2WKOF

Structure of metal loaded pathogenic sod1 mutant g93a.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
153
structure length
152
Chain Sequence
ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDAVADVSIEDSVISLSGDHIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE DISMUTASE [CU-ZN]
publication title Structural and Biophysical Properties of Metal-Free Pathogenic Sod1 Mutants A4V and G93A.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 152
sequence length 153
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2wkoF00
4A7GA 3QQDA 2Z7UA 4FF9A 2AQPA 5KBMA 2ZKXA 2XJKA 3KM2A 1SXNA 1QUPA 1SXZA 4OJAA 1CBJA 1COBA 2ZKWA 4OH2A 3RE0A 1IBFA 1Z9NA 2WWOA 1OALA 1P1VA 3ECVA 1XTLA 1SDYA 1SXSA 3GZPA 2GBTA 3HFFA 1SXBA 2WKOF 3CQPA 3L9EA 2WYZA 1N19A 2WZ5A 2VR8A 1S4IA 1U3NA 1EJ8A 1YAZA 1FUNA 1YAIA 3GTVA 2Z7YA 1MFMA 4L05A 4MCNA 1JK9A 1IB5A 3T5WA 4A7QA 2AQRA 3KH4A 4U4IA 1B4LA 1OZTG 3L9YA 1E9PA 3KM1A 2AF2A 1YSOA 1OAJA 1OZUA 1TO5A 1XSOA 1F1GA 1HL5A 4BD4A 2APSA 1PZSA 2JCWA 1AZVA 2WWNA 1Z9PA 4A7TA 1EQWA 3GQFA 3GZOA 1UXLA 1E9QB 2ZOWA 1IBBA 3F7LA 3CQQA 1RK7A 1Q0EA 1XTMA 3H2PA 3SODB 3PU7A 2AQSA 1UXMA 2WKOA 2GBUA 2NNXA 2C9VA 3MKGA 1CB4A 1TO4A 2Z7WA 1E9OB 3ECWA 1BZOA 1HL4A 3MNDA 2V0AA 3KBFA 2AQQA 2E47A 1SXAA 1SPDA 2GBVA 2WZ6A 2AQNA 2ZKYA 3F7KA 2XJLA 4MCMA 2AQTA 3HOGA 1N18A 1SOSA 4A7UA 1IBHA 4A7VA 2SODB 1JCVA 1DO5A 1IBDA 3QQDB 3K91A 1F18A 4N3UA 1E9QA 1PTZA 3CE1A 2WZ0A 1L3NA 2WYTA 4BCYA 1SRDA 2JLPA 1BA9A 1DSWA 1F1DA 5KBLA 4BCZA 4A7SA 5KBKA 1KMGA 4N3TA 2LU5A 3GZQA 3KH3A 3GTTA 1ESOA 3ECUA 1SXCA 2AEOA 1E9OA 2C9SA 2E46A 3H2QA 3HW7A 5CU9A 2K4WA 1OEZW 1F1AA 2VR6A 2R27A 1PU0A 3S0PA 3LTVA 2Q2LA 2C9UA 1JK9B 4B3EA 4A7GF 1SDAB 3KBEA 2Z7ZA 2VR7A 1E9PB 1B4TA
chains in the Genus database with same CATH superfamily
2DQUH 4ELKB 2R69H 5FHAL 3CFJB 5I0XA 1ONQB 4JQIA 4LP4A 4PGEB 4ABUA 2IH1A 4JMXA 2DQDH 5MHSE 5L2KB 5D6CA 5FHBL 3V79C 2V7NB 4NSKA 1ZT7A 3BN9C 4KXCA 4UILL 5AALA 4LCVA 5ICYA 3QZWG 1L6PA 2I7SA 1NGPH 3GMNB 2APBA 3ZDZF 4MXQC 5IB3A 1KULA 4RNRB 5JDSA 3S2CA 2OMZB 3WDHA 1E4WL 2LU3A 3P2DA 4LKCB 4KWUA 1O9WA 2A77H 1J5OL 3PWNB 4YPGA 3EOTH 5KOMC 4AITA 5CJQL 2YMXH 4ZUVA 2BSSA 2KKQA 3QEQD 4JRYA 3NVQA 2VLJA 1ZLSH 2IVFC 3WNOA 4O2FA 4FL4C 3VFPB 3KBHE 1X5GA 2NW3B 1X5XA 1BEXA 3IT8D 1M1XA 4NWUL 4PHZA 4BZ1L 3NRQA 1N0XH 3BVXA 3MAWA 5DO2D 4C83A 3ULUF 1P4IH 1QG3A 3QEQE 3RZCA 1IBGH 3D0AA 3K2IA 4PJGA 4F58L 4HOXA 2JJUA 3MA7B 4RQQB 1FNEB 2J12B 5CGTA 1D5RA 3SDDD 3P0YH 3SBPA 3LNIA 3RJDA 1BFVL 1RL1A 2KQMA 3HC3L 2WZPD 3BWUC 1A2YB 1MN4A 3RRQA 3KGUA 3TBVA 5J1AB 2E8ZA 3MA9L 4HALA 3O6KH 4ZUTA 1YY8A 2W65B 2OMUA 2BFGA 5HYSB 1WJ3A 5HYJB 1HHHA 4GB9A 1DO5A 3KVQA 1OGSA 4FQPA 4HUMB 4TVPD 1JVKA 4P4RB 5JW3L 3MNZA 4RRPA 5CO1A 3LH9A 2IH1B 4LSVH 5K1JA 4CNIA 1NCAH 5D6CB 4Y1SA 1DL7L 1X5AA 4OM0L 5C08B 3VSVA 3ZMRA 3ULUL 2WSDA 1WSST 2QTEA 2XV2A 3ATBA 3CSGA 4NSKB 1ZT7B 4MNQA 4FFWC 3WI9A 3HUJA 1KPUA 1G0XA 4IU2A 5K9JL 3TWYA 3SE6A 1EXHA 4OFKA 3GXUB 3EO1A 3EO9L 3BISA 3EJSA 2KI6A 3ILPA 3SBWA 3O6MH 3ZTJG 1F4YH 1SEQL 1XAKA 4H0GA 5IB3B 2YBGA 4NKOA 2BS9A 4Y9BA 2Q1EA 3V6FA 5JDSB 1GR7A 3E8UL 4APQD 1WD8A 3QDMD 1G1CA 2IQ9H 4M1GL 4OLXH 4PRPD 5E6ZA 4QHKJ 3ZDYF 1IKOP 4PWHA 3HNVL 5C0FA 4TLTA 1J1OH 2WXLA 4YPGB 4AL8H 1OF2A 4DKFH 3B3BA 4PBDA 3KPQA 3L1GA 1NAMA 4ZUVB 4XPHL 2BSSB 5KBMA 4JRYB 3QDME 3KM2A 4Z3FA 2VLJB 3DHMA 4K5OA 5AAWA 3TVMD 1CWVA 1HZHL 1SXZA 4O2FB 4YK4B 2APWA 2ZXBA 2NQ3A 4EEEA 1O5PA 2FLMA 3NIFE 1FP5A 1M1XB 2ZUXA 1KJMA 2ISDA 4PGDA 3WS3A 4C83B 1WUZA 3OKDA 3PFUA 4ZMWA 5JW4N 3GUTA 1CICA 3RZCB 2DQCH 4PJGB 2V2XA 4DPCX 3T0DA 3VDBA 1F4XL 1FZKA 4GG6E 4POUB 4KVCL 5AYUH 5GRVK 5GZNC 5DUML 3B37A 1VCAA 2IJ0C 4JVUA 5KS9A 4PBVC 2W5PA 3ZKMD 4YPJA 3WUWA 2EXTA 4WKXA 5D1XC 3TBVB 1HL9A 5F0PB 4ZUTB 4KK6C 3GMMA 1YY8B 5B3JE 5I75C 3V0DA 2FEDD 2OMUB 1FNAA 1GKEA 2OXGB 5FO2A 4ETQA 1HHHB 3G6AA 3FZUD 1BECA 4GEIA 5CBEA 3GDBA 2EYTA 3O45A 4CNIB 4QTHA 1J88A 1B2WL 3PV6A 3KAAA 3AB0B 4UT9L 1UQSA 4ANKA 4MNQB 1OGAD 2PR9A 5FYLL 5A40E 3HUJB 1KPUB 4IU2B 4MA3A 1QBLL 4N22A 3CLEL 3EO1B 3ILPB 2PO6A 3KJ6L 4OD3H 2ZICA 2TSBA 2UWEE 5F21B 4X0NA 3BLBA 4PJ8D 4AGNA 1H3TA 4NKOB 3K3QA 3V6FB 3NCYP 1OGAE 1OP5K 3MJ7A 2J4WH 2CJUH 4H1LH 4WI2A 4QPEA 5AOLA 2G0LA 5GRJL 2AQTA 3HOGA 1FO0H 4ZTEA 3NCXA 5C0FB 5I1AA 5CWSA 1OF2B 2FTAA 2B59A 5DZNA 4WFGD 4ZXBC 3KPQB 4PIBA 2EVFA 3AREC 3VRLE 1YPZE 4OLVL 5C0CE 2LAAA 2HZHA 4PRHD 1VESA 2QMJA 1KN2H 4ECNA 4ZG1A 4FABL 5KBLA 1KJMB 4GUPA 4PGDB 4W6WB 1MEXL 3WS3B 1DANT 3SE8L 3OKDB 4AVKA 2X6CA 2YEQA 4JDVA 4GOSA 4RWYL 1CICB 3GUTB 1CG9A 4UCFA 3ABLB 1A7RL 2IAMC 4PJBA 5E7BA 4AMKL 2V2XB 2ZYSA 4LQFH 2DW5A 1BJMA 4F15C 1FZKB 4NQCD 2N0MA 4GXUN 1OP3H 1HQRA 1GZQA 4UYQA 2J6WA 3LHAA 3P11H 1Q1PA 2KBGA 1BZ9A 4GY4A 5L88H 1KOAA 1R19A 2HYMA 1QSFB 5TE4H 5KS9B 3WUWB 1NCJA 1F11A 1I1AC 3U1SL 3PREA 4BE5A 1R9FA 3GLEA 3CDFA 1EO5A 5F7BA 3SKJL 4ETQB 3US0A 3G6AB 2FT6A 4N2FA 3RNQA 1OB1A 4PBXA 5CBEB 3VNZA 4S1SH 3O45B 2EYTB 1G9HA 4QTHB 1FNHA 2YD6A 3PV6B 3RURA 5EUOF 1UQSB 2R0ZH 2IBBA 2R2BA 3DJTA 2WKOF 4MA3B 1CU4L 5AB1A 2XI9A 3OF6A 4N6QA 3LKQA 5BZZA 1ZLVK 2PO6B 4M6OH 4UQ3A 4DUXA 