2WKOF

Structure of metal loaded pathogenic sod1 mutant g93a.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
153
structure length
152
Chain Sequence
ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDAVADVSIEDSVISLSGDHIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Biophysical Properties of Metal-Free Pathogenic Sod1 Mutants A4V and G93A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE DISMUTASE [CU-ZN]
total genus 35
structure length 152
sequence length 153
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2wkoF00
3RE0A 4U4IA 4MCMA 2ZOWA 4A7GA 1F1AA 1BZOA 1YSOA 2AEOA 4A7TA 1IBHA 2XJKA 4A7GF 1SXSA 3MKGA 4A7VA 2AQQA 1JK9A 3K91A 3HFFA 1XTMA 3GTVA 3KBFA 1OZUA 3T5WA 2WWOA 2GBVA 5KBLA 1E9OA 1S4IA 2AQRA 3GZQA 3GZOA 1IBDA 1Q0EA 1UXMA 2VR7A 2AQSA 1CBJA 1QUPA 1Z9NA 3GTTA 2LU5A 1L3NA 3LTVA 1OEZW 3F7LA 2E47A 2V0AA 1SXCA 3KBEA 1PZSA 4BD4A 3H2QA 1IBBA 3PU7A 1XTLA 2C9UA 3HOGA 1OALA 2ZKYA 3SODB 2K4WA 2R27A 1IBFA 1DO5A 2Z7YA 2WZ0A 1RK7A 1EJ8A 1F18A 4L05A 2C9VA 1XSOA 4N3TA 2ZKXA 1SXNA 1ESOA 1TO5A 1OAJA 2WZ5A 1SDYA 1SDAB 1E9QB 2SODB 2AQTA 3KH3A 1KMGA 3CE1A 1E9PB 1FUNA 2GBUA 3QQDA 3S0PA 1COBA 1P1VA 1E9QA 3H2PA 4FF9A 3L9EA 2NNXA 4A7QA 3L9YA 2WYZA 2WKOA 1SRDA 1EQWA 1JCVA 3KM2A 1UXLA 3CQQA 2AQNA 2JCWA 2Z7ZA 2VR6A 2XJLA 1DSWA 1B4TA 2Z7WA 1AZVA 1HL4A 2ZKWA 1HL5A 1SXAA 1OZTG 2C9SA 3GQFA 2JLPA 1SXZA 3MNDA 2VR8A 1BA9A 1TO4A 4A7UA 3GZPA 1YAZA 1CB4A 1YAIA 4B3EA 3KH4A 1MFMA 1N19A 1B4LA 5KBKA 2AF2A 2APSA 3QQDB 1U3NA 1E9PA 2WYTA 4BCYA 1F1GA 1E9OB 1F1DA 2E46A 1JK9B 2GBTA 4OH2A 1SPDA 1PU0A 3HW7A 3F7KA 3KM1A 5CU9A 4BCZA 1SOSA 1PTZA 1N18A 4N3UA 1SXBA 2Q2LA 3ECUA 4MCNA 2WWNA 1Z9PA 2Z7UA 3ECWA 2WKOF 4OJAA 2WZ6A 4A7SA 3ECVA 1IB5A 5KBMA 2AQPA 3CQPA
chains in the Genus database with same CATH superfamily
1I1AC 1CI5A 2UWEE 1FFRA 3KYKH 4MCMA 1T80A 1P84K 3EGSA 4Z7AA 1PYWA 5LQBL 3TJEL 1AI1H 1MCQA 2FGWH 4C83A 4NYLB 2HRPL 1XEDA 3PNRB 1JWSB 4WWKC 2VLJB 5BO0D 1KYDA 5D7IF 5EO0B 3N04A 3VFNA 4BFNA 5JIMA 2WM0A 5DVNA 5FPIA 3HS0B 4D0BB 4YDIH 3H3PL 2MEJB 1T7WA 2OJZL 1UT9A 3ECBA 3DV4A 1CGSL 4PIBA 1GGYA 1RK0A 4LHUG 2PCYA 4L1DA 6PCYA 3AXLA 4QGYA 1X4YA 5AOLA 2MNUA 3KPNB 4YBQD 2PCFB 3VVWA 3KPRA 3EG9A 4OFVA 3B9AA 4JY5H 3QCUH 4U1LB 2N7SA 4YGAB 2B2XH 4UTBL 1CGXA 5ID1B 2J1ZA 2KUTA 1UWEL 5CD5D 1ZA6A 1A21A 4L3AA 4M5ZL 3BSGA 4NPYA 1QI3A 3FT2A 3GJFA 4X6CB 5G5DB 3TX4A 1XCWA 3ZYIA 5CIPA 1AGBA 2HVKA 3WKPA 2K4WA 3INOA 3IKCB 3JWNG 4G6KH 4MDJB 3BWZA 4JG0L 3K3QA 4JRXA 5B3JE 4YBLB 4HWBA 3OHXB 4ZFGL 1BYNA 3BWAB 4KXBA 3RX5A 5BZZA 1PKQE 5D2NE 1JN6A 4ZSOA 1WAAF 4DCQA 5EU5A 1ZSDB 3A47A 4ILDA 5DLLA 4APQA 1O7SA 2XC8A 1RZJC 4LLVA 4TNEA 4FA7B 5I30L 4ECNA 2IFFH 3HC2A 4E41B 1SVZA 4N0CD 4YQXL 1RJYA 2M1KA 3H3PH 4UF7C 2XTJC 5F7MC 4PRHA 2GSGA 3ZL4H 1UM6L 4X8JB 2IH1A 1YMMB 1VB9A 4E0RB 3CXHJ 4H1LA 1JPFB 2CMRH 4WQOA 2NXZB 5DEGA 5AYQA 4QYOB 2WLYA 5BV7H 1P7HL 1K2DA 3K2MC 2CLRA 5TDPB 3V95A 4F33A 3A6BL 2NXYC 1ZAGA 3D08A 3DVNB 4LOUC 4F15B 1G0XA 1NTDA 2J88L 1FH2A 5FGRA 1NGYA 4AQAB 5ICYA 1WA2X 4S1RL 2GT9B 3IU4L 4LPVA 3RGVB 2NTSP 3AREC 5KSBE 4AK1A 1VFOA 3CDZA 4HDIB 5E2WH 3WS6C 5IQLA 4ZFGH 1NGXB 4ODVL 3WIIH 1X3DA 4WJ5B 3CLFH 3REWA 3WUWA 4MD0B 5ESVB 1OAUH 1EHKB 1SBSH 1TPXC 4ETQA 4Y19B 3ILQD 2YAHA 4NQEE 5DFWH 1RUQL 1WH0A 4AWJC 2E7CA 3V4PL 1JD7A 2G3XA 1UM5L 1R33A 4JFEE 2RMNA 5EWIL 1J86A 4JKMA 4YQXH 4HPHA 1B2WL 1L7TH 1BXAA 2E3VA 2YQ3A 1XF1A 3JWNH 4G6FB 4XBPA 4XP9L 3PIQB 1KY6A 4N25A 3X11A 1BF5A 1A5FL 1JIBA 4XBPB 1KCSH 3FTXA 1CFTB 2H6PB 4DZBA 3ZDZF 2APWA 2CMRL 2VSKB 5AUMA 3SGEI 1WCQA 3NCJL 4NUJA 5DR5L 1OD7A 1I9EA 1FIGL 2A1WH 2I32A 1ZLVK 1E9OA 1CDJA 2PKDA 5B8CC 1C7TA 2EIMB 3NJMA 4GINA 4P46C 1RU9H 2X4QB 4FG4A 5T1DL 1YN6B 1G1YA 1EMTH 3TYGL 2ED8A 3ULUE 1LGVA 4HHGA 4OQTL 3FCTB 4PUBH 4PVBA 3UTQB 1F6LL 4KBPA 1BIHA 3LQAH 1VKXA 2QJDA 1L9NA 2YEVB 3K6DA 4K2UL 3VWKA 1HNGA 3ZKXC 2NXZC 4R5XA 5DHYA 3EJRA 3QDGD 2Q87A 4ZMQA 3CHRA 1PKOA 3OB8A 3DX3A 5ID0A 1VSCA 2WUBH 5E5MA 4AQ1A 2Y5TB 1LD9A 5F7EL 2FSEB 1BF8A 4ELKA 4GIAA 1FJ1B 5DJCB 5HGAB 4HK3N 4XPTL 2JK5A 1IJNA 1BLNA 3VCLB 3C5ZB 1U8CA 1A7RH 4XP5L 1DJXA 1GKEA 4LSQL 4Y4KD 3UTOA 1UD2A 2OR9L 4HIEB 5AVZB 4ZNCD 3IMWA 4UTAA 3MTXA 3OKLB 1DQIA 5B8CB 5JXEC 2BW4A 4LOEA 1J8RA 2IQAA 1KTCA 3O4OC 2YAOA 4TNVF 1AZVA 4FZ8L 4JFPB 2VLKB 3MRJB 4NUQA 4QHMB 1D5ZB 3O6FD 2Q5BA 4XR8C 4FABH 3RA7L 2DTML 4JRXB 3WD5L 4HAFA 3TV3L 1CL7L 4RETB 3VE0B 3J27A 1NMBL 4J28A 3S3JA 5FF6B 1CG9A 1G9NL 4M8UA 1A6UL 2WTOA 2WTRA 3RFZC 1ZVYA 1GHFL 2P5EB 2R2EB 1QSFE 5IB5A 2YD7A 2YZ8A 3KGRA 4LASL 4C4KO 2BCKA 1XIWD 1KC5L 3LD8B 3T4AC 1ONQA 1SY6A 2Q3XA 1PS3A 5B38A 1TVDA 1KPUB 4H2AA 5I8CB 5IVXE 3LXBA 2RALA 3RY5A 1E0OB 1OAXH 5FO2A 1GAFL 2JQZA 5ADPH 1F8TH 2IAAC 5IMKA 2YEQA 2RJMA 1FDLH 3FU9A 1JWSA 3CHSA 2DM7A 4AZUA 2Y4SA 3RVVC 3WMQA 3IAQA 5HYFA 4X9HA 5C09D 2YSSA 3GIZH 2AXFB 2DF3A 3KLDA 3MCLH 5F1SA 4FZ8H 1G1CA 4KVNL 1HKLL 3RX8A 4U6YA 1OK8A 2XWZA 2CIIA 2FBRA 3MOAH 3N6YA 1S7WA 3DMMD 3SGDI 1XGQA 2P43B 3OG6B 2PYEE 1AD0B 1A22B 1J1PL 2L0DA 1EFQA 4KXAA 3ZE1B 3S9DB 1OY3B 4WKZA 2PW2A 4P4KC 3WEOA 1Q9LA 4J8RB 1RZ7H 2AQSA 2E6JA 5L88L 3ZXAC 5C7XH 5HHOB 