2WKOF

Structure of metal loaded pathogenic sod1 mutant g93a.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
153
structure length
152
Chain Sequence
b'ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDAVADVSIEDSVISLSGDHIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE [CU-ZN]
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Structural and Biophysical Properties of Metal-Free Pathogenic Sod1 Mutants A4V and G93A.
pubmed doi rcsb
total genus 35
structure length 152
sequence length 153
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2wkoF00
4A7SA 4A7GF 3PU7A 3LTVA 2XJLA 1P1VA 2XJKA 2Z7ZA 3ECUA 1IBBA 2LU5A 1U3NA 1SXNA 1DO5A 1OEZW 1F1DA 1QUPA 4A7TA 4BD4A 1UXMA 2C9SA 1YAIA 4BCZA 1SXAA 1OZTG 2Z7YA 1PZSA 1YSOA 3CQQA 2GBUA 2AEOA 3KH4A 2VR8A 1SDYA 1B4TA 2E47A 1E9PB 4B3EA 4N3UA 2E46A 2AQPA 3GQFA 4A7UA 1E9QA 4MCMA 3GZQA 1E9PA 1OZUA 2ZKWA 4U4IA 1EJ8A 1CBJA 2WZ6A 3SODB 1AZVA 1IBDA 1XTMA 1SXSA 3KBFA 1Z9NA 3MKGA 1HL4A 3ECWA 2ZKXA 1SXZA 3CE1A 2C9UA 1B4LA 3H2QA 3RE0A 1PTZA 2APSA 2WYTA 1RK7A 3H2PA 3KH3A 3S0PA 3L9YA 2Z7UA 1COBA 1DSWA 2AF2A 4A7GA 3GZPA 1FUNA 1BZOA 1XSOA 1YAZA 4FF9A 1EQWA 2AQTA 4OH2A 1JK9A 3MNDA 3K91A 2ZOWA 1JK9B 2C9VA 3ECVA 3GZOA 4N3TA 4BCYA 4OJAA 2K4WA 2V0AA 2WKOA 2Q2LA 2AQQA 1MFMA 1CB4A 3HOGA 1BA9A 3T5WA 2AQSA 1E9OA 2GBTA 1OALA 1TO4A 2VR6A 2ZKYA 4MCNA 1F1GA 2SODB 5KBMA 3HW7A 1SXBA 3QQDB 3KM2A 3KBEA 1Z9PA 1E9QB 1IBFA 3CQPA 1SXCA 2AQNA 4A7QA 3GTTA 1XTLA 2JCWA 3L9EA 1OAJA 3KM1A 2AQRA 1SPDA 1SOSA 1IBHA 2NNXA 2WZ0A 5KBKA 2R27A 3F7KA 2JLPA 1L3NA 4A7VA 3QQDA 5KBLA 3HFFA 1TO5A 1S4IA 2VR7A 2WZ5A 2WWOA 1F18A 1SDAB 3F7LA 3GTVA 1UXLA 1ESOA 1SRDA 2WYZA 2WKOF 1N19A 1JCVA 1Q0EA 1E9OB 1PU0A 2WWNA 1KMGA 4L05A 5CU9A 2Z7WA 1N18A 1HL5A 1IB5A 2GBVA 1F1AA
chains in the Genus database with same CATH superfamily
4FMKA 4AIEA 1B6DA 2D7MA 3RVVC 3BAWA 4XP9H 1YEDB 3M46A 3QXAA 1YN6B 4HWEL 4ERSL 1BMWA 4YHZL 3VGEA 3KPTA 4PTTB 1AY1L 1J0JA 4L9LB 3PJLA 2WK2A 4NKOA 3IDIA 1ZS2A 2YR3A 4PJIB 4PJ6A 1UZ8A 3NESA 4FZEH 5F7BA 1OE3A 2BNUB 5FDWB 4WFFE 2Y0SA 2IXQB 1DVTA 3RNQB 3GLZA 3NFNB 1I3GL 3WU1A 1HEZB 2GJRA 3ZE2F 5EC1B 1SM3L 3DV4B 5JXEC 1WCBA 4NAJA 3OHXA 4HOWA 1UB5A 4HALA 3O6MH 5GZND 3L2LA 4G6AC 5HDQH 4IHOB 4NRXB 4Y19B 3FB6A 4QRRE 4G1EA 4F37K 3L3GB 5D2NB 4FNLL 3LN4A 3OL2A 3VYNA 1L9PA 2VR9A 5DURB 2BFVH 1PTZA 4XNZC 1JGEA 1X9QA 4TOYL 3SKUD 1YY9C 3OKOA 1ANUA 3PQYE 1RP9A 1OPGL 2LLGA 4LCVA 1H19A 4E9TA 2NT1A 3NIDE 2EDJA 2P47B 2C4XA 1U2YA 1E30A 4P8QA 5CZVH 3IM1A 4BFKA 3QIBC 3GMMA 2JI2A 1DHKA 4GKNB 2ZKHL 3RRQA 4XC3H 2Z8VC 2DMKA 4J3XA 3CSBA 4PWHA 3U0TA 4F2MB 3ARPA 2B4CL 4NUPA 1MCJA 2XQBL 4E36A 3GD1C 1L0YA 5AAMC 2JB5L 3C12A 3SIKA 5TPWH 4FFZH 4JMNA 2ERJC 3NFSL 1ED3A 4Z0XB 4Z7WF 1DL7L 5AVXB 1BFOA 4XODA 4ZXBB 5C0CE 3B5HA 3ALPA 3BH9A 3D50A 4A7QA 3SBWC 2CA3A 4HIXL 1A25A 1SY6A 3KLLA 3O6KH 3WYRA 4FFYH 4MA8L 5EU6D 4AH2A 4XNUL 3FO9B 3IFPB 3F01A 3C60B 1I3GH 4N2LA 4N2MA 3GKZA 1JDDA 4GBXC 1DDHB 4RFOL 1OGSA 1SYVB 1JAEA 2A74B 3A6OA 3FU8A 2FCBA 2Z34A 2WKOF 4X7EC 3IJHA 5IREA 3L81A 4XVUD 2VO8A 3T0VA 4I48A 3AJ7A 4ZUVA 4WKXA 1Y18B 4PJFE 3HIZA 3AWFA 1BAWA 2Z7WA 1N18A 3FQTA 4NKIL 3WFHA 3CXDH 4TNWK 3BUPA 3RWEB 4JO3H 4EOWH 2YSTA 4NQDB 5DRWB 3KR3L 5IBTL 1U8KA 1RY7B 5DLMH 4NBYB 5E2WL 3JV6A 5I8OH 2LU4A 4BDVB 3K72A 1KIPA 4TTGA 1TZHA 3MRQA 2GC7C 2EH8L 2WHVA 4OCSH 2VWEE 3CFDA 3ESOA 1PEWA 2WSKA 1NPUA 1II4E 5FPIA 1KJ2H 2X6MA 4OD1L 4P2QD 4PEEA 4PD4J 2GYSA 1RUPL 5I1EH 4L0ZA 4OM1L 4EN3C 4XMKL 3TO2B 4WCYH 4P2RB 4W9DC 2XWZA 3FQUB 3U2SB 1JUFA 1DL7H 1X44A 2Z31C 3G7TA 3UYRL 4P46D 4Z95H 2R15A 3TGXA 3OSKA 1NFDB 4AGOA 1U91B 3QEQE 2X0UA 2CO7A 1R3LB 1TCRB 3SCMB 4UB0L 3UG4A 3UTZA 2DLFH 3S2CA 3MC0A 3TOPA 3V6ZA 3L3OC 1F0LA 1H3UA 4FQXD 3H42L 3FYIB 3FB8A 4D8PB 2WNGA 1IQDB 4WNQA 3RY6A 5HYSA 2AQ2A 3FJTA 3QDGD 4NJ9L 3SDXB 3U7WH 3KH3A 5HVFB 1XIWA 1HKFA 2EIBA 2WBJD 3QAZB 4E42A 1QFWM 1H6TA 4LESA 1XGUB 3CFTA 3D4YA 4WTWA 5DK3A 3QEHA 5CWSB 4LCIL 1LQSR 2IANE 2PPAA 4U31A 5D1XA 3CXDL 3B7RL 4OZFH 1ETB1 3GGWA 4OLVH 1ZPLA 3I50H 4YHYB 1UWGH 3HB3D 4ZFOB 3T0ED 3HHMA 3OLIA 4H25B 3HE6A 3C5ZB 5HJ3A 1AOHA 1NKOA 1X5GA 2E5EA 2ID5A 4P2OA 2HKHH 4F7KA 1TJGH 5L9DL 2PO6B 2WBXA 3FTSA 4POZC 3BP7B 4FNLH 1KTBA 5CFHA 4KHXL 3ARDC 4ZW8A 4G8IB 5DZNA 4YE4H 3DPDA 5GGUB 4FMFA 4WCYL 3BW9B 5CGYD 3GBEA 4HJJL 3QNYB 4LCCC 1IC4H 5I8EA 5KTEH 3G08B 1M7DA 4K71C 3DSNA 2B5IC 5TDPA 1IRAY 3H85A 5F89B 4WI3A 3II3A 1E2ZA 4N2NA 5EU3A 1SEQH 1E2VA 4S1QH 2ZYSA 5ESAB 2MCMA 4RGMC 4Q9RL 4LBEA 3C6SB 4PUBL 2GY5A 3DXAA 4NFBA 2XXFA 3H9SE 4ZOBA 1YYMH 5DUPL 1X3DA 4UWQB 1KPRA 3S5LG 5A3IC 5C2BH 5J6GA 5IMLA 3AT0A 2HT4C 5CXPA 3FTWA 4N90E 4RDQG 5HGGS 1ZHLA 2VDNB 5E5MB 1YMMA 4LCWB 4HKZB 4PGCA 5I30H 3WFDL 3VFSA 4LL1A 1FZKB 1U8QB 3SBQA 1AGFA 1NCWH 1YEIH 1DQQB 5K9OB 2UXVA 1T03L 3NG5A 4Y19D 4C57C 1KLFA 3DARA 1OW0A 3WDHA 1K8IB 1YAIA 4HXBH 2JJTA 5KSVA 3NIGB 4RQQA 43CAB 3QHTC 1D7BA 2CHZA 3L48A 3GYRA 5EOQH 5JLZB 1I7UA 1H0DB 2RTTA 4ODHH 2X2IA 3PPEA 3E6HA 3DX2A 5DO8A 3BZEB 3ZT5A 1NUDA 3E6HB 3BZEA 1W6WA 1B0RA 4N2GA 5BRQA 1R0AL 4BGDA 4FQXB 4U4IA 1AZUA 2XV3A 2EIEA 1W9XA 5LAXA 3ARGA 2QQLH 1Q9LA 