2K9UA 3L3JA 5J7CC 3GMOA 1P84K 1ZS2A 3MJ7B 2JE8A 2VC2B 5B1AB 4UOJA 1YYML 4TF4A 3H9ZA 5CWSB 5I1AB 2B59B 4WUUE 5GGQL 5M94B 3UTTA 1IQWL 2MCMA 2EIBA 4N0RA 5EZLA 1D7BA 3GD1C 4IGBA 1A5FL 3MRBA 2F5BH 1MCIA 4M93B 3HB3D 1NCGA 3TX4A 4GUPB 2VN7A 2C34A 2Y5TA 2CO4A 2BIIA 3V4PL 2L7JA 1UM6L 1MW2A 1XH0A 4JDVB 2XIBA 4DP4X 1CG9B 4PJBB 2AK4A 4HIPA 2WSPA 4IOFC 2G0KA 5INCA 4UUJA 3MRRA 4LNVA 1QBBA 1HQRB 1GZQB 1E50A 1S9WA 4YSRA 3UAEA 3MTRA 1BZ9B 2QPSA 3SD5A 2Q3XA 1SVCP 2Z92A 4HD9A 3U7WL 4TSAL 2DQ6A 1F11B 1T1ZA 1B90A 4HJJL 5C7ZA 5CN2A 5D93C 3FFCB 4NJ9L 1OHQA 1CFTA 3HJ0A 3RNQB 3MRQA 2VRAA 3BGAA 4PJDE 4YH6A 3UTQA 3O41A 4ZSOA 4JM2C 3VWKA 1R24A 4U6TA 1EK3A 5A2KH 3NDYE 3GIVA 4LGPB 4NZTL 1I3GL 4YOKA 2R2BB 3T09A 3GHEH 5I1EH 1T7ZA 3Q44A 3TN0C 1H6UA 4N0YH 3QXTA 2A9MH 4ZPVA 4UQ3B 2V3FA 4U6HA 2LTQC 3CIQA 3L3JB 4AW4A 2FSDA 3HAEG 2MTPA 3K5RA 1T21A 4B3VA 4LRNH 1NIDA 3ML9A 4ZTOH 2EZ0C 5ACZA 2M83A 5AKTA 2J55A 2DD8H 1KIPA 1UOLA 3QORD 3R8QA 1UZ6E 4J6RH 3UTTB 3B5GA 4WHTA 2Z8SA 7FABH 2TSAA 4HOZA 1E6JL 5EZLB 3PGFH 4IGBB 3MRBB 4U1KA 3LRHA 2DY2A 4JRXD 4S1RH 2DJMA 4RSVA 4GRMA 5HYQA 3O9WA 3JSSA 2HLAA 1QRND 2Y5TB 3KXFA 4MXWH 2K7QA 1AZZC 3NJLA 3U4BH 4X6CA 3RVWC 3ASOB 4KV5E 2AK4B 1OP4A 1YJDH 5INCB 4KFMA 4UUJB 4N0UA 1NC4A 4GS7B 1R34A 2VE6A 2HFTA 2F19L 1DJIA 3Q13A 4H0IA 4NCC2 5MERA 1QRNE 5JQHC 4KKLD 5BRZA 2NXZC 1S9WB 3UCQA 2GEEA 2R1YA 1TO5A 1A1MA 2IDTA 3IDXH 3QUMH 5IHHA 4KK5D 3NQKA 2Z92B 4H26A 3ZZ1A 1GHFH 5T3ZH 2H5UA 4MAUH 1UOWA 1Z7JA 5GJTH 1T1ZB 5FHAH 1BXVA 3UMNA 5J1SC 4A67A 1FZMA 4CILA 5F3FA 4M56A 1UB5A 1CFTB 2X0VA 2P5WD 3DYOA 4NFBA 5C0BD 2ZYHA 1XF2A 2NY2B 1U8LA 5GGRA 4ENEC 3MRQB 1U6AL 5I6OA 3UTQB 3O41B 3QEHA 4ZSOB 4A2MA 2AQSA 1BYPA 3VWKB 5EEVA 1R24B 2WBJD 3GIVB 3LMJL 4R7NA 1TR7A 2EC8A 2HRGA 5ERWA 3UH8A 1X4XA 4OJEH 5D96C 1KCVL 3TYGL 4ZPVB 4I2XA 1BAWA 3BUIA 4U6HB 2H3KA 2VDRL 4OZGE 2CHXA 1F3DH 2EDKA 4JFDA 1GMIA 1T21B 4Z3EA 1ORSA 1D5IL 2QKIA 3T0AA 1CPUA 1L6XA 3TH4T 3BFWA 5ACZB 5M95B 3CSBA 5AENA 1KIPB 4JHUA 2WO3B 1EO8H 3FU8A 5HJDA 3VG0L 5I2IA 3D39D 3GBLA 1FO0A 3I85A 1SEBA 4KJWC 3CZKA 4WHTB 4FQLH 1U3ZA 1RSFA 1RURH 5IUSA 1NCBL 2VH5L 5EWIL 1XL6A 4PUBH 4U1KB 2EH8H 5CP7A 5HI4C 4YE0A 4GRMB 3D39E 4U7KA 5HYQB 1E7VA 3IF1A 3KXFB 1WBYA 2CPCA 5F44A 1WGVA 2ED6A 2ZONA 3BZ4A 5F0MB 4LVNC 4X6CB 5G4NA 4PP2A 4G8EA 5AWNL 5D55A 2ZUTA 4N0UB 1NC4B 1HIMH 4FYSA 3L3HA 2J8UE 2WKLA 4NM4L 3Q9QA 1HH9A 2AXGA 1XDTT 2NZ9C 3G04A 5MERB 2H1XA 5BRZB 1PDKA 2R1YB 5IFAL 1A1MB 4PWEA 3UO1L 3CFKA 2AFNA 5AQ0A 1NANH 1BWMA 5KANI 4H26B 4EXPX 5K5YA 4MQXC 4Z18A 1GY1A 2OZ4L 3NFSL 1FZMB 2VMEA 5LGHL 3B9DA 3ECVA 4ZAKA 1UB5B 3K81A 1BFTA 4JL1A 1XF2B 1QO3A 1JSYA 3TYFA 1U8LB 5GGRB 4LFHD 2VW4A 4LSSH 3ILDA 3QEHB 1PJ9A 4QCIA 2HMID 2B0SL 1AG0A 5KANG 1MFMA 1SEQH 4R7NB 2J1KA 5ERWB 1F2XK 1OM3L 1C08B 5ENWA 1YYCA 1NINA 4N5ED 1GGIH 3TT1L 2XTJC 3E8UH 4JB9H 1CC3A 2Z3FA 7TAAA 2CNZA 1IAOA 4I2XB 1UCTA 4GINA 1OP3K 2HTKD 2F53B 4BXVA 5IG7A 4PLJD 4JKLA 3BIBX 1NFIA 4JFDB 4BD4A 4YDLC 1ORSB 3EJPA 2ZAHA 2E4FA 5C09D 5EBMA 4BWUA 4FI7A 5I2IB 1KZYA 3FSZA 3M46A 5AVRB 1KFAL 1FO0B 1SEBB 2Q2EB 1TPXB 5AVSB 1U8IA 2WGNB 4IRZL 4PEEA 4MAYC 4TNEA 2BVEA 3BZEA 1KCRL 1E8ZA 3U46A 5CP7B 2GJZA 2P7TA 4HZ1A 3SKUD 2FQEA 2WUBL 5C09E 4EN3C 3MV7E 4JG1H 1BZOA 3IF1B 1WBYB 2OKMA 3K8LA 5KSAA 3BZ4B 3AVEA 3QHFL 4NRXB 4R7DB 3FQNA 4KNUA 4PP2B 2XFXA 3ZT5A 3LQAC 5E4IA 1QW8A 3L3HB 5K9QI 4G6JL 2Q7AA 3PYCA 5D1ZA 1HH9B 2AXGB 3QZPA 3G04B 4A6YH 5IVZA 4FKKA 3IKKA 1ZE3H 5T5FL 5J6SA 1IBDA 3VWJD 4OTXH 1PDKB 3J27A 5I6XC 5JIIA 3CFKB 3EGDA 1ZHBA 4YSCA 4HPOH 4XBEL 1DFBH 4NQXA 1GW6A 1KACB 5GSVB 3RIFF 3UP6A 2Y2WA 4S11A 4I0KA 4JVWA 4ZAKB 1QO3B 3TYFB 4QXWA 3B9KD 3WKNA 4NFDA 4YXHH 2QHRL 4YBQC 1LDSA 1MFEH 2EDNA 1G7JA 1PAZA 2DQTL 2VR6A 1YMHA 4QCIB 5B38G 1AMYA 3SPVA 4N26A 4K2UH 1JV2A 3PIQA 5ENWB 4AENA 3GMRA 5AB2A 2FX9H 3GHBH 4CN4A 5E08L 3TA3A 4NN7B 4B6ZA 1U8QA 1IAOB 3V0EA 4KTEH 5L2KD 5DD0H 5BS0A 3L3OA 5IG7B 4NN5C 1KWKA 1MF2L 3L5WA 5CNHA 1NFIB 1A6PA 3FHEA 2LLGA 5SWSA 3WFCL 1NCTA 1NPJA 2AK1H 2WUCH 2BNQE 2X2JA 3L6FA 4QOKB 5EBMB 4MRCA 4NKIH 5L2KE 2RGSA 1NKOA 3MGOA 4HEME 4QRFA 3SQOL 1F4AA 1U8IB 2VDMB 4AIOA 1AQHA 5TH2A 1MEXH 1FFOA 5FYJD 1OSYA 3SE8H 1U3HA 5ALBL 2GJZB 2P7TB 3O81A 3BHBA 4HJ0D 3U46B 3S3SA 1JJUA 2X4NA 2KPNA 5KSAB 2WN3A 4A7QA 2UZIH 1X3DA 4HK0A 3Q8AA 1PZUB 3FQNB 3H4FA 5FYJE 5KSBB 2CR0A 5D1QB 2W95A 2XFXB 4JPVH 3RJQB 2VXVH 4BHUA 1AQ8A 3MXVH 1JXGA 1UZ8A 5D1ZB 3ZE0F 4DGYH 5FUCE 3S4SG 2JLLA 3MRPA 5ELIA 1IARB 1MAKA 4PJXE 4N90D 5DWUH 1RUKL 1V10A 1E27A 3EGDB 1CIUA 1IC5L 1ZHBB 4Z7QB 1HI6A 2BSCA 1TJHL 4NQXB 4DO6A 4G80A 4LP5A 4OCSL 3EADA 4RGMC 3K6OA 4ZTPL 4FA8A 4L23A 2OS7A 1CGWA 1CDHA 1MFDL 2NTFB 2Z7WA 2D8KA 4MJ6A 1TTRA 3SKNA 4MZ2A 4NXSA 5DC0A 1YMHB 4MA1C 2JB5H 1DBKH 5TPWH 4YVNA 1E5ZA 3O0LA 3SPVB 3T8VA 1PLCA 1JV2B 3PIQB 4AENB 3GMRB 4MWFA 5GRWA 4OB5H 1NMCC 2VN6A 1L9RA 1G1OA 3KPRB 3MRIA 3NJIA 4KHTH 2ATPA 1U8QB 4J2XA 2WAQA 1RQ5A 5BS0B 3L3OB 1ROWA 1RULL 3CSTA 1MLBA 3L5WB 3WIIL 3MRCA 1C8QA 4AQZA 5CLZA 5SWSB 3VYPA 3QR1A 4Q4IA 5IQLA 4MDJA 5IHBA 3L6FB 3IJHA 4M6NH 3JWNE 3MGOB 2XN1A 4BBWA 1JGDA 2DICA 2IOIA 1QI3A 2XVGA 3PAYA 1FFOB 1TZGL 