2CO7B 2A0LC 5DJZA 1TVHB 3C5SA 5BV7B 2CR0A 4Y5XB 5J1AA 1D5XB 2AAVA 1DBAL 2VL5A 3BLPX 2GJZB 2WINB 4P2CG 5AAWC 2B1OA 2B0SL 1NMCB 1YQVL 2CG9X 3EFDL 5BRZE 4N2AA 5K39B 1FZOA 2VLKA 2OI9C 4WFFE 3RL1A 1NAMA 2FO4A 3WFBH 1TZAA 3TCTA 2BY1A 1MY5A 5HPOA 4OZHA 3PQYB 4ZX5A 3LNFA 1JZ2A 2FYYB 5SWZD 4Y16A 3IFLH 5F7DA 3KPOB 5I8EA 5LN4A 3TLRA 4BZ2H 4DP6X 3DBSA 3LRKA 1PLGL 3HC0B 1TZGL 1HINL 2XZCH 3ALXA 2JK5B 4KI5D 1OSZB 2VDRL 5AKRA 4LNRB 3V0WL 4JRYD 3MOAL 3ZX1A 4PJXB 1CFVH 1GY1A 3X2QB 2OK0L 5HPMB 4OIFA 4C57C 1AP2B 3MLUH 5DYOA 4PLKC 1I8MB 4FRWA 2B4CC 4FAAB 1Q9KB 2IDUA 3ARDB 2F2HA 5IFAL 3HMXA 3TVMC 5FGBC 4EMZA 5JQIB 1OW0C 3QUMA 1N4XL 2K3HA 3ZY7A 4PP1D 2V2TB 4XH2B 2QV4A 5HJGA 3PDOA 2P5WB 1KIRB 3OAYK 5BS0D 3OLDA 1HQRA 1MFBL 1I3UA 4PGJA 3T3ME 5LGJA 2GIYA 4KMTL 3BUYB 1DDHA 1QZNA 2BLFA 3ARFB 3BH9A 1E9OB 4QNPF 3TO4D 4ANVA 5JW4M 1JWUB 3T0EE 3IETB 1H0DA 2QLYA 3FBKA 5HHOA 2YPVA 3CIAA 3BPLB 5H4ZA 1DSFL 2GJRA 4MA3B 2JIXB 3FFCB 1S9WA 4NN6C 3SOBH 3PIQA 4PJ8D 4TSCH 3TPKA 3BD5A 3BCDA 4Y4FD 5ESAB 1BF2A 4IGBA 1DBKH 4HS6A 4UM8B 1ROWA 2R2HA 5HI4D 2W1NA 1TJGL 4A66A 2YGPA 5GGSA 3NJLA 4LSPH 4HUVB 5ESVA 1C1EH 3NFSL 3MRDB 3TO4B 3E3QE 2GCYB 2G5RA 4AE0A 2VDOB 4OZHE 4PYHA 3L13A 1MCPH 3KBFA 3SDDD 3AAZA 3TEWA 3CSYB 1X9LA 5DC4B 5IJVA 5BRZA 4TSBL 2UWEB 2ITDB 3TNMB 3H9HB 2ZP0T 3HE7B 4PV8A 4M9PA 1SM3L 1U8KB 2X3BA 1XFPA 3E6FB 3QDME 4M6MH 3AT8A 3UAAA 3BDBA 4NOBA 3FOLA 4PJBF 3NPSC 1R5WB 1TOXA 2GB2A 4GG6F 3LIZA 3VWKC 3LN5B 2KZKA 3NP3A 3V2AR 3IAPA 4N6QA 3C6LC 2N7AA 3BHBA 3QNXA 2J71A 5T3XE 4QHUB 2IG2H 2XX1A 3W37A 4YXKH 3G5XA 1U8JA 3B7TA 3I6KB 4KKAC 4KK6C 4AVIA 3ARWA 2X1PA 1UTDA 3LSOB 1CD1B 3V4VH 2E9GA 5BJTB 1HE8A 3MRLB 4B6ZA 4RMSA 1BW8A 1CN4A 3I85A 1C1EL 1A4AA 1HHHA 1T3FA 1XIWC 2ZYHA 1J1XL 3CFQA 2WLJA 3TZVD 2CWRA 4O2FB 1RULL 5F7KC 5BOJA 5BQ7B 1J5HA 1WC7A 3VFVB 4TVUA 5KVEL 3A24A 2J6WA 4XP6H 5AOIA 3EUUA 3PAYA 4NGHH 2JCWA 1ZKAA 4N0UA 1AGBB 2HVKB 5IUSA 4PWFA 1T22B 5DFTA 1NCJA 5AKVA 3ARPA 4CW1A 3H42H 4CRPA 3EJZC 4C58B 1E4JA 4QRBA 3QZOA 5D72H 3IU3A 4A2LA 4YZWA 3LH2L 2K8QA 1EAPA 4JY6B 5FKPB 1U8OA 4PJGE 1KJVB 4HWNA 2ZSWA 3TF4A 3U4AA 4ZSOE 3VMNA 4PJ7A 3M86A 2GSIB 3BPLC 1OKEA 4QWWC 2CBPA 2ZOLA 1JTTA 2X5PA 1NAKL 3IDIA 3L7EB 4YWGH 4LK4A 4Z77A 3BP4A 4J3SA 3T2NL 2UVFA 3QDGE 3OMZA 3D30A 1IC5H 4R4BA 4JFZL 1QUNA 4S2SB 3B56A 1CFNB 1HOEA 3QR2A 3AC0A 3SPHA 3A6OA 1IVLA 3IWVA 4HT1H 3O3EB 4NZTL 3UZVA 5I18H 2LHAA 3T3PE 4ABWA 3FH5A 4HOMA 5IMOB 5DRNB 2H32H 4LGSB 3K8LA 3ZIMA 2IMMA 3GFUA 4LLWB 3OWRA 4OZ4A 1Q9OA 1ETA1 1RZJL 1WPCA 1GJWA 2IANE 2YD3A 1Z3RA 2MQ3A 4KKCD 1MFUA 2VH5H 2H3NB 4LCCC 3ZPDA 1X7SA 5D2LF 4JDZA 5CD3A 5DZAA 1P7KA 1NGZB 2AXHA 1A7PL 1FG2B 4OU3A 1NGZA 5KSAC 1YEKL 1FNLA 4MD0A 3GTTA 2B1HH 1JGVH 2P1YA 4MMZB 5GS0C 3EFOB 2O30A 2VW6A 1NGXA 4OT1H 1N0XH 3X1FA 3PV6A 5HI3D 1YO4A 4HD9A 4MQTB 4F2ME 2E27L 1NCOA 4J27A 3T65B 3TIDB 3LPFA 1E65A 1T2JA 1MNNA 5K9KA 1E4XL 3OMIB 1F6AB 2H47C 1Q9WB 1P1ZA 5LBSH 2CD0A 2BXYA 1ET8A 1MF2L 4PIRF 1H9DA 1YEIH 5CZVH 1JXKA 4FP8H 5E0QA 1W6WA 2C3HA 3JVGA 1FZJB 4O51A 2Y07H 4BKLA 3FKUS 3MRKB 5D7SH 5G2NA 4Z3FA 1EHNA 1RZKL 2PO6A 3BKJL 1I9JH 4LNRA 2VB5A 1M2VB 4KTDL 1R3IL 4QXWA 5EG6C 3S88L 1KJVA 2ZG1A 1OF0A 1LE9A 3KEHA 4DT2A 5BO1L 4L8CB 4ZPTA 3D48R 3SBWA 3SKJL 1HCFX 1WBYB 4PFEA 4OM0H 2JJTC 5B7MA 5D9SB 1HIML 3KPPA 3DOHA 3MHZA 4XN7A 5FUZH 5KSAB 2EYRA 4OZHB 1IV8A 1IEAB 1DLHB 2GUOA 4XMLL 4XCEA 1RZ8B 3D18A 5IM7B 3T0EC 3E3QC 3QWRA 4L4JA 5FM5O 4E9TA 1HILB 1FIEA 2YPKA 1SY6L 3RGVD 2R29A 1R3JB 2VNCA 4UB0H 5G5DA 3WNIA 4LCCA 5E8OA 2IH3A 1DCLA 1U8IB 3FT4A 3MRRB 2B59A 3MR9B 3TC9A 3VB8A 3U0WL 4XNMB 1RUMH 5FX3A 2Y07L 5IQ9A 2F5AH 3PP3K 2RA1A 1A6ZB 4F7PA 3H56A 3OLIA 4UILL 3D39B 1JK9B 3GBNH 1JNHA 2PMZA 2NUPA 3HZVA 5DLMH 4TVPE 4AQZA 2ENJA 3ULVE 4K0OA 4IU3B 3S8FB 3FZUD 3ARXA 1NGWA 1DUYB 3MLTB 4AGNA 2IF7A 1ZHLA 4HC1L 4DN3H 3FO9B 5ADOL 2YQ2A 3NZHH 5F7WC 3P0GB 4AQEA 4MFHA 4DESA 4NB7A 1YZZA 4CAGA 4PJEE 2ZX8A 3TIEA 4IRJD 1DUZB 2QQLH 4YXLH 3Q3GA 2XKNB 1XVSA 1DBML 3NIGE 5LLIC 5LGYA 1JK9A 5I0WA 3GPSA 1A65A 1MJJA 3MLVH 5EO9B 4LP8A 5F96L 5KS9A 2R2EA 4QY8A 4WJKB 4Y2OA 2N7BA 5AW2B 3HAEH 4RZKA 3FT3B 3TH2T 1N67A 4BFEA 4DN4L 5TJWK 3N1QC 3TFBA 1CT8B 2F5AL 4BSWA 2JI1A 3FU5A 4UM8A 3C2AH 1OM3H 3VRIB 1KIRA 2K6WA 2F7RA 5DJDA 3WEXB 1MJUL 5CBEA 1A47A 3TA3A 3PWJA 1P69B 5KUKA 1XZ0B 5C6TH 2A83B 3MLRH 1CTMA 5FYKH 2NR6A 5DRWA 4OI8A 2GC7C 3JT2A 5DURD 5HD8C 3QNYB 3O4LD 4EIUA 2WNKA 2VLLB 3QJHB 4LIQL 1XQ4A 1Z3GL 4HXAL 3T0ED 4X7EC 3V6BR 4EZKA 5GJSH 4OQTA 4X6DB 1XF2A 3GSXA 4HPYH 2JKTM 3NEOA 4W6WB 2R8SL 3MRIA 2R9HD 5B38G 5E6RB 1MIEH 2Z1KA 3IEAA 1XT5A 4I2XA 1S9KC 2WQSA 1HJBC 1ZGLM 3JTBA 2BS71 3QULB 3COOA 1MQ8A 5JHDE 1GS7A 2HRPH 2Z31C 3V6FA 3BRFA 5IB3B 2IH9A 1Q9KA 4DN4H 3FFDA 1DVSA 2XKSA 3AY4C 2GSMB 4KKQA 4AYMC 4Z7WF 5T1MB 4JL2A 1SXZA 1M1SA 2R51A 3VG0H 2A6IA 3UBFA 3B5HA 1WZKA 4PJFB 4KHTH 4JGMA 1RUAL 4JHWH 2Q20A 5FYLL 3ZQ9A 3MRBB 1VPOH 4DP8X 1ID5I 3MLRL 1T20B 1BOGA 3QCUL 5EZLA 2EYTB 1NZRA 5FLUA 2BC4B 3P3UA 2KLSA 2GBTA 2IBBA 3FUFA 3RYMA 1BZ7B 3DTUB 3QWRD 1H5BB 2AK4D 3BW9A 1FH5H 1IBYA 3MA7B 1RVFL 4KDTC 1MFEL 4KZDH 5LB1A 1NCBH 1S8DA 4OJEH 5LCVL 5DRNA 4M5SA 