4YAQB

Crystal structure of a computationally optimized pg9 mutant
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
214
structure length
214
Chain Sequence
b'SALTQPASVSGSPGQSITISCNGTSNDVGGYESVSWYQQHPGKAPKVVIYDVSKRPSGVSNRFSGSKSGNTASLTISGLQAEDEGDYYCKSLTSTRRRVFGTGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PG9_N100FY Fab heavy chain
publication title Redesigned HIV antibodies exhibit enhanced neutralizing potency and breadth.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 40
structure length 214
sequence length 214
chains with identical sequence L
ec nomenclature
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yaqB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yaqB02
4DN4H 3NZ8B 1IILE 1GOGA 2IEPA 5B39A 1SJEA 3QNZA 5H35B 2HT3C 3CLEL 3LKNA 1J1PH 3OAUL 5D7IF 2X44D 2H2SC 1FGVH 4Y4KD 5L2JA 4ZFOL 4J6RH 4APQA 1ZA3B 1R5WA 4L3ED 3QO1B 3QXAA 1ZAGA 4N9GA 1SYVB 4WEBL 3VGFA 4NO5B 2FJHB 4UQ2B 1JTPA 4NRZB 1T21A 2ICCA 3IDMA 3DVNA 3ULUF 1JPFB 1A6AB 1FNSH 1IRAY 1N59A 1O5DT 2BVYA 2OMBA 1HIML 2VUYA 5F1NA 4X6EB 5F7EL 4UV4L 4PPTA 4OFYA 2M1KA 3ZDZF 1VCAA 3P40A 4HFUL 1K85A 3NPSB 3VDCA 1NJ9B 1OPGH 4H8WC 4H1LH 5D2NA 4LARL 4LQFL 4NM4L 3D0LA 1WWWX 2VLKD 5KS9A 2DS4A 2ITDA 5C3LD 4R7DA 2CKBB 4HAFA 4C4KT 5C0DB 3KPNA 2B0SH 2RBLA 4G8FA 4MX7B 1E4KC 3TBVA 4LVOC 2UYLA 4I77L 3C2AL 3EJZC 1MOEA 5GS0L 4Z7NE 3E3QC 3GRWA 1BVLA 4QRPD 1AKJD 4JFPA 4GKOA 2PTVA 3TBSA 1XAUA 4A2LA 1HNGA 1MY7A 2QLVB 4PJ9D 3K1KC 4NKDB 5CINH 1BZQK 1MELA 5BW7C 1LE5B 4OZIA 1I9IH 4N8VG 5FF6B 3L3HA 5J12C 1NLDL 1Y6MR 3KNBB 3JWOH 3TN0C 1CVSC 1YYLH 1JN6A 1SJHA 1U42A 4HBCH 4JRXE 3IFPA 5DZNA 3ZDXE 4PJBB 1SJVA 4PR5A 4XP9L 4PREA 5DQJB 5DVOA 4QHKI 4X7SL 1A1MA 2YMXL 3GM0A 1NAMB 2QQQA 4QKXB 2AP2A 1EHAA 4K3EH 5IQ7L 2BC4A 1NSNH 4OCRH 5HI5C 1E4WH 4MNGB 1D5XB 1DR9A 2A38A 4H0HB 4UOJA 2HAZA 5DXWA 4OZHA 1HQRB 4LLVB 1OT2A 2HKHL 1MFNA 3WIIL 1X5JA 4ONGL 2MCPL 4Q9RL 2F74B 4B41A 3LRHA 1YPZE 1A0QH 2NMSA 1NMBH 3BZEB 4OCXL 3D48R 4NQXB 2HJLA 3ARFD 1ADQH 1MCQA 1A02N 3FAXA 5HYJA 1A6VH 1FIGH 3GIZL 4YHIA 3HNVL 1P2CA 2VAAB 5CJQL 4AEHH 3HRZB 4LEXL 1MRDH 2CXGA 5DJ0A 25C8H 2E9WA 4UUJB 4XXDB 5L2KD 4U6XA 4F2MA 2BOBB 1S9VA 1BAFL 1JNJA 3LEXB 1QLEH 3CC5B 3RNQA 5HHOD 3QIWD 4E42A 5GRYA 4M7JH 3ARGD 1ZS8A 2FB4L 1K5NA 3LRSA 4HKZB 4YXKH 2CIKB 3MUZ1 4KKAD 3QDMD 2XKSA 4WHCA 2V5YA 4YDIL 2OP4H 1WQVT 2HRPH 4YGVA 1K9TA 1FO0L 3GI8H 5HJ3A 2X4PA 4WVRA 1JNNL 1A22B 3CPLA 2VYRE 4FXKB 3KS0H 4MDJB 4TNWK 5ICXA 2GK2A 5B22A 2N1KA 2KZWA 4ZTPL 5F9WB 5KJRL 2YUWA 3D85D 4TUOB 2ZOKA 4RIRA 1MEXL 2QHLA 1DQTA 4BQ6A 3I3DA 4XNXH 1RD6A 1P5UA 4YZFF 3IJSA 1ZOXA 3BDXA 2QQLH 3MV7B 4MA7L 2GFBA 4G43B 3KXFA 1WCQA 2P49B 3MV9D 4Q0XH 4IHOA 4OF8A 4NRYA 1F3JB 5ALCH 1A3QA 5E2TL 2C3VB 1JTOA 2F53D 2F15A 3CH8A 3O3DA 1TVHB 2E9JA 4I9WD 3ESUF 2XKUA 1GGUA 4KZDL 3HE6D 4CU7A 1T20B 4Y4FC 2APVA 4GW4A 5DC9B 1QFPA 4S2SA 4EN3A 1U8OB 2VSDA 3TNNA 3G5YA 4O2EA 4PRHE 2UWEA 2BY1A 4N1CA 3FT4B 3GRWH 1UJ3A 4GSDL 5IJVB 4XNQA 5HY9A 4HJGA 4N8CH 3QIUB 1R0AL 5DD0L 1AC6A 5L88L 3LN5B 5JW3H 1M6OB 4G9FA 3FT3B 5JZ7C 3LKOA 4KUZH 2HLAA 3DGGA 2H2PC 4NQVA 2R2CA 4NM8H 4O4YH 4P2QB 5IFAL 3KPSB 3QEQA 2D3VA 4RMUA 2NY0B 1GHFH 1NDGA 3CFJB 1DVFD 3BKJH 2JIXB 1HWHB 4JFOB 1QSVA 4I48B 3PUCA 3UTPD 1YY8A 1BF2A 3N1PC 2OQJB 1FAIH 3UZQA 3C09C 4U05A 2GTWA 2A6IA 1K3ZA 2Y5EA 3ALWA 1QR4A 5IMLB 3EJYC 2AXGB 1JCKA 1QACA 1IT9L 1LO0L 3TA3B 3IF1B 3SKMB 1MH5A 1I85A 1WVZA 5IHLB 5EULV 1BZ7A 4TSAL 4Z7WE 3HLAB 1JGLH 5INCB 3SJVE 1UYWL 1J10A 4F58L 5C7XH 1A3LL 3JTSA 3MA9H 5TE4L 1BD2A 4Z6AT 4AEIL 5EU6D 4DKFL 3M17A 4PJXE 1W72A 2R2EB 4N90D 1F13A 4XPGH 4KTEH 1UWGL 4S1RL 3T2QA 1TPXC 1A7QH 3EDFA 2ICWJ 5ITFA 4UT9H 3EO1A 2X4TA 3D1MC 1NBZB 3O81A 3HI1B 2IAMB 1HHGB 2EDLA 3SY0A 3U4EA 4C55A 2V7NA 1VGEH 3IDXH 4B7LA 3VFWB 4QOKA 1KG0B 5AWNH 4Y19A 4PJ7B 4RZCB 2A77H 3MUHL 4IOIA 1H15B 2PO6D 3KPOB 3FONA 2NW2B 1HHKB 3CFDA 1BIHA 1OAXH 2YRLA 2VC2H 5F7KC 5DJAA 2VLRA 4KUCF 2KQNA 4LCIL 2WP3T 4JDTL 5IFJB 1MHCB 1OF2A 3ARVA 5KANI 4X98A 4XHJD 3EOBA 2ESVA 4PG2C 1U8NB 2DM7A 1CL7I 4K8RL 3HI5H 1J1OH 4U1KB 5C0NC 4QRQB 4OGXH 3LD8C 5FUOH 3RWHB 4KY1H 4AH2A 2VXSL 2Q76B 1W0WB 5BXFA 2C4XA 1H3XA 2Z8SA 3WNOA 4P9HH 1M05B 5K9OA 2RQ8A 4RFOL 3NIFE 1NCTA 3NFPB 5FO8B 1GYAA 2AEQL 1L7IH 4ODWA 3TCLA 1DQLL 4CUCA 1WLHA 5D7LD 4R0LB 3EYUH 4NOFA 2OZ4L 2FJGB 1RIHH 4MAYB 4ZNEA 3CVHL 2CR3A 1V7NL 1UJTA 3IGAB 3Q6GL 3P77B 5CIPA 5DWUL 2P24A 3FT2A 3U36A 3MZTA 3PWPA 1KB5A 3QCVH 1SEBA 2NY3D 5CHNA 4DEPB 3FO0L 4Q6IA 1T22B 1XGYH 2E9IA 1KLUB 5C08E 4YHMH 4UDTB 4NYLA 3VMNA 5IVXB 1U93B 4R26L 5IGXH 3V8OA 1HXMB 5EO0B 3QUZD 2X6MA 2F5AH 4S11A 3V2AR 3KJ6L 2DBLH 3L5XL 4RGMC 3I02A 4H25A 1MHHA 1N0XH 3BIBX 3T3PF 4ZUTB 3C8HA 3WL9B 4Q2ZA 1RK0B 1FYTD 1KJ2A 2VDLL 3GSNB 5F7DB 4N8VB 1ZHNA 4LHJB 4YHPB 3CFKB 1LO5A 5H2BB 2LU7A 4WUUA 3ROLB 3DXAA 4DGYH 5J89A 5JOFA 3NH7L 4QT5A 4CMMB 1FVCA 3H42H 1NC2B 2DL2A 5GZOD 4K8RC 1ACYL 4P4KC 2R0ZH 3MRKB 4DUWA 3EFFB 3FOLB 4V2CB 1IARB 2WK2A 3GMLA 5IP4A 4X6FB 2I07B 1DANT 3FQTB 1YECL 5E6IC 4NC2B 2EE3A 2UZIL 4P5TD 1S7UB 1YJDH 3RWIB 3MV8D 4Z7UA 4GAFB 1W72H 1CGTA 5F89B 5EU3B 4YIQA 1F11B 1CE6A 5D1ZA 