2WKOF

Structure of metal loaded pathogenic sod1 mutant g93a.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
153
structure length
152
Chain Sequence
b'ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDAVADVSIEDSVISLSGDHIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE [CU-ZN]
publication title Structural and Biophysical Properties of Metal-Free Pathogenic Sod1 Mutants A4V and G93A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 35
structure length 152
sequence length 153
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2wkoF00
1ESOA 2AQNA 2VR7A 1PU0A 1FUNA 1QUPA 2Z7YA 1B4TA 1HL5A 2AQSA 1OZUA 1N18A 3GZPA 4N3UA 1S4IA 3QQDA 4L05A 1E9PA 1IB5A 3K91A 2Z7ZA 2WYTA 1PZSA 1SXBA 3ECUA 3HFFA 2LU5A 2WKOF 1HL4A 1TO4A 3QQDB 2XJKA 1E9PB 1YSOA 3F7LA 3MKGA 2ZOWA 2WZ0A 2VR8A 1E9OA 2WWNA 2GBUA 1L3NA 1CB4A 1F1AA 1OAJA 3H2PA 1MFMA 1SDYA 3T5WA 3L9EA 1PTZA 1UXLA 1JCVA 1E9OB 1U3NA 4BD4A 1BZOA 3GQFA 3GTVA 4A7GA 1IBFA 5KBMA 1YAIA 1TO5A 1SOSA 4A7QA 1F18A 1BA9A 2APSA 2ZKWA 2C9UA 5KBKA 1SRDA 1SPDA 4BCZA 1CBJA 4BCYA 1SXNA 1XTLA 2E47A 1SXSA 3GTTA 3MNDA 2VR6A 2ZKYA 2AQQA 2V0AA 2WZ5A 3KBEA 3KH4A 4A7VA 1IBHA 1IBDA 2GBVA 3SODB 1Q0EA 3HOGA 5CU9A 2JLPA 1N19A 3CQQA 1JK9B 4MCNA 2ZKXA 4U4IA 2AF2A 3KH3A 4A7GF 3GZOA 1UXMA 2C9SA 1XTMA 1DSWA 2AQPA 3CQPA 1COBA 1E9QA 2AQTA 1Z9NA 2WYZA 3L9YA 4B3EA 4OJAA 1EJ8A 1OEZW 1YAZA 2E46A 1E9QB 1KMGA 4MCMA 4A7TA 1EQWA 2WZ6A 4OH2A 2GBTA 5KBLA 1B4LA 1JK9A 4N3TA 3CE1A 1F1DA 2K4WA 3S0PA 1XSOA 3HW7A 3KM2A 3KM1A 2AEOA 2Z7UA 3KBFA 1DO5A 2R27A 2XJLA 2SODB 3RE0A 1F1GA 3ECVA 1SDAB 1OALA 2WKOA 2Q2LA 1OZTG 2Z7WA 1SXAA 4FF9A 3PU7A 3H2QA 2WWOA 2AQRA 1Z9PA 1P1VA 3LTVA 1RK7A 1SXZA 3GZQA 3F7KA 2C9VA 1IBBA 2JCWA 1AZVA 4A7UA 2NNXA 3ECWA 4A7SA 1SXCA
chains in the Genus database with same CATH superfamily
5IROD 2I24N 2VDKL 4PG9A 1I1AC 5EORH 4NYLB 4AIZA 4G1EA 1OZUA 2QQLH 1KLGB 3CN3A 4QTHB 4FKHA 3HS8A 5TQ0L 5L2JB 4QY8B 1U8QA 1H6UA 4AENA 4N2OA 4V2BA 1QRNE 3O3DB 5IFAH 2BNUA 3W0WD 3HG1D 1L7TH 5E6IA 4G8EA 3KPOA 3BDXA 3ZQWA 4B9PA 3BEWA 1TDQA 5C70A 1P6FA 3P4NB 2FB4L 4BK8A 2ENJA 1NCOA 4G6KL 2ZYIA 1H9DA 3OR6B 3ALPA 5FX3A 3JBG7 3MREA 4R7NA 3VH8G 3BZDA 5F3HB 1J0HA 3ZTCC 3KE0A 4PP1C 1YAIA 3SOTA 1SOSA 3GB7A 3M17B 5I6XB 3GDCA 4MCZB 5M95B 4JRXE 4TRPL 4NC1C 3ZGIA 4NJAL 1BZ7A 5FUZH 4L8CB 4RGMC 4N1HB 4KU1A 1JPSL 2F0CA 4ZD3L 4JAMB 4M7LT 3WS3A 1WS7A 1BFOB 1Q1JH 2BZ7A 4WY7H 4B9YA 4GG6B 3G5XA 3I3BA 2O5YH 3BXNB 3DSNA 3EJUA 3LIZL 4QCIB 4WTZA 1BXXA 3RTQC 2Y7OA 5DJXA 1KZYA 2R1XA 2YMXH 5L4IA 3LRHA 5I28A 2EYRA 4ODXA 5JXAL 1CYXA 4LP8A 4IRZL 2ZXDA 1P4LB 4XNQB 2P5ED 2BSRA 2GB2A 1EZVY 3GZOA 2PR4L 4I48A 2V2XA 4RAUB 2HFTA 1NDGB 3KLLA 2O30A 3FUDA 4AKOA 1BPLB 4OKDA 3ZT6A 2L04A 4NUJB 2ZF9A 1EIBA 3F8UB 4XHJD 2GUYA 1WZMA 3QIWB 3ULSA 4YDNA 4DP4X 4KPHH 5H2BA 3TN0A 3DNKA 3HB3D 5CBEA 1AGDB 1XGYH 1AJ7H 5I5MA 2GIXA 4U7MA 5DRWB 4X83A 5C0AB 3GRGA 1IKOP 3VTTA 1DL7H 2VLLB 3BCFA 4JG9A 4M8UA 3S35L 3ZO9A 4C4UA 2CLRA 5EC2A 1H0DB 1ODAA 4Y4FD 2EC9T 3KR3H 4TKWA 4MMXA 2RQEA 3SEPA 12E8H 4IQHA 5I8KH 1LK2A 4P3CH 1HOCA 2FQFA 4QOKE 3ECWA 4ZFFA 3ARFA 1OAXL 3NJNA 3SGKC 3FFCE 3GTNA 5CSZB 5TH2A 1TVHA 5E94A 5K93A 4CILA 4JN1L 4LLQB 3PWLA 1M56B 3DJ9A 2AVGA 1NGWB 4R96A 5D2NE 1SLWA 3FCSB 2VQ4A 5J6GB 5F7BA 4WGWB 5KWYC 3MX0B 3OKMA 5EBLA 1X6NA 4A2FA 1IEHA 2BP0A 1FZOA 4FNQA 3R8BB 4HUMB 5ANHA 1CQYA 1G6RB 4J8QA 3IE4A 1RUAH 5DD0H 3GM0A 5AVWB 2WLLB 3M86A 4Y9BA 3L1OH 1JN6A 1HKLL 1QA9A 4JHWL 3O2WH 5T1MA 2A83B 4FQHB 1X5FA 1TCRB 1J12A 1HHIB 1NCTA 3CVIH 4B6ZA 1WTGT 1LDPL 1P7QD 4JL1A 1VEMA 3C5ZC 1AXTL 3KDMB 2X3CA 1Z6JT 3MUJA 1ERNA 4M7KL 4MXQD 1OAYH 3PGDB 4MNGA 2G9KA 1YPZA 2EXSA 1E6OH 4WRLA 3DHPA 1U8CA 3BH9B 1PDKB 3B9KA 5FAAA 5L88L 3IDNB 1A02N 2X2UA 2X6CA 2FT6A 4JJ5B 1MVYA 1PKQE 4HHAB 1A6VL 1WAEA 4ERSH 1T0OA 3AG3B 1BQSA 5DT1H 3PWPB 2BHFA 3LZQA 2JFCA 2YHGA 3LEVH 1T2QL 4H20H 4Z7QF 3GEWB 4MHHG 4LBAA 2EIZB 2GITA 5SX4H 4A7GF 1WCBB 4N90D 5D1XB 4TLSA 4LPWA 3L7EB 4KRPB 4Y5YA 4BKSC 4NNXA 4KNUA 2CNZA 1J5HA 3UBFA 5C0FB 2LTQC 1QSZA 3P02A 1I1RA 3KPPA 4PBXA 3SKJH 4Q52A 2YK1L 5D2LA 3O2VH 3MMEA 3HZKA 2GBTA 3N1MC 4KTDH 5E51A 4X7TA 5FGBC 3QIBC 2AK4A 2AEPL 4Y5VB 4E41A 3F7YB 3BAYA 5AB9A 1S78D 5MERA 2PP9A 4OCXL 5LCVH 5DC9B 4DZ8A 3ULUL 3H1ZA 5CZVH 3HR5A 2NNFA 5LGYA 4R4BB 5GZND 5MHSE 1YA5A 1BEXA 1OLZA 2HFGL 4MRBA 2JKXA 1L9RA 1SXAA 2VMDA 1HC1A 3SE9H 5C0RH 1Q1PA 3G6JB 5CZXD 4QHKI 1QHQA 2OR7A 4UM9B 1CF8L 4MD4B 4UYQA 3TBVA 1XD1A 3QUKB 2YOCA 2DDQL 2VLMD 2HKHH 2DYRB 4PLJC 4JZOA 5L2KA 4GJTB 4JX0A 2WSPA 4WKZA 1OP9A 2V17L 4RWHA 4W6YB 5I1JH 3VM5A 3E6HB 3WUWG 3KPSE 4IGBC 3MV9D 4G8FB 1X7TA 4PJIF 5D2NC 2F1BA 4OFYD 3S3DB 1HZKA 4Q0XH 5EU6B 5JNYA 4RGNE 2DD8L 2CDFB 3OMNB 3OL2A 5A2BA 5CZRA 2WXIA 4M7LH 2QQQA 4HWEH 1TZGL 1MCDA 2CLZA 4RISL 4DP6X 1HQRB 4XX1E 2R2CA 3EJCA 5HP5A 2DQ6A 3G5WA 4JY4A 3OKEB 3RBSA 3U83A 4NN6C 1B0IA 3KJ6L 1KPRB 4F57L 4PWGA 1N59B 3PF2A 1I1AD 3DGCR 3MQIA 1F18A 3PPSA 3W11C 1AP2A 4F24A 2FX8L 4JQVC 1N7ML 5GPRA 2RR3A 3O4OC 2BC4A 3HEIB 1MAMH 5FKPA 4MXWH 3O4LA 3S96B 3MLRL 1S3RA 1W6LA 2VZTA 3MBXL 1QPXA 2HJLA 2ZKYA 2BW4A 3F85A 4C8XA 4CJ0A 4IJ3C 3KNBA 