM0A 5MEPB 1XGYH 1YNLL 5I17A 4XVSH 3BRFA 2YR3A 1AD9B 3OKEA 4EDWL 3T4AA 2ADGA 5E94A 3EO1A 1MCCA 4HCRL 5TE7L 1YQVL 4JO1H 1U8LB 1HSAA 2G60H 1SVCP 3BP7A 3LRSB 4U7MA 5FCUL 4FQJL 4RFEA 4MHHG 3KPOA 4LNRB 3MLWH 3GMOB 5D1QD 1BFVL 5B8CB 2BXYA 4CJ1A 2BERA 5HGDA 5EBGA 3RAJH 2C5DC 4X7CC 4AY0A 1BZ9B 5IFAH 4E0RB 2AK4B 1NEZA 3NFPA 5LXGH 4GG8A 3O41B 4UINH 5E6YA 2ZNXA 3CC5A 4OLZL 3SGJA 5CBAA 2P5WE 2F74B 3HCVA 5FYKL 3D9AH 1OCWL 4GXVL 4DGVH 1ZK9A 2VXUH 5JUEH 5BRZB 3ULVF 5K9QI 2CR3A 3UTPE 5DMKA 5C08E 3BD4A 4Y16A 1S7SA 3TPUA 1VENA 3GM8A 2XZQH 3X17A 5HVGB 1I3GL 3VFOB 4N8VG 5CHNB 5FUOH 2ZWLT 4RMRA 3BO8B 1H0DA 3OBAA 1I9RL 3C5JA 4N8CL 1T66C 2IPTH 5DJ0B 3L5WA 5C0CE 4IM8A 1YPZB 1PBYA 2NXZB 4N0YH 5EUOA 1YNTB 4XBGA 1HHKA 2IFFL 4PP1C 4C59B 2FWOB 5HYJD 2ZCHL 4MX7B 1GOGA 4PS4H 4TULH 4QF1B 3R0NA 3VDBA 3RVUD 4I5BB 4JZNB 3TCXA 3QCTL 5IB3A 5HGAA 3I3EA 4NQCE 4LAQH 2R2EB 4JDVA 1JGDA 2R69H 3G6DH 1LP9A 3SDYH 3EO0B 4K94H 1N6QH 2G75B 2NY7H 1TZGH 3FFCA 5F9OL 3WXWL 3TYGL 4L9LC 5J1SC 4XC3H 5IHUL 1XZ0A 4M7JL 5LCVL 1INEL 3GSXB 4MQ7B 3KPQA 1D6VH 4YZFE 5FO7A 2ERJB 1N6VA 2BJML 4P9HL 3VG0L 2HN7B 2Y6SD 4WWID 3HR5B 5DEZA 4P5MB 2ZG2A 5FDWA 2DQUH 1FZJB 1BBJB 2VJXA 2ZOKB 3VH8A 5GISH 2LAAA 3ULUH 3BEVA 1WT5A 4KDVA 1LP9F 1FV1B 1CLYH 2BY2A 2J6EL 2J8UA 3MNZB 2XTJC 3BN9C 5JHLH 2DF3A 1GC1H 4FTVE 1UEMA 2FX9L 4Q6IA 5EZLA 1HH9B 3O6FD 5E8NB 3IS1X 2AJXL 2QADB 2F5AL 1MWAH 1YDPA 3FHAA 2O26U 4PBXA 4MJID 3DUUA 5HHQB 1I75A 3T0XA 4JPWL 2EXYD 2G9HA 3QO1B 2IH3B 3DX7A 4F8QA 2OTUB 3IVKB 1A7BA 2OJEA 1UEYA 4FQHA 4U05A 5EC1B 4UOJA 4JLRB 2A73A 1K3IA 2X7LB 5K9JL 1SM3H 2WIMA 1CGUA 3CD4A 4HJ0D 3WNPA 4BK4A 4EI5C 3SJVE 4QHKJ 3ARDA 1ZT1B 2VWEC 1NC4B 1BIIB 2BMKB 1FNSH 2W9DH 5EBMB 2AJUL 5GRWA 3NCJL 3FT4B 4OZGA 2D31B 2VL5A 2OCFD 4CVZA 3N1PC 3SE9L 3GBNH 1KJVA 2Y5TB 4PJEE 1KN2L 4E41D 5CEXB 3OR6B 2P7TB 3GMQA 2VR9A 4XPAH 4HG4J 1SJVA 5C2BH 1F3JB 1X5ZA 1BOGB 4HV8A 2PO6C 2RBLA 2OP4H 4Z77A 5DJCA 4FQCL 3GSWB 4JKWA 2A1WL 4OZGF 1P6FA 3QDAA 3JWOH 1P7KA 4I8DA 4HZLB 4NUJA 4NQSA 5D7SH 5LVEA 1F90H 1DQDH 1TCMA 5IT2L 3A67H 5CMAA 2HKHH 1AO7A 3LH2H 3KPPB 1G84A 1QFUL 4IIQC 2K1MA 3FQNA 3SO5A 3WHXB 4HXBL 1QNZL 3QEHB 1KEMH 1JHLH 4IRJD 5BW7A 4OQTL 4K8RD 4WEUD 2WUCH 5DRZB 4IRSD 3L3GB 3UTSB 3O8XB 2AEPL 4QTHB 4U6TA 1T1ZA 3O4LA 3GSVA 4GXUM 4DEPB 5BS0A 2VLKD 1SJEA 5B3NA 3NABL 5FO8B 3BZEA 4DGYH 3BZ4A 1DEDA 3JV6A 2HLFD 3IYLW 2LFGA 4PJ5B 4HWUA 4I2XB 1MAMH 3T77B 5T1DL 4DK6A 1HXYB 1LQSR 1KLUA 1X6NA 3ARED 1U8PB 4PB9H 5HHME 1IGJB 1YNKL 5I1KH 3V7AE 1CDGA 3K74B 1HKFA 1HXMB 4XNZC 2V5TA 1XIWB 1QG3A 4KK9C 1JTTA 3TA3A 4EVNA 3G6AA 2PCPA 5C86A 1EHAA 1W0WB 2NX5B 5DRWA 2FIKA 4KZEL 5JPMB 3NN8B 2A74A 5FKAA 5I1DB 4OBRA 1NMCB 3KPSB 5EOTB 2DD8H 4ODHL 4JG1L 3DHJA 5E99H 3RL1A 2ITDB 3LOWA 4FNLL 4I1NB 1ZE3C 3QJHA 1CR9H 1IBGL 5IB4A 2IF7A 5BOZG 2IG2L 3JWDL 4EN3B 5T5NG 4EOWH 2XKNA 2J12B 4WNQA 1QBMH 1KCSH 4I48B 4PB0L 4LCYA 4JREB 3QUXA 5DRNB 3MBED 1MLBA 1A6TB 2CJUL 3M17A 5DJZB 4V1DD 3VXUD 4X4YB 3EUUA 1PY9A 3QUZA 5KSBE 1YA5A 5F7FA 2FJGA 5D1XA 3VXRE 5KJRH 1CG9B 3KS0J 3GIZH 4ZS7H 4G7YH 4WHCA 2JB6A 4U6XA 3WEXA 3S34L 2VDPL 5EA0L 1CICB 3IFNL 3HG1A 2R0ZL 4LVOB 3U0WL 1B0GB 4WUUB 3BUYB 1V3JA 4M4RA 3OJDB 1FVCA 2XTLA 3F7YA 2DM2A 1NCBL 2XWJB 4MS8C 4MAUH 5IQ9A 4OTXL 2P5EB 1EPFA 5F1NB 2BOBB 3EKCA 4JRYE 1S3KH 3VWJC 4L8SA 3RPIB 4HULB 2DJUA 4DZ8A 4YAQB 5TDOB 4QXTA 3LHPL 2ZUTA 3S37L 4EUPA 1S9VA 4JPKH 2NY4C 4XPGH 2X4RB 1U8HB 3WBDA 2CDFB 3GKWH 3QDMB 2OR9L 1S8DA 1QO3A 1A7QH 1WITA 2DS4A 1QZ1A 1AE6L 3MCLL 2FNBA 5FM8A 4ZFFB 5T33L 2ZP0T 1HZHL 3UJIH 2V7NB 4QHKI 3ARBD 2ZCLH 3Q5YA 2C7UB 4Q9RH 3EDDA 3REWB 3GJFB 1LEKB 2H45A 4HK3J 3UJJH 4G5ZH 5I8OH 3DURB 1ZT4A 3RUGB 2C3XA 2AGJL 1EFQA 3KHOA 2XN9D 1Q9OB 1NBVH 1ZTXH 2KDGA 2DTSA 3GMMB 2GJ6D 3TPKA 1EHLH 4MD4B 3SGKA 4WWKB 5D7LB 4M6OL 3VFUB 1G7JB 2X1OA 2GSIA 3RVXC 5BV7B 3UYRH 3CFJA 3FCTA 4JZJB 3CZFB 4JN1L 4FFVC 4B5EA 4N9GB 4CW1B 3OZ9H 4PRDB 1OP5H 3MRMA 4X5WA 4M62L 5C0FA 4M93C 2NXYD 2OQJA 5HJ3A 4YHYB 4NC1C 4EQ3A 4UT9H 1KPUA 5C6TL 4ZG1A 3O45A 1M1SA 4QTIL 2H8PA 4GSDH 1I8LC 4S10A 1LK2B 4XCNB 2ICEB 3LKSA 4JCLA 1M6OA 3NGBB 1BD2B 3VXMB 1P2CA 1NCDL 1YEEL 2ADFH 3RIAK 3VFTA 4NKQB 1WIOA 