1ZE3C 3S88L 4OI8A 4OD1L 4ZOEA 4X4ME 2YPLD 5C0CD 5D1QA 4QLRA 4NHUB 3EO0A 3T0DA 1NEZA 1VFOA 1UM4L 2IFFL 4LKXB 1EBPA 1HHJB 1FG9C 1KEML 1VFAB 1YEJH 4OZHF 2A9NL 5C0BA 4MA1C 4YHNA 2J8UB 3A0OA 4RGND 1XF2A 3VWKA 1FNGB 1T1XB 1DQJB 3QUXD 4ONHA 1KN4H 3TBTA 5JNYA 4K7PL 3WDIA 4AIZA 5DFTA 4OF5A 3MNZB 4YHYB 4OT1H 4RAUB 5IMMA 1QO3A 1KB9K 4OIIL 4YQXL 4DVBB 2IC2A 4R90L 4S1QH 4KI1A 4KROC 4ZNCD 2BDNL 1GXEA 4I5BB 3WUWB 1RK1A 4NZTH 3MA7A 4Y4KB 4OV5B 4GAGH 1EJOH 4GMSH 5HI3C 4L3EB 1S7SB 2V2WA 3P30H 3TN0A 5CD3A 2I5YH 1NFDE 3ARDC 4L4VD 1FFNB 1H5BC 2ZG2A 5KVDH 4P5KA 1J8KA 1KGCD 1T4KB 5HDBE 2VMFA 2D9QB 3TWCL 1Q0YL 1DUZA 4O02H 1Z0MA 4MCYB 5CIPH 2P8MA 5D7JC 3DMMD 1KB5H 5EC1A 4HIHB 4ZFGL 1ZVSA 5FB8A 1MWAL 1BWWA 2NLJB 5IBLD 5AZEH 1JK8A 2CLVA 4P9MH 4WW2B 2OSLA 2VLKB 3V5KA 5AZ2H 1CGSL 1T2XA 4U1IA 2UUDK 3VXUE 1N7ML 3I2CH 3BP7A 4XI5D 3RUGA 5I2IA 3ZYOA 4ZSOB 3OHXA 4LNRB 1MFCL 1E6OH 4QRPB 1MRCH 5J6GB 1AKJB 3LN4B 4ODVH 3CAFA 3QPQD 1B9ZA 4QF1A 1DEDA 4JRYA 2CDFB 1CS6A 1PQZA 4L9DA 1CT8A 1DL7H 2JJVA 4PJ9B 4RRPA 2A83A 3D18B 3PV6B 3TT1L 4KK6D 5DF0A 4GQ9H 3BKYL 1CLCA 3RVTD 4P23B 3UBXG 1BQUA 1FL3B 2UWEF 3FRPA 5HGAA 3RDTD 2ZCLH 4LCCA 5F6HJ 4QRRA 3QYCA 3VE0A 2ICES 4LSTL 2EDYA 4R4FL 4TSBL 4KVNH 4PJ8A 5IK3B 4YJZL 2Q6WB 3VW3L 3V52H 4MD5A 5I18H 3DIFA 1AGEA 2WBKA 5HHME 5JTWA 2DQDL 4G8EA 1ONQB 4E5XA 4PRDA 5JIIA 3I3EA 1KPVB 4YDKH 4WY7L 4DFHA 2FD6H 5E2WL 4Y2DA 4QTHB 3IAQA 4M43H 2Z92B 4KGLA 3NCEB 3QDHA 4X6CE 1MCJA 5CMAB 1J1XL 4IRJD 1CDIA 4XC1H 1S9YB 4LSQH 4H0IA 3W0WD 1I1AD 2D0GA 3T77A 2GUOA 3GMQA 1P4LA 3ARFB 3NIGF 3C5ZC 3BJLA 1LDPL 5EA0L 3H9SB 4TQEL 4HUXB 3LIZL 2A6JB 1FNHA 4MLSA 5DRNA 5HYSA 4Y5YB 5SWSA 4JHWH 2X4SB 2ZUWA 3RPIB 3WLWD 3MRJB 3VGBA 5KVGH 1JNLH 2P42B 4FMKA 3V0VA 5L2KB 1TIUA 5CD5D 2AABL 3GB7A 2Y6SD 3RI5F 2NCMA 1VPOL 3N50A 3QIWB 4Y4FA 5FDYA 2XA3A 1F3RB 4IRSD 1MJJB 1OTSD 1YEDB 4YDJA 2YN5A 3C87A 3ARGB 4PJIE 3F62A 5F8RC 1X9QA 2MHAB 4XCYA 5HGDA 3HAEG 3QDMB 3LQZA 1WC7B 1I3RB 1YMHA 1P1ZB 2BSSB 1NFIA 2B5IC 4PS4H 3TM6A 4PRAA 3MACH 2YBRA 1LK2B 1V7MH 3WKNA 3GSXA 5FA4A 3SCMC 1AP2B 3DUUB 3ESVF 5ADPL 3V4UL 1H8NA 2EDXA 1MJ8L 4NFCA 3CDGA 4NZRL 3FN3A 3FO1A 4XP4L 1OGTB 2NX5A 4GBXD 1QRNA 5GGUB 3LKQB 2WSKA 1WFUA 1H8SA 1OM3H 4WWKA 4TYUA 1JFQH 5DMIH 4DZ8B 3E6HA 3MV9B 4WFGD 1FO0A 2YUXA 1SYSA 2D7QA 3FB5A 3OAUH 4X6DA 5I1EL 2QJDA 3V0WH 4KJQD 4Y16C 4CN4A 1AI1L 1EXUA 1KCRL 1AD9B 4WO4C 3TGXA 3DX6B 4JE4B 5F3BB 3HE6B 1A4JA 3QISA 4WEBH 3O11A 4BSWA 1K2DA 2FX8H 2FEEL 1CFSA 3IDIA 2O26U 2X9WA 5KW9L 5DJXB 3EYSL 2IAND 2ATPB 4HGMA 1I8MB 2DI7A 1R24B 1TCMA 1U8LA 3UTQB 2EDNA 1F4HA 2AVGA 5JIPA 3RP1A 2PW1A 1ETZA 4IS6A 1PX3A 4HZLA 4LARH 4HULB 3RZCA 4NM4H 5BZDA 3U7WL 4LCWA 4F33B 4NDMA 5KSAC 1AFVL 3D3VA 2BVQB 5IHUH 4R2GC 3MBEA 1CQKA 1OSPL 2R1YB 5HHQA 3SDAC 1JF6A 1P6AB 3Q2CA 1AC0A 4YC2B 1DVFB 4NUGL 2MQ3A 5GS0H 1Q9OB 3OKKA 3QDJA 4WTZA 1IM9B 3V6OC 1VGKB 4KMTL 3SGKA 4CVWA 4ISVA 1ZK9A 3RA7L 4HWEH 3GMPA 1ZT7A 1MAJA 2AJ3B 2QSVA 5ETUB 4LLWB 4FXLA 1A1NB 1OP9A 4JR9L 4LSSL 2V17H 4MGXA 2V2TA 4WI2A 3W81A 4AMKL 4YHZL 4Z78B 2VDKL 2ZCKL 2W9LA 1TZHB 3L6FA 3KVQA 1MFBL 1BBDL 2MKWA 1MJ7H 2VL5A 4XP6H 2X89D 4WHYH 2HFFA 2X4NB 3PWNA 2R1XA 4JFXB 4X7SH 1EIBA 5F1KC 4HCRL 2XZCH 5EU6B 3UTSA 3EYOB 2FIKA 5H37G 3TO4C 1QKZL 3LV3B 1MCLA 2E8ZA 2IH3B 1A7NH 3VXMD 3PWJB 4K2UH 5I75B 1T5WA 3QZWG 4ZXBD 4ZFZA 3MGTA 3K1DA 3C60D 4EJ1C 1NCAL 4ONGH 2X4UB 3HCVA 5L8LB 2X1WL 3EW3B 4JQVC 5C6TH 4XP5H 3HI6L 3SDDC 5I15L 3QEHA 1JGVL 2VZOA 3FAWA 3OX8B 4JGUA 3EKCA 5HGBA 3KGRA 4XAKE 5D71H 4XPTL 3BKCH 3HNVH 4LVHB 5CJQH 1HH9B 2PO6B 3UX9B 1FPTH 3RNKB 3ZT5A 1T83C 4HWZB 4D9RD 4LEXH 1MCCA 2QSCH 3MLXH 2L0DA 1RFDH 2YD2A 4UILL 1C16B 5TJWK 4NKMA 4PUBL 4O51B 1A6WH 5BVPL 3H3KA 1S5HA 4P99A 1FGNL 5F7FA 1CE1H 1F4WH 3VDBA 3QEUA 4YHLL 4QXWA 1EMTH 5DR5H 1OB1B 3HPJB 5K9JH 4U1LA 3VJ6B 2P5EA 1IGJB 4FFWD 5EZLB 4D3CL 1FO0H 5D7LB 1G6VK 1HILB 2H6PA 2OTWB 3LRGA 5EO1A 1JNNH 2GCYA 5EOTA 1Q9WA 1KACB 4YH6A 4KVCH 1OVZA 1AQDA 5ANME 4JO2L 1MREH 5LXGL 2E7HA 3BP5A 2VITA 3BWAA 1NBVH 4GKSB 4P4KA 1MEXH 2J6EL 1JRHH 2EEAA 5TQ2H 5E8PB 2Y06L 1EH9A 3FQNA 1G0YR 4MA7H 1VB9A 1YNLH 3U0PA 4AYFA 2DICA 3B2VL 1OP5K 5DVMA 5JIKA 2O5XL 2ZG1A 3AS2A 4QHNA 3KPPB 3AB0B 1A7PH 1RZ7H 1YA5A 4KRNA 3CZJA 3QA3B 5E2TH 3QUZB 3H6JA 3DOSA 4O2FB 4D9LL 5KVEL 3CVHA 3S5LB 2YEZB 3PP3K 5EPMB 1A6TA 1JHKH 1D5ZB 1MCNA 2QHRH 4OQTL 3HNSL 1U91A 4DTGH 2ENSA 3ZZ1A 4XBGA 2GAZA 2MSPA 1AO7A 1FYTB 1ZA6B 3QFDA 5HGHA 3DI2B 4FZEL 3RUGF 3KPLB 2CIIA 3DSFH 4GSDH 5BQ7A 5AYQA 3REWB 3RTQA 4PGCB 5T5FL 4U7SA 1R0AH 5DD0H 5DEFB 2YD8A 3IKCA 2F54D 1NDMB 3MRIB 1AGCB 4F7CB 1QBLL 4BZ2L 3PE9A 3MRMA 2ICWI 4HHAB 5ENWA 2CMRH 4JFDD 5C0AA 4KHTL 4WNQB 4PJFF 3TCXA 5IB3A 3QFJA 2EH8H 4RA0C 4Z18A 1OHQA 3UZVB 3SN6N 4Z7VF 2YD7A 3F7YA 1HCVA 1A9EA 3PHQA 5I19L 1BQHA 4P5TB 3BRDA 2UZXB 3DV6A 5I8CA 1HSBA 4X9FA 3MV8B 1WF5A 2CPCA 4IOFD 4QTIL 2IBZX 2DB8A 2I24N 2OJEA 1EK3A 5B8CC 2YPLB 4MAUL 5C0CB 2C3WA 4QNPF 1H5BA 3QHZL 4X5XB 4KH2A 3OR7A 3IU4H 4TSAH 4NC0B 3U9UB 3R06A 4NO0A 1DQDL 3BVNA 3LQAH 3VH8G 1NGWA 3EYVA 4F58H 4OCWH 5D7JA 3GBMH 1BVZA 2BNQA 3AAZB 4Y8AA 2OTUB 3Q0HA 1S5IL 4RGNB 4HQQL 4DUVA 4APQD 3QUXB 3H8NA 5ERWB 