3Q8FA 1JF1B 3EFDH 2NY0B 1YEJH 3HS0C 1EEZA 4JO4L 5IWLA 3VRJB 4BQ6A 5ALCH 1FBIH 2NUTB 2FGWH 3FN9A 4MQTB 2WWKT 4PR5B 4BIKA 5IW1A 4UNUA 4PP1D 4F9LC 2C9SA 1MRCH 3GINA 3WFDL 4MASA 1RZQA 4U7KA 3ZL2A 3ZX1A 2PO6A 5FUCE 2DBJA 2QSCH 3O3AB 1FO0B 3QNXB 1P5UC 3HUJB 4OZHE 1RV6X 3DX4A 1YJDH 5AB0A 4JFVA 2WQXA 4P99A 3IB4A 1Y18A 4Z95H 4HV8B 1KLUB 2ZOLA 3RGVA 4GSXA 3TVMB 3TBSB 1I8MB 5KYXA 1G7MA 3EDEA 4XNUL 4MBOA 1UD5A 5GRXG 3RTQD 2AV7B 4ODUA 1TKWB 1DQLL 2D3LA 3QCUL 1VACA 2Q86B 4PGJA 3LHPH 2HX9A 1RMFL 4HUWA 5I1IL 3B4NA 5EF3A 3H2QA 1TYJA 1M05A 4OKVA 2R56H 4DVRL 1KPUA 5KYYA 4L1HA 3MLXL 3B34A 3QFJD 4X8JB 3ZE2F 1NBVL 3FBKA 1YHPA 1S7QB 1DR9A 2CO6B 1EJFA 1N12A 1WZ1H 2UZXB 4YPGA 4A6YL 2JJUA 3MLUH 1FNGB 5B7FA 2EDJA 3G7TA 5DXWA 1E2ZA 2VISA 1AAJA 1I3UA 2XA8H 3NRFA 4GFTB 1QFPA 4PBWD 43CAB 2OYPA 5C2UB 1G7JA 4M29A 1FNLA 1UXWA 2WK2A 1ZANH 3BPNB 5F7MC 1O6SA 4RGNC 1Z66A 3BDYH 3VG0H 4KVCH 3RY6A 3N50A 1HX0A 2P5WD 3QJZA 3WIHH 3O45B 3US0A 3BHBA 1QACA 1E9OA 3HTLX 4HKBA 1DJHA 1MW0A 4QF1B 5JW4Q 2QHLA 3QWOA 1JXKA 1GPOH 3QH3B 4PJEB 2GFBA 4HETA 2UV3A 4HWUA 3K3QA 1Q0YL 2Z31C 3IVKA 3OJDB 1MFNA 4WFFE 3FFDA 5BV7B 4HF5L 1V27A 1ZPLA 3WIFB 3SDXF 1KGJA 1OCWL 2B3RA 4FTVE 6TAAA 5HJDA 3T65B 3PHOA 1FNEA 1KJMB 3WTSA 3GSVB 4I18C 4TRPH 3F84A 3EOTH 1ZLSL 5C0BB 1A8JH 1P0SE 2J8HA 4APQB 3HCVA 5IB4B 3ZTNH 1FPTL 2N1KA 3PWVB 4JVPA 4KXCA 2NY5H 1KV7A 2EDBA 1NBZB 4F9PA 1EH9A 2DEWX 2B8OT 4LSUH 5GSRA 3FQYA 4FQQB 1JGEA 4JY6A 1DDHB 4N0UB 4HMDA 1D2PA 5IIEA 2H8PA 3S4SB 2KS0A 4QAMB 4YHPB 1BM3H 3FCTA 3NCJH 1HZHL 4FI6A 4UCFA 3SDDA 3TIEB 4YIQB 4KZ0A 5AD0B 3UADA 3LKRA 1S9YA 3I3EA 3QB7C 2ZCKH 1UCBL 3C5JB 4NNPL 4KUCD 4CBZA 1ZXQA 3SPJA 2WTRA 3C5ZD 4ONFH 4PJCF 5FUCC 4Y5XA 1E2VA 4K3GA 5G4OA 1NCAL 4BYHA 4D9QE 2AABL 2AJZA 3ARBC 3GSOA 1ZEAH 4X7SL 4F7KA 2C8NA 4DERA 5JDJA 4XN7A 5HJGA 2XZAL 4JDTL 3FTVA 3C60D 1AIFB 5T1LD 1EZLA 4XCNB 1T03H 5CCKH 4ODVL 1T0MB 3X12B 2WWKO 2IV8A 1J05B 5D7JA 5DMJB 1PAMA 3LH8A 4NQCB 1M9SA 5SWZA 4H8UA 3GMOB 1CLOL 3TTSA 3QW9A 4NKIH 3ZK0A 5FO9A 2OMUB 2KKQA 1ZDQA 4PJGF 1SVBA 3GPEA 5B3JE 4W6XB 1VERA 4JR9L 4RA0C 1JFHA 4PJ5E 2D3JA 4O58L 3WXVL 1TFPA 2X6AA 2J1ZA 1U2CA 4ZXBB 3B9VA 4KWUA 4S10A 4DCQB 4Y16A 3TH3T 2I7SA 4M43H 5BVJB 2FD6H 1DVZA 1AH1A 3ECBA 4Z7UF 1OM3H 1GGIH 1NMAH 3WSQL 3CDYA 4L8BB 5E9NA 3IMUA 2DWDA 2BP5M 3JV5A 3Q13A 3QIBD 3HN8A 4FC3E 2VDPB 1BIHA 2R1YB 3R7RA 5IBTH 4AUJA 3LNHA 4PG9B 1Q38A 2F8XC 4AIZB 4UILH 4G1EB 3PJNA 3UFIA 3LD8C 1EGJL 5BMFH 2V2WB 1KY7A 1T20A 4QRSA 1U8QB 1A7PL 4AENB 2DB8A 1G6RL 2V37A 5L7XL 2BNUB 4DQAA 2WPGA 1G84A 5E6IB 4PLJD 4X6DF 4G8EB 3KPOB 4QOKD 4YL4A 5EUOA 1V8HA 1AHKA 4OZGA 2GT9A 3BEWB 2APTA 3AS1A 4GG8B 4GSRA 5E5RB 3U30B 4BD4A 1HHGA 3FFCD 5I1KL 5E8DL 3ULUE 3GBMH 3ZE1F 5CUSL 4ZX6A 3KD4A 2H3KA 3LKQA 2Y0SA 1W0YT 4IGBD 3MREB 4R7NB 2VLKE 4BFNA 5TF1L 1Y6NR 4ZPVA 3LQAH 4Y1SA 3GB7B 2I7OA 4NQVA 4EKJA 1JGVH 1T6VN 1BZ7B 3AW5A 4JS7A 4CGTA 3V4VL 3E9TA 3GXUB 2ATPA 3PS6A 3K2KA 4CVZA 1URZA 3APCA 5IVZA 3WS3B 3E7JA 5F7NC 1H5BC 4JB9H 1LO4L 1ADQH 3UAJC 3A6CH 1MVUA 4NKMA 5CXPA 3G5XB 4UT6A 2EKSA 2VN7A 4WO4C 1UATA 3K6FA 3DSNB 1WZLA 4HEME 2H6PA 4I87A 3VI4E 3W9EB 4P5KA 2JB5L 2WXPA 5DJXB 4CN6A 2R1XB 1T2QH 2EYRB 1KELH 4ODXB 3W11D 1TQTA 3O6ML 1ILUA 3QJHA 2CXGA 2WKGA 3MOAL 3LPPA 2BSRB 3NSYA 4UQCA 2UZIL 4J3OC 1YO4A 2WBKA 3RFRA 3B2PA 1WJ3A 2V2XB 4I48B 3SQBA 2BSED 3IGUA 1OSYA 2HRLA 3ARGC 4LQ1A 5I1HL 2WZ6A 3QORD 2RB8A 1RH8A 4PY8I 1VHPA 2OFQA 4XVJH 4E9VA 2IOIA 6FABH 1M7DA 3ESMA 3NFNA 4F7CB 5DDHA 2O6DA 3WIIL 3GXFA 3CBKB 3Q5TA 3ULSB 4LSVH 5C0CD 4Z8FH 3K2UH 5H2BB 3TN0B 3HLKA 1UQSA 3UCQA 3QR0A 3A3YB 4R84A 4Y2NA 3V5HA 3F58H 4FF9A 4GRWH 4GXVL 1M2VA 2FCBA 4KHTL 1WH0A 3H85A 5DURB 3KL0A 3VGBA 2F7PA 1HCYA 1INEL 1JHLH 5EC2B 5F9WC 3A21A 2WXLA 2XXFA 1ROCA 5E03A 1DQQA 1FORL 3AREA 3EUUA 1AD0B 3GK8H 3V8CA 3NP4A 1OWWA 2I27N 1SVZA 1LK2B 4PVMA 3SCMA 1HOCB 3WN5A 3GZPA 1JZ3A 1XGUA 2EEAA 1H6TA 2X89D 5TH2B 1TVHB 2YA2A 4PJAE 1J0JA 2DMKA 5E94B 1TSRA 5JXEC 3PWLB 5MHSD 1VZHA 1AR1C 2B1AH 3RLSA 1X7SA 3FTSA 4R96B 1UKSA 1BJ1J 4J4PC 3RDTC 1QRKA 5EO0A 4KTGA 3Q6GL 3N41F 3NUKA 3OKMB 4XPBH 5EBLB 4EDXA 1S5IL 2A4EA 5D7LA 2BP0B 1Z0MA 4KXDA 1FZOB 3QJRB 3TV3L 2K7QA 3OSVA 4DO4A 2WXHA 3E8UL 1LP9A 2NQCA 2XVKA 5ICUA 2N0MA 1PCSA 3GBEA 5KOMC 3IAPA 2GK0A 4RX4A 3SDCC 1JN6B 1QLFA 2XWTB 3O2DL 3ULUC 3PP3H 1QA9B 5DI8A 3W37A 5T1MB 3KPSD 2DQMA 5JIMA 4G8IA 2NXZC 1FN4B 1DBKH 3FZUD 5GRJH 5A7EA 3P2BA 1WD9A 2FX8H 4PYHA 2ZSWA 4L0PB 1L0PA 4FD0A 3KYMA 5F88A 3EBHA 3K6IA 5ECGA 3BKJL 4Y4KC 3ETBF 1TEFA 5KW9H 3DXAD 5EDXA 4OW6A 1BAFL 4LIQH 4UQIM 4MNGB 1M42A 1JWSA 1OSPL 1I9EA 3WBDA 2YBGA 4WU7A 1YPZB 5I16A 4L4TE 3WS6C 1U8CB 1OARH 3B9KB 4QXUL 1W80A 3QDME 3RBGA 2KLSA 4WSJA 3UC2A 1J5CA 2F7IA 1PF3A 2Z31D 4ADJA 3CPUA 5E7FA 3LKNA 3LNDA 3U9UA 5B8CA 1RY7B 2DLFL 2JF1A 1BEYH 3AITA 2X4UA 2ZE0A 2ZWZA 3GYRA 1BZ9A 4TTDD 3HNSL 2CR0A 1OP5H 4GBXC 2OXHA 5TJWK 2GITB 5T3ZL 4FA7B 3ILPA 1S9XA 2Z91A 3V6BR 3HZMA 4Y5YB 1NFDA 4UI2A 2J73A 3IMRA 4LEXH 2WO2B 4NNXB 3CE1A 3KPPB 2ENPA 1WFIA 3W3BA 3D8MA 2COVD 2JWYA 1MCCA 4XCEA 5ICXA 5D2LB 1N0LA 2XJLA 3MMEB 5JW4R 3HZKB 5FEBA 1J7VR 3L4VA 4X7TB 2AK4B 1L4IA 2X4OA 