4NC0B 5DUBB 3QUXC 5D71H 4AH2A 4JM2D 2XN2A 5E1GA 1LO5B 4M7JL 1NLBL 1BD2B 3EOBA 4BSWB 1YNKH 4MYPA 3T8MA 1KWKA 1U8QB 2KL6A 1JZ8A 3BP4B 4A7GF 1T5KA 1SXSA 4OLXH 2NNFA 4AITA 1NCDH 1U3JA 4JO8A 1Q9LB 4J8RA 3DIDA 4OGQC 4O02L 1IGYA 3HG1B 2XN1A 5EO9A 1KTRL 1CICB 2MRYA 3VD3A 2VLRD 4TNWK 5FEBA 3JSSA 2YWZA 2Z1PA 2XWTB 3ESNA 3TTSA 4JY6A 5AW4B 3OC5A 4X42A 2FBJL 2VISA 3UFIA 2YD6A 2I9LA 3I74A 4K3EL 4M7KH 1DUZA 1MQKL 2YMTA 2P8MA 4OD3H 4CVUA 1CLZH 2CDFA 2DDQH 4OFYD 2RAMA 2F68X 2CHWA 1JXDA 5DHEA 1U3HD 5AZEL 1Y6NR 1I8KB 2QVFB 3QZWG 5KJ4A 3ASWA 4PI0A 5MERB 3W57A 3ZIYA 1R9FA 3CFTA 2F54A 2HLAB 3HG4A 2OZ4A 2J1XA 3MROB 4RISH 4KZDL 5TE7H 2BSSB 3S35L 3GBML 1OF2B 2P4AB 2WK2A 4Z3IA 5IOPA 2BNQA 5CWSB 4L23A 2DM3A 1OTTD 2QR0A 1QBMH 4G5AA 5D8JL 2XKUA 5IHZA 3MLYH 1RHFA 5IHZB 1CYGA 1QYGL 2CO2A 4PN6A 1KT2A 1VFBA 3HKFA 1ZLWH 3T3PF 3VFWB 2ENSA 5EWIH 1M1XB 5T3ZD 4YAQB 1ZWIA 1OHZA 1XD0A 1SRDA 1TEYA 4L3CB 4MJJA 4XP9H 1U8JB 3I6KA 5J0BA 3VI4A 3VI4B 1E3ZA 4NT6B 2OMNA 3BHBB 3OTTA 4JFFB 2VMDA 4HK3J 4NX0A 2ZKWA 4F37F 4GS7C 4K5PA 1A7NH 4NZFA 3FTGB 4TMPA 3U2IA 1B4JL 5C0AD 3HN5A 5CS7A 1D7DA 2E7HA 4JFYB 1ASQA 4IRJC 4M5ZH 5IBUG 3GS4A 3KPNA 4Q97A 4ZPTB 4Q6YA 3WLWD 4IBZA 4PTTB 2DLTA 2YJLA 4HA1A 1JYNA 4QRQA 2APSA 1XH1A 5JHLH 3HE6C 5KVGL 1MW0A 3BKYL 4U7SA 2EYSB 4YHPA 4BA0A 1VZIA 4YMPA 5CLYA 2UX6A 4IRZH 4NC1E 3ULUD 4FFZH 1YN6A 3BLBA 4M4RA 3WN5A 5JDSB 4QKTA 4KO6A 4Y9GA 3O6MH 4ZFOL 1IGCL 4PI2A 4NYLA 5TF1H 5FR3A 5GZNA 5DQ9A 1F00I 5IMMB 5KSBF 4HS6B 2AKRB 3IFNL 3ZRFC 5DS8B 3RGBA 2FD6L 9PCYA 3QDAA 1ZVSB 3OM3B 4JO3H 5DK2B 3OJVC 5KVMC 1T03H 1QSEA 2DQ6A 2F1EA 4YLQT 3L9RA 4OFYA 4G6MH 1QRNE 2EVGA 4HEMA 4J8QA 1FFOA 2QGDA 5J57B 1ZJBA 3ZHNA 3DA0A 4JFDD 3L8QA 3BGMA 2N59A 1FG2A 3X12B 3BGMB 1DVQA 3BUQA 4HK0B 3BLKA 5IQMA 2J88H 2BH0A 3T6QC 1LO5A 2J4WH 2UZXA 3BIBX 1JTPA 2DQGL 3WXWH 2KZBA 1T1YA 1WCBA 1IFHL 4AIZA 3UTTE 4GKNA 1UGNA 4JMXA 4FQCH 1R3LA 3IT8D 4NQCA 3BUIA 4UIKL 3RILA 1NANI 1ZT7A 4ODVH 4QEGA 1GGBH 2VMJA 2BVUA 3MV8B 1YA5A 4XOBA 2XWBB 1HSBB 3MV7A 3ME0B 4FYSA 4XVSH 3QUZB 1UA7A 1JG9A 3HBQA 3IKKA 4XI5C 4YO0A 3P73B 3PP4L 3FO2B 3TOPA 5ICZB 3KLLA 1B2WH 1L7TL 4YUEL 1NM4A 1YMMA 3DJSA 3MRBA 5DJAA 4ZX6A 1A6PA 4PJ7B 1T03L 4OV5A 1T5XB 3BI9X 4WFHE 3MFGB 4BFBD 2DN7A 5CR8A 4G6ML 1J05A 1V3KA 2E6PA 1TQBB 3JWNC 4KDWA 1CL7I 3UL4A 3PWPD 1FDLL 1JSYA 3V6FB 1IVTA 3QNYA 3FN0L 2CLRB 4Y16B 3K81A 3J8F7 5HVGB 3W3BA 5JHDD 5F70A 3VRLE 4JFDA 1JN6B 5DUML 2VRQA 2R23B 4ZSOB 1AY1L 2WZPD 3WJJC 1IBGH 3NG5A 4PS4H 1OLZA 1HFUA 2X6AA 2DQJL 4K7PY 5FA3B 2A4EA 3PHOA 4NIYE 3NAAL 4OGYH 4MJ5B 4EO5A 1KJ2L 4NT6A 5H37G 4Z3TA 4WDIB 5IROA 2B16A 3H54A 4RAHA 3C08H 3NEXA 4GRLA 2XUWA 3IDXL 2XWDA 1WE5A 1S7UA 2ILLA 2K70A 4OVVA 5BW7A 3PYCA 5BRPA 5E6ID 1JXJA 1EDYA 1M05A 5T3ZL 1JDDA 1NC2D 1Q38A 3KGSA 2PCXA 5EU5B 4L0PB 4LPTA 4Y7MA 3TU6A 3UJIH 1CGYA 3NJJA 4XX5A 4L2YA 1S7TA 5JHDB 2E74C 3QEQA 2XQBH 4IKKA 3HW7A 1I7RB 3H6JA 1TVBB 4KXZH 4NQEB 1J8HA 3SQOL 2DQEH 2XQYK 1TQBC 3BN9C 4WGWB 1FP5A 5ETUB 1HCVA 2HPOA 2X9XA 3LKPA 1HINH 2XZCL 1ETZB 5KS9B 5LVEA 3RIAK 1CE6A 2FEDC 1NL0H 5JW4N 4PW3A 2AV7A 3CHPA 4FNQA 4PV8B 4BQ6A 4A7VA 2O5YL 3NAAH 1IAIL 1CFVL 3WIAA 4GG6B 4FI7A 1CL7H 4H8WL 1G7LA 2JWYA 1B3JA 4NJ9L 4X4ME 5E8PA 5H2BA 2WXHA 2Y6SD 3MCKB 1E2WA 2NY6C 3I6SA 3HZMB 4QF1B 1JZJA 1O9WA 1GSKA 1MVUB 3TURA 5EC1A 3FO9A 2LTQC 1SMAA 1TJIH 5AW6B 1ORSA 3EOBB 4EI5C 5I6XB 5L4MA 1GIGH 1IQDB 5ISZA 1YLBB 5D6CB 3GI8L 4GUPB 3U4BL 1FBIL 2P49B 3JWDC 2BDNL 3PHQA 4LP4A 1X5AA 4G83A 2DD8H 2EIEA 2OZ4L 1L0YA 1X7QB 12E8H 5DZNA 4LVNC 4ZDHB 4AUYA 4HIEA 4JAMA 5DJ6B 5IW1B 4UZGA 3OMAB 4Y2DD 2AXGB 3F83A 3WNMA 3CDCA 5AL0A 1KGIA 3BO8B 3GSRA 3LNDA 3BEWA 4D8OA 1XR9B 4P3DA 1RMFH 1NFIB 3N43B 1FYTE 5F89B 3QO0A 3FOMB 4NBYB 3IXAA 3MGAA 1THCA 3EAKA 4P2AA 2QT6A 2A2QT 2ZWZA 4PRPE 5GS0H 4L29A 4YSPA 3KPPB 3PWUA 3QEQD 1KBGL 3CUPA 5CMAA 3S6CA 4LSPL 2AITA 3O3AB 4TQ8A 4MD4B 3VWKB 5C0DB 2NW2B 3CPUA 1BCIA 4WI0B 1C5CL 1NGQH 4K55A 1U33A 3H9YA 4HJSA 4PV9A 4OGXL 1J05B 3GXNA 3T0XA 2AJZA 3OV6A 1EDQA 1CFMA 2AJYH 5ICXB 1X5LA 4QHLB 1HHKA 1U4EA 3CDFA 4KK5D 5FDWA 2EILB 5DHVH 1KPVB 1N64L 2YC1B 3BCFA 3QVAA 4P3DB 5EU6A 2K7QA 1AZBA 2DD8L 3MRIB 3MLPA 5MP6H 3SDXA 1H6FA 4KK8C 1XF2B 1P7KB 2VXQL 3LPOA 4HGWB 3LPGA 4ALAC 3APMA 3WGVB 1NIAA 3D0LA 3ZTNL 1E8ZA 4N2CA 4QHKI 2FYYA 2XQYA 2PWHA 1F6AA 2NTFB 2EDJA 3CPLB 1R3LB 3DETD 1OAUL 1SBSL 4HSCX 3VD0A 1T1YB 1I85C 1W6LA 1WCBB 1SHMA 4BZYA 3HB3D 2WWMD 4IOSD 2CUIA 3TYFB 2R1WB 3UEQA 1QTPA 3N5AA 4WWPA 1L9PA 2NNAA 1MHHA 2Q8BL 4RA3A 4RH4A 3SKNB 4NZUH 2EACA 3GSNL 3IYLW 4G6AD 5DJZB 3QFJB 1J1XH 4OJFH 1RURL 4ORGB 1U8NB 5CO1A 2R0ZH 5DR5H 1DVYA 2XPZA 5EOCJ 1MCFA 2AS5M 4L9LC 1PG7X 1MFBH 5HY9B 2W07A 1QWHA 4I88A 5DA4A 5T1DH 1CR9H 3ARBD 4G7SB 4JLRB 3UAEA 4HUWA 1EMTL 2X0VA 3TYGH 3MZTA 2C5DC 5ETUA 1WEJL 1F4WL 2MKWA 3ZTNH 1YYCA 2ED7A 4BQCA 4E0RA 3RZCD 4G80A 3DMMC 3FO1B 3HNVL 3PPSA 4FHJA 2XYBA 3MLTA 4FX5A 2FJHB 1IZKA 4NQDA 1CFQB 3NJKA 4JPWH 4Z0BH 3ARGD 2CKNA 4UT9L 2ADIB 4XBMA 1DBKL 1N0LB 1NAKH 4JQIA 1L7IL 2ZWKA 2WXLA 1KJ2A 4ZPVB 1DZBA 1RIHH 3QQDA 4XNMA 4NZUL 5DJYA 3B7UX 3AG3B 4LVHB 1P4IL 1K3ZA 2VLKD 1RPQA 4CMMA 1OWWA 1RURH 1S7UB 