5KTEH 1BOGA 2BCKA 4PRPD 5DO2D 1UWGH 5MERB 4MDIB 4EI6A 1WWAX 2NNAA 1NFKA 1J12A 2H9GA 5AAWA 4JPVH 5F9WC 5HD8D 1CXHA 4LPUA 1Q9LA 1NL0H 1VFBA 1UEYA 3HAEB 1IGCH 5MEQA 3KHQA 2NY5H 1SMOA 5C2BL 4CGTA 4UIMA 5ESVB 3MSPA 3HNTH 3L3OB 4H1LG 4K9EC 1A3RL 1F3DJ 3QQ4A 4XGZA 4YPJA 3SDCA 1KN2L 1XCTB 3O3UN 4PP2A 3L5JA 3UJTH 4ZQKA 2PW2B 2BOCA 2F8XC 1ZSDB 3WS6A 3O8XD 4Y89A 5TF1H 4Z5RA 4JDZB 2Y07H 4PJ5B 4UV7L 2ZUQB 4WFEE 1E27B 1BEYL 3SKOA 3QQ3B 3F5WA 4EBQL 4ZPTB 2HG5B 4HIJB 2Z4QB 3BP4A 3PV7A 5CBEB 3DMMB 3FZUC 4MQTB 4AT6B 3MLUL 2VXSH 4LCYA 3AMKA 5IJKC 1YMMD 5CSZB 3GI9L 4RFOH 1NUGA 3MR9A 2R56L 1KTDB 3TEUA 4I2XE 3TFKC 1DQLH 3PQYE 4LDLB 1DBML 4G6ML 1IFHL 2OI9B 4PV9A 5I1AA 2APTA 1W2KT 5D8JH 3EHBD 2BSRA 1IAIH 3Q6GH 3VXSB 4X6DF 4YFLI 4NC1E 2BHZA 5JO5B 3VFSB 3C5ZA 4ODUA 4FN0A 4PJDB 1MWAA 1INQB 1JPST 4TVPL 2I9TA 2CK0H 3FO0H 4D9QD 4OLZL 2PYED 3BSZL 1T3FB 1T1WB 3EJJX 2XTLA 4V1DD 3UO1H 4NWUL 4NFDA 2K1MA 4G42B 1Z9LA 4QRTA 3DHMA 4L1DA 4U7KA 1TJHL 1JGDA 5J1AA 3RDTB 4Y1AE 3TYFA 4PYHA 3QUYC 1CL7L 3QRGL 4JQIH 5B3JE 2XG5A 3NN8A 2Z9TA 4DQOH 4JG1L 4PRIA 2B20A 2BRQA 2OXHA 3U4AA 1TJIL 4N0UE 5HYJD 5JXEA 4F15C 2QKIA 2VDLH 1DBBL 3W39B 4OD2A 3RL2B 2VSCA 4AJ0A 2JB5L 2BFVH 2A73A 4WI5A 4R97C 1W0VA 4HF5L 4PTTA 4FNLH 3IXTA 5D7IB 4IRJB 3W0WB 1ZXQA 5ELIA 1KBGL 2IAMC 3I85A 3SGEH 1HWGB 3UROR 2R4RH 2CDGA 5CGYC 3U30B 1ACYH 5F3HB 1UCTA 1RUQL 4X7EC 5J11C 2AJVL 1RMFL 1VFUA 1Y0LB 2VWEE 4C56E 4X99A 4I13B 5B39G 3JV6A 1UQSA 1B0WA 1S7RB 2W0LA 1NCNA 3L1OL 3ZDXF 4WI7A 3O6LL 4TOYL 3S4SG 3X3FH 5EBMB 4Y16A 2PR4H 2V9QA 4LAQH 2YRPA 1I8IA 1OGAB 4X4MA 2XZAL 4S1SL 1HXYB 2X4OB 4IRSB 4UOW0 3OZ9H 4RFNB 1UM4H 3TBYB 4LPCA 2FR4A 1JF1A 3CX5K 4UT6H 2VE6B 1DE4B 1YC7A 2YPVH 4B7IA 1ZEAH 1IAMA 4CDGC 5DLML 2FLRT 5GSRB 2F19L 3STZB 5D5MA 4H88H 1C12A 5IB1B 3X11B 3LPGA 2VDQL 3PL6D 5DD3L 1EEQA 4K23H 4Z95H 5J6HB 4UAOB 4A6YA 5KSAA 3G6JA 1K6QL 1C08A 3OTTA 2H32H 3WMSA 4WHDA 5AUMB 1EFXD 4EDWL 3SDAA 3BKML 4PIRF 4MVBD 1J7VR 2XA8H 3WJLA 4OIIH 4YQXH 4GBXB 3DVGB 4C83A 2FLBT 2ZUUA 4DKEL 3V6OA 4BH8A 4PJGE 5FO7B 3JVGC 4XNZC 4XPFH 3RVWD 3X13A 2DLTA 3ARBC 1WCBA 3AXLA 3SPVA 3H7LA 4KZEH 4EI5C 2AXHA 3KPQB 1Z3GH 3ZKSD 1PSKH 3M45A 3TESA 2X2YA 3MJ7B 2VR5A 4NQEB 4HX1B 4X80L 4PGBA 1RAMA 4KJWC 3O2VL 1RZJL 5EU7E 1UT9A 2VXVH 3GMRB 4ZUUB 4PGZA 4XCEB 5F44A 1JWSA 1KEGL 4HPOH 1Q0YH 3K4DA 3ARYA 2IANB 3EYFB 3D9AH 2IG2H 4N5UA 4XP1L 5EO9A 1HOCA 2W9DH 4OM1L 3TO4A 1MWAH 3BMWA 4MD0A 1C1EH 4JKWA 1CGWA 1TMCB 2DMKA 3ILQD 2UV3A 2Y36L 3LN9A 1QSFD 1MCKA 2XQYK 5C3TA 4MWFA 1S7TB 3RRQA 4JDVB 3SDDA 3MRNA 2HFGL 3NZ8A 3KPRE 3BPCB 3K3QA 4KK5C 1BD2D 5H35A 5I30L 5HYIA 3HRPA 4XPHL 1R3HA 1AY1L 3GMOB 1ND0A 1T83A 3TT1H 1CGYA 4TRPH 5BO1L 5MENE 3QPXL 3FOMB 4O9HL 4RMQA 2DBJA 2MTPA 3OJMB 4NO5A 3C9NB 2FJHA 4L9LC 3O4LE 1BF8A 1JPFA 2R69L 4WJ5B 1A6AA 4P3DB 4WFHE 3TH3T 5JQ6H 1HSAB 3VW3H 1PG7H 2Q20A 3MLVL 4X6EA 1ES0B 1BLNB 3BXNA 1CI5A 3V7AE 2DQDH 4UMGA 5GGQL 5ISZD 3NA9L 5E4EB 4AZ8A 4D8PA 4FFVC 5AYUH 4LNVA 2HTKC 5ALBH 5E24E 3CH1B 3QCUH 5E2WH 5IVZB 5C0DA 2EO1A 4EEEA 4MX7A 2JK5B 1N0LA 1LVEA 5IR1A 2IPTH 2C3HA 3QAZC 4OLXL 3RWFA 5IW6A 1RZJC 3VH8B 3C60B 1RSFA 4KKCC 1D5MB 4PLNC 3DX8A 2H8PA 2J7LA 3L3IB 1ZANL 4HCRA 1G7HA 3PJSB 1T2QL 1ORQB 4NKDA 1FZMB 3NACL 1MFAH 1I7ZB 5FF6A 3BGMB 3GUTB 1KLGB 1S9KC 5L7XH 3EOTH 3NIDE 4QWWD 2NYYD 1R5VB 4P2YA 3NTCL 4LEOA 5DJYB 4MMXC 4Y2OA 4Z77B 2Y23A 1WFTA 5FECB 4Z76B 2FRGP 2AABH 5DQJA 5FCUL 1Q9KB 4LF3B 4A6YH 4LSRH 1VPOH 1REIA 2VLME 4JPIB 2ZP0T 2OJZL 3WFHA 1NAMA 1T04A 2R8SL 1DP0A 3RAJL 2LABA 4JO1L 4M6MH 4M7KH 2XWBB 1EGJA 3MLWL 5IQ9B 4YFEA 3CSBA 3VFVB 2VZ1A 1QFUL 1HQRA 2YXMA 1QPXA 1BQSA 1CYGA 2WIIB 4MQSB 1AE6L 2F74A 4ZYKB 4F8TA 3R0NA 1FYHB 2G60L 3UXFA 3BZEA 4NQXA 2IGFH 1EFQA 4E41A 1MJ8H 1LP9E 4NZRH 3H9HB 2IPKA 1O7SA 4RAVB 3QR2A 5EN2B 4FQ1H 4LOUD 2W9EH 3HRZA 5E2VL 2ORBL 4ZS6C 1LO2L 4OJFL 2VWEC 3DXAD 3I50L 4UUJA 3TNMB 2MWCA 3T4YB 5B8CA 1HZHH 2G2RB 3PWLB 3LEXA 4DGVL 1EHLH 3BPLC 3MLYL 1E28B 4I0PB 4NQCD 1EEUA 3WFZA 2G5RA 1AI1H 1KCRH 5IW1B 2YC1B 3HC4L 4LIQL 5MEOA 3GSWA 3MFFA 2J6EA 4P2OD 2CIKA 1L9MA 3NIFF 3WN5C 4W6WB 3EYSH 5KVFL 2HT3D 4HJ0D 1QLFB 1SVCP 2H2SD 5E9DD 2Y5TB 1X4XA 4TVSa 5HVWA 4FXKA 1NGZA 4MDJA 4KGJA 2F54B 2V9RA 2DYPB 2ZSVA 5IEKB 4Q7DA 3K80A 5A16B 1AFVH 4TUOA 3CSGA 3HZVB 1OSPH 4FFZH 4WTWA 3L5WB 4WWID 1WITA 2B8OT 1CU4H 1QP1A 4JFDB 3N1FC 3MV7A 4G43A 5C0BD 5FFLA 3N06B 2YD3A 3Q5TA 2PN5A 5EC2B 3W11C 4KMTH 1F3JA 4ELMB 1INEL 2OL3B 1NGYB 2QSTA 3UTTA 1S78C 2C3VA 5EIIA 5JORA 1GGCL 2ICEB 1AR1C 4NCC2 1TVHA 5TE7L 2EYRB 4LAJH 3PHOB 1OY3B 2D0FA 4YHZH 3V9FA 2ZCKH 3JV4B 4HWUA 1U8OA 3Q1SL 3S35H 5EU7C 4WCYH 1BBDH 5B39B 3FT4A 3QNZB 4U0RC 1HKLL 4EXPX 5IJVA 4AG4H 4YLQT 1RIVL 3S4SB 2BX5A 2XN9D 3QIUA 2GSGB 4M4RA 5L2JB 4APQB 3AUVA 1M6OA 1R5WB 2R0LH 4PRPB 3O9WC 4HWBA 4PV8B 3TN0D 5HYFA 1QHPA 4JO4L 1KXTB 4TUKH 3O6ML 2V5MA 4F7TA 3UC0H 3G9AB 3WNKA 1CQYA 3KPSA 1ZTXL 1N59B 1NCAH 3CFJA 3IFNL 5F1NB 1YEIH 3L3DA 3HI6H 2C7UA 4JFOA 4I48A 4MCZA 2ARWA 1RJZB 5EOQL 1JMXA 5T3ZE 3MOAH 1NAMH 1UADC 1XGPB 5HI5D 5IMLA 2VDOH 2ITDB 4R7DB 3GIVA 2JE8A 3QBTB 3WSQL 1EGJH 3IF1A 4G8FB 3LKSA 3O8XB 3QUYA 1RJLA 3HLAA 1ZLVK 4OZGA 5HPOA 