3MLPA 2VQ4A 1BQLH 3BHBB 1MCPH 1SHMA 3IJYA 4G7QB 2X4NB 1MCBA 4F8PA 3STZA 1A6VH 4HK0B 4JRYD 1WWCA 5LNGA 3M7FB 5KSUA 1XT5A 2VLJD 3T04D 1E7UA 1NEPA 3BPLC 2J7LA 5BRPA 3IDJA 1BAFL 1UZ8B 3MRPB 3BGFC 4H40A 1NBQA 3OKOA 1CDYA 4HUNB 3PWPE 1E27B 5CLWA 3RZCD 5GS2D 2VLJE 3B3IA 1A7OH 5BOJA 2YFOA 3FHAA 1HI6B 1W8OA 2XVKA 1XIWA 5DUJA 1K4CA 4G80B 5DK2A 1WS7A 2ZWYA 1D9KC 4K9EH 3IM1A 1L9MA 2IALA 1AQKH 4ISVA 3AG2B 4PB0L 4MJ6B 4ELMF 1I3GH 4PJGE 3SKNB 3DK2A 2PYEE 1H6FA 5CJXC 4GLRH 2DIBA 2VERA 1EX0A 4HS8L 4AZ8A 1FLRL 2M8XA 3MLYL 2FJGB 4FQ1H 4MWFB 3MCYA 3NFNA 1FAIH 1JNLL 3EBGA 4C54A 3MRIB 1NA8A 2ATPB 2APTA 2JCWA 4TNGA 2X0UA 3UZVA 3RQ3A 1E5YA 1MLBB 1T89A 2EH7L 3MRCB 4G5ZL 4MNQD 4E42A 5LQBH 1KGJA 1S5IH 4JFUA 1NQBA 3BAIA 1M2VA 3ZT7A 4MDJB 5TGBA 3HR5A 1AZCA 1NUDA 1TITA 4EVNA 3UL4A 1RZJH 3G6DL 3PHQA 1HDMA 3VGAB 1JGDB 1YEFH 4D0BA 3BD3A 3DKHA 2D0FA 1IC0A 3HUJE 3Q8EA 5F8RC 4WU7A 3TT3H 3IJYB 5ACLA 4V2CB 2EXWD 4EBQH 1UKQA 3REVA 3RGVC 4JO2H 2CO6A 3STZB 3VA2C 3IN2A 1JZ3A 4OVVA 4F3FA 4PWKA 1DBMH 5KSUB 4NYLA 5D2LE 2F7PA 4LDCA 3SB3A 1Y0LA 3NACL 3HRZA 4LHUA 3VACA 3E9UA 3IDJB 3ZSSA 3F7RA 2HG5A 4JW3A 1UD3A 1XGPA 4MB3A 5DQDH 3OKOB 4BCYA 4K15A 1YNKL 5EDSA 1CICD 1E5UI 4A6YA 3B3IB 4BXSV 2V2TA 2FHCA 4ZK8A 1K4CB 5DK2B 1HH6A 2IALB 4KK8C 2FSEA 4OIFA 2CLVA 4ISVB 2DBJA 5DD6A 4UQ2A 2AJZB 3FH8A 5KVFL 1XCWA 2GAZA 5BXFA 3WYRA 3X3GH 4CMHB 4DFHA 4PJ7A 4AZ8B 1KC5H 4A68A 4ZMNA 3SE3A 4H13C 4GJTB 3WSQH 4YDNA 3J7HA 3NFNB 4FXKA 4KHXH 3TV8A 3S3JA 1Q90A 1AQMA 3UZVB 5F89B 5A2BA 4MRBA 4UB0L 1HHGA 4E42B 3QQ9C 5CGYC 1D2PA 3DUSA 5AZEL 1JWUA 1M2VB 5D2NC 1YZZA 2WO2B 1INDL 3HR5B 4EVNB 2PO6D 4G2AA 3PHQB 5HD8D 1HDMB 5LLIC 1IZKA 1D7DA 1UD4A 1YAIA 2XSKA 4XI5C 4Y8AA 3IPBA 2ORBH 3LPFA 4U4BA 2WXQA 4WU7B 1BJ1H 1IM3A 1UWGH 3SD2A 2Y7LA 2HFEA 2Y3AA 4FQHA 1RIUH 3O2WH 5A6MA 1MVUA 3REVB 2CO6B 2W07A 1BGXL 4F3FB 4GMTH 1IL1A 2DH3A 4NYLB 4WU5A 2H6PB 1YG9A 4UZSA 3D4CA 2JKIS 3LVEA 1Y0LB 3HRZB 4HCRL 4LHUB 5IFAH 2XV0A 1V7NL 2HG5B 4F9LA 1PEWA 3B9AA 3BO8A 3FF8A 1OE1A 4GP8B 4PP1C 4Y4FC 2D9CA 3I6KA 2X6BA 4AVIA 2YAMA 3LH2L 1OV8A 3JTBA 3GS0A 1KTLA 4A6YB 4AQEA 4RIRA 3S88H 4DPAX 1CBVL 5DJXA 3WN5A 1EAQA 1X4ZA 3MQIA 1HH6B 3JVGA 4G3YL 2FSEB 2CLVB 4NZUH 2HT4C 4J3OF 3CU1A 3PF2A 4JPWH 4UQ2B 1SXAA 4BH7A 2GBVA 4YZWA 2GAZB 1WVZA 1MRFL 4J4PA 5BXFB 1JYWA 3FUHA 2VMCA 4F8LA 5I8EA 1A6WL 3QJQB 1AR1C 4PJ7B 1FL6A 5JHBA 3UTPD 2WLHA 3Q43A 5EBWB 2EDEA 5AL0A 3SDYL 4FXKB 3JZYA 2OP4L 4JJOA 4PG2C 3F58L 3MACH 4WEMB 2YARA 2DKSA 4KI5C 1WD9A 1XGZA 3UTPE 4MJJA 4Z7OF 2NZ1A 1HHGB 4AQOA 4FTDA 4I1PA 3DUSB 5J1TC 1JWUB 4GAJL 1JZ5A 3OF6D 1FYTE 3W2DH 1SN0A 5DWPA 4EOWL 1ZT4A 4HFUH 1XGUA 5C0DA 2CQVA 2X09A 2XZAL 3EKCA 3QI9A 2WY3B 1SM3L 3I2CL 4F24A 1W72H 3WFDH 1IM3B 1INEH 3KEDA 2PPEA 2HFEB 2ICEA 4FQHB 4J6IA 3MODH 4WW1A 2Y07L 3SYAA 1MVUB 4M6AA 4G6FB 3UTTD 3SHSA 4LIQL 2VITA 1KIUA 3LN9A 1IL1B 4WU5B 1WEJL 3RKDC 2IPTH 4IGBD 5I16A 2XY2A 5D8JL 1NEUA 5DLMH 4Q6YA 1UM4H 3BO8B 1KTDA 2ITDA 3IDMA 3I6KB 1SXSA 2BHZA 4AQEB 4XNXL 1KTLB 4FNUA 4X5QA 4RIRB 5FOJA 1NFKA 5DJXB 3WN5B 3HHSA 2V9RA 3LHPL 1QOKA 4P05A 4HSAC 3G5WA 5T1MA 2DYPA 4M5ZH 4CL7A 1JK9A 5DEFA 2R0WH 4KKCD 2IQAA 4M3HA 4ZOEA 4BH7B 5EU7E 5J3HC 2OCCB 1BVZA 2G4GA 2X4TA 1NICA 5I8EB 1I8IA 2FCBA 4ZI8A 2IWFA 4JHBA 2V8MA 1FL6B 4MJIA 2APSA 1RIVH 5LVEA 2ZCHH 5JIQA 1FV1A 2O5XL 3DWTA 5EOCH 2NY2D 4NKQB 1MNUH 5I1LA 3ZOAA 4K3HA 2K9FB 3MUHL 3SGEH 1FE8L 2X0WA 2Y4SA 3VWKD 2OMNA 3GSNL 4UAOC 4ZFZA 5EOCJ 3N04A 4X4ZA 1DVYA 4XVOA 2VABB 3VGBA 2UX6A 4HC1A 3MKGA 1IQDA 1TJMA 2DMHA 4PW3A 4AV4A 4YXLH 3O8XA 3ASNB 2GTWA 1W15A 5D7JC 1ZT4B 5C0DB 1XGUB 2K45A 2D31A 1LXMA 4PJFF 1EEUA 1O6VA 3QI9B 1MIEL 5FWQA 4WGWB 4DERA 5E1QA 1IJNA 1DEEA 1SOSA 5IGXL 4GFXA 3ZRFC 4WW1B 4DJMA 5JA9A 4I18A 3OXRA 5D7SL 8PAZA 4WQOA 2VITB 3I6LD 4GSDL 3K72A 1KIUB 1WPCA 2YXVA 5DGQA 4FXLA 4YSAA 4R7XA 5AZUA 1OCCB 3VFMA 1K8IA 1JV5A 4OM1H 3ISRA 1JYXA 2V3DA 4LVOB 5K1VA 3IVKA 4G72B 6PAZA 2BY2A 1KTDB 2CLRA 3O9WD 3KXFD 2CRMA 2ITDB 3IDMB 1RSYA 4QHKI 3QIBA 4WEEA 2KLSA 2E7LC 3MUUA 3O6LL 2OFQA 5IW1A 5BZWB 5I15H 1NC4D 4ONHA 3SCMA 2RIKA 3HHSB 4K8RL 3VQ2C 5DO2C 3CDYA 1RCYA 1PSKL 2F8OA 4XODA 5T1MB 4EIBA 2DYPB 1NTDA 3L3GA 1JK9B 3PL6B 5DEFB 5BRZD 2IQAB 3FB5A 2ENYA 3IWUA 4X6CE 2NRDA 4W9KC 4Q6IC 2GPZA 4U1SA 2BH0A 4N0UE 5LWYH 1I8IB 4LSPL 4B41A 4J3SA 3V9FA 1JFQH 4F2FA 1PQZA 5LO7A 4MJIB 4MB5A 2IWEA 2BJMH 3U79A 5BRZE 3QW9A 2G5RA 3QRGL 3MZTA 3Q5OA 2WVTA 2X44D 3W37A 4R90L 5I1LB 4JN1H 1CVSC 4BK5C 2CSPA 2AJYL 1FG2A 1F00I 1JXJA 3C60A 2DQEL 1Q9KB 4ZFZB 1CF8H 3WTUA 4FQJH 5FYJU 5AZ2H 3G9AB 2A1WL 3GT6A 1TNNA 3UG5A 4WV1A 1PLGL 1IQDB 1WG3A 1WBZA 1QI4A 3QCVH 2GTWB 3CFCL 2D31B 1C5BL 4BK8A 2Q8AH 2R8SH 1AFVH 2G2RA 4JFDD 1BM3L 1GGBH 1GZHA 3LRGA 3KM1A 1J48A 3A24A 4WO0A 2H1PH 4B0MM 1DEEB 1ZEAH 2CA3A 4I2XE 4K71C 1OCRB 4I18B 3OXRB 1LDPH 4H5SB 3ZDWA 4APQC 4ALAC 1N4XL 3K72B 3KCWA 3CMOH 1G4MA 2Y7QA 5T3XD 1KENH 4M43L 4OF8A 5IJKA 3VFMB 1K8IB 1JV5B 4TULH 1KYAA 1PY9A 2QSTA 4DP9X 5A2IH 3IVKB 5J11C 2CLRB 2ROXA 4XVJL 4LMQE 2ICWJ 2GJRA 3HZKA 2OMBA 3EJYD 3QIBB 4LDOB 1J0HA 4TPRL 1CTNA 3TVMC 5IW1B 2IDSA 3CFIC 2QSCH 4ONHB 3SCMB 1DBJH 1AAJA 3CXHK 3OR6A 