4E41B 1XB6A 4OLXL 1J0KA 5MERB 3N9GL 3ELQA 4BK5C 5BRZA 4DZ8B 5F1SA 3VTAA 2A99A 2D7QA 3BISA 3HR5B 3BZ5A 5H4ZA 3VW3L 1SXZA 4HVBA 1NEZA 2ALAA 4LL1A 3ARWA 1CXIA 2WBJD 3A47A 3CD4A 4DVRH 3ARBD 3DC0A 1S3KL 4OIIL 4UQ2A 1A9EA 5CJBA 2A73A 3WE6A 3NK3A 3TBVB 3VD7A 1GMEA 1MDAA 4UDUA 4JZOB 5L2KB 2RTTA 2HUHA 3SYOA 2WSDA 1TEYA 1UOWA 4ZMWA 4E36A 4LHUD 1T7XA 1WGOA 3S3BB 3T0XA 4WKZB 2XA3A 3E0GA 3OHXA 2TSAA 1ZK9A 2UWEA 15C8H 1W72A 2NSQA 3VJ6A 2H3XC 1P6AB 3IM1A 4YWGH 3OLGA 2G4EA 2ZCHH 4JDEA 1YEDA 1H9VA 1NCUA 5JNYB 3O41A 3ULVE 5C6TL 3NP3A 1RFDL 3INUH 3NA4A 4AGNA 1NCDL 3EO1A 5FHAL 2CLZB 3MV7E 3VI3A 2B1OA 3SKNA 2MCAA 4AUUA 1CGTA 4M6ML 4KZEL 4I9WE 4Y88A 1E6JH 1T2JA 3NJHA 4HFUL 2CRIA 4OU3A 1Q90A 3HI6H 4JY4B 2APSA 3IJHA 2H0FA 5DUML 5EEVA 2YBRA 3PHQA 1MCQA 1YEGH 2H9GA 3L4TA 4LVNB 1E67A 1AP2B 2X3AA 4HJ0C 4JFTA 1RIHH 2F68X 3K8KA 4LCIL 4LRNH 1FPTH 3MRFA 5HGHA 2ORBL 3X17A 2BC4B 4Y2DC 2BNRA 5FKPB 1GAFL 3O4LB 4E9RA 2OYKA 1BGXL 2HJLB 2GC7C 3ETBJ 5HYEA 4WWPA 2BFVL 3T0ED 4WJG3 5KYWA 2NY2C 4YZFF 2WIMA 1MFCL 1HZHH 4LPTA 1BVLA 5EA0H 1HFUA 1EEZB 2GAZA 4F15C 3Q2WA 3S2AA 4IBWA 2IG2L 5IW1B 1EXHA 4FKEA 4U49A 4GI9A 3HC0A 1FGNL 2VLRA 3L3IA 4I3SH 1VAHA 2DN7A 3IBEA 3LQZA 4PJHA 4HWBL 2EC9U 2Q1EA 3SDYH 3K6NA 4B0MM 4B97A 1WISA 2PO6B 1O7DC 1IKFL 1P7KA 3L7FA 4C56D 1N2RA 3HG4A 4AKPA 5HYJA 1QX1A 5JQ6H 3Q0HA 2CO4A 5DK3A 3ZHLA 3UAJD 2NR6A 1Y18B 2PCFA 4YHZL 2OJEA 1XDTT 2ZOLB 3RGVB 3GGWA 2YGOA 4W9LC 2M8XA 1R0AL 4WO4D 2QPEB 2DF3A 1G7MB 5KYXB 4JFZH 4GSDH 3OB8A 4K9EH 5F1IA 4ODUB 3VXMA 2D2CC 3A5VA 3C09B 1VACB 2V5TA 1KENH 4DPCX 4DF9A 3FQ2A 5BNXD 4HUWB 2XIBA 1PVHA 1F8TL 1I1FA 4J3OD 4TUOA 1M05B 2I9TA 4JRYA 4OKVB 4YR6A 3UXFA 1KPUB 5KYYB 1AQKH 5JHDE 4DP2X 3SE6A 2ARJA 3ARGD 5F2FA 3IJ8A 4N20A 4WUUA 4PG2C 3W2DL 5AB2A 5BZXA 5FYKH 1KB5H 4YPGB 3L81A 5MENE 2VDPL 1SBSL 2X0VA 3AY2A 1IGML 1DJIA 4H8QA 1BAWA 4PRIA 2VISB 2P8PB 3CBJB 1U2YA 4QYAA 4JPIA 4XZ4A 1MCBA 3B2MA 1G7JB 5EO1A 1UXWB 4MDJA 2QGDA 1VGKA 1R33A 2ADJA 1O6SB 2ZJSH 3Q9PA 4PJ5D 5F9OL 2QDVA 3ETSA 2Z4TA 3QO1A 3VMNA 1GTFA 4OGQC 3N43B 2AK1L 2WXOA 1I3RA 4RAHA 5FS5A 3BHBB 2MCPL 2FVNA 1E9OB 4HKBB 3NQIA 3S5YA 2ENQA 1MFVA 2K1MA 2NYYC 2ADFH 4PJBF 3QWOB 1IRAY 1YEIL 2GFBB 3KLDA 5CIPA 4ZOAA 1BQLL 1CS6A 2J1YA 2VERA 1UD4A 3BAIA 4GY4A 2PWEA 4K9EC 4WI6A 5E70A 1NCGA 4ZW6A 5C9KA 3IVKB 4DO6A 3CZNA 3PP3K 3FFDB 1FVEA 4FLOA 4ZFGL 5TF1H 1SMDA 1IAIH 3L1EA 1WUZA 4PD4J 1AR1D 3PHOB 1FNEB 4HT1H 3TA3B 4FYRA 4XBEL 4R8WH 4ALAH 2X2YA 3V4VH 1FLTX 3HCVB 4U1SA 2ZXCA 3DV6A 4BQ9A 4OM1H 4E9TA 4CJ1A 5F7FA 1CR9L 2IAAC 4JUSA 5GSRB 4Q4IA 4XPTH 5H4YA 1JGEB 4JY6B 4WI5A 1IARB 2COQA 4LDCA 5IIEB 2H8PB 1GVIA 5GISL 3ULUD 5CFHA 5IHHA 3HHSA 2R69A 3FCTB 3J7HA 1S46A 3SDDB 3T8MA 4BQ8A 2NXZD 1IKNA 2DKSA 3KPNA 3LKRB 1S9YB 1FCGA 3D7PA 3RILA 3LMJH 3EAKA 3SDAD 3U6XS 2UZIH 4Y4KD 4Y5XB 1OP5K 2OCJA 4DGVL 1ECZA 2AJZB 2DY2A 3GSOB 3DK0A 3MNMA 4G8GD 4KO7A 1EV2E 1GCYA 1QSEE 1XQ4A 2QKIA 3HJ0A 3ULVF 4WTWA 4JPWL 2AFNA 5ADOL 4ODBD 1E7VA 4JY5L 1ZS8A 5SWQA 5DJZA 3RVWC 3CVCA 1G5GA 4LESA 2F1AA 3F6IA 3EJRA 3GBNL 4OT1L 5D7JB 5SWZB 3S8WA 4WO0A 3A6BH 5HY9A 4GXVH 2EDTA 4KHTH 5KYNA 5FO9B 3TX4A 4XR8C 3EO9L 1K72A 4U6XA 3WJJA 3TPUA 5LG6A 4GBXD 1J1OH 4OAWA 1AOHA 1RZIA 2QDWA 4OF5A 4N6QA 1SXCA 1CGSH 1IQWL 2WV3A 4WJKB 2CZNA 1MFAH 1EVTC 2NY1D 1B4TA 1TJGH 4Y16B 4FULA 2CIKA 3RGHA 2ZOTA 4AYMC 5LG1A 2R0KL 4S2SB 3S3PA 4HOZA 5SV4A 3ECBB 1WPCA 4N2KA 3MHZA 4FFYL 3FCBA 3HAEA 2NX5E 4ANUA 2YSSA 5KVGL 2K78A 2O4EA 4KRPC 4LRIC 5I5IA 3WHE0 4H8VA 1RSYA 3ILDA 2X9ZA 4XC3H 4PLKC 4ZUSA 3E3QE 1FVCA 5CLXA 3KLQA 4B0MB 5I30H 3INOA 5TPWH 1V7ML 2EIDA 4L29A 4PRAB 1T20B 4FMVA 4QRSB 4XB8A 5F7EH 3MA9H 3VQ1C 3UZEC 4PAZA 1UFUA 3VXTB 4Z1PA 5EUOB 5GGTA 1AZNA 4D9RE 2WXKA 2GT9B 4OZGB 3ZHKA 4DETA 5A2KH 5AKTA 3RU8L 4MYWB 1Q4NX 1QTPA 2XQYA 2YLKA 3R1GL 5CO1A 2E47A 3UIYA 5E5MA 1VB9A 3LKQB 3FSOA 5B1KA 4XOBA 3HE6A 3BKJH 3D33A 3L4ZA 2D03H 3NGBB 4S1DC 4ZPVB 1J8HE 5F21B 2CBQA 5CEZL 4MA8H 4NQVB 3UYRL 6PCYA 2DQUL 4P23D 1PJ9A 3S35X 1RZJL 5A2LH 1Q0EA 1VGEL 4UIKL 3SOBL 2ATPB 1NIAA 2VR5A 3L5XH 1NAML 1MNUL 2K6ZA 4CVZB 5IVZB 2QEJA 5LGHL 4Y7OC 3HC3L 1Z9SA 4IMKC 4DEWA 4HJ1A 4ZS7H 1MVUB 4NKMB 5I8CA 4QLRA 2EKSB 3I6GA 4JFXB 1I85A 1EO5A 3FB6A 4FMKA 3V55A 2H6PB 1KDIA 1Z9NA 4P5KB 2PXYC 4DKFL 4G6ML 1GCFA 2E46A 3B5GA 4XX1G 2CUHA 5J5EA 2YZ8A 4HJ0D 3R19A 1F00I 1HHKA 3UEQA 2EILB 3N2JA 4HALA 3VSTA 4IBYA 1I3VA 4Y8DC 1KEGL 4JQIA 1JXGA 4Y2DD 3SQBB 2DV6A 2IQ9L 4NWTH 1REIA 3MRIA 3BVXA 2WZPA 4YSEA 3H53A 4UOQA 1M7DB 1Z5YD 3NFNB 1OZTG 5DDHB 4G2AA 4UQBA 2VXVL 1QBAA 3CFCH 5TTRA 3T3MF 3T9WA 1BOGA 3ABKB 2ATAA 1TQVA 3F7KA 3V5HB 3BE1L 3PPEA 2Y69B 4A7UA 3DRQB 2UX6A 1OPOA 2NY0C 1ZA3B 2B4CL 2IBZX 4AV4A 3KS0H 4CNIB 4OCYH 4R5TA 4X8XA 4M7ZB 1CI3M 3LIUA 3MLTA 1DQQB 2JJTA 3AREB 4C58B 1IC4H 2AVFA 3CK0H 4XPAL 1E3FA 3PGFL 3SCMB 3WN5B 1XGUB 4TPRL 3LNGA 3QUGA 2I07A 1JNLH 4PWIA 1GH7A 3E3QC 4YFEA 2OW7A 4W1TA 3AXLA 3O8XA 5EF1A 4JHZA 1KXHA 4X5RA 3QQ4A 2ZONA 1SDYA 3FN3A 2W0LA 1MJ7L 3OGOE 3MGTA 3CLFL 2PN5A 1T7YA 5B1BB 4EDXB 5GS0H 3QUXC 4LQFL 5D7LB 4A7GA 5IHUL 5KBDA 4XMUA 4PI2A 2BOBA 3CDFA 4LHUG 4N2EA 2BVTA 1LP9B 5E6RB 1KCSL 2GK0B 1QLFB 3SBRA 