1FNGA 2A6DA 2GY7B 5FHAL 3G5VA 4POYA 4KVNL 2DQIL 1P69B 2R56L 4PJCB 3BIKB 5DT1H 1CWVA 3BT2H 2DQDL 4RMUA 1HHHA 5ALCL 4JFQB 3DHMA 1WCBA 1OP5K 4HDIA 2C3WA 3WLWD 5FGSA 4MNHA 1F4HA 1U3HA 1CGSH 1VDGA 3C6LA 3D87B 4I9WD 5FYLL 1GH7A 5DYOA 3TBSB 3X3FL 4ZXBD 2B8OT 4NJ9L 1XGUA 5IFHH 1OPGL 4XVJH 3S6CA 3NZHL 5KOMC 3MFFA 3M45A 2A6JB 3K80A 4X6EB 1WZKA 3QNZA 5TH2B 1YEKL 2AKRA 1OGAD 4BFIB 4N0UA 4EDXB 2GAZB 4LL9A 3VA6A 3Q6GH 1Z9LA 3LIZH 4QXUL 1ZVHA 4LSTH 2DRUA 3FB6B 3HNTH 4RFOH 3RNQB 5J3HD 4XC1H 1HK6A 2BNRB 2VDLL 4ZD3L 3MBXH 3HI5H 4WU7B 1HHGA 4ELMA 5A1AA 2DQGH 4NM8L 5LGHL 3P4MA 3SDDB 4KK5D 3MLSH 3SY0A 3ARRA 2GJZB 2W65B 5JR1H 3ECBB 4QYOB 3C5ZD 4NNXB 4JFFA 2WZPD 4PY7B 3NVQA 3LSOB 2D7QA 1TQCB 3KYKH 5ACZB 1KG0A 4GAYA 1AR1C 1UACL 2QQLH 3BKCH 2ZUSA 4RGND 4PV8A 4FG6C 1R5IB 3DIFB 4BKLA 2DQFB 2IAMB 4Y2DC 2AABL 1LE9A 3MRKB 5GGSY 2EICA 4ODUA 4CVXB 4ELMF 5DQ9A 4BZ2L 3WIFB 1JHTA 4ODVL 5E8DH 1ZT7B 4AEEA 4KUZL 3VFGH 4L4TE 1ADQH 1J8HE 3ZT6A 1NCUA 4ZUVB 3FTGA 3EYSL 5KSAD 2L7UA 1QVOB 1KTRL 1CU4H 2K7PA 1C08B 2DTML 3G5ZA 4KJYB 3CPLB 3GB7A 5H8DA 5ACLA 1RFDH 3FO0L 1RU9H 4PJIB 1RV6X 4PR5B 1KXQE 1UQSB 1HNGA 1URLA 4DOHB 1BZQK 3IKCA 2YEZA 1B88A 4R0LA 4BZ1H 3BN3B 2F15A 3NIDF 1KJMB 4QOKD 3L95A 1U3YA 2NZ9D 3BWAA 1PEZA 4JQXC 2A0LC 3AXLA 3DETC 3KXFB 3SQOH 1L0XA 2Q8BH 3RDTA 2QLVB 2CK2A 2VZVA 4AIOA 1FDLH 2BHYA 2BXZA 1S9KC 1B6UA 1X5AA 1UWGH 1ONQA 3KNBA 1PQZA 1Z3GH 1BLNA 3H3PH 3BGMA 1JWSB 2WBWB 4ODBD 3UZQA 3MGOB 4XP5H 3G04A 3NIGF 4LPTA 5DK2B 2PYFB 1DBKL 1VEOA 3HMXH 1M7DB 5GRUL 1G0DA 4S0TD 5L7XH 1FN4B 4R26H 3B3IA 1JK8B 4F37F 1IZJA 5DJ6B 3RWJB 1OTTC 4JFYB 1N5YL 2EE2A 3BPLC 4Z76A 1N3NB 4XWGH 3OGOE 4LCWA 2NLJB 4H8WL 1NCTA 3ZYIA 2DI9A 5EB9A 2E27H 2Q76A 4FQ1L 1RZ7H 1V7NL 3MQIA 1BECA 1Z2KA 1NFKA 4JB9H 4PP2A 2EE6A 4PJ7F 4ZUTA 3KLAA 1LK3L 4LBEA 1RULL 4YGVB 3MRJA 4KTEL 4O2FA 3AS1A 5D2LB 5I8EA 5J6GA 2F53B 3BYYA 3VDCA 4GRWF 3ULUE 2WSKA 3LS4H 4GG6B 5AWNH 3L3IA 2N7AA 4OT1H 3GSNL 1E6OL 3FB5A 1KUMA 4KKNA 2XTJB 1MRFH 3O2DA 4ODWA 3S5LB 1FC1A 3B2VH 2IPUK 5DEFA 1KNOB 2FX7L 5FYKD 5TFSL 2F8OA 3B9KA 5AYUL 2NTSP 5DFVC 2AK1H 3B2UD 3JBG7 5IEKA 4DQOH 1OTUC 5I6XC 2Z8WC 5D5MA 3N06B 4ZTOL 4YXHH 3AMLA 4F7MB 1Q0XL 3DV6A 4ZS6C 4ORZC 3WKNA 1R5WB 1TZHA 3ARFC 4JZOB 5IGXL 3PDGA 4JPIB 5FO9A 2Z35B 3U4BL 5E2UH 5SWSA 2FZ3A 3TH3T 4KK8D 4EBQH 5HVWA 1S9YB 2R4RH 1F11B 3LKQA 5F21B 2ARJB 1L7TH 4QNPF 1H8OA 4EI5B 4OCYL 2O93L 5MENB 4MNGB 5JORB 4BA8A 4I18A 2DB8A 3KJ6H 1TZIB 1NMAL 3H8NA 4MAYC 5CLTA 2EKJA 2WLZA 4I3GA 1L7IL 5FCSH 3K46A 4WO4C 2H3NB 4ORGB 3HNSH 1JYNA 1Q0YH 5CP3H 3U4EA 3CFEB 4YHLH 3O81A 4MXQC 3TVMD 1IEBB 1FAIL 4TSBL 2X89D 3BH8A 3MRNA 3GSQA 5ALBH 2CGRL 3MYZA 4YHZH 4ISVB 4Y1AD 3ZDYE 3ROOA 5ADPH 1F5WA 1H3PH 3W5NA 4GKNA 2AJSH 4HCRA 1YN6A 2PO6B 3TF7C 3GMPA 3MNVB 3MRBA 1T22A 4JY4B 3EHBC 2J4WL 4POZD 4AEHL 2OK0H 4U1KA 4L8CA 3V0VA 4ZSOB 1T83A 1QSZA 1BFSA 3SO3C 4HJJH 5E7BA 3PXJA 3GK8L 3M1BB 4FMFA 3RZCD 3O6MH 3FT3B 3QNXB 4HQQH 5ICZA 3LN9A 2AJVL 1UA6H 2IWGA 3SE3A 3WD5L 4YHPA 1EA9C 1LD9A 4N8VA 1E27B 4LFHG 4PRPB 1F58L 2EKSB 3W81A 1A4JA 1A22B 4G42B 4IIQB 5HDQH 3ULSB 5F7LB 3STBA 4PLJC 2NY1C 3OKYA 4HGKC 4R7DB 3QIWD 1SJXA 3ZHKA 4UIKL 1EAPA 1TPXC 2IPKB 3E8UH 4JKPH 4EXPX 5I1HL 4Z7OF 4IHOA 4DCQB 4F7TA 3F58L 2VDKL 3LV3B 3C5SB 4I4WA 1KIPB 4WW1A 5I1LA 5J6HA 4NRYB 1N6UA 1FE8L 4PRID 1MCJA 3TEUA 2YN5A 1CF8H 1QP1A 4O02L 5CINH 3N1QC 5BO1L 3R06B 4U6YB 4Y16C 1NGXA 3R1GH 3MV9B 4QCIB 4G8GB 2H6PB 1ZAGA 5KW9H 3NPSB 3LCYA 3ARSA 4D0BA 5TGBB 5DXWA 1Y18B 3WS6A 2HP4A 4XNZB 4WENB 4XNUL 4Q0XH 4MXVE 5T1MB 3TVMA 2XZCL 3IDGB 4NZJA 3RIFF 3T3PF 5MERB 3U83A 2X89A 3MLPA 3QSKB 3GDBA 3FRUB 2CMRH 1NFIB 2I60H 2KQMA 2HYMA 1G1CA 5I8KL 4OGAD 3FZUD 4X8JA 2PXYD 1X4ZA 3SE4A 5ITFB 4P23C 5I71C 1OAXL 5CZKA 1FNEA 4Z7QE 3KWWA 1VGKB 4FFYH 1MCRA 6FABH 5GXBB 25C8H 3NCFB 1HH6A 4UMGA 1B0RA 3PWJA 4U49A 3LKRB 4HWBL 2G2RB 3T1FB 1I1AA 2BVOA 2W60B 5I66B 2VXTH 2FJHA 1L6XA 1RI8A 3BQUA 3OAYH 4QRPA 3W39B 5DC9B 3QQ3B 2J6EA 4FRWA 3BX7C 3MOBH 4GMTH 3ILPB 3H3BC 3SDXA 4XPTH 2WW8A 2YD5A 5KVFH 5E70A 3C8DA 5D1QC 3PP4H 3EW3B 5HYEA 2E6QA 1WT5C 2VZOA 2V2XB 2DM4A 2I9LA 3FN0H 4HGWB 2FSEB 1T6WA 5HPMA 3VW3L 4UTAH 2V9RA 5JW3L 