2WLLB 1K8IA 1N59A 4MAZA 5E2WH 3TS8A 3CJJA 3POHA 4P46B 4RX4D 2NY5C 2ENYA 2E3VA 2WXGA 4PP1D 1V8HA 3WLBB 4RFEA 2NZ9C 4DP1X 4W70A 1YQVH 3I2CH 3MLYL 4P9MH 3US1A 4MJIE 5EZLA 4IBTA 4OI9A 4P2QB 1FFOA 3X11B 4Q6IC 3BPNC 2WXQA 3S3PA 5FYKH 3GXIA 4OKVA 4X6DA 1VEOA 1GH7A 2VR4A 2Q3AA 2Y5EA 4HFWB 1NANI 4D9LH 4FG4A 4I3GA 3X14A 4OI8A 3UAJC 4K8RD 4KX7A 1RIVH 3C6SA 3ZKQD 5FECB 5IHUL 3S5LB 2C4FU 1G1CA 3LSOB 4MS8D 1DBBL 5KBMA 4L1BA 1WAAE 3L9BA 3LS5L 4OFDA 4QXGH 1S7UB 4ZYKB 4CMMB 1Z5LB 5DCCA 5D8JL 1R6VA 5ANME 2J71A 2V5YA 1ILSA 1H8OA 4XPGH 1YA5A 1EAPB 2VE6A 3MRCB 3VXMD 2RCSL 3MRBB 3MRHB 4AXWB 1PZUB 1P84J 1PQZA 3E3QE 4WUUB 3IMSA 5H94B 3L1FA 3CFCH 3T8XB 4AITA 4CGUB 5CN3A 4GXVL 4LHUB 1JZ7A 5KSAC 3NACL 4YDVA 3IGFA 2X6CA 1EFXA 1MJ7L 4P9HH 1GMEA 4ZPVB 5F9OH 4D9RE 1LHZA 4JO2L 3U4BL 1G9ML 2QVFB 3V9EA 1K2DB 3Q8BA 4M29A 1QFPA 2GCYB 4PB9L 1LVEA 2AGJH 3ULUE 3G5WA 2X4PA 2ESVA 4HH9B 2IH1B 4HZLA 4KHTH 4XNBA 1BJ1J 1IBBA 4JRXD 1NLDL 3ET9F 1MFCH 1NDTA 4HZ1A 3FT3A 1RIVL 1L0PA 1HAWA 3O3AA 1GOGA 3QHZL 3L3DA 3N6YA 5AW4B 4YHIB 1NFDF 1S3KL 4KXZI 5HDWA 2EDKA 2V9RA 4G42B 3ARGD 1LEKA 5TH2A 3IGAA 3GSUB 4LASH 1WA0X 2OSLB 5J5EA 2AEPH 1TIUA 4YZFE 3ESNA 4QXUH 2FWSA 4FFTA 3AT9A 1FDLH 1UD6A 3U9PH 4D0CB 2PF6A 3OKEB 3NUKA 5L2KA 2P80D 4Y1AE 5EORL 2AK1H 3B5GA 4RBPH 3UZQA 2XTJE 1ZV5A 1XR9A 5MEND 25C8L 3BE1H 4XP6H 2JXMA 1CE1L 4AJWA 5C0IA 1MLCB 2XT1B 4NQEE 4LCWD 4CSPA 4DQAA 3KPRE 1F90H 3NACH 3ISRA 3RWHA 2O5XL 3WIAA 1JK8B 3QGVA 4JRFA 1LO3L 1KIQA 3GSRA 4FLQA 2EP6A 3K4DA 1WG3A 4HW6A 5JDSB 1U8JB 4JM2F 1JNJA 1BYNA 1MVUB 3BDBA 2F74A 2OMWB 1T5KA 3RDTC 1DTUA 2IPTH 3UBFA 1F42A 3O8XA 3IJ8A 5SX5K 3PGCA 4L2LA 3BHBA 4L4TE 2YD8A 2F54D 3HAEG 4YSQA 1F3JA 3BXNB 3NQIA 4MHHG 4M1DH 4N0UB 2DQGL 4KJYA 3D48R 1RZFL 1T1WA 3EBGA 5FUZH 2IH3A 4AZ8B 3B5TA 1IM3B 1BVLB 3TH3T 4E0RB 4R83A 1N5AB 1DSFH 1J10A 3D4CA 4TUJA 4BZ1A 3IFLL 3TM6A 3B2PA 4DAGL 3QS3A 4KNTA 2BVPB 3CN4A 1AQHA 2F8VA 4XWOC 1ZA3B 5EO0B 2HJFB 5F97E 4ZXBA 1IEAA 1ZVHA 4D9LL 1ED3B 5F6IB 3ARRA 2PPCA 5E6ZA 1QBLL 2HRGA 3EO9L 4ZW6A 1ZPUA 3I75A 3QDMA 2NQCA 4Y0GA 4KI5D 3LZQA 1BZ9A 3BQUA 4DEPC 2H32A 2FLMA 1KEGL 2ZP0T 3GBLA 5CJQL 2QVMA 3J2PA 3GMOB 3I3EA 4YSRA 2XN9A 3ZKND 2D0HA 5DZJA 3TX4A 2WBJB 5J11C 4OZHA 3WO4B 2DQCH 1BBJB 3EJRA 1QPKA 3QDGB 2P52A 4Y4KA 1AI1H 2I27N 2B4CC 3O41A 3RVWC 4KVNL 4RGOL 5F1NB 4CBPA 1D5MA 5JIPA 1P1ZA 4BFNA 5DJDA 5FA4B 1DVFD 5D7IA 5F9DC 2ADGB 3IE9A 3UDWA 1ML0A 5EZPA 3M1OA 2ODIA 1WCBB 4XGZB 3IDNA 5JORA 5KS9F 2ZXQA 2R23A 3H56A 4UM8A 1ZRUA 1UVQA 2CDGA 3Q9PA 3ASOB 3UIYA 3S7GA 4PS3A 4FABL 1MFAL 2X6UA 3CZJA 3IEAA 1ID5I 1Y6NR 2IGTA 2IXQA 1DSFL 4NRZA 3WJMA 4PAZA 4DAGH 2BVQB 5DJ8A 1LWJA 3WKML 3GM8A 3FU7B 5DD1L 1LO2L 5GJTL 4CW1B 2UXTA 4BELD 3MV7B 2N7BA 3IDIB 4YL9A 1ZA6A 4XN8A 1VERA 3FB5A 1EVUA 4U1MA 2ZQKA 2FTAA 3FO0L 3SDAC 3CFEB 4MAUL 4Q6IB 2R59A 3RZCC 3GKWH 4GINA 3G04B 4HIEB 5C0ND 5B3JE 5F93C 1KF9B 3CFMA 3CXHJ 4A68A 2F54A 1XMEB 1E4HA 2B3RA 4HKXA 4BQ6A 2PP9A 3UPAA 3TIDA 2G3XA 5IEKB 1UD8A 3CWGA 3R4DA 1AS8A 2CQVA 2F53B 2OMZB 2CALA 4ZMNA 1FWXA 4UTBA 1AIFA 2IFFH 2VW7A 2DQEL 4RGMB 2GEQA 2KH2B 1FQ9C 2DDQH 3QDAA 3BZ4B 2Z93A 4PJBE 5TE7H 1LO4H 3X3FL 4JY6A 3M6DA 4NOFA 4J8RA 3U2JA 1J8HE 4HIIA 1Z7JA 4PJBA 4R5TA 3NOIA 3WMPA 3LIZA 4HDIA 1MJJA 1ONQB 3HPLA 3UGXA 4EI5B 2GJ6A 2I9LB 1EXHA 5JR1L 1JPFB 2GTQA 3RX5A 1Y6KR 1IGCH 2CBQA 1J9CT 3HZMB 1SJEA 3NCYS 4S2SA 4YNYA 3BWUF 2Z1PA 1WBYA 3TNMB 4H0HB 3D06A 4LRNL 4WZ9A 3LZFH 4GW5A 4Y4KD 4YHOL 1MH5A 4KK5C 1FGVH 4WY7H 4G7QB 2BVTA 3W5NA 2BOBB 4TNVF 3NYKA 5CEZL 2AHIA 1AACA 3M17A 2BS71 4AJYV 1IBYA 4H20H 4GSQA 1NSNH 4QT5B 4LVOB 4QDGA 3NZ8A 4GIAA 1QVOB 5JOEA 3SKNA 4ZSOB 2BWIA 5CEXB 1Y07A 2VSKB 1AR2A 3GIZL 3HZYB 3O3BB 1MCIA 3MLWL 3EW3B 2JKWA 1FVCB 1Q8MA 2R9HD 5EOTA 4XNDA 3SCMC 3ZE1B 4GUPB 5D1QA 3RP1A 4M7ZC 3F6JA 1FAKT 2PO6C 3TFKC 1WZMA 3L3KA 3MCKA 1DVUA 3SKOB 4D9QE 1S7VB 5I0ZA 3WLWD 1UZ6F 2UX6A 4PV9B 1GR7A 4P2YA 4DZ8B 4YDLC 3V0AC 3VD0A 1TEFA 2EDHA 4LF3A 1G9NH 4P5MA 1ZTXL 5ERWB 3SKNB 1IEHA 3P40A 1MNUL 3V0FA 2XIDA 1Z0NA 2JKSA 3SQBB 5F1IA 2AJVL 2WWMC 4PLJC 1LO5B 4FCAA 2R2BB 3EOTH 4RGOH 4X9HA 2BMKA 2QFRA 4TSAH 1MJUL 3KXFA 3UAJD 3ECVA 2ADJB 2C9VA 4YHOH 1NGXB 1IAOB 2VDPL 3VXQA 5DMGD 3ROLA 1AD0A 2R51A 1BQHB 3UL4A 4AJ0A 3Q1SH 4XNAA 1GIGH 1R46A 3T3MF 2ZSVB 1GTNA 4O2CB 4DOHE 4UT6H 2XG5A 3D85A 4FXLA 4U3SB 4HETA 2PWEA 3SDXE 5K59F 2W1NA 3KCWA 4BV1A 1ZHNB 3VGHA 4ZTOH 1J9RA 1LK2B 1DZ0A 1OPGH 1Q9OB 2J7LA 2OZ4L 3EFFA 5AUMB 4J3OC 3CN1A 4Z7VF 3SKOA 1MCQA 2E9JA 2LFGA 1BOYA 1ZLUH 5GGRA 1AIZA 5CLTA 3HVNA 2YZ8A 1EBAA 5E00B 4UIKH 1CC3A 3L4TA 3HS0A 1UA3A 1MCEA 2CO1A 4F92B 1N6VA 3G5ZA 4PJBB 4LKXA 1NKGA 5JW5B 1N0XH 2P7TA 4ZMYA 2ED9A 2Y6TE 4A7VA 5BO0D 2DLIA 3OZ9H 3Q06A 8PAZA 4D2NA 5FM5M 1T89A 4GMSH 1S7RA 5CILL 4C8XA 5I6NA 4YE0A 2WKGA 5EU5B 3MRJB 5C0AB 2PYED 4PJXB 1KLGA 1MREH 4AGLA 2VZ1A 2YRPA 4I0KA 1U33A 4M8RA 1A3LH 1GGIH 3I3DA 1RHHB 1RKRA 2ZUTA 5HYQB 1HILA 3P77B 3PQYD 3S88H 2ADIA 4YHZH 5T8IA 2I5YH 2QVKA 1FGNH 5E2VL 4BA0A 2XA8L 3G04A 1MEXL 2Q5BA 15C8L 4HCGA 3IBOA 4X9FA 2ATKA 1SJEB 4YNYB 1FNHA 2HLAA 3TEYA 2EVIA 1MQKL 1UXSB 2Y36L 3D0VB 3ZE0B 5IKCA 1L6XA 4IRSC 4PBDA 5E1HB 3SDCD 