5T1KA 1TCMA 3AY4C 3L3GB 4HZAA 4ZW3A 3FB5B 5C3IA 4FDWA 3PAZA 4U1SB 4KUCD 1L0QA 3TIEA 1Y07A 1PQZB 5CSGA 1JZ2A 5E6YA 4ZAKD 2AMGA 4H1LG 3MGTB 3VFUA 1SJVA 2PNDA 3ZKMC 1NL0L 2YC1A 3DRTB 1ACZA 1HEJC 3ULSA 1IGFH 1FG2B 3CH1A 2WWKT 4MCYA 3AM8C 4OFQA 3LH8A 3NEOA 4BDVA 5DHDA 4W6XB 2KMWA 2C4FU 1BVKA 1WBZB 2TAAA 1EHXA 2BO0A 2CZNA 1EBPA 4QXVA 2CGZA 2CIKA 2YR3A 5HYJA 1WHPA 2G2RB 3DBSA 4F9PA 4WSJA 2ZZUT 5LKNA 1T03H 4ZMAT 2W91A 1QZ1A 3HLAA 2A7BA 2YQGA 3EAKA 4MD5A 2HN7B 4CVXA 3BVTA 1W72A 5E8DL 5DFAA 3F6IA 5H8DA 4OGXL 3BE1L 5AVTB 1QZNA 2Y7QB 4MB4A 5DRXA 2MCPL 2QLYA 2JKLA 1G6VK 1AIZA 4M8RA 5FGCB 1IKFH 1VA9A 2CNYA 3FUJA 3H7BA 3O2DL 4PJIA 3QA3A 3E2HC 3HZKB 5KSAD 4AUUA 1AVAA 4ZFGH 4JG0L 1UH2A 1I9RH 1IIKA 1BQHA 3IJSA 3BZFA 5DQJA 3RPKA 3B2VL 4LOUD 3APFA 4HWBL 5JHDE 3NMEA 3UMTA 2WW8A 1YRKA 3OR6B 5D1ZD 5T1KB 4EIGB 3BSZH 4M3KB 4PI2A 3GBML 1CGVA 3EG9A 3ECQA 1G6RL 1U8PA 1F1GA 3QUXA 3OGOE 5MI0C 3KL5A 5J9PA 4TTGA 1JZJA 1UGKA 5I76A 2RQ8A 3LYRA 4XCFH 3T6WA 3TIEB 4AVHA 2YAHA 4M00A 3WV0A 1JI1A 1ODUA 4D9QE 2GUYA 4K94C 1QD0A 1W8NA 3OQRA 3BAKA 3BD4A 4ZODA 2ZJSL 3RWHA 3VFUB 3WD5H 2YC1B 8FABA 3ZDXE 3ULSB 5LB1A 4S1QL 3GINA 3KCPA 3CH1B 1E4KA 3X3FL 4MCYB 1N64L 2G30A 4BDVB 3H3PL 2EACA 3EFDL 1E6OL 2QPUA 1MCRA 2DQJH 3IAGC 1YQVL 1BVKB 3GI8L 3TA3D 3MBXL 3RPIA 5BS0D 2GI0A 4FLRA 4DGWC 1PG7H 4CRPA 4HG4J 5SWSD 4N2MA 2CRYA 3LKSA 2IC2A 3FAWA 5AVWB 4A66A 3HLAB 3GSUA 2Z64C 4MD5B 4CVXB 1W72B 1IVLA 2WYTA 5BS0E 4Y16A 2EVJA 1MCEA 3DPDA 2FX7L 4YC2C 2WIMA 2YS4A 4RDQF 5SWSE 3B34A 4L8SA 3NIGF 4JDTL 5DRXB 3S37X 1U3HD 3B56A 4IMKA 1JPTH 2W94A 3QSKB 3RIFK 5E5MA 2FZ3A 5TF0A 4AGQA 4GQQA 4PJIB 3H7BB 4MS8D 3QA3B 3IGLA 1OPGH 2B3RA 2YGPA 3KGRA 3W81A 2WLKA 3SDCC 1BQHB 3IJSB 4G6KL 4NS0A 5DQJB 4Z95H 4QI3A 3FN9A 2XFGB 3UBXA 5TFSL 2LU4A 2BSDA 1G4RA 2G9HA 3EG9B 4N2NA 1U8PB 3QUXB 4GIOA 4PI0A 2CG9X 2VQTA 5J9PB 3M6DA 5I76B 4OJAA 2X1OA 2DF3A 2ZKHL 3QRFM 4Z7UF 5CLXA 2ERJB 4ZX4A 5T3ZD 4S0HA 1IGIH 4BFRA 2K1MA 4XPTH 3UPRA 2DLFH 3RWHB 3OAWA 4NPYB 1E0OB 4POYA 4N68A 5BW7C 3LPGA 3KCPB 4BHUI 4LCWA 4XNZB 3BJLA 4MJ2A 1YC7A 2ZUQC 4N9GA 4D9LL 2R2HA 2M2DA 3C6EA 4NNYA 1OQOA 4J7RA 1BBDH 3K1KC 1MAML 3OSVA 4HAFA 3RPIB 4GQ9H 1KSRA 2L7QA 5LGJA 2B8OT 1RPUA 3ZHNA 2X5PA 4TUKL 4DETA 1BVLA 1WFMA 3IS0X 3TPUA 4IQHA 2ZCLH 3FCBA 3LKSB 2WLYA 2GKIA 4I3GA 3EBIA 2HFGH 3B5HA 4D8PA 1SY6H 2F7QA 4Y16B 1A6AA 5D8JH 2D7TH 5I74B 2A6JA 1OAYH 3S96B 4L8SB 4HPYH 4FLQA 1IFHL 4I3RH 3DSNA 1N59A 3QORC 4YZFE 1MCNA 2FD6H 4XB8A 3MOQA 5E5MB 2FZ3B 2O6PA 2V0AA 1JGUL 4MFHA 5I28A 4G7VL 2WYIA 3MI6A 1AD0A 5E8EA 4UOZA 4XMZA 3KGSA 1QLFA 4XR8C 2GC7C 4NB7A 3UBXB 4WCYL 2AZAA 2NY6D 4M1CC 2VM9A 3REWA 3D1MC 2WZAA 2G9HB 1KDIA 3ZIYA 3ZE1F 3QG7H 5EORL 2EXYD 2K70A 4AYEC 1LO3L 4E41A 1S46A 3J07A 9PCYA 3PV7A 2P42B 1IE4A 1ZRUA 1XIWD 1XV8A 4GRLA 4GKOA 4POZD 3FO0L 2OR9L 3H55A 1D6VL 2ADIB 2H0PA 3UPRB 2YAFA 1JOIA 4Y5XA 4KK5C 2B4CC 4GKNA 1FFPA 3GXDA 4TVUA 2OQJA 4LCWB 3E0GA 5TJWK 4RGOL 5EOQL 4N9GB 3TJHC 2AKRA 2C9UA 2VIRA 2ID5A 3M07A 1WICA 4NNYB 1TXKA 4ODHL 4ZZKA 3MFFA 1SLVA 3MLTA 1TJIH 4FS0A 4X42A 5IBTH 4OZIA 5GHWL 1KYUA 1NANI 3WELA 1QWNA 2WBJC 5LGJB 1BVLB 3WFEL 1P7HL 3MXWH 1U8KA 3TPUB 4B0MB 1LYQA 3E8VA 5E8OA 4YX2H 3KLKA 2VXSL 1RUML 4D8PB 3D2UA 1A21A 4CJ1A 1A6AB 4XN4A 1OT2A 2A6JB 5FXCH 4L0ZA 4RWHA 1L9SA 3CFUA 2CMRL 1HINL 3HZMA 3DSNB 4JDEA 1N59B 5TQ0H 2Z8WC 2I7OA 3BVUA 3IBEA 5I5RA 1R3IH 2F1BA 1HYSD 4BELD 1AD0B 3OV6A 4F8OA 3TESA 1OK0A 1QLFB 2FAUA 4OCRL 4RDBA 5KVDL 4LHUD 1QKZH 1QBML 5KN5A 3BGMA 3REWB 1H3PH 1WK0A 4AYGA 4MJ5B 3SIKA 4XCCH 2D03L 2YOAA 3AXLA 3BSZA 1IBBA 3Q8BA 1JWMA 4E41B 1YECL 4CU7A 1JMZA 4TQIA 4DHLA 4E9TA 5I1KL 4M4RA 1NLBH 4GRLB 5LXVA 1VDGA 3RUGE 3NCBB 4ZNCD 4P4KA 2JTDA 2AEQH 1KGXA 4Y5XB 4QHLA 1M4KA 4GKNB 4YVUA 1FFPB 2GJJA 5CEZL 1CE6A 12E8L 1HHKA 2OQJB 1ETB1 4W9LC 2AQNA 1PD0A 4UQ9A 3ZTEA 3GMLA 2AKRB 2VIRB 2YAQA 3VXMA 5HHVH 2NY0B 3MLZL 1HAWA 3CHRA 2PPDA 3U6XA 2HMIC 3MLTB 2R4SH 4LASL 3L16A 4RETB 4OZIB 3WKMH 4LGRB 1L7IH 2X6UA 5EEUA 3CN1A 1U8KB 2ZAGA 2DYRB 3EH2A 4N5EC 3C9NA 5E8OB 2C3WA 5EO1A 1WP6A 3KBPA 1DSWA 1FRGL 5BO1L 1XF1A 2JNZA 4M43H 3D2UB 1OCWH 3GIZL 4PLJC 4EI0A 1OGTA 2CKBA 2JVUA 4KQ4L 2JKNA 3TO2A 1UWYA 3HZMB 5CR8A 5JOPD 4JDEB 4XP9L 5JLZA 3OKYA 1RZ7H 3T3PF 3QDGA 3H8NA 3DOHA 2B5IC 2FYVA 2O5YL 2QELA 3ATDA 4M3JA 4IU3A 4HS6A 1QSZA 1IAKA 3D4GA 4XHQA 4L4TA 4HG4K 3UGXA 2BS71 5HI3C 5JOPE 3W5NA 1MJJA 5KN5B 3QULA 1JHLH 1TQBB 4H20H 4I1RA 4NQDA 3BKYL 4XRCA 3CGTA 5I1GL 5F7EH 1SN2A 1OALA 1DLFL 3THML 3AXLB 1REIA 4ZYKA 1JWMB 3QNZA 4HA1A 1CXIA 2GITA 2CPUA 4OKDA 3U82B 4M4RB 1E5CA 3R7QA 4HX1A 1RZGA 1WTGT 3NJNA 3NFPA 1MW0A 4XP5L 4XCYB 4P4KB 3NH7H 5DUBA 1FVDA 3LN4A 5TDNA 1G7IA 5JUEH 3QC6X 2XOTA 4WI3A 1VIWA 1W0VA 5EU6A 1LK3H 4KDTC 4QHLB 4J4PD 2VWEE 1CE6B 1HHKB 1AHWA 1RERA 3HTLX 1JZEA 5ES4B 2WXKA 4A2HA 1JZ7A 1ZTXL 3GMLB 4UTCA 5B22A 3B9KC 3EYQD 2C9RA 3VXMB 4G6MH 5IHLB 3B1UA 4FG4A 1UJ3A 2E27H 4JQVA 1P6FA 1CXKA 4DQOL 2YKLH 1EQWA 1IGMH 2J21A 4H2CA 3ILEA 3LXUX 5DJCA 2VO8A 5EOTA 2PN5A 3WJLC 4AM0A 2JJSC 3C9NB 2A6IA 1DZ0A 5EO1B 3UAJC 5C3TA 3AT8A 5FPIA 1UD6A 1SVBA 2C26A 4HISA 5CJ8A 2CGRL 2QV4A 3MLWL 4D7PA 2DJ4A 