2J5LC 3UAJD 1J0KA 4F9PA 3EJZC 1CFSB 5A2IH 4Q6IC 3PABA 1GZQA 5INDA 4NNYB 1QR1B 1JUFA 3OAYK 3SDXF 4PRIA 4K3EH 2BNQE 1GZPA 3TN0D 3VWJB 4Q9QL 1QUNA 3EIFA 4MA7L 5FYJD 5D72L 4FQXD 1ZLVH 3MOAL 1AD0A 1MFBH 4CBPA 3ARGA 3GBML 4G3YH 5CUSL 5ANMA 4CVUA 4KTYA 2E7LC 2XRAH 2YPLB 3MRCA 3QZWB 2F8XC 3UTSE 2NY4B 1RUML 1UB6A 1A3LH 2AAVA 3EFFA 4NOFA 4LLDB 3PWLB 5HGBA 2VLJD 5CEZE 4YZFF 3IFPA 3P0GB 1S5IH 1H3TA 1E4XI 3P4OA 3SKOA 3VGFA 4XPBL 4U2YA 4M6MH 3MROB 4WI8A 2G5BB 4N0FA 1HE7A 1WSST 4I2XE 1RZJL 4FFZH 3IGAB 4MYWB 1QSEA 1RURH 3RVUC 3V4PL 4WI6A 1ZLVK 2BVUA 2D7TH 1ES0A 3CMOL 4O5LL 1E4XH 4ZUSB 4BK5A 3KPTA 2ESVB 2RFXB 1CLOL 2AV1B 1QA9B 1HDMB 2J8HA 3N9GH 1CQKA 1MPAL 2H26A 3WXVL 3D85B 1HSBB 2CDEA 4DN3H 5MP6L 2GQHA 2ITCB 4OLXH 3REVB 3KPSE 1IAOA 4HUWB 1MJUL 2Y6SC 2XA8L 3FL7A 2GYSA 1BQHB 4GLRI 3T3MF 4C56A 5DD1H 1OWRM 4M93B 3F12A 1QKZH 2EXWD 4QEGA 1SBSH 2R2HB 3CFKB 1KN4L 4OF6A 3AGVA 4B50A 4MDIB 1HYRC 3L5HA 3QEGH 4EIZC 1ZHLB 2XOTA 3TCLB 5FA4B 5DR5L 2YMXL 5HXMA 4XB7A 3QHZH 4GLRH 5DZOA 2ARWA 1V3MA 2ADIB 1R3IH 4OSUH 2P8MA 5BW7C 2CUMA 1ACYH 5E8EB 2YPVH 4Z7WB 4OFYD 3NFSL 1VACB 4PLNC 1OD7A 2NY0C 4IOSD 3HE6A 3SKUD 2PW2B 5DD5H 4PJEF 4L3EA 2VNCA 1KJ2A 2YPKA 3MV7B 5JDJA 1CZ8L 3RJDA 3VI3E 4JHAH 1RUKL 1G9NL 1XR9B 4ONOA 2LVEA 1I8IB 1IC4L 4BYHA 3LKNA 5I1JL 1EZVX 1DJSA 5D9SB 2W0KA 1KB5L 3TV3L 2Q86A 3QQNA 5HHPB 3UROR 4LSQH 1SJHB 1H15B 5FECA 1XF3A 4HUUA 5FV1L 3C6SB 1AGEB 1XF5B 5JQ6H 1IGTB 1S7UA 3FOLA 5E2VL 3ARYA 3OR7B 2CKBB 1MJJB 3E0GA 1CIDA 4HX1A 1KPRA 4XP6H 3TWCL 3OL2A 5F6IC 3V79C 2AEQL 4JGJA 3QDME 5D2NA 2A6KB 4MA8H 3U0TB 4K9EL 1I9EA 3TH4T 4N1HB 5F6HJ 2X70A 2MCPH 3SDCB 3UJTH 2P46B 4QY8B 2R8SH 1UJ3A 4XVTH 4XNXH 3H42L 1WFNA 1LO2H 1YMHB 1DUYA 3ZDXE 1SVZA 5BJTA 5LBSH 5B38B 4OM0H 5E00A 1F8TL 1IKNC 1UM4L 1OL0A 1DSFH 4I0CC 2R29L 4CNIB 5B39B 3WFEL 4QHNB 5C0JA 2D7NA 1UM5L 4IMLB 1A1MB 1I85C 1WFUA 4Y2DB 3E1F1 4WRLA 3ZE1F 1CXHA 3FO1B 4JFDD 4PGEB 5D1XC 3QUMB 1A6ZB 3P40A 4U1GC 1XGRB 4MB4A 4URTB 5F9WC 4IRJC 4WGVB 4EI6A 2Z8RA 3L3HA 4K8RC 5F88A 4LLWA 4IOIB 4RSVA 2A9NL 4IRSC 4OCXH 3U1SH 4M8QA 4H5SA 3CX5J 1NBQA 3DPBA 1GAFH 1J7VR 4KRMB 4NRZA 2IQAB 4EJ1C 4UILL 3RWDA 2KL6A 1HCFX 3U6RB 5I0ZA 2HLFC 1BD2E 3VXME 4G6FB 3IETA 4L8SC 4Y5XC 3I75A 4FFWD 1R5VA 3PWPA 1S9XB 2VKWA 4J1UB 1OAUL 5TQ0L 2EYSA 3K4ZA 1PX3A 3AREC 3BXNA 3UXFA 3FO2A 1EV2E 4PJCE 5H94A 1FSKB 2UZYB 4NBXB 1MFCH 4NWUH 1D9KD 4GUPA 4G8FA 4HC1H 4MWFB 3MSPA 1FFNA 1GGIH 1I7UB 3OKNA 1NSNL 2XZAH 5KN5B 1I4FB 2HFEA 4GJTB 2IANA 2IJ0C 3D48R 5IQ7H 2FL5B 4G6ML 3FB7B 2LTQC 3D18A 3QFJB 1ZLSL 1G7QA 2VZ1A 2EDJA 4I3RH 3PHSA 1KIRB 4Q74A 1ZS8A 4U1HA 2PYEE 4PRNB 4TSAH 3MJ7A 2BRRH 3HUJA 3WS3B 4WVRA 1S7TB 4M8VA 2FD6L 1C12B 4X9FA 3DXAA 3MLTB 4HF5H 3MUY1 4N8PA 4LARL 4HFUL 1GOHA 3LKPA 2YZ8A 2NZIA 4F7EB 4WW2F 5I0DA 3TNNB 4JFDA 5I16B 3PNWA 4OIIH 1DTUA 4HKJA 4MNQA 3GMLB 3BESR 3SGEI 4UTBL 3X12B 2EDNA 1BGXH 4JO2L 3WFHB 2OMBA 3CUPB 5IHZB 3HUJF 1U3ZA 3LS5L 1G9ML 3VFRB 1VKXA 1FORH 2YD4A 1MFAL 4JFXA 1DBJL 3PWUA 3L3KB 3SGEH 4BQ8A 5CIPB 2ICCA 1U6AL 1DLFH 4XNQB 1CE1L 3QBTB 3IFLH 3QDJA 5ESVA 2VC2L 2YWZA 4WFFD 1R3HA 5TE4L 1ZGLB 3DUSB 5IUSA 3B5HA 3N1FC 2BHUA 1MCEA 4XAKD 4M1CD 4KTDL 1IAKA 3MRPB 5ISZD 4MQSB 1WC7B 5I6XB 5ETUA 4ZQKB 2OTWB 2D0GA 3NMEA 5IIEB 3JV4B 4LIQL 2PR4L 4LLUA 3ZYZA 1KJ3H 3W2DH 3ARFB 1UADC 2OXHA 4XX1G 5DA4A 3T0EE 4PJIE 1JZ6A 3ARBC 3KPRD 1HHIB 4DOHE 4RGMB 5F1KC 2MMXA 2QHLA 4YDVA 1ED3A 3CLEL 1II4E 2DLTA 1PVHA 4Y4KD 3KXFE 3U0PA 1IGFL 2IALA 3QULB 4BH8B 4JQIL 3GSRA 2GK0A 1MCPH 4MAYB 4HWEL 4F9LC 3IU4H 5DMIH 1WLHA 3FRPG 4WO4B 3RY6A 1WBYA 5MEOB 2EIZA 4XMPL 5EBLA 3A0OA 3C8KA 3I3DA 5F6HI 2M8XA 3IJHB 4ZNCD 1SEQH 5DQDL 4HGMA 3LQAH 4XPFH 4TNWK 1I1YA 1WFOA 3L5XH 3VMOA 5GJTL 1D6EA 1Q9LA 1R3LA 1CLZH 2NXYC 4GAGH 3PDOB 2MKLC 3H0TB 4XGZA 4PD4K 1QOKA 5EU7C 3O9WA 5CJ5A 1QSFE 2L0DA 3BE1H 4FXGB 2Z8SA 3ZKND 4RCAA 1UT9A 3SO3B 4YE4L 4CAGA 3MRRA 4Q7DA 4M00A 2H2SC 1ZKAA 5I17B 5ID0A 4HK0B 3BGFC 3KYNB 4RWYL 3OKEB 4HBCL 3D0VA 2ADGB 3T4AB 5E94B 3EO1B 5HYFA 3GRWL 3NA4A 4X5LA 3BYTA 3ELAT 2NYYD 1RUPH 4K7PY 1HSAB 2OTPA 3BP7B 3UTTD 4CMMA 2HFGL 3NAAH 4LVEA 3MLZL 4RFEB 3WLWC 1TXKA 4L4VD 2O5ZH 4Z0XB 1KULA 1IC7L 3RI5K 