4YAQB

Crystal structure of a computationally optimized pg9 mutant
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
214
structure length
214
Chain Sequence
SALTQPASVSGSPGQSITISCNGTSNDVGGYESVSWYQQHPGKAPKVVIYDVSKRPSGVSNRFSGSKSGNTASLTISGLQAEDEGDYYCKSLTSTRRRVFGTGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords PG9_N100FY Fab heavy chain
publication title Redesigned HIV antibodies exhibit enhanced neutralizing potency and breadth.
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 214
sequence length 214
chains with identical sequence L
ec nomenclature
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yaqB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yaqB02
3M45A 4ZOAA 1UXSB 4ZOCA 4BFIB 2XA8H 4JFQB 2AI0L 3EYUL 4JG0L 2E7LC 1KB9K 4HMEA 5H8DA 4OD2B 5D7JA 1JNNL 4OZGB 1HIMH 4P5TD 3FQNA 5D70L 1P7QA 3C09B 5DXWA 1U3HA 4DGIH 3LPFA 4GKSA 1BECA 3GI8H 5AG8A 3CFEA 3DO7A 3RWHA 5HYEA 1XGPA 4X80H 5FO8A 4GAJL 4EJ1C 1KUMA 1UYWH 3D18A 3E2HC 1P1ZA 3C60B 1QP1A 4Y4FA 5D7IB 3QAZC 2CLVA 4W4OC 2QADC 2OQJA 5EZLB 4ZNCD 4GQ9H 2DQJH 3LEVL 3FFDB 1D5XA 1C16A 3PNWB 3RWJB 4XNXH 1BQHA 3P9LB 2FB4H 3PXHA 1MQKL 1AGFB 3O2VL 3HCVA 3EDDA 4H0IA 3MLUL 3RX8A 3SJVD 3VE0A 1PSKL 5E7FA 5EBLA 2FHCA 3QPXH 3NGBB 4B53A 1CS6A 1CDCA 1OPGH 2FEEL 3B9KB 3MLSL 4BSVA 4QY8B 1QSEB 4X8XA 4ELMA 1WIUA 4PJGF 2FD6L 4MQTB 4Y1AA 5EOCH 4G7YL 3REWA 1QSFA 1CZ8H 5C09E 2H45A 5DVKA 1HI6A 1XGUA 1S8DB 4QHLB 3RGVA 5EZIL 5DMIL 4FP8H 2CDEA 5T5FL 1DBJH 4AT6B 3VFMB 2ATPA 4L9DA 1PX4A 2F19H 4LCUB 5J6GB 4QHNA 1C08A 5H37H 2O5ZH 2K1MA 4OBRA 4R7DB 3WJJC 4JVWA 2DLFH 3P30H 2KQNA 3F7RA 3X11A 3PABB 3GSNA 4MLSA 1VEPA 3Q1SL 4HFUH 5GISH 2ZSWB 3DGCR 5EZJA 4NDMA 1GGTA 4R26H 1CD0A 3G9AB 2HKFH 3ULSA 4HIIB 3ME0A 4XBPB 5IQ9B 4H5SB 3PV6B 3VWKC 5DI8A 3MFGB 3T0EA 4M43L 3LKRB 2VJXA 2DLTA 2Q8AL 2FJGB 4U1KA 1IC5H 2C3GA 1UM5H 5E4EC 5FHBH 5C1MB 3VH8B 1MCIA 1J5OL 2GY5A 3V6OE 2BP3A 4LPXA 3I50H 4NJAL 2DM3A 4L4TA 1NAMA 3FHAA 5ACZA 5IESH 4KI5C 5B3NA 4YDLB 2YUZA 3D2UB 1HXYA 1UM6H 2V7NA 4AL8H 1DDHB 2EYSA 1JF5A 1N5YH 3QG6B 2PTVA 4XWOD 3MSPA 4RWHA 3D1MC 3U2SA 2SEBA 1D3CA 3CXDL 2A6DA 4WU7B 1ND0A 4TSBL 3O4LA 1OT2A 2RB8A 4NNXB 5CUSL 1AE6H 1KJ3H 4I4WA 2YEZA 3L6FB 3ZE1E 1AGDB 4X5XA 2AI0H 3EYUH 4JG0H 4MGXA 5GGQL 1ZGLM 4XBGB 1JNNH 4CU6A 1CXEA 1HH9A 4HPOL 3KYNA 1YECL 5D70H 1HEZA 5GHWL 3R06A 3MRBB 5FFLA 5KSVA 3ZT7A 4PJEA 4PV9A 1K4CA 4GAJH 4HIIA 4G6MH 3VGAB 4PTTA 4FA8A 2PF6A 5CIPB 3HAEG 5D2NC 1Z2KA 1ZHLB 4K7FB 3SDDA 2V9RA 4TNVF 1I7TA 3RP1A 3LEVH 5I1JL 5C0CA 1HINL 2DQFB 3KR3L 5EU5A 5E6ID 1ZLSL 4WEBL 2NTFB 1MQKH 2NY3B 3PL6D 3O2VH 3MLUH 1QZ1A 5DO2D 1PSKH 3RHWF 3MLSH 1WSST 4ZXBB 3QG6A 2W0PA 5JPNA 2FD6H 3PHOA 1S7RB 3VMNA 4G7YH 3SGKC 4RISL 4KJQD 2I5YL 5D1QC 1GGYA 5GS1A 3ILQD 1AH1A 3SCMC 1H8NA 3PE9A 3O2WL 4NO0D 3RKPA 5EZIH 2OXGA 5DMIH 1D6VL 1PZ5A 1U8MA 1U8NA 2CDGB 3U0WL 1NLBL 3V4UL 5T5FH 1E4XH 2Q7YA 5HGDA 4CAGA 3VGHA 3OKDA 2BDNL 3MYJA 3WN5A 4Z7VA 2WAHA 2JKXA 1CICA 2J5LC 4WFFD 2GYSA 4G6KL 1DL7L 1XAUA 1YA5A 3EFDL 2X1PA 1I75A 3A6CL 3Q1SH 4L9LA 1V7NL 2Z31B 4DK3A 4QRSB 5J13B 5CIPA 2D4DA 3WNMA 2A6KB 5GGRA 2YPKA 1Z6JT 1L9NA 4IJ3B 2B1HL 5E9DE 1T6VN 3MRLA 4P23B 3C6SB 4I2XB 5ID1A 4M43H 4O5LH 4ORGB 4KROB 4HGWA 2NTFA 4BH7A 1NUFA 2Q8AH 1ZTXL 3RVTD 4HWBL 1WFUA 3GIVA 3KS0J 5A2JH 1R24A 2XIDA 1J5OH 1QRKA 1AGBA 4NJAH 3HNSL 2AEQL 3JSSA 1J0ZA 1JTOA 4O9HL 4R97C 5GGVY 3KPNB 1IGYB 3CDFA 5ICYB 1LE5B 3CXDH 5DMYA 5DJCB 1D5ZB 4Q0XL 4TSBH 4GT7A 2LFGA 4AM0B 4FQHA 5CUSH 4PJHF 1UM4L 3H9YA 4KKAD 5I8OL 4PREB 1BVKA 2NXZD 1CQYA 1YN6B 4NKOB 3THML 1UACL 1AXTL 5CBEB 5GGQH 4ELME 5CEZD 1OAUL 2Z8WC 3IFOB 4Y1AE 5MENB 4P3DB 4HPOH 4KTYA 4KQ3L 1YECH 4HHAB 1QSFE 5GHWH 5JW4R 4GKOA 3BQUC 1C5DB 1P6AB 3B2VH 2E8ZA 5D7JD 4Z77A 1CN4A 5K59E 2A6KA 3NABH 5LWYL 1N3NB 1WBZB 1P7QD 1JUFA 1U3HD 1EJOL 2JF1A 1R5WA 3BRGC 4OZGE 4P23A 1ZA6A 4K23L 3W81A 2DLEA 1FGVL 5IM7A 3DTXA 43C9B 1S3KL 2APTA 2EDJA 3SDCB 2YOCA 5I1JH 2DMCA 4MVBD 1NGZA 1DN2A 1HINH 3CC5A 4KKCD 4Y4FD 3KR3H 4PJXA 2XI9A 1ZLSH 3S4SB 4WEBH 2V2WA 4OZHF 3KLHD 1R3HA 2JCCF 5EDXA 3VG9C 1AY1H 2OZ4L 5IHZA 3KPNA 4E41B 1NBQA 1T3FA 3GMOA 4YNYB 5H2BA 1FSKB 4ETYA 4RGNC 2ESVA 5TF1L 1A7BA 4TVPL 4KDVA 5BVJB 3MQIA 3DYMA 5L8KB 1NBZA 4RISH 2I5YH 3BPNC 4W68A 5DK0B 3SKNA 5IBTL 5B39B 3O2WH 4Y1AD 4PREA 3FOMB 1D6VH 3V4UH 1CF8L 3U0WH 1CFVL 1NLBH 4L4TE 3QUMA 1QSFD 3S97C 4PY7A 1JZ4A 3B6SB 3L7FA 1FJ1B 2X10A 2DF3A 3TH4T 5CEXA 2BDNH 3RGVD 1AC0A 4X7FC 3RI5K 3D3VA 4G6KH 3TBVA 1DL7H 4GOSA 4LRNL 2CXGA 3KJ4C 5D6CB 1GC1L 3EFDH 3O4LE 3A6CH 4JDZA 1SJEB 3SGJC 3Q5OA 1V7NH 3W5NA 1ZHBA 5HGBB 3AGVA 3QXUA 3QIWC 2IANB 3HG1A 4LPCA 3AS3A 3P9WB 4CW1B 4P46C 3TP4A 3SDCA 2B1HH 4KGJA 1B6DA 1TXKA 2D0FA 3L95A 1TNMA 3TA3B 4YE4L 2FSEB 3S4SA 4CNIA 1WWAX 2VZSA 1NLDL 1KB9J 1ZTXH 4HWBH 1MFNA 3ALXA 3SKJL 1QG3A 2OCFD 1ZHKB 4PJEE 4NKMB 1NANH 4O00A 3KPTA 3O8XA 1CIUA 1OGAB 4OLVL 3HNSH 4WI6A 2KH2B 1RK0B 3NTCL 1DQTA 2AEQH 2R0WL 4FQXB 3TZVB 3P4MB 1N5AB 4O9HH 2FR4B 4WHDA 2G5RA 5EU6B 2VERN 4I18C 1WBXA 1JBJA 4L4TD 5DK0A 4YK4B 3PGCA 1HCVA 2V2TB 3QUYA 1HE7A 3R0MA 2NY6B 3FOMA 4Q0XH 4MX7B 3REVA 3B3IB 4FQ1L 2A9NL 4MD5B 1UM4H 