3SGKC 1OGTB 2CKBB 4YGVA 2NNXA 1VRSA 5TF1L 2FUQA 3TO2B 5DVKA 1SY6A 3QI9D 4M5SA 1DBBL 2X3AA 4TLKA 3NRPA 1I8KA 1EEQA 3BX7C 1DQDL 5JLZB 3RX7A 3QDGB 2VXQA 3PWUA 2AAAA 3KD4A 5E2TH 1R5WA 3VTAA 4Y2DA 4IU3B 1CLOH 4HS6B 2P28B 1IAKB 1EGJL 3FB6A 4L4TB 4BZ2L 4E36A 3BIAX 4FL4B 3V52L 1MJJB 3QUYA 5E95B 4FZEH 3QULB 4N3UA 5FUCC 4NQDB 1KTRL 5HDOA 5CCGE 1EVTC 4XRCB 4EDWL 1V8HA 1AJ7H 2RAMA 1X7QA 1V05A 1RZQA 3ULVD 2PMZA 4ZYKB 5AEAA 5IB1B 3QNZB 1WAAA 3DJZA 2GITB 2VM3A 4YHLL 5CZVL 4HX1B 1RZGB 3NFPB 3WO3B 5DUBB 4GQZA 5GZNA 4DUVA 4GQPH 1FVDB 5TDNB 4OLYL 1G7IB 1T7XA 2DYPD 4LB8A 4RFOH 2VN4A 3DK0A 1FORH 1W0VB 1G5GA 5EU6B 3ULVE 3F84A 3BAWA 4FNLL 1CXHA 3RU8H 4FMFA 3TV3H 2ZXGA 1SLXA 1AHWB 1PKQA 4IRSC 4HBCL 4Z3IA 2OL3H 4MJID 2FWUA 3MRLA 3LEVL 4IMLA 1G1YA 1J9SA 1NPUA 4LOVA 4Q58C 1JGLH 1UJ3B 2GC4C 4Q6KA 3RVUD 5J6HA 1U2CA 5FYKH 3NSXA 1AXTL 3EH4B 5EOTB 5DJCB 1P1VA 3VI3A 1NCOA 4AM0B 2FHFA 2A6IB 2OCFD 1ZGLP 1MLCA 3JWNC 2AW2A 4P9HL 4PS4L 4BSWA 3O8XD 3KYNA 4YGVB 1HNFA 1MJ7L 5GRYA 1NH6A 2H32H 4P5MA 4QRPA 4GLRI 1JNNH 3ECBA 2O5ZH 1I8KB 4BGLA 1OM9A 5IQ9A 4Z76A 2HKHH 2K4AA 1C9SA 3TOPA 3QC5X 1K8DA 2XQYA 3PWUB 4YHKL 4AEEA 4ZXBA 5EZIL 3AREA 4H8WC 1R5WB 4TQ8A 4Y2DB 1CVRA 3FB6B 3FRPA 4LARH 3D4ZA 2AJ3A 1IT9L 3QUYB 4Y5YA 3NCJL 1S78D 2VLLA 1SYSA 3U4AA 1CTMA 1X7QB 3OZ9L 3QIBD 4OD1L 3FULA 1F4WH 3S9DB 4YK4C 1QFPA 1RZPA 4KY1H 2DQGL 1RFDH 3NPSB 4KZ0A 2WQSA 4G7SB 4QRTA 1A7QH 1RZKC 3SCMD 1OAZH 4OQTH 5AW8B 3GRWA 4HXBL 4MKTA 2QQLL 3N55A 5KVEH 3CN4A 3RZCC 2XQYK 2CBOA 5KYXB 4NKDA 1UA6H 2F8VA 3QK0A 4NZDA 4AC4A 3LIZA 3T2QA 1PKQB 2X4QA 2XA8H 3NESA 1XF3A 5F9AC 4LT7A 4U1GC 1ZKAA 3RILA 1CFVL 3MRLB 3SDAC 4IMLB 3QBTB 2ZPKL 3K5SA 4EN2A 1MJ8L 3LEYL 1SVZA 4WK2B 4E5XG 5FUOH 2AAVA 3C60D 5J6HB 3FT9A 5E8PA 2FB4H 1DSFL 4JHWL 3FNKA 4PJEA 3VI3B 2VL4A 3HI5L 1X5YA 1OTSD 1TQTA 1JRHL 1YNLL 3NOIA 1MLCB 4DAGL 4BSWB 1VSCA 1BEYH 3KYNB 2VDQL 3CK0H 3VU2A 3INOA 2XIDA 4P5MB 3DOIA 1FGNL 3N85H 4QRPB 4CADA 1J5IA 3ECBB 4KO5A 3GXNA 4RFEA 4DWHA 1FPTL 1IAIL 3B2XA 3D0VA 5GRUH 4Z76B 5IQ9B 2B14A 1K8DB 4ZXBB 2AVFA 4XVUD 2XWXA 3GKWH 4XXCC 3V5KA 2X9XA 3AREB 4WGVB 3TONA 2XPYA 1RU9L 2ZKXA 3T1FA 1DVTA 5SX4H 2AJ3B 2NY1C 3PXJA 4PMFA 4OH2A 2ZKWA 4NUMA 1GOHA 4Y5YB 1WFIA 3U9PL 1LO3H 2VLLB 3HE6C 2AQ1A 3ARZA 1SYSB 2PXYA 4OCLC 3LQAH 5TE7H 1IBYA 3C5JA 5AAWC 4GRWB 1P4LA 1SXBA 4EZMA 4F15B 3GMQA 5EEZA 4NQTA 4QRTB 3T1FB 4HAKA 1T04A 1YEKH 3Q1SH 4XVSH 5T1KD 3TU6A 3QEGL 1I7RA 2PWGA 3KPTA 3S36X 2F8XC 3ZE2F 5LBSH 2ZX8A 4U6VL 1YLBB 4NKDB 1S7XB 1ZSDA 2J20A 5GGTH 4KY2A 3V6OE 4N8PA 1NUFA 4UANA 3D69A 2X4QB 3JYBA 4NBZB 3FMGH 4N4YB 1QHQA 3TXAA 1P1ZA 4XMUA 2P5EA 4CUCA 3ELQA 4ZD3L 3X1EA 3KYOA 4PJAE 2PCXA 3CZNA 5AAMC 5L4MA 2DLIA 1FWXA 4LSRH 5E8PB 2XETA 2VXSH 5C6WH 4PJEB 3IB4A 4FLSA 2FDBP 5BVPL 3NJJA 2VDPL 2MOGA 3TN0A 4YDIH 1N9PA 5HTSA 1MUJA 4YHIA 2CMRH 4FADA 1NFDF 4LSTL 4M6ML 4HJIA 3ARTA 2OTWA 2XWBA 2J1XA 5I6NA 4CADB 1TZ8A 3APMA 4XP1L 4B9CA 3P30H 1WISA 1HESA 3M86A 4ONOA 4GG8A 1TYJA 1WBXB 4FQIH 3D0VB 3DTDA 3JV5A 3OX8A 1NGQL 1OSPL 2SODB 4JRLA 4NP4L 3V5KB 4P07A 3N42F 2WXNA 1FC1A 3DPBA 3UJIH 1L3NA 4JGJA 3CFDA 4HAGA 2PLTA 1YMMA 2G2NA 2NNCA 2CK0L 3FYIB 4NOBA 4PN6A 1A47A 2G4EA 4R5XA 4XNYH 3GJFH 1H6TA 4BFGA 3C5JB 4X5LA 4TL4A 1P4LB 5FM4A 4HOMA 4YE4L 1ZPLA 1P5VA 3GMQB 4FYRA 3H56A 3LS4H 4KKAD 3VXSA 1AOHA 1T04B 3K2UH 3P4LA 1JP5A 3O4LA 4OGYH 4PJIE 1I7RB 5F3BA 1EHKB 2DEXX 4HWEH 3U0PA 2W60A 3VNYA 1RJYA 1VPOL 3N9GH 1ZSDB 1MJUH 3OLDA 3QUXD 1DBAL 5CSBA 3G6JE 4KPHH 1AC0A 2Y1YA 3SY6A 1MHPH 2Z7UA 3D69B 2MHAA 4Z7VE 3ZXAC 5D93B 2KT6A 1J0IA 4ZMOA 3FUDA 3VJ6A 4ZMYA 1P1ZB 5IQNA 2P5EB 3KYOB 2R59A 2IGLA 2OL3A 5DJ8A 2EADA 3TS8A 4KKRA 1XTLA 3OC5A 4KQ3H 1FL5A 5MEPB 4J8RA 3AG4B 1CL7H 1DJXA 1U8NA 3BVDB 3QISA 4DO4A 3TN0B 3WXWL 1I9EA 4NNXA 4XN7A 1MUJB 2FT7A 4YHIB 2LTQB 4YLQT 3OHXA 3T5WA 4AC2A 4M7LH 2OTWB 2XWBB 4U6YA 3NTCH 4ANXA 4TVPL 1TKWA 2NQDA 2H32A 1RUQL 4GG8B 4AE0A 1HE8A 2ZOLA 1KV7A 3F04A 3OX8B 4UTAH 5KW9H 1J9QA 1LO4L 4DGIH 2OJZL 2QFRA 4Y16D 5ANMA 2D2CC 3ESPA 3IJ7A 4IK6A 3SGEI 3DPBB 5DFWH 3BKYH 4BZ1A 3ATAA 3RIAK 2GEQA 4LSUL 1GYAA 3SOBH 4F37F 1Z66A 3CFDB 1PZCA 1YYLH 2JKRM 1YMMB 3VI4F 2EINB 3NP3A 4GP5B 5F9JA 1PZBA 1BG9A 4LEEA 4LDEB 2YD3A 5IUCA 4XP5H 1JHKL 3TP4A 3WS6C 1GOGA 1P5VB 5DEZA 5E4AA 3S37H 4M7JL 3QG6A 4HQQH 3VXSB 3UG3A 4NBYB 5F3BB 4FJZA 5A3ID 2NXZB 3WU1A 4G1EA 2Z91A 1LMKA 2DBLL 2CK2A 2E86A 1MQKL 2W60B 5EU7C 5F7DA 3U0PB 1RJYB 4PLNC 3P2TA 2J8OA 4NGHH 4A2FA 3TF7C 4HIXL 4PCSA 5BZDA 1S7SA 3PP4H 2MHAB 4KRMB 2LAGB 4JFZH 4UNTA 3BLPX 3VJ6B 4KKCC 2YQ3A 2YRLA 4DQOH 2W9EL 4W9JC 4LPUA 3WNIA 4BEIA 2WOYA 4WUKH 2OL3B 2Q9OA 1T0OA 1FL5B 1D5BA 2N56A 2YLKA 2YAOA 3UBXI 3ZGHA 4LCWD 4J8RB 3KDMA 1U4EA 1U8NB 3N5AA 4QLRA 4GAGL 4QXGL 2K4WA 2NY2C 4WKZA 1KBGL 1E2ZA 4NNXB 5I18H 3OG4B 1JGVH 2LR4A 4P2AA 5IQOA 3OHXB 3KR3L 4U6YB 3VXRA 4FNQA 2O30A 1T2JA 3UBXG 5L9DL 1B0RA 3GBDA 3WAJA 2L04A 1TKWB 2H32B 3FN0L 2ZOLB 4AK1A 5D71L 3B5TA 4ATTA 5ANMB 3BAXA 1LGVA 4L5FE 1F45A 2ZWSA 4MAYA 2NYKA 4OLWH 2PKDA 1Q9LA 4D8OA 4WRLA 3QNXA 3FN3A 4KO7A 2VQ1A 2X41A 4EN3A 2NY3B 3FTVA 2H6UA 1ZLEA 2YN5A 4RA0C 4UNIA 1F6LL 2WPGA 1MDTA 1ADQH 1N2RA 1YEJH 