3V6ZB 4JN2B 2LAGB 1FNGA 4MAUH 3QXVA 5J6GA 3X3FL 4TSAH 2JKIS 3MBEC 3BESR 1Z0MA 5DGQA 1YHPA 4MJ5A 4J3XA 3ZYZA 4FQXC 5T1JA 4QHMA 1C8QA 4C4BA 4UU9A 2BSRB 3K80A 3D7PA 3RBGA 5D9SA 4XCNA 3RTLA 3TGXA 1KENL 1UKTA 3OD3A 3VXRE 4FABL 1F4WH 4HGKC 3UPRA 2XOTA 2Z31A 3CFIC 4DK6A 2JMRA 5GISL 1JVKA 1OF2A 4KU1A 4J3VA 5BRZB 1J5CA 4JFFE 1UWXK 4D3CH 2NY1C 2OMWB 3ZDWA 1F1DA 3FO1A 3MROA 3OJ2C 4Z0BL 1AKJD 2KH2B 2FLMA 4LSVH 4YC2C 5ICZA 4BCZA 4HV8A 3QORC 4LASH 4HUVA 5E5MB 1WJ3A 5E9DE 4AQ1B 4YO0B 1I8KA 2VR3A 4J3OG 2I85A 4ODTL 5C08A 2MCAA 3ZSSA 4HUWB 2D4FA 2ORBL 3BISA 2EIZB 1BQLH 3WIFA 5CINH 3SE9L 5AVWB 4HS8L 3S3DB 5KG9B 1CLOL 4ES9A 5IJVB 2OR8A 3S88H 5IFHL 5C08E 4X5LA 3D05A 1KYUA 2BVTA 4L4VE 2Z8RA 1WFUA 3FCGA 2MWCA 5D7JD 4CVZB 1V55B 4ZMWA 1PSKH 1OAZL 1P84J 2NYKA 1MIMH 3IBEA 1AKJB 5JOPE 1TYJA 3MV8E 2NNAB 3VFGH 2CBOA 4IJTA 3ARFC 4RMQA 1SF5A 4NI6A 2YA2A 4KKBC 3SJVB 1OARL 2AEQH 2JE8A 4TNGA 1CFTA 2H6PA 1L0QA 5GISH 5FV2A 1BIIA 3VXRA 1CTNA 4DZBB 4XP4H 2DLIA 1M3IA 2R56H 4OZ4B 4P49A 2VITB 3CPLA 4MA3A 1FAKT 2J8OA 4R7DA 4KKZA 3UJJL 4P3CH 5BNXD 1I1AD 1ZANL 2VMFA 4E5XB 1XIWA 4OF6A 2AKRA 3SDDA 3V7AG 5ECGA 2XTLA 4PJ5E 2JKLA 5EF1A 2QKSA 3BUYA 3UGXA 4DP7X 4ETQB 3NABH 5GGRA 3IDIB 3L7EA 4Z77B 1JMXA 4GKZB 1WFMA 2V5MA 1IGMH 1UCBH 3E8UL 2ZJSL 1YEFH 1ZV9A 1I8IA 4N28A 2DLGA 3ULVF 3OPZH 2EVFA 2RD0A 3S7GA 4G9DB 5FWRA 4Z7OB 1NFAA 4FL4C 4KV5E 1PLGH 5F6IB 2EAEA 2Y7QA 1KTLA 3ISRA 5JPMB 3KWVA 4QRRB 2HN7A 3CAFA 1NJ9B 4UI2A 5HI5D 1IM3D 3GRWA 4GS7B 3GSNB 5DWPA 4WW2F 3ZE2B 4ZO9A 2VR6A 3VXMA 5ACZB 4IRZA 2A3TA 4Q6IB 1HL5A 2V2XB 1OGSA 2BFGA 3WJLA 5LHDA 2IDFA 4X8JA 2R56L 3BEWB 3FUKA 4M00A 2BP0B 1NMCC 5ACLA 4LT7A 4PJAE 3UJJH 2LE9A 4HEPG 3BYYA 3OBAA 2FEEI 1ZLSL 5LBSL 5IFAH 4JM0A 1FFPA 2R69L 5CZVL 2OFQA 1KGJA 3QJSB 3TZVC 2ICWB 3KPOA 5I8EB 3OX8B 3HHSA 3Q5TA 2CKBA 3MO1A 3NCWA 2NW3B 3JUZA 4HBCH 5B21A 1JE6A 2IBZX 3IDYB 4HWEH 5T3XL 5CWSA 5CU9A 2YBGA 4KMTH 4UDTB 3F85A 1SMDA 2WCPA 1JS4A 1NCTA 4MCNA 4M8QB 5AAMA 4JG5A 5E6ZA 5GGTA 3UYOD 3BQUC 3B2UD 2C7FA 2LW3A 4BFRA 4IBLT 1FZMA 1DSFH 4JQXC 1KGYE 5MERA 5KJRL 2DIJA 1U2YA 1WP6A 1Z3GH 3VFOB 1ACYH 1B6DA 1ZTXE 4R2GC 2IFGA 2YUWA 3WNOA 1FWXA 2OMTA 4FHBD 4OKVB 3TO2A 4AUJA 3VSUA 3EG9B 5I8CA 4XMLH 3ZKMC 4EN3B 1RIUL 2KC0A 2OSYA 4O2EA 5GGVY 3SPVB 2ODIA 2ESVB 4TL4A 5ILTL 4I8DA 3UO8B 3L16A 5T5FA 3UTSB 5DEFA 4B96A 4G5ZH 1U58A 4UZUA 4EUPH 1NBVL 4LRNL 4UB0L 4DK3A 4AQEB 3UP6A 3QS3A 1CG9B 5L2KE 2W9DH 3IDNA 2VR4A 5C97A 3IPBA 2ADFL 4UWQB 1T66C 2OBGA 5IR1B 4OJCA 5T3XH 4FQXD 3OR7B 5KJ7E 3HZVB 2A9ML 4L3EE 3QEQB 4NLHA 3RVWC 5AALA 5JIDA 1IM3A 1VAHA 5IQ9B 4XN9A 5AAPA 3QW9A 1CE1H 3SCMB 3ENEA 3G5VA 2XXGA 2N3JA 2OV0A 2ZX7A 5IWLA 1UQSB 3IMSA 4M5YH 5F88B 2IXQA 3EYFB 3DX9B 4JGNA 1FH5L 3NUKA 3UTSD 1OCZB 3DC0A 3NIDB 4UQCA 1T20A 5HHVL 3LVTA 4ENZA 1COBA 5LGJB 4GI6A 1AJ7L 1S5IH 5FO8A 1AO7D 2JQMA 3FCSB 3R18A 3WLWC 3NIGF 4H88H 4A7QA 3NRQA 1KWGA 1MRDL 3DX2A 3JVFC 4KXZI 4Z7WE 4YHLL 3FN9A 3MLVL 3H55A 5CSGA 5T5FL 4TUKH 3BH8B 1AI1L 4Q6IC 2GI7A 3FTYA 4X6CE 1VHPA 4FA6A 4L8CA 4IU2B 4H8WC 2PXYD 4TL5A 4BUHA 3C87A 1EAQA 4DFHA 1NEUA 2RQEA 3FSOA 1NEZB 1V3LA 5IK3A 4HEME 4N6RB 3B8SA 3L7FB 1D6EB 5E1AB 4DEPC 1MFMA 4YHZH 4U6TA 5EF2A 2BHUA 4F2MA 1CLYH 5AENA 2A9MH 3H42L 2FBJH 4D94A 1OE2A 2HTKC 5D7IE 4WSKA 4JRWA 5ES4B 1CLZL 1NCUA 4K5MA 3QJVB 4K23H 3RWHA 1Q72L 2I9TA 2YUZA 3QJHA 3BQUB 3EBHA 4G72B 2JCCB 4RAVB 4YFLF 5F7DB 2DWEB 3L6FA 2ZYRA 1Q1JL 1RXLA 1AO7E 4Z7VA 4JG0H 3R4RA 5E9DD 1MCJA 2VITA 2ZNXA 3DDFA 4YWGL 5IHBA 3DHPA 3GK8H 1I1CA 1LK2B 2R83A 2A73A 2JKNA 1SLUA 4LO9A 3US0A 4I5BA 2D31A 1BM3L 1IC5L 2UWEF 3V0FA 4YHLH 2HJFB 5JXEA 2GJZA 2WINA 5HYSG 2XWCA 1XH3A 3FT3A 2EEDA 5FM8A 3Q8AA 4QI3A 4G8IB 3DOIA 4NRYB 4GXVL 5D7LD 5B1JA 3RVWD 5MEOB 2FNBA 3I02B 1IARB 4N8CL 2F19L 4LLWA 2EP6A 1QSEB 1R3HA 2QVKA 5ANME 5IEKB 2X4SB 1FCCA 7CGTA 4KOBA 2OL3L 4XRCB 3GUFA 5IZ7A 1K9TA 2NRDA 1FHGA 4JRLA 4W4NA 3VTAA 1ZGLA 2P24B 2XG5B 4DQAA 3DVNA 1NCNA 1J8SA 4XTRC 1CDIA 5BV7L 4MDRA 5EMYA 4JR9L 4C56A 4LHUA 1W0YT 1TFHA 3Q6FA 3GBDA 3QRLA 2AEPH 5ESQB 1ZHLB 2OPCA 5DD3H 3SKOB 1YNLL 2D7TL 1J1OH 3Q1SH 4JKNA 3SQBB 4M1GH 1TF4A 5SWQA 3H53A 1ZRUA 4LKXA 1J5DA 4UM9B 1W0VA 2UX7A 1WF5A 3TBVB 1EV2E 4ATTA 5D7SL 4HG4J 3C09B 4PJIE 5C7ZA 4MJ4A 4BE6A 4BFJA 2YAMA 2ZF8A 2ZOKB 2F8OA 1PIFA 3E8VA 4PB0H 3LXUX 2KLRA 3W9DB 5FF6A 4AIOA 1TG8A 1W2KT 4WV1B 2EKJA 4W9GC 4NENB 3VE0A 2HX8A 4HKJA 1E2VA 3NFPA 5D7KE 5DJ0A 4MDJA 2EIJB 3PFUA 4DP9X 1M6OB 2VDNB 5A7EA 5I76A 1RJYB 4OM0L 1G6RA 4HGMA 5IM7A 2QV2A 3D3VA 3MMEA 4QJ3B 4KO5A 1ZT1B 4DUVA 4GT0A 3OKNA 4XO4A 3ROOA 2DDQL 3SD5A 4CSZA 5B8CA 3MNDA 4NM4H 3VD9A 4BDVA 3KPRB 4RNRA 3LXCA 2O93L 2QR0B 3BZ4A 3ZKQD 1RZGB 3GJEB 4JZJA 4RDBA 4GUOA 4LCUB 4PUBL 1M57B 2PPEA 4P2OA 1NIBA 3DSNA 4JBSA 4NI3A 4NQXB 4WO0A 3SDCA 2K3TA 3IKCA 2NUTB 4OH2A 1WISA 3A4FA 3RWFB 4WUUD 1CD9B 4JQVA 4AKQA 1LMKA 2VLJA 1EHAA 3BIKA 4JM2F 1AZZC 5A2JH 1AQKH 2TRHA 4JFOB 3KPSE 1QYGH 2NT0A 3B43A 5JYLA 1U8KA 2LOEA 3SGDH 2IAMD 3RNQB 1Q9WA 2ITDA 4Q2ZA 1I1AB 3OAUH 3V5KA 1JV5A 4B9YA 3DK0A 1U8PB 1PDKA 3OXRB 2Q76A 4NIKB 5FUOH 4GBXC 2GY7B 2QPSA 3CSGA 4XP5H 4Z7WA 3BVNB 3LX9A 4JG9A 1ZS2A 4A04A 1KBWA 