3T04D 2HVJA 1FAIL 4AENB 3MA7A 2EXYC 4FHBD 1H3UA 2Z92A 1I4FB 5I8OH 3QUZB 4WI9A 1F13A 3O4LD 1JGLL 1P5VA 3THMH 3B9DA 1UACH 1AXTH 1VB9A 2QEJA 3O9WB 4DWHA 1OAUH 4OZFB 1FVDB 2RGSA 3W9EA 2VDKL 4KQ3H 3SE8L 4YHNA 2CR6A 1CL7L 3OV6A 3I84A 4MSWB 2BSRB 5EA0L 1FNHA 5L88L 1TIUA 1K5NB 5ERWA 5LWYH 2BVPB 4PJIF 1EJOH 2H1PL 2DIAA 2W65B 1R3LB 2ZPKL 5I0DA 4K23H 4Z7VE 4XRCB 1FGVH 4M7LT 4G43A 1S3KH 3HAEB 3F8UB 5ID0A 5EN2A 2JELL 1CFNA 1RK0A 3AUVA 3L3KA 4NRYB 3LH2L 1H15A 2Z0BA 2OZ4H 2NX5B 5MEQA 1EHXA 4CL7A 4GRMB 3VFPB 5JLZA 2JK5B 1KIRB 1OSZB 5TF1H 2PO6B 4TVPH 5CD3B 1P84K 4LQ1A 3LD8C 3OKEB 4MX7A 2IMMA 3B3IA 3IKCB 3L9RA 4S1RL 5B3JE 1PG7L 5T33L 2QKIA 3IVKA 5J0BA 4KK8D 1UWGL 1JNLL 3K8LA 1V3MA 2BX5A 3MREB 1FN4B 1CF8H 3ARYA 1CFVH 1FIGL 4JVPA 4GRWF 3DIFB 2ARWA 5J1AA 1ACZA 1LMKA 1MI5B 2FECL 1OGTB 4JO4L 4UQ2A 2JIXB 4M6ML 1L0QA 4NQXB 2P45B 4JANA 1TPXB 3JTTA 4QRRA 4LRNH 1T7XA 1NFDB 1GC1H 3VXNA 1OF2B 3JWOC 4I9WE 4Z7UB 3WCYA 3WBDA 4P5MA 4X9HA 2CLRA 1ROWA 4XWOC 4IIQB 2UZYB 4JFOA 1AXIB 3FB5B 2R8SL 1TDQA 4PBVC 4YBLB 1FL3B 5AEAA 1W72A 4YE4H 1NLDH 2HJFA 3SKJH 2W9DL 4FZEL 5D7LB 3UPRB 4OLVH 3VFPA 4XVTL 3VW3L 4HUXB 3NTCH 2NW3B 2R0WH 1XF3A 5EC1A 4BUHA 3RDTA 4BELD 4ENED 2E7MA 1KCUL 4X6CF 8FABB 4J3XA 3HS0B 3ZYOA 4M1CC 3OX8A 1FP5A 5JPMB 3WL9B 5CGYC 2I26N 4O2EB 3MREA 3V4VL 3IETB 3UPAA 1TQCB 4ZO8A 5DF0A 4FQ1H 4Z76B 1OTSD 3DYPA 5DJ2B 1NFIB 1MI5A 1FAIH 4ZUSB 1LEGA 3TBYA 1FC2D 1F6AA 1JZ3A 1KLUB 1JGLH 3O3AA 4M7JL 4I9WD 3IDGA 1KJ2L 1H3GA 2ESVE 3ZDYE 5I75B 4U0QB 5J6HA 1G6RA 2VDKH 3O11A 4ZOEA 5E6IC 3SE8H 4NRZA 1CL7H 3EDKA 3PL6C 1WZKA 1JRHI 4Z9KB 5EA0H 5EUOB 3U0PB 5L88H 5JOEA 4MNGA 5CEZL 4WI3A 5DMKB 1YUHB 1AGEB 1JZ5A 2H1PH 5AD0A 2R69L 3Q6FA 4QO1A 4YHKL 2ZPKH 2NY1D 3UBXI 2BVYA 5EUKB 1ZA3B 4EQ3A 1ZLWH 3ILQC 1IM9A 5I71B 3G5XB 4UMGA 4GH7B 1WIOA 4P23D 4M61B 4DFHA 5KW9L 1AGCA 3HTLX 3WO4C 4CMMA 2VAAA 2JELH 3MRPA 4KROD 2GSGB 1XZ0B 3LH2H 3BO8A 3ULVF 1NSNL 2JJTA 1ZT7A 2YPLB 1I3RA 4PLKD 2MSPA 4IHOB 3HG1E 4HZAA 2UV3A 4LMQI 1AQKL 3ARDC 4O2EA 4BZYA 4JQIL 1A6AB 2CLZB 4S1RH 1PG7H 5T33H 3JVGC 4ZUSA 2R1WA 2ESVD 3KYOA 1UWGH 1JNLH 2HFEB 2DMBA 2FATL 2ZUXA 2YA2A 1FIGH 3VI4F 3IDYB 4OCSL 1G7HB 2GT9B 4NZUL 1QFOA 5C0EA 1Q94A 4JO4H 4GLRH 2CO7B 1NGYB 2BOBB 4M6MH 3RVTC 1LD9B 2NZ9D 3QDJA 4QXGL 5CWSB 4X6BA 3U0PA 3VXSB 3RPIB 2IPKB 3FRPA 2ZCHL 3RWCA 5INDB 3NN8B 1BFOB 1EA9C 5MEOB 4G3YL 3D3VD 2H2PD 1IGTB 3QPQC 4LGRB 2HFFA 3AMLA 3STZA 1I9EA 3QXTA 3UBXA 3KYAA 9CGTA 2R8SH 4RAUA 4M61A 3U9UB 4JN2A 3V4PL 3HG1D 4NT6B 4MD0B 5JW4N 4MNHA 1XZ0A 1MWAL 5C6PB 1EFXB 5FUCC 1FNFA 4S0TD 5ITBL 2YPLA 2W9DH 4MQXD 4KKAC 5E03A 3SDCD 5IWLC 3LQMA 2VITB 4FZEH 1K8IB 4IHOA 2NXZC 1U0QA 3BN3B 1JGDA 2FJHB 4XVTH 3WMSA 3VW3H 2I24N 2GAZB 2MKWA 3MGTA 4OFVA 1A7QL 2QSQA 5F1SA 3DUSA 4UILH 1G7QB 3F5WB 3O8XD 5AG9A 2CLZA 4XTRC 5H35A 4OZIB 5D6DA 2E9IA 5KSAB 1R3IL 2HAZA 1ZE3C 4X4XA 4RQQB 3V4VH 4KRLB 2N4IA 1KXVC 4QHUA 3VFSA 1G7HA 1ACYL 3KPRA 4WDIA 3ZO0A 3I02A 3V5DB 3HUJB 1NAML 3M17B 4FFYL 5FO9A 2HTLC 3QNZB 5D7SL 4M7JH 4JFFB 3H9SB 1HXMB 1KJ2H 3PWUB 4Y4FC 4KKCC 4TUJB 4DUVA 5HI4D 1IILE 4TULL 3KLHC 3IFPA 1RZIA 1CLZL 3C08L 4XB7A 5FGCE 3ARFA 3MNZA 5CEZH 3N0PB 3JV6B 1OP3K 4JFYB 1H0DB 2R69H 1SJVA 2F54B 3QDMA 3QH3A 4OCYL 4S0SD 4YHKH 1X5JA 5SWSA 5DFVC 3U9UA 4FFWD 4JY4A 5E1AB 3LQZB 2VITA 4WUUB 4XI5D 2ZOKA 5F7HA 5KW9H 3ZMRA 5A3ID 4XH2B 2IQAB 1QQDB 5DSCA 2X42A 5CINL 1NSNH 4Y88A 1JWUB 2XKNB 4OUOA 4PJGA 5E99L 1F4YL 2AV7B 2APBA 1RULL 1WFTA 3PWVB 1J12A 1AQKH 1GAFL 4P9HC 5T3ZL 3PDDA 4PRDB 1FZOA 4L5FL 3T8XA 3G6DL 2DLGA 5F44A 3C09C 4Z0XA 2EKSB 1V7ML 1NPUA 1CT8A 3CNKA 1UCTA 2NX5E 3M17A 2FATH 1CFTA 2VIRA 4OCSH 2FNBA 4NZUH 4IRSA 2PN5A 1T04A 1FVEB 2DL2A 1HQRB 3QUZD 4OCNC 4PJAB 4BZ2L 4JFXB 4QXGH 4JKKA 4EI5B 3O9WD 4JRXA 3FRUA 3O6LL 3FO2A 3NOIA 2ZCHH 4MA3A 4ONHA 1TZGL 4BSJA 4OCXL 1F97A 1MI5E 3NGBC 3OB0K 4LHJB 4QRRD 3B9KC 3LB6D 3D0LB 1D5MB 3LMJL 5DJXB 4X5WB 1YMMA 3NACL 3WS3A 3RA7L 4HKZB 1ITBB 3V4PH 1WTLA 3MV9B 4Z7UE 1MWAH 5CFHA 4HEPG 3K7UA 1GGUA 2X9XA 1UZ8A 2UY7A 5DQ9A 2ITCA 1XIWB 2Q87A 3CFKB 4PGCB 1INDL 1FL5B 2M26A 3CU1A 2NX5D 2A73B 4QNPF 2ICES 1R3IH 1WZ1L 5DUPL 3RDTD 2H8PB 1WAAA 1ZV5A 1E28B 4LIQE 3R0NA 1ACYH 4AEHL 3LIZL 2IH1B 3C87A 3QJHA 1NAMH 4FFYH 1HQRA 5T1KA 5D7SH 2GFBB 3I6KB 4C59B 5GGSA 3EYSL 4R6UA 1UVQA 2EXWD 5E2WL 3MJ9L 3HNVL 1MI5D 4BFEA 4XPGL 5HY9B 5HDQL 3D48R 1CVRA 4TULH 5I30L 3DYOA 3JV0A 3B83A 3V6FA 1CLZH 5IOPA 4FTVA 3C08H 5FA3A 4IS6A 1P84J 4ZODA 4EN3B 1K3IA 5IFJA 5A2LH 4OCYH 5FKAA 4FFVC 5SV3A 1WVZA 3H9HA 4L3AA 4PRPA 1FG2A 2JJUA 1BOYA 3DRTA 4N5EC 4QRUB 4P5KB 4HAGA 3QDJE 4KK8C 3T4YA 2P7TA 5EUOE 1U8QA 1DQQA 3ZHLA 1WC7A 3CFKA 1BM3L 4N8VA 2OL3A 1W0YT 3CZJA 3QO1B 5CINH 5C7XL 1U6AL 2Z93B 5ICXB 5JQ6L 4KWUA 2XNAA 3T0VA 4JGJA 1GAFH 5T3ZH 2J4WL 2ICWJ 2CKNA 3BP5B 3LVEA 3QXWA 4L5FH 1OWWA 2VQTA 3G6DH 1LE9B 4D9LL 4XPHL 2EDWA 3SPVA 1V7MH 2D7QA 2YPLE 2FIKA 1RZGA 3MGOA 4Q9BA 4TPRL 5LGJB 5IUSA 3MLXL 1LK2B 2J3SA 1Y6KR 4QTHB 3VGAC 1NDMB 1I8MB 2IBZY 4JN1L 3CFJB 1OAYL 4HS3A 4ZG1A 4XMKH 1ZWIB 2BRQA 5HJ3B 4BZ2H 2XICA 5GZND 1KN2L 1YEDA 2EDDA 3O6LH 4Q6IA 2IAMA 3HZVA 2PYEA 3MV7A 1TZGH 5DZNA 3IDXL 4CDGC 4UQ3B 3O3UN 