4O00A 2JTDA 1U2HA 3BN9C 4K3HA 5EU7E 3H3BC 3X1NA 5DI8B 5F6HJ 2ZUYA 3BP6A 4FEMA 3V9EA 4G8IB 1BBDL 3P0GB 2BPBA 3VYPA 1A5FL 3GI9L 2ZSWB 3KYMB 5F88B 3QDJA 3UBGA 4RSVA 3QIWD 3VD1A 4YZWA 1MQ8A 4TUUA 1N19A 4KNQA 4FQ2L 1JWSB 1UUSA 1X6LA 1D6VH 1DBML 4WU7B 5KS9F 5I16B 2NYYD 1TJIL 1MHPH 4M6OL 4OCWL 2EH7L 1MFCH 4KKBC 2FBJL 4ODHL 2F19L 1D7CA 1K9TA 4TUJA 3U46A 5DD5L 1NCHA 2Y36L 5LXGH 3BCDA 3LKNB 2NPLX 4XNMA 4D9LH 4EUPG 3U9UB 3OC5A 5B8CB 3OF6D 2X4UB 1UWXH 4RA3A 3US9A 1BZ9B 4A37A 3ZSTA 2MNJB 4MCMA 5HVWA 4AJVA 3M1OA 1EXGA 3CSYA 3HPJA 1JK9A 3GHEL 2OXHB 2YD4A 5D7SH 3ILPB 1S9XB 2Z91B 2BLFA 4LLVA 1WEJL 1NFDB 4MB4A 2I26N 1CICC 1MUJA 4TYUA 3ESVF 4YDZA 2AP2A 3OGCA 4GINA 4XCEB 5ICXB 3DTXA 2N7BA 1N0LB 1A7QL 1KN2L 2X4OB 2XWBA 2HJFA 5TDPA 3T2PA 3DYMA 5JOEA 5I74B 4YGVA 1NEZB 5MI0C 1KWGA 1X5GA 5CJ8A 4AYEC 5CF3A 3FMGL 4PTTA 1WITA 2YGVA 4UQ2B 4L3FA 1A9EB 2A73B 3WE6B 4FRWA 1XR8A 4FP8H 4AW7A 3LDBB 3O9WA 4UDUB 3UTTA 3PGCA 3KPRE 3PDGA 1ORQA 1CDIA 1UM6L 4JKKA 5AW4B 1E42A 3AABA 4CC0A 4F80A 5H37G 2UWEB 1W72B 4JKPH 3VJ6B 4X6CB 4R2GC 3VVWA 2LGNA 3H2PA 4J3OG 1IE5A 3EH5B 4FEIA 4JDVA 4HJJH 1MJUL 4JDEB 1YEDB 1XCTA 1N6QL 4P05A 3NIDB 3O41B 4AQ8A 3HG3A 5JHDD 1JZ5A 4LCCA 3K4AA 5C08E 3EO1B 3VI3B 3GRBA 3JVFC 3SKNB 3PWPD 1PZAA 4YQXL 3AFLA 5MEND 2W1NA 5EU7C 2GI7A 2WLHA 4P2CG 3RIKA 5HHVL 4PJ7E 3IJHB 3QJVB 4KRPD 4NPYA 3MLWL 4S0TD 2ZUUA 4I77L 4ETQA 4GUQA 2YBRB 3BKCL 3PHQB 4PLKD 5HHOA 3ZR5A 1V7NH 2H9GB 4HIQA 2IPUK 4M3KB 4XP6L 2CQVA 1UWGH 3QG7L 3MLSH 3MRFB 5JZ7C 4Q7DA 5HGHB 1F4WL 4XX5A 1D5BA 5KSAC 2A1WL 2BNRB 1HIMH 2OTWA 4WSGA 1BXAA 2YSTA 5LNGA 3IMVA 1PEWA 4JPVL 3TONA 5KVGE 1B0RA 1UD6A 4B3VA 3RIFK 5KYWB 1RZKL 4J23A 4NKQB 2QPSA 4CW1A 3AMLA 1BVLB 2Y1YA 4BA0A 2FE0A 1MCNA 2GAZB 3VWKA 2VUOA 3L9YA 1D5ZA 4F7EA 2Z8VC 1JPEA 3Q1SL 4G82A 2D8KA 4GT7A 4LLWA 1GOGA 3SGDI 2NCEA 1GW6A 2QT6A 2X5PA 4S1DD 5HHXL 2RH0A 3HC0B 2OSWA 3TF7C 2VLRB 3L3IB 4PJHB 5FM8A 3LQZB 3U30C 3UO1L 2R27A 4WHYG 4Z78A 3F01A 4JZNA 4O9HL 1P7KB 5EZLA 3L7FB 1CUOA 4HCRA 1N2RB 4JPWH 1KBWA 4MLIA 5JHLL 2TRYA 2XI9A 5HYJB 1KJ2H 1GYAA 1EWHA 1T83C 5GRWA 3VH8A 3BUPA 2PCFB 2Y7SA 4LT7A 2OJEB 1RK7A 2XN1A 3GGWB 4JFHD 4XRCA 1KXQA 5CEZE 1RPQA 2PWDA 3G9AB 3VXMB 2XTJE 3CXDH 5F1IB 3EO9H 2PXYD 3ZQ9A 2V9UA 1ESOA 4XHQA 5C6PB 3S5LG 3FYIB 4Q6YA 3SDXA 4HC1A 1BG9A 1I1FB 2R4SL 2QHRH 2XWEA 3FU8A 4TUOB 2DQFA 1YQVL 3ZYOA 4JRYB 4YR6B 2I9TB 2JE8A 4H7VA 3NESA 5DK2A 1FFTB 1G7QA 2R0KH 1I1YA 3OQRA 1E4JA 2VDNB 5DZVA 3CLEL 4AGOA 3JZ7A 2B1HL 3IKKA 5FYKU 1E43A 1PLBA 2Z92A 5KVGH 2XJKA 5HGGS 5DHVH 1EJ6A 4PRIB 2ITFA 2DQDH 3LXAA 3FU6A 4N2IA 1M4KA 4JPIB 1F1AA 2RFXA 4W4OA 4YBQC 5EO1B 4MDJB 4P9HL 1UXLA 2BZDA 1VGKB 2ADJB 3EF4A 4PVNA 5DR5H 5HPOA 5JPMC 3QO1B 4BUQA 2NY0D 5DVOA 1URIA 2ICEC 3V7AE 3FU5A 3HS9A 1I3RB 4S1SL 5I9QB 4PJCA 3MGOA 2HPOA 2C4XA 4X50A 5DC2A 1UVQA 1HL9A 1SXNA 4L9LA 3L3KA 2X44D 4RFEA 5CIPB 2NX5D 3L5JA 3GTTA 2A0LC 4A67A 1IM9A 3WD5H 1FVEB 5T3ZD 2A9CA 2UX7A 2O5ZL 4PS3A 1CGXA 4FNSA 4NJ9L 5IESL 4OI9A 2OCCB 4MMXC 2Y7MA 1M1SA 5HHQA 5JLZA 1JMXA 3MXWL 4NN5C 4UIKH 3BRFA 4U1SB 3VFOA 4PJGA 1OY3B 3ARFC 3DV6B 3QHZL 5SWSA 4B9GA 4PRHA 4Z6AT 3OR7A 2OZ4A 4D9RD 3S34L 4R7VA 1T89A 5HTSA 3BN9D 3HHSB 5CCGE 2R29H 1EMTL 1ES0A 2D7NA 2HLAA 1AD9A 3ATAA 1SQMA 4Z7WB 1PZ5A 1X5HA 3KPNB 3GSRA 2M26A 8CGTA 3D25A 5AG8A 4X4MA 5IK3A 3IRCA 1UWXK 3P30L 3O0RH 1B2YA 1L7IH 1CURA 4KKCC 3II1A 3TWCH 4AW4A 5DO8A 4KQ4H 5D5ME 5BPPA 2IBGA 2QKIB 3ZZQA 2QTEA 1EEYA 1WHOA 1N67A 1PIFA 2IANE 1K4DA 5IOPA 1ZS8B 4KKBD 5DJZB 5SWQB 4Q9QL 1OCZB 4U0QB 4G9FE 4X6DA 4F1SA 2XTJC 4OBSA 1I9RH 5JA9A 4WEEA 3NH7H 2YR3A 1RZJC 1GC1L 5HY9B 2AANA 2I69A 2E9GA 4X9FA 4XOCA 1OP4A 4ZFZA 1M6UA 4K4KA 4U6XB 3TPUB 4OAWB 2FUTA 4PB9H 4TQEH 4XGZB 4XO5A 4B9KC 3OAUH 3O11A 1CD8A 4GQ9L 1CICD 4WK4B 2GQHA 2CIKB 4RMRA 1NGQH 2W9EL 4HU2A 4OZHF 3C2AH 4QGYA 4LKXA 2IIJA 5J06A 5C0BD 2G60L 3JWDL 4Y89A 5EMYA 4ANVA 2WUBH 3HAEB 2VQUA 2YSSB 3AWGA 4OIBA 3KWUA 2GC4C 4LCWE 5LBGA 2WQUA 2H0EA 3WJMA 2J1WA 1CLZL 4FQXA 1QFUH 3Q6FB 2YAQA 4ZUSB 4LK4A 4Z7VF 1FVCB 5F1NA 4KXBA 1WK0A 2R2HA 4J6RL 4MTMA 4J3BA 4L29B 1TJMA 1TPXB 2TRHA 1ZVNA 4HQQL 1BZ8A 1GIGL 3QZLA 5H94A 2ZXAA 3OKLA 4IK7A 3P77A 4X99A 5T1JA 3OZ9H 5JOFA 2QVFB 1GY1A 1I4FA 5TE7L 2OAAA 1AI1L 5IW3A 4F33A 4QRPE 3A23A 1ED3A 5CEYA 4ONGL 1BX2A 2B4CC 4KUZL 3MJ7A 3ZDZE 1GJIA 4BWUA 4R2GD 3ZMEA 3NZHH 3HE6B 4EI5A 2B20A 3H9SE 5IMMA 5KSVA 2BIOA 3MCLH 4PBVC 4PN6A 2DW5A 3RHWK 3V4PA 1BECA 3V0VA 4HUXB 3LZOA 3WUWA 1Z9SB 5KJ7E 4LO9A 3IU4L 3SJVA 3SGEH 1KCVH 5I8CB 3WEOA 1FNHA 4L8DA 3I6GB 3IFLL 1YAZA 4TVSa 3K6SA 2MNWA 4QDGA 3FB6B 2WLMA 1AHWB 3RA7L 1PYWA 4UU9A 1LDSA 2MH4A 2N01B 5J13C 3JT0A 2FBOJ 4JFDA 4ZAKC 5EU5A 5CZKA 2BIPA 3SHSA 2YQ3A 1HHKB 1OGAA 3BLPX 1MPAL 4K15A 3BIKA 1TU2A 3MRBA 3VU2A 4JPKL 3B2VL 1MJJA 1WA0X 3APMA 1AGCA 4KDWA 4XCCL 1O9ZA 3RP1A 1B3JA 4OGYH 3MRIB 4CC4A 4NHUA 4LVNC 5DQDL 4P2QA 3FSWA 3N0AA 4GXFA 1RUML 2WIIA 3GI8L 1KN2H 3KWWA 1Z32X 3DDFA 1J5OL 1TTBA 4QHKJ 4PTUA 1BOGB 1CXLA 3WTWA 2UXFA 1J1PH 4CC1A 4CMMA 1MCFA 3H4FA 4MLSA 3ARPA 4WW1A 3MXVL 1BAGA 3VXUA 4LXFA 5E1AA 4HSAC 3BPLB 4N2AA 2BY1A 4F8LA 3DO7A 3DX8B 1P9MA 4H1LH 1LLAA 3MLTB 2DJMA 