2F54A 5HGDB 1J10A 5F7HA 1U91A 4OLYH 3MYJA 3A6CH 4PJXA 3VXSA 4XCFL 2F53E 1TPXB 3JTSA 2F58L 4ZXBC 3MODL 4GG8B 4ZO8A 1OP3H 3L9RA 4FQPA 5DSCA 5CBAB 3HCVB 4PJHA 4PJFA 4P2OD 2C1PB 3D0LB 4LLMB 2DQEL 1AQKL 2VLRA 2UZXB 5FYJH 1JGVL 5SX5H 1RK0B 2FGWL 5FV2A 1XAUA 2LE9A 5DMKB 1IILE 5EOQH 4G43A 5F70A 1MRCL 1S7SB 4Y16B 3T0BA 3TPUB 5C0BE 2IQ9L 5EU6D 1CT8A 3I50H 3BVNB 1H0DB 4PTUA 2AV7A 3C5JB 3QWOA 1UKSA 5KZCD 1UCBH 4PUBL 4YFEA 3FT2B 4MJ5A 4V2CB 1OP3K 3PJSA 4KQ3L 5C0IA 5EUOB 4HIIA 4H88H 4AIZA 1HHKB 4PJ8A 5D7KD 4HIJA 1MNUH 4KK5C 1KTKE 4G6KL 4D2NA 1DZBA 1DVFD 2B4CC 2RB8A 1KXVC 1T89C 2JCCA 5SX5K 5IVZA 4NO0B 5MENE 2FATH 4MNGE 1NC2A 1EEYA 2GKIA 1R3KA 3RRQA 3D3VA 3HI6L 4P23B 5I71B 4RGNC 4LRIA 4JDVB 1JGDB 2YA2A 3DGCR 4NGHL 5C3TA 5ESAA 1JE6A 1U95B 4Z7UA 4DZBB 1TNMA 5FUZH 2BY0A 4HH9B 4UIMB 4E42B 4GBXA 4YHML 3G5YA 2O5YH 5L2JB 3EOBA 1XZ0B 3NZ8A 1UJTA 3GSNA 2A77L 2JCCF 4JVPA 3KPQB 4B53A 4JO4H 4UDTA 3MC0A 2D0HA 4Y4FA 2JB5H 2NY2C 5FDWB 4G6AD 2X1WL 4CU7A 3GI9H 5D1QB 5DTFA 3BEVB 4ZMAT 3VFSB 1ZWIA 4ZSOE 5HHOD 1V5JA 2J8UB 1UVQA 4LLQA 4RDQG 2J5LB 3AY4A 5T3XD 5KTEL 2CLZA 1XF4A 4HIEA 3UTQB 3CXHJ 4Q6IB 4NQDD 5EZLB 2IADB 5C0ND 2Z31A 4FZ8H 1BZ7A 3V7AG 1GRWA 4P9MH 3L1OH 1YDPB 3ZKXC 5IESH 1R0AH 4PRPE 4P49A 4V2BA 4MQTB 4L29A 3ULVH 1JFQH 4PGDB 1TJHH 1X7QA 4TSCH 1JZ2A 1DLHA 1FFPA 2HH0L 2G9HB 3ROLA 3DX7B 5SWZD 2OJEB 3RTQD 4FQHB 1T0NA 3L3DA 4G9DB 4OJFH 1YYLL 3BZDA 2A73B 2GITB 4X4XA 2H2PD 5IOPA 3BKYH 5MEPA 2H32B 1SQ2N 4Z7NF 3MLXH 1AD9A 4YBQC 3O0RH 4ZO7A 4YUEH 5I1IH 3CU7A 2OJZL 1KFAL 1U8LA 4I18C 4LK4A 1EEQA 1BVLA 1IEAB 3Q1SL 3HC4H 3N1GC 2H1PL 4YR6A 4FA8A 5IHBA 5KOVC 4LNRA 2FIRT 1T1XB 3GMOA 4G8GE 1A5FL 1CK0L 4E0RA 1BZ9A 1KT2A 2VL5B 15C8H 2AK4A 2JLLA 2IEPA 4M5ZL 1KJVB 1A14H 1MCNA 2ORBH 5F9JA 1JL8A 2YUZA 4Y19E 4YPJA 4JY5L 2EDDA 1HI6B 3IDUA 4NM4H 2X4SA 1AQDB 5C6WH 1X3DA 3GMQB 1OHQA 4JHWH 3V6OC 5BRZA 4HV8B 4Z77B 2OR8A 5DJCB 1CXKA 1XEDA 5J1TC 4I0PD 1T83C 4NIKB 3WFCH 3LEYL 3VFOA 5CHNA 1FO0B 3ZYJA 4OFIA 1CXLA 4NUJB 2I5YH 4NQSB 5DJ0A 5ITBL 1L4IA 3V0AC 1YPZA 2I9TB 4Y0GA 2FX8L 1AO7B 1YNTA 5EC2B 4ONFH 2FWOA 3SCMD 1H3XA 3ZL4L 5C07D 5DO2D 3B2UC 4XMKH 1ZANH 3P4NA 1BAFH 4QF1A 4DVRL 4ZOCA 5E56A 4I5BA 2D7MA 4U4BA 5EU5B 2NY0B 1T1ZB 2VXVH 1NCCH 1T04B 1PZUB 5BS0B 4OF7A 3MV8A 1YPZF 1N2RA 4A6YL 3BZEB 2G75A 2W92A 3IRPX 4S11A 3BZ4B 4LLVB 4KK8C 3JV6B 1I9JH 5CILL 3TO2A 2HKFL 1B2WL 3A6BL 1J1PH 3IJSA 1GJIA 1CLCA 1P84K 3V6FA 3GSXA 2WLYA 4DKDC 2C3GA 1K6QL 3NCEB 1EJOH 3DI3B 3TJEL 4P5KA 4PYGA 3IDXH 1BBJA 3DROA 5KAQF 4P2RD 3WS6C 3BPCA 3LZFH 3BMWA 1KCLA 4WU5B 1FV1A 1JWUB 4UBDD 4EVNB 2PCPB 1EFXA 3TVMC 3FQTB 2B1AH 2YC1A 3MNZA 1FL5B 1WK0A 3WIIL 5DRWB 2FIKB 5MEQA 5F6IB 2A74B 1LMKA 5FKAB 4TPRL 4PJDA 1T7XA 3MXVL 4E41B 4HWBA 5GSVA 3RL1B 1F6AB 1QLEH 3UX9B 3WFDL 3ARTA 3MNWB 2V5SA 3SE4C 4K7PX 5IWLA 4QRSB 3FMGH 3QJHB 3BOVA 4LHQB 4PJ9D 5HHQA 4P9HC 4POZC 4JFED 2FCBA 1NLBL 2IH3A 5JXAH 2OTUA 4WNQB 4LDOB 5EC1A 1TJGL 3EZJB 3E3QE 3RZCC 1I1AC 1OAYL 4LCYB 2J88L 1J0JA 3CU1A 2X7LA 4OLVH 3G6JA 3QUXB 3BQUC 1A6PA 2YD1A 1MLBB 1U8QA 4N0CD 3HMWH 4AG4H 3CVHH 4G8EB 1ZT1A 1U58B 1S7WA 1G0XA 2FJGB 1F3DH 3GFUA 4OLUL 5D1XB 4U1GB 1BIIA 3K8KA 2WBJA 5L8KB 4IRJB 5C09E 2GIYA 3JTTA 1ZVYA 4LLAA 3QIWC 3GI8H 3FQWA 4MD0A 1MIEL 5CLWA 1WF5A 2FECL 5CD3B 1FVCB 4OD1L 4F9PC 3F7YB 3VD9A 1CFQB 2V17L 1RVFL 2VLKB 2Y5TA 5C0AE 2XNAB 4O9HL 2NW2B 5IQ9B 4P2QA 2GHWB 1IQDB 4TRPH 5INCB 5DEGA 1OM3L 2GW5A 3WKMH 4L8SB 4Y5XB 5JIIA 1F3JA 4S1SH 3QZWG 3BRDA 1BOGA 4WFED 4DZ8B 3D39D 3EFDL 3TJHD 1FFOA 1LO5A 4Z7QF 4YDIH 3EOTL 2PUQT 3GMRB 3GSWA 1DBAL 3AREB 1RUAL 4Z7WE 4EUPB 4XZUA 1S9VB 1MJ7L 4KROD 1P4BH 1R3JA 5J4MA 4HZLA 1RZ8A 1S8DB 4M7LT 3WLBA 4XVSL 1MVUA 3MV7E 1OB1A 3KPPA 4RQQA 1W72B 2XIDA 2GSGA 4JO1L 4GKZB 4F33A 5KVGH 2G60L 4M5YH 4DTGL 3L7FA 2LTQB 4MJ6B 5FOJA 3K8LA 3FZUC 3WJLC 2PXYC 2NQCA 1KC5H 5JW4R 3MLWL 5AUMB 4TVPH 5DRZA 1ZT4B 3RAJL 3QIUD 5IFAL 3O8XA 4R3SA 3CXHK 5CZVH 5LXGL 3C60D 2DI8A 4UINL 3HRPA 3T8XA 5FO8A 3KPNA 2Y1VA 4O4YH 1D5ZA 4DGVL 1BQHG 1T20A 4V1DB 2VXUL 2GSIB 4PJ5A 2EDQA 1YEGL 3CFBA 3P0YH 4OCSL 4NN6B 3HN3A 1KGCD 5KBNC 2XZQL 3MRMB 3GZKA 3W9DB 1T7YA 1U8PA 1GHFH 3UEZA 2OQJB 5HJ3B 3CXDH 