4OCXH 1J05A 3QDJD 5IFHH 1OLLA 2ZG3A 1PLGL 4CJ1A 4I0PB 3TNMA 3B5TA 2H6PA 4M5ZL 2MNUA 4P5KA 3LMJH 3MRRB 1KB5L 1BF8A 4PTUA 3NACH 3BP6B 1ORQB 3RUGB 3RA7H 3MXVL 3MJ7A 4S10A 2ARJA 1OTSC 2ED7A 4C56B 1CFQA 1FG9C 2Z93A 5ICXA 5F71A 4OZHB 1T5XA 2DJUA 2FX7L 1RUAL 1RIVL 4NCC1 4X4MA 1NH6A 1SEQL 3SHSA 1INDH 2GTWA 4K8RL 1J1XL 2XTJE 4G9DB 4H1LB 4WFGE 3FB7A 4R90L 4ODUA 3BP5A 3UDWA 2YPLD 4F9PA 2D7OA 3HC0A 3JXAA 4N0FB 2YD7A 5C70A 4PJHA 1U3YA 1WZ1H 4XNMA 5DUPH 4ZS6D 3TPUA 5HGHA 1FPTL 5HHMB 1DANT 1ETZB 5J13C 4AEHH 1JWMA 3CFJA 3LIZH 1BFSA 3T0AA 4PJGE 4YPGB 1CLCA 2FLRT 4I3GA 4BQCA 4ZAKB 5DJ8B 1Q9LB 3L3DA 5E8OA 3EYSH 4IJ3C 4P48A 3MJ9H 4ZPTB 5E2WH 4JPVL 2VDRL 5B38G 3HNVH 3FT3B 3KPRD 4P23C 4XPGH 3I75A 5HDQH 3BIKA 5IVZB 4KROC 1DJSA 5I30H 3EFFB 5F93C 4PLKC 1X4ZA 3V5KA 3BP4A 1GZQA 4YJZL 2D7TL 3OSKA 3GFUA 3H9SE 4C55A 4ZO9A 3W9DB 1W0VB 4XCEA 1D5IH 1G7JA 2O5XL 1P9MC 1H9VA 1J8KA 1MIML 4LLVB 3ARFD 3T0BA 2X09A 4J8RB 4MDJB 5F70A 4I48A 5GIRB 3QEGL 2XTJD 3PWPA 4WFGD 5E2VL 4XX1E 1KPRB 5K9QI 2JCCA 3GSVA 1JPTL 4LDOB 5JORB 1BM3H 1TVHA 3SBWA 5C0RL 4DFIA 4JZNA 5J1SC 5C7XH 1U6AH 4TTDD 2F54E 2VAJA 3WFHA 5F7NC 1U92B 2B20A 4NOBA 5JQ6H 4ODWB 3ILPB 4O2FA 2NZ9C 4ORZC 4N0FA 3ELAT 4PUBL 1T22B 2J4WH 5TPWL 1YMME 4WUUE 3V5HB 4S2SA 1UG9A 2ERJB 3BRDA 3PGDA 4D9LH 4XPHH 5E5MB 4NN5B 2H2PC 2B1AL 5I1LA 1G9NC 4Q2ZB 4TPRH 5J57B 3P4OA 1PD6A 3K4ZA 4LEOB 3VXPB 5CZKA 3MLXH 5GSVB 5C0DA 4FXGA 3T1FB 4JN1H 1UB5B 4Z5RB 1OAYH 4HW6A 3L3GA 3UTPD 1FFOA 2W91A 3PP3H 1MAML 2XWJB 1KN2H 5EWIL 1GGIL 3SDCC 1ZHNB 1IE5A 2YBRB 3P77A 4CVZB 1WAAE 4C54A 1H3TA 3G6JB 3LRGA 3QXAA 4GG8A 4PJIB 1PLGH 1GPOL 3JWNC 5CJBA 3O8XC 5ISZA 3AROA 2YXFA 4M5ZH 5KS9F 1FSKC 4HIEB 2AK4B 3S88L 1KB5H 2R0KL 3NFSL 1KLGB 4LCYA 5CZVL 2XWTB 2X4QA 3MXVH 5F3BB 1NGWA 3O3BA 4J7RA 1IGJA 4FTVE 5EFIA 1B0WA 5GRWA 2FX7H 1RUAH 1YMMD 1RIVH 4ODWA 4WUUD 5ESQA 3RY4A 1SEQH 4WW2B 1M05A 5FYKU 3C5SB 4K8RH 1J1XH 3UTZB 1GZPA 3UTSA 3QEQB 4NSKB 4R90H 2ZUTA 5I73B 3EW3B 1FYHB 4MZ2A 5HI4C 2A83B 4PRPE 3E1F1 4JLRA 2Q76B 2ZNWA 3U4AA 3IJYB 1IQDA 1U93B 1X4XA 3MUGA 5J4MA 1W72L 2F74B 1DEDA 4X8JB 3WKNA 1K8DB 3D25A 1FPTH 1XGRA 1CE1L 2OK0L 4Q9CA 4MJ2A 1A1OA 5E00A 4FFWC 2OX5A 4LSDA 1QFWM 1EAJA 4JPVH 2VDRH 1AQDA 1LGVA 5A3IC 4QYOB 3TA3C 1CDBA 3CPLB 3O3EB 3OR6A 5T1KD 3R8QA 5ITFA 1B2WL 1EHLL 3QDGA 3SY0B 1KV3A 5FKPB 1U91A 2V7HB 4Y5YA 2D7TH 3K1KC 4YAQA 1QPXA 3F7YA 1VPOL 3HMXL 4FQXC 3D69A 3BW9B 4FTVD 1Y6MR 2O5XH 3AU1B 4IEFB 1MIMH 2DTSA 1RK1B 3QEGH 3LEYL 4XNUL 4YK4C 1CBVL 5E2VH 1G6RL 1AO7A 3PHSA 1JPTH 2NY6C 5DWUL 3KWWB 3LOWA 5ELIA 2PYEE 2DIBA 2W38A 4PRPD 3MV7E 5DJDA 5C0RH 4WV1B 5ICZA 1MLBB 4AYFA 5DMJB 1IL1B 4PY8I 5ETUB 4HPYL 1DCLA 1GIGL 1XIWD 3QUZC 2VC2L 2VLKB 3ZE2F 3G5YB 1A9EB 3OAYK 4X6CB 2AJXL 3O9WC 3VFNB 4LSTL 5IGXL 4PUBH 1A6ZB 3HLAA 2HA1A 5TPWH 1BX2B 1KULA 1H5BA 5F3HB 2AXFA 3W11D 5HVHB 2R2BB 5FOBA 4U6TA 3BPLB 4TOYL 5TDNB 3TCLB 2B1AH 2ZUSA 4PJ8A 4QGTA 3LB6C 1BD2B 4X4ME 4EUPG 4OF3A 2Q6WB 3Q3GB 1HZHL 5I8EB 4W6XB 3L3HA 5EPMA 1QHOA 5DT1L 1RZKL 2VABB 5JA8B 5GRJL 5TFSL 5KAQF 3OKNA 4RMTA 2GSIA 3KYMB 2XG4A 2E8YA 2DQUL 2UVEA 4ZO7A 3TEUA 3QIUA 5C0AB 1MAMH 5EWIH 4QTIH 1GGIH 2DJ4A 1XT5A 3SY0A 4PJHE 3BGMB 5FKPA 3KPSA 4DN4L 4FXKA 2VDPH 5I1KL 3D39B 1FO0B 5KVFL 3GJEA 2D2OA 3IT8D 1YEFL 3AU1A 5IG7A 1GPOH 3RIAK 1QHPA 3DV6B 2PYFA 2PYED 1A1MB 4AH2B 5HD8C 3A67L 3MV7D 1QTYT 4XHQA 4NNPL 1G7IB 1FYTB 3QXDA 5FM4A 5TGBB 2NLJB 3HE7A 3S88H 1UKQA 2PO6C 1FLTX 5L0QB 3NFSH 4JM2B 5CZVH 4F7CB 1T20B 4E5XB 3F6LA 2P8MA 4IMLB 4GAGL 1MLBA 5C3LD 1DVFB 4JDVB 3IS0X 5IHLB 5IB1B 1JRHL 2C1OA 3QIBB 2AJSL 5BZDA 3EO1B 2EXWC 1W0WA 1UB6B 4LSVL 4UOJA 4PV8A 2DQEL 1G6VK 3GSOA 4QXUL 1I1YB 4HKJA 5F7KC 4HGKC 4HUUA 4XP9L 3P9MB 1TPXC 3PWPE 5JOPE 4OZHE 3BN9D 1GVIA 1W72H 1XR9A 2JCCE 2RBLA 4NYLB 2X9WA 4DCQB 3EZJB 3PHQB 1MHHA 3Q3GA 5I8EA 1CE1H 1EGJL 2IG2L 2BJML 4QRPA 2OK0H 3QUXA 1KIQA 5DD6B 3WIHL 3NCJL 1U9KA 2HN7A 3KYMA 1CIDA 3BD3A 1RZFL 1TVDA 5DQJA 3WEXA 4HCRL 3M07A 4LCWA 3LRSB 5KVMC 4LKXB 4YBLC 4YHIB 2B4CC 2O93L 1QEWA 4NQSB 3VGDA 3MRJB 2WP3O 3NCCB 1B2WH 5C8JA 1EHLH 5ILTL 4WTWA 2H3NA 2B2XH 4EVNB 1A3RL 1HQ4B 4JY5L 5TDOA 1G7IA 2CSPA 5HGGS 1FYTA 5TGBA 1VPOH 3HMXH 4R3SB 5A43C 3MROA 1A0QL 2OLDA 2JJTC 3SDYL 4XC3L 2GTZB 5IVXF 1F8TL 4AEFA 1CLOL 2NXYB 2KDGA 1A3LH 1NJ9A 5GZOC 4PB0L 1SQ2N 3LEYH 4XNUH 3ZKMC 1WBYA 3BZFA 1CBVH 5T1MB 1G6RH 1VGKB 4POZD 1H8SA 4PJ7F 5DWUH 5KN5B 2W9EL 1X6LA 1I7UA 4PJBA 1TQCC 1BLNA 1UXWA 4BKLB 2XQBL 4OF0A 4P4KA 1UB6A 3PWPD 5JOPD 4HPYH 1F58L 1U8OB 2F53A 1GIGH 4NZJA 4QKXB 2VC2H 2OTUA 1RJCA 2G75A 5GZNC 2AJXH 3Q2CA 4LSTH 5IGXH 5I75C 1YMHB 5C2UB 4D0CB 4YPJA 1CG9B 4XP1L 2Z91B 5BV7B 1MRFL 3WE6B 1T0NB 4YX2L 4YR6A 4QRTA 5DD6A 4TOYH 3TC9A 2LAGB 3CJJA 1U8KA 3HE6B 4WWKB 3JBG7 4WJ5B 1PKOA 2P5WA 3SEPA 1DUZB 3FN3A 4RMUA 1HZHH 5LAXB 1KTRL 3UTSE 3QULA 5DT1H 4YXKL 1UADC 1RZKH 3FQUB 5GRJH 5TFSH 4E0RA 1CD1A 4J12A 5MEPB 2CMRL 1AIFB 2FWOA 2OM5A 2DQUH 4NQSA 5I9QB 2DKSA 1I1FA 2OXHA 3GJFK 4ZAKD 2R2EA 1IZKA 1A4KA 5I71C 1T89C 1MREL 1NGXB 3MUJA 4JFEA 4Q97A 4ELKB 1A9BA 3T65B 5I1CL 4DN4H 4XNZB 5I1KH 4H25A 1N59B 2W9LA 5KVFH 5DR5L 5J1TC 1YEFH 5GGRY 3QHTC 2ZSVB 3S35X 1E6JL 