3BAJA 1MJ7L 1A14H 3RVTC 1Z5YD 3WTUA 5KBNC 5HDBE 3HNTL 4G1EB 3QO1B 4LLMA 4Q8BA 5EEYA 1NSNL 5LBSA 5I74C 4PS4L 4XNBA 3J2PA 1RP9A 4GJTB 3ZBMA 1EZLA 2HSIA 1BG1A 1KJ2H 5DVKA 5KVGH 4DAGH 4MZIA 4PJ8C 2NTFA 4NQUA 4KJPC 2KKQA 3AFLA 3PL6A 1N8OE 2XY1A 4KUZL 4WW1A 5ENWB 1RCYA 4UDUB 3MJ7B 1KB3A 5F1NA 3HZYA 1MJUH 4JDVA 4NNYB 5AVVB 1IE5A 3FQXB 3LHAA 3IFNH 5A6IA 4N3TA 1K4DB 4E9SA 4LCWE 1AO7B 4LMQE 4P9HC 3II1A 3SPJA 1SDYA 3CC5A 4JO3L 2WC7A 3MX0B 2P42B 5SV4A 5C0AA 2IGFH 4MWFA 4RIRA 3G08A 5GJSL 5FKPA 2WQWA 1E7UA 1NGYB 4AQAA 5GSVB 5ICYB 1RSYA 5FK9A 3ARDA 1KJ3L 3QIWA 3L4WA 3TFKC 3KVPA 1DE4B 1UKQA 5I24A 1G4RA 3EFFB 1KYOJ 2XA8L 5AZ2H 2ZWNA 2K78A 4FQQB 4L5FE 3ZRSA 2J4WL 4GXUM 4PY7A 4K3GA 4H1LB 4MXWH 3FO0L 1JF5A 4MQXC 2JJTA 1OTTC 1QSEE 3WFHB 3VDBA 3IJ7A 3RZCB 2X89A 1J1PH 5H35B 4ZUUB 1OANA 4H0GA 2VQ4A 4GBXB 4JRXE 3N40F 4KUZH 1ZLUK 3IGLA 2BNUA 1Y0LB 4AV5A 2VKWA 4ZDHA 3ULUF 3POCA 4FFTA 1HNFA 1ZSDA 1OOAA 4RWHA 5E08H 5D1XB 3PQYE 2BMKB 4PWHA 1ZHBB 43C9A 2DMHA 5CP3A 5INCB 3QR1A 1FBIH 2XICA 4PJXE 4FQ2H 1GMEA 1CCZA 3WFBL 3M1BB 1EJ6A 3KCPB 4AYGA 3QWOB 3ZHFA 3VRIA 1ZD6A 1FN4B 1OTUC 2DB8A 4HF5L 1ZDSA 3K6OA 4DW2H 5F3BA 3QNXB 1L6XA 4DQOL 2J3SA 1MY7A 3P3TA 4JMNA 5IB4A 5F2FA 1D5XA 3HCVA 4MCYB 1VACB 4N2GA 5E2UH 2C26A 4R0LB 3EF7A 2MCPL 3FN0H 3INUH 1KFAH 4KI5F 1IAII 1F1AA 1BZEA 3FRPB 4P5TD 2CGRL 5HHMB 2DWXA 2PCFA 5DD5H 3ULVH 1JGUH 5JPNA 2BFVL 3HAEA 4G43A 3RIFK 1E7VA 2XWRA 3VXUD 2UWEA 3TNMA 3VI4E 1RK0B 4LL1A 4LL4A 5KN5B 3Q3GB 2ITEA 3R7QA 4XO9A 4Y2LA 1DVZA 1H8LA 3CSYA 4U1HA 4OLXL 3IDXH 1CIDA 4MJ6B 2O6EA 3OVUB 4OZGF 1O75A 2OJZH 3DUSB 5FW7A 3FB5B 4E9VA 4RQQB 4P46A 1BQRA 3UTTB 1C5CH 1NGQL 2BWQA 3RWEA 4Z7OE 1UM4H 1C8PA 1R19A 2H0JA 5E08L 2DQUL 1R3KA 3EGSB 3IXTA 3B2DC 1ZA3A 3E80A 4N2HA 4BD4A 5HSFA 2XQBL 1H3WM 4FI8A 4JY5L 3V10A 4OD3L 4QHPA 3SYQA 2BNRD 3LRHA 1BM7A 1JNLH 3D39A 1KXQA 2WBJB 5JHDA 2YAFA 4NHCL 2VN3A 2W8CA 2E9IA 4OCRL 3QUML 2AERT 3P30L 5B22A 5D6DC 4DH2A 1TTBA 4R96A 3UZEA 4RRPG 1SDAB 2R0KH 2EDNA 3ARFA 3BH9B 4GQ9L 2WB1A 4NBXB 2CDGB 1VEOA 2CH8A 4UINH 4WDIA 4WVRA 1JGUL 4K7FB 4GSDH 1N9PA 3L9EA 3PHOB 1AGDB 3VG9C 2ED9A 3V7MA 5HI3C 3WDIA 5JPNC 1V5JA 5I30H 2XN9E 4NJ9H 1FG9C 2IQAB 4WGKA 4LQFL 5C0RH 3KS0J 3ZTJH 4W81A 3RIKA 2CSPA 4ZXBC 1QA9A 2VN5A 3FQYA 1HL4A 3MA9H 4Y9FA 3W56A 4ACPA 4L0YA 2AK4E 2KPNA 3EOYG 3NFSH 2FWOB 1SXAA 1QLEL 2LLNA 4K5OA 3OKKA 4GW5B 3L3DB 2BHZA 1J8HD 2IANA 3NSFA 5TH2B 5KW9L 3RBSA 3QYCA 1B4JH 3ATFA 2X1XR 3MJ9A 5F0MB 3KHOA 1KUMA 1B4LA 1I31A 2DI8A 2EDOA 3EADA 4F15C 1FO0B 4NRXA 1F3JB 2TRYA 4BZ1L 3O45A 3C8HA 3QZWA 2M2DA 5AKTA 4LCYA 2L7QA 4HH8A 3O81A 1CBVL 1G7QA 5JHLL 5FUCE 5AEAA 3SDYH 4NN6B 4DPAX 2JELH 5CSZA 1ILSA 1XWVA 3HNVH 3BE1L 3APCA 1MXGA 5FFOA 2FWSA 3ARFD 4NS0A 4UQDA 3IJHB 3N0AA 4G8FA 3HI5H 4JPVH 3O6ML 1RMFL 5FFLA 1IGCH 1BP3B 2NY2D 5K39A 4XVOA 1A6AA 1G0YR 4MMZA 4AW7A 4CGTA 1YNTA 1NBZB 2EUZA 1NOAA 5DS2A 4ONHA 1DLFL 1A8ZA 4V2CB 3RY6A 3E38A 5DVLA 5EEUA 4TOYL 4XMWA 2NY3D 1T6BX 2Y0SA 1VGEL 1SLXA 3AGVA 2GHZA 4L4TE 3V0VB 5HYEA 4R4ND 3D39D 3V4UH 3KPQA 4S1DD 2BP8A 1LP9E 4QR7A 3X3FH 4XGZA 4UTAH 1A7QL 2E76C 4FXTA 4ONFL 1CU4L 4H8HA 4YDLB 1UG9A 2VM9A 1FIGH 1NBCA 3JZ7A 4L18A 1JZIA 2VZ3A 1HYSD 1FV1B 3LS5L 2WV3A 2NY2B 3DOSB 4BQBA 5CXPA 3TFKD 3JQOB 1F11A 3HPLA 3KEDA 4NQDE 4WI5A 1PEZA 3QPQC 4HKXB 1CBVH 1YMME 1XSJA 2JELL 5TD4A 3RRQA 3QAQA 2GSIA 2E8ZA 1BMGA 3ZDXF 4IBYA 3LQAL 3TBSA 4Y5YB 1XGZA 3VQLA 3QIUB 3HI5L 4XO5A 4WW2B 5GS0D 4FNRA 3EBGA 4FTVE 2NY3B 1AOHA 2GABA 3K6SA 1DLFH 1DBJH 4B9IA 5TDOA 3MJ8A 1BJ1H 1UVQB 3MRNB 3GSNH 1VGEH 2WHVA 3B9KA 4XPTH 4HT1L 1XF5B 1CLOH 3SDXF 4N0UB 3S5LG 3N1MC 1F5WA 1NC4B 4PRPB 4UTAL 1X5HA 4BM7A 2GSGB 5HGGS 2OR9H 3V52L 1F4YL 3H3BC 3FU7A 4MXVE 5E2TH 3JVGC 3RQ3A 4LLAA 3CH8A 1M1XA 4WGVB 3P4MB 4GSUA 2WANA 1PZ5A 1PW3A 4UOW1 3VFGL 4AMKL 4B50A 3QYNA 1AGEA 2HP4A 4WWOA 2DYPD 2DQJH 3DKHA 1PKQB 4JGJA 2ENQA 1K3IA 5HHNB 3SPCA 2UZYA 2Z9TA 1NDTA 3U36A 3FL7A 4CDGC 3BZDA 4PWEA 2JI2A 4M43H 2C7UB 4NJAL 2P8PB 1MUJB 2ZCZA 2ZXEB 1G7JA 2FSEA 2Y24A 4N20A 5I6KA 3JUYA 3CN3A 1X5KA 3AXHA 4YR6B 4PJ9C 3FOLB 1T7XA 2YPLA 5EB9A 4AGQA 4OV6F 3SIKA 1I3RA 3B9DA 3KLAA 3CZEA 6CGTA 3JV4A 5E7BA 1HXYB 1IGML 1KDJA 2DQEL 3MJGX 5FKAB 3VM5A 1TJMA 1A6TA 3GJFK 1F4YH 4WY7L 3K71A 2R0LL 1A6AB 2F0CA 1OGAB 5FLVA 5JOFA 3O9WB 4PG2A 2GCYA 3D4YA 1CICC 1X44A 4YDZA 4PJGF 4Z7IA 4G11A 5T5NG 1GL4B 4XOCA 5PAZA 1HQ4B 2W91A 4RZCB 1HIMH 2X09A 2EE6A 2CUAA 2XSKA 5FECA 5SX5K 1RJLA 3B37A 4KJYA 4Z7NF 1P4LB 1RZ7L 3QZWB 1NKOA 4I18A 1S9WB 2APVA 1IBZA 3DRTA 4IIQA 1PZSA 4HS3A 3GMMB 5I16A 1N5YH 3SO5A 3UTZB 3U9PL 4BFIA 1MELA 4HCFA 2WSPA 1PCSA 2Y5QA 5EZJA 1AKPA 1CWVA 1O6TA 1E6JL 5I5JA 4BA8A 2EE2A 3SZ6A 4Z5RA 3CHQA 1URIA 1S7RA 2WUCH 3DMMB 1M7DB 2V8MA 1WYJA 4WJG3 1G6RH 5DWUH 3SE9H 4DKAA 5EH1A 1ZIBA 2MPAL 1SHWA 1WT5C 3KR3H 2J72A 3LQAC 2DQTL 2ZAGA 4HUNB 3HJEA 4XVTH 3N44B 4M48L 4LGPB 1WDAA 4HW6A 1AHWA 1EEYB 3CX2A 1HKFA 3HR6A 3CGTA 2X88A 4KNUA 4YEEA 2ZNWA 3I3BA 5AW9B 1MOEA 2V2WB 1NMAH 5I1IH 5KSUB 2J21A 1AANA 4MA7L 3FT1A 5DK0A 5IB3A 1M9WA 3FJTA 4ESKA 5JW3H 2YO3A 5J4MA 4D0DA 1U3HC 4L4TB 4OLZL 5DEGB 3W1ZA 2QVIA 3GRWH 4LGRB 4P0DA 3UCQA 2JVUA 5GS0L 