4HUNB 4YUEL 1BVLB 1OP3K 1TQBB 2FGZA 4JFPB 4R7NA 3TBSB 2AK4A 2ARJA 5SX5H 2Z31C 4Q6YA 2R2EA 1IVLA 2D7MA 4NUJA 1HN1A 4OLVH 2DKUA 1YMMB 2EDOA 3NCYS 5C07D 4FOMA 1CIDA 1SJHB 3LZFL 3IFPB 3BYTA 1D9KC 5AG9A 4HV8A 4PR5B 4GRLC 1NBZA 4BJLA 4JANB 1FC2D 3H9YA 1XIWC 2IAMA 1HHGA 1A1MB 1H3PH 4JO2H 5F1IA 4DK3A 3HPLB 1IKFL 4DKDC 4UTAL 1TETL 4PJ7A 4RZCA 5T3XH 1N8ZB 2XWJB 1ACZA 3KPOA 4V1DB 1MCRA 1NFDF 2AEPL 3HZYA 5HDBF 4JKPH 2QR0B 4J2XA 1MHCA 3OL2A 1G9NL 1HINL 4CDHA 2WV3A 3WFBH 5E99L 2KKQA 43C9A 1NEZG 2AJSH 1I7TB 2HJLB 4RMTA 3OKEA 4QRQA 3V79C 5K33A 3NCMA 4LSDA 3RWHA 5HYJB 3WDJA 1W0WA 4YHIB 1M05A 1UH4A 4YX2L 5IFHH 1YQVL 1UWXK 3GO1H 1I1CA 4IDJL 1B0RB 5FO8A 5DJ0B 1ORSB 5SV3A 1A7RH 3VXNB 2OTPA 4R0LA 4F2MB 2FJGA 3D87B 1CDCA 1BPVA 1YN6B 4G8GE 3RNQB 4MAYA 3IGAA 4E42B 1OAYH 2WWKT 3A6BH 3P77A 3CDYA 4LLQA 5IMKA 2HT4D 1WFOA 3KLHC 1A5FH 1QBLH 5D7KD 1K5NB 3QP3A 3LRSB 5GGVL 4JO3H 1AJ7H 1T22A 1DSFL 3QDGA 1JGUL 4XMKL 4KHTH 4YGVB 3CXDL 3ARBA 4UDTA 1CXEA 5DVNA 5BS0A 3MNWA 5HGGS 2EYSA 2L7UA 4EI5A 5IVXA 3CPLB 1WBXB 5GGTL 5JZ7D 3HG1A 2H2PD 4MHHI 1AGFB 5ICXB 4OBSA 1NCWH 4G6KH 4QTIH 4HWBH 3SQOL 3BISA 4FFYL 4MAUH 2DQIL 5IIEB 1JTTA 4RIRB 3KYAA 3WL9A 1FRGH 4XH2A 3IJSB 3GSNA 5F7DA 1X5ZA 2Z8WC 2VDML 5D6CB 3QULB 4Y7MA 3C6LD 4YHPA 3CFKA 4IHOB 3BT2H 4H20L 2ITCB 4NRYB 5H2BA 3T8XA 2E3VA 3CLFH 3EJYD 2R2BB 4ODXB 3VI3E 1QLRA 2ERJB 3ROLA 1S5IH 5T3ZL 1B3JA 3PL6B 2RR3A 4HQQH 3PIQB 3LAFA 1NCDH 3G9VA 4YWGH 1G9NC 1NC2A 1BJ1H 1EFXB 4GW4B 5HHVL 1U92B 3W9EB 3VRJA 2E5EA 4N68A 3VD9A 1I1RA 2NY3C 3FOLA 3G5YB 4OI7A 3MODH 4M7LT 4LLUB 3QCTH 3VXOA 3OAYH 5ITBH 4GW5A 4WTXA 1UJ3B 5C2BH 1N2RB 5GJSH 4M9PA 2I07A 4HJGB 1S7UA 5FM8A 2YSSB 3RWIA 4N0YH 4NBXB 4RRPG 4HMDA 1TNMA 3HMWH 3N9GL 4G8IB 4G9FB 1F11A 4LCWD 4Z8FL 3DGGB 1KN2H 4NQVB 3H2WA 3TIDA 4PJBE 4PJIF 4MZ3A 4W4NA 1J87A 4M6OL 3FRPG 4M6NL 4L9LA 4LKXA 3S36H 1NDGB 3B2UC 1QBBA 1HHJA 1B90A 4UV7H 4X9IA 1VFAA 1H3VA 1BEYH 3B6SA 4HH9B 4L8BA 4QGYA 2YD6A 4EBQH 3RVXC 1YY8B 1N3NA 2A9ML 1DANU 2GTWB 1RUKL 1BVKA 1JMZA 1HDMB 1R3KA 4MNGE 4D94A 1T03H 1MH5B 5CEXB 1BZ7B 3SO3C 4NSKA 3IVKA 3BN9C 1QSFB 4DK6A 5KZCD 3WKML 2WINA 4JRXD 4XVSL 3Q3GB 3O6KL 1AQKL 1KXQE 5A2LH 1CFQA 1IFHH 2LAGB 4JZJC 1MIEL 5C0ND 1U8MB 3JTSB 5CJ8A 4I5BA 2V5SA 3WUWA 3MX0A 1L9NA 4HSQA 4MYWB 1BD2B 3ME0A 3ES6B 3UTSD 5JPMA 2I9LA 2DKSA 1W72B 2J88L 3P11L 4X9BA 3SDXE 2AGJL 2AKRA 4LMQI 4TVPH 5LGJA 4OV5A 2KDGA 5HYSG 1GPOL 3REVB 3LEYL 4HXAL 2MKLC 5ITFB 4NWUH 3WFEH 4LK4A 1FFNA 2X4TB 2YHGA 4WV1B 2AJXL 3QWRD 4BUGA 1L7TH 1CL7H 3FCTA 5I6XB 1UZ8B 3IS1X 4HIEB 3SY0B 3OR6B 4UT7H 4MCYA 2V7NB 3QHFH 1BFSA 2O5YL 3EUUA 5ISZB 2NLJA 5I71C 5HPMA 3TC9A 4IOIB 4WW2A 1XF5A 2AK1H 2DOCA 1CFTB 3FONB 5LWYL 1DBBH 1X5HA 1ZLWH 3S96B 2X41A 5FYJU 2IBBA 5DJAB 2BSED 2JB5H 3HFMH 3VGAB 5EUOE 4ZSOA 5D70L 1WK0A 4X98B 1YC8A 4GJTB 4AIOA 2DWEB 4HT1H 5L6YH 1AKJA 1FVEB 4LLYB 1ZLSH 5DURD 4PJ9A 3GNMH 3GSNH 3PF2A 3PV6A 1RUQH 4TNVK 1CK0L 2AJVH 2CGRL 1SY6A 3TCLB 1UKSA 5DJ2B 1UM5L 3F8UB 2DQEL 1RV6X 2W0KA 5IK3A 4FQQB 2Q6WA 3U36B 4K8RD 5HBBA 4JKMA 4P4KD 1SEBB 5CHNB 1ONQA 4HFWB 3WN5A 2C1OA 1KPUA 1WAAE 5E6ID 5FYJL 4JG0H 2AQ3A 3MXVH 4DUXA 2OR8A 5JXAL 32C2B 5CUSL 3FJTA 2AAVA 2VDQH 4U1GB 4GKZA 5DD3H 3VXQA 1OW0C 3TZVC 1S9YA 4HUKB 3I02B 1V05A 5T1DH 1MHHB 4S10A 1K6QH 3T4AB 5CZXC 3GJEB 3ARFA 5J06A 1KJ2B 4PB9H 1ZHNB 5E1AA 2VN7A 3G08A 2PYFB 2A6JA 2DDQL 1UACL 3KYNB 4PRHD 3E2HC 1LO5B 4HUWA 1SHMA 4WTZG 4KI5E 4OZGF 4WUUB 3RPIA 4HIXH 3DXAB 2DAVA 5L2KA 3KS0J 4HXBH 4LSUH 3MBXL 4NQCB 3MRQB 3QIWA 5HHOA 5T5NF 4X80H 1MJJA 1DTUA 3AVEA 3IETB 2CO7B 4KROD 4HGWB 4NZJA 2I60L 3N1QC 3QDMA 1G7JA 3KYKL 1P1ZA 1JYWA 4R8WL 5JMOC 2F58H 2P8PA 5E03A 5E9DB 4PGJA 2PCPA 3WLBB 4YIQB 5HI3D 3O9WA 2XOTA 5E94B 4QO1A 1A2YA 1O7VA 3ARDD 3WBDA 2FX7L 3O2DH 1AP2A 1NEZB 3GSVA 1WZ1L 4PJ7F 3PHSA 3OB8A 4JVPA 3RX7A 1I1AC 3D85A 1PY4A 3LKRA 4M8VA 2E27L 3SJVD 4EOWH 1CFVL 2ZPKL 2DQTH 3IDGB 3LY6A 5GGUA 3LKQA 5D7JD 5C0BB 3RWCA 4XAWL 4DZ8A 3R0MA 4OSUH 1ZGLB 2MCG1 1WICA 1XF2B 4PJAE 5I30H 2DM4A 4LRIC 1GVIA 1F02I 2F53A 4ONHB 2QSQA 3TBTB 4GAYB 4XPHH 4LVOB 4TULL 4AIZB 1AD9A 2ZNXA 3WXVL 3W5NA 3QPXH 5TFSH 5F3BA 4NQUA 5IMMB 1IEHA 2JCCE 3P4MB 1RURL 3UBXI 4PYGA 5GGRA 2EEDA 1JWMA 2APXA 1DEEB 1IC5L 2FH6A 4OM0H 4GRMB 1I8MA 3MLVH 3MGOB 3QG7H 3DO7B 1KOAA 2P47B 4X5WB 2Z31A 2XN9B 2Y25A 3BD5A 3S34L 5CZVL 5J12B 2XRAH 1CCZA 4ONFH 3WNLA 5FUZH 3TN0B 1BQLL 1QA9B 1SY6H 4PY8I 2W65B 1D9KA 2BVQA 3FFCA 1FNEA 2R1YA 5IOPB 5DT1L 3KR3H 4GRLA 3FN0L 4ORGA 3L7EB 3IAGC 5I1CH 3HUJE 1DVFA 1RZGA 3JWNC 5I17B 1JZ5A 1U41A 3N85L 4GBXC 1Q9OA 2R2HB 4DVRH 5LCVL 2GW5A 4XVJL 4P3CL 3AU1A 2Q1EA 5FK9B 3B4NA 4MB5A 3ZO0A 1F3DH 1JK8B 1Q38A 4JZNB 1QFOA 2OSLB 3V5KB 2AJ3A 4KKBC 4ZFOB 4U1IB 5ETUA 3HR5A 1SMAA 3L5HA 1A1NA 5ECJE 4J3OC 3CU7A 4PGDB 1U95A 1IGFL 3BP7B 5I2IB 1PJ9A 1TZHA 4P3WA 3OHXB 5FYKE 5BJTB 1OD9A 1Z9MA 1RUMH 3T0WA 1FHGA 2YD1A 4FG6C 4JFXA 3CSYB 4QF1B 4XBEL 2OJZH 3BOVA 5EU6A 1PQZB 3IDYC 4RBPH 2D2OA 4GLRI 2JELL 1IGTB 3Q6FA 5C08D 1MF2H 2NW3A 4XMLH 4PJFB 3X12B 5C07B 1X5XA 1I9JL 1QFUH 4Z7VB 3S3PA 4D2NA 2YA0A 3VE0B 4UOW1 1MHEA 1PG7X 4ACPA 1MRFL 1T1YA 2J2ZA 4G8EB 5F7UA 1Y6NR 4PRDB 1OAZH 