1JNJA 4N5UA 1HHKB 4ONFL 1BZ9A 3P4NB 5E1HB 3JWDL 1FZKB 2G9HA 3A67H 4NNPH 3FO9A 4PJFF 1NBYB 1OP5H 4RNRA 2NY4D 5ISZD 2B7DT 4NC1E 1IC7L 4QXTA 2XT1B 1NKRA 2RCSL 4WNQA 1F4XL 1QFUL 1SEBB 3QDGE 1JRHH 2AJSH 2Z35B 4HBCL 4N9OB 3UJJL 2FEDC 3AB0C 2AK4E 3IDYC 4PR5A 3TN0B 4LSVH 1YMHA 2DQEH 3HI5L 2DWEA 4QXUH 5KVEL 5DYOB 2J8UA 1QO3A 5GJSH 4XP9H 3KPOB 1CD9B 3UTSD 1DE4A 3C8KA 3L3OB 3OR7A 1ONQA 4Y5XB 3GMMB 5EORL 2V5SA 3NPSB 5LAXA 1EGJH 2IG2H 2BJMH 4JZOA 2HP4A 1KJVB 3QNXA 3QWOB 3WIHH 3NCJH 2BNQA 3ARFC 3DROB 2ID5A 4L3CB 1IKNA 3BWUC 1RZFH 4DVRL 2XTJC 3SQOL 4Y16B 4HCRH 4HS6A 5A40E 1X3DA 3KPLB 2YHGA 1JWSA 3L7EB 3AXLB 1FFPB 3T65A 3H7BB 1HWHB 4LPVA 4LSRL 1T21A 3NCMA 4ACPA 1RZ8B 4TTDC 4OM1L 1ZSDA 4GRWE 2HJLB 1I1AA 4YDJB 5ILTH 4FS0A 4RFEA 4L29A 4JKMA 1A3RH 5IK3A 4V1DB 3S6CA 1FZKA 2R56L 4JY5H 5HDLA 3GMPB 4DZBB 1NEZB 1A6PA 3TIEA 1A0QH 3SDYH 4XC3H 1F8TH 3QDGD 1BVLA 1CLOH 2V5TA 4E42B 3RWFA 3WHXB 5D2LF 4R8WL 5KSAC 4YFEA 2L4OA 1QOKA 2D31B 3ZYZA 5JW4Q 2W9EH 2L0DA 3MFFB 4QHMB 1TQBB 5IW3A 5KTEL 2XQBH 5E2UL 3AM8A 2VKWA 4S1SH 2YC1B 3DVNB 3VXTB 1KPUB 1CWVA 1F58H 4F33A 1EEZA 3OAZK 1MUJA 4NQCA 4O2CB 4X9IA 4LHUB 1WF5A 2CRYA 4YIQA 3WNKA 1K85A 1JI2A 3AREB 4HWZB 4XP1H 2RFXA 1MRFH 5ACMA 4OBSA 4YHML 1JZ7A 4YX2H 4YGVB 1MJJA 1F6LL 3VRIB 4PJ9A 2A6IA 3TPKA 2OL3L 5KSUA 4F7TB 4ZFOB 3UYRL 5E94A 5KZCB 3QZWG 4X6CE 1OVZA 2AJYL 5J06A 5JHDB 4BM7A 4YXKH 1EAPA 2GJZB 4NZTL 2E9JA 4PJ8D 3D87B 1OTTD 2CMRH 2FYYB 3MBEB 1KEML 4BK4A 4GG6A 3H7BA 1MCWW 2D03L 3HR6A 5EBWA 5HYFA 3RY5A 1MREH 4D9RE 5CSBA 4V1DA 1D5BB 4HG4J 1YPZF 5I1CH 4ZSOB 4QRPE 4XGZA 3QIUD 3TBTB 5DR5H 3A6BL 4G8EB 1MH5A 2BNUA 4WUKL 1MJUL 4PRIB 3MV01 2P8LA 2O61A 1E6JH 4ONFH 3VU2A 5KSBA 3OPZL 1MCCA 1S7UB 4QT5A 5FYJU 4Z95L 3GSRB 3JWDH 1MSPA 3KPSD 4WI5A 3V8OA 3WHXA 4ZNEA 1UT9A 5C0AE 5DVLA 4LCWE 3RVWD 1TTGA 3QQ9D 4DKFL 1I3UA 1KC5L 4OAWA 1IC7H 1WGOA 2RCSH 2J7LA 1F4XH 1QFUH 3OKKA 3HE7D 5EOTB 5I16A 5IB5A 3H2WA 4YBHA 5HHNA 3DRQB 3UJJH 3L3IB 2JJVA 4U1IA 1UH3A 3ZKXB 1FYTE 3Q48A 3HI5H 4P2QA 5KVEH 2OJEA 2BXZA 5FYLL 5TF0A 5JNYB 5DFTA 1K4DA 4EI5C 4G6AC 1VFOA 2AXJA 3WUZA 3ULVE 3U30B 3UXFA 4B0MM 2PW2B 2PTUA 5EORH 4P4RB 3MRKA 3UEZA 3U0TB 1QBML 3KNBA 4D9RD 1IBGL 1NGQL 2F53E 1J0KA 4DVRH 3SQOH 4GKZB 2EE3A 3WJLA 4QRPD 3QUXD 2E6PA 5IEHA 1H8OA 1NC2B 4MJ5B 4I3RH 4L8SA 1GYAA 4ZSOA 3O2DA 3IXAA 1DLHA 4LSRH 3VRLF 2EDLA 3VI4E 3V6ZB 1VESA 3BVNB 3FO0L 2NYYD 4G8EA 4OM1H 4JZJA 3QEHB 2AJUL 3OKYA 4LCWD 1XIWC 1CVSC 2P5WE 5I17B 5IBUG 2XZZA 5JIIA 2R56H 4J1UA 3G5VA 4X7TA 3D0VA 1UJ3B 3V2AR 3W11C 1P2CB 2P5EB 1B6UA 4ZFFB 4U6HB 1F4HA 4R8WH 1FYTD 5F8RC 1JHTB 2QTEA 1D9KB 5GS2H 2Q86A 3RNKB 4JFEE 1ZT4A 1FFQA 3BFOA 5I66A 3D6GA 4G6FB 1JPFB 5KTEH 3E6FA 5E2UH 5GS0L 4X6EB 3MO1A 3WIIL 2DQHL 3HPLA 3ULVD 3SOBL 1M71B 4K71B 5CJOL 1UJTA 3H9ZA 3DBXA 1I3GL 3ZKND 4P4KD 3EYQD 4Y5VA 4I5BA 4CN4A 3V79C 4TUOB 4YHMH 1BJ8A 2DQCL 2F53D 2NNAB 4BFBD 5DD3L 4XXCC 5EU3B 1GL4B 2OL3H 1MF2L 4ODBD 2D7PA 5E08L 5C0FA 1J10A 2AJYH 2A1WL 4EN3C 5KG9B 4NZTH 1IAMA 3OKLB 4F7EB 1CGUA 1KEMH 2P5WD 2D03H 3BH8B 1ES0A 5IMMA 3TVMA 4LLAA 1A7RL 1RJZA 3GBLA 2EZ0D 5F1IB 3MJ8B 1A6UL 1KT2B 4HK0B 1VFAA 1JK8B 1U8JB 2XKSA 1MVUB 1ZT1B 5EIIB 2CK0L 4YBQD 3E2HB 4HEME 5HTSA 2VSCA 2GI7A 2X4TA 3A6BH 1UJ3A 4WUKH 5T3XE 1MJUH 1VCAA 2BNQE 3RKDD 2LU3A 4KJYA 3OPZH 1WCQA 2R23B 4JFED 4Z95H 4P2CG 4U6HA 3TJHD 4JPWL 1BPVA 2Z8RA 3VXOB 3BN9C 4JAMB 2BSED 1L9MA 1LP9F 4DKFH 3OKOA 2NXYD 1KC5H 5HYSB 2YSSB 4NJ9L 4DUWA 1S7VB 4HH9B 3ZDXF 2DIJA 3MUZ1 3MRIB 2PTTB 4MZ3A 5HHOA 1H3XA 5L2JB 3MLYL 1EEYB 1T7YA 3MTRA 5FYLH 1H3VA 4U6VL 5DRWA 2ZUVA 4MCZB 5EU3A 2QQKH 3SGEI 2A74A 2Y4SA 4OV5A 3BEVA 3G5ZB 4HKBB 1OSPL 4BK5A 1EVUA 4M7LH 1JPST 2HT4C 1FFRA 3HZMA 4UT7L 3V0VB 4K94L 1QBMH 5HDOA 5JW3L 3E6HB 2A6JB 4I0PC 1IBGH 1NGQH 4HULB 3LAFA 3BH8A 5C3TA 3SE3A 5IV2B 4NQCE 4POZC 4GJTB 5FCSH 1FL6B 2X4PB 5F1IA 5T3XD 1KT2A 3LKQA 2BNQD 1ZK9A 3Q0HA 4OQ1A 3CUPA 4ZYKB 4NM8L 2GUOA 3FO0H 3G9VA 3OGCB 2AJUH 2CIIA 1I7ZA 1RIUL 3QQ4A 2N1KA 5A2KH 1LO3L 3K3QA 4K3GA 4TNWF 4JFDB 3SBWC 1XGTA 4UB0H 5IW6B 4LAJH 5KS9B 5FYKE 4JAMA 1VEOA 1Z5LA 5EIVA 4NCDA 3RL2A 4B7IA 1I1AD 4KK5D 1HOCA 3AFLA 3QNYA 4OTXL 4OI9A 4U4BA 4RA0C 5DRNA 1K9TA 3BHBB 4AIOA 3TWCL 1E6OL 1PJ9A 1MCDA 3JV4A 4ZUVB 5E4EB 5JIKA 1S7XB 4V1DE 2C1PB 1N6VA 5IR1B 1J7VR 2Y25A 5GS0H 1NCAL 3WIIH 4PGBB 3O3DB 2DQHH 3RWGB 4HZLB 3FJTA 5T1LB 4HGMA 4KMLB 3SOBH 1XF2B 4KUZL 5F8QC 3VD5A 1FV1B 4ZAKC 5CJOH 1SHMA 1I3GH 3WS6C 1OD9A 4ZFZB 4APQB 4NQDB 2EEBA 1WWWX 2DQCH 4XCYB 4CVXB 5CSZB 2BY3A 1TLKA 2DM4A 3F12B 5DD3H 4D8PB 4NQCD 4L4VA 2GK2A 1LEKB 4NFBA 5EO0A 1MF2H 5JA9A 1BZ7B 2GCYA 2ARJQ 5EG6C 5E08H 3KPMB 2AQ3A 2A1WH 1H3PL 4P2OA 4QNPE 4KGLA 3C6LA 1SY6A 3LKSB 4PJ9D 1BF2A 4P2QE 5JDJA 4X0KA 2R4SL 3CFDB 4PRBA 4JY6B 4JCMA 5FYKD 3VDBA 3NFNA 1A6UH 5EO1A 3ZSTA 1S9WB 1C5BL 2VXVL 1MCFA 5JHDE 2BY2A 1PQZB 2CK0H 2F9BT 4F2MA 1QLEL 2XFXB 4ZUUB 1RUKH 1AI1L 1Q9WB 3LSOB 5DZOA 4RWYH 5HYJA 4V1DD 4JPWH 3O6ML 4WFHE 4WI2A 3GB7B 3S3PA 1CGYA 4WENB 4KZEL 4KKLC 5IJVA 4F7MA 5E4IA 2C1PA 4ZSOE 1HSAA 4NJ9H 3VGFA 4NN5C 5DHVA 3DSNA 1V05A 4PRIE 1JNHB 1TITA 3MRHB 2AEIT 2MMXA 3M1BA 5AWNL 3MLYH 4HD9A 3FQXB 1M7DB 4ZFZA 2CO6B 