1YSOA 4HQQH 5IBTH 2VR8A 3QUXC 4M6NL 3TEXA 3KGSA 3O6ML 2E46A 5JO5B 3SQOL 4JGJA 1GJIA 2ADFH 5EPMB 3QZWB 4N0CC 4G6KH 5C92A 3PGDB 3ZT7A 1MFEL 4PJAB 2R1XB 1NWPA 3BSGA 4AEHL 1BZ8A 4IBZA 4L37A 4PGBB 5DZ9A 1FI8C 5FFGA 5DJDB 5I66B 1M7UA 5KYUA 4GFXA 4PI0A 3SDDD 4HSCX 4LCUB 1MW1A 2ITCA 4O2FB 5HHOE 5L0QC 4FNTA 3QPKA 3AB0C 2R56L 5FFOA 1PAZA 3ULUF 1DEEA 4YVUA 5EOCJ 5JW4N 5D6DC 2ZCHL 3SYPA 3FN0H 3NH7H 3W38A 2DIBA 4K07A 4HIEA 5CJXC 4AENA 4PWFA 1DQMH 5EWIL 4PRHA 4IMLA 4I18B 3LQAH 1U8MA 1HHIA 3QNFA 5LBSH 3P4NA 1G9MC 1DVZA 2MRYA 2KUTA 3FQYA 3PWVB 3IMRA 1JL8A 3TLRA 4NFCA 2ZPKH 1NGYA 3PWNA 4WHYH 4PLKD 4OCRH 2Z4QA 2IDTA 4K7FA 1WUZA 3QQDB 4QAMB 1U93B 1JTTA 2Y5QA 4U1IB 5E94B 4XC1H 4XX1G 4F37F 2N7SA 2CDGB 3EOTL 5LG6A 1TVHB 4IDLA 4PV8B 4BIKA 1MY5A 4JPIA 3GJFA 4O4YH 2XV6B 1JF1B 1FC2D 4O00A 4TUJB 1HWGB 4K94H 2AXWA 4Z9KB 1BVLA 5D7IB 1HWWA 2DJ4A 4KKAC 2XV0A 5HPMA 3GHPA 4O9HL 4EN2A 2RJMA 3H3BC 4HAFA 2NX5E 1A6PA 3L5HA 3F12A 3P3TA 2FH6A 4XE0A 3IGLA 1TETH 4L8SC 3FSZA 2DS4A 3QZWG 4ENZA 5CMAA 2DKSA 4ZTOL 3QZBA 1DUZB 2HT2D 2G9KA 2W80C 1DO6A 4ERSH 4HWEH 3HUJB 4HPOL 4MJJA 2WN2A 2R0LL 1CZ8H 3QYCA 4HPYH 4HV8A 1RJLB 4TRPH 4WUUE 1G0XA 2VLKA 3LHPL 4OLWH 2J6WA 1SEQL 3ULVE 1G7MB 2OTUA 3MXWH 4OD1H 1DQML 3Q13A 4IGBC 3HMWL 4AI7A 3T0DA 2H1PL 1XB6A 2HJKA 3L8QA 2QTEA 7FABH 3IFOA 5C0IB 5C2BL 4M62L 5E08H 1IEAB 5FEBA 4S10A 1FO0H 5EZIL 4WWKB 2VC2B 2GBUA 2CJUH 1JNNH 5L2KB 4Z77B 1F45A 3GHBL 4NC1C 4LAQH 6CGTA 1XF2A 2H1LM 1YEIL 4U1KA 4Z7OE 5B1AB 1UENA 2J8UE 2Y3AA 3FUHA 1IZKA 1E5CA 4PJDB 5EIQA 1XGRB 3NZSA 4WV1B 3C8KB 3BLPX 15C8H 4PRPD 1XH3B 5ANMA 4MJIB 2BNRE 3TV3L 3TFBA 3TZVA 4YN3A 5D5ME 1KTJA 2WIIA 1YC8A 1OAYL 3ME0B 4LCIH 4NZUL 4AGMA 3IRPX 2FAUA 5E8NB 1JVKA 3DKHA 3K5RA 2EDNA 1YAZA 2X41A 1P0SE 3JWOH 3VRLE 4F8LA 5MP6L 4KY2A 2HKFL 3RWHB 4QTHA 5ESQA 4A67A 1H9DA 4ZFZA 1G7IA 1K2DA 3VFMB 1I8KA 4JY4A 4Y5YA 3S97C 1WFMA 3B9DA 1A7NH 2YD1A 3ATEA 5INCB 2YQBA 2R1YB 2Y2TA 4DP0X 4OFKA 4PMFA 3RGVB 4G7YH 3DK2A 2G2RA 3HZKA 5BRZB 2GJZB 1MCPL 4GAAA 5IJKC 3HZVB 2AJ3A 2AQNA 3U0PA 1PG7W 5AWNH 1DQTA 3TN0B 2EDEA 3WTXA 2X4SB 3LPPA 2ZCHH 1KCVH 32C2A 1HI6B 2GK0B 4G42A 5IQ7L 2R69L 5D7HA 1U8NB 1CIUA 3NH7L 1ND0A 2JLPA 2Y24A 4RRPM 1CL7I 1OCCB 3ZJAA 1QWUA 1K5NA 2XZZA 3TT1L 1SF3A 4ZYKA 1URLA 3QIWD 3I02B 4AVKA 2LLNA 1JPGB 3U9UB 2O26U 3OSVA 5L8KB 4E41E 5L7XH 5J4MA 1THAA 3KR3H 2L04A 1P4UA 1OCWH 1SMDA 4XPGL 4H8WC 2XWJB 5EOCH 4OSUL 1CXKA 4GH7B 4HXAL 4HH9A 4YSEA 1IMHC 1HHHA 4V11A 1OAYH 4EUPB 3VD5A 5JA8B 3RDJA 1F11A 4N0UE 3T3PB 3Q05A 4XZUA 3CFCL 1KPVA 3NEEA 3EH2A 2KQNA 2XWXA 5IB1B 1QA9A 2IWEA 1RVFL 2BNQD 2HT3D 4YDVB 1QEWA 1CF1A 3UYRH 5ID1B 4CJ0A 4NNYB 3W82A 1BFVL 1A6ZA 5AW2B 4XO4A 1MRDL 1WBXB 2XVLA 2G3NA 2Y69B 4G7YL 1PZ5A 1U41A 2C9RA 4AK2A 3B2UD 3ZZ1A 1H8SA 5DD0H 2BSSB 1NIEA 4FQXA 5L8LB 4Z7VE 1RUKL 4IBYA 4PRIE 4WQOA 2COQA 4K73A 3EHBD 5FCUL 3V4PL 4GP4B 5BW7A 3DRQA 3GEWB 4GKSB 4LEOB 3JT0A 1AHMA 4HUVB 1MCKA 4XCEB 4F7PB 2AV1A 3WFBH 2BW5A 3F7YB 5DR5L 4AM0A 5JIDA 4P9ML 4J1UA 3HNSL 3VXSE 3QQ4A 2HX9A 1D9KA 1OGAB 1TVBB 4YWGL 5HJBA 4DP8X 1IAII 2NUTB 3RTLA 4ABWA 2FO4B 5DUMH 1QAWA 4RMTA 4KXCA 1YPZB 4A66A 1OSYA 4RFNC 2EDLA 2GIMA 1TUPA 3LXBA 2BP0A 4TQ8A 3UAAA 4FNRA 4XXDA 5KYWB 1MPAL 1UA7A 2DJUA 4A6YL 4HG4J 1BD2D 4HCRL 3K1KC 2QKSA 1NEZB 5D7LA 3ULUD 4TUUA 2QADB 4JRXA 3BGFC 2BY2A 3V4PB 3DXAB 1L7TH 4O02B 1GGTA 1BVKB 4XPTL 1HE8A 2WLLA 5H37A 3VI3B 1I85C 4JRXE 4LXFA 3U7YH 4JUTA 2C7FA 4BUGA 2H6UA 5H2BA 3BEVB 3N43B 2YD2A 4Z6AT 3INUH 4Y4FB 2XTJB 3KBEA 3Q2LA 4G70B 1E9QB 4WKZB 5D2LF 1XGZA 2ODHA 5GSVB 3MFFB 1REIA 2FEDD 4DGUA 4S1QL 2E8ZA 3UPRA 4IRSB 2AJXH 3VFTA 4BFIB 4G8GA 3FFCD 4UQ9A 1MUJB 4YVNA 4TTDC 5FYKE 1MAKA 2H7WA 3A5VA 3PUUA 1RZFH 4NYLA 4LEBA 4B9KC 3SE9L 4CMHB 1DJYA 1A6ZB 1J5HA 3WTUA 4PJCA 1VLXA 3F7LA 3RWFB 1OAQL 3RWJB 4LNVA 3UO8B 1SN2A 3VXRD 1RL1A 1JPST 3HG4A 4NQED 3CZFB 3MJ8B 1C5DB 3STZB 1SJHB 2BSTB 2VKXA 4ZDHB 5DUML 4QMEA 1HQRA 2Y4SA 4EUPA 4G11A 2Q86B 3KYNA 1MWAH 4M48L 4RA0C 2FL5A 3L1OH 4PCTA 5IQ7H 1JP5A 4B5EA 1GZHC 2UZIH 5F7EL 3S96A 3G6JB 4Z78B 1SLVA 3MLUL 3KW7A 4X7TA 1LEIA 5FK9A 5HYJE 4LEXL 5I1GL 3UTQA 2XDHA 2LT9A 3DSNB 2C9SA 2XLLA 5JOFB 5IMKA 2F54E 2QSVA 1IVLA 3L6FB 3I6KB 4HJ1A 3VGGA 2CLZA 3W39A 1QSFE 3QO1A 4NZRH 4POZD 4HG4K 1N6QL 4N5EC 2XRAL 4QPEA 4RX4A 5EA0H 1Z6JT 1KXVC 5DZAA 3U0PB 3O2VH 3MJWA 2BFGA 3K2UL 4PJIE 5L88L 2PO6A 1DFXA 3QUHA 5EU6B 4NAMA 1TNNA 5E24E 2NY4B 1H8NA 1HH9B 1BXVA 3N50A 3LEVH 3X12A 1NM9A 3BKCH 3MRQB 2AW2A 1YG9A 1YZZA 5ENWB 3JV6B 5F3BB 2GT9B 5I0YA 2FWLB 1V3KA 3P11L 1ZE3C 5DD1H 1CFVL 2YEZB 3UP1A 4XBEL 3DPBA 3FL7A 4WHDA 4KKLD 2NNCA 3UYOD 4AQ1C 4ZZKA 2ICWA 2B08A 5F88A 1KFAH 1KGUA 2MCPL 1IC0A 3GKWL 4JFVA 3ULVF 2YAHA 2UZIL 3CFBB 4HGWA 2R2CA 5EUKA 5F7EH 2EINB 1XGRA 2YD7A 3MLUH 4GQQA 4MHHI 5IJVB 1BQLH 3IFLH 2ZTBA 4FNUA 4LMQI 4ZPTB 1RSYA 3RKPA 2HKAA 2RBLA 1JN6B 1X5ZA 4Q58C 3H55A 1W15A 1QRKA 3MV7E 4NN7B 5CUSL 3C60A 3QUYA 4Y2NA 4HK3N 4FLSA 1LQBC 1EK3A 4DO4A 1QBLH 3L7FB 2EUWA 1G9MH 2VZSA 4GIOA 4AY0A 3O2DL 2HLFD 2V3EA 2F1EA 5A2AA 4X4YA 1XD1A 2FYYB 3Q2NA 4LGPB 4LVHB 4IBVA 2OJEB 2J8UF 5HHVH 1V05A 4ZMAT 3GSXB 4WI9A 1E8WA 3MRLB 1BPVA 4PRAB 1KTRL 