3GD1C 5TF0A 5A2KH 2W0PA 5FB8B 4C54A 4JJHA 3RKPA 4U3XA 2X4PA 2IH8A 2ITCB 2JCCF 2K8MA 5D4JA 4BELD 2G4GA 5JOPD 5C0IA 4W70A 2YOAA 2DYSB 2VUYA 2WXNA 3MDJA 1NBVH 3DBXB 1XGUB 2YGQA 2EECA 1KG0A 3R4DA 4U1MB 3RDTD 1NOLA 1YPZE 3GXMA 4Y4KB 1IGJA 4AW4A 1F1GA 3GNML 3NABL 2ADFH 4ALAH 5C0FB 4LNVA 1G6RL 2DICA 2A83A 3WNPA 5SWZA 2ADGA 3WS3B 4Z76B 1PZ2A 1YEFL 2ZJSH 1UWGL 4ZW8A 5DDHB 1ZTMA 1XV8A 1JZFA 4G7RB 4N3UA 2Q2LA 1WRFA 4KX9A 1P5VB 3L3JA 5FYKL 3TNNA 3QORB 4P2RA 1GYCA 1PLAA 2M83A 2VERN 1S7VA 4P23C 4MRBA 1RJZB 2X9WA 5L6YH 3RWCB 1M4KA 4PG9B 2VLME 4X6CA 2VDQB 2ZQKA 3DVFA 1AR1C 3EJQA 3NMEA 1PF3A 2FUQA 4AG4H 2ZOWA 4BWWA 3VDCA 5ID1A 1LXMA 4PQXA 4M7LH 5JR1L 5TE6H 3IF1A 1EA9C 1AD0A 3UJTL 4PHZA 4XX1G 1VLXA 1JYVA 3AXLB 2DLFH 4EEEA 1TQVA 1MRDH 5I1GH 2FT7A 1A1OB 1ED3B 3QXAA 3AU1B 2C3VB 4G8GB 4C59B 5E4IA 5T5FH 1HXKA 1AXIB 3MCG1 5I6LA 1XDTT 3VFMA 1FVCB 4WEUD 1CF8L 4G3YH 3ISWA 4AEIL 4K07A 1G5AA 4HSQA 5IMKB 1SXCA 1ZVHA 1QRKA 1YN7A 1FRGH 4QD2E 1HVXA 2BXZA 5D7IB 4RFNB 1J8KA 3UG4A 2CKBL 4JO4L 1U2HA 2IADA 4K3HA 2Y2WA 3S36H 3VGBA 1UWGH 4FQ1L 2VRAA 2IGTA 3QPXH 4XB7A 3K5RA 1JHTB 2R27A 3ZR5A 3EYOB 2YXVA 4LPUA 4GQQA 3ULVD 1BAWA 4KO9A 3KWWB 5F3HA 1QFOA 2WTRB 4KKBD 2YLKA 2VDMH 2ZICA 4RMVA 2A74A 4ISVB 3SYAA 1F2QA 5C8JA 1WLHA 1X9QA 2V6HA 1WA1X 3NZUA 3VGAC 5HP5A 4EKJA 1G7HB 3PWNB 2FHCA 4FQLH 4IIZA 4JPWL 3UDWA 1CTOA 1FUNA 1AMXA 3F5WA 4NPJA 3V4VL 4YJZL 3IGFA 4OF8A 2ETWA 3RDJA 3MYJB 3SE3C 3B2MA 5E51A 1CDUA 4DSYA 2IJ0C 3KNBA 4X98A 3FFCE 1LO2L 5CP3H 4O02B 3B3IA 3GB7B 4CMHC 5C0CD 1OXYA 2YA1A 4IOFC 3BJLA 4HUMB 4PJAB 4AVHA 3ILEA 1RZPA 1YECH 4L1HA 1D5MB 5FO7B 3KH4A 3PL6B 3S36L 3AQZA 5AAWA 2YBRA 4NKMA 1LD9B 3P2DA 4G9FB 1R5IA 3FB6A 2ZWSA 1IKNA 4F9PC 4BKLB 4GW1B 4P9HH 3DX6A 5C0GA 3FBQA 2P80A 1KJMB 1EVUA 4A6YH 3IPFA 4ZZFA 3BGFC 2WQXA 1BX2B 5CJXA 2YN3A 4GP8B 5IG7B 2QKIB 3ARGA 2W65B 4Y5VB 5DD3L 2PWFA 2IV9A 4ERSL 5E99H 5EZOH 1ROCA 1TCRA 4UNIA 2WXJA 1QFUH 3SE6A 2HVJB 1MCOH 1S5IL 1AHMA 3VU1A 2DBLH 3JWNE 3MRFA 3X1BA 3LNEA 1INDH 1Q4NX 1T0NA 1CDCA 1P2CB 2BVOB 1SNRA 4DPCX 4QRTB 5IVXA 4JFQB 5I18L 5CD3B 2V7NA 3I6LE 2ESVE 3X17A 4JNXA 3MVSA 4OTXL 2IDSA 2OSXA 2UUDK 1KXHA 2GJJA 1AFVH 3KDMA 4AGLA 4FNLH 3TCLB 4Z78A 4XPGH 5C07B 3SD2A 1CLYL 1A7PH 5A2BA 3ILDA 4IKIA 1RK1A 2EXWD 5FO7A 2EDLA 3MRHB 4QXGL 4YFDB 2C7UA 4X83A 5ACMA 3ZT6A 2TSAA 3H4HA 2XTJD 3ZDZB 3GUTB 1R17A 2DLEA 1N0XL 2O4EA 2W60A 3VGEA 2ZOLB 1RP8A 5IVOA 1D9KC 4OD2B 3V5HA 3V8OA 4AENA 2ADJB 2AMGA 3TONA 2Y1AA 1RK7A 3U7WH 2GJ6A 1HWGB 3OZKA 3GK8L 3IN0A 2K9UA 4I3SL 4OY9A 4L8DA 3ZVVA 1FL3A 1INDL 4XX1E 2WVTA 1BXUA 4WO4B 4KZEH 3KPLB 4L37B 3Q2LA 1PGRB 5ERWA 3W11D 1NOFA 3U1PA 1QG3A 3MJ9H 5MHSD 2FLBT 1AHWC 4OGAD 3BT2L 3F64A 4L4VA 5HGHB 5AVXB 1EPFA 1OSYA 3KD4A 3O3UN 5DTFA 3K4DA 5FUOL 2OL3H 2Z7WA 1QNZL 1TLMA 3T04D 1DJIA 4ZXBA 4PJ7F 3A6CH 4F5CE 5CAYB 3DVGA 3MRCB 2XACC 15C8L 1OB1A 4PS3A 4PGCA 1PAMA 5LUMA 2VDOL 2JLPA 3HFML 5D7IA 5ALCL 4KDTA 5FGSA 1T1WA 2XN9A 3MRPB 5TGBA 5C0EB 4O4YH 5FXCH 4JR9H 1KGUA 1NKGA 3HC3L 5DVOA 3O8XB 3O0RL 3V0EA 2XG4B 1ZLSH 3B4NA 4WO4D 4UT6H 3S37H 5I5MA 1JWMB 3QJZA 4IBWA 2A7BA 4TVPD 2NQ3A 1E5CA 2CPUA 32C2A 1RUML 1SHXA 5CIPB 4JRFA 1UASA 5EO1B 5FW6A 3U7YH 4HWEL 2O6FA 4FHKA 4FFYL 3FFOA 3MJ9L 4PB0L 2CXKA 1TSRA 3WKYA 3BT2H 1H8SA 1C16A 3I50H 1NCHA 4H13C 4D0CB 1NBQA 2BZCA 3GMNB 2VXVL 1DSYA 1U0QA 2CGZA 4FQXA 4G1MA 4POYA 1GPOL 4QYAA 3NZHL 1G84A 1SN0A 3EIFA 5DZLA 4A7TA 1JZ5A 5DDHA 4HXBH 4HWBH 15C8H 3MRDA 1D5IL 3TO4A 5JW4R 4ZMNA 1BVKA 5EULV 4OZIF 1DBMH 4LCWA 1XR8B 1DHKA 4LAQH 4OZGE 4WEEA 3EH2A 4P4RB 2D3VA 4N9GA 4RAVA 2DEYX 5IG7A 4Q89A 3TZVB 4G5ZL 2YIHA 5KS9F 3RWDB 2CHNA 4M9OA 1QOKA 3NACL 1EK3A 3FTUA 4A2MA 3PCYA 5JXED 4FXGC 5IVNA 1QATA 1LEGA 3ATDA 3V4VA 4PRDB 5KOVC 2WVSA 5EU4B 5J89A 4XCYB 2IPUK 3EXLA 3K2KA 4L4TD 3MNWB 1HXMB 2IANB 1B90A 1P53A 3LN4B 3KBHE 5EBLA 3QXDA 4YDKL 3WOVA 1HHIA 5GPRA 4DO5A 2ZIDA 2E7LC 1HH6A 1ICTA 1HQRB 4M93C 5DK0B 3SHSA 4LSRL 2XVLA 5JO5B 1DVFD 3BZFB 1GYAA 2Y36L 4R2GB 1A4KB 3CVHB 3CZFB 4TKWA 2R4SH 3LS4H 3UBXG 3ZKNC 2IBZY 1QLFA 2P7TB 1MJ7H 2MSPA 2PXYB 3BKCL 4G42B 5CJBA 4ZNEE 4QAWA 1EXUA 3TH3T 2WGNB 4IDLA 4QXVA 1T21A 2CGRH 2XJLA 1ZLVH 3ULSB 4HH9A 4DOHB 5C8JB 3KW8A 4HULB 3MRQB 2JIXD 3FFCD 2QGBA 4HUXA 2EDFA 5A40E 3SE8H 4X99B 4LSTH 2VM4A 4OF0A 4BSJA 3KPRE 3HHMA 1P4LA 3L81A 4OF5A 1J5IA 1KCWA 2ROYA 4U49A 1WAAE 4UV7L 4KHTL 5FYLH 1U3NA 1P6WA 1T7ZA 2JKRM 5GGTH 1XR8A 3NJIA 3Q5YA 3O11A 2R15A 4GI8A 3KLHC 2JKJA 1OGAE 3GGWA 4I9WE 3CSFA 1NIEA 5FYLD 2F53D 2G9KA 1T1XA 3JZYA 1UADC 3ES6A 4IS6B 3V4LA 5DU7A 1Q72H 2OZ4H 2YOCA 4UBDD 5AOJA 1JPGB 1DCEA 1RLWA 5KBPA 2COQA 1A3ZA 4FQPA 4PJIB 1KJ3H 3LNGA 2CO7A 2NZIA 4I48B 3RL2A 3DSFL 1NM9A 2R0KL 1O7DE 4GQ9H 1OCWL 4GI9A 5D71L 3TCXA 2XA8H 3PF2A 5AZ2L 1BM3H 5INDB 3WE6A 1AZNA 1XGQB 1ZDQA 1NLBH 1W91A 3ZQXA 1K6QH 4L3ED 1FZMB 2YAEA 2K6ZA 3CU1A 2CDEB 2DZEA 2Q1EA 2FL5A 1KTKE 5C0RL 3VXNB 3V0HA 4GXVH 2CLZB 4N8VG 4PRIE 2B5IB 5KVGE 2PCPB 4UV7H 5IT2L 3BKMH 3WJMB 5F9WC 4X6DF 1IEBB 2ICWA 1FVDA 3U4EB 4EJ1C 3WSQH 3QDMD 3QIBD 5C2BH 1FFPB 5B38B 4Y5VC 2CAKA 3WY4A 1HAUA 4Q74A 2BCKB 4HSAC 5DTFB 3RWIA 3HZKB 4DW2L 4X99A 3WUWG 1WBZA 1D2OA 