1UFGA 4TF4A 4FX5A 2EAEA 2YAEA 3UO8B 4NDMA 3LZLA 4FXGA 1T6BX 5D70L 4PM1A 3TV8A 4ZMXA 4Q97A 4OZ4A 1IX2A 4QMEA 1W72L 2PO6C 3ISWA 2P80A 4Z18A 2X10A 2EO1A 2ZZUT 3WN6A 1HCVA 2I07B 2LE9A 5CJQL 2MJWA 3AXLB 5BCAA 3MGAA 3O8XB 1FNSL 3QQ4B 1EFQA 2JCCE 4WI4A 5KUMA 2MQGA 1IBZA 3D3VA 2J56A 2YEVB 5AVUB 1N5YL 1E5UI 2E59A 3MGTB 5B3JF 4M7JL 4PJDE 1OPGL 4Z7QB 1A0QL 2HH0L 4K8RH 1OP3H 1ZGLA 1EXUA 3IRZA 1EO8H 1KTCA 1N10A 2BOBB 3WMSA 1VADA 2HKFL 2XICA 2R1WA 3GSNA 1JGLH 4IDLA 3BP6B 4QRTA 5GHWL 5F97E 3IU3A 4BZ1A 5LBVA 2Q7AA 1PFCA 2ED8A 3FT2A 3DK2A 3QG7H 4ZMPA 2YPVH 3QDJB 4AEHH 1W16A 1EZUA 2WO3B 5C08D 3AROA 1JYNA 3D30A 2KDYA 3FU0A 2AJXL 3Q8EA 2IDUA 2VXUL 4OD3L 3EHBC 2ESVE 2IMMA 2DLGA 2VUYA 4KJQC 3WEBA 4HGKC 1JZ8A 1A64A 1IILE 5T5FA 3QK0A 3ZHFA 5GS2H 4QRQA 4TUJB 4L1SA 5EIIG 3U46B 2V3EA 5LHDA 3ZR6A 2VCOA 2VABA 4XNMB 4E0RA 4ILDA 4W9IC 3I6SA 4YSOA 4ETYA 2HSIA 2LV4A 3KM1A 3NJIA 3PREA 2GW5A 4JGUA 1UD2A 1E30A 3CSYB 5DZ9A 4K8RC 1P4BL 4ZK8A 5E24E 2LU4A 4O9HH 4C4KT 5AAWC 3ARFD 2GHWB 5IROA 4LLVB 2G3NA 4AYSA 5DS1A 3NSCA 4NZUL 1MFBL 3P4LA 1MUJB 4EZMA 5IUSA 2VM9A 3QHFL 2KZ1B 2JVUA 4Q6IA 3OGCB 1J5DA 3DTXB 3PLYA 3WKPA 5C3LD 5M94B 4XVUD 2NNXA 1YLBB 3MODL 1A6WH 1OOAA 4ONOA 4WFEE 3EJJX 5F7AA 3W0WA 2XWBB 3EGXB 3HG1A 4LLDA 2HJFB 1M7IA 1QEXA 3OKKB 5TDPB 5DA0B 2AQSA 3VI4F 3Q01A 4Z7NE 4N3UA 4GS7B 4JG0L 4I1NB 4HUVA 1HSBA 5JDSA 2J3SA 4KKCD 3DURA 1IC5H 2XXGA 1HCFX 2VN3A 3SDDC 1RZKC 3ELAT 4PTTB 1J86A 1TMQA 5C2BH 1XR8B 7PAZA 3L4WA 2YEZA 2A7BA 3O9WB 5D4QA 3RIAK 1UD8A 3UTTB 1SLUA 2FNBA 2HG5A 3H42H 4JKWA 3PGCB 1OAJA 1ORQB 4A2DA 5CEZD 3RUGA 4OZFA 4WUKL 1OAQL 2XTJD 2B0SH 4WNSA 5D55A 5ESVA 2JELL 5IVNA 3GC3A 2F5BH 1BZOA 4FFTA 3IKCA 3Q2NA 4CSTA 4HPOH 5D8JH 2JKIS 4JDVB 4HUCA 4FKKA 2J5WA 1MG3C 1XCTB 1I8LA 2YAHA 2CO3A 2ZUTA 1GGBH 4LCCB 5MEQA 1XTLA 3PXHA 4P04A 4QXGL 1OSZB 2IPUG 2VXQH 5ACLA 5CJOL 3QDGE 3I9GL 4HPYL 1KTDA 2P5EA 2ZX8A 2E8ZA 1DQDL 3IJ7A 5IHLB 3IS1X 2MTAA 4GAYA 1WTLA 5E99H 4J3VA 5DEZA 4NPYB 1XF4A 3OB0H 4IRJC 4M1DH 4AYBA 3JV6A 4ETQB 4Y16C 3FRUA 1SEBA 2VDQB 5HHOB 4PJAF 5DLMH 3REVA 5IF0A 3PJLA 2XY2A 4TVPL 5J1AB 1TITA 3C08L 4XNBA 3OKOA 4HIIA 1JZFA 3KPQA 3QRLA 4EZJA 1S8DA 1D5BB 1F4XH 2AK4D 3MBEC 1TG8A 4OJFL 3X1EA 4E41D 5B3NA 4EMZA 2OTWB 1SJXA 3S34H 2K6YA 2ISDA 3CZKA 2YD7A 2R69L 3SE8H 5AYUL 1B0RB 1EMTH 3ZE2B 3HBPA 2I9LA 3VGFA 4CW1B 3VFVA 5KVMC 1U3HA 4Y4FA 3VWKB 1YCSA 4HS8H 5FHBL 1D5ZB 4F7EB 1RHFA 4LLWB 3OPZL 2BSDA 2H32H 2JJSC 3NDZE 1X4YA 1H3WM 3PAYA 1KIRA 4WVRA 4Z78B 3IGFA 1XHHA 2K9UA 4JZNB 3EFOA 5LN8A 5EZLB 3CJJA 3CSTA 4OUUA 1YYLH 3ZYJA 3CFDB 1X7QA 1ASOA 2J88H 3D52A 1BREA 2WY3B 3NGBC 4ORZC 4YDLC 3VH8B 3ABGA 3T04D 3T6WA 4ACTA 4BJLA 4YC2B 1UKTA 4PJBA 1YEEH 3BI9X 3L54A 1CL7L 3FO0L 3V4UL 1NL0H 1FSKC 4CDGC 3QWQB 4XRCB 1MW3A 1NA8A 4XVSH 3PRZA 2Q6WA 3Q43A 1FL3A 4C4KO 1UB6A 4L1TA 4FXLA 4YHIA 2J8OA 3FTXA 5LBSH 4JREB 3BKYL 3ZKSD 4ZAKD 3FQTA 3SDXB 1I8KA 1B9KA 1FYTE 2XQ0A 3LXBA 5CLTA 5IGXL 3LCYA 3ZPDA 3ECUA 2DQFB 3DPBA 1YNLL 2K9FB 5DK2B 2IAND 2E6QA 1G7QB 4XMPH 1I1YB 3GO1H 2V5SA 3NJGA 4G9FD 4CADA 2ZWKA 4YHML 2Z92B 3HA0A 3RJOA 2BP3A 2YD1A 3DSFL 1FLRL 2E27L 7FABL 4Z3HA 1FH2A 4PV1C 1MH5A 4KJWC 5IQLA 1ZT1A 2D3NA 3O4LD 5A43C 2RFXB 1W8NA 1KCUL 3CN0A 2PPFA 1BWMA 1JRHL 3SN6N 2ZKWA 2E4FA 3CLWA 3QJOA 5DJ6A 4HQQH 1T5WB 4K2UH 2VRKA 4PJCB 3KJ4B 3MGOB 4ELMF 3DIFA 1LK3L 2VSCA 1KBGH 5FDWA 4M62L 1UVQB 2H0PA 1OP3K 2ERJB 4MDRA 4L9LB 3K7UA 5BRZE 3L3KB 4RFEB 4K3DL 4LCWD 1ZV5A 5DZLA 3ASWA 4BZ2A 3CZUB 2PO6D 1IM9B 3MSPA 4M7ZC 2C9AA 4RBPH 1QWNA 3I84A 3LRGA 4G7VL 5KTEH 2DMGA 3QUHA 5CS7A 1UZ6E 1KIUA 5HHQB 5CD3A 4N26A 5JLZB 5I24A 1B4RA 3SCMC 5DUPL 4QIRA 2XXMB 2ZX6A 3VFOB 4I2XE 4PJGB 1MRFL 2VXTL 2ZOOA 5SWSB 4PRHB 2X28A 3RQ3A 1MFEH 3OR7B 4O4YL 3RJDA 5C7XH 3IU4H 1OEZW 3TBWA 1OF2A 5FW7A 4AX3A 5D72L 4QRPD 2WBXA 4FQLL 1DP0A 2EDEA 2MFNA 2Y2YA 1ES0B 3KCPA 3IDYC 4L2LA 5E2VH 4PMFA 4BUHA 2HLAB 1AD9B 3C8HA 1PZ5B 3GSRB 4HZLB 4PY8J 3H9SD 3D25B 3GRWH 3VX1A 4AWJC 2CO7A 1JZJA 5IK3B 3NIFE 1MPAH 4MJHA 1JPFA 4FLRA 1CFQA 4JPKH 2D0FA 1QSFA 4XCCH 4L0ZA 4PWEA 1OKEA 1UJ3C 1X4XA 5HVHC 5DQDH 3LH2H 1JXFA 1K8IA 4N87A 1EEYB 1A65A 2PW2A 2ZP9A 4KJQD 1K4DB 2E9BA 5IOPB 5EF2A 2V9QA 1ZDSA 4X4ZA 4HAKA 4X6DB 4ZTOL 3SBQA 2O72A 4DTGL 2V2TA 4MVBC 4BE6A 2XZCH 4J3TA 4ZFZB 1EANA 3ZE1B 1EERB 2AEQL 5D1QE 2WMPA 2Q3AA 1ZVYA 2MPVA 3D09A 1C5BL 2E7HA 4G70B 3VXSE 4NP4L 4JFOA 3AY4A 5A40E 4YHOL 5J9PB 3O11B 5I1CH 2FYYA 5I71B 3D1MC 4JFSA 2XKNA 4OCSH 4LKXB 4ATTA 4N0YL 5D70H 4QRRA 5J89A 5ILTH 4ZBJA 4PJFF 4OV6F 3RY4A 3B3IA 5AKSA 3FKUS 1EEQA 4PJHE 5CJQH 2ZAIA 2WLYA 3DX9A 3FFOA 2KLTA 5ESAB 5GGRY 4O02A 4FQXB 3N6YA 4RFNB 1ZJAA 4FNRA 1E8YA 3DJRA 1N5YH 2CBTA 1FZMB 1TQBC 5F1NB 3CIAA 4Q9CA 2R2HB 1OV8A 2FEDD 2O1AA 4GEJA 4XP4H 4YBLB 2E7LA 1A0QH 3LH9A 3SDDD 2QQKL 5H94B 5ITFA 3UJTH 1EJOH 3BN3B 2VZVA 3OKLB 2YGPA 4WEBL 3ZQXA 2HKFH 5C09E 3P77B 4G83A 4X99B 3FRPG 1E0OB 4FAAB 5JOFB 2HP4A 4TOYH 1I4FB 1GSKA 3ZTJH 3FNKA 4OFKA 4FXKC 2MQ0A 3DBXA 4JO2H 4YSRA 4F33B 1JZ6A 1ET8A 1ED3B 5CEYB 2CHXA 1BX2B 4U6VL 4KRNA 3MJ7B 4MA7L 3QNZA 3OB0K 3R8QA 3X14A 4FQJL 1TZ8A 4EI5B 5IMMB 3IDIA 4WUUE 3RY5A 3TF4A 2X6UA 3QAQA 1QPPA 1JPTL 