1N19A 3LX9A 4UV4L 4V1DA 2JSFA 4FYRA 4X80L 3W9DA 3V2AR 1W6LA 3MJ9L 3T0XA 4JFED 2HH0H 4D3CH 1CVSC 3ARVA 2J1XA 1CCZA 1XV8A 4H88H 4ZZFA 1KCKA 3ULVC 3SE3A 4F7TB 4HJGA 1SBSH 3I9AA 4XNQB 3G9AB 1G1OA 4DPAX 2IGLA 1LJMA 4Y5XA 4A7GF 2JV6A 2Y23A 2X88A 3E9UA 3OR6A 1I7TA 2JWYA 2QBWA 4S0SD 1IQWL 2CNYA 3SYQA 3HN8A 4EQ2A 1J5OL 2NY0B 5ECGA 3S48A 1L9RA 4UQBA 1MRFL 4ZFFA 1CFNB 5JIMA 4WY7L 2W07A 3BWSA 2HG5B 3IDMA 4JFFD 5JYMA 4FABH 1FIGL 1UT2A 3WEBA 2VUKA 3GRWL 4N26A 1BW8A 5DHDA 2DW5A 3QFDA 4JFSA 1U58A 3KEDA 4TS6A 2VXQA 2P8PB 3FO9A 1M2OA 1T66C 2DLHA 2HUHA 3GJFB 5MENA 3QWNA 3AAZA 5AAMA 3ZT6A 1GRWA 2WZAA 3TO4B 2VB5A 4FKHA 1JG9A 4QRUA 1KWGA 4MCMA 3V4VA 3E38A 5J12C 3QR1A 1AGBA 1XGYH 4Z3JA 2HPOA 2X4QA 1A8ZA 2VN5A 4F58L 1IC7L 4WO4A 1MXDA 1G6RH 4FKKA 2DWDA 3ZDZB 5KBPA 4FQCL 4MNGB 4GAYB 1CXHA 3DBXA 4FN0A 1F2QA 3P4NB 3EJPA 4IMLB 1QR1B 4RESB 5LNEA 4X6CA 2EDRA 3GK8L 1RURL 4FL4B 5K93A 3FZUD 1NIAA 3CH8A 3LS4H 3QQ3A 1AR1B 2VYRE 4UBDD 2GUYA 5AYTA 5FUCE 4X80H 1V54B 2P5WA 4MQTB 4WW2C 4X9IA 4N9OB 5DHEA 4BWTA 3H7LA 1DEEB 1RUMH 1TJHH 3RU8H 2DQEH 3U36B 2KLSA 1JGEB 4YZWA 1HDMA 2VLRE 4UQDA 3ALWA 3QIBA 5D7JD 1AP2B 2DMCA 1OB1A 4YAQB 1KY6A 2JJTC 4YDNA 4KK9C 3S36L 5A2CA 3MUGA 2P46B 1EANA 1PSKL 3G6DL 3BD4A 5KVEE 3FUIA 1FSKC 1P6WA 3RTQA 3FB6B 3S37L 5FOBB 2JELH 4IRJB 4PJAE 5GGVH 3MXVH 4JFHE 3DVFA 4RIRA 3SE8L 4XCYA 4BE6A 4DUXA 5JR1H 4G6FD 1HEZA 3WHXB 1NGZA 3WXVL 2ZOKA 1HXMA 2RHEA 2Y6SD 2N0MA 5FDWA 1WS7A 5HI4C 5KVFE 4ABUA 2OZ4H 5F7WC 3MRRB 1AKJB 5IKCB 2BS9A 4KV5F 1HZHL 2HFFA 2MKWA 2W0KA 3LEXA 3VO0A 3KYAA 4PTTA 4QHLB 1S7SA 5HGHA 3B9KC 2XN9D 3KPSB 4G43B 5DFTA 1I7ZB 4WJKB 4F33A 2G0LA 3BKYH 3BPCB 1J11A 2F7QA 2DQHH 4OIIL 2IAMB 3APCA 4Y7OC 2ADIB 2IADB 2VDOH 2XY2A 1TZGL 2WWNA 2CUMA 1Q1PA 2VC2L 1KBGH 3RAJL 3RDTB 1IGJB 2YMOA 2E7BA 1KTDB 2XWRA 3OZ9L 4JKLA 1QHPA 1FL3B 3PP3K 3C2SA 3CX2A 5K39A 3BGMA 1L5GB 4IOIA 5IR1B 3MRJA 2CUAA 4MBRA 3T2OA 4C56B 5IT2L 3D85D 3EJYD 1E3FA 2UXFA 2IDUA 3QYMA 3RDTD 2NNAA 1QKZH 3NQKA 4JG1L 4NO3B 4ORGA 1PSKH 4KTDL 2IBZX 1MWAA 4BH8B 1OZTG 3EYVB 3UIZA 1VFBA 4LSUH 3EJZC 3G5ZB 3HE6C 4YPGB 2WZPD 4AW7A 3PJNA 1KJVB 2BSCA 3DX8A 2F1BA 3L5JA 1RU9L 4K9EH 1TTGA 5E9AA 3GF8A 1FVEA 5HI3D 3ZX1A 1CDJA 1CE6A 1PKQE 3C08L 4MAUH 1MNUH 1NJ9B 3ABLB 4ONHA 5LB1A 3V7AE 5JMOC 3ARDA 4N0YH 2Q8AL 3C09C 5LUMA 4NXKA 3O45B 5IROD 4C4KO 1MCOH 4ALAC 2L7EA 4U1NA 2NR6A 2OMYB 2ADFL 4HWUA 3RVXD 1S7TA 5C07A 1RAMA 3QQXA 4NN6C 1DQLL 2X1WL 4JCWA 3BKYL 5D7KE 5DK0B 2CDFA 1T0NA 2NCEA 3U82B 2AEQL 2NYYC 4DGIL 4BCYA 4X5WA 2W65A 2IBGA 3H9SB 4PGJA 5AB9A 5IB4B 1XZ0B 2PCFA 3VD7A 1AGEA 2PP8A 1ETZB 4YHPA 4JO1H 3B9EA 4U1JB 1ULVA 2OW6A 3MRKA 5CZXC 4ZX6A 1A64A 1XGYL 3VGDA 4P2QE 1VGKA 1NBVL 2QKIC 2GG1A 3KS0J 2VDQH 2CUIA 4ES8A 5ICYA 3T8MA 2GUOB 2B1HL 2ZXGA 3HJ0A 2DTSA 3SPVA 1R33A 5J06A 1CT8B 3A4FA 3A47A 3QIUD 1ZKAA 5D1QB 2XETA 1OW0C 2FBOJ 4MJ4A 4OFQA 4PJGE 4ODVH 5FO7A 1KN2L 3EYSH 3C6LB 4JDEB 4NO2B 5AVSB 2F8IA 2CO6B 3APDA 3QR0A 1ZSDB 4WSJA 2BC4B 1QVOA 3U83A 3V52L 2LVEA 1CBVL 3IGUA 3FSVA 4X5PA 4EXPX 4RRPG 4I0CC 4GAFB 4W6YB 3MYJA 1OQXA 1MFDL 5DS8B 4R7DA 4F7EB 1HSAB 1A3RH 4MA1B 3T1FB 1TZIA 4OCXH 5FGRA 5SV3A 4Z3TA 1CGWA 1JPSL 4UQIM 1XL6A 2YPKA 3BESR 3L5IA 1TYEB 4O5LL 2E7LA 4ZX3A 3QZNA 3ZK0A 2ZWSA 5I6LA 3UO1H 5ACLA 4L8SB 2YSSA 1PZBA 4GI9A 2Q2EB 1I7ZA 3PNRB 4FQQA 2J25A 2Q7YB 1MSPA 4Y8AA 1GCFA 5DEZA 3UTSD 3V55A 2X2HA 4IJTA 4NDMB 4F8TA 4JPVL 3MRRA 3Q3GA 4M7JL 3AXHA 3ZRCC 5BMFL 5D4IA 3MSPA 4R97C 2B1HH 2OL3A 3ZYOA 4NRYB 4PJEF 4GXUN 2E27L 5FKAA 3WHXA 5KZCD 1G43A 4B9JA 3B3IA 3GS7A 3KWUA 3UYPA 4LFHG 5E5RB 4FQXC 5ECJE 2V4LA 1Z66A 3B2VH 1ZGLB 4PJ7A 3SKMA 1FG2A 3FOLA 3ZTCC 2NDGA 1QYGH 2CRZA 3ZTEA 2R0KH 3OAZH 4EF3A 1V3JA 4NPJA 4QY8B 4MVBC 4XI5D 2AK4B 3IS1X 5DEGB 2P45B 4NB7A 3RPKA 1PZCA 3DMMD 3LMJH 3OPZH 4BQ8A 4F5CA 5BQ7B 1D9KC 5LBGA 3QJXA 5B1KA 3L4CA 2EVGA 3DTUB 4Y4HB 4DZBA 3D5OF 3CFKA 5AW8B 4G5AA 3LNFA 3JTTA 3QQ3B 5EUOF 3UTTD 1XCQB 2BINA 2VLKD 4Q6IA 4FHKA 3RGHA 3X1EA 4EO5A 5I8OL 4R4NC 5L0QB 1QR1A 5F3FA 5I9QB 1JXFA 3RFZB 3WS6A 3VWKA 3UJIH 1KELH 1ZA6B 5DI8B 4G9FA 5JIKA 3O3UN 4XRCB 1G0DA 4J23A 4GOSA 1IGFL 4MX7A 4BQ9A 4OM1H 5IFHH 1I1FA 2ZCZA 4HHAB 1SUHA 3P9LA 3TBTA 1JGUL 4A2MA 1MCOL 2ZKMX 5A6MA 3H9HB 3D39E 4EI5D 4R7LA 4LNRA 3FUKA 4AM0Q 1OHQA 2A83A 4X7SL 3QSKB 3D18B 2DLEA 4U6VH 5GRJH 1PCXA 1EO8H 4FQHB 4B9FA 1QNIA 5I1JH 2XXMB 3A23A 5C71A 3EADA 2L4OA 2MQ3A 2VZOA 2MTPA 2VRKA 3HPJB 4YO0B 4EVNB 4ZFFB 2AVGA 3LD8B 4GRLA 4LLMB 2D9QB 1FGNL 5E2VH 1I7TB 2N3JA 1IBGH 3U4AA 3VUAA 4PRPE 5KSAA 1NC4A 2J72A 2WWMD 1BBJA 3ATFA 3D33A 3F58H 3NT0A 1XIWD 3BUYB 3OPZL 4ODSL 4YHYC 2WBJA 1UKQA 1GW6A 1UWXH 4YLQT 2VLMD 2EDMA 3I6LD 4OLEA 3GMOA 5EN2B 3HAEA 4JG0L 4P4RB 2NTSP 3U48A 3LZNA 2HAZA 2CLRA 2EEXA 3HR5B 2N1KA 5D1XD 3S3JA 4YGAB 1IFHH 3JWNH 1T83C 4F8NA 3VG0H 3DOHA 3JYCA 3KNBB 2CIKA 3O6LH 3PNWB 3PWLA 4AKPA 3CLWA 2B5IB 3DETD 4GAGL 4G8FA 1ZLVK 3CN3A 3VFPB 1MFEH 4X4YB 1J8RA 5EO0A 3WKNA 3CFNA 3ECBA 2OBGA 4ZMWA 2JB5H 2X3BA 3ATBA 3EZJB 4YE4L 3EUUA 4FFZL 4YL4A 4F20A 2JVUA 5I23A 4ZX5A 1O6SB 4B3EA 2VABB 2A6IB 2ROXA 1ITBB 1B0GA 1DR9A 3PXLA 4NWUH 4NENA 5BNXD 2K8QA 2WWKT 3IF1B 2FJHB 2Y06L 