4H5SB 4K94C 4PGDA 2AEPL 2VIRB 4YHIB 5KYXA 1EXGA 1TZ8A 2ZOTA 3B1TA 3CC1A 1WVZA 2WXGA 3KXFB 1XF5A 4MAYC 4RISL 4XZUB 3Q43A 5D7JB 5J11C 1NCWH 1V3JA 3VXMB 1KFAL 3EFFA 4PRNB 3VYPA 2OW7A 3NRFA 5L4JA 1UB6A 5E23A 1A9BB 2JB5L 2HRGA 3EJZD 4ELME 1FCGA 3QIWB 4IEFB 4YDLC 4D9QE 4PY8I 4WTWA 2HFFA 1K6QL 1QLFB 2P7TA 4N0RA 5DRXA 1AQMA 1TLKA 1SJEA 2YZ1A 1SOXA 4NHUB 5K1NA 3QJXA 5AW7B 2X4UB 1ZSHA 2CCLA 35C8H 1E4HA 2B15A 4QTHA 2EC9U 4PJ5D 1FE8L 4R8WH 2UVEA 4Z7VE 3QUZD 4K5LA 1JV2A 2F53A 3RTQB 1QASA 3FQXA 1T21B 4PJ9D 3V4UL 3GQFA 3I9GL 4NNYA 4F3FA 1KBBA 2ZXDA 4X6EB 3SKMB 3GMOB 3P3SA 3KS0H 2BOCB 3PWLB 4E68A 2CIKB 4CBZA 2GPZA 3L3OA 3QI9B 4GAAA 4LRIC 3DUHA 3A6BH 1IRAY 2X87A 3B7SA 5FM4A 1RD6A 3STZA 1FNEB 1F4XL 4Q58C 3T4AB 1QSVA 5FV1L 5EOTA 3QHZL 4U05A 3ZTCC 1ODAA 1KTDB 1WEJH 5J11B 2A9BA 3GSVB 1Y18B 2ICES 4ZMYA 2HJKA 4NO2B 4YEFA 4OCLC 2VC2H 1OT4A 4BFOA 2VAJA 1KELL 1QP1A 4FFZL 5C0ND 2DL9A 4ODXB 1T0NB 1CS6A 2FB4H 4EVNB 3ARBB 5TF1L 4PRBA 4MZ2A 5E1HB 2WKGA 5D2NB 2N0KA 4EN3C 4XPBH 1KV3A 2C9XA 1JV5B 2HKAA 3U4KA 4LQFH 4GO9A 4XI5D 5I0XA 5MENE 3KLAB 3OAUL 2WQRA 2YPLB 5DJ8B 4MAUL 2R1XA 5DF0A 3QG6B 4HCRA 4PJDF 3C60A 3NCJH 2ZONA 4AT6A 3Q0HA 5E2TL 4EUPG 4KKNA 2LFGA 4BQ8A 5FC9A 4AC2A 1O6SA 3SDCB 4N5EC 1D5MA 3OAZK 3QDGB 5TH2A 3MV7E 2L3BA 3HRZA 4Y4HA 2J1KA 1M42A 3BD3A 2XG4A 4PY8J 4Y19A 3SN6N 2PYED 2YFOA 2F8IA 3FB7B 3IM1A 3JTTB 4OQTH 4YVUA 3SDYL 3T3PB 3VJ6A 3UAFA 5I2IB 3TVMA 4PM1A 3A5VA 1MCHA 4CC1A 1A0QH 4ADJA 4TLKA 1PZ5B 3OKNB 3IDJA 2HJLB 4OZGB 1QR4A 4UQAA 4JPVL 4U0RB 5EO1A 1YEEL 4MVBC 2XCMC 4MD5B 3ZTDC 4LSVL 3FU7B 5SV3A 2OZNA 4HOWA 4CVXA 1WGOA 4K7FA 2C3WA 2K9FB 2V5TA 3FTWA 1A9BA 2VDNL 4YUEH 3FUHA 3V6ZA 1KIPA 4GSQA 2J2ZA 3U46A 1M6UA 1UB5A 2ZUQC 3I84A 3FNKA 3MV9B 1QRNA 4L5FH 1I53A 5IROC 3QFGA 1IT9L 2ZG2A 4X5WA 1UXLA 3MRPA 2VIRA 5KYXB 4QCIB 3P40A 3BPNB 1JERA 3AS0A 4J4PC 2VXUL 1KNOB 3QYMA 3EYQC 3WJJA 3VI3F 5HDRA 5IQOA 2J8UA 4QT5A 4QHKJ 3W5MA 1KNOA 3UIYA 3D3VD 1IEBA 1LO0L 1LNUB 3EBAA 5C0NC 5E0FA 1MWAL 5EUKB 1I7UA 1IAIM 2Z4TA 2B9AA 1HZHL 4P5TA 2OTUB 3F7VB 3C08L 5MHSE 5EN3A 2NYYC 3ZT5A 1BFSA 4ZG1A 3VX1A 1OIOA 4X9BA 1X5JA 2YS4A 2LABA 4GRMB 1XX9C 1G9NH 5AW5B 3VSVA 5JNYB 3ZUNC 4WK4B 4HFUL 3UJIL 1DN2A 2KQNA 1AACA 2GITA 1E6JH 1DQDL 4W4OC 1KC5H 5MEOA 2R7EB 4AYSA 4D7PA 4EI5D 4YHNB 4ZUVB 1VACA 1A7OH 3L5WB 3RE0A 3MRGA 3S3PA 4RGOL 1U2CA 3KR3L 2PWDA 2J1YA 2XQYG 5F44A 3WL9A 4M29A 3RAJH 4FLRA 4TLTA 4J12A 4Z7QF 3VXOA 1T1XB 2Z0UA 2EE3A 4JKPL 2KS0A 1KY7A 1NL0L 1FNHA 5D2LA 2EC8A 1VF5C 1E4KA 5D1QC 1NDGA 1NUFA 2AK4B 3GZQA 3GLEA 4C56E 5CGYD 2B4CL 4YK4B 4F7CA 3D0LB 1G7QB 4N1CA 3GMRA 3EW3B 4ACTA 4HYTB 5HVHC 2Y7LA 4Y1SA 1KYAA 3AW5A 4XO3A 4R26H 5E8EB 1WQVT 3P2TA 5LNGA 4JVUA 4NJAH 4CSSA 4HUUB 1MNUH 3T2PA 4KY1H 4FCHA 1IMHC 3PJLA 4ZW7A 1GW0A 4PRBB 2J55A 4XNAA 2X42A 3B9KC 3UERA 4XXDA 2HT2D 3UP1A 1JDAA 5CGTA 1XGTB 5IGXH 1HSAB 4WI3A 4S0SD 4WWKD 1DE4A 1I7TA 1QW9A 3PABB 1TZHB 5B1AB 3W0WE 3X1EA 2NW2A 1SXNA 3N42B 4FTVB 1H3UA 3ZT7A 2QEJA 2ZUVA 2VWEE 4DOHE 4J3OH 1UXWB 1RZFH 1T7VA 1R6VA 1HH9B 4P4KA 1RPKA 2D73A 4HUCA 4PCSA 4YSCA 3AY2A 1O7DC 2AV1B 3RAJL 3UAJC 1DQTA 4WY7H 3FOMA 3FW6A 3QG7L 1U8MA 1UXWA 2RQ8A 3IGAB 4X8XA 3K6NA 5D96B 5HBBA 1AO7A 2JJVA 2DY2A 1I1YA 4FZEL 3LKNA 3Q2CA 3KYMA 4PJAA 3EHBD 2J20A 3MV8D 5C86A 4NKIH 4YK4C 4NUPA 4I4WB 3OL2A 1WWAX 4XC3H 1KIQB 4XPAH 2DLFL 5EU4A 2ZX5A 1BVLA 1IM3B 4H8PA 3ZR6A 2OMVA 3ARVA 3DGGA 1N5YL 1JHTA 5EEWA 4NQVA 1QLEH 2NY4D 4WKXA 4G3YL 2HFFB 4GY4A 1BYOA 2KHAA 2W9DL 1NCAL 5K5YA 4GUQA 1EEZA 1N64H 5I17A 1G7HA 1SDDA 4HX1A 4WU7B 3DECA 3QP3A 4MMZC 4EIBA 4N0CC 1MCLA 5MP6L 1FVCA 1PTZA 4Z7WB 1UURA 4H26B 1CYXA 4PGDB 4YHIA 1U58B 4M48H 4KKLD 4DUXA 1ES0A 3MNMA 5DQJB 3BMWA 5FKAA 2W94A 1MFCL 4D9RD 2IADB 3ZDXE 4IMLB 4EN3A 2DYRB 4KPHH 5ALBL 5EFIA 1GS8A 4OKVA 2VMEA 4HD5A 1YSOA 4PTUB 5EBGA 2X2IA 2ZUTA 1D3CA 1EGJH 2ICWI 5FA4B 2FL5B 1WGVA 5JNYA 3RHWF 4XCFH 5LXGL 4Z3EA 1JPTH 2APXA 1BECA 1EZVX 2Z93A 3S8GB 5D93B 1R34A 3GBEA 2B1AL 3WHE1 4RX4A 3WEMA 3QBTB 1ZPLA 1XGRA 2E9BA 3K72A 3QCVL 4V33A 2X41A 4TSBH 1NCAH 4Y4KA 1WZMA 3UAJD 3T09A 3UTPE 2D9QB 2OJ1A 3HG0A 4AY0A 4U1MA 3NIFB 3GIVB 1VADB 3QSKB 4YL9A 4EE2A 4YSSA 1XCXA 2EDBA 4PJ5B 4F9LA 3B6SA 4K9EH 2MCMA 3N1PC 3ZK0A 5F7AA 4X5WB 2J8HA 4FKKA 4YXHL 4DZ8A 3WS3A 3QHFH 3DWTA 4KITB 3AACA 5KVEE 5C0FA 3WKQA 3I75A 3P9LA 4M7LL 4OLYL 4W93A 3BN3B 4HAKA 4GG8B 2ARJQ 4NAMA 1YYML 4HZAA 4WI6A 2O61B 3V6OA 1EBPA 1EGJL 5DI8B 5I1AA 1SF3A 4PWIA 4PLJD 3IDJB 4XCFL 5LXGH 4J39A 1M7XA 2YHGA 2AABL 3DUUA 4MYWB 2Y6TE 1L5GA 1QI4A 3Q6FB 4IKNA 5ESQA 1TFPA 2CJ3A 1D9KB 1HCYA 1T83A 2CM5A 4I4WA 2J2ZB 4DEPB 1SFHA 4MZ3A 4U3CA 1MXDA 3WFCL 1UOLA 4EQ3A 1HC1A 1JF6A 2WXQA 2NCEA 1A02N 3R06B 2AV1A 1JUFB 4ABUA 1YPZF 4NWTL 3KDMB 4KJYB 2VDML 5FECB 4RMWA 5JO5A 1SPDA 3KM1A 3AITA 2MQ0A 3NN8B 2ICWJ 5JQHC 1J1OL 4PCYA 4MZRA 4HMCA 4OLYH 4JJOA 5A16B 3FPXA 4XMPL 5AWNL 4EBQL 3CZLA 2EINB 3TWCH 1WO2A 2WKLA 4FFWC 3T2NH 2ORBH 3B9KD 3RPIB 2W9EL 1I1AA 3EYSL 3V5KB 5EPMB 3W82A 3ZOAA 4DKEH 3MBXL 1EH9A 1Y18A 3NK4A 5IF0B 1TTRA 5LG1A 1E5BA 3RWHB 1I8LA 2I9TB 2VZTA 1OZUA 3NOIA 4OCMC 1JZEA 3DX6B 3V0AC 4ZMLA 4M6OL 3D69A 2P9RA 3BP7B 3TF7C 