1GH7A 5F9JB 3V0AC 3NJMA 5CZVH 3DV4A 5F96H 3L4VA 2WXFA 1Z0NA 2R4RL 3BAEH 3VW3L 4LGSB 2N4IA 1QI5A 5IROA 1A64A 1G7HA 4Z0BL 1Z3GL 2AQRA 1PL3A 3GNMH 3O9WC 1IV8A 5BOPA 5ESQA 2GIYA 2YPVL 3SJVE 4G1EB 2Z91B 5F7DB 1OAQH 4YBLC 4E41D 5DMGD 1PLBA 3IYLW 5BZDB 2ICWI 1S7SB 5GGTA 4GRLD 4N85A 1T0PB 3FPYA 4HXAH 1L6ZA 2ESVA 2FJHA 5C07A 4UT9A 4XP4L 4JGUA 1D5BB 2J5WA 1FH5L 3PG2A 4RMSA 1MFBH 3KDMB 4Q52A 1S3KL 3EHBB 4Z8FH 4PS7A 1Y6NR 4J1UA 2YMTA 4PBWD 4WKZB 1WC7A 2NY0D 4KJPD 4RX4A 3UAFA 1QNZH 4OGZA 3WLWC 2ZP0T 3T9WA 3QXWA 4F2MA 4PGBA 3ENEA 2WLLA 2WQWA 3VXRB 4XBPA 1A7NL 1RPQA 1U8JA 3HMWH 3OM3B 1YEGL 4L29A 1B0RB 2BIMA 1J1XL 2ZSVB 1HCVA 1TCRA 3MREA 3D2UD 3O3AA 4WK4B 3S8FB 1CMOA 1BYNA 1U2HA 3TFBA 3BD5A 2HTLD 4ANVA 4N2DA 4MAYB 3WIAA 1Q9LB 4PU2A 2QKIC 2ARJA 4PW9A 3QNXB 4WHYG 5D7IF 1KTJA 2VQ1B 1OWRM 1TETH 4EN3B 1F4HA 5DD5H 2FGWL 4FQ2L 4X7SL 1N2RB 2OX5A 1AKJA 1TPXC 3CHPA 3LQZA 3DV4B 1CYWA 2LLNA 3BRGC 4W70A 3K0YA 4Z7NE 1F8TL 3GJFA 4Y1AE 2QVIA 3HG4A 2B1OA 3CZLA 4DN4L 1G7HB 1Q0YL 5H94A 3LNHA 4N0FA 1F5WA 5ESQB 1S7RA 1KGYE 1T0NA 5EZOH 2RBLA 1CYXA 3EJUA 4PJCE 2ITFA 4EMZA 1NAKL 1NCCL 4DEUA 5KYNA 1XBRA 3MNMA 3WTTA 2CDFA 1JGEA 3MYJA 4O58L 2AXFA 4P4KD 3I02A 4FNRA 2ESVB 2IG2L 3LRKA 3BVVA 1T3FA 2FJHB 2AVGA 5C07B 5LCVH 3POCA 5T8IA 2AS5M 3CG8A 2FQGA 4QWWC 3GJFK 1YAZA 4ZAKC 1SBBA 3FCGA 1MCFA 1EHLH 2BP3A 5I82A 2QVKA 2MOQA 4J1UB 3VXMD 2BNRA 1X9LA 1WC7B 3F3HA 3H1ZA 3MLSH 2MJWA 4NN5B 4F2MB 1LP9B 4PGBB 1XXFC 1XSOA 3BN9D 5MP6L 2WLLB 4XBPB 4UINH 1U8JB 2WWNA 4L29B 3TPKA 1Y1DA 2UXTA 3LKNB 3DX4A 1TCRB 4MXQD 5BQ7A 3O3AB 3ZKSD 1OVZA 4EUPH 3U9PH 3CWGA 2C9QA 3KS0H 4TSBL 4UTAA 5D6DA 1XGTA 2CO2A 2ARJB 5D5ME 2WKOA 4YHML 3V4PA 2WWKO 1BVOA 5KUMA 2WNGA 3GSQA 2NY5C 1JG9A 2WXRA 3UACA 1R46A 4CVWA 2XXGA 3BP7A 2OX5B 1AKJB 3ZUNC 3LQZB 4X6DE 1KB5L 4M48L 3TEUA 4L4TD 3GJFB 1AI1L 5C6TL 5DJYA 5H94B 1A9VA 1KCLA 2M1KA 3A67H 2EDJA 1IBHA 2MOVA 4N0FB 1CGSH 1S7RB 1CO1A 1T0NB 5KSAC 4UT6L 3T4AC 2R0LL 4OCWL 2QQKL 1BMZA 1QW9A 4LOUC 3WDJA 4Q89A 1GC1L 2CDFB 1JGEB 1D9KA 3IFNL 3MYJB 2OTUA 4RGMB 4O51B 4BCZA 4ETYA 2YD7A 4HT1H 4LU5L 5I6KA 1UCBH 3N41F 4NPJA 4RMTA 3APDA 4XC1L 1T3FB 5EU6D 3GB7A 2FO8A 5AUMA 4RBPK 1HAUA 5KBDA 3CPUA 4TNWF 4EZLA 1FDLL 5EF1A 2ARJQ 2CALA 2NY4C 1VGKA 1VKXA 1SJEA 5FW8A 1PU0A 4G8GA 5PAZA 2WCPA 3QEUA 5B39G 2B20A 4M6MH 2BNRB 1NMCB 4AGPA 5IW6A 5I19H 2GCYA 2FGZA 1J0JA 1IMHC 5HDBB 2NX5E 4X8XA 5EIQA 1DEDA 1EBAA 1OE3A 1UWXH 5DZOA 1WZ1L 3WNNA 2QSVA 1J5DA 3FRUA 3ZR5A 2OSLA 3RWIA 2QL1A 2J71A 3PFQA 4MS6A 2HPOA 5BQ7B 5ILTH 3U0WL 2XRAL 3L3OC 4BQCA 2FECL 4XPFL 3KPSD 2B1AH 5CJOL 2JJVA 1XGTB 2QHLA 3WHE0 4KXZH 5KVGL 5BMFL 4AK2A 3V4PB 3DHJA 4JO4H 3GSQB 1EJ8A 4M7LT 1MCWM 4JO3L 2AV1A 3BP7B 1NKGA 3KPSE 2ZNWA 4Y2DD 2O4EA 2P9RA 3KL0A 1ADQA 1U3HC 2V7HA 3FQXA 4K73A 2D3LA 2DM4A 3SE9H 5DJYB 3QUYD 3N91A 4AW7A 4XCEA 4R97B 4X4XA 3BGFB 4X9YA 3P0VH 4G6AD 4G71B 3RWDA 1DVZA 3DXAE 4XMWA 3ARBC 3NJHA 5IZ7A 1E8YA 3DX2A 1XZWA 3VB9A 4HHGA 2R2CA 1S2EA 1D9KB 2OTUB 3NAAL 1NMBH 3MJ9L 3H2PA 4ZUWB 1DCEA 1CLYH 3PU7A 5CGBA 3HNSH 3Q5YA 5L7XL 4DOHB 5I71C 3GB7B 5AUMB 1Q38A 4AYDC 1MWAH 1WAAE 1ZV5A 2NNFA 4KZDL 1F58H 5DT1H 1RK0A 1VKXB 1SJEB 1CD9B 3KYMA 2GY5A 4KK6D 4G8GB 4PY8J 3RDJA 5LDSA 3FHQA 1G9NC 3QEUB 1EZUA 1H3UA 1HKLL 2CHDA 4HWUA 4P5TC 2ZCKL 4NQSA 1QYGH 5IW6B 2GCYB 1WS8A 2DM7A 2PUQT 4UYPA 3T0XA 1GPOL 5HJGA 1IFRA 5BUAA 3V0WH 1N5YL 2OJZH 4NUPA 2ZX6A 3FRUB 2OSLB 5K69A 5GS0D 3RWIB 1QSEE 4MZ3A 4WY7L 4A7SA 3GXIA 5DHVH 3BYTA 3HS8A 2LU5A 5DVMA 3GTTA 3T3ME 4XNUL 3RBSA 3WEMA 4WWKC 5D4HA 2AEWA 4QRPD 5I8CA 1YQ2A 1I8UA 4HIEB 4Y89A 1JBJA 5IVOA 4ALAH 5IBUB 3RAJL 2AV1B 4ZXBD 1O5DT 1NWPA 1J5CA 4O9HL 1MI5E 2R0KH 3EZ8A 3ARED 3HKFA 2DQIH 2APVA 4QRPE 4MBOA 3RY5A 5IF0A 2V7HB 3FQXB 2VW7A 5C8JA 4RISH 1EJFA 4I3SH 2W1NA 1DO6A 4XCEB 4X4XB 4Y4FA 3V6ZA 1QP1A 3RWDB 3VO0A 4XPBL 4I9WD 4MHHI 3AC0A 3DETC 5F7MC 4WNQA 3TBBA 3VAEA 1RZ8A 4BQ8A 5E6SB 3NCWA 1MRDH 3IGKA 2NY6C 2P3YA 1B4JH 4Y9EA 1KCUH 4L3AA 1KXVA 2IPKA 1K5NA 4NO3A 4DP5X 2Y06L 3ARYA 3I50H 4DGUA 3CQPA 2EXYC 4I9WE 1N19A 4YHYB 2Y69B 4JFQA 4GRWE 1YC8A 3ZTNL 4HHWA 2YUZA 1A9BA 2PYFA 1XIWC 1RK0B 5LCVA 3KYMB 3OPZL 4NNPL 4NLHA 3QCTL 2R2EA 4PD4J 1IC7H 4OF0A 4NQSB 1XD0A 2PWDA 1OAKH 4FLOA 2D4DA 4ZW7A 2FBJL 5EMYA 2A2QT 4JHZA 5I8KH 4H88H 1KEGH 3AXIA 3ZZLA 5CILL 1UD8A 5T1DL 1OCZB 2CDGA 1PCXA 3HZ3A 2XNAA 5IOKA 2A9BA 3ABMB 3DVIA 4Z6AT 3GLZA 3WIFA 4IRZA 4L3EA 1A3RH 1KCBA 4QRRA 1I75A 5K9OA 1KLFA 3AGWA 1VAHA 4PJEE 4OV5A 5FKPA 5I8CB 1KJVA 4EUPA 3IAPA 3IAQA 3FKUS 3ZU8A 4BSJA 3U2JA 2CE6A 3UC0L 5I1JH 5K93A 1CGYA 1U0QA 4ODXA 4ACTA 3DYMA 5IF0B 4A7VA 3UJTL 4KITB 1GL4B 5JIHA 1OLLA 5C8JB 1L0XA 2AI0H 2FJSA 3HA0A 4P59H 5E5RB 5T5FA 1A6UH 3T6QC 2XV6B 3A4DA 1WA1X 4JPKH 1I1FA 2J88H 1IEHA 4Y4FB 2PXYD 1PW3A 3FBKA 2MWCA 1HYSC 1RLWA 3MLRL 1OD9A 3HFMH 1KJ3H 1UKSA 4X99A 2GT9A 2LOEA 1I9IL 4WNQB 1XGYL 3DSFL 5BZXA 3S8WA 3HKZA 4XO9A 2WQ8A 5E9AA 5B7EA 1XD1A 2AEOA 2IPKB 1K5NB 3SPCA 5CU9A 1SF3A 1CF1A 4MKMA 1LHZA 5F1OB 4J39A 5DD1L 4JFQB 4PJ5B 3VXNA 2EUWA 3AY2A 4K94H 4JZOA 1HHIA 1A9BB 1ETZA 2PYFB 5KSVA 3I3DA 1AR1B 4TUOA 5CUSL 1USZA 4L9LC 3AZUA 4CC1A 4OIIH 2BOBA 4QGYA 4F5CA 