1RZJC 4NQDA 2XQYK 3T4AB 2WIIA 2DI9A 4XCYA 5FGBA 4U6VH 3SKOB 5CSZA 5TJWK 4TNWK 4NRXB 1ZVSA 4PRNA 3L5HA 5D1QB 5JQHC 5K9KB 5EU4B 1QR4A 3SCMB 1OSPH 5HYQA 4JRYB 3CSYB 4P2QD 2VLRA 3FT2B 4BA8A 4NC1C 4URTB 6CGTA 4UT7H 4CGTA 3LCYA 5ADPL 3ULUL 3EDEA 3ROOA 4K94H 5JW3H 1SYVA 2BY0A 4FQPA 4Y5YC 1YEGL 1VADA 3B4NA 1YDPA 4AIXA 4W81A 5JHDD 4MJIA 2J5LB 3SO5A 1PX3A 3KG5A 3GSQA 3IDIB 3MBED 4NM8H 4MD4B 2CDFA 3X12A 1UA6L 4WFHD 2YA1A 1RIUH 3LSOA 2KZ1B 1LO3H 1DQJB 4WW2C 3O6FA 2XKUA 3D5OF 4ISVA 3I9GL 3GM0A 5I73C 5BRZB 1IEAB 5KVDL 2CIKA 4PRID 2YD6A 1CD8A 3K8KA 5DUBA 5IBUB 4OTXH 2I07B 5LXGL 3UTTA 4AJ0A 4LKCA 3FB6B 2QR0B 3KPPB 4OGXL 4Y4HA 1U3JA 4FG6C 3BEWA 4FFZL 3AMKA 1E6OH 1BVZA 5ESVA 3TWCH 4G9FA 4HV8A 3GJFB 4UAOC 1I8KB 1U8IA 4HKXB 1DZBA 3BD4A 2PW1B 2ITDB 1NCAH 2HJKB 4EI6B 4PG9A 4PJ8C 1OTTC 3VXUB 1JTPA 3TBSA 4KUZH 1JZ6A 2VL5A 2OR9L 3HB3D 5EZOH 4NRXA 5C08A 4I0CC 3RIFK 4JO3L 1KCKA 3MLZL 4CDHA 3GMNB 1KCLA 3QIUC 4N0UB 2VQUA 4NNYA 3ULVL 2HVKA 4HC1A 4UTAH 4NKIL 1F3DJ 3RBSA 4LSSL 1MCRA 5HHOE 5GS3A 2XZAL 1H3PH 1MCWM 3RVWC 3EOAB 2R29L 2WW8A 3QQ9C 5I15L 1DN0B 2R4SH 3IDNB 3JTSB 5ANMA 3BQUB 1L0XA 1SJHA 1I1RA 3VXMB 2FJFB 1C5BH 2VXVH 5DK2A 4NHUB 2XZCL 4WV1C 2EYRA 2YD4A 1BBJA 1ORSB 1QLEH 1U95A 3FAWA 3TVMD 1U8LA 4MCYA 1AI1H 1NAKL 4KQ4L 4QCIA 2APXA 4YC2B 5IVXB 4NKQB 1Q0XL 3FQRB 4LPWA 3O6MH 5TH2A 4DEPC 4KZEH 2Z4QB 2J1KA 5IB3A 4PJ7B 1JF1B 3BPLC 4HKXA 4M6AA 3WLBA 5F96L 3S35L 1C8PA 2IALB 3IXTA 3W2DL 3BMWA 3ZLQC 1D9KD 2PXYB 1T1YA 1T7WA 3CZFB 4HJGA 4ZDHB 5AWNH 3X3GL 5FAAA 3QUXC 1WT5C 5ABDE 3GGWB 4NCC2 4MAYA 4RDQG 4UDUA 2VISA 4IOIB 5HHOD 5CMAB 3VFRB 2BZDA 2E7BA 5DJYA 4LLQA 4JJ5A 1P7KB 4YHOL 2LU7A 5IB2B 1QSZA 2ICWI 5ADPH 2BFVL 3MPCA 4K3EL 5SX5H 3T2NL 2XRAL 4ONOA 3UAJD 3QRGL 2PUQT 3T77B 1DN0A 1G0YR 5GGSY 4WW1B 1YEGH 4Z0BL 5INCB 4TYUA 2WK2A 4LLUB 4W6WB 5L0QC 3P0VH 4JM2C 5J7CC 3ES6A 5CCKL 2FJFA 5M95B 4X6DF 3DMMB 2EDEA 2MCG1 3P0GB 4L4VE 3K0WA 2IADB 1RSFA 3QIBC 2AXGA 4PJXF 2NR6C 5I2IA 3ZKNC 3ZYIA 2DI8A 2X7LB 3I9GH 4P4KC 3QFDB 3QT2A 5H94A 3RZCA 5KVDH 3BPCB 4PJFB 1GCFA 4XVUC 3EZ8A 2JB6B 4PJ7A 3MV8A 3FAXA 5HGAB 5LXGH 5ACLA 2X40A 4PJCF 3HI6L 4OGXH 4GRLB 1G7LA 4FFZH 1OY3B 4BH8A 1AD0B 3CZFA 3UZEA 2I60L 4RBPK 1NCBL 4D94A 1OT1A 3FFCA 5B21A 5KS9E 5L8JB 2GJ6A 1U58B 3WSQL 4XP4L 4G80B 4P5TB 1ZVHA 4WHTA 1OARL 2OR9H 3NZHL 1CK0L 4I18B 3LKNA 2EZ0C 4JO3H 2WBJA 4LLWB 5CHNB 3MLZH 1VHPA 4DVBA 4Z7NF 4YBQC 1PKQB 3ULVH 3VWJA 4N1CA 4M93B 4NPYB 4NKIH 4CADA 4WW1A 1S9YA 2PETA 3ZKQD 3TJHC 1P7HL 4LSSH 4X98A 5FA4B 2ADGB 1UC6A 2XZAH 4ZPVB 3BDYL 4NN6C 4L4VD 2R29H 2DRUA 2HG5B 3BP7A 3W0WA 1X5GA 4NQDE 3LKPB 2NXYC 4PRHA 5I15H 5FXCH 2AKRA 4NO2B 4P2OD 2AV1B 1ZANL 4WTZG 3C6LD 3SJVB 4CVWA 4Z7WA 4PD4K 1RFDL 3GI9L 5KBNC 2VLRE 4L3EA 2XZCH 4KHXL 4PP2B 4ZMAT 2OS7A 3P73A 4M8QA 1XGQA 1T83A 5D1ZA 4BQ8A 2R1XA 5FM5M 3GMQB 4KQ4H 1F2QA 1A1NB 1NDGB 1Q0XH 4U1HB 4MJIE 4Z7OF 5JZ7D 5IB4A 5D2LB 5BV7C 5FB8B 2H9GA 1QYGL 2XACC 5FO7B 3GDBA 4HS8L 5F96H 3S35H 3K1DA 3W2DH 1QKZL 3U6RA 5DHYB 1T5WA 3HE6C 4WWKC 1MLCB 2WINA 1A22B 4HWUA 5JTWA 3X3GH 3HKFA 3NCEB 3QHZL 3U4EA 1CFBA 3MYZA 5I9QC 43CAB 3E3QE 1QLRA 3QP3A 1N2RA 1R3JA 4K07A 3F65A 4LGSB 2VUOA 5EC2A 3I3DA 1HCFX 2FDBP 4NPYA 4APQD 4NQDD 2P44B 4Q7DA 4YHOH 3WHE0 1LO5B 3WLWD 1N7ML 4MNQA 1X7QA 2BFVH 4XNZC 3FCTA 5IMLA 3VD9A 4IOFC 2VLME 4K3EH 5A2IH 3ZE2E 1UQSA 3T2NH 5CD5D 4NO5A 2XRAH 2PCPA 3MJGX 3QRGH 4KK5C 1KG0B 4AEIL 3EYFA 4OLZL 1Q38A 3PP3K 4U2ZA 4D2NA 2VLRD 1UKSA 4Z0BH 1FZMB 2P1YA 5C08E 3KS0H 2NW2B 5GRVK 3RVXC 5CCKH 1MFAL 3KPQB 1VFBB 5JXAL 1T0PB 5TE6L 1ADQA 4MJID 2FH8A 2YRPA 5LGKA 2VE6B 4ODXB 1NDGA 3BUYB 3TN0C 4XAWL 3AM8C 4ZS7L 1T4KB 1A2YB 4MJ6B 4O51B 2DL9A 5JO5B 4Y89A 3IU3B 3W39B 1JJUA 5E2JA 1KELL 3O6FD 3MCKB 3HI6H 4H26A 4KTDL 5ANME 1MLCA 1VKXB 1S7QA 3O2DL 2BOCB 4JPKL 1S78D 3NPSC 2I60H 1JV5B 3UTTD 3I2CL 1KGCD 1TJIL 4Y4HD 1HH6A 3WSQH 4OF8A 5BRZE 1HILA 4XP4H 5FUZL 1TZIB 2VO5A 4G42A 3DURA 4LLYB 4G9FD 1EX0A 1OARH 3QO0B 3KLAA 3NZHH 1CK0H 4QRQB 1DEEB 4Y16C 2VLMD 3U9PL 3HR5B 1XH3B 1LEIA 3HRZA 4U6YB 4BFGA 5ADOL 1LO5A 5DLMH 5B22A 3CFBA 3TT3L 1O7SA 2V2XB 1YEJL 2I9TA 2F5BL 5C08D 3VXUE 4ONGL 3CX5J 4N8CL 2RR3A 2D9QB 3VJ6B 3TO4A 3BDYH 5FK9B 3L5WB 4TTGA 5K93A 3GIZL 3HAEH 4YHPB 2ZOLA 5K9OA 5FECA 5SWQA 3S9DB 4Y7MA 2E9WA 3BKCL 5E6IB 1YPZA 1S5IL 3ARBA 3MOBL 1ZANH 3PL6B 4UUJA 1ED3A 4WU5A 2BVOA 1EPFA 1RFDH 3GI9H 4YZFF 2VZOA 1TQBC 3T2PA 4KHXH 4HXBL 1S7TA 1GHFL 4AMKL 5TDPB 4LLMA 3IU3A 3MXWL 3O45A 1T1WA 5FYKH 1F02I 3LPGA 4IBLT 1IVLA 5C0IB 4NO0B 4AQ1B 1QYGH 1ZMYA 3WV0A 5F7EL 5A16B 4HS8H 5GPRA 1S5HB 1TZHB 4DJMA 5KANG 5IVXE 1HHJB 1NCDL 2BCKA 1C5CL 5E8PB 1XH3A 4P57A 3QHZH 1R3KB 2DQGL 3DX6A 3MBEC 2GK0B 3VXUD 4PJ7E 4EBQL 4O02L 3V9FA 1SBSL 2EIZA 3MV8E 4U1JB 2L7JA 3MRMB 1JGEB 1KFAL 3WJLC 1WUNT 4HLZH 4WVRA 4HDIB 4Q9QL 5IF0A 3R1GL 5LVEA 1P69B 1BJ1J 2Z8SA 1N7MH 3RWIA 1T1ZB 3ARUA 3JUZA 3T2QA 4IOSD 1M6OB 3BKML 3FFCE 5E6YA 1MFEL 3DECA 2GJ6E 4JDTL 4HX1A 4AEIH 5DRZB 4OLZH 3HZYB 4BSWB 1MELA 4LVOB 1X5HA 2Y5TB 3BXNB 5I1DA 3NAAL 3UTQB 5DA4A 4GAYA 1MFAH 5JXAH 5TE6H 1MCBA 1YNKL 4XNQA 5F7DB 3HB3C 3TH2T 7FABL 3ZKXC 4XAWH 4ZS7H 1S7WB 1NGPH 3I6GA 5B38A 3W0WE 