1S7QA 2DKSA 1FGVH 5F7KC 1KPUB 4CKVX 2WUBH 2IPTL 5IK3B 5DVLA 3UAJC 1M6OB 1W0WA 2NX5A 4ZUWA 5EZIH 4N0YL 5MHSE 4FABH 5JPMA 3NN8A 1LO0H 5I1DA 1C8PA 2A6DB 1EUUA 4GH7B 3G5VB 1JGUL 1MRDL 3N0PB 2AI0H 1JRHI 2ITDA 4PS4L 4TULL 4LPXA 2CSPA 4KWUA 5M95B 4JRXD 1WCBB 1VEMA 3B43A 4HT1H 4HS8H 4ONGH 3U30C 1KB5A 2W9EL 3NACL 3HPLB 4MNHB 5K9QG 2CLVA 1PZ5A 3DMMA 1U3HB 3G6DL 1CD1A 1PG7H 5JW4M 3SDYL 2XICA 5EO9A 1JRHH 1WCQA 3C6LB 2NY7L 2VSCA 1TZGL 2QQKH 2YRLA 4XC3L 5T1LD 1PD6A 4RFNC 1XGUB 3BKJL 5DRNA 5DJZA 5AZ2H 1A9BB 1D6VL 1VGEH 2AKRB 5I1GH 1CG9A 4N0UB 3BSZL 3U82B 5GISL 3ULUL 3DRTB 5I2IA 1B0GA 5IJKC 4N5ED 4WUUA 2CDGA 4OFDA 3MMEB 4X6BA 5EWIH 1SEBA 3OJDA 3RU8H 3S36H 4NKIH 3KPMA 5DGRA 1GC1L 1FYTA 2GJ6B 2P5EA 1KCRH 1J11A 2P5WD 4OCWH 5F1NA 2PKDA 1HHGB 1TENA 2R0WH 4ELMB 3RPIA 1MWAL 2B5IB 4N68A 1CL7H 4LLYB 1UJ3C 2R39A 5EORH 1WISA 1MHHB 3QFJE 3RQ3A 3W0WA 3UTPD 5C08D 1CCZA 3I6GA 2NXYB 5B39G 3ZTNH 3S88H 2EXWC 3RWHA 5M94B 5IVXE 2FEDD 3N50A 1HWGB 2V2TA 4GAYB 1A7RH 4U0RC 2FGZA 5IW6A 2CDFA 5KANI 1SM3L 5TDPA 3M8OH 4LPYA 1AH1A 1LE9B 5C0CD 1T2QL 3OJVC 2V9TA 1JGEA 3CVIH 3UPRA 4OZIB 1JHTB 2R0LH 3BGFB 3FJTA 3BHBA 4QGYA 2CXGA 3GJFA 1FNSL 4NQUA 4ZUUA 3FTGB 2DJSA 4JRWA 2MCG1 5HDLA 3DURA 2CQVA 4G9FE 4HMEA 3G5ZB 5TDNB 3RUGA 3HAEH 3GB7B 4JKMA 1A7NH 1HWHB 1IAII 3GBNL 1AGFA 1Q9OA 2AXHA 4NQCD 4QT5A 2VE6B 5IMKA 4EEEA 4APQA 2R1YB 2UYLB 5T3XH 4ZXBB 5DVOA 4JFZL 4MD4A 1JN6A 5D7LA 3RBSA 3IKCB 2GCYB 2YEZB 5GRYA 4WY7L 5C2BL 3MXWH 1IAIH 3QXAA 2CLRA 4DAGH 3CZFA 2OP4L 3L95B 3BWAB 3TC9A 3RUGF 3TYFA 5F7DA 3JWOL 4H1LH 1MHCB 5D7SL 3WNMA 3LEVH 1LK2A 1ONQB 1F90L 1DQDL 3A67L 1WJ3A 1YMME 1T21B 2ED8A 3LH2L 1UG9A 3BGMB 5C9JA 4FTVD 1J1OL 5DD6A 1U8NB 2OSLA 1BFOA 4O51A 3G04B 2X10A 2E7CA 2D2OA 4R4FH 4YNYB 3BIKA 2LAGB 5C0GA 2ZUYA 3QI9D 4JFQA 4KHTL 3B3IB 4QRRA 2P4AB 4J6RH 2Z9TA 4WUKH 2B1HL 5B3JE 1FIEA 4Z76B 4F15C 4NFCA 2JELH 1A4KA 4RGNB 3MJGX 4LCWB 3HI1A 3ARPA 4Q9BA 1MAML 1M71B 3KR3H 4PJCF 3SJVD 3OXRA 5E9DA 2Q76B 4X6EA 1FZMA 3BFOA 3LB6C 5JHDA 4AEFA 4PP2B 5DFWH 4LSSH 1JZ8A 5H37G 4ZUTB 3KLAB 5LKNA 4LBEB 4O00A 3VD4A 1ZLWH 3MRJB 4O2FB 4PRHA 3H9ZA 5J6GB 5DD0H 2NY2B 3QH3B 3RNQA 4W4OA 2ZCKH 2ZUQC 32C2B 1I1FB 2BNRA 1CDYA 3L3IB 4CL7A 1LO3H 2NMSA 3FB5B 2DD8L 1TTGA 1CXFA 1WICA 4ODWB 3RGVD 3FRPA 1IE5A 4PG9A 5DEFB 3SDAA 1OAZL 1FPTL 3B9KB 2GJZA 2W65A 5JNYA 1NMBL 1SYVB 1Q72H 5IEKB 2BRQA 4OF5A 3VMNA 1XT5A 1JNNH 3ZKXB 3LSOA 1UZ6F 4HD9A 4QLRA 2AW2A 3ULVE 1KCSL 5D5MB 1ZLWK 5ACZA 4JPVH 1MCLA 3NCYS 2DICA 1TZHB 5FO9B 1R5IA 3DIFA 4KMTH 2DQFA 5SWSB 3MRKA 2FZ3B 3U9PH 4CVXA 4YQXL 3W11C 3WIFA 3LKQB 1N5AA 2VAJA 3GEWB 4ZS7L 5CGMA 4G7YL 2RR3A 4ZUVA 1T4KA 3HE7D 5D93C 1WIUA 4I18B 4P0DA 5E03A 1QVOA 4UNVA 2DIAA 4KJYA 1C08A 3CPLA 4TOYH 3PXHA 3AM8C 2P49B 3JV5A 3QCVH 2ICWA 4MCZA 2HRLA 1U93A 3U4EB 4NBYB 1WTGT 4AEIH 1UQSA 2UZIH 1NGZB 2EIEA 2RIKA 3MRNB 3GSQB 3PGFL 5H35A 3SE8H 5FEBA 3RPKA 2DL9A 5EUOE 1PKQB 4GKNB 3FB8A 4JPKL 5HHMD 1TVDA 2VDOL 4XPGL 3MRBB 1CTOA 3MR9A 4U1KB 5FK9A 4L8CB 3GKWL 1KIQA 2YKLH 5EOCJ 5F96H 4PJIF 1A7QL 5GGVH 4U1NB 3LRHA 5ICZB 4GRWH 3NCCB 3UJIL 4LSRH 1LP9E 5CD5C 2ZCLL 4JFHE 4NQEA 4YHPB 1LD9B 4N8VB 1DN0B 1YC7A 2ZUVA 3FFCE 3QR2A 3MPCA 3WNOA 4G5ZL 5IBUG 3IDJB 3UBXI 1F4WH 2JE8A 3LEXA 2DQHL 5EZOH 3TIEB 1A6UH 4M1CC 2DMKA 4NDMA 1ZTXL 5A16A 5DJ6A 4NO5B 4LHUG 1AHWC 4LRNH 2YHGA 3VD7A 1EAPB 3MRLA 4AL8H 2FYYB 1QPPA 3MUJA 5DHVB 3VU2A 3P73A 1EHLL 1N3NA 4IHOB 5DF0A 4F7TB 4GQ9L 2NNAB 1LEGA 4WW1B 2J8UE 4XBEH 1E6JH 3ZSSA 1TQBC 2XYCA 5J6HB 4L9LA 4BUHA 3WN5A 4XP4H 3OZ9L 3LAFA 3O2DH 4HLZG 4ODXB 4PREA 4R8WL 3VXRD 4B41A 1NQBA 1NGXB 4Y4KC 4UT9L 4HHAB 4YGVA 1DFBL 1V3LA 2YK1H 4Z18A 4GSDL 2HLAA 5D2LA 4UOW0 4D0BB 1DN2A 3IAGC 3BAEH 5DRXB 3VA2C 3AB0C 1MHPH 2P8LB 4GG6A 3TVMB 1MIMH 4XNYH 1EEUA 4JRYD 3E6FA 3BT2L 2V5RA 1X4YA 4H8WC 4OCLC 4IDJH 4PBWD 3O2WH 1MUJA 3EAKA 4HMDA 3A6OA 2FLBT 4NC0B 4MHHI 4NRXA 1AI1H 3EYOA 5D2LF 4MMZC 2HVJA 4LRIC 1CGSL 3GMNA 3QIBD 4L3AA 1FNEB 3KWWB 4N1CA 5DUPH 4GG6F 4JZOA 4LCIH 3V5HA 4OZGE 35C8H 5IFHL 4XVJL 3D25A 1B0RB 3PWJB 3RZCB 1I1AB 2BVOB 1IM9D 1GGBH 4HKZA 3LMJL 2FJHB 5CP7B 4PV9A 1F11A 1PJ9A 3BQUB 5JO5B 3SKNA 5L88H 4UQ2A 4EI5A 1YECH 2VQ1B 