3VFVA 2LTQB 3NAAL 1T1WB 5I17A 2I25N 3FPXA 4JPKH 5DQDL 3JWNG 5JHLL 3WXWL 3EGXA 1UM4H 4HGWB 2CBMA 4JZOA 3FAWA 1UTDA 1MWAB 5EB9A 4BYHA 4KZEL 5LN8A 1OLZA 4UBDC 1I3RB 2F74B 4I0PD 1YYML 2BXZA 5DVPA 4K5OA 3C5SA 4HIHA 2HSIA 3LN5A 5SWZA 1NAKL 3WNIA 2PPFA 3T3MB 4TQEH 3UG3A 3TCTA 1V10A 4K5PA 4YSPA 4DH2A 4ODSH 3EDJA 5DFVD 4BZ1H 3GRWA 3KE0A 1I1AA 3TJHD 2BSEA 1QNZL 4XC1L 1YMHB 2CK0H 1EFQA 3D4GA 4PSPA 4YWGH 1ROWA 3NCJL 2IADA 4WW2F 2EC9U 2C7UB 3L3OB 4JPWL 5DLML 1HHJB 2UZYA 2ITEA 2J8HA 3NP4A 3BRFA 1Q0YL 2QDVA 1XR9B 3RZWA 2OL3L 4M7ZB 3N1QC 3JUYA 1A6UH 2LTQC 3PCYA 3W57A 3B9AA 3KLSA 4Y8DC 4ODHL 1SXCA 1X7SA 3DBSA 4W4OA 4QRRB 1L7TL 2NNXA 3E3QC 3O11A 5TH2B 5EIIA 1DFBL 3B9KD 4PRID 4JFZL 2Y06H 3KMDA 1NC4D 1OCWL 3WEXA 5K9KA 3MBWA 5IK3B 3D0LA 2WQ8A 4A2HA 4ZXBC 4EXKA 1KYOJ 2W60A 4FULA 1KELL 5FOBA 1EGJA 3P54A 5IMOB 4JX0A 4ZOEA 4S1RL 5F7UA 3IJSA 5SX4H 2CRMA 2HTKC 5I76B 1BQ5A 2WNXA 2FYVA 3K4AA 3VGFA 3GJEA 2WXMA 2O5YL 4PBVC 2ZXCA 4L3EB 1LP9A 3UJJH 1KZQA 1V55B 1LE5A 2FLRT 2GITA 2HX8A 3RWJA 4MJ5B 4AG4H 3QUMB 4MTMA 4Y5XC 3WY3A 1UOWA 5TK2A 5E56A 2WV3A 5DD0L 4OGAC 2EDYA 1VHPA 5HGDB 4BZ2H 4OD3H 4CVXA 3NJKA 4PLKC 3F83A 4PGDB 4KTEH 4B97A 3WN5B 4BFIA 4PB0H 3EF7A 2XYCA 6PAZA 3MR9A 4I1PA 3CFJB 1QSZA 2OMTB 1NCDL 35C8H 1UQSB 3D2TA 4PRPA 3X1NA 2B2XH 1QHQA 4PQXA 3DVIA 5DGQA 2VISA 2YAPA 4AXWA 1K8DB 1MG3C 2V5SA 3BD5A 4PJGF 4L3EE 3QFDB 4Z3GA 5EEUA 1Y7VA 4DKFH 5T3XH 2H8PA 3VI3A 1NGPH 4KI5E 4CC4A 5ES4B 4JL2A 1N6QH 3QULB 2J4WL 2P8LB 3QI9B 4L1DA 4PJ7F 3EBIA 3HNVH 3FULA 3FUFA 3O0RL 4WU5A 4OCSL 2VDLL 1HYSD 1D2OA 1OSEA 3P0GB 1BPLB 2DI7A 3W0WA 2BZCA 3VW3L 3CZNA 3KYMA 2OMVA 5DHVH 4HS6B 3UJJL 2FO4A 1RULL 4MA7H 1R5VB 3WLBA 4WU5B 5FW6A 1CGYA 2DI8A 3U6RB 5TF1H 1ZLSH 1IEBB 5EBGA 3ZKMC 1IKNA 1EZVX 4UB0H 2VZVA 4NO0D 1J1OL 3VE0A 5JHLH 4IGBD 4GSRA 3MFGB 3TASA 3BVXA 4UM9D 4JFDE 4F7MB 1K8DA 2X70B 1PJ9A 3MGAA 4QLRA 5HHPA 3K71A 3EJUA 3NEXA 3U7WL 3FHEA 4FAAB 4J5VA 2D4DA 3PHSA 4ZQKA 4YDIL 2MCPH 2JJUA 2UXGA 1KJMB 2R27A 4MDIB 1ZWIA 4GW1B 4QEGA 4JQIL 1NTDA 25C8H 1EJOL 4X5XA 2FBRA 2O6EA 1NMBH 4K3JL 2TRYA 4WHCA 3WE6B 1JZHA 5EH1A 4OZIF 5HJGA 1Z3GL 1AO7D 1BEXA 2LQRA 4DKFL 3A22A 1BYPA 5E4IA 3D3VB 1YECL 4DHLA 1RZKH 4WWNA 1WIUA 3Q8EA 4L4TA 2X87A 3TVMB 1EZUA 5BOJA 3MREA 4FEIA 1ZS8B 2ZF9A 4DP9X 1A6TA 1SLUA 2FX7L 2WUCL 3B2MA 3GSQB 4HUUA 4UTBL 2VDKL 4FJYA 4U2YA 2DQIH 2W91A 3D1MC 4HJJH 1KSRA 3FU9A 3PAUA 3F7PC 4Y88A 4L1LA 5TD4A 5EU3B 1F6AB 4NHCH 1ZVSB 1JPGA 2DQGH 4PW9A 1A1OA 1YNTA 3LXCA 1TJMA 2DMBA 3MNWA 5BZXA 4HOXA 5AAWA 5FFLA 4YHMH 5DQ9A 4XR8C 3QT2A 3RJDA 4V2CB 4W6XB 1NOFA 1TF4A 3BW9A 4MB3A 3LDBC 5CLYA 1IQWH 3AMLA 4QTIH 4LPYA 4X7CC 1NCJA 3VG9C 1XQ4A 4AW4A 2GTZA 3OXSA 4YDIH 4MVBD 5BJTB 3GI9L 3LH9A 4JJHA 5BRZA 4XXCC 2RCSH 1W2KT 4JKKA 1U6AH 1CICD 5TE6L 2APVA 4FJ6A 3TONA 1K9TA 1AGDB 2VT0A 1KENL 4RMSA 1I8KB 2C9UA 4JY4B 4F91B 1W8EA 2SEBA 4QHPA 4XBEH 1U4EA 4R8WH 2K45A 5FR3A 1NPJA 1XSOA 4JFOB 1Q4NX 3QEHB 5CWSA 2VSCA 3KVQA 3L95A 5DQJA 1RK0B 1RZKL 3GSQA 1GZPA 4NO0A 1JK9B 5C08B 5AG8A 4BFEA 4JREB 2NY1B 2UZXA 1EEQA 1IQDA 2B2XL 2GSIB 3VDCA 2DQDH 2VLLA 2FH8A 3CUPB 4LP4A 4D8PA 3GMPB 3PL6C 3FB8B 4YSCA 3C09B 4P04A 3OX8A 2F5AH 3M7OA 1NCHA 4MMXC 4EN3A 1NLDH 4MXWL 4OVVA 1ACYL 5FW7A 5IVZB 3FMGL 4JKPL 3BI9X 1JZ8A 3WAKA 5ALBH 4F9PA 3EYFB 1RUML 1TJHL 2MOQA 3FK3A 3CU1A 4RBPK 1XF2B 4IKNA 4NC1E 3ZR6A 1B0GB 1BXUA 2JKTM 5T1KD 4Z77A 2YAFA 5A2LH 4OZ4B 2VO5A 1J1PH 4KTYA 1SVZA 2EIKB 2ZICA 2DWSA 5JXED 4OF7A 4LPTA 3DJTA 4G8FB 3GI9H 1IAKA 1S7XA 5I6XB 1TZHB 2ICCA 1JXJA 3L1OL 1K5WA 1NGQL 2R1WB 3TNNB 3RURA 4ZI8A 2FHCA 1JZDC 2R0WH 6FABH 4XP1L 3EO1B 3QO0A 2B9BA 5D1XC 3X13A 2UYLA 4W9ZA 1GYVA 2CGYA 3IAQA 4QHKI 3S34H 3DJRA 4N0FB 5B4MC 2ICWI 1Y18A 1BHGA 1CICB 3IDGA 4NUMA 4ZAKB 1OT4A 2MH4A 3EGSA 1EEUA 4WW2B 5KSAB 5KUKA 2HXAA 1WAEA 2VRQA 3PQYB 1FIGH 3PJSA 5E8EB 3LZPA 3TBCA 5IW6A 1L6PA 2A4CA 2VDOL 5EA0L 2EIZB 5E03A 2P8LA 3QI9A 4M4PA 1P5UB 4OCYH 2H8PB 5DUJA 4A6YA 5F7YC 2IQ9H 4LCCA 3ZZQA 1N0LB 4PP2B 1MJ7H 3D18A 4LSVH 3DRQB 4JHAH 4MD0B 4F7CB 4QRPB 3BAJA 1S5HB 4U3HA 5JPNA 5F21B 1GC1C 4MXQD 4MZIA 4PHXA 4WEUD 4AV0A 4LPVA 5J13C 3AW5A 3TBTB 3M1BB 2FX7H 2WUCH 1S78C 2J1KA 3BIAX 3F65A 2VDKH 2EKSA 4N2AA 3NK3A 3HC0B 5TK4A 4TTDD 3SGJC 4G9FB 2ARJQ 3R0MA 2PYEE 4F2MA 1WDAA 5JZ7D 3LZFL 5B3JF 1NBCA 4W9HC 2ZX9A 3D12B 5IGXL 2CGRL 4G9DA 2FZ3A 2UZPA 1FZJA 4NKDA 4NQDD 3GMMB 1QEWB 3O81A 3P4MA 1YJDH 4LLQB 4OJDH 3S36H 5IB1A 4XP1H 2W94A 1LE5B 1Q1JH 4GRWB 2FT7A 3VQ2C 1F11B 4D7BA 1XSKA 5J1TC 3Q5OA 2UV3A 3FNKA 3SE8H 4TNFA 4OV5A 5FM4A 5D1QE 3HS9A 5TDOA 1JMXA 5IESH 1D6VL 4PGBA 1E5AA 3UBGA 1JHKL 4K5LA 1BJMA 3VXTB 2ZX6A 1CI5A 4XP6L 1ICTA 3K46A 1ZE3H 1D5XA 2D03H 4D7PA 1JWUB 4CVZB 5K9KB 3BOVA 3HN3A 1QG3A 4RRPA 3OTTA 3GBNH 3AREA 3NFNA 5T1MA 2CRYA 3ML9A 5DVLA 3V6BR 3KLAA 3U1SH 1NCBH 1A6WL 2D7QA 3VVVA 3VSUA 3T4YA 3G5VA 3TN0A 3K6DA 1IE5A 1IGYA 4BBWA 3OAYK 1EV2E 4AEIH 1G7LB 4KJWD 4AIOA 1R5IA 3FQXB 1KEML 1R3KA 2ZG2A 3I9PA 2KERA 2DQUH 2WLZA 4DKEL 3LZOA 1CYGA 2IMNA 3MOAL 3CDYA 4PSRA 4EIBA 3OBAA 1E28A 2XACC 5E9DE 4EAEA 5D7EA 5EZJB 3QPXL 5LKNA 1A22B 1I1AB 2WTOA 5HHOB 4ELKA 4YHLH 5FYLD 4N85A 1QKZL 4DEWA 4WU7B 4YX2H 