4AQAA 2VXUH 3ML9A 4OD3H 3QXWA 3OHXC 4FQIL 4UYPA 3RTQA 5SWZD 3MJ9H 1QBLL 1OSEA 3V4PB 3V0VB 3D4CA 3WUWB 4DP9X 1K85A 3SJVB 5E7BA 4JHUA 1WIUA 1KJ3H 3K6SB 2VO5A 1DBAH 1PGRB 1R24A 2P3YA 4NUMA 2CKBL 4IRJD 1H8OA 1PYWB 3TYFA 4UU9B 4Y16D 3MNVA 1JZEA 2E74C 2QFRA 3P69A 4RZCA 2OMYA 1P4BH 4I13B 3NSXA 4JFDB 2BJMH 5EU5B 4OF3A 1OGAB 3QA3A 4M6NL 2XLLA 3BIKB 1TU2B 1ACYH 2AI0L 3MRBB 1IZKA 3MBED 3R4RA 1MJJB 2ESVD 4YHLL 1AGCB 2AV1A 2W8CA 3IGAA 2AJVL 2W88A 5I75C 1KY6A 1CI5A 2WTOA 3GLDA 4NHUB 3CVDA 3EYOA 4U3SA 4P2QB 4G5AA 4KMTH 2BSSA 5HDQL 3CVHL 2WIIB 2K0RA 3KWWB 3TJEL 1QW8A 2VL5A 4PTUB 4XN2A 2Y1AA 4AG4H 4AUYA 1C7SA 4TVPE 4CMMB 5D1QC 3X11A 1YC8A 5FCUH 4WW1B 4TM9A 4DN4L 1LQSR 2ZTBA 3VXUB 4FNUA 5LDSA 1IGCH 2Y06L 1IT9L 5E1AB 2MHAA 1JHKL 5MEOA 1VIWA 3SGKA 4F58H 3DO7B 1YSOA 2IBBA 1DO6A 3MKGA 4PFEA 5JPNB 2N3JA 3TFKC 2DJSA 3F6JA 2VDLB 2W95A 1QKZH 1ET7A 4NDMB 1UB5A 4FXGB 2TSBA 5BRPA 1QRNA 3OJMB 4WFED 4HBCL 4OZ4B 3T2LA 4IBVA 1G0DA 3BUBA 4HW6A 3S36H 1CBVL 3HE7C 3NCFB 5GRZA 3EH2A 1QLEB 1I3GL 2WCPA 1LWJA 1UOKA 3L45A 5DO2C 1CBJA 4G3YL 4WK2B 1T4WA 3PAUA 2NR6C 3D3VB 1OAKH 2VE6A 1BSIA 3NSJA 4ELDA 4MZ2A 3C6SA 2AJUH 5CGBA 3ESPA 1ZGLB 1ETB1 3CFKA 2X1OA 2R0LH 1EXUB 4JRXA 3NBNA 2KH2B 3IDMA 4L8SC 4AL8H 1VADB 1IAOA 3EADA 4EZKA 2WXNA 3VD3A 2E0PA 2R1WB 3GSNB 3VE0A 4B27A 1LMIA 4G5ZH 3RPIA 4KJWD 3NACH 4PI0A 2VJ8A 4QRTB 2AF2A 2YGQA 3D9AL 5T1LA 1F3JA 4RBPK 1XF5A 1F4YL 3QYMA 2WQSA 3F64A 4YXKL 2J6EH 4RRPA 5DRXA 4OJFH 2ZF8A 3V9CA 5C6WH 4HH8A 3P9WB 3FO2A 2NY6C 5C8JA 3ZDXB 3H6AA 3EGDA 5LXVA 4JJHA 4RLDA 5DGRA 5EULV 4FQPA 4OBRA 2A74A 2UY7A 4QRQB 5F89A 4OLUH 1X5IA 1G9MH 5FHBH 1MREH 2VABB 1T1WA 1CTMA 4E0RB 1VEPA 3FOLA 3FAXA 2OMWA 4YO0A 3DVFA 3V7AG 5HGBA 2CALA 2DTML 4QRBA 3NPSB 4LNRA 5FGBA 3SCMD 5EWIL 4HCRL 4U6YA 5C7ZA 3PV6A 4O51A 3RZCC 1S7WA 4GKZA 5GRYA 2WLZA 3HRZC 4XP9H 4Q6IB 2K4AA 1PU0A 3F3HA 4ZYKA 3E1ZA 2C3VB 1UA6H 3LV3A 3ZU8A 5FGCE 3V4UH 3GXDA 1UOLA 5F9JB 2X2HA 5FO8A 3MYJA 3N40F 2NW2A 3ALWA 3QCTH 3W0WB 1U6AL 3HG1B 2NY4C 4LLDB 1M7IB 5E1GA 2WYTA 1JD7A 3CZSA 4QOKA 1E7UA 3BT2H 4YE4H 3IF1A 4HUVB 2ZWSA 1HSBB 5JDSB 4XO9A 4RX4D 2QSVA 2VQ1A 3FFCA 3WKYA 3DURB 1BYOA 4DKTA 4RESB 1O7SA 3HBZA 1IKNC 5D2NA 3N1GC 2RMNA 3G5VB 1UWYA 1J9TA 3QG6A 5MP6L 5IBUG 2YEZB 2CGRH 3DX6A 3LB6D 1UT9A 2HG5B 4N5UA 1KDJA 3APNA 3RGBA 1H6FA 5DQJA 3RUGB 5ESVB 2AXWA 1LHZA 5CGTA 4XP1H 4MVBD 2QKIC 3S48A 3IKCB 4GP4B 3POHA 1FYTD 3PP4L 4ZFOA 1WFMA 5GJSL 2DYPD 2BSCA 5DJ0A 5MEQB 1LK3H 5GRUL 2OSYA 1JP5A 4M62H 3R18A 2BO0A 1WWAX 3FN0L 3C9NA 1KTDB 3WJJC 2P5EB 4JQVA 3CNKA 1E4WH 2A9DA 4GAYB 1JFQL 5D7IF 4JQXA 4FA6A 2XWJA 1XF4B 3QEQA 1A25A 3JV6B 3FRUB 1SEBB 2IDFA 2BX5A 4PWKA 3K5SA 1VFUA 1MFDH 1ZSHA 1DEEA 3ESNA 3HIZA 1NKRA 5IF0B 1OO2A 1PKQA 5EUKA 2EIEA 4FCAA 3HS0A 4UQ9A 4HIIB 5FDYA 3KPQB 2OZ4L 3HB3B 1S8DB 4JN2A 4WCYL 2Q8BH 4PMEA 5BRZD 1XCXA 3QPQC 4F9LA 5AAPA 1IGTA 3CN4A 2OKMA 4ECNA 1RKRA 1R34A 1OCCB 2I9LB 1SHXA 1SDAB 2W0PA 3VFVB 3RPKA 5INDB 4Y4FB 4W68A 2JV6A 4E9WA 2DQHL 1HINH 3WV0A 2Q76A 4MMYA 4N2DA 2CK0H 1QLRA 2YS4A 2L8AA 2O5NA 4QR7A 1BQ5A 1KIRB 4HXAL 3EFOB 3LXCA 3FH5A 4OUUB 1BF5A 4ZUUA 4B95C 2FO8A 2PCXA 3TASA 2PCPA 3ET9F 4R4NC 5IHBA 3RX5A 1IGFL 1N18A 4LPXA 2E86A 4PJBB 4UTBH 1CE1L 4K23H 2Z7ZA 5IM7A 4H1LG 5DZOA 3PQYE 2Q6WB 2DKMA 4F2ME 1GJUA 1LL1A 1FL3B 1NIBA 1H19A 2CGZA 4YHIB 1VZGA 5CBAA 1E5YA 3K4ZA 2QVIA 3ZL4H 4UMSA 1E65A 3FQTB 5K9JH 1I8KB 3V0WH 4NQEE 3KPSA 4OGAC 4X6EA 4YXLH 3DPBB 1THAA 4CKQA 5FR3A 2IVFC 3L9BA 3A0OA 4XAWH 1FO0H 2LFGA 3RVVD 4HKJA 4X9HA 3NJKA 4TNWK 3HI1A 4CADB 4GKSA 1BVZA 1JHTA 2EIBA 4PJIE 1MEXL 2FECI 2BNRD 1MH5B 5IMLA 1ZT1B 4WF7A 3K0YA 5D1QD 1XGQA 3OD3A 2FSDA 4HP5A 3VXSD 2WB7A 2LR4A 3LZFL 3RHWF 1MCJA 1PY0A 2OL3A 5BO1L 2XOTA 3R06A 1RJYA 4GW1A 4XVTL 3U7YH 2Y5TA 1CD0A 3DIFB 5FDWB 3UJJL 3LXUX 4I18A 4HZ1A 4IOFC 2WKLA 2N59A 4IDJL 4ZOBA 4DKEL 2VLRD 4FFZH 1ID2A 2AERT 3BLKA 2DRUA 4F8TA 4QJ5B 5ECJE 4GO9A 2ZCLL 3HE7D 1AO7E 4EN3C 5DO2D 4LMQI 4F2EA 1KXVA 1KIUB 2J4WH 2NSMA 3RVUC 2NR6D 4JG1H 5AALA 3VB8A 1N3NA 3ILQC 2EKJA 4M03A 4YSQA 2AZAA 3MO1A 3V4PL 1QBLH 5FYLL 1N0XL 3M7OA 3NA9L 2LAAA 5AENA 5C09D 3VXMD 4DK6A 4UINH 1V3LA 3WIHA 3TBWB 4ZMYA 1OF2B 2YRBA 5I0DA 1KFAL 5H35A 5TF0A 5I0YA 3ARBA 2AXJA 4OZHA 1N8OE 2IGFL 3KCPB 1S2EA 3D0AA 2Q0ZX 4JRYD 4PJ7F 5BV7H 4U0RB 2VTFA 4WUUD 3QJXA 3IJYA 2CO7B 3X1GA 3TH2T 3K81A 3P73A 4N0FB 4LHUA 1DVXA 2EP6A 1JPFB 3UTSE 1KYOK 1QZNA 4YHLH 2IGLA 1FNAA 4D0BA 3A4FA 4PRID 1QSFB 2AJVH 2NY6D 5E2JA 2AQNA 4LOEA 4KX7A 1P4IL 4V11A 2LQRA 2H6OA 4HOMA 1K8IB 3ZOAA 3VQ2C 4TULL 4KAQH 3RVXC 1BF8A 4E42A 2VSDA 1YECL 3KYNA 5EOTA 3T0WA 4ABWA 5L9DH 4DQOL 4J28A 5E08L 4PWHA 2V2TB 2DKUA 2NRDA 3LIZA 1ZHNA 1MFUA 4G11A 4LMQE 1LNUA 1BFVL 1NFIA 2WMPB 3KWTA 2LU3A 5I19H 1KPVA 2DEXX 1ITCA 4AEIL 4JFOB 2OMNA 4RRPM 4P5TC 4NKOA 3D4ZA 5JOPE 1IFRA 1RURL 4HPHA 2FYYB 3KLSA 4V2CB 5KN5A 3VACA 1J9SA 4EUPA 1JTOA 2ZYRA 2XKNB 2WXRA 4P4KA 4QRRB 4EIBA 4YHKL 4HBCH 2LLGA 5F3BA 4Z5RA 4NM4H 4TVPD 2FX9H 2NY4D 1JZGA 1MY5A 3DX9B 4PY7A 4O02B 2Z9TA 4MJ6B 4FQ1L 3DI3B 3SPIA 4HUKB 3C2SA 4JM2F 1A7NL 4URTB 4ZODA 1TVBA 4UV4H 4D3CH 2EDKA 4FTVA 1DTUA 2DOCA 2BSTA 5BVPL 4IBTA 4ODWA 