2NYYC 4RDQF 1S9WB 3SDXB 1VHPA 1I7ZA 3Q6GL 4M02A 1EEZA 3KJ4C 3TT3H 3QA3B 4LSTL 4LKCA 1P1ZA 2JK5A 4LEOB 4XC1L 3C09C 1ZA3B 5GHWH 3QIWB 2H3NA 2I9LB 3VWKD 3DX9A 5HPMB 4X7EC 3AY4C 5EIQA 3HI5L 1EBAA 5SX4I 2VN4A 3PABB 4P2OC 4OI7A 2Z31C 4LF3A 3MLSL 4OI9A 1AO7E 4PRIB 3X11B 5JR1L 1GZPB 1NCAL 4OLZH 5SX4H 1AD0B 3MNVA 3VDAA 4GXVH 4WI9A 1EDQA 5ANMB 4G6JL 1E0OB 3BKCL 4YIQB 1MOEA 3TBTA 4JVWA 3M1BA 1U92A 3MOQA 3O4LE 3WHE0 5BS0E 3FT3A 3QNXA 1H5BC 5E8DL 3IFPB 1RMFL 4LPVA 2VR5A 4X6DA 3P4OB 4LPWA 5BQ7A 2VAAB 4W70A 4LNVA 2HRPH 4A2MA 1DVFC 4N0FB 2EKSA 4JJHA 1CU4L 3FQUA 5L6YL 1FO0L 1QSEB 2RQ8A 1NANI 2PXYB 4JJ5A 2BFVH 4TVPE 3T0VA 1IGIH 2EC9T 1WV7T 4JR9H 2IPKA 4AJ0A 4DCQA 3R8BB 2Q87A 4BZ1L 3C5SA 3QCTH 4X6DF 5E2WH 2UVEA 4JGMA 1PEWA 2CDEB 3T65A 3NA9H 3RVWD 4MCYB 1WBZA 3PHOB 3MZGB 3WO3B 4MSWA 2Q8BL 3RIFK 3MCG1 2QSCL 4XCCH 3FAXA 3MV9A 4QCIA 4Z7VB 5IHUH 5GS0D 1QFWI 5GJSH 1XGTB 2H6PA 4G6AC 2LU7A 4UDUA 2WNGA 4PRAA 1UWGL 4I3SH 1INEH 4X5XB 1Y18A 1Z3GL 5GRVK 4IJ3B 3VWKA 1UZ8A 3H3PL 1CI5A 3DYPA 3IDGA 4XWOD 4XP5L 2YA0A 1QFWH 3QNYA 3HMXL 5C0NC 5EOCH 4A6YA 4W68A 1BJ1J 1TTFA 5KS9B 2C4FT 3PQYA 1IC1A 1V3KA 2FX9H 2QR0B 4ZTPH 2PTTA 1N26A 4J7RA 1YQ2A 3CMGA 4C4KT 1PDKA 5ITFA 4YDLC 2MKWA 1BJMA 3U30B 1MJ8L 2Q8AH 3P11H 3RTQC 2AJXH 1VGKA 1T2XA 4L3EB 2F5AH 5HDBF 3HG1E 4XWGL 2BX5A 4QXGL 2QTEA 3LKRA 2R23A 3Q6FA 3VCLB 5KVMC 5I66A 4JPWH 4Z0BL 1RZ7L 4RFNB 1MF2L 3K1KC 3QQ3A 3LKNB 4JB9L 2DN7A 1REIA 3QEQA 4L4TD 1J8HD 3QDHA 2Q86B 2AXFA 3IKKA 1CVSC 5FECB 3G9AB 2V2XA 4PG2C 1S7UB 1F4XH 2I27N 4GRLA 4HGWA 3LS4L 1KYOK 1DQLH 2FSEA 5AWNL 1G7PA 2X05A 4HX1B 1KPRB 2AJUH 3NCJH 1CFSA 4HKBB 5D2NB 3GNML 3B2VL 4NNYA 3SE9H 3OXSB 2WV3A 1MI5A 1QR1A 4HIHB 1P7QD 3GKZA 3VWJA 3IAPA 1JGLH 2AK1L 1TCRB 3RWCA 1KB9J 4DQOL 2PW1A 1UJ3B 3MO1A 4I0PC 4YXHL 3EYQD 5BJTB 2YPLA 3QZWA 5DDHB 5E00B 4FOMA 1BPVA 4CN1A 4EBQL 1KCVH 2R4RL 2XZZA 3PWLA 2A2QT 5GS1C 3IAQA 5I30H 2VR4A 3IDMB 3SCMC 4D0CA 2G5BA 1A7PH 3I85A 5CSZB 2WBJC 2P43B 4X8XA 3H9SA 5DO2C 1BQSA 2NR6C 3KJ6L 4EI6B 3PWVB 5F88B 1P4LA 2BSSA 1RUQH 4CJ0A 3E2HC 4YEFA 1I7RB 1BJ8A 1A2YA 4M8QB 4U1SA 4H5SB 1FL6A 3UC0H 2B0SH 5C3LD 3S8WA 5E6ID 5FUCC 4YHLL 4NRZB 3ISWA 2CUIA 2ESVA 2RFXA 3L3JB 4ZYKB 1H3UA 4XMLH 5ALBL 1R6VA 4OV5B 2AV1A 2AEPH 3IETB 1LVEA 3I75B 3KYOB 4YHZL 3D85A 1R5VB 1HSBA 5T3ZE 5ADPL 1H3PL 2VERN 4GT7A 5EU3A 2AJSL 3REVA 1KENH 2EYSB 4HUWA 5GIRA 5H94B 2OK0L 1BQHA 4XI5C 2EH7L 1RZJC 4RMQA 5GGRA 4HJJL 5T1DH 2BVQB 1FFNB 3CFKA 4UBDC 2VZSA 3O6ML 2QSQA 4MDIA 3ULUD 4HQQL 1KJ2H 1YNKH 1ZHLA 3QUKB 5FA4A 5HVHC 2HFEB 3MLYH 2IANB 3B5TA 1P9MA 1YEDA 2O61A 1MEXL 3Q0HA 3QJFA 2IBBA 4M7KH 3D18B 2V9QA 5HDQL 3IRZA 1G7QB 4LU5H 4N0RA 2C1OA 5E8EA 3TNMA 4OLWH 2HT4D 1DBML 3MV01 4KZEH 4PJ9C 1ZS8B 5E4EC 4U1HB 3U9UB 4N0UE 3CDFA 2YD7A 2P8PB 2PW2A 3E8UL 4JKPL 1WGOA 1NFDA 3EO9H 1XH3B 2XACC 4L9DA 5I1CH 3J8F7 3DXAB 3TZVD 1IBGH 3M07A 2FH6A 1C16A 4F15B 3JWDH 43C9A 5CINL 2YD6A 3MGTA 5D9SA 3EGSA 4JFDB 3PNWB 2H41A 4HKJB 4MNQB 4ELME 2UUDH 4R90H 5GGQH 2EEDA 5I19H 5KW9L 2OBGA 4NZRH 3SBWC 4MLSA 3C6SA 1XF5A 4S0SD 1IGTA 4JFFE 4NKDA 5CJXC 2CKBA 4OGYH 4JFXB 1A0QH 5EU7E 2VDPH 3PWUB 4LQFH 4X0KB 2ZUQB 2A6KA 2P1YA 2VISB 2CMRL 2EDXA 2I60L 4UOW1 4WHDA 1ZVSB 3UDWC 3TJHC 3QDJB 1R3HB 3RA7L 1FNLA 3NIDE 3QXTA 1XGPA 2UUDK 5FGRA 1Q9KA 2MWCA 3DMMC 6FABL 4FFYL 1IAKB 25C8L 5TF1H 2V2WA 4WTZG 5ETUB 3LHPH 2O5XH 4BJLA 3QDGA 4LLUB 3RWGA 2VXTL 3KYMA 4CNIA 4XP9H 5B39A 3B6SA 4IMLA 1A1MA 3MOBL 2BSRA 4HPYL 3FO1A 2OR9H 3QUMA 4EQ2A 3BRGC 1A6ZA 4XPTL 4OCMC 3AS2A 4YDVB 1ED3B 1CE6A 3PP4L 3NIGE 3QIUC 5D6CB 3FN0L 4D3CH 3IS0X 4UTAL 4LVHC 3UYPA 3O11B 1WBYB 2QQNL 3EJYD 2EIZB 4AM0B 1AKJD 5EBLB 5ESQA 3C8KB 3TO4D 4LSPH 1QYGH 4K3EL 3HS0B 1I1YB 4F7PB 4YEEA 1D6EB 1Q9LB 1R3LB 3RFZC 1MFBL 4LDEB 4JQXA 3C2AL 2XRAL 4XGZB 4YPGA 4MWFA 3OKOB 4JN1H 3PGCB 5CZXD 2W9LA 1A3LL 3OX8A 4RA3A 4M6AA 3MRRB 2R2BB 4OUUB 2BVTA 5IMLA 3UPCA 3QO0A 3VFMA 4LCWE 3D0VB 4M6ML 3FB7A 3CFDA 5I76A 2X9YA 5GZOD 1S7VA 3QWRD 4P4KD 1WWCA 4FFZL 4KUCD 2CO7B 1RURL 3WHE1 4ETQA 1JTOA 4CMMB 2D7TL 1Z9OA 2B2XL 2DDQH 1NC4D 3CAFA 4PTTA 2FRGP 2ADJA 1E4XL 2RHEA 1JNJA 3DWTA 3RWFB 5HYSG 3SN6N 1S7TA 4OFPA 5ISZB 1AHWB 2WBKA 4PJXB 