4YNYB 4U6YB 5F9DC 4EKXA 2DLHA 3KYOA 3GSQB 4MB4A 3U4BL 2FHCA 1HH9A 4OCSH 4PY7B 1I8LC 2EE9A 3MRHA 1BQHG 1IC4H 1WIPA 1JHTB 4KV5E 1EV2E 3SCMD 5IB4B 3BP6B 1C16A 4JFFE 4NQDE 2IMMA 4DN3L 3T77B 5ADOH 3MLYH 3GMMB 1U8QB 2APWA 2FYYA 3V6ZA 1V3MA 4LIQH 1NCUA 1ZT1B 3MGAA 2VDNL 3VFTB 1PZUB 2HH0L 2AQ2A 2J8UE 5DRNB 2XNAB 1HEZA 1OB1A 3HPJA 5HYSB 5DS8B 3K2MC 1PBYA 4R96A 1IGJA 4IMLB 4NP4H 2OTWA 3V0VB 1VEOA 5I8KL 4Y16D 1LO4H 2B1HL 4WO4D 4ZXBC 2ZOLB 3RVVC 5B3NA 4Y4FB 5DSCA 1A4KA 3RFZC 1BOYA 4YDJB 2A0LD 5CGMA 3VD3A 2SEBB 4XCYB 5HGDB 5BV7L 4YHKL 5DRZB 5E8PA 3LQZB 1UH3A 1L4IA 1YMHB 4ZPVB 5DUMH 1NFIB 5FYKU 4GKNB 4PRAB 1FIEA 4U33A 4P59L 3KPPA 1II4E 3VA6A 2X1OA 4KQ4L 3PWVB 4EQ2A 5B3JF 3IS0X 3L3GA 4I3SL 3GSXB 4KI5C 5FA4B 5I1JL 4XPBL 3QUZA 4JY5L 5IB5A 3MREA 1GGCH 4R2GD 3TBWA 3DLQR 3S5LA 2YEZA 5EPMA 3SDAD 3VXTB 2HWZL 3CDGB 4NFBA 4ODHH 1WT5C 4KXZI 3FO1B 1FYTA 1UM6L 3CNKA 4HG4K 3OAZH 3FQWB 4KK8C 3C09B 1M7XA 4OCLC 3KPLA 1FO0B 1UWEH 2V9TA 3FTGB 5EB9A 5F9OH 4D0DA 3REWA 1IGYB 4X6DB 3BH8A 4PGCA 5GGTA 4F7MB 1MAKA 5DEFA 2VQTA 2X1XR 4M1CC 1EXUB 1AGCA 1Y18B 4JO4H 4HW6A 1A4JB 4LRNL 1G6RL 3FO9A 3O11B 4HIIA 4BSWB 1CIUA 2DTSA 1CFSB 1ZTXH 4QRPE 4HKJB 3GJFK 3T0BA 5FYKL 5TE6H 4WNQA 3LOWA 2Y7QA 4MSWB 1ZVYA 1U8LB 1R3IL 1TXKA 4LGPB 4P5TA 2PW1B 4GW1A 1KLFA 1ZHBB 1DZBA 2D7OA 1J86A 1R5IB 2FO1A 3MV8A 4OZ4B 4LCWB 3W5MA 1TPXB 2CO6B 4NDMB 3P2TA 2YPLA 5C0CA 4W68A 2G9HA 2FIRT 2K9UA 1A7OL 3VGGA 3T2NL 4JFEE 1E4JA 2M26A 1F2QA 4OBRA 3SDDD 4F3FA 4Y5XC 2Q3AA 4Q9CA 2X1QA 3U9PL 3EFDL 5BV7C 4CAGA 4YUEH 3D69B 2P1YA 4OGAD 1RUAL 3TYGH 2OTUA 3GMPB 1ZT7B 2XZQL 5K9KA 1F6FB 4XNMA 5J9PA 1LK3H 1Z2KA 5MERA 4MDIA 5GSVB 5DFWH 3SE9L 3DI3B 4JCLA 3O0RL 4BFIA 4XVUD 3LZFH 5KZCB 5JIHA 1WUNT 1P7HL 3S35X 2PTUA 2VL5B 1YDPA 4CRPA 3HKFA 2HFFB 2R1XB 2LVEA 3LD8B 4HK3J 3H9SE 1E4XH 5ESVA 5T1MB 3UTSB 5HHMD 4K3JL 3P0YH 5GRXG 3L3OA 4UB0L 1IKFH 2Q8BH 1TETH 3IT8D 1B4JL 4JN2B 4S0SD 4KDTA 1XCTA 3HTLX 1MHPH 2FBJH 1O0VA 1YZZA 2PW2A 4YDLC 4OFPA 4BSVB 2QQNH 3UZEA 3V8CA 5DTFB 4L4VA 3MGTB 1F4XH 4JDZA 3MOQA 5F88B 1U8PA 4P0DA 1E27A 1G9NH 4ZPTA 4HIJA 4M48H 5CBEA 5FYLE 1KCSL 5JMRA 3Q48A 3ZE1F 4AT6A 5EG6C 3TVMC 4OKDA 1P4IL 4IIQC 3P4NB 5I74C 1FG2B 8CGTA 4FHBD 1MCOL 3BO8A 5CSZA 5L8KB 5DO2C 1Y6KR 1KTDA 3GHBL 2HLFD 4JRWA 1SBSL 1TVBB 2FX9H 1F90H 1AXIB 4RGMB 2UVEA 5JHLH 1GRWA 1U3HC 5JO5A 2QQKL 1YEFL 3O3AA 4PJDA 3FQXB 3MJ9A 5GGVH 3MV9E 1DSFH 2X9YA 4U1LB 2OK0H 1T3FA 4G42A 1W0YT 5JDSB 1EO7A 1KCUH 5EO1B 3RDTA 3O8XC 1RZ8B 5GGTH 5C9JA 5JR1H 1R3LB 4U6VH 3RWDB 1I1FB 1MNUL 4P2RE 2KPNA 3BP5B 4I3GA 3SQOH 4FFYH 4P4KB 5M94B 3CMOL 4NZUH 5GRVK 3ILPA 5SX4I 3MUY1 3NZHL 4W70A 2X70A 5E6IB 3RGVD 3U0PB 3W39A 3RL2A 5T1KD 2DQUL 3EDEA 1JHLH 3VCLB 1D5BB 4PJHE 1UCBL 5D7IA 4IRJA 2VDPL 1TZGH 3CVHB 2AV1B 2NY2C 1T5XB 1A6TB 1I1AA 2EDTA 3EZ8A 4XCNB 5ABDE 4FP8H 2ADJA 1GOHA 1RULL 5DQDH 1DJSA 3P9MA 4X6BB 3HA0A 5F3HA 1J0KA 3QFDB 5HGHB 4Y4HC 5K93A 4NPYA 4MA1B 2HVJB 3NIDF 1KCVL 4XTRC 4PRHB 2DRUA 5TQ0L 3DGCR 2GITA 2FO4B 5LBSL 1S7RA 1TENA 5BQ7B 3BAEL 4UQ3B 2HJKB 5B21A 3WHE0 4DCQA 1ZV5A 5GZNC 4L4JA 2I25N 1YEGH 5I1GL 3CVIH 4FTVA 4OIBA 4L4TA 2X4OA 4IRSA 4NZDA 3MRMB 4FQLH 4TSCH 3JWDH 4U49A 4CADB 1H0DA 4M6OH 4NN6C 3QJFA 1JPSL 3TBYA 4KROB 2HTLC 1X5KA 1Z9OA 3OKMB 3HAEH 3LHPL 2VE6A 4XB7A 3UMTA 1DE4A 1MCPL 3M07A 1ULVA 1A9EB 5E8EA 3C5JA 4N90E 3DV6B 1MAML 2B2XL 3UTTD 5I8CB 1HSBB 4YBLC 1RUKH 2WNGA 3X11A 4NBZB 4KJYB 5J6HA 3ARDB 4ALAL 4XX1E 1H5BB 4ERSL 5AG8A 3W9DA 3OR7B 5AUMA 15C8H 2YZ1A 3R06B 3SDYH 3BVNB 4Z7WB 3O6KH 1AQKH 4GBXA 3DVGA 1S9WB 5D7JB 5MP6H 3RWJA 1XF3A 3U0TB 5FO7A 3FZUD 3BDYH 2ATKA 1U58B 4JM2C 4NWTH 2HFTA 1P84J 2GJ6E 5J7CC 5F70A 2J88H 3P11H 4PJXB 1YYML 3VFOA 1BOGB 1IBGL 2NNAB 3MOBL 2H9GB 3MJ7A 3TFKD 3H3PL 1VERA 4HX1A 2R9HD 3K2UH 3LEYH 4HXAH 1WZLA 2ADFL 2J12B 4CBPA 3GMRA 4KPHH 1GL4B 1VFBB 4ZUUA 4K3DH 3QWOB 1EUTA 4HPYH 3BHBA 2C1PB 1C8PA 4YAQB 3LEVH 2D4FA 3OQ3B 4UIMB 1J0JA 3JXAA 1BGXL 3STBA 2OR9L 2O5YH 1PDKA 3MJ9H 1FZKA 2ERJC 1QHOA 4NT6B 4XAKD 5DI8B 5LWYH 5D7LE 2BOCB 3D2UD 4F7PA 4Z5RB 3CDFA 3S36X 5HVHC 3SKOB 4JDVA 1YN7A 3F5WB 5I8EA 4DAGL 2AK4D 3B9KC 3BPCA 1VKXB 1XCQB 4BYHA 3T1FA 3HE7C 5DZOA 1CDHA 5KOMC 3U7AA 5CJ5A 3UTOA 4L3CB 4LCYB 3ZMRA 5KG9B 3LH2H 5FUCC 4XPAL 1I8LA 3GMOA 4FS0A 1CLZL 4M1GH 2EDBA 4XXCC 3MQIA 1LWRA 2HT2C 1NUFA 2CGRH 3B8SA 3FOMA 3C9NA 3L3KB 1LEKA 5B38B 3IFOA 3O41B 2DQEH 4PV9B 3RHWF 3U0WL 1J0YA 2BSRB 5KN5A 3AM8C 1KUMA 5BOPA 1TCRA 5IKCA 1ES0A 1F58L 4JFYA 3VD7A 4JLRA 4PBWD 3C5ZB 4M00A 1MWAB 1NBYA 5H37H 1G9ML 4FQXC 2D31A 2P45B 4ONOA 1PKQA 3WFDH 1RZKL 4PJCE 5FYJH 5C08B 3JTTA 3U83A 4HLJA 2EC8A 3B9VA 5GRVL 3VXMA 2CRYA 2JK5A 4ELKA 5J1AB 5FGSA 3R1GL 3TYFB 5CUSH 5GS1C 2DQHL 3RIFK 5JXAH 3BE1L 4ZXBA 4KAQH 4UTBH 4J3TA 2YR3A 3NN8B 2F5BL 2PXYC 3QWQB 3L9RA 4PB0L 5EBLB 3WIHL 3L3IA 1GGBH 5DRWB 3CFBB 3PJSA 3QG6A 2HJFB 5D93C 2ZCHH 4Z7QE 1I7ZA 2B39A 3QNXB 3OKYA 3BGMA 3GUTA 1KLGA 4QYOB 4LSVH 3IJHA 1JZ2A 1SJXA 4LHUA 5CZKA 4J1UA 4ZMAT 3SCMB 5DJYA 4Z77A 5IESL 2DIAA 1F6LL 1AGDB 1DBAH 4L29A 2AQ1A 4J3XA 1EZVX 4MA8H 1GGIL 3AMLA 4JPIA 5CILH 2OS7A 5GS2D 1WT5A 3O3EB 3UPCA 2PNDA 4PBVC 5DVKA 4ENEC 9CGTA 3QI9C 2I60H 5DK3A 