5ITFB 1BMWA 1NH6A 4EDWH 3FUJA 1JIBA 2CPCA 4YXHH 3GSNL 4YUEH 4W9EC 3ZDYF 5CKAA 3WEMA 3DBXB 2J1XA 3KPLA 3MKKA 4RGMB 1HK6A 4JM0A 4DW2H 1YMHA 1DQIA 1J0IA 4J27A 4XWOD 4BZ1L 4LL9A 1JDDA 5C07E 1A3LH 1WC7A 3AAZB 5T3XL 4UTAH 1H5BA 1FFPA 3T3MB 3UAJA 3X14B 2APXA 4ZQTA 3IDIB 1EJ8A 4Z0XA 4W6WB 4WO4A 2J5LB 2ADIA 4AQAB 1MF2L 2Y7LA 3RTQB 3SPGA 3D39E 3CX2A 3QYCA 1QPKA 1DCEA 1PNDA 3NCYS 4W9DC 1PD6A 5H37A 1RCYA 3NCCB 4HJGA 4E9XA 3TEYA 3I6KA 3M1CA 4NFBA 4XWGH 2VW7A 3DYPA 4ZUTA 3TEZA 1S7XA 5E1QA 3ZE0E 1R24B 1SVCP 2WSKA 4EKXA 1HWGB 1ZMYA 2B9BA 3UIZA 1LO2L 2BRQA 1XL6A 3GF8A 3TYFB 3D50A 3MNVB 3U9PH 4K3JL 4OB5L 2OMYB 4PP2A 4MZ3A 3QA3B 4YSDA 1YYML 2IAMC 1UEYA 5DD3H 1TTUA 2DWSA 1YEHL 3G5YA 4OGXH 5AL8A 2YD2A 4LCUA 5AW7B 2AV1B 3IGAB 4TQHA 3RIAF 2CMRH 5BZDA 4U3SB 3EYOB 4PJ5A 3QPQD 3B9DA 5K9KA 1YN6B 4OLYH 2CE6A 3WDHA 1S5HA 1CLYL 2B3IA 2ZXBA 4BDVA 1ADQA 2VL5B 2H1XA 5FB8A 1XF2A 5EEUA 5CP7A 4AV0A 3K46A 3X11B 3SKOA 3DMMC 3HFMH 2F58L 4NQUA 4BFJA 5DEJA 4JM4L 3WNOA 3L16A 3VYOA 1QZ1A 3VFWA 5MEOB 1PZCA 1NGYA 1OD7A 3AU0A 1F0LA 4FL4B 1LWRA 3AM8A 3NTCL 5JXEA 1CVRA 4Z7UE 3A4AA 4JRLA 1NMCC 5L6YH 2JSFA 3HE6D 1A14L 1UB5B 4R4ND 3RDTA 4J4PA 5JR1H 1N64H 1QRNB 1JL8A 5LWYL 1UM4L 4KROC 2QGCA 3RX8A 1Z2KA 5DJCA 1KUMA 1GHFH 4L5FL 4XO8A 4N24A 4X8GA 1LTXA 3DETC 5CP3H 3MV8E 3SDCA 3ME0A 4HJSA 2W0KA 5K1JA 3TO2A 5FYJE 1IBHA 2VE6B 3V52H 1C9SA 3MLVH 2VLKA 4OGAD 3C6SB 4RMSA 3V79C 4KY1L 2C3XA 1WQVT 3CFKB 3NIGF 4LCYA 4JRXB 4N6RA 5CNHA 5I1AA 3LNEA 2NT1A 3IDMB 3QPXL 1IAOB 4Y4KA 4IHOA 3VRIA 3TJHC 1SOXA 4ZMZA 3S5LA 3WLWD 3VE0B 3RPIB 2EYTA 2EZ0D 2FIKA 5HDRA 1ADWA 2DQGH 2CD0A 5T1LB 1F3JB 4TNFA 2WZPD 3FULA 5BUGA 2V5YA 4HEMA 3VI4A 5DRXB 1ID5I 2Y6TE 3OMIB 5I6LA 1XEDA 3FO2B 3WFCH 5C8JB 4NBZB 1C5CH 4K0OA 3EGDB 1MVFA 2Z0UA 1BVNT 3M8OH 3FTGA 2K7PA 2ZWNA 4GBXA 1AC0A 4HA1A 1OGTA 2FT8A 4IOFD 1FDLH 3DI2B 2RHEA 2O5XH 5IQMA 1XB3A 2A74B 2UY7B 5F89B 5FLVA 3C5SA 2YD5A 2IFFH 2WXQA 3BJLA 2DQHH 4BSWA 4AYID 1T1WB 2X2IA 2LTQB 2V7HA 3FOLB 1YUKB 4YO0B 1DVSA 5JUEH 3PCYA 5FFOA 2NTSP 2DL2A 5CJXC 5HGBB 4EN3D 3SO3C 3HHRB 3ZDZF 2J8UE 4GIAA 1WIPA 1MJ8H 4H0IA 3U9WA 3RVUD 4D7BA 4LNRB 3W57A 3AU1A 4DIXA 3ILQD 3UJIL 5BOPA 4G59C 4U6YB 2OP4H 3PV6B 2FATH 4H8WH 3HPLA 2Z7YA 4O51B 5FYJH 3A24A 2YPLE 1S7WB 4GKZB 1P84K 4M1CC 4YDIH 4W9JC 3QS2A 1FGVH 4BKTC 5I2IA 4OR1A 4ZYKB 5TQ2H 1TQUA 5HXMA 3LV3B 4NQXA 1DVFC 1SXBA 3HC2A 1TENA 3DGDA 3MYJB 2NW2B 3M07A 4LLMA 3S97C 4ES9A 5FO8B 1DFXA 4ONHA 1RIVL 4HOXA 2PTVA 4R0LC 2WVUA 2WZ0A 4QOKB 5J3HC 3IF1B 4H25A 1DE4A 2VQ1B 1TETL 3FFCB 1MQKH 3IDJA 4PJAA 3B37A 3DV4A 2WUCH 3QVAA 5EZOL 5KANI 4Z77A 3CXHK 1YMMA 3WTVA 1O9VA 5D2NB 3DOHA 3PV7A 1NPNA 5FM5O 5B3SB 2WN3A 3QG6B 3DX6B 3RVXD 4BCZA 2CBPA 3T2OA 1JZHA 3PWJA 3W9DA 3G9VA 2FUQA 3PQYD 2P8MB 1AGBA 4Z7OF 4Z23A 2PF6A 1MCKA 2FO4A 1NSNL 4H8WC 4M1GL 4NQED 4AI7A 4ZFOB 1R9FA 2Y7NA 5IOKA 3DUHA 1JGDA 4NN6B 1ZWIA 1IE4A 1NZRA 5HSFA 5IP4A 4P5TD 4GMSL 2IWGA 1TJHH 4HCGA 4OLVH 5DJ0B 2HTKC 2V33A 2XX1A 3N5AA 4HYTB 3UJJH 4FZEH 3HMWL 3BT0A 4DP0X 3ULVL 2WHVA 4A6YA 3LN5A 4NUGH 5E9DE 3O4OB 1E9QA 4MB1A 4Y2DA 4LEOA 3KVPA 2I60H 2CO2A 4L4TA 4XNAA 2XWJB 4LSRH 1I53A 5F8QC 4DP5X 1OAUL 2IFGA 2WNGA 3QDMA 4A1RA 3MRHA 4XBGA 3WCYA 2EEBA 5GGQH 3QZMA 5B1AB 4OLZL 5GGUA 4G1MA 3SBPA 4KK9C 1DEEB 1B2WL 3WEAA 1PKQB 5EUKB 3HS0B 1KCWA 2JI2A 3KM2A 4JN2B 1JNNL 3UC0L 1HDMA 2H2PC 3VXPA 4GYBA 4PJDF 5LB1A 3ZIYA 3GIZL 2G9HA 1XB8A 1IGTB 3CZFA 3DX1A 2G5BA 4NFDA 4NHCH 2IGFH 3S3JA 1CFSA 4R4FL 1WO2A 2AQRA 2QBWA 2CKNA 4P9MH 1BYPA 2BW5A 3GSWA 1USZA 1AO7D 3CFEA 4QRFA 2NSXA 3ARZA 3I2CH 3HVNA 2Q76B 4DEUA 2DM7A 5KVEL 4MMYB 4A7SA 3O9WD 5I18H 1QWUA 3UTTD 3MLZH 3RWEA 4QUOA 1U0QA 1QLRB 1MHEA 4QXWA 3HVDA 1L0QA 3JWNH 4RAVA 2WAHA 2ZKMX 4PSRA 4ZUUB 1CU4H 3A67H 3QUML 2PCPB 1V5JA 2VDMB 2JMRA 3CPLA 4OQTL 3SPHA 4Z3JA 1UA7A 3L08A 5T3XE 1WFJA 1ZCRA 1A6UL 2H4EA 2ZXWB 3EYQC 5DFAA 3RNQA 2OI9C 3TBYA 3ARVA 5GGVH 1CYGA 1NCCL 2BK8A 5LAXA 5IM7B 4EVNA 1BFVH 1ZTXL 3SSGA 3GM8A 2Z35A 1WFUA 3GMQA 5CBAB 3U7AA 4YDJA 1YY9D 3PIQA 2R9HC 4GMTL 3KPSB 5F7DA 3WFBL 2CDGA 4X6EB 3QUZC 1RPUA 2WVTA 5C3IA 3OMAB 4OZIE 2A77L 4LEEA 2ZPKH 1BMZA 4RGNB 5F0LB 4HKJB 5HHOD 3PE9A 5LQBH 3HI1B 4DK3A 3NDYE 3VFMA 3MV7A 1ICTA 2AW2A 5IZ7A 4GKSB 1JHTB 4ZW8A 3TYGL 1AY1L 1GTNA 5IMLB 2M2DA 2B14A 1MHCA 2WTPA 4YBHA 1XGQB 3B7UX 1X5KA 3DMMD 4RFOH 4B5ZA 4NS0A 5B39G 4RMBA 1KXTA 3BH8A 3QZPA 5DQ9A 4CRPA 4MGXA 4Q2ZA 2Y7QA 3RFZC 4GAJH 4D2NA 1BFTA 1RUKL 2OL3B 2G3ZA 3R06B 1RJYB 4GW1B 4OTXL 2Y5TB 4U4IA 3PWNA 3MNZA 5JHMA 4LAQL 1LWHA 1YNKL 1RJZA 4I18B 1A7OH 4JGMA 5DCCA 3ROOA 2ZX7A 3VG9C 4DH2A 4P8QA 3WDJA 2XWRA 3BD4A 1KB5A 2Z1PA 5BXFA 5CSGA 5E1HB 1P9MC 1ZIBA 3QZWG 5F44A 3DETD 2VDKB 5F93C 4FXGC 2QQLL 3ATEA 1BOYA 3N04A 1EGJA 1N3NB 4O5LH 2YAMA 1DQVA 3MO1B 4EOWH 4EO5A 4CKVX 2Z4QA 1T7WA 2APFA 4R6UA 5IFAL 4IOIB 1ULVA 4E5XG 1L7TL 1THCA 4CU7A 2C9QA 3E8VA 3WNPA 3N42F 4FZ8H 5H35B 3TJHD 4L5FE 3ARBB 3CQFA 4JK0D 4OZHB 2X87A 3S9DB 4WWNA 3Q5OA 1D5RA 4PJFA 1L6ZA 5DJDA 4M93C 4H88L 3VDCA 2EIJB 3IJYB 2HZHA 4NRZA 2DYSB 1KYFA 3P73B 4LSPH 3B2XA 4XN8A 4LHUB 5AG9A 1DZ0A 3QCVH 3IRPX 3D39D 5FUZL 4LFHD 2FNWA 4D0BB 1P6WA 3RWJA 3KXFE 