3RNKA 4APQC 3G9VA 5L2KA 3JTSB 3F65A 1HIMH 1NCWL 5AZEH 3L9RB 3N9GL 1IT9H 5DSCB 2DKUA 1YJDH 3DECA 3RZWA 4PJHB 4PJFB 4F7EA 5DUBB 4OLXL 1KSRA 4Y8AA 5FYLH 1TQBB 3KPRB 2BHZA 2VLRB 5I16A 4NJ9H 1KELL 1RIVL 1A6WL 3GMLA 4KKLD 3F62A 2CRIA 1OPGH 1Y6NR 3X12A 1QKZL 4C58B 3MRQA 5D70L 4UV7L 3WFHA 1SBSL 4Y4KB 5J7CC 1KXTB 4N5EC 1H8SA 4PLKD 5C0RL 3VFRA 5F7YC 4JY6A 3QEGL 4P3WA 4PTUB 5D5ME 2AV7B 2DQCH 3QWOB 1JHKH 3C8HA 3QHZL 1G7IA 3IJYB 3AB0B 1R3IL 4MJ5B 4OSUL 3PJSB 5C0IB 4HIIB 4H26B 1CGYA 3DGGA 5SWSE 5ENWA 4AIZB 4XNQA 1QLFB 1ACYL 4PJ8B 4HIJB 4GW1B 2BNQD 1TJIL 1J5OL 4ZD3H 2Y4SA 2JCCB 2KZWA 3OF6D 1VCAA 5IVZB 1BBDH 5DD5L 4PJBA 3PIQB 4JAMA 1EEYB 2FEDC 1R3KB 5LGHH 4NM8H 2KH2B 3MRPA 1QTYT 1PG7X 3UTSD 1RIHL 1G9MC 4X6CB 5EZJA 5ESAB 4Z7UB 4LCUA 1OQOA 5CEZD 1WWWX 1IZKA 3QWQB 2J3SA 4RMTA 1UACH 4NUGL 3EOBB 4LSDA 3NZ8B 1I1CA 1RK1A 4LSQL 4BSVB 2HVKB 3DVNA 4Q2ZA 4UDTB 3Q3GB 4NO3A 4NWTL 4BZ2H 3KJ4B 5JQ6L 1WAAA 3QULA 4BH8A 3V5DA 5FM5M 4L4VB 5DTFB 4XP6L 5DJDA 1ZWIB 1GOFA 2JKXA 4I0KA 3U2SA 4K07A 4MA8L 2DTMH 4QO1A 1XIWD 4LLQB 4Z7OE 1XF4B 2AEIT 2DWDA 4RX4A 2MCPL 1HYSD 2VXQH 3MRHB 4HFWB 4P2OB 3UJTL 3V5KA 2Z31B 1BZ7B 3QPQD 2R8SL 1ZEAL 1NPUA 4ZFGH 1MFNA 3KPSD 4XNXL 1MCWW 1LO2L 3PDOA 3LRGA 1WAAF 5HI4C 3H0TA 2Z91A 5K9KA 2VQTA 5B3JF 3FO9A 4L29B 2ILLA 3PV6A 3E6HB 1DLHB 3ROLB 5EU6B 1NUNB 1DSFL 4KI5C 1QRNA 1MLCA 5IOPB 4HK0A 3KYNA 5I1EH 1H5BB 1IAIM 2ZKHL 2N7BA 4KAQH 4KKBD 3QI9C 4OCXL 3T3PE 4F80A 3U1SL 1BVLB 1DVFB 3UTOA 5D7JA 4MVBC 4XH2A 4YR6B 1GAFL 4Z0XA 5JXEA 4RGOH 2ZPKH 4JEGB 1KT2B 1CICD 5HGHB 3OGCA 1CFBA 5F9JB 3DYMA 5K93A 5BVPH 3VXPA 4WV1C 1IEHA 2EZ0D 4LHUA 2X4SB 1N5YH 2C1PA 3D0LA 2W91A 4LLMA 4U1IB 1RK0A 4YWGL 3V6ZB 1MFCL 4NWUL 4G7VH 5FYJU 4HC1L 3HB3D 1GGIL 1JF1A 4OAWA 4WFHE 1T0PB 2XZAL 3BVNA 1M7XA 3OV6A 2VLLB 1J87A 3BMVA 1RULH 5HHOB 4NHCL 3SOBH 1A02N 5IQ7L 4KTEH 3FT2A 3QDMD 1U8IB 2GTWB 3RGVC 4NQDB 4ZAKD 4I3RL 3DV4B 4QRPE 1A1OA 3GSNH 2OZ4H 3P4NB 4TSAL 4NO0A 3SDXE 2BVYA 2BRRL 3MTRA 1O7VA 4K23H 1J1XH 2FX7H 4P23A 4YDLB 3BISA 1OQXA 5SWZB 3S35L 3VRJB 2APWA 3MV8B 1CDIA 3VFWA 1U95A 1N2RB 2DL2A 5IEHA 4DZBA 4POUB 4HH9A 5EUOF 4UIMA 5AG8A 4E42A 3PV7A 3TO2B 3WN5C 4Z5RA 1Q0XH 4XVUC 3IJSB 3IU3A 5L2JA 1A8JH 1QHOA 4OIIL 3WO4B 5IGXH 3V6FB 5CJQL 2D9CA 3U4BH 1BGXL 5JDSB 3MLRH 1GPOH 4KJWC 2EDRA 4P5KB 2IMNA 2DQJL 4YHOH 1FORL 4K3JH 3DROB 1KEGH 5D1QA 3BPCB 1L9NA 5ANME 3VFSA 1EFXB 4CADB 4Y5YA 1NMAH 3PWNB 2YC1B 1U0QA 3ET9F 2Y07L 1L7IH 5MEQB 1OAKH 1BD2D 3IFLL 4PJDB 3UTQA 3VXMD 4U31A 2IADA 2JJVA 4XPHL 4L5FH 5GSVB 1FAIH 4TSBH 3TBYB 5E2JA 3GJEA 4C83A 1T1WB 3U7WL 4OF0A 2CGRH 4PGDA 2MFNA 3UP1A 2X5PA 4BQCA 4I0PB 1QSEE 5I9QC 2VMFA 5IM7A 4HH8A 2E7LA 4Z9KB 3W2DL 3T3ME 2J8UF 3BD5A 4ZNEA 4G9DA 2GITA 4X4MA 3VFPA 2H32A 3G6JB 2J4WH 4LEXH 1U8QB 5IMOA 2X09A 3N85H 2PN5A 3K2UH 2E9WA 5HSFA 4CDHA 3ZDZE 3SCMB 5HYJA 1S7WB 1RZKH 1S78D 4MJ2A 1IEAA 5C07B 2WBJB 3JTTB 2PYED 1MCPL 1QHPA 1FAKT 1Q8MA 3QQ4B 3S3JA 1T1XA 5DMIL 2R1WB 4XHJD 3FQWB 3E2HB 4MD0B 4H0IA 4C56E 4OGXL 4G8IB 3BDYH 4PJGA 1UGNA 4U6VH 4X7FC 4KRPC 5IBTH 4U0QB 4KVCH 3DBXB 4P2QB 1HI6A 3BW9B 1XCTA 1H3VA 1SEQL 3LQAL 4XPFL 3NFNA 1AQDA 4K71C 3L5XL 5DEGB 4DFHA 5FIEA 1J86A 2YA1A 1CLZL 4GAGL 2ARJQ 3UYOD 1YC8A 1FFOB 3OAZH 5T1KD 1DQQB 1LO5B 4P5TD 1ROWA 2NPLX 3SDDD 4XZUB 3BE1L 4O2CB 4ZOAA 5A40E 4PJAB 4GRMB 4R2GD 2VYRE 1R3JB 4PJGF 1FO0A 4ALAL 1ZA6A 2HT3D 1PLGH 2ZOLA 1RZ8B 3H9HB 3RX8A 4L3EE 3OAUL 3WLBB 4ZOEA 1O0VA 1MVUB 4OZFB 2I9TA 1AR2A 1LHZA 1OB1B 5HVHB 4Z8FH 4RQQB 2IAMD 5EC2A 2GSGB 1RUPL 4F33B 3O3DB 3AFLA 2IBZY 4XNUH 5D8JH 3O6FA 3L7FB 4NFDA 5EIIA 3NAAL 1T7VA 2XZCH 2O5ZL 4M48H 3OAZK 4MJIA 5CEYA 4PJ9B 4JM4H 5E4EB 3O3EA 3QIBC 5EU5A 4OLYL 4YDKL 5J13C 4R3SB 3WSQH 3A6CL 1V05A 1T04A 2E7HA 3RBGA 5I8KH 4KI1A 2W0LA 3T8XB 5JW4Q 3KPNB 1N64L 5DUMH 1A3RL 3WE6B 3RX5A 4LLVA 2W38A 1OAXH 1D5ZB 3T0ED 1OTSD 1T20B 3F5WA 2DMBA 5D2NE 5FYJL 3CFBB 1W2KT 4HWBH 5EOQL 2VXSL 1DDHA 4U1JA 2DBJA 1PGRB 2MTPA 3HMXA 3ZE1E 4LGSB 3KXFD 2OM5A 4Y4HD 1S7QB 2HAZA 3I50L 4WI7A 4XT1C 3VWKC 4OV6F 3U46A 4WU5A 3AC0A 1UCBL 1JWUA 1EBPA 3FQTA 3H6JA 1FL5A 1KPVA 3I2CH 4ZUWB 4H88L 4E41A 1T66D 3VW3H 3CLFH 2AJZB 5JW3H 5GS3A 1G7HA 1F6AA 5GRJL 