2DYPA 2J8OA 1KJ2B 1KELH 4OGYL 2OTPA 4LVEA 1A4JA 1KPVB 3SE4C 4KTDH 4K9EL 2AJ3B 5DTFB 1HK6A 4JKPL 3U30C 3RZCD 3O2DH 3ZTNL 1G7PB 5F89B 4JPKH 1P4LB 4L3EE 1RZ7L 3TFKD 3MV8D 1FRGL 1G9ML 3I2CH 1TJIH 4PJFE 5FUZH 2GK0A 2XPGA 1H3WM 4U2YA 5L8LB 4FQQA 3U9PH 3ZTJG 5CP7A 3FFCD 4HDIA 3ISWA 1QNZL 2GJ6D 1B0RA 5D7JB 4WO4A 5ADOH 1KJMA 1Q72L 3FQNB 4KPHL 3TT3H 4HJ0D 1P7QB 1U3HB 1YEJH 3FL7A 3VA2C 2F5BH 3ZZ1A 2YMXH 4GKSB 2WBJD 4ONGH 4RGMB 3CGTA 3CFEB 4H0HB 4N8CH 3DO7B 3H0TA 3RWHB 5FOJA 5DS8B 1XGPB 5FO8B 1R5VA 1EZVY 1RPQA 3D18B 4XZUA 1UJ3C 3GIZH 1P1ZB 3MZTA 4PP1D 3VWJD 1HHIA 1YNLL 2ZP0T 4Y4FB 3GBNL 2P47B 3OHXB 4F7PA 3MRQA 3GM8A 3IF1A 3BKCH 1PKQE 2CLVB 3BZDA 1S5IH 2OQJB 3SDAA 3MOBH 1D9KC 3KLSA 3W0WD 5F88A 5F7DA 1D5XB 4PRHD 5SV4A 1C16B 4HXBH 1AJ7L 1MCKA 1BQHB 1QFWL 4MNQE 3DHMA 1GHFH 3FN0L 4AMKH 1EFQA 5DEFA 1F4AA 3V0AC 3HCVB 3MXWH 3GSWA 3VE0B 5EBLB 1LP9A 5JDSA 4QXWA 2LQRA 4L3ED 4TVPE 4BSVB 1SY6L 2Y5EA 4OUUA 3SJVE 4ELMB 4GW5A 4EDWL 4HUVA 5D1ZD 4Y1AB 2Y06L 5HVGB 5IJKA 4A6YA 5F7EH 4KDTA 3REWB 4NN7B 3LKOA 4KRMB 1J0YA 3QSKB 4PBXA 1CGTA 4GRLD 3T0XA 4L8CA 1FE8L 32C2A 3IGAA 1HI6B 1XGUB 1NCDH 3B9AA 3RGVB 4XP5L 5TQ2L 4U1GB 5D1XA 2V17H 1C5CH 2CDEB 2C4FT 3OXRB 4RZCA 5D2LE 3V95A 2DQGH 2ATPB 4YDVA 4EBQH 1QA9B 4O02H 3IU4L 1SBSH 1YY9D 4QHNB 1C08B 3SE3C 1KFAH 2WWKT 4Q9QH 3FZUD 3CMOL 5CKAA 3R1GH 3X11B 5DS8A 3GSNB 4GXUN 2E6QA 4DZ8A 3BKMH 1MFEH 1IAIM 4JDTH 2IH3A 5EZJB 3OHXA 4NDMB 4MNQD 3NAAH 3J8F7 3MRCB 1HWGB 3S4SG 3ULSB 3RAJL 2W1NA 4L4JA 2X4RB 1OQXA 1MCQA 1EMTL 2XA3A 5DI8B 4TVPD 3T0EB 2DOCA 2VXTL 2FO1A 1YNKH 4HT1L 4U1KB 3RBGA 1Q9KA 4U6XA 3S5LA 7FABH 1SVCP 1KTLA 4L4TB 1NAMB 1OP5K 5ACZB 3HI1A 2QV2A 4FZ8L 5BZWA 5B39G 1QR1A 3ZHKA 4OGYH 2P8PA 1HXYB 4S11A 3O41A 1YPZE 2V7NB 4ETQA 2EYSB 4K9EH 4MS8D 4JKPH 2VLLA 5D5MF 3LN5A 3U2SB 1FQ9C 2SEBB 3ZTNH 2A6DB 1OW0C 3HMWH 1ND0B 4NBZB 4CRPA 1RZ7H 3O4LB 3OXRA 1FRGH 1G9MH 1WWCA 2P48B 4FQ2L 4HIHA 4LPTA 4I4WB 1L7IL 4Z7QF 4PD4J 4JPIA 5CBAA 2YEZB 4JJHA 1QA9A 1GOHA 4X5XB 2DQTL 2UYLA 4LBEA 3QI9A 3C6LC 1F45A 1QNZH 5A2FA 1MWAA 3SDXA 1PY4A 1HH9B 4KPHH 4NBYB 3KYNB 1JP5A 3AAZA 3U7YL 1HEZB 3R06B 3BSZL 5KSVB 4OLYL 2IFGA 5F1NA 4PJEB 5J8OA 2C4XA 3OAUL 3QCTH 4PV9B 1K4CB 4Y4KA 5JZ7C 3MRCA 1KYOK 5JOFA 4FQIL 1JGVL 4PTTB 1YNLH 2X4RA 3SKUD 3GBNH 2CXKA 2C5DC 4LARL 4PY8J 5FYJL 3S3JA 3TO4D 5ESAA 1F2XK 3MNVA 4YFDB 1BFVL 3SDDB 1I7TB 3CH1A 3SGEH 5C0CB 4U1LA 2BSTA 3VFUA 4EUPA 4EDXA 1AJ7H 1QFWH 4HC1L 5EU5B 3FN0H 3ARBD 4XWGL 3DI2B 1PAMA 1B4JL 2C4FU 4GBXB 3ARXA 3GK8L 1SY6H 4LSQL 3X13A 1IGIL 3MODL 3VRLE 4IRZL 4APQC 3ABZA 4EDWH 3WLWC 4OKDA 4JHBA 5JPNB 2Y06H 1J0IA 3PHOB 1EJ6A 1BMGA 1RMFL 3MLTA 3TBWA 2EECA 5GS1B 2LVEA 1FE8H 3S8WA 4OZFG 5BXFA 1WAAF 1KCRL 1ZOXA 1YC7A 4XP5H 5TQ2H 3I85A 1PZ5B 1U8MB 1U8NB 1R0AL 2Q3AA 2Q7YB 2AS5M 5HGDB 1MIEL 3IU4H 3OKDB 1JVKA 3MYJB 4Z7VB 3WN5B 4UDTA 3H8NA 1CICB 3CMOH 1WJ3A 2FRGP 1DBML 5DHVH 3BDXA 3WIFA 4WFFE 4L9LB 1P53A 5KOVC 3ZKSD 3ZL4L 1EEQA 5E8NA 3CDGA 4GW4A 5GGRB 2YPKB 2VWEC 3IKKA 4WEUD 3RAJH 3EDJA 2EIDA 3E3QC 1M4KA 3C8DA 3MRLB 1EMTH 1TETL 5ID1B 3WDHA 2N56A 3HPJA 4HGWB 2DLIA 2VXTH 4OQTA 4BH7B 4HT1H 3GIVB 2ZG1A 1R24B 4GBXA 4HUNB 5BS0A 1AGBB 4U7SA 1NEUA 2IWGA 4O4YL 4FZ8H 4GXVL 2VH5L 3OXSA 2BERA 1M7IA 3EJJX 4RAHA 4JFZL 4KAQL 3JV5A 3U1SL 2DYPD 5BQ7A 4E9LA 1B90A 3DX7A 4FQHB 3RZWA 4FQ2H 1L7IH 2G5BA 5CJXC 5B8CA 1LP9E 2M1KA 3CH8A 5DC4B 4YDIL 2DQTH 1F3RB 1R6VA 3F7VA 1BVKB 3R4DA 5DD0L 5E2TL 5HYIA 2LTQC 1Q9OA 1OP9A 5DZLA 4R7NB 3ZDXE 4UT6L 1FNEA 3U7YH 5CEZE 1UZ6F 3BSZH 2DLHA 2VL4A 4JRWA 4KRPD 2NY1B 4Z77B 4HF5L 3A0OA 3OAUH 1EO8L 1JUFB 4FQIH 1JGVH 1IAKA 1R5WB 3BX7C 5D9SA 5SX4H 4LARH 5FYJH 4WHYH 1CR9L 1P4BL 4X6DB 1ZA6B 2I9LA 1BFVH 5IM7B 3DTXB 3VD4A 2HT3C 2E7LA 5CAYB 3HZKA 2E7HA 5HHQA 1NGZB 3CC5B 4PJXB 1HN1A 4HC1H 3NA9L 5EO9B 4NFCA 3NCYS 3SDAD 2V2WB 3OGOE 4KXZH 4UBDC 1S9XA 1R3HB 3OBAA 1B4JH 4I0KA 5HHPA 3MJ9A 1PGRB 5BOZG 4LNRB 2P49B 3BZ4A 4RGOL 5IHZB 3GK8H 3MUHL 1T3FB 3GMOB 4LSQH 1IGIH 3MODH 5H2BB 4IRZH 2ESVB 3VXRA 4YXHL 4K7PY 1D6EA 2VYRE 1XCQA 1N8ZB 5DEGA 2P43B 4MDIA 1RMFH 1NBZB 4W4OA 4MQ7A 3SKNB 2FX8L 4KJPD 4KVNL 4TNVK 5IIEA 2XN9A 1KCRH 2F58L 1SYSA 2CRZA 3EOTL 5DEZA 3QUMB 2UUDK 4PY7B 1R0AH 3L7FB 5JR1L 4HIJA 5ALBL 1EH9A 1FVCA 4R7NA 3G6AA 5CEXB 1KB5B 5J9PA 2C26A 3FQTA 1J1PL 3RL1B 3RHWK 5D1XD 5MP6L 3D3VB 3TBVB 3UJTL 1DBMH 1YJDL 1J0HA 4GXUM 1TMCB 4JDZB 1A02N 3ZL4H 4KK9C 2UZIL 4XPFL 4YC2C 3EOBA 1ZHBB 4C58B 3HG1B 4X6DA 3OL2A 5KVGL 3UTOA 1FZJA 1TVBA 1JIBA 4YFLF 3NFPA 3SDXE 2OYPA 1DLFL 5DJZA 1INEL 5SWZA 3TFKC 3L95B 1TETH 4LFHD 5EO9A 2DWDA 4N9GA 4CNIB 2F5AL 2PXYC 4QOKA 3WJJA 2H26A 3ARVA 2KZWA 2DQDL 5D7IF 4LNRA 3PDGA 3O8XB 1SVZA 2D4FA 4PJCA 4O4YH 5GRZA 4GXVH 2VH5H 1X5YA 4G8FA 1VERA 2MQCA 3WXVL 1N8ZA 4HJ0C 2HRPL 3T0EE 3VI3F 1G7MA 1KNOA 4JFZH 1WBXB 4KAQH 4X4ZA 5HPMB 3PGCB 3U1SH 1E4XI 3QUYB 1ADQL 1Z0MA 5IMKA 4K2UL 3VWKA 3REVB 4PJDA 3VWJC 2HVJB 3MA7B 1KB5A 4Y2OA 5DDHA 2Z92B 4YDIH 3RL1A 5E2TH 5EU7E 2ZUQB 5BJTA 1IGFL 3DMMC 3W9EB 4MJ4A 4UT6H 1ZGLP 3EYVA 4YHNB 1QVOA 5E8EA 2EO1A 1KXTB 3QI9D 1CGVA 4DOHE 2ED9A 4HF5H 2BHZA 5ERWB 1EO8H 4XPTL 5C0BA 3N06B 4ZUWA 3NPZB 2QHLA 4KKBC 1WICA 5FF6A 