4HUUB 1FFRA 1ZVHA 1CN4A 1MCIA 2WUBL 3ARBD 3JV6B 2VJXA 4RGNE 3VFVA 5BS0D 4WI6A 4R8WH 5I9QC 5IV2B 3ZKXC 4EI5D 5EOCL 3HG1D 2CUMA 2GK0A 2WWMD 4X7TA 4Y16B 1QRKA 2WIIA 4WO4B 4ZYKA 3IFLL 4KJWD 1MFEL 3H7BB 4KFZC 3NCJL 3QQNA 3BX7C 2EIZB 4NKIH 2M2DA 5I0DA 5J1TC 1N6QH 4GRWH 4TPRL 3VXRA 2FR4B 1V5JA 4YXLL 1JF1B 1G9MC 1KELL 4JPKH 1M1SA 3UYRL 5EN2A 1RZKC 4WEUD 4XAWH 2DD8H 5CWSA 1C12B 3UYOD 4OLEA 5C09E 5IUSA 3TNMA 3IRPX 4G6FB 1CBVH 3T4YA 1YEKL 3PWLA 5KSAB 4N0RA 4R2GB 2ZJSL 1C08B 1E28A 2FCBA 4FQ2L 1CLOH 1B88A 1E0OB 5IW1A 2YC1A 4PJ5E 3SDAB 2I27N 3WXVH 5IBTH 5GRUL 1OCWH 2MQ0A 4Y5XA 3WO3B 2RJMA 1BFTA 2JCCA 5I16B 4C83B 4MXVE 4KK5D 1PLGH 1IC5H 2GT9B 2FHFA 3VU2A 1JWUB 4I3RH 1XGUB 5T5NG 4JM4H 5ILTL 5CZVH 4CKVX 2F54A 4KTDL 3EO9L 5IEKA 3LS4L 5A16A 4PJDF 3G6AB 1FDLL 1BQLH 4CVZB 3T3ME 5DD6A 1NFDB 3HZVA 1JWSB 3L5WA 5DT1H 3VXSE 4JFDA 4WFED 2VUOA 1QYGL 4QGTA 2JB6B 1LGVA 4ZD3H 1I3UA 3N85H 3ZT7A 3VRIB 3ZTNL 5EO9B 1LQSR 5EC2A 4LOUC 1IGMH 4XVJH 4P3CH 3F6IA 4ELMA 1NAKL 1NGYA 2C9AA 4FFVD 1LDSA 2HTKD 4OLYL 4XC3L 3ULVE 4PLJD 5FHAL 2ICEA 3AGVA 4C57C 3BGAA 4X4YB 3BRFA 3C8KA 2RFXB 3DSNA 1V3JA 3MUGA 5FGBC 3LDBB 4KKCD 1HYRC 3JV4A 3K0WA 3PQYD 3SDDB 3MRNB 4P2OC 5L9DL 2CJUL 3WHXB 2AEIT 2P44B 3VI3F 3HR6A 2CK2A 4HJ0C 4XBEH 4Y5VC 3TVMA 4RX4D 3S4SA 1JGEB 3A67H 2E7MA 2GSGA 5CCKL 1R3HB 3ZHKA 1ND0B 1QFWH 2DQJL 4PRPA 4PV8A 5DJZB 1N6VA 2DIBA 4Q97A 3LVEA 1J05B 5HVFB 4BK5A 2H3NB 3NFSH 3W0WE 1RHHB 4LCUB 4Y1AD 3OKDA 1NGXA 3WE6A 1AR2A 1U3HA 5GJTL 1MRFH 1FCCA 4K94H 3BXNB 3F58L 4MNQE 2AS5M 1RJZA 3IB4A 5HHMB 5BRZE 2P46B 4IJ3C 1XGPA 4D8PB 3ULUE 1A9BA 2JJTC 4GS7C 3U4BH 2XI9A 5JA8B 5IR1B 3O8XA 2XY1A 3JZ7A 5IW6B 3RWFB 4KKNA 5TF0A 4D0CA 5KSUB 1OGAE 4XCCL 3V4VL 4BQBA 1H9VA 4ODSH 5JLZB 3DX8B 4F57H 4LVNC 2H8PB 4DN3H 4ZAKC 2R0KL 5JDJA 4UNVA 1G7HB 5A3IC 1KJ3H 1T0NA 3HMXH 1DQML 3VRLE 4GG6E 3WNPA 3OKNA 1XR8B 4ZS6D 1YMMA 3B43A 1BFOA 3R4DA 3FFDB 3TF7C 4LEOB 4L5FL 2HVKA 1K4CA 4MJ5A 1XGQB 2JJWA 4JANA 2IF7A 2WBJC 3NCBB 2LE9A 4G3YH 4CU6A 4OB5L 1MQKL 3WFHB 3PP4H 5F97E 1E6JH 5IMOB 1T04B 3HPLA 4WUKH 5ID1B 3LKPA 4PJIB 1HK6A 4YHKH 1N8ZA 2XWJA 2PYEA 4WFGE 1DBJH 3IU3A 4V1DA 3OPZL 3TJEH 1LEGB 2WUCL 4GRWF 3DPBA 4YHOH 2IWGA 2QR0A 5CEZE 3CFCL 3GSUB 4NQEE 4XPBH 1NMCC 4JY5H 1U2HA 4KRPC 1S9XB 3WIFB 3ZE0F 1I7TA 3EGSA 4CW1A 4E41B 1I4FA 2HWZH 4OGZA 3BZDA 4AY0A 2F8OA 3QXUA 3V5HB 2VH5L 2E6QA 2IPKB 3HZMB 4U4BA 1UM6H 3W11D 1VACB 4Z7OE 5IT2L 2GSIA 1B0RA 4N0CC 1S78D 1ORSA 5EUOF 3VXNA 1F45A 2OL3H 1AR1D 1RZFH 3QUML 5B8CB 4OGYL 3ULVL 1RU9L 1IC7L 1SEQL 4NJAH 1YN6A 1DUYA 1FORL 3OGOE 3EDJA 3RVUC 3BPOC 3L7FB 4HGKC 4ZTOL 2GKIA 3MLRL 1G0XA 4LRNH 3GSWB 3MFFB 5FM4A 5MEOB 5GRWA 1T2JA 2D9CA 3MRPA 3V5DB 5SWZA 1EHXA 3QNYA 4C4KO 4FQIL 4BH7B 3INUL 4J3VA 4HDIA 1IJ9A 3WUWG 5KSBA 2EDWA 1R3IH 3QSKB 1WBXA 1X5AA 3OGCB 5IVNA 5J0BA 1NGZB 3VG0L 4U1NB 2LFGA 3O9WD 4MJIA 1AGFA 4YPGB 2ZSVB 3QB7C 1NPUA 5DDHB 5IROA 5IIEA 3LB6D 1L6ZA 3TPUB 2CRMA 4WU7A 2Z93B 3RU8H 2VXTL 5TPWL 5JUEL 1IGIL 3S98A 5LGKA 2BVPB 3MJ6A 5D6CA 3QULA 3ZYZA 1J8HE 3EFDH 5GHWL 1D5IL 2ITCA 3KPRD 4TNVF 4PJEE 4X7CC 4ODXA 4O58L 2R2BA 3UTTB 1RUAH 2BHUA 5J4MA 1KJMB 4DWHA 5EIIB 1P6FA 5JORB 4YZFE 3PL6A 3QEGL 3PIQA 4WFFE 3ULUL 3DX9B 1QSEE 5LQBL 5F7HA 5MEND 4ZUWA 2FATL 1B4RA 1EFXA 3TV3L 3O0RH 2HT4C 1U92A 3VMOA 3W9EA 5EIVA 1LO3L 3O4LD 4XZUB 4LLUA 4WFHD 1DBKL 1N2RA 4KI5F 5IWLC 3D39E 5C0IA 3LS5H 2Z31D 2Y4SA 3BD4A 2IQ9H 2YPKB 3NAAL 2YSSA 4AEEA 2YA2A 4GG8B 5GRJL 4UB0H 2BVOB 1B2WL 4R4BB 4X4XA 4G8IA 4RWHA 1B4JH 5IF0B 4Y8DC 3SBWC 1P69B 1WWCA 3ULVC 4F7TB 4WI9A 1D9KD 3FFCD 4U0QB 2YXFA 4B53A 4GRLD 4JFQB 4UU9A 1XIWD 4OFIA 4MB3A 3T0EE 3L3JB 1HKFA 3ZTJH 1JPTH 3L3DB 1X6NA 3UPRA 4HH9A 2C7UB 4QXGL 1N4XL 4MCZB 3C6LC 3DYOA 4XT1C 2AEWA 4FQXA 3MXWL 2ZKHH 1HDMA 2AJYL 2Y9RT 5A2KH 4XNYH 1IM3B 3GIVB 2A1WL 3STLA 4KQ3H 4YEEA 3LKSB 5CEXA 3QUYB 3D2UB 3GHBH 2BP3A 1QSFA 1RJLB 1UA6L 1SBSH 3V95A 4OZGB 4IRZH 3Q3GA 4QXUL 2PXYA 4TUJA 4R7NB 1FH5L 4M61A 1U8MA 1MSPA 2AK4B 2ARJB 1YNKL 2VLMD 4PJAF 3ES6A 4F15B 1YEHL 2JJUA 2B1AH 1M7IA 4YXHL 4ZUVB 4NUJB 3DURB 3ULUC 2D7TL 3REVA 4JPWH 2JCCF 4R97B 2E8YA 1BFVH 2MPAH 4WV1A 5ACZB 4HV8B 4M7LL 1UZ8A 4HIEA 3PDGA 3KLHD 3OR6A 3O6FC 4Q9QH 1MNUH 5F1IB 5ANMB 3ORJA 4S0TD 3QI9A 5ISZA 5J11B 3HC3H 2AI0L 1EJ6A 2DWDA 1CFTA 1YNTB 1UKTA 3S96A 4RMSA 5DQ9B 3HZYB 2Q87A 1OAUL 5CJXA 1QD0A 4F37F 1M4KA 1CLYL 4X0KB 43C9B 4ELMF 2DWEA 3WFCL 4IBLT 5BZWA 4LLYA 1FVEA 3OKEB 1D6EA 3SGJC 1BX2B 3BQUC 5GISL 3T65B 1A6PA 4OI9A 4KHXL 3GBNL 5TQ0H 4XNUL 2G5BB 1KCLA 1QVOA 5LBSH 3BAEH 2BNRA 5DJ2A 1DCLA 2DIJA 4FQHA 2JJSC 3SE8L 3OF6A 1FFQA 1T0MA 3WD5L 4FQQA 3VWJC 4LLQB 5IMKB 5I1GH 3DVFA 3WIHA 2IH1B 4HFWA 3EZJB 5E8DH 1JPSH 3QDGB 5ESAB 5F1SA 4DGIH 4KDVA 2NR6C 3MJGX 4XNZB 3LHPH 2UZYB 1EBAA 1H3GA 4JAMA 3ARBB 1J1PL 4GMTH 2XQYG 1FZOB 4JJ5A 4NNXA 5BS0B 1MCPH 3MNWB 1ZKAA 2EYSB 1KB9J 4EI5B 1FGVL 4EQ3A 32C2A 1ZHLB 4J6RL 1MAMH 2B2XH 3EYQC 4F9LC 3HG1B 2BY0A 3FO2B 3FRUA 2A2QT 2R0WH 1IAIM 5FO9B 1FVDA 1RIUH 5EWIH 4ALAH 3VG9C 3T4AA 4AENB 3B2UD 3O4OC 4XH2B 3GJEA 1FNSL 5EBGA 1W8NA 4JB9H 2D0HA 4M5ZH 1G9EA 3RVXD 2PYFA 3KYNA 5D2NE 3QXVA 1OPGL 3C6SA 3T8XB 5KS9E 1QLRB 1EAPB 1GCFA 