3NH7H 2FATL 3MNWA 5F7MC 1GGUA 3D39B 1UENA 4QRSA 2A38A 4LVNC 3RP1A 4NC2B 1AGCA 4PP1D 3QXVA 1KB5B 2DI7A 2CLVB 1PZ5B 1QSFD 3DMMB 4Q9QH 2DLHA 1BREA 1CD1B 4X9IA 5BZWA 4E9LA 5D72H 5EO9B 5FUZL 5DURD 2B39A 3PUCA 1IKNA 5EPMA 3SKJH 4M03A 2O5YL 1A6AA 4XCYA 2OL3L 2I26N 1I85A 2YRPA 4G8EA 2J1KA 4JO4L 1U58A 5D1ZD 3PWPE 4Y5VA 4CN4A 3QCUH 4IRJA 2IGFH 4L8DB 3GI9L 2FR4B 2BVPA 4XXDA 2P42B 4GRLC 4IRSA 5IROC 5I2IB 3QIUB 2CDGB 4JDZB 5B4MC 5CD3A 4XRCB 4X6BB 1SEBB 1QPXA 1CFQA 2VLKA 2X1QA 4LVHB 2F53D 1AXSA 2XNAA 3KPMB 2NW2A 3NIFF 4NCDA 3LN5A 1FYTB 1YY8A 1IQDA 5INCA 4CVWA 5IB2A 1KOAA 4FZ8L 1F6FB 4DK3A 4O5LH 2IANE 5SWQA 4P9ML 3L1OL 3RVWC 4FZEL 4Y5XA 2NW3B 3K81A 5IESL 4KRNA 3ULVL 3W0WB 5GS0C 3GMRA 1TJHL 4FP8L 3AREA 3I6GB 4RAHA 4TSCL 2DLEA 3OPZL 4OUOA 5C0BD 5HHVH 4IEFB 1QLRB 3RWHB 5MP6H 2V2TB 4OJFL 5IW6B 5IMMB 3OB8A 3BKYL 3TT1H 5TDPB 3HUJE 3S97C 4OZ4A 3MLXL 3CIQA 4X80H 5CEZH 1I8MB 4YUEL 5I1IL 2D7PA 3DXAE 5GZND 1BWWA 1JGEB 3UPRB 1W72A 3OKMA 4GKZA 1J0IA 3BHBB 5IW1B 4HWZA 2VDML 4OFVA 4MJ6A 5KVEH 4ZUUB 1I3RB 5KVDH 5DR5H 5GS2H 5CJOH 4JFDE 5AUMA 5MEND 4MNQE 4D9QE 8CGTA 3MUGA 5FKPA 3B9EA 5ID1B 5T5FL 1AGFB 4BZYA 1A14L 2ORBL 4QT5B 4HSQA 3NFSH 5IMKB 4NM4L 4APQB 3PL6D 2ZSVB 3P30L 1T3FA 5T1LB 1JN6B 4ZPVB 4AT6A 3MBEA 1J9CT 3NCMA 1NCNA 1QFWM 4V1DA 3VXUA 4JHWL 5DWUH 3QXAB 2CLRB 1OWWA 1A47A 3VFNB 3ZHDA 1YZZA 4ELKA 1UFUA 2DQTL 5FYLE 4HLJA 5DJ8A 1G9NH 4FN0A 3TYFB 3W9DA 3CNKA 1LDPL 5F7DB 3QDJE 4H0HB 1IC4H 3WFCL 1P4IH 2PO6D 1KB5H 5IF0A 2I5YL 5IK3A 1ITCA 3HHRB 4W6XB 1P9MC 5C9JB 2QBWA 4TTDD 5DD6B 4K7FB 2OSLB 2P5WB 5IB1A 1BFOB 3OSKA 4KDWA 4O51B 1MCSA 2HFTA 3QHFH 4XMKL 5C0GB 1EHNA 1BAFL 2XY2A 4PRPD 3R0MA 4K9EH 5C08B 4QRRB 1AFVH 3EYQC 2CUHA 3P9MA 2VXVL 1NCCL 3HPLA 2BK8A 3DX6A 2VTFA 1ND0B 4DW2L 4YO0B 1A4KB 1I9JL 1FP5A 3H7BB 3WDHA 1W0VA 5FM4A 3HI1B 1J1PL 1IRAY 4ZOBA 4UV4H 3CFIC 3EYUL 1A9BA 4WTZA 3OXRB 5E9DB 3ARBA 3P3YA 5EU4B 1FZMB 5JHDB 1EJOL 1MAJA 2P47B 3V0WH 1A1NA 5E24E 4IS6B 1AY1H 1P7HL 1T0MB 2CR6A 3QAZB 3BP6B 2OLDA 5IVOA 3LZFL 3DRTA 4PRHB 5E6IC 3L5IA 4G8GD 4P57B 2XN9A 5C2UB 3MMEA 1Z9MA 4HPOH 4NQCB 4F9LA 1FZKB 1VB9A 4IOFD 4Y19D 1D5MA 5K59F 2GJ6A 3Q48A 1QLEL 1WTLA 3FKUS 4UILH 1XGQA 4PG9B 3SDAB 4LLYA 4UUJB 3GJFH 2IBZX 1MHHA 1C5CH 5JNYB 2VDRH 5DJAA 5JXAL 3R4DA 3HC3L 3L3OA 5TQ0H 4NPYB 3ULUC 4P2YA 2IH1A 1YEHL 4OLVL 2F54E 4R7NA 4JFPA 1AGBA 4BH7A 4PJXE 3VXSE 4CDGC 1Z5LA 3HMWL 2Z0BA 4MMXC 1GC1C 3CVHL 4FTVB 4OZIA 1L0QA 1G6VK 1IARB 1N5AB 1JBJA 4PJHE 5BV7H 4PJFE 2PF6A 2HT4C 3MJ8A 2EH8L 5C9KA 2UWEA 1T4KB 3PP3H 3GJFK 2VLRE 1PYWB 3QI9B 5FB8B 5TDNA 3GI8L 5E95B 4RMVA 1TMCB 2WWMC 4X4ZA 1ZLSH 2ICWB 4MCZB 1EJ6A 2VE6A 4F2MA 4PIRF 1U93B 4KJQD 3TZVC 4M3JA 1QBLL 4TRPL 2R1YA 2UYLA 5ACMA 3V4VH 4HXAL 4ZXBA 3EDKA 4OZIF 2GCYA 4J4PD 4K3DH 5HYSA 3QPXL 5H35B 5J1AA 4S1SL 5I18L 3SJVB 2UWEF 3BIBX 4YDIL 1OGAA 4HFUH 1KBGH 1GGCH 3FB8B 3PP3K 3O6LH 4XAWH 2XQBH 3DARA 1P4BL 2JCCE 1LE5B 3MR9B 5FK9B 4FQIL 1MHCA 1KIQB 4WHYG 4KQ4H 3D3VE 5E5UB 1MCQA 4D9RE 5LJYH 2VQUA 3ZKMD 1T21A 4XXCC 4BFGA 2NY4D 2Y7QA 1EMTH 4J23A 1T03H 4X9GA 5LAXA 1YEJL 1U8NA 4NQEB 4W6WB 4O58H 5DD3H 1C5BH 1DBJH 4YNYA 5TQ2H 1O5DT 4TVPL 4BQBA 3WNNA 4Y2OA 1RHHA 1S7XB 3LEXB 1U6AH 4XBPA 2CIIA 1K3ZA 1T89A 1KCUL 4L8BA 3C5ZA 4NDMB 4GMSL 5CZVL 1QEWA 5A16B 5F7EH 3HZKB 1G7MA 1DQJA 2I25N 1IGMH 5AEAA 3JWOC 3MRLB 1NEUA 2XWBB 5TE4H 3MA9H 4NKMB 4O4YL 3P73B 2BNUB 1VA9A 2BP3A 1LEGB 2F19L 1M71A 4L9LB 3P0YL 4Y88A 3WN5B 4LIQH 2PR4H 4Z7NE 1JPFB 1JTPA 5DMYA 3V9FA 1GHFL 4PREB 5F44A 1BP3B 3CXDL 3ARUA 5KSAA 4OCNC 5C09D 3RVXD 4S2SA 2WUBL 1BQLL 3K2MC 4FFVD 2HLAB 1WUNT 3QH3A 2D9QB 5EZIL 4PFEA 32C2A 1I1FA 5C0AD 2NY5H 4FABL 1LO0L 3QP3A 3UTZB 1B4JL 3TO4C 4JQIH 1X5LA 2YBRA 1NJ9A 4A2LA 3KPLB 4TQEH 3E6FB 4QOKA 1Y0LB 4HT1L 1QD0A 4HS8L 1MUJB 1SYVA 4K7PH 4NRXB 3EYOB 3B5GA 5DQDH 2AJYH 2HVJB 1PG7L 5GJTH 3GMNB 1JRHL 4F58H 2QQKL 4ZO9A 5I9QB 1NLDH 3V5HB 3VJ6A 4R4BB 1QFHA 4FXLA 1SY6L 3D25B 2AK4E 2YD3A 5AZ2L 4HKZB 2VIRB 2VITA 3MV7D 4PV9B 1VGEL 5DJ2B 1F45A 2VN7A 3GSUB 3SKNB 4UQ2B 5GZOC 4EZMA 5I1GL 4P4KC 4YE4H 4BQ9A 9CGTA 1JVKA 1I7ZB 2XI9A 1EEZB 1CGVA 4ZPTA 1QBBA 4HBCH 5BRZE 2DKMA 5D5MF 4LKCB 1P1ZB 2JK5B 5EWIL 3RU8L