1I85C 2Z8VC 2R2EB 4KJQD 5I0WA 3H42H 2P5ED 3S36H 4OUOA 3UBGA 3E6HA 4JX0A 3LXCA 4XXDA 5CCKH 3IDUA 2VMFA 3V9CA 2FQFA 2CDGB 4U3CA 2XNAB 2P5EE 4XPAH 3TN0D 2HCZX 5FFGA 3WIFB 4L3EB 3C87A 2YUWA 5D7JA 2XU9A 4QRRB 3D7PA 4P04A 1BG1A 5K9OB 1KLFB 4FQ2H 4OV5B 2VSMB 4MNGB 5FKPB 1KJVB 3U83A 4EUPB 5GZOC 4U7MA 3UERA 1X7SA 3NEEA 4GKZA 4JQIL 2BCMA 2WINB 3S8GB 2F5AH 4IBVA 4TYUA 3CDCA 15C8H 2OLDA 2VDLB 2OK0H 1CD1A 4PB9H 1YUHA 3BKCL 4ODXB 4X8GA 4M62L 5KBPA 1RVFH 2ZG2A 4NLAA 4NQUA 3D07A 4GP4B 2ADFH 1YMMD 1I1FB 3WOVA 2XTLA 2HWZL 4URKA 2BIPA 1UASA 3ZHLA 4TSCH 1DR9A 1F6FB 4X99B 2GT9B 3Q6GH 1EAOA 2N59A 4UM9B 4XC3L 4AYMC 3IFLH 3VXSD 1YMME 1AZBA 3H6AA 2ZTBA 5K59E 3O4LD 2WQRA 5TQ2L 2NXZD 4JFVA 3T2OA 4JHAH 3QHZL 1VGEH 3NRFA 4K3JL 3C08H 3VXNB 4JKPL 4IHOA 4E9VA 4JZOB 1HHIB 1ETZB 2VWEC 3WLBA 4B9ZA 3FQ1A 5KSVB 1NM9A 4RA3A 1JGIA 4TUOB 2XX1A 4YEEA 5FKAA 5KYUA 3VXSE 3JVGC 2BOBB 3O4LE 4Z3TA 2FEEI 3MSPA 3D9AL 3GBNL 1FNGA 1V54B 4F2EA 3CU7A 4NUGH 4EKJA 3OZKA 3E6HB 4BK5A 5K9KA 2CJSA 3A4AA 3NSFA 2WNWA 3P9WB 4OCXL 5TE6H 3VD3A 3K6SB 4UDTA 4UAOB 2H4EA 1N3NA 2A6DB 2F18A 4X8CA 2ZXDA 3EYQC 3K6DA 4YL9A 1T4WA 4OT1L 2QJDA 1UM5L 5D7JB 5EBLA 2NR6C 1A8ZA 1JAEA 2IGFL 4NHCH 4AJ0A 3S34L 3WY3A 3SQBA 3V9EA 2IIJA 1QFWH 4GKZB 1H9VA 4MYPA 4PSRA 3UJJH 3SYQA 2YJQA 1AI1H 1NCWH 4MBRA 1EZVX 3FQUB 4KJWD 3O11A 1B9KA 2AJXL 4ZX6A 1QFWM 1YUHB 2COVD 1CUOA 2MPAH 4S1DD 1NBYB 3RA7H 1F3JA 4OCWH 4TOYH 2ICEC 2NY3D 2AHIA 1QFUL 2RTTA 5K39A 3K7UA 4NEHB 1WFUA 3QDJE 5ANME 3QEQB 5GISH 4ZRGA 3KPLA 2GG1A 1ZY9A 3TVMA 1X5FA 1KTKE 1MFAH 2G3XA 3B2UD 5CF3A 3OJDA 4QKTA 3OHMB 1GIGL 4Q9BA 3CLWA 4ADIA 1ZHLA 5F6HI 4GG6A 1EO7A 3NJXA 3NG5A 5J06A 3ZDZE 5KS9F 4TKWA 1U33A 2LQRA 4JFOA 3ULVC 3BUYA 5ALCH 4A2GA 4JM4L 2YA0A 4FFYL 4IHOB 1Z2KA 3WLBB 2R29L 4MQXD 5CS7A 3LXAA 5KYUB 1GCFA 5FKAB 3MUJA 2B4CH 1PGRB 3AQDA 1GJWA 5EFIA 3S3BB 2X4SA 2BFVL 1ACYH 1FNGB 5B1JA 3O2VL 3ULUD 4GO9A 1HSAA 1WO2A 2HVBA 4LEBA 4K3DH 2VDNH 2ZOWA 1NBCA 5K9KB 2JKJA 2IOOA 1DQML 4UDTB 2V17H 43C9A 2NY7H 1N3NB 1UKTA 4PQXA 4C4KT 4F7CA 1AZRA 1UT1A 2BSBA 3EHBD 4HHAA 1YA5A 4WWNA 2Z65C 3QFJA 2IAND 1RZFH 2YRZA 3ULUE 5CJOH 2EICA 1RP8A 2UWEA 1MRCH 2LV4A 2QGDA 3CPLA 5EBLB 3V55A 4NKMB 5JYMA 2XYBA 3WFZA 3SQBB 5IEHA 5DHVB 4RDQG 3VXRD 3OPUA 2JF1A 4HF5H 2IANE 2Z9TA 4JKKA 4KOBA 4PD4K 5LBGA 2N1KA 4M8QB 4Q0XH 1TEYA 4MQSB 5DRWA 3GK8H 3O8XC 4K71B 5CIPH 3QWNA 1W0WA 3O11B 4CBPA 1XL4A 4WAFA 1C1EL 3VXRE 4MAYD 5C0CA 1HCZA 2FATL 5FCSH 1AXSA 1F3JB 2P46B 2BS8A 4AE1A 3PJSA 3NIFB 4EN3D 1PZAA 2F0CA 1AOZA 4AUYA 5K39B 5J11B 2KPWA 4F57L 3SGJC 4PJBF 3B8YA 5C92A 5HHOE 2Y24A 1ETA1 4ORGA 4PVLA 4MA7L 3KPLB 3ECUA 2VDKL 3CDGA 3TVMB 2ED9A 1G9ML 1QLEH 5F7UA 3OJDB 5IROD 1FGVH 5DJZA 5DMYA 4HIHA 1ZHLB 1S78C 4GG6B 4JREB 4EIUA 3CVHH 5BCAA 4MLIA 3EFOA 4X6BA 2Z0BA 3POHA 3GSRA 4JFOB 1SDAB 3BUYB 4NX0A 1JD7A 4K7FA 1HX0A 4JFHD 5G2NA 4U1IA 4WW2F 3II1A 4AEIH 3ZDYE 1U36A 4XNDA 2AJUH 4K7PH 2X3CA 4ZO9A 5SX4I 2AMUA 2IWGA 5EFIB 1JFHA 2X4SB 2C7UA 1JPFA 2ESVD 4N8CL 4FQQA 1HJCA 1HSAB 5C07D 3VXOA 4ZS7L 4QD2E 5HHPA 3ZQXA 4OGAD 3C6LD 43C9B 4U1JA 1X5ZA 4F7CB 3GSVA 4HHAB 1GOFA 3VD1A 1PS3A 3QIUC 2ESVE 3QFJB 5C07E 1CDCA 4RX4D 4P8QA 2H6OA 5JW4M 1MVFA 2UWEB 5FYLE 5DJ6A 3CPLB 3C60C 4OFIA 1QAWA 4NC1E 1FNLA 1NBVL 1OGAB 3QZNA 5IEHB 4APXA 4BV1A 2G5UA 3SKMA 4WV1C 1KELL 4KC3B 4Z3HA 4P48A 4UIKH 2XZZA 3HLKA 5TTRA 3F7PC 5DRWB 4WUUA 2OMTA 2Y25A 2ZWNA 2DQUL 2IH3A 1QHOA 1W0WB 2R69L 3Q2LA 1YPZB 2QDVA 3ZHKA 4HCRA 2XQ0A 6CGTA 3DHPA 4CAGA 2DQDL 1GZHC 1WZMA 5C0CB 3I6GA 2OMXA 3Q2NA 1AXSB 3PJSB 4RLDA 3VRIA 3VSUA 3BW9A 3MRHA 4ORGB 3DC0A 1AKJD 2D7NA 4LEXH 1NGPL 3CDGB 3RL2A 5L4JA 3SDCA 2XXFA 4L1SA 5HVFB 5DJZB 4HIHB 4K4KA 3AWFA 4U49A 3LRMA 5AD0B 1J9TA 1KTBA 2CO7A 3HIZA 2MNWA 3FTUA 3C2AH 2A77L 3EFOB 4X6BB 5IT2H 2FH6A 3GSRB 2JV6A 1MZZA 3EOTL 2UZPA 2LFEA 4K7FB 5MI0B 3V6OC 3ILQC 4U1IB 3ARQA 3JVFC 3QCTH 2YMXL 2YBRA 4Y4HC 1GVIA 5D7EA 5DJ0A 1AS6A 3CE1A 1ZLSL 1NJ9A 4OR1A 2YGQA 1C5CH 2C7UB 4U7SA 1JPFB 5F7AA 1G0DA 4FQQB 4ZUSA 3VXOB 3P54A 4PJDA 3UROR 3CFEA 5EF0A 1N0XL 2ZYIA 3SKOA 3IMWA 5HHPB 5BW7A 1R0AH 3QUHA 3GZQA 1P4IL 5CN3A 1BP3B 1KEMH 1IBGL 2C9XA 2I25N 4U1JB 4BH8A 2XICA 4O02H 2BDNH 3GSVB 3P0YL 2BNRD 4F7MA 2MQGA 4P2YA 4I9XA 1RIHH 5DJ6B 3RB7A 1J7VR 2NSMA 4APXB 3OAUH 4GXUM 3SKMB 1TTUA 3DI3B 4UZGA 3O6KL 4WTXA 3DI2B 4LESA 4FMKA 2OMTB 4WUUB 4F8TA 3OXSA 4ODTH 2IH3B 3DX9A 4YC2B 3WIHH 2JJWA 2IH9A 2PP8A 3INUH 3BIKA 4LSVL 1DSYA 3NZHH 2KZWA 1NCAL 2OMXB 3DVNA 3I6GB 1K2DA 5G55A 4I88A 2AITA 1CL7I 4OZFA 2EECA 2VLRE 1TVDA 4FYQA 1SLUA 4IHBA 3RY4A 3EJRA 4ZOCA 5FYJH 3VRIB 2ZOOA 3BW9B 4KKBC 5DTFA 2PF6A 3UEZA 1OSEA 5EUOE 2UY7A 3RL2B 3O6ML 3SDCB 1F4YL 3OBAA 1XWVA 1GYCA 4F80A 2WN2A 4JPIA 1HZKA 1TZAA 1B88A 2IQ9L 4OLXL 2CO7B 4DEPC 5FM8A 2AF2A 3LZNA 3QO0A 2AQ3A 1J1OL 2KZ1B 4AL8L 4DKFL 2BM3A 3W1ZA 3F05A 1CCZA 1AHKA 1F6AA 1AO7E 1NUNB 1SBSH 2YBRB 2GJ6D 3SEPA 4FKEA 4V33A 5TDPA 1D9KD 3SZKC 2EQDA 5DJ0B 1A6TB 1NJ9B 3EJTA 2EVHA 4MQ7A 2WTRA 4DFIA 3U48A 3IRZA 2EDHA 4JK0D 4ZUSB 3GSNA 4PJDB 3JUZA 4UOW0 3CFEB 2NUTA 3SKOB 2ENQA 1VERA 2IOMA 2GJ6E 4FGMA 2DQCL 4G8GD 1HE7A 2ZUQB 5ECGA 4BH8B 6TAAA 5E6UB 4KXBA 1AYOA 4H8PA 