1BECA 3PGFH 1CTNA 2V2XB 1IBGH 3O45A 5DUPL 2EIEA 3BN9D 4NQCA 3MRQA 2ADFH 3AC0A 3VRJB 3IETA 4RSVA 4P2OA 4HGWA 3VXOB 4GW5B 3UJJL 2BJML 4OV6F 4OZIE 4B0MM 2WP3O 5E9DA 1I9IL 5T3ZD 3WLBA 2AJZA 1M71A 2XV6B 6FABH 4M62H 1UZ6F 3JWOL 4L8CA 5D9SB 5E94A 1RJCA 3TIDB 4KMLB 1YYLL 2NZIA 4OF3A 4HS8L 3U46A 1A8JH 3AREC 5I8OL 4L9LB 4Q74A 4FQCH 3WDHA 5J57B 4L8SC 4D0BA 3B6SB 3IDGA 3S9DB 4L8BB 5I1LB 1IAKA 4ZDHA 1N3NB 2B4CL 5IG7A 4K3EL 1BVKB 3TO2A 1ZGLA 1NSNL 3D0VB 1CD1B 1R3KB 4OCRL 4GAJH 1QG3A 3I6LE 1W8OA 1E4WL 2JJTA 2AERT 4GAYA 4OZHE 1E4KA 2EDDA 5EZOH 2IFGA 5F1OB 4NSKB 3IVKB 5D1XC 3QAZB 3F12B 2WINB 3P4MA 4I2XB 2H41A 3MV11 1CFQB 1A0QL 4HKBA 3PQYB 5E6YA 2OYPA 5JOPE 1NMBL 3EAKA 3U0WH 1DEEA 1FLTX 2A6DA 4ZAKA 4GRMA 1ADQL 1QBMH 3T0EC 5DGQA 5JPMB 3MGOA 1A6VL 2I9LB 3S37H 1CICC 1FIGL 3DO7A 4X5WA 1CF8H 5BW7A 2YD5A 5GGSB 2AKRB 2XN9A 5LGJB 4AEHL 1JRHI 1MRDL 1L0XA 3SQBA 1U8HB 25C8L 1RZIB 3DX7B 4P57A 1QA9A 2W65A 2HFEB 2XKNB 3UTZB 1ZT4B 5IOPA 1QLEL 4QHKJ 2DQHH 3FCTB 4Y1AB 3BE1H 5KSBF 3L7EA 2NY7H 4HC1A 1MCHA 4UINH 3DRQA 4XWOD 5D2LA 5I17A 4M7JL 2F5BH 2R2HA 1VADA 3BWUC 4HKXA 1DLHB 4YXKL 5FK9A 5HPMB 2LQRA 1XF5B 4JZNA 4ZFOA 2HRPL 3CFIC 3AROA 4AQOA 4FZ8H 3GI8L 1JBJA 3JWOC 1OSZA 4PGDA 1QPPA 2YK1L 2XQBH 3BIAX 4NIKB 3TZVD 3A6OA 4DZBB 5BJTA 3RJDA 4AM0B 1NEUA 4G8GD 3B5HA 3S5LG 5CZXD 2KUTA 4XNXL 4MXWH 3FMGH 1GGIH 3CSYA 1XT5A 1KFAH 4Y88A 3KXFE 3R8BB 2B4CC 4OF7A 1H8OA 1T66D 1KJ2H 4F8QA 1IGTA 3RQ3A 3WHE1 2GQHA 5ALCL 2QADC 4PJFA 3X12A 5DJCB 5C07A 4Z7VA 1J9CT 3BPLB 1EDQA 3WJJC 5T33L 2EKSB 3OKLA 3MJ8B 3SE4C 3BFOA 4K7PY 1SM3H 3U7YH 4NJ9H 4BUHA 2UWEE 5AEAA 1QNZH 4YNYA 4MXQC 4U6YA 3HB3C 3WN5B 3GRWL 2C1OB 1TTGA 1KPUB 3MYZA 2EYTB 1VSCA 3GSQA 1KELH 3CXHJ 3ZDYF 4PY7A 3DO3A 1OARL 5HHXH 5JW3L 1NKRA 4G9FE 5C0GB 1JHTA 3UYPA 5IB4A 4GKZB 3VXQB 3BP6A 4G7YL 4O4YL 4EUPB 3QEQE 4ZO8A 3FQUA 5DYOB 3RIAF 2W0PA 3GMMA 4FQ2H 2FEDC 4ODBD 4GFTB 1GHFL 1U8QA 3RI5K 5GRUH 3BKJL 1ZT1A 4NKOA 4X9GA 5E1AB 3E1F1 3G08B 3VFTA 5FYJD 2XNAA 4HUWB 4YK4C 2CSPA 5DS8A 4PJGB 3QXWA 4H8WH 4MNHB 2L7JA 4IMLA 2LTQC 3NIGE 1MI5E 2D03L 4YE4H 2NY6C 4C59B 2J3SA 2CKNA 3ROOA 2DLIA 4M7ZC 1S7WB 4XRCB 4FTVD 5HHOB 2NXZC 2ZOLA 3EO9H 3LS4H 2Q3ZA 3DUSA 4L4TD 4G6JH 1JGLL 1KNOB 5KAQF 2SEBA 2FH8A 4CN6A 2FZ3A 1G7JB 5DRZA 1BD2E 4ZPVA 4U0RB 5IWLA 2JLLA 4GKNA 1M7DB 4S1DC 1C5BH 3V6BR 2P8PB 2KL6A 4O5LH 2PCPB 5KBNC 3PWVA 2NY1C 1IZJA 3O9WB 2CXKA 4XC3H 3THMH 1HHIB 1A2YB 4NRXA 4UT9L 3GSVB 4YR6B 2P5WA 3OJVC 4M5YL 5FGCB 3D85B 5LGHL 3TH2T 4KU1A 1BJ1J 3VXTA 3LKRB 1CXFA 2LU3A 2N4IA 3DTXA 4YBQC 2NTFA 4HC1H 3RWCB 1VGEL 2VL4A 4QOKE 3IDXL 1IE5A 4K71C 1MCEA 3FQWA 3C6LA 4Y19E 4JQXC 5L9DH 5AWNL 4LFHD 4QHUA 3KPRB 4R6UA 5M95B 1IAII 2A77L 3FTGA 4RCAA 3CLEH 5CP7A 4KKBD 1EHNA 1IGYA 3S3SA 3MRGB 2F53B 4F7MA 3EDKA 1JPGA 1OAXL 3ARXA 4QY8B 2VLRE 2DQJH 1FCGA 4JKKA 1Y18A 3MCKA 5EFIB 5MENB 2Y1VA 2ESVE 5GGRB 2A0LC 1JWMB 5AAMA 1ZLUH 4HKJA 4FG6D 2F9BT 3HI5L 1J1OL 4KKLC 1HIMH 4MSWA 3F7VA 1RQ5A 5F7EH 4UV4H 5FUOL 4KY1L 1AGBA 1KIPB 2Z31B 4HFUH 4RDQF 1P5VA 1ZHBA 1R5IA 4LQFH 5E2JA 1DN0A 3NGBC 4OZ4A 4MJ6B 4UBDC 3ZKND 2AXFA 1L7IL 1AHWC 3EYUL 1D9KB 3FFCB 1FNEB 2DI8A 1RIHL 2XYCA 4GRLB 2VIRA 4ORGB 2Q86A 3KDMB 5F8QC 1XIWB 4I77H 3C2AH 2MMXA 3PWPE 4IM8A 1MLBA 1RZGB 1TFHA 1I3GL 3DETC 3QCVL 2W59A 4XCCH 2XTJE 2C4FT 3D69A 3AU1B 3SGEI 5BVJB 1XGYL 2R0KH 1IL1A 4PG9B 3B9DA 3HR5B 4YHML 4C58B 3SHSA 2UY6A 1NLDH 1U95B 2VKXA 5GSVA 4NNYB 5IGXL 2X7LB 2DBLL 4JRXA 4L5FH 4PG2A 1EEZB 2CRZA 5I1KL 4XP9H 1KIQA 4FXGA 1MQKH 5T1MA 2YMXH 5HI4C 1JIBA 1LE9A 2VLLA 3NCFB 3Q6FB 5IQ7H 5E1HB 4JN2A 1R6VA 2IPUG 4WUUE 1P9MC 2NW3B 3DXAE 4XBPA 3ZE2E 3VFMA 4BSVA 5DTFA 2HKHH 5FEBA 3WIIH 1MHEB 2MCPH 3QWRA 1CWVA 3H42L 3LDBC 5F88A 3RVVD 4Q9RH 4QHLB 3CFCH 2P48B 3WO4C 1BWMA 1T1YB 2N7BA 1YPZA 1MY5A 5F7LB 2R0ZL 1UB5B 4OCXH 4BKLA 4OGAC 3G5VB 1LP9B 3KYOB 2VH5H 3SGDI 3GIZH 1RY7B 3P4NA 1FG2A 4X7FC 1YJDL 3MRHB 4Z7UE 3EDDA 4LHUD 4KI5D 1PVHA 2YUVA 3BGFC 1TVBA 1MLCB 4XVUC 4OGYH 1BAFH 1PY9A 1RU9H 1TZIA 5EU5A 1K3IA 5D7SL 3IRZA 2Q7YA 5AD0A 2FYYB 2ZUXA 3V6ZB 1OAKL 1YEJL 3FQXA 2FB4H 4EN3C 5CAYB 35C8L 4KK8D 1GZQB 1FLRL 1AD0B 1HEZB 3T1WA 4YDIH 4R96B 3MLZL 5KSVB 4LFHG 5JDSA 4M1CD 1RZ8A 1R3LA 2DQCL 4HMEA 3RWDA 5DSCB 1I1FA 1PKOA 1A4KB 4ZTPH 5KJRH 5E8NA 5K59F 3E3QE 2NY3B 3BZ4A 4S1QL 5FXCH 3VXRD 1C7SA 1D6VL 3BH9A 1IGIH 3VGDA 3PWUA 5E6IA 4R3SA 1EVTC 4NZTL 3LPWA 5GHWH 3DV4B 5I1HL 1D5IH 4J4PC 5D2LF 3QQ9C 3L3GB 1IKNC 1EJOL 4GMSL 2OZ4A 2HLFC 3VCLA 1D5BA 5I1DA 4EXKA 5IB5B 1UXSA 3MREB 2I5YL 3QEGH 3TBWB 2AV1A 1T5XA 5T1LD 5DJDA 5K9QG 3OXRA 4KZDH 3VFPB 5EU4B 3U48A 3T2PA 2FATH 4XCNA 4L8SA 4O02L 4Z7QF 4X6BA 1KB5L 2HVJA 1LO3H 1PG7W 2Q8AL 3F7PC 4PRHA 5FV1L 4LQ1A 4WHTA 3U79A 1G7IB 2FO4A 4K9EL 5AZEL 1YJDC 4D0DB 3D39A 4UQ3A 1A6UL 3BH8B 5AZ2L 5ID0B 3VFGL 3NAAH 1OWRM 2HJKA 4JZOA 5L88H 4PLKC 1WISA 1B2WH 3RIFF 3I2CL 4J8RA 3RUGE 43CAA 6CGTA 3SO3B 4CNIB 1EPFA 4NKQB 2J8HA 3FO9B 4HIIB 2GTZA 5IFAH 2VERN 2GEEA 4CADA 1E6OL 1FJ1A 4JZJB 5DK2B 3OKMA 2Y7QB 4XVTL 4ODVL 4JRYE 4I18C 3RGVC 5IB2B 4GW1B 5E4IA 1TLKA 2X10A 2R23B 4GQ9L 5F6IC 2AJYH 4ZOBA 5DUBB 2ICWB 4KJYA 1IT9H 1LO0H 3ARDA 4MA3A 2G9HB 4QRRE 4I4WB 