1NC4A 3UJIL 1P4BH 4Y4KD 4GRLC 2FGZA 4G43B 4MXQD 2W60A 4C83A 1Z9LA 3DUUA 4ALAL 5I6XB 5ID0B 5CKGA 3QZWA 3NA9H 1CXFA 3T0ED 5EN2B 1CFNB 1JPSL 1CCZA 3L3KB 5AAWA 1H15B 4P5TC 1YY9C 4W6YB 4F15B 5T3ZE 3MRDA 2NY2D 4RGOH 5MEQB 3N1QC 1XCTA 4M03A 3RVUD 5JLZB 5HPMA 3VCLA 1NCWL 4JHAL 5C0CE 1QLFB 2G2RA 2RJMA 3ARGA 1WIPA 5D2NA 3R8BB 3L9RB 3OJMB 4M93C 2QKIB 3IVKB 2FX8H 4KVNH 3EYOB 3FTGA 4MXWL 5FGCB 2F58H 3IJHB 5BS0E 3EOTH 2NY0D 3VFWA 5CZXD 5AYUL 5JR1H 5ALBH 5J1AB 3MRFA 3DETD 3VMPA 2YD3A 4XX1G 3MGAA 4UQ2B 1J1PH 4M9OA 5C07A 3IRPX 1FO0L 5MP6H 4JANB 3VD3A 1F00I 3JTTB 5L2KA 4QGYA 4QRRB 3UJTH 1LO0L 1YJDH 3FO1A 3VXNB 2CR3A 4FOMA 4Y19A 2F15A 3SGKA 4P5MB 2AEPL 2UZIH 4UIMA 4RIRA 4XPFH 2CLRB 3UPCA 4ESKA 4PRAA 1G84A 1PYWA 1VENA 4KMQA 5KVGH 4MS8C 3QA3A 3ALPA 4JFOB 1DLFH 1D7FA 4UNVA 1INEH 5T3ZD 1I8LC 1W72B 2EDTA 2Y9RT 3MRGA 2VR9A 1GC1C 1LQSR 3SDDD 4U3CA 2F5AH 2HJFB 4UINL 2DQDH 3QQ3A 5C0CD 3D85B 3PIQA 1OCWL 4POUB 3DWTA 1XF3B 5EC1B 3IJSA 3RDTB 3WXVH 1QLFA 2GKIA 2HRPH 4GBXD 5BS0D 1ZLUK 1AD9B 2QJDA 1KYOJ 3RWDA 3OX8B 4H0GA 4RAVA 5IBTH 3EYOA 4M6NL 3IJHA 1Z9MA 1ADQH 3RTQA 1RI8A 2MWCA 4K2UH 2UWEF 1E4JA 2EDBA 3DVIA 4M4PA 1LEGB 3TBYB 3MRNA 1F6AB 2B8OT 3TO4C 2HLAA 4U31A 1EO5A 1U3ZA 4JQXC 3O3AB 3ARRA 3IDGB 5DJAB 25C8L 5FM8A 3VXRE 1IGFH 4LLDA 1UH2A 5J6HB 2DBJA 1G6RB 3O11B 5KOMC 5IHUL 4NRZB 3VXQA 4X4YA 4N1HB 1CICD 2VZUA 4NQTA 3DX8A 2XN9E 4MNGB 3HFML 4XPTH 5CP3H 4J3SA 5HDBF 5AD0B 1CDIA 4HJJL 4HUKB 3Q6FB 3UJIH 2IMNA 2NCMA 5CSGA 5DJ0A 2DJSA 1IC4L 3QB7C 4DAGL 3OJDA 1IM9B 3D85A 4ALAH 1AGCB 1I3VA 1INQA 1GGBL 4CMMB 5HPOA 4H8WL 2VAAB 4P2RB 3MRPB 1JPSH 3ULUF 5I1AB 2ATKA 3H3PL 3BO8B 1MHEA 1ZT7B 3PQYB 1I3RB 1BBDL 3OKMA 1U8PA 4X6DE 1AD9A 2H32A 1BHGA 3ZT5A 4HIXL 4N8PA 4D3CL 1NCWH 4JHAH 5MHSE 3EJYD 3N1FC 5SWZE 4PJXE 4BQ6A 3KHQA 2A9NH 2NTSP 1GXEA 3QYCA 4QOKE 3HMXA 2R1WB 1WWBX 4MXWH 3KYOB 3VXRD 2EDXA 4NHCL 3FOLA 1OLZA 3V6OC 1FHGA 3FONB 3PWLA 5AYUH 4PJCE 2HLFD 5F6IC 5DJAA 4F9LC 1AFVL 5C0EB 1Q94B 2X1QA 3FQWA 2XN9D 4PYHA 4RFOL 1IAII 1X9QA 1FO0H 2DMKA 2QQLL 1CYGA 2Z8VC 3QDJB 5DO2C 4X6BB 4A6YL 2EC8A 1LO0H 4TSCL 3QISA 5EULV 3RWCB 4LRIC 3T3MF 1FAKT 1YYLL 3TIDA 4OI8A 4OGAD 1LDSA 1JL8A 4V2BA 2HFFB 3CFCL 5CS7A 1I8IA 4KJQC 4Z7NE 1JFQL 3STZB 1B4RA 3C5JB 4AIZA 1RJLA 2E5EA 3D3VE 1AXSA 3UBXB 1UWXK 4ZUTA 4RAUB 4JN2B 2C7UA 4P2RA 1NMAL 4OFDA 4MNHB 5I1AA 4UINH 3PQYA 5MHSD 1OP3H 2R4RL 4PJBF 4G8IA 5SWZD 1OCWH 1JGDB 1NCTA 2CKBA 1JHKL 3MGTB 5C0BE 3SGJA 1Y0LA 3LS5L 3DUSB 4QOKD 2YWZA 3H3KA 4HFWA 1B0GA 5CLWA 2AGJL 3QIWA 4FRWA 4P46A 5H35B 4XXDA 2X4UA 2PR4L 4YO0B 4M6NH 4KY1L 1T80A 2V5RA 4X4XB 2OTWA 4GAFB 3FONA 5F9OL 3AB0B 4QHUB 3VFSB 1DBBL 4Z7OE 1FCCA 3KPRB 3ARSA 4WDIB 2HRLA 3I02B 4LVOC 3IDMA 3MMEA 4WFEE 4OZ4A 5FO9B 3VWKD 1SJXA 25C8H 5JIHA 3U46A 3CFIC 5SX5K 5IHUH 2UZXB 3WUWA 3IFPB 4L8BA 5C71A 1RZIB 3DX9A 1EXUA 2XWBA 2W0FA 3AY4C 2J6EL 3ARFB 3HC3L 3SQBA 1I85C 4QF1A 5I19L 1QPPA 3HFMH 2BNRB 3MNZB 4ODTL 3U48A 4GKNA 2XTJB 3C5JA 4HJJH 4LHQB 4K8RD 3QH3B 3QDMB 5SWSB 4JY4B 1YN7A 3NCBB 4M1DL 5D96B 5C07E 1IC4H 4DAGH 4JREB 2E27L 3GMRB 4H1LG 1OAQL 1EGJA 2VOTA 5C0BD 3EO9L 4LPUA 3WIHA 2ZOKB 4JE4B 1ITCA 1NC4D 4KDTC 1GGBH 3LQAL 4H8WH 5DSCB 1I7RB 1YEEL 3H3PH 4J3OC 4HCRA 1BBDH 4PJGB 2FH6A 3G08A 5D1XC 1KCUH 3BIAX 4X9FA 4HIXH 4DGVL 4D3CH 5D7JC 4YO0A 2VLJA 1FZOB 2FL5B 4ODVL 4ZFOL 2J8UF 5AZ2L 5D5MB 1LVEA 5I8CA 3T8XB 4J23A 4WFED 3SO3B 1U3HC 4Z0XB 3DXAA 4XB8A 3VG0L 2X89A 1CT8B 4RGMC 5ECJE 4NHCH 2EKJA 3QUYD 1ZXQA 4M7KL 1HHGA 4Y2DA 1MAKA 1CFTB 2VIRB 2YD8A 3ARGD 3MUY1 2ADJA 4MVBC 1AFVH 4IRSB 3C9NA 2AABL 1T04B 1JGUL 4RFOH 3TF7C 2QQLH 2BSSB 4JRXB 1T7VA 3FRUB 2YR3A 4A6YH 1JPGA 2ADIA 3K2MC 3FO2B 4TSCH 2BNRA 5IFAL 2PKDA 2Y7QA 4ONHB 4MA3B 3RVVD 5C07D 3WNPA 2DI7A 2EDFA 3NZ8A 1F3JA 1YYLH 5EBMA 1L6XA 3DGGA 3GHBL 1T0MB 4AY0A 3CFCH 1BQSA 1JFQH 1Y18A 3GMRA 2IBZX 3BT2L 1YMMB 4QRRE 3WS3B 4DQOL 5D7KE 4NN7C 1I9IL 1NMAH 2EDRA 5GQBA 5IW1B 3BKJL 3NH7L 1I7RA 2WMPA 1BOGA 1UZ8B 5DQ9B 3RGVC 2ITCB 2R4RH 4U1GC 4WEMB 3CLFL 1EK3A 5LGHL 1JHKH 3LS5H 1OB1A 2FL5A 5C09A 5I1GL 1QRNA 2XXMB 2YN5A 5D5MA 2YRZA 1XFPA 2EIBA 1HSBA 1MHCA 4JQIH 1PY9A 2DDQL 4YZFE 3MX0A 1QBLL 2AGJH 2M8XA 3BH9A 3QI9C 2CRMA 1LDPL 4KTEL 4RMSA 2PR4H 1XR8B 2AERT 1K2DA 4GLRI 4KY1H 4PIRF 5GSRA 1ZGLA 3K2UL 5F9OH 2MFNA 4MB3A 4OQTL 4XCNA 1DBBH 3HN3A 4H88L 3QJHB 2BRRL 4P0DA 1MY7A 5T1KB 4J3UA 2BSSA 3RTQD 2ICCA 5GGSB 2FZ3B 1UVQB 2NY5L 4GG6F 3ECBB 3QXVA 2AJZA 3T0EC 3CCHA 4YUEL 3GUTB 1MFBL 5F6HI 3IDJA 3V6FB 5IOPB 4FTVB 4G3YH 3SGDH 3U36A 5FA3B 2X05A 1A6TA 4IS6B 1DUYB 1T0MA 2J6EH 5T5NG 1RHHA 5I19H 3GMLA 4ODTH 5CEYA 3RVUC 5D7KD 1FC1A 4GW1A 3T0DA 5IFJB 2AEWA 2RQ8A 4NGHL 3LRHA 5KSBF 3BMVA 5FKAB 1AP2A 3H9HB 4PRPB 3GSUA 2KQMA 4M1DH 1J18A 1FG2B 5EU7C 5IW1A 2E27H 3DRTB 5F72S 4JO1L 3T4YB 5ITBH 2P7TB 1F90L 2W92A 3EO9H 1KCSL 1DQQB 1U8QB 1YY8A 2A38A 2W0LA 4MNGE 2NY0C 1WC7B 4N8VB 4ZQKA 2FO4B 2OL3B 3LQAH 5CZXC 1DQML 3PWJA 3EO0B 3UMTA 1KEGL 3DETC 1YEEH 1A7QH 1J1OL 3VRJA 3D85D 3DO3A 5JW5A 2XNAB 2VDLL 4LP4A 2R1YA 4ODVH 1XR8A 5AZ2H 1K3ZA 2F8OA 1PG7X 4NQEA 4OGZA 3QR2A 4P2RE 4G8GA 3SPVB 2EICA 4J3WA 4F3FA 3VG0H 4EUPH 3P0YL 3PQYE 2FIKB 5BO1L 1IEHA 2VTFA 