1CDGA 3TCLB 1P1VA 1D5RA 1QTPA 2PR4H 3EDKA 4JDTL 5E2TH 3S9DB 1L9NA 4LLDB 4JKWA 1G0YR 4LQ1A 4C4UA 5CS7A 2OPCA 1I3RA 2GJPA 4GG8A 4GO9A 1K3ZA 1R1CA 5KVEH 4FA7B 1BM3L 1MCSA 3HB3C 2YEVB 5JW5A 4HIQA 3T0WA 4YC2C 2NX5B 3EO9H 1JFHA 4P2CG 3QXUA 3FT4A 1GVIA 1NMCB 4N0CD 1T7ZA 1MFNA 3KH4A 1DCLA 1HJCA 4N0YL 2Q8AH 3X3FH 3EJTA 1NBYA 4OJCA 5I5MA 1R24A 4WWPA 4YEFA 5EIVA 2IV9A 5HVGB 2EIDA 3U1SL 3D4ZA 2DQCL 1KC5L 1WVZA 3EYQC 2H32H 2DZEA 1RCYA 1GPOL 5IHZA 1XF4B 2Z65C 3TIEB 3GHEL 1CN4A 2A73B 5T1DL 3PNWA 4LSRH 2AEWA 3OJ2C 1U8HB 3MOAH 1AD0B 1IAOA 3VXQB 2ZG3A 2JELL 3KXFB 2EYSA 2IFGA 2Q76B 2R0KL 2BMKB 2WKOA 3IN0A 1MHEA 5JHDD 3LKOA 3RA7H 2HJLB 3RGBA 3MV9D 2ZUWA 4JKNA 1I1AC 1MAMH 1TSHA 4U1NB 4KPHL 3BP6B 2Y7NA 4OJFH 5CCHE 4YEEA 1S9XA 5CMAB 1ZT4A 4JMXA 3T9WA 2GSGB 3OJDB 3D6GA 2QMKA 4RMQA 3GSWB 4PVLA 2JJSC 5E6SB 3L3KB 3MCKB 2OXHB 5CIPH 1ZMYA 3V5DB 4GUPA 1IU1A 5FX3A 2V7NB 2JKLA 2QFPA 4L5FH 2GI7A 5CSGA 5FGSA 3PPSA 4KXZH 1MFBL 3SPIA 2P24B 4YXLH 3OQ3B 1CL7L 4R5VA 1TSRA 1JHTA 2J88L 3MMEA 4BKTC 4CUCA 2F0CA 4RAHA 2FEEL 5DSCA 5F44A 1BIIA 4OCXL 3VFNA 3QRGH 3FCTB 3E7JA 1G9NL 4NP4H 4UQEA 4P4KB 5F1KC 4NBZB 4M7KH 2B1OA 3AQYA 1EZSA 4L9DA 1EMTL 1R75A 2AAVA 1BIHA 3FAXA 1J87A 2YPVL 4I13B 5GS3A 3RFZA 4I18A 4TVPD 5JA9A 1MIEL 1U8PB 3RDTA 4F27A 1LDPH 1NQBA 3VSVA 5I2IA 1CFQB 3Q8FA 4HC1L 4GW5B 4NZDA 3HHSA 2C3VB 1JZ3A 3WOVA 1KT2B 2UUDH 3MODH 5C09B 5MEPA 1UADC 3D52A 3EJCA 4RFNB 1AAJA 4S2SB 3PE9A 4M3HA 4OCRL 3KPSA 3NA9L 4K8RC 3GSOA 2AK4A 4UYPA 2HFFB 4NKIH 3TL5A 3WDJA 3I85A 2GJ6B 2I9LA 4XB8A 1ACZA 2ZOKB 2D2OA 1M56B 4O4YL 3U4EB 2X0WA 3FF8A 2P26A 5IB5A 5JXAH 2KC0A 5ABDE 3SO5A 1ZLDA 1BBDL 4CVWA 3ZW3A 1PG7L 2M1KA 4W93A 5SWQA 1AZZC 5JO5A 1KTLB 5F0MB 3FYEB 4NSKA 4B7LA 2BFVL 4PYHA 2WUBH 4IRJA 1E27A 5SWSD 4DGIH 2OQJB 1INQA 4H20L 3BGFB 4NDMA 1DBKL 4XO3A 2OM5A 1NSNL 1A7BA 4QF1A 4Y16B 3QIBB 4PJ5D 3RKDD 5DWUL 3PWUA 5CZVL 2GC4C 2LAAA 1NC2D 3GT6A 4Z7UA 5AW6B 3LH2H 4YXHL 4C47A 1BAGA 1OLLA 1OD9A 4UNUA 5FO2A 2H9GB 4BFFA 1N5YL 4K7PY 2ENSA 4FC3E 5FO9B 2AQQA 1MFMA 2VLME 4RSYA 4KZEH 1HQ4B 5D2NC 4L8BA 1A7QH 1OSPH 2NXYD 5CJ5A 3PWPB 4MNGA 1G7JB 4M62H 4HMCA 4ENED 1U8LA 4K2UL 2AP2A 3FCTA 5I18L 5DSCB 1MN4A 1GZHA 2HRPH 3QW9A 4UU9A 3V4VB 3GHEH 1EHLH 3MOQA 4HUXA 3N1PC 1YHPA 3AG2B 3QJVB 4JNXA 3MLSH 4LKXB 1UWFA 5MENB 2VERN 4QRQA 4GQPH 5JW3L 4TSAL 3TBVB 1JV2B 5E00A 5I19L 5HI3C 1WH0A 3KJ6L 3HBZA 2W07B 5IBLC 4UCFA 1K6QH 4NN5B 2XSKA 5F6HI 4HUMB 3SPVB 1FV1B 2UVEA 3NVQA 2FLBT 2XV2A 3GSWA 3GRBA 3GS4A 2GSGA 4APQD 2WWOA 1S9XB 4PJFF 1FL6A 3SYCA 4JM0A 5EZOH 4GLRI 4APXB 2XG5B 2UX7A 2G75A 4GUQA 3AVEA 4B27A 3H7BB 4GI6A 2AK4D 2Q76A 3OZKA 3JTSB 4GAGH 3RVTC 1UWYA 1JGDA 4Z7UF 3G6AA 5ALCH 4OFIA 4NQVA 5J1AB 5AZEH 5GS1B 2CDFB 4A04A 4PWGA 4PS7A 1SXNA 4XHJD 1OP3K 1S7TB 5C07B 1J5IA 1N0XL 5F1IB 4AQ1A 3F00A 2WW8A 4H8VA 2G5RA 1N68A 4K2UH 3MROB 4YK4C 3O8XC 3HG1E 5I0WA 1JZ6A 3ZZLA 5ISZE 2VDOB 3AQZA 4E41A 4WV1C 4FTVD 1MREL 1UFUA 5KANI 2UY7B 2DIJA 2AQPA 3ZGIA 3FFCE 4TYUA 5ISZA 3FCUB 1I8MA 3HRPA 4KZCA 5I75C 4XAWL 1R5WA 4G7RB 5FYKD 2IPUK 2PPEA 3DMMA 1J8HB 2XNAB 4KJYB 3LZRA 3SGEH 5IJVA 3S88L 1HXKA 2EUZA 2VMEA 4E5XG 4M1GH 1G7QB 1U3YA 5T1LD 5MEOA 3PGCB 3GI8H 2IPKA 4TQEL 3AABA 3RX9A 3O8XB 1U8CB 1EGJH 3DUSB 1AKPA 3GIVB 1COBA 1MVUA 1U3HA 1QSED 3EDEA 1FVDA 3ILQD 4ZMPA 1W0WB 4YBQD 3WNPA 2YEZA 5LXVA 1KGCD 3W5MA 1SY6H 1BZ7B 2UWEF 4BK4A 2GBAA 2ZWKA 2WCPA 3W1ZA 4LCYB 3WKPA 2Q2LA 1BXXA 2WAQA 2EQDA 3HOGA 5DTFB 5ENWA 4FFZA 3QCTL 3AWEA 1I3VA 5E6UB 1AC6A 4TL5A 1JD9A 4Z7VA 2A9BA 3ZQXA 5HYJD 2A9ML 4Y1SA 1X4ZA 1CU4H 2C8NA 4ACTA 3PL6A 5I1JL 1FRGH 5E0FA 3HZMA 1SN5A 3MNZB 4JQXC 5DJ0A 3ULVL 3JZ7A 2ZP9A 4ZUUB 3NGBB 4I4WA 1NFIA 2VQ1A 3S4SB 4HBCH 3ZDYB 4U49A 1WAAF 4O51B 1MJJB 1IBGL 5KVMC 5GRUH 1RFDL 3VJ6B 3KLAB 2XC8A 1IGTB 2CLZB 3ARWA 2BS8A 5CO1A 2H0FA 2WYHA 3O3AB 3CX5J 5EU7C 1D5XB 3BZ4A 5DO2C 4PJ8B 3C5JB 5HY9A 3RVUD 3UTPD 3FTYA 4FZ8L 2ZNXA 4LOUD 4ONFH 3P73A 3RTQB 5BV7B 2WM0A 1XGQB 3KPLB 4ZNCD 2ILLA 2ZONA 1SOQA 3FCGA 5IEKA 1EJOH 4QAWA 1SMAA 5IWLA 2B1AL 5C0NC 1HL5A 5GSRB 2HB0A 3DX7A 4WVRA 1NCWL 2GKIA 4X4ME 3VACA 3VM7A 9CGTA 3FW6A 2YN3A 1P6FA 1G4MA 2ZOLB 3P4MB 4LLQA 1E65A 2XUWA 4UV7L 1WFJA 3ZQ9A 1A7OH 2YPLD 3GEFA 4FYQA 3FFDA 3QCTH 4BCXA 4FTVA 3GO1H 3INUL 4BSVA 4PTUB 2OI9B 2AKRA 3QI9C 1YPZF 2E7MA 2EKSB 4AGPA 4PRBA 1FRGL 3VFTB 3H42H 2ICES 1YRKA 4X8XA 4NRZB 3WJMB 1TTCA 4RCAA 4OI7A 3CTTA 1CR9L 4U1SA 2JI3A 3NTCH 1KV7A 5JPNB 3H2WA 4K55A 2R4SH 5DU7A 3TO4A 4CMMA 3MACH 1XF5A 4JN1H 4HPYL 5KYYB 4MD0A 5GRUL 2OR9H 3WTWA 3QHZH 1YC7A 1GSKA 3EGDA 3QHFL 3O0RH 5H2BB 1AZVA 1XTMA 1UCTA 3MGOA 2VDLH 2O30A 4PU2A 1A3QA 2A3TA 3CZSA 1QP1A 2K9UA 1AZCA 4MD4B 2YD0A 2PTUA 3KJ4C 4LASL 4PCKA 1WWCA 1GS8A 3FQ4A 1NEZA 4GRWE 5D7LB 3DA0A 1AYRA 2A0LC 2ZAIA 5DD3H 2EXYC 4QD2E 5EOCL 5FUCC 4Y5XB 2HKHL 3T0EB 4N3TA 1FH5L 1QMUA 2J1ZA 1QR4A 1UFGA 3BE1L 5HGBB 1J1OH 3TBBA 4B60A 4TSBL 2RH0A 1HTYA 3FTGB 4XAWH 3HRZA 4PWIA 4M56A 4QXGL 3TBWB 1RERA 3IJYA 1BZ9B 4WWOA 4G3YL 4PY7B 2NCMA 4QHNA 2YD3A 1XH0A 3NZHL 1QBAA 3I75B 2LE9A 4LK4A 2QZ5A 1E5BA 1H8LA 2XPGB 4FG6C 3HMXH 4HUCA 4KUZL 5LAXB 3WIFA 5KW9H 4X6BB 4GT7A 4G6FB 2JQAA 1JNHA 3I6GA 1XB8A 