1S9VA 4N1EA 3S4SB 5D2NA 4NKMB 4F57L 3A21A 1I9RH 1ZOXA 4UNVA 2BZ7A 2JKWA 2Q3AA 3AADB 5DT1L 1RPUA 2R39A 1B0WA 2V5SA 5ALCH 5E5RB 2ZT9C 3GKWL 3PWPB 1U8LB 4NM4L 1ZE3H 1RFDL 3HTLX 2ATPA 3KXFD 3HC3H 2BWIA 4KNSA 5BZDA 2DLHA 4K7PX 4F24A 4PRID 3C12A 3CLWA 1UOKA 4UT6L 1H3TA 4P3CL 1HTYA 4H20L 5D7KD 4XMPH 2F1AA 5AWNH 4JVWA 4EBQH 4Y9CA 4FP8L 1KN2H 3MMEB 1ESOA 2DQFB 1P0SE 1CIUA 3QRGH 4TF4A 3EHBB 4RGNB 1FNGB 1RZKH 3BKJH 5J6GB 3VFRB 3WENA 3U6XA 4N1HB 3U36B 1BHGA 2L04A 4XNZB 1R3IH 2YD2A 3EH3B 3STLB 3TBCA 3LZPA 4XZUA 5D7JA 3W81A 1N70A 2YRZA 2NXZD 3CN0A 3SCMA 3E2HC 2WAQA 3LCYA 3D4ZA 4R7VA 5JUEL 3LEVH 3Q9PA 3QI9D 4HG4K 2ARJB 4P59L 1A14L 2AP2A 3FCUB 1PX3A 4JFHE 3SBWC 5J7CC 4FG6D 3HNTH 4TRPL 3UTPD 5EIIB 4ZAKA 3O2WH 1F13A 2WNXA 4L4VB 4JHZA 4RLDA 3U2SA 3L2NA 3VFTA 4P07A 5JW5A 3U46B 3KXFA 2BS8A 4XCCH 3CHXA 3CN4A 2P8MB 2FECL 4DEUA 1WBZB 4H5SA 4P57B 4AI7A 2OAAA 5C92A 4HJ1A 4PJCB 1KN2L 4G7YL 4I3SH 4IJ3B 5AL8A 1WK0A 3ALPA 1SOQA 5K59E 2HG0A 2CR3A 4O2EB 2GJ6B 1OE3A 3U4EA 4UILH 4FNTA 4BK8A 5INDA 3KJ6H 2BP8B 2BIMA 4XOAA 4I0PC 3LDBC 4Z0XA 5GRXG 2FSDA 1JZHA 4KMLB 4WUUB 4EI5A 2ATPB 2YMOA 4K8RC 1MHHB 2YAQA 3SKNA 2Y36H 4MNGA 1RJZA 3ULUL 1F11B 3HPLB 3MFFA 1H3VA 5JQ6L 1MG3C 2IGFL 2ROXA 4IS6A 5GS3A 2FTAA 5FWQA 1OPOA 3A6CL 3P69A 4IKJA 3BUTA 3TASA 3VXQA 3GMQB 4KI1A 1UC6A 4X6CF 1RIUH 3VX0A 3QARA 2BMKA 2WLHA 5I19H 5LWYH 1Q94A 1UOVA 3JTSA 1H5BA 3EO9H 4X7SH 5EORL 2LU5A 2X6UA 3KJ4C 5IF0A 4IMLA 2BVEA 3C5XA 4F91B 3Q2VA 4AXWA 3BD4A 3MC0A 4GIPD 4RVBA 4AEIH 3N44F 1AQHA 5AVUB 1OALA 2WXOA 4Y4FB 3RJDA 1SDDB 3NCBB 4DK5A 3I2CL 5JZ7C 2XZQH 3G6JF 4P23B 2OSWA 3RUGB 3M45A 2F74B 1SYSB 3HG5A 1SJXA 2H6OA 2KLTA 4JY4A 5D7LB 3OKMB 4MD4A 2BVQA 2CK2A 1BX2A 5JA9A 1YJDL 4QRFA 4ZUWA 3QXTA 1UWXH 1S3KH 4RIRB 3HN8A 4GW1A 5C0GB 4L29B 3PNWB 2Y7OA 2ZUQB 1BXVA 3STZB 2EH7L 4FXKB 4FG0A 3H6AA 4ZMVA 3VTTA 4U1JA 4HPYL 2Z34A 1D5IH 1CD0A 2V8LA 1A3LL 5EOCH 3F12B 4F3FB 4YHML 4LAQL 3OWEA 4H88L 2NX5A 3AWGA 4HIJA 4R4FL 4IGBC 3IE4A 1VEPA 2HVBA 4U2ZA 1CMOA 1D5BA 1TKWB 2NOYA 5F1KC 4JFDE 4X4ZA 5LDUA 3DK2A 3EZJB 4KK6D 4ZO8A 3NH7H 3PNWA 5HHXL 1HH9A 3OZ9L 4WTQA 5HJDA 4S0TD 3PAZA 3RDTA 3I2CH 2CDGA 5CZRA 5FYJH 2B8OT 2JXMB 4L9DA 3SPGA 3U6XS 1U92B 1UZ8A 5I1HH 3X3GH 5FOJA 4ZXBD 2Y06H 3MNWA 4KV5F 4HVBA 1Q0XL 3EO0B 4QF1A 4F37K 1HK6A 1HAWA 2BSEA 4P9HL 3LPPA 4A6YL 2WN2A 3V4VB 1FYTA 2O1AA 3T77A 5EIQA 2VQ1B 1A4BA 3SEPA 4OCRH 1DJZA 5IMLB 4NN5C 1Q1JH 2HWZH 2N01B 3IRCA 4ERSH 3DV6B 3G9AB 1H9VA 2JFCA 4NN7C 3BC9A 3BKCH 3ARBC 3FDWA 4P4RA 2DBLL 1I8AA 3HE6D 2FUTA 3FF8A 4R0LA 2X38A 1UKSA 3QCTL 4GQZA 4R4FH 1J9CT 3BIKB 1TJHH 3KYKL 2X4RA 4Y1TA 4WK0B 3SGKC 5LQBH 1MN4A 3WTSA 1JBJA 4WIQA 3RWJB 3T8VA 3X14A 3UGUA 2J8UE 1PMYA 2WSKA 5BRZD 3WMSA 5I0DA 2AQRA 5HYJB 3QWOA 3WL9B 4M8QA 2HKHL 1Q0EA 3ETTA 3OZ9H 2FR4B 4X5XB 3OQ3B 1DANU 2NUPB 6FABL 2I07A 4YDVA 2A99A 4A6YA 4WEBL 1A6ZA 1MCCA 4ZOCA 2F54E 4F7PB 3VGHA 1IFGA 2E9JA 4Y16C 1K8IA 1E4WH 4Z0XB 4OCSL 4X50A 1Y0LA 1M05B 4PGCB 3CVCA 5FGCE 3G5WA 1RI8A 4G8EA 2GITB 4JANA 3QXUA 3FUDA 2P8LB 1KTJA 2E6QA 4PJCE 5EC2B 4N8VB 2Q10A 2WO2B 1Z66A 4PCKA 2EO9A 4BZ1H 5HVFB 3M1BA 3AGWA 4WV1A 1YNLH 2D7TH 3Q1SL 3ZE0E 4G6KL 2VDPB 2ADGB 1OGAD 2YRLA 1DEEA 1G4MA 3WFDL 5B39B 1QO3A 3DSFH 2GUOB 2X9YA 3CZNA 3ETBF 3PE9A 4KMQA 3U7WL 2R23A 3GBMH 2QHLA 5I1CH 2D9CA 3IJYB 1TZIB 5EIIA 3BJ91 3ARED 4OUOA 3U0TA 4LLYA 3D4GA 4GP4B 5F7HA 3QK0A 3WLBA 4K15A 5AVYB 5GSVA 3MRCA 3UDWC 3VWKD 4A37A 3MJWA 5HDLA 2VDQH 3DBXA 4H2CA 3G5ZB 4UM9A 3C6LD 5C0AB 5CEZD 2EVJA 1PY4A 3GYRA 4HIIA 5AD0A 3LZLA 3MUY1 5HTSA 4GT7A 3V0JA 1GZQB 3HZ3A 1JHKH 3B2PA 1BQUA 1UB5B 1OGTA 3ABGA 1KIPB 1E4WL 1BD2E 3AJ7A 4HIHB 2I7OA 2LLGA 5C0CB 5KEZA 2BP3A 2FVNA 4IK7A 4X6DE 4Y1AA 3WSQL 2P24A 3K8KA 3RFZB 1CPUA 4OZIE 1TT6A 4G6AC 4XAWH 3SO3B 4LEXL 1Z9SA 4IRJB 4B9ZA 4KHXL 3LS5H 3SDCC 5KBKA 3VH8A 2CO6A 4P2OC 2A74C 3O0RH 4P4KB 3ABKB 3T0DA 4B9GA 4S1RH 4JZJC 2XWXA 4ETYA 1QD0A 3NGBB 4KUCD 1N68A 4LCWD 5GRWA 3CMGA 3BH4A 4N0UE 3SJVA 3O6FA 2BHYA 2WD0A 5F6HJ 1L9TA 2ZUWA 4KGLA 2F7QA 2R1WA 1UWYA 2AZUA 2D31B 1AXSA 2ZWYA 1NFDA 1KLUA 3DX0A 3RZCC 2Y3NA 2OMZA 5HHME 3ZDYF 5L2JA 3DXAE 4U1KB 1TTCA 2P5PA 3TZVA 3THML 5AKSA 1EJOH 5AQ0A 3QO1A 1XTMA 2VMCA 4RA0C 2K4AA 4U1KA 3HI6L 1MJ8L 4MS8C 4V2BA 3SPIA 2CXGA 1D2PA 4PGZA 4HWBL 2PPAA 1NEPA 1SN2A 1FFNA 4UT6A 2DWDB 2LTQB 4XAWL 1OGAA 2C1OA 4DGIH 5GZOA 3OXRA 3L7FA 4PRPD 2B5IC 4UV4L 1TCRB 2RIKA 2AJZB 5KSVA 5E95B 5CKGA 2J56A 5H94B 3RB5A 5I0VA 3QHZH 1SJHB 2NY5C 1IBBA 3HE7D 3ARQA 3TS8A 4LMQI 4YHNA 3T4AA 1KELH 2WWKO 1JGLL 1YQ2A 1KFGA 4M8VA 3PJNA 4YR6A 3HG1E 1RLBA 3ATAA 1AGFB 3KGUA 3P77B 4K3JL 1BBDL 1G7JB 5F8QC 3CZKA 1ASOA 2ZYIA 4DETA 3PP4H 5C0CA 5FS5A 1GTNA 3KVDD 3L5XL 1P1VA 4N2FA 3CLEH 1JV2B 2R4SL 3LS4L 4PJEA 4QRUB 3RTQA 1J0IA 1I7UB 1UQSA 5CZXD 1Y07A 3HI6H 2ITFA 1IE4A 4GAJH 1LEIB 1JZ4A 4JM4H 3SYOA 4X7CC 1G43A 3OR7A 2VO5A 3KLSA 4D9QD 1YDPB 4L3FA 1S9XA 4FXGB 4WLCA 4QGTA 5I6OA 2BOBA 3GLDA 1CFSA 3NJHA 1A1NA 1QRNB 2A6JA 1QO3B 4I18C 1NMBH 3MRNA 1EFXD 2ZOKA 4HLZG 4R26L 2IPTL 3VFSA 1JGLH 2VABB 4L3EA 2ZF9A 4KY1L 4AQ1C 1YEEH 4GRWH 4M93B 3BSHA 3WHXB 1SEBB 5KN5A 1BBDH 1IUZA 3O41B 2VDMB 5JPNB 4OZGA