3DECA 2H0JA 2WZ6A 1SPDA 4FHKA 1EV2E 3SO5A 3ZZSA 4B7IA 4F7MB 3QPKA 5AYUL 1ECZA 1F86A 3FW6A 3BN3B 3BFOA 3MLVH 2NDFA 2CDEA 4J3TA 4L0PB 4G43A 3PAUA 4JKMA 3JWNH 5CINL 3FTWA 2F61A 2D0GA 4YWGH 3GSXA 2CA4A 1A7PH 3N44F 4OLEA 4W9IC 3OXSB 1TZOA 2H0EA 3DX9B 3A4EA 5F1NA 1XO8A 2X6VA 4HFWA 3BIKB 4XO3A 2O1AA 1QASA 1K2DB 1OP9A 2CHNA 4OZFB 3QORB 4H8WH 2Z4QA 2X05A 3F01A 4GW5A 2YZ1A 4P2QA 3RWEA 5DTFB 4YNYA 2AJVH 1OTUC 2UY7B 4OD3L 5TQ2H 5E7FA 4TNWK 1N6UA 2J8UA 2Z1PA 4JPIB 5AVYB 2IMMA 2J4WL 3UIZA 1QRNB 2CJUL 2DTSA 4XOBA 2MTAA 4L8DB 4PREA 3QO0B 1FO0L 4A7GA 1CLZH 3CVHA 4HMDA 1RZKH 5T3XL 2X4UA 2YOCA 1F6AB 4UAHA 1XVSA 3IU3A 5TDPB 5GS2H 5CGMA 3OAZH 2I5YL 3JWDC 1RY7B 2IDQA 2WTRB 4MQ7B 4Y7MA 4AH2A 1WIOA 1OTTD 3X17A 4CSTA 1G84A 5D4IA 1KN2L 4UOW1 4HEPA 5EV7A 3GSNB 3MJGX 4ABWA 1DVSA 2NUTB 5CU5A 2J56A 3FUNA 1NC2A 3E3QE 1ZVYA 2QQNH 1ID2A 1XSJA 2VDNB 5E2VH 1MH5A 3VXPB 4LQFL 2EIEA 2YJLA 4L48A 3X11A 1YEHH 2XWCA 1HNGA 5ACMA 1OQXA 1II4E 2H3XC 4K7PY 2LU7A 3FO9A 3P11L 3LZLA 4AYFB 2CDEB 5JTWA 5L88L 4G43B 1CE1H 5TE4L 1JTPA 3MOBH 3IMUA 2Z0UA 3UTSE 3RTQA 4A04A 4J3BA 3GSXB 1EFXA 4IBSA 4YHZH 1U41A 2VTFA 5IMKA 3R0MA 5F1NB 4S1SL 4H8QA 5FA3A 5CIPB 1RH8A 5I1IH 5EIIA 3WCYA 3MV7A 2R0ZL 2Z4QB 3N0PB 4JO1H 4RMRA 3LOWA 4M4PA 4YSQA 3QQ3A 5KSBF 4P2QB 5DK0A 3V4LA 4YNYB 5AYQA 1X4YA 3EYSH 3G5VA 5C2BH 2ZKYA 5LXGH 5IQ7H 3KWTA 2ZF9A 1S7VA 1NAMH 2J8UB 1RZIA 3DJRA 2GHWB 2KH2B 3LS5H 3QAQA 4PREB 1JDDA 4PP1D 4Y4FD 4Z7QF 3T0WA 4BKTC 5GGVH 3CVHB 1T83C 1H15A 5EG6C 5B1CA 3S5LA 2X4UB 3LKOA 3B2MA 2R7EA 4A37A 3IU3B 3PWJA 2IO5A 1UADC 1ZJAA 3V10A 1MFVA 2F5BL 2HT4D 4AH2B 2JTYA 5F9OH 4KDTA 2R23A 4LAQH 1SQ2N 5DMGC 4LLMA 4C56E 3EXJA 1Q0XH 4OF5A 5IHWA 1NC2B 2ED8A 1ADWA 1P7BA 2RH0A 1N5AA 2AEIT 1AR1D 4GRLC 4RAUA 2QGBA 4GXVH 1Z32X 1MH5B 1F02I 2YZ8A 5H35A 4N20A 1V5JA 4Y5VA 3X11B 1RUPH 2YSTA 3ESMA 3QUKA 4O02A 5AVQB 4YDKH 1F13A 1X5MA 2VT0A 3FO9B 3GWJA 4KI5D 5FLVA 3ESUF 3ALWA 1LE5A 1KLGA 4ANWA 4Q9QH 2H7WA 2YO3A 1UJTA 3WJLA 5INDA 5CD3A 2JJSA 2BNQA 4Y88A 3RTQB 1N10A 3UAJA 5KAQF 1YVLA 1EFXB 4WI7A 4L3ED 5IMKB 3SGKA 4R4FH 4QRRD 1JDCA 5AVUB 3QZOA 1U58A 3ML8A 2VN3A 2GIMA 4UQIM 2R56H 5FA3B 3O2DA 5EIIB 3WIHA 3R18A 3G5ZA 3MV7B 4NUQA 5L4IA 3NT0A 2YPLA 4XWGH 2YQBA 3QQ3B 4NM8H 4Z23A 5I1DA 2VC2H 2B5IB 2VZVA 4KTYA 4QRRE 1IB5A 5DK0B 4DF9A 5C6PB 5I1EL 1MXGA 2EE2A 2FWSA 3MV9A 4HWBA 2DLEA 1EERB 3G5VB 2A9ML 4N0YL 1XHHA 4AG4H 1S7VB 1YSOA 5JW4Q 2H45A 1NCNA 4RESB 1RZIB 4GO8A 1NSNH 3D06A 4LRNL 4PJXA 3WY1A 2GBAA 4EXKA 2Q3AA 4ZTOL 1RHHB 1N7MH 4A7TA 1ZHNA 4IBTA 2DD8L 3CZFA 3GQFA 5FOBA 2P26A 1H15B 3S5LB 2XWEA 3LKOB 2R7EB 2O6FA 3HS0C 3PWJB 1FCCA 4R8WH 1ZWIA 7FABL 3HG0A 5FF6A 3PGFL 1INQA 1FL3A 3CX2A 1TLMA 1WQVT 2XN9E 4S1RL 3BEWA 4QAWA 2R23B 2P80A 2EYRA 4LLMB 1FNSH 1PMYA 4IOIA 2YEZA 4MXWL 2AC0A 1EANA 3N2JA 2OZNA 1N5AB 2FBOJ 4E0RA 3HC4H 2RALA 4RAUB 3EDEA 1YEEH 4JG5A 4IRSA 5CZRA 3U4BL 1KB9J 4QY8A 3U7YH 3VFOA 4P4KC 4GAAA 1YJDL 2WXPA 1CFNA 3A6OA 1EHNA 5H35B 2Y72A 5C0AD 3QUKB 4O02B 2YAPA 1EEZA 3EJQA 3ZL2A 2CCWA 2PP7A 3F5WA 4HLZG 1P84J 1FQ9C 3IDXL 1LE5B 1KJ2H 1KLGB 3QUML 4H4NA 3VFGH 1PY0A 3M7OA 5T3ZL 4MAUL 5CD3B 3N1FC 2C1OB 5GJTL 5INDB 5C0RH 5C0AE 3IFPA 2BNQB 2ZUYA 1Q9OA 3VMPA 5CKAA 1XGRA 1A3QA 1XZ0A 3C12A 5JXAH 2N3JA 5D7JD 2Y7OA 2GSIA 1YEIH 4AIZB 3VQMA 4BYHA 1U58B 2NT1A 3FOMA 4YHOH 1NIEA 3VFRB 4BFNA 3G5ZB 3L9RA 1WYJA 2XX0A 4JAMA 3NJGA 5I73C 4PWIA 2YPLB 5HP5A 2MEJB 2B39A 1NM4A 4X6FA 4XX1G 4IYKA 1JPSH 5ICYB 2DWDA 3MV9B 3AWGA 5JZ7C 1XR8A 3CVBA 1I7TA 3C8HA 3KEHA 1TMQA 2AQPA 4FLHA 4AGOA 2YGNA 4PJXB 4FP8H 4PFEA 4RCAA 3JWOC 1TSRA 3BT2H 1QSVA 3PWPA 3TC9A 4WEBH 1ZHNB 4CVUA 3CZFB 4PRNA 4E9QA 1WLHA 1EO8L 5FOBB 1GYVA 1SNRA 1UVQA 2WQAA 4IIZA 3L1OH 4FQLL 1UWFA 1EDYA 1ZWIB 1RURL 3FT1A 5FF6B 2D3NA 1A7BA 1INQB 1FL3B 2HUEA 4PUBL 2EH8L 1E3XA 3HG1E 2DDQH 3BEWB 3MV8A 3X12A 4KBPA 2EYRB 4IOIB 5DFVC 2PYEA 1UHVA 2VSKB 2YEZB 1HOEA 3F12A 4E0RB 5HBBA 4IRSB 3VFOB 4QY8B 5T5NG 1UG9A 4LAJH 4B5EA 1CFNB 5KG9A 3SDAA 1HIML 1OAJA 4LCYA 4R0LC 3CXFA 1OZUA 3R7RA 3GPSA 2BVUA 2JQAA 3BJ91 4AKQA 2XBZA 1EEZB 1AHWC 1S7UA 3F5WB 3LX9A 3V4VH 5A6IA 4GH7B 3ZE0E 4YXKH 1U8HA 4GMSH 3RY6C 4LBEA 3IFPB 1MG2C 1Q9OB 3Q8FA 1UJ3C 1XGRB 4JQVC 4LPCA 1XZ0B 4PY8I 3OAZK 3FO2A 3NCCB 5IB4A 3NA9H 1DJWA 2GSIB 4R2GB 5BV7C 4LSSL 2YGVA 3FOMB 4QRSA 4LCCA 1VZIA 2NW2A 3L9RB 4JAMB 1VFAA 4UZUA 4CC4C 5ID1A 4X6FB 4XXCA 4ODVH 1GGIL 2Q76A 2DWDB 3T08A 4CN1A 4JB9L 4HIJA 4X8JA 1HL8A 2HLFD 2BZCA 1XR8B 3NGBC 3P9LA 5D2LA 4H2AA 1I7TB 1FFTB 2RCSH 5FR3A 3R4DA 5GSRA 3BI9X 3HE6A 3OKEA 4G9DA 3HZVA 1GGCH 3PWPB 4MDIA 4Y2DC 1OOAA 5IP4A 4PRNB 2GHZA 1HWWA 4TTDC 1UVQB 2NDGA 3ZZQA 3ARDD 1MHCA 3QUYC 5AKRA 1SUJA 2C4FT 2DZEA 2C9SA 1BM7A 1CURA 2F15A 4LE8A 2DLTA 4G6AC 5DRZA 4Y2OA 3NCEB 1HT6A 1L9PA 3AQYA 1K72A 1SUHA 4KFZC 4C59B 2DH2A 4LLWA 4PJ7F 3W11C 4BFFA 4JG1L 1S6NA 4MCZA 4FHJA 2PYEB 1A14H 2FX8H 3F12B 2FJFA 3NPSC 3N1GC 1I3RA 2DRUA 1OK8A 1ZXKA 2NT0A 2X70A 2YD2A 1NBZA 1E65A 2YRBA 5GGVY 4U1GB 5KG9B 1IGJA 3SDAB 3EDKA 1W16A 1TDQA 5CINH 4A6YL 1ET8A 3K0WA 2I07A 4JS7A 5AAMA 2K8MA 1S7UB 4OTXL 4UDUA 2DN7A 2WVSA 4QRAA 2UV3A 4RMWA 2ITCA 1GJUA 4P5KA 3T71A 1U8HB 4HPOL