1RZGB 3MGOB 4M7KH 1UEMA 5IKCA 3INUL 1TCMA 2R39A 2FZ3A 3P3YA 2AABH 3ECBA 4HS3B 2X4SA 1JGUH 3DV4A 2QQNL 1CXKA 2NY7L 3SDDC 3GUTA 4A2LA 3CSPA 4GUPA 4C4KT 3TYFA 1YEDB 3CSGA 1DUYA 1SMAA 1CU4L 4Q6IB 1A64A 5DVNA 2IAMB 3ARDA 5IFAH 3HZVB 2PYEB 4D0DA 3MV7B 4YGAB 1T1XA 1MJ7L 2OBGA 3CVHA 4JEGB 1J05B 4J3VA 3CK0L 4R4ND 3GHBH 1VACA 4GBXC 3TNMB 2H6PB 2C3VA 1PVHA 3BT2H 1Z9SA 4LF3A 5DD5L 4PTUB 5DRXB 5C9JA 4DQOH 4OD3L 2V9TA 2FO4A 3MJ7B 5LJYH 1I9IH 2ARJB 1DFBL 3EO0A 3NH7H 1CFQB 5GS1C 1IM9D 1MCSA 3DPBA 1T5XB 1IM3A 2C3HA 5E99H 5ENWA 3GSXA 1F4YH 3L3JA 1RULH 2GTWB 3CLFH 4P2RD 3FB7B 4NO3A 3V8CA 5IEKA 4ODUB 1NKOA 3PQYD 3LHPL 4HH8A 4AEEA 2DDQH 3WN5C 1QBLH 3HC0B 1CICC 3KAAA 4OI7A 3STBA 4HK3J 1LDPH 2EDYA 4KTEH 3ORJA 5C0GA 2AK1L 4N1EA 4PJHB 4XNMB 3TPUB 5C6TL 3K2UH 5HGHB 2OI9B 4OQTH 3ROLA 1X5FA 2C3XA 4L9LC 3QIWD 3PDOA 5JXEA 3ZDZF 4P46D 5E8DL 1JWMB 1MRCL 2D0HA 5HSFA 4LMQE 2BRRH 5BVPL 1E4KA 3KYKL 1LO4L 3L3DB 5E8OB 3SKMA 1J11A 2VLJE 5C86A 2NY5H 3BE1L 2GITA 1TCRA 3I75B 1KTDA 2Q20A 3BIKB 4YUEH 1MFBH 3E8UL 3AVEA 3DXAE 1RVFL 3Q5TA 3KPRE 2UY6A 4U1NA 3V5KB 4ENEC 2DTML 3BP4B 1RHFA 5E9DA 1WFOA 1GZQB 3VFOA 2EDHA 2IQ9L 4MAUL 3S37X 4XCEB 1G7JB 5DRXA 1RURL 3EJYC 4NGHH 4JM4L 4YDKL 1KCVL 2YUVA 5JW4M 3QDHA 1GOFA 4I48B 5F1KC 1C7SA 1UENA 4JO1H 3OF6A 3PWPB 1ZS8A 1F90H 4G6ML 1KCSH 1HHHA 2JCCB 3GSVB 5IT2L 1PDKA 2CGRL 1TVHB 2BNRE 2Y72A 4NQVA 2EXYD 4PJ5A 5IMOA 4JZNB 2HLFC 3B8SA 1DQMH 2OSLA 4MWFA 2EH7L 1KEGH 3VGGA 1J1OH 3F58L 1S9VA 1G1YA 3QDME 5SWSE 3WFHB 4O2FB 1XF5B 4EXPX 2CPCA 3LS4L 2JTDA 4WTZA 2VDLH 4BJLA 1NCCL 4DGYL 4KZDL 1A6VL 5IVOA 4S2SB 4MA7L 2ED8A 3PGDB 3C5ZA 2VSDA 3P0YH 4OGAC 5LKNA 2NY1C 5I1LB 2VLJD 4PGDA 3RNQA 5BO1H 2YUXA 3H42L 5AUMA 3MA9L 3INUH 3P4OB 4NKDA 4KVCL 4UT9L 3BGAA 5C0DB 4FXGB 3DXAD 4OZIF 2X89D 1QRNE 5D5ME 4QHKJ 1UXSA 4BFIA 1IFHL 3L3GB 1FFOB 2QQNH 2NY7H 4Y2DD 4JFQA 3RU8L 1J86A 5F7YC 1CU4H 4Z7QE 4OD2A 3UTPE 3HUJF 2WP3T 3P77B 1E4XL 4OZGA 1CGXA 1MJ7H 3QXAB 4GG8B 4HQQL 3CK0H 3BYTA 2NY4B 5ISZB 2BNRD 2IGFL 4FMKA 5DD5H 1URLA 4JRXE 4LCYB 3C60A 3QDMD 5SWSD 4OD3H 2X4QB 1EBPA 5D7IA 1NGWB 3O3BB 5DK3A 1DFBH 1BAFL 1KENL 3B43A 4LK4A 1IGJB 5EZLA 5EFIB 1NFKA 5FM5O 5ESQB 3FFDA 3WFBL 3PNWA 3RWJA 1XF5A 1M05B 3P9LA 4O5LL 1GZPB 3UTSB 1AGFA 3LHPH 3B9KA 4JLRB 5DFWH 4PGEB 4QY8A 1IQDB 1FNSL 1QSEA 3MUGB 2AK1H 5C09D 1QRND 1VDGA 4KHTL 4RMRA 5C6TH 3D25B 1XGRB 3BWAB 4DN3L 1J88A 1UEYA 2WBWB 1CDJA 3GKWL 4K8RC 4J3TA 5E8DH 1MRCH 1NL0L 1A1OB 3OAYH 4WCYL 5E00B 5C0ND 1RUPL 1S8DA 2DM7A 4KI1A 4QHLA 5BVPH 3KYKH 1LO4H 4MQXC 1AQDB 4IRSD 4AT6A 1RUQL 4F57L 3VFMA 3BE1H 1TENA 5D93C 4LCUA 4NQEE 5J6GA 3KJ6L 3IDXH 5KANI 2IPTL 3OR6B 3E8UH 4G8GE 2QSTA 5ITFB 1RVFH 2ZUYA 5J12B 4R7DA 1Z3GL 2EYTB 4JRXD 2FHFA 3QDGB 2W07A 2DTMH 1U91B 4Y5YB 2D9CA 3PABA 4MA1B 3GHEL 4PJAF 2IQ9H 4YAQB 4MAUH 3F7YB 1CTNA 3D69B 2ZSWA 1RURH 4JM4H 4M1CD 1KCVH 4YDKH 3B2VL 1HKFA 3GKZA 5CGYD 1G1CA 3NABL 1AO7B 3QUYC 4XBPA 5IQ9A 5IT2H 1DANU 2CGRH 4H5SA 3PV6A 5DURD 3ARGC 5DJDB 5T1DL 5ICZB 5CILL 3LKRA 2EH7H 5J3HD 1UCBL 2FJGA 3F58H 3VH8A 1SBBA 4NUJB 4PGEA 3LS4H 2ZUQC 4XCCL 1MY5A 3HLAB 4PBWD 1NCCH 2DN7A 5MI0B 1A6VH 4DGYH 4KZDH 1H5BB 4MA7H 2AXFB 3RVVC 4UAOB 1AY1L 4LCCB 3D2UA 3BWAA 5FOBB 1DDHA 3B2UD 4GRWB 2UWEB 3HA0A 3VDCA 4PJ8B 3H42H 2CH8A 4WU7A 1YNTB 3MA9H 3WFZA 4NQED 3S34L 4KVCH 3L3HB 4UT9H 4G8GD 4NNXA 5EPMB 2VQ1B 4XI5C 3OKNB 2DICA 2GSIB 3L6FA 1AGDA 5D8JL 1IFHH 5E56A 3RU8H 4JG1L 4Z18A 3QIUB 1KIPB 2EYTA 1NEZG 4XBGA 2XYCA 5I6XC 3CX2A 3KPSB 1IMHC 2E7CA 5GS2D 4OIIL 5DD1L 4FXKB 1FNLA 1LK3L 3GJEB 1N6QL 3CMGA 2FX9L 4HQQH 3MRBA 5IG7B 4F15C 1WITA 5FUCE 3NBNA 4HLZG 1J87A 5JMRA 3ARDD 2PYFB 2IGFH 3QXDB 3HE7B 2VDML 1UZ6E 1MJ8L 2P8MB 2DB8A 1ZHLA 4K7FA 1BAFH 4DKEL 1KENH 4LHUG 4DW2L 4LDEB 2C1OB 5BZDB 3RTQC 3WFBH 2DQFA 5GGTL 4LPYA 4NUJA 5FYLE 1W0WB 4KJWD 4PV8B 4TRPL 3BUTA 4DEPB 3GSOB 4HKJB 4LCCA 4HUUB 3RI5F 1HDMB 4ZXBA 2UWEA 1FNSH 1DP0A 1XR9B 1NMBL 1YNTA 4KHTH 1G0XA 1MHHB 4PJ5E 1BFTA 5I1HL 1S7RA 3QPQD 1MCHA 4DN3H 4QRPB 1V3KA 3QUXB 3NIDF 1KIQB 2VQ1A 3GKWH 3H7LA 1NL0H 2HN7B 4WCYH 4FNLL 2EO9A 1RUPH 2CKBL 5F9AC 5DQJB 3WEXB 1A7OL 2CDGA 1KIPA 4I1NB 5JXED 2Q7NA 3BAEL 4LCWB 2EDOA 3MLWL 3LDBB 1RUQH 4F57H 1JMXA 2AAVA 1QEWB 3KJ6H 4JHZA 2IPTH 5C8JB 1Z3GH 4YXLL 2H3NB 2WWKO 4TUKL 2IAMD 1SMOA 1KACB 3GHEH 5TDOB 3B5GA 3MROB 2Z31A 2R0KH 3M8OL 4QRSA 3RDTC 3GJFH 4XTRD 1N26A 1NJ9B 5E9DD 5FYLD 1IAIL 1WBYB 2VUYA 3BZFB 4J2XA 3BESR 4OFPA 1BJMA 1AHWB 3C6SA 1I7UB 4I2XA 4PJBB 5T1DH 1BLNB 2P4AB 5CILH 1UXWB 4ORGA 4P4KB 3OF6D 2HTLD 1UCBH 5E5UB 5LQBL 3RUGF 2F53B 3KXFB 1VEMA 2OTUB 2ZKHL 4PJ5D 1HDMA 2G75B 1MRDL 3IAGC 4XCCH 2YA0A 1P9MA 5D7IE 2FHBA 2OJZL 1IGYA 4YR6B 5ICYA 4QRTB 2NPLX 4R4NC 2JLLA 1LE5A 1L0YA 1U8KB 2P5WB 5DJCA 1D5ZA 3BYYA 3S34H 3VI3E 3C5ZD 5DFVD 1FBIL 4AM0A 3QULB 3G04B 3OZ9L 1CD1B 4E0RB 2HWZL 2FWOB 2MJWA 3KHOA 1X6NA 2H32H 2I27N 4N68A 5D8JH 3WO3B 4PB9L 1I1FB 4OD1L 4NKOA 1YN6A 2R2EB 4JG1H 1A4KB 2XY2A 4P2YA 5CBEA 4S1QL 1QSEE 2ZNXA 2KBGA 2WBKA 3IFOA 4U49A 1JHLL 4HWNA 4JFEB 4UV4L 5MENA 1A9BB 1BIIB 1WCBB 4P3DA 5J11B 4OIIH 3RX5A 3SE9L 5DD1H 4HHAA 4H25B 1EDQA 1LK3H 4NN6B 1N6QH 2FX9H 1C5DA 1RZKC 4YH6A 5GS0D