3ABMB 3QUXB 2DIAA 3DI3B 4F9LC 3VXUD 4OZ4A 3NFPB 1YEEH 4WI0B 2DLTA 4EI6B 4GXVH 4JHVA 2P9RA 1IM3A 2O5YH 3D25B 4MQ7A 1JN6A 5T5FA 4XOBA 5IHWA 1HINH 5KSBB 4JN1L 4DSYA 1MI5A 4G59C 5DVKA 2EIMB 2VXQL 1CYWA 2XZQL 4TF4A 1SVBA 2CD0A 3QUZB 4ZTEA 2PUQT 3NSDA 4FS0A 1GYUA 3DYOA 1M6UA 4PGEB 3RZCD 4NBXB 3QJTB 2K6WA 1O0VA 1QA9B 2XKSA 1X5IA 4P99A 4ADIA 5CJXA 1BMGA 5AKVA 1P53A 4I3RL 3DVNB 2J2ZB 2MWCA 3DOIA 3C8HA 1KPRB 3SO3C 2VLRD 3RFRA 4Z23A 2FT8A 4R90H 2EC8A 3QJHB 4ZQTA 5DFVC 4FXGA 2GT9A 4TUKH 5C0BD 3VB8A 4DFHA 1X5AA 5A43C 2Z91A 4TM9A 4J3WA 1INDH 3X12B 5IP4A 4KRLB 4GW4A 1T66D 4X83A 5TDPB 3TO4D 3D05A 2K6YA 5AZ2L 1BZEA 3FPYA 3QNYA 2DJSA 5T3XL 4MJ6A 3QJFB 5GGUA 3QUML 3MI6A 3T8VA 1P9MC 3GSNB 2Z8WC 2AXGB 1DBAL 1D7FA 2VRAA 3GSNA 3IGAB 3E8UL 5D55A 2RAMA 1B2YA 1R3JA 5AEAA 1I8IB 1X5YA 2XN9E 5DJ6A 3HZKB 3QJZA 2PABA 3ISWA 4HC1A 3OB0H 1Z0MA 5BUAA 2FSDA 4ZFOA 4MJHA 4LT7A 3SE9H 4ETQB 3BO8A 5GZNC 5AW9B 5FK9B 3IAPA 5CEZE 4Z8FL 1ZXQA 4D3CL 4AE0A 3QBTB 4ZFZB 1ZLSL 4HYTB 2NR6C 1PFCA 1XR8A 3GFUA 2BIIA 4X6FB 3BAXA 3LKQB 5B38B 3BJLA 4GNKB 4X6FA 1NIFA 4XE5B 1I9IL 1P7QB 3IXTA 4UT6A 5BXFA 5I15H 2DKUA 2NW2A 3UGUA 3FO2A 3WD5H 2EUVA 2G3MA 2ZNWA 4LMQE 1UHVA 4HWBH 4ONGL 3B6SB 4L4VA 2YRBA 4HK0B 3TH2T 3C8KA 1UC6A 2NY2C 2NSXA 3WCYA 1TLKA 2XZAH 4R2GB 2V5RA 3AT8A 4KMTL 5AKTA 4GG6B 2QKIA 5H94A 3T8XA 3NP3A 4BWUA 4BKSC 2VXVL 1NFDA 1SHMA 1Q9KA 5ITBL 1TNMA 2NMSA 4MQ7B 3VFGH 1AQDA 4L1TA 2AXJA 4IRSA 4LOVA 3FQUA 3U2SA 2WGXA 3VAEA 5LHDA 1NLBL 3AS0A 1LWHA 3QVAA 5F9OL 3WLWC 4CAGA 4HULB 3QJQB 4NQCD 2QHLA 3V0JA 4JS7A 2R0WL 2DYRB 2H3KA 4K94C 3QCUL 2C3WA 3KCPA 1X9UA 1HU8A 4DP6X 4HU8A 5FUOL 4FXGB 1AE6L 2CZNA 1U8KB 1IEBA 3KD4A 3TTYA 3WIHL 2V8LA 3GTNA 3V4PA 2IV8A 2WMPA 3HJEA 5C09E 3T71A 2GAZA 1PAMA 5CU9A 1L9TA 2OCCB 3OR7B 3X13B 4J12A 2XI9A 3EJYC 4NXSA 2ITDB 4XOCA 4XXDB 5KYWA 4HGMA 2ZD0A 4UOJA 5D7JA 4JBSA 4HT1L 2E7LC 2RQ8A 4Y4HC 3MO1A 4QTIL 3IBEA 2NUTA 3HKFA 3SJVD 2VIRB 5BVJB 1D9KB 1TVBA 1DDHA 1KIRB 2IBZY 9PCYA 2ICEC 4R7NA 3EGDB 5E6IA 3VU2A 4IS6B 1WD9A 3DV6A 1OV8A 4DW2H 3BFWA 4X42A 1JVLA 4GAJL 3JYBA 2JKIS 3MCYA 4K3GA 4DP2X 1LO2H 5GJTH 2FHBA 3WL9B 4HD5A 3GZQA 4BZYA 1BM3H 1TQBC 3MJ9A 2OMTA 3MRFA 3Q7JA 4PR5B 5D93B 1CBJA 2EE2A 4UMGA 2NQ3A 3QPQC 5E23A 4CVXB 3ZTNL 1KLFB 3FONB 3IJYB 2Y5TA 3I84A 1VZIA 3B8YA 4NI6A 2ZF8A 4IK7A 1JRHL 2ZAGA 3OKLB 2D0GA 1C1EH 1AE6H 3S5ZA 3SBRA 5HPOA 4ZNEE 2I7SA 1AQKH 5C6PB 5C3LD 1A4KB 3TWCH 4AMWA 2WXIA 2YKKA 1GPOH 4OJAA 4J3VA 4MCZB 5FUZL 1IT9H 2AFNA 3JTBA 2ZCLL 4V2BA 1ZEAL 4B9CA 4Z7QB 4AIZA 2WBJC 1M42A 5KVFL 5AVQB 1CD0A 5TE4H 2BSBA 3LN4B 1LO4L 3WS6C 4Y7MA 5HP5A 3MX0A 3QIUC 4Q56A 5EFIB 1YUHA 4JM4H 3IKCB 2JH2A 1KCUH 5LGYA 4UT7L 1HNGA 3U9UA 3ZDZF 1A6WH 3B8SA 5F89A 3UGEA 1Z9PA 3F6IA 2OYPA 1CLVA 4Z8FH 3GSNL 4U1LA 1ZDQA 3G08A 2V2TB 1NAMB 4ZUWB 1EHAA 4U1SB 1KN4L 4Z7NE 2JTDA 3FRUB 4N0RA 1OM3L 3O11B 5I1DB 4KV5E 1ODUA 5I1CH 5DO2D 4QRRA 3TPKA 4ELMA 3ERXA 4LOUC 1E8YA 4O51A 3ARQA 2HUEA 1I9IH 4LRIC 3KXFE 4MS6A 4ZUUA 4LRNH 3ZL1A 3HZVA 5C6TL 2P3YA 1UXSA 1CI3M 3BDYL 3QPXH 5IJCC 3ZHLA 2G2RB 4DPCX 4CDGC 2VR7A 4F58H 1QI3A 1QRNB 1PLGL 3C5ZA 5HJ3B 2ZXBA 4KQ4H 1G6RL 3ENEA 2TSAA 2F7RA 1MFBH 5CEZH 3I6SA 5J1SC 2ZSWB 3NN8B 4YSUA 3J7HA 1VENA 2PR4L 1RURH 2QPSA 1LK3H 4IBQA 1OGAD 5E95B 2IQ9L 4QOKE 2D8KA 1F2XK 4PJXA 1W0WA 2NY6D 2IAND 4MCYA 3S8GB 2ZCLH 2OXGA 4QOKA 5B39A 3MNVB 4BK8A 4X50A 4EDWH 5A6LA 5I1HH 1CDUA 3TZVB 4HAKA 1NAML 3HCVA 5ANMB 3OKNA 1OTSD 2CM5A 1FYTD 4EIGB 4R6UA 1PZSA 4UT7H 5LG1A 1NZRA 3NPSB 1T04B 3BH8B 4NAQA 3QXWA 4TVUA 4XPHL 4WEMB 4M9PA 1F6LL 1I8MB 3NA9H 3N1GC 4I4WB 4LPWA 3S4SA 1KN4H 5DC4B 4YBLC 4XMXA 2FO1A 4AUJA 3MNZA 3MYZA 3O6FD 3TO2A 1F41A 2AJSH 4LSRL 3PL6B 3NPSC 5T3XD 1Q1JL 1E8XA 3LZLA 1T4KA 2CH8A 3E1F1 2OX5A 1KTKE 3PDGA 4Z7VB 4XO9A 2HN7B 2F53E 1NUFA 2WCGA 4HBQA 4S1SH 1TQVA 4RWHA 5GS1A 4PY8J 4NQVB 2XFXB 2JFCA 3HZ3A 3QDME 5DRWA 2OSWA 3K91A 3JTSA 5DLLA 4P4RA 2Q20A 2XXGA 3DHJA 4J27A 5FAAA 3WFHB 3EFOB 4TVPE 5JQHC 4HV8B 3SDXF 5K59E 1J0YA 3VD1A 4F1SA 2IOOA 3VXSB 3QIWB 2G9HA 1GC1L 1UKTA 4HEMA 5LJYH 1LO0L 1XEDA 2J1YA 3V10A 4CDHA 3FSOA 1RIHL 3BCDA 4AYID 3A67H 2XHNA 4PS4H 4FZEL 1KZYA 1I8LA 4PJXF 2IQAA 4FHBD 1SXBA 1AJ7L 1XGPB 3FU0A 4U3XA 4FQCH 3OXRA 2YGNA 4I89A 4OJYA 2ICWJ 4BINA 1CL7H 5PCYA 5LBSL 1J5DA 4ZUSB 1TJGL 3HNTL 5EOTB 1OPOA 3B2VL 3CVIH 1JV2A 3K5SA 4TL4A 4J3OF 1T21A 1EAQA 3TURA 4A1RA 1SOKA 1TVHA 4PV8A 3R8BB 3F3HA 1HSBB 2E6JA 1YEJH 2F2HA 5F0JB 2QEJA 4IBUA 2XWTB 2E4FA 4Z0XA 1GZQA 3CIAA 3DHMA 4JFTA 4K7PX 4UTAL 4WJ5B 4KKCD 1S4IA 5IOKA 4JFWA 3ZE1E 3M17B 1F8TH 5D70H 1VZGA 2HVKA 4FTDA 4PJ5E 1PY4A 3K81A 5ICUA 4GKNA 4C58B 1P84K 3RHWF 1K6QL 3MLVH 4XPBH 4MJID 1J0ZA 1VSCA 2HFEA 1S9YA 3DVGB 4UQCA 4FQIL 3H3KA 1JYXA 1Z5YD 1FL6B 2C9QA 2ZOTA 1A6AA 1IC1A 1NOLA 4F9PC 1AR1C 3H9YA 3WTYA 4U6YB 4TULL 1QFOA 3DX4A 4QY8A 3QUYC 2J73A 1ONQA 3T04D 3MV8B 4EI5A 4KQ4L 2R1XA 4M6AA 3F8UB 4NSKB 4PJEA 3DV4A 1PBYA 5EU4B 2YO3A 2YFOA 5HGAB 3H0TA 3Q2WA 4NNXB 1CMOA 5MI0B 2ZX7A 4NZ8A 5L4FA 1F3DH 3CVHH 2QQNH 1QLRA 2I60H 5ID0B 3QXDB 4Y9GA 3HBPA 1G6RA 4OLXL 4YIQA 3S37X 3TWYA 3B2DC 3QYNA 3VDAA 1R0AH 3IMTA 1PNDA 1PVHA 3F05A 2MQ0A 1CFMA 1M9SA 