3V4VA 1X5LA 3THMH 1LEIA 1NIDA 1QFOA 1Q1JL 3UACA 4CVUA 4WY7L 5I1LA 4E42B 1RZ7H 4DGYL 3PAVA 3KYNB 4KMLB 5EOTB 5FA3A 4PV8A 3QEUA 1W15A 1Z9OA 1JGUH 4MDIA 2O5YL 5DFVD 1PX4A 2HTLD 5MENA 3CDZA 3P4OA 5AVSB 3COOA 2YMXL 1ZHNB 5J8OA 1LNUB 1NFIB 1KPVB 3SZKC 2PWGA 2YN5A 4NKOB 5D9SA 5AQ0A 5EIIA 2QPUA 1DJZA 5KN5B 5A1AA 4EUPB 1JBJA 3LD8B 3KWVA 4P4KB 2XN9E 4N86A 4NM8H 3ZIMA 1JDAA 3U6RA 2CAKA 1DVFD 2YIHA 2RIKA 2YEQA 5F3BB 5IVXE 3UZEA 4Z5RB 4KPHL 1LQBC 2YKLH 3V6ZA 1XGYL 4PY7B 4O2CA 3ARDC 5J3HD 3V8OA 3BC9A 2X1QA 4Y2OA 2PPEA 2F9BT 3FB5A 2P26A 2X1PA 1AZBA 1TVBB 1WIOA 3DOIA 4FTVB 2CUIA 1HXYA 2BSTB 4S1RH 4ODWB 4MFHA 3AWFA 1FC2D 3SYAA 3QEHA 4G42A 1CN4A 3KR3L 3KGRA 5I15H 3UTPE 1GGUA 12E8L 3DO4A 4P3CL 3KPLB 5DVNA 2KT6A 1TYRA 1YMHB 3VXRE 5EBWA 2HJKA 2PYFA 1WC7B 3AT0A 2VKWA 4K7PH 3MV8D 4KV5E 4P5MA 5AW6B 1H5BB 1FFPB 4JVWA 1YEKL 4IMKA 2FLRT 1S7RA 5JW3H 4EXKA 1SUHA 4AMXA 4Z0XB 4WO4B 1OB0A 2UXVA 3Q9QA 2ICWJ 1NC4D 3T0VA 2HTKD 1B4JH 2PXYA 4TNEA 4H2CA 4P46C 4UM8A 2EECA 3BZEA 2Q7YA 5AW1B 2APBA 1RUAL 3P0VH 4LGRB 1QSEA 2LT9A 4HJGB 3TC9A 3L1OL 3I6KB 5C0ND 1I8LC 2R0ZH 3LNFA 4FJZA 1Y6MR 4ZUTB 1KWKA 1S7XB 3O2WL 2C3HA 2ZOKA 2DZEA 4Y9CA 3AQXA 4IRSA 3C8DA 3CN2A 4RCAA 2WGNB 3CVIL 5FWQA 4KK9D 3HLAA 4PP2B 2AJ3A 1ETZA 4EIUA 1TTFA 3FU9A 4LP5A 3IDXL 4MJIE 4X4KA 3GJEA 1DANT 1OAYL 3IDUA 3G5YB 4K07A 2H2PD 3QQDA 1NJ9A 2CLVA 3QDAA 4FDWA 4LCUB 4R7XA 3ASNB 5BZDB 2O93L 5J0BA 1E6OL 4FQXD 1Y1UA 4PJ5B 4TTGA 4NRYA 5K9KB 3D6GA 4AVJA 1S5HB 1ML0A 4LB8A 2KI6A 1DLFL 4UT6H 4BDVB 3N85H 2X4QA 4F27A 2V9TA 1XF2B 1LYQA 3CFMA 5CP7B 2BWDA 4GT0A 4ERSL 4L48A 4FI8A 1PTZA 4Z3TA 5DT1L 3SKOB 1A7RH 2NX5A 2JKTM 2QADC 4H20L 1D7DA 2BZCA 3VFWB 2YO3A 1KJVA 2ZX9A 1NGYB 1U3HC 1NCWH 3WKMH 2GJZA 2N56A 3U7WH 3J8F7 4BFIA 5KVFH 1AR1B 3SKJL 2PWFA 2XZQH 3HC4H 2NYZA 5IJKA 4XI5D 4EI5D 3RDTB 3RWFA 1A6ZA 2BVPA 3WE1A 1A66A 5DEGA 3EYQD 3QUXA 2X4SB 4PUBH 2HX7A 2P42B 1XF3A 5DJCB 1DSFH 3QRGH 1F90H 3RKDC 5LCVL 2YD9A 5FYLD 4QHPA 1MSPA 3CX5K 4HIXH 4N2HA 4LSDA 2UVEA 1CD9B 5CZVL 3SDCB 3ME0B 7TAAA 4H8PA 3TO2B 5EZPA 2R9HD 4GMSH 3U1SH 2NXZB 5J11C 3SE9L 2VLKB 3SZ6A 5C0RL 5ITBH 2XWZA 3QUZD 2J43A 2R8SH 2DWTA 1J8HA 2D2OA 3GHBH 2EDWA 4LCYB 4IBUA 4N6RB 3QWNA 2A9NL 1U95A 2JIXA 3LN4A 5I1AB 2HKHL 3D08A 4Y4KB 1W8OA 4IHOB 4NPJA 3VRIB 4PJXE 3LYRA 5DFWH 3S5LB 5DGQA 2VLJE 4QYOB 3AQZA 2RBLA 1AMYA 1B6DA 2EYTB 4HHWA 2ED7A 2FIKB 5EH1A 5I1JL 1PMYA 5JQHC 5FGSA 4P2QD 1AFVH 3LRSA 2BSBA 2O6CA 2ADGA 4OCLC 1T7VA 1ZTMA 4Q0XL 1FIGH 3IJ9A 3VI4B 1JNNH 3T0BA 2BIHA 2KERA 2XWXA 4M7LL 4U6HA 4HWEL 3VXQA 4Z3EA 3FTGB 1RI8A 3PY9A 4XMLH 4GBXB 1OGTB 3H56A 5GGRA 1ZD6A 3C6LC 3CSBA 3C5SB 5C0JA 1ZLDA 1X9UA 4FGMA 3ORJA 1CICA 4BSWB 2V7HB 3EZ8A 2JB6B 4GO8A 1TOXA 4X9IA 5I8OH 4KDTC 1ZLEA 3BPOC 3CSPA 4M48H 5HYFA 4AJYV 1SN5A 1UYWH 5G4NA 3AU1B 5I8EA 3ULVC 4OFDA 1U93A 4JO3H 2OK0H 3DX0A 1J48A 3HPLB 3L1FA 1MAML 2P80D 4MXWL 1NUGA 4JLRA 4UV7H 3VD4A 3QZNA 4O2EA 1BVKA 1H15B 5DMGC 5I2IB 2R39A 4X9YA 3OC8A 3EFDL 4NQXB 1YEJL 3I9PA 2DI9A 4LLMB 4F8QA 4N2LA 1SYVA 5ALCL 1A1OB 4ONHB 1JCVA 3EDJA 1FBIL 1XGRA 2FGWL 3M6DA 3VGAC 1SJVA 1UT1A 2IPKA 4J2QA 3PAZA 4LPCA 4H25B 2EDDA 1DE4B 1MRCL 1XMWA 3O6KL 3IDJB 2CM6A 4PJAB 3DV4B 3QI9C 4NQQA 2K3HA 1JYVA 1CFVH 2HG0A 4Z77B 4F37K 2QSCL 4PWJA 4KVNL 3UTQA 1SXSA 5T3XD 1FP5A 1QWHA 1YJDL 3CSGA 4UAOC 4MWFA 4OFIA 4Z95L 5TDOA 4PLNC 3PWJB 2AGJH 5FLUA 3W9DB 5JYMA 3VXOA 1TMCB 1XR9A 4NB7A 5EB9A 1AGBB 5LGJA 5I1EL 1F3RB 2RGSA 3LHPL 5C0IA 2A4ZA 2JJWA 3WNMA 4I88A 2A6IA 2O6EA 1C16A 2YRLA 1FV1A 2PNDA 1ZWIB 2ED6A 3GT6A 1IAIM 1U42A 3BVTA 3F7VA 2CXKA 5DMIH 2R56L 3N1QC 4K5LA 5JQIB 1ORSA 3GSQA 2OZNA 3VU1A 2L7UA 5G55A 1LO3H 2XPGA 1OTTC 1WZ1L 4A6YB 3LN5B 4L2YA 3MLUL 2W07A 5JIHA 5KSAA 1E9QB 4Y2DB 1H8NA 3BDBA 3RWIA 4L4TB 2ZWLT 3TT1H 3H54A 4AVKA 2XA8L 1YVLA 2MMXA 3QDMB 4JG5A 4QTIH 3MRHB 4XBGB 4PIRF 3BPCA 4HG4K 1ZANL 4NZTH 5GGUB 4G1MB 25C8H 2NY2B 4NGHH 4XPHH 2BDNH 1TZOA 2K45A 4EJ1C 3BDYL 4OCRH 3VG0L 4I9XA 4KVCL 1NOFA 3BAEH 3HI5H 3FCUB 4F15B 1HDMB 3WIHL 4GAAA 2OMXA 5KS9E 2CJUH 3VXPB 4XCFH 5C0EA 3GMMA 4JFFE 4XNXH 1HYRC 2MPAH 2G9HB 5AZEH 1GPOL 1IEAA 1I7RA 5EOCH 3CZFB 2GUOB 2G5BB 3FPXA 3S37H 1CFSB 2UXTA 3KMDA 2E7LC 2VMEA 3I74A 3GZKA 3CFEB 3ARTA 4H88H 1RUPH 4X6FA 4P2AA 1T83A 1JE6A 1EUUA 2VDRH 3BSHA 1YQ2A 4F92B 5CMAB 1S6NA 2R15A 3EOTL 3RWEB 5I73C 3FRPA 4FERA 1S4IA 1MHEB 1H8SA 3C8KA 3ZTNL 1J1XH 2EH8H 3QXAA 2NY5L 1RQ5A 4P46D 4POZC 4RAVB 4LSUL 3O6LH 1PJWA 2DWEA 2DLEA 1NINA 3F00A 4LHQB 3T4AA 1UUNA 1RU9H 4DGYH 5E6UB 3CPLB 5TE4H 2PYEE 4Y19E 3RNQB 3TBYB 2J5LC 1BM3L 3NCJL 5LAXB 2OS7A 1A21A 4M5ZH 1FZKA 2AQ1A 3VGHA 4EVNB 3KPRA 5SX4I 3GMNA 2ZCKL 4LFHG 3QJTB 4N8VG 3K71B 1HT6A 3GMQB 1TZHA 4WFGE 4YDJB 3PIQB 4ONFL 1CG9A 5F7DB 2CDGB 2CRZA 3Q8BA 1ZEAL 3G6JF 1MN4A 3D34A 4PJ6A 1U8NA 5DUJA 2BOCA 3D85A 4IIQC 4M8RA 5JPMA 1I9JL 5DRZA 1FAIL 5C08A 1T03L 3VFMB 1UH4A 2ICEA 3MV7B 5DYOA 5CCKL 2OCFD 1IMHC 4OFPA 1SMOA 5JIIA 1ZK5A 2BHZA 3T0DA 1MHCB 4NKIL 1BCIA 4PJ7A 3FXIC 3PJSA 4NN7C 2QADD 3BYTA 1KXTB 2BP8A 5DQ9B 1C08A 1E27A 4Q2ZB 2Y7QB 1OT1A 2AQPA 4KI5F 4K5MA 3WYRA 3T1FA 3UBXI 3EYUH 1U3HD 4GPVA 4YJZL 3KAAA 2XN9D 1ZHKA 3PWNB 3MNZB 4M43L 3M46A