1I7RB 3GKZA 2CUIA 4KVNL 3V52L 4F3FB 5I18L 1UYWH 5FYKD 4Z7WA 3SJVA 4NO3A 1S9WA 4QNPE 3U0TA 1A3LH 2XACC 2VRAA 5I71B 5TE4H 3TVMD 1U58A 4AEIH 3BYYA 4G7VL 4DKFH 5K9KB 1J5OL 2CDEA 4KK9C 1KT2A 4YXHH 4PJXA 3ETBF 2EDEA 4XNMB 1GGYA 5J9PB 4LU5L 2OM5A 5H8DA 4XCFL 5DHYB 2V7HB 4S1RH 4J3SA 4BFIB 4LHUG 3QWOA 1YDPB 2R29L 2C1PA 4YAQA 1U3HD 4M7LH 1KIRB 5TDPB 5ESQB 1FN4A 3KG5A 4RMRA 3ZSSA 2DL9A 2XTJC 4Q6IC 4LLMA 5SWSE 1U3ZA 2HMIC 2AI0H 4NT6A 4JHWL 3MO1B 5DI8A 5E8OB 5KVGL 4MD4A 1JNLL 3T3MF 4L4VB 1K4DA 2FJFB 4BQCA 1U8PB 4LCIH 5HHPB 4JDTH 3WJJA 3BEWA 3SE4A 5ACLA 4JFFD 3S7GA 5D7KE 4WW1A 4NQDD 2FECI 1VKXA 4YGAB 1T7XA 4K8RH 1XCQA 3ULVF 1VEMA 3MRDA 3P4OB 2DI9A 4L3CA 4N0FB 3DYMA 2XWTA 5I73C 1A1OB 5KG9A 4PS4L 3BO8B 3QH3B 1U8JB 4KHXH 3GBNH 2AEQH 2CUHA 4XNUH 5B4MC 1V7ML 2R9HC 3L3KA 5B38A 3TZVB 2NY2D 2OZ4H 3O41A 2HYMA 3CVHH 1RJYB 1V7NH 4G8GB 5DWUH 2VDRL 2NX5E 3O3AB 1QRNE 3DROA 4UI2A 4LVEA 1VDGA 4DW2L 4Y4HD 2PKDA 3V7MA 3W82A 4XTRD 4BFEA 1JFQL 5DMIL 3E2HB 5INDB 2ILLA 3KYMA 3RX8A 5C08A 4X6DE 1MVUB 2RGSA 3V0WL 5GZND 5C9JB 5I0ZA 4R26H 5C70A 5D1ZC 4EVNB 1CZ8L 3P0VL 3KJ6H 5D1QC 2FX8L 3L5XH 4H26B 3PNWA 4UZGA 5EBLA 2HTLD 4ZOCA 3E6FB 5DRWA 3CFBA 2HJFA 3ILPB 4ZODA 1KTLB 3TIEA 2X70B 3QNXA 3GKWL 1KSRA 1OTTC 4QYOA 1EERB 3QO0B 4LCWE 4DJMA 4JFHE 4KMQA 1Q72L 3VWKC 3CK0L 4OUUB 3SCMA 4Z7NF 1TTFA 3D3VE 4LSPL 1AGDA 5IHUL 1ITBB 3NH7H 5DUPH 1I1AB 1JUFA 4O2CB 4PGEA 5D72L 4WDIB 2ADJB 3O3EA 3P9MB 3VRLF 4GG6F 5SWZD 3QDJE 4UDUB 4NPYB 3HZKA 4JQXA 1GSMA 4HUUA 1N5YL 3UJJH 2GITB 4KJPC 1S7QA 4FQPA 4JM2D 4HWEL 5IV2A 1YECH 2BJMH 2UZIH 1FL5B 1KV3A 2XIDA 4DCQB 4MJID 2V17L 3S88H 4WO4A 4P23D 4OD1H 5DMGC 4FTVB 1PD6A 3H7BA 3OMZA 4W81A 4L4TB 1MJUL 5DJ8B 4HS8H 1H0DB 2EIZA 3S6CA 2BXZA 3QJFB 5GIRB 5I8OH 4JFED 1MJ7L 2IFFH 4XP6L 1KEMH 4B50A 3UTSE 2A9NH 3JSSA 2XICA 2XZCL 5E8EB 1KC5L 3C5JB 2B4CH 2ID5A 3QIBC 1YPZF 1A7NL 2ED7A 1AHWA 4JN1L 4K2UL 1B6UA 1NKOA 5CP3A 3W9DB 3MNVA 4K7PH 1EX0A 3NCCB 5JW5B 5C6TL 4XP5L 3U6RA 5I16A 4R90H 3B9KD 4Z7OF 2WIMA 3RWJB 3DUHA 1XF3B 5E7FA 3WNMA 5EORL 2BDNH 2GT9A 4MS8C 3HE7D 1JWUA 5C8JB 2ATKB 3I9GL 3H9SD 5D71L 3HHRB 3BKCL 1XGUA 1U8KB 3SDXB 3VFOB 1FPTL 2HT2D 1OAQL 2QSCL 2WWMC 3MLXL 1RFDL 2N7AA 3C8DA 3G6AA 4F80A 4CVZA 1NFDA 4LCCC 4GRWB 1A6WL 4AQ1B 3BHBB 2NQCA 4HZAA 5F6HI 3ZTJG 4PJ8C 3TWCH 5GS0C 3PGCB 2JB6A 1CE1L 1EZVY 1F4WL 5FM5M 3VRIA 3IDYB 4FQXD 4ZFGH 5FYLD 1FZKB 1EMTL 5IM7B 5DR5L 5K9JL 5FKAA 2P5EE 1P9MA 1CGSH 4Y2DC 1I9RL 3VXUA 4X4YA 1N7MH 2RFXA 4F7PB 2YK1H 4W6XB 5FA3A 4KVCL 1T7WA 2LVCA 5E2UL 2PXYD 5EUOB 4JQVA 1MREL 1WGOA 1YN7B 2A6KA 2ZSWB 5I8EB 1MFCH 1NBVL 4IOSD 2E9BA 3WHXA 1A14L 4PJEF 4HD9A 2ZUYA 1JRHL 4NCDA 3T1FB 5TQ2L 4L8DA 2WZPD 1G7LA 2RAMA 4HMCA 1JGEA 1YNLL 3ZKMC 1FE8L 4GUPB 1A7BA 5TDOA 4TNWF 5DJZA 3BKYH 1A7PL 1RZ7L 1J05A 2AV7B 2NY4C 1LEKB 3IFOB 3R8QA 2H3NA 1RHHA 1LD9B 4LCUA 1JHKL 4LSTH 2QHRL 4R4FH 4TSBH 4M3JA 5KN5B 4DTGL 4J12A 5T33H 1TCRB 5IKCB 4JFYB 4JLRB 1AO7E 4P2RD 3PGDB 3S37X 2QTEA 1PYWB 2VQ1B 4ENED 1NBYB 1QR1B 3QI9D 3RBSA 2D31B 1PKQB 1R3JA 4EDXA 1UVQA 4WY7H 3DSFL 4PLJC 3JTTB 3VXMB 2VLJE 4ELKB 1OARH 3QXDB 4ZXBB 1J1XH 3G5ZB 4X6CA 3OB0H 5KSUA 1DN2A 1KYOJ 3A6CL 3L9RB 4G7YH 5F9JB 2VABB 5JLZA 4HS3B 3IDUA 5C0AE 2CMRL 4KTYA 3QFJE 3QG6B 4NC1C 2EH8L 1IQWL 1LDPH 5EA0H 4TQEH 3LIZH 1IM9D 1EO5A 1XR8A 4WWKC 2BERA 3IJHB 4J4PA 1IEBA 4MHHG 2DJUA 2PTTB 2BNRD 4Z7WF 1IKNA 3FFDA 4LHUB 1S8DA 4J1UB 2MJWA 5E0QA 5GGSY 2D03H 3OF6D 1MI5A 4JHZA 1D3CA 5CKGA 1GZPB 1QSZA 1XGQA 4L29B 3IU4L 2YUZA 5HXMA 5CP3H 5DK0B 3VFRB 3VMPA 4PJXF 3T0XA 5IMOA 3LQAL 1SBBA 2V5TA 5ID1A 4OCWL 4PJIA 2BNQE 1NC4D 3GBML 4LDEB 3B9AA 4GO6B 5D96C 1LEGA 3ECBB 4IMKC 2X09A 1OTUD 3MMEB 2OX5A 3ULSA 5KTEL 2GK0B 4X7TB 3RZCC 3DBXA 5CKAA 5I76B 3NOIA 5F7MC 4ZUSA 3GSUA 4NO2A 4JHAL 4JPVL 4U31A 1S9XA 3WIFA 5ADPH 3V4UH 3MRLB 3MBEC 1NL0L 4M5YH 1KPRB 5LGHH 1IGCL 1B0GB 1NCBL 2EC9T 2NY5L 3V5HA 3VXRB 4LLDB 4XP4H 4OLWL 4I18A 4MLIA 3HZMA 4JJHA 3AY4C 5A2JH 3RGVA 1VACA 4HUVA 3HNTL 1L0QA 5T1KA 5CWSB 1CFNB 3SGKC 4BZYA 1UB6A 2XG4A 1PFCA 3BPNC 4PJAB 2GJ6D 3UJTL 3FB6B 4RGOL 5I1EH 2GY5A 3SE3C 4M1DL 3AS1A 4LLAA 5TF1L 2XT1B 3RKPA 3L7FA 5T1LB 2Y07L 4NN5C 2CD0A 1X44A 5JHDE 3O3BA 4Y5XB 2JCCB 5BV7B 3V5DA 5KW9H 4BH7A 1I7UB 5GXBB 1DDHA 5SV4A 5LKNA 2EZ0C 4J3WA 3OGCA 3IDJA 4U1NA 2APBA 1Q94A 4YPGA 3U7WH 4NN7C 5KAQG 5DDHA 1NANH 5E5RB 4K07A 4OQTA 1I1YA 5DD6B 4LASL 4ZG1A 3TPUA 2UUDH 2Z93A 3LQAC 5D8JL 1IAIL 2BVPA 1J88A 4NUGH 1I3GH 3HUJB 5IVOA 5DMKA 3VFNB 4NGHL 4OFDA 2CK0L 1T6VN 5MI0C 1KJMA 3RA7H 2J1KA 4K7FA 3UO1L 2O5ZL 4YDLB 1FZJB 3DX9A 5MHSE 4LSSH 4JR9H 3C8KB 1SVZA 1G6RB 4AMKH 4JQIL 2VDKH 1J0HA 3MUGB 4OCMC 1MFBH 4DQOL 2ZZUT 4PRIE 3NBNA 2NY5C 4XHQA 4XZUA 4ZAKD 5I1KH 1QEWB 5KS9F 3WEXB 4M8QB 1IQDB 3G6DL 5CEYB 5A3ID 2P4AB 3RKDC 2Q7NA 3EOAB 3KWWA 3TVMB 2YPKA 4IIQB 5E5UB 4HCRH 5I74B 5DHVB 4GG8A 1LILA 4M93C 3CGTA 1FSKC 2BVOA 1QKZH 4R4BA 5MEPB 5IJKA 1FAKT 3OB0K 5IF0A 2BFVL 1VENA 4FNLL 2V6HA 1NGQL 4JFQA 3OKDB 1BZ9B 3IJYB 3LB6C 1NGXB 2WBJD 1LEIB 4RDQG 3SEPA 1FNFA 3Q5YA 3WE6B 3L3JA 1U3HB 2R4RL 5FOBA 2EDFA 4OZIF 5I15H 1HI6A 3OWEA 2C3XA 1FBIL 1CG9A 1JGVH 5EZJB 3JBG7 2EDHA 4EIGB 2Z35B 1A9BB 1IM3A