3BLKA 1NM4A 2ZJSH 2AEIT 4OIBA 2MOVA 3SBPA 1CYXA 1CDBA 1M2VB 1EWHA 3BPNB 3S3CB 2HA1A 1NEPA 1NCNA 5D5MF 1JV5B 2BP8A 3ZO0A 4OAWA 1ORSB 4GS7C 3F2LA 1BGXL 4XPHH 1U8PA 4JRYE 1EGJL 3OAZK 3VRLF 3C08H 1WZ1L 2PKDA 2HRPL 4OY9A 2BRRH 4AUUA 4F7EA 3UO1L 1ZV9A 2N4IA 2VJXA 1UG9A 1BWWA 5KYXB 1IKNC 4QHUB 5DJ8B 5AB2A 2WSDA 4X5QA 4MJ2A 1QABA 4HPHA 2CO6A 3EDDA 3QRGL 5GISH 4JHZA 4FCHA 5E4EC 3IDNB 2AEQH 3U46B 4UOW1 4NQXA 4FTVE 4U7SA 4JDVB 3LKSA 5C0CB 3WS3A 2ADGA 3WXWH 1VDGA 5FS5A 4XN4A 3ARFC 5AD0B 1RIUL 1D5MB 5EF3A 5J8OA 3MUZ1 3K1DA 3GSOB 3O41B 4HEPA 4Y1AD 2V2XA 1MCWW 3OC5A 1CDIA 4OLXH 1WUNT 2G4EA 5I1IL 2B20A 2KPNA 2FIRT 1YY9D 2FRGP 4TRPL 1AOZA 2Y2YA 2GIYA 3DVGA 1YEKL 3TF4A 3CDZB 3GLAA 1ETZA 3CFUA 3LXUX 3HE7D 5IB4A 1PDKA 3WEOA 1QSEE 4YDKL 3S35X 3FUDA 4UOZA 3BIKA 3CC1A 5FB8B 5BUPA 2WQAA 3BQUB 2FE0A 1BF8A 2XJKA 4U0QB 2PYFA 1FFTB 4QYOA 4GP8B 4ZFGH 4KRPB 5F3HB 5FWQA 4JUSA 3AREC 2UUDK 2B1AH 3MMEB 4LPXA 4UTAH 4FA6A 3F7RA 2NY4C 2IH9A 3EOBB 1RVFH 1SN0A 3J27A 3IWVA 1S7VA 2BVUA 5KSUB 3LH8A 2H45A 1IC4L 2EXTA 4LL4A 3SSGA 5CBAA 3P0VH 2FATL 3F5WB 2DYPD 2VUYA 4W9JC 2V3DA 2PNDA 3G9VA 5GIRA 4Z7NF 3A6BL 3EOAA 3WNJA 2MHAA 4XBMA 1BAFL 4N0UA 2BIQA 4O5LH 3ARYA 3IMVA 4Z76B 3OJDA 1BF2A 2CIIB 5ICXB 3D69B 1DQDH 3FH8A 3JUZA 2EZ0C 3K3QA 1UWEL 5I16B 5EWIH 3D30A 1VGEH 5E0QA 2BHZA 4K15A 2AK1L 3CMOH 1AY1H 1G1KA 1YDPB 4QT5A 4Q14A 4KKZA 2OK0L 1Q0XH 1BQKA 4X4XA 1R17A 3RIKA 5IR1A 4N25A 4F1ZA 2XQYG 3TPUA 1ASPA 1J1XL 2JKNA 1DSYA 5A2BA 1CLZL 4YHKH 2EVHA 1ACCA 2E27H 5KN5A 1CU4L 1U8HA 4R4FH 1FL5A 4OGYH 43C9B 3SE4A 5F8QC 5EZJA 4J2XA 5FYJL 2AQSA 3S36X 5I1AA 2OX5B 3GBMH 4PG9B 1EJFA 1TMCB 5JTWA 5G2NA 3RIAK 3BPCA 4JFPB 4Q9BA 3K6OA 1X6NA 3QRLA 3F64A 4URKA 3JBG7 2EECA 2A99A 1IJNA 2PXYA 2ZCKL 4U6XA 5IW1B 4Q8BA 1FHGA 1TZAA 1IC5L 1JERA 3GSVB 1OWRM 2KKQA 4UQ3B 2CRIA 1RUQL 3T4YB 3GSUA 2DYPB 3RJOA 5KS9B 3FT2A 5T1MB 3FT4B 1TDQA 4KRPC 1AC0A 5E6YA 3T77B 4OZFB 3LKPA 3V4UH 1QI4A 4I5BB 4OF3A 2J4WH 2ARJA 4XC3L 4FGMA 4XNYL 4ADJA 2YK1H 4BSWA 1I9JL 4G8AC 5CD5C 5F1OB 2KLTA 4OT1L 1JZGA 1TQCB 2AJXL 1BXAA 1VGEL 2OJZL 2ZAHA 1E9OB 5CIPB 5DJAA 5TPWL 2X4PB 3QK0A 4UV7H 4ELKB 2HFTA 5A2IH 2CKBL 4TQPA 5E4AA 4GG6E 1EVTC 1LDSA 4M5SA 2OK0H 5IFAL 2OMXA 5I9QC 4OLYL 2H26A 3GNMH 5ADOH 4XO8A 3HMXA 1MCLA 3DIFA 3T0EC 2CKNA 1IE4A 2FZ3B 2JJVA 4NKDB 5D7JC 4LHUA 2CK0L 4ODWB 5ABZA 1G7LA 2I7OA 1H3VA 4EKXA 5EF1A 3QP3A 4WO4B 1IGYB 4UM9A 5I0XA 2J20A 4Z18A 5CLWA 2I07A 2OL3H 2Q3XA 2BSDA 1ZHKB 3MLPA 3IFNH 4TLKA 3FRUA 1P4IH 3AXIA 1PZ2A 2ED8A 4LGRB 5IY5B 5F7FA 1UD5A 4FQ2L 1I9RH 3IMUA 2YMTA 4YXKH 2LU3A 1JWUA 4CVZA 3LIZL 2Y6SC 4ILDA 1EJ8A 2NQDA 3Q48A 2C3GA 4LB8A 4FJZA 5DMIL 1QSEA 3IMBA 1IBDA 4LDLB 5E7FA 5AZ2H 3VI3F 3BMVA 3KWWB 1CGVA 3VMPA 4R2GD 5D1ZB 3UCQA 3RFZC 5BOZG 4GKLA 4QRFA 3ULUL 2CM6A 1PCSA 2WVUA 4IW4C 4WTXA 5DEFA 3FUMA 3SGJA 1FH5H 4AIZB 4Q9QH 2A9MH 5DJ2B 3ZDXF 3CMGA 4PB9H 4KKBC 3E8UH 2F7PA 5CINL 1VPOH 1T20A 3KAAA 3EGSB 4DN4H 4I87A 2X38A 1FFOB 4UTBH 3VI4A 3ZHDA 1MAJA 5E2JA 3D2UB 5C3TA 3NDYE 1Y1DA 1IAMA 2PWGA 4G9DB 3IXAB 4ES9A 2FATH 1YY8B 1PF3A 4ONOA 5C0BA 1CO1A 3GNML 5DMGC 3SY0B 1FZMA 5E5LA 2DI9A 2WYIA 3IKKA 2QPEB 1Q9LB 5D2LE 2VH5L 3RB5A 4WFFD 2W8CA 2OJEA 2WY3B 3ES6A 4ZS7L 3OAUH 3DUUB 4UI2A 2YBRA 3SDCA 2ZYHA 5EO9A 1KOAA 5HD8C 2CJTA 1N12A 1S5HA 3EKCA 3QE5A 3L9EA 4R97B 3HE6D 4P05A 4J3OD 4NZJA 4PB0L 4DPRA 1JPEA 1XF1A 1U92A 1DCEA 2IVFC 5JQ6L 3VFOA 2NY3D 4A6YB 4JN2A 5B22A 3G6JF 5KANG 2EO7A 2CWRA 1LYQA 2O6CA 2F18A 4K5NA 3L54A 2DBJA 1FZKA 1U8QA 3GBML 3NJNA 5EUKB 5DYOB 3RQ3A 4NQDE 4YDZA 5F9JB 5I24A 2NZ9D 1B9ZA 3OX8B 1N3NB 1QLEH 5L9DH 3GMPA 2XG4A 3HI6L 4NJAL 2PWDA 5J6SA 2OMWA 1R3IL 1QRND 2QPFA 5CEZD 1NBQA 2EH7H 4J3OH 1BQSA 4L05A 3VWKC 4F2FA 2FWOA 4AYBA 1FYHB 3B7UX 3DDGA 1U8JA 4CL7A 3BN9D 3QCUH 4TVSa 3RY5A 3JSSA 1NEZG 3R0NA 3O3EA 2ENQA 2YGQA 1UACL 2AJUH 4NCC2 4EIUA 1OB0A 2R4SL 2YIHA 3U1QA 3V5HA 1HH9A 4M6ML 1P4LA 2ORBH 5MERA 1M7DB 2ZOOA 3WUZA 4ZMZA 3QA3B 5HHMB 3PUCA 3KGRA 2CKBB 3CVDA 3NGBC 4M5YL 4IRSD 4LBAA 3L4ZA 4Y5VA 3U6XA 3WNLA 1SFDA 4C4BA 4GRLC 1J86A 5AOIA 2VJ8A 3EYFA 4JHWH 5B1JA 1JWMA 3ATDA 1SJVA 4NQCA 4GG6A 2GJJA 3QG7H 3JWOC 1QO3B 1KXHA 3OLGA 5DZPA 5JQ6H 3JV5A 4HK0A 4PCYA 4XBGA 3ZE1F 2FEEI 2NTFA 1MXGA 4NQCE 3QORC 2KZ1B 1O5PA 4KGLA 4YSSA 1ZVSA 3APFA 4JANB 1B4LA 3T3PE 4ANXA 5JHAA 2AQ1A 1X9LA 1BDYA 3G6JA 4UMSA 3VXNA 4Z78A 1E4XH 5C08A 1JYWA 4HXBL 3SDDC 5FDYA 2FL5B 3MGTB 2WNWA 2F1AA 5DRXA 4H8UA 1CXLA 2G0KA 3HMXL 3B83A 4KUZH 2Z3FA 3IFNL 4JFOA 2K1MA 1HQRB 3PAZA 2GCYA 2IG2L 4XCNB 5DD5L 1ZLWK 1FO0A 3SDXA 1SJHA 2SEBB 3MVSA 4JANA 4NM8H 4ETQA 4KVNH 3ELAT 4C55A 2VXVH 1C1EL 1BFTA 1ZOXA 3EG9A 1J48A 4PJCB 2VSMB 3SJVE 2CO7B 3UTZB 4FKEA 2DEYX 5BJTA 3QWOB 1A66A 2P1YA 1PQZB 3VFWA 4PWKA 3O6FB 4Q9QL 4A2LA 1MI5D 4PN6A 4RGNC 1TKWB 2VE6B 3SJVB 1ZWIB 2G30A 3W56A 3MBEC 2AABH 3QEQD 1HH6B 5CGTA 2PP7A 2EE0A 5L2JA 4J6IA 2QR0A 3VM5A 1T7XA 1IUZA 2PCPA 2B59A 5HI5D 4UUJA 2CHNA 1U3HC 3TT3L 3RVXC 4JE4B 2VLRA 5DVMA 3UPCA 5C0JB 3MLXH 4JPQA 5IMMB 1BVKA 2I26N 4O02A 3KVPA 4UINL 5CU5A 1T2QL 5ESVA 1FNFA 4ZMQA 3MCLL 4DGYH 5B8CA 2FD6H 3BAEL 4L4TB 1DJZA 3CHPA 3IJ9A 3QJRB 1ID2A 4AMXA 1M6OB 2YMXL 2WVTA