1H9VA

Human fc-gamma-receptor iia (fcgriia), monoclinic
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
172
structure length
172
Chain Sequence
b'APPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSRLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LOW AFFINITY IMMUNOGLOBULIN GAMMA FC RECEPTOR II-A
publication title Molecular Basis for Immune Complex Recognition: A Comparison of Fc-Receptor Structures
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system, membrane protein
total genus 28
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2001-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13895 Ig_2 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1h9vA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1h9vA02
2PTTB 3DV6A 1CGUA 4ODHH 4Z7QF 2X10A 4FQ2L 5JNYA 1YNKL 5DD6B 3BN9D 1CQYA 1D6EB 2CGRH 1I9EA 3DLQR 2CH8A 1ZSDB 4KDWA 1H5BC 3BZ4A 4NQEB 3VI3E 4H25B 5F3BA 1LEIB 1C12B 3RWJA 4XGZA 1YUHA 4PGDB 4WW2B 3FFCE 5CZKA 4XNZB 3T0XA 3B4NA 1E0OB 4M43L 5EBGA 1PSKL 4HKJA 3P4OA 1G9MH 1TVBA 2E27H 4DEPB 4OZHF 5C0FA 3R8BB 3VFMA 5ANMA 4YXLH 2HVKB 1N59B 4WHYH 1FVCB 3SKJH 1AGCA 5T1LB 5C9KA 1G6RA 1UKQA 3EYSH 2YPLB 2M2DA 2WMPA 1T89A 2A0LC 1U3HA 3S3JA 1J7VR 1MRCL 3DO7B 1YN6A 5IFJB 1CBVL 4W4NA 5C0IA 4LVNB 1Q9KB 4HIHB 3SJVD 2Z35A 43CAA 5IW1A 5A2JH 5IHUH 1CN4A 3HC0B 4Q6IB 4FXKA 4P46A 3SDCB 3RTQC 1IKNA 1G1YA 2YKLL 2FEEL 4HIJA 3UTSE 1DBJL 1NC4B 3BHBA 4PJCF 1NFDB 1MCHA 3SO5A 4O4YH 1YEHH 1I7UA 4HZLB 5CJBA 32C2A 1RFDL 1ZLVH 3GIZH 4NYLA 1DEEB 3WKMH 2ATPA 1QRND 3QT2A 3NFSL 5F7EH 3CFCH 1RZKC 1JGVH 2IADA 3L3KB 3IT8D 2VSDA 2X4OA 3U30B 1WV7T 3D5OF 3N1MC 4ZFFB 3KPPB 4N9OB 2FBJH 2P1YA 2XZAL 4OBSA 3L1OL 3CDGA 3ZDYE 1M7IB 3H3BC 4XBGB 4XPHH 3ARFC 4NO0A 1SJXA 3VGEA 5ELIA 4W68A 5D1QC 4K3JH 2EO1A 4M61A 3TBYB 2JB6A 1N4XL 1J86A 2DKSA 3EDJA 3TFKD 4JM2A 2VB5A 1EDQA 1AD0A 4G5ZL 5H94B 5K59E 5T1KA 4R90H 2IGFH 4N1CA 4R3SA 5TF1H 1MREH 1IGIH 2M26A 4OT1H 1WFOA 1QBMH 2BSSA 5JTWA 2ICWB 3DUSB 4K55A 3CCHA 1F02I 3DVGA 1N6UA 3QISA 2Z91A 3MNZB 5HGHB 4YHOH 3GMLB 4OUOA 1NGXB 2G60L 1KV3A 5SX5K 3FT4B 3CPLA 3SJVB 3ZKSD 4LK4A 1HK6A 4JY6A 5AUMB 3AS0A 2NZ9D 5GGTH 3DYPA 2P8LA 4S1QH 4X6CE 5EA0L 1QFWL 2FJGB 1HQRA 5DMKA 5A2FA 2ADFH 2CLVB 3VRLF 1XF3A 3FO9B 1V7MH 3AREC 2HFFA 3IJSA 2R69H 5ADPH 2FLBT 1D5MA 3TIDA 1IEHA 3EOAA 3J7HA 3L5WB 3VW3H 4PJIF 3OAZH 2P45B 4AENA 1P7QA 4QHNB 4WUUE 5IMMA 2HLFC 4U1GB 1R0AL 3G6JF 3TO4A 4E9LA 1B6UA 4JRXB 1HI6A 3SE4C 5IW6B 2R1XB 5C09D 3GMRA 5DK0B 4EN3D 4N1HB 3ZHLA 2F53D 1ZT7B 5FHBL 1YNTA 4PJHB 4XMLL 3WCYA 4LBEB 3VD3A 2CKBA 1MFAH 3KPSB 1I7ZB 1RJZA 3HAEA 2Q6WB 3B5HA 4B53A 5T1MB 4TTDD 25C8L 3JBG7 2IQ9L 3GB7A 2WV3A 4GS7B 4YWGH 3MJ8B 3JTTA 2F5BL 5DMGD 4A2LA 3HE6C 1HHJB 4MA8H 4KKLD 1F6LL 5HVFB 4OFYA 1KEGH 1T1ZA 5FO8B 4YO0A 4P57A 4KTYA 1RVFH 1QBLL 1PAMA 2DQTH 2IAMA 4UUJA 3S36H 3I84A 5FO9B 3QO1A 3OKDA 3OG4B 1BX2A 3HC3H 1A7BA 5E8OA 3WDJA 3OAYK 1GGTA 4NQCB 3VU2A 5KSAB 4KZEL 3MRCA 5IOPA 2MKWA 1UWGL 1MVUA 3L3OB 3ULUF 1RK1A 4WTXA 1OSZA 1PG7X 5LCVH 1VFAA 1OAUL 3I6GA 2OBGA 1N64L 4U31A 5SWQB 2FL5B 4AIZA 1GVIA 3EYOA 3ZE1E 1K9TA 4GUPA 3ULUH 2PYFA 4J4PA 3U1SH 2VN7A 1HYSD 1DLFL 5D7IA 3T3MF 1N2RB 4XVUD 5JW3H 4JZOB 5EZJB 3HI5H 4H8WC 1UACL 3WE6A 5JPMB 5L6YL 1U8KB 2PTTA 3MLTB 5CP3H 5I1KL 4V1DE 4N8CH 4EI5D 5ISZB 4R96B 5DD6A 3C2AL 1D6EA 3BKJL 3VE0B 5LXGH 1ZSDA 1XH3B 4NQEA 4H25A 3ALXA 4MNGE 1CXEA 5C09B 1ETZA 2VLJD 4YLQT 2DQGH 4PGDA 4WUUB 4X4ZA 4WW2A 3BKML 2OTUB 4PRHD 4P5KB 1P4IL 2R4SH 5JLZB 7FABH 1NCAL 2ITDB 3BE1L 2HVKA 2NXYC 1U2HA 2YUWA 1IGFL 4WWKB 4U6HB 2PXYB 1FVCA 5D8JH 4P2OB 3KLHD 2XG5A 2XZQH 1U8JB 5T1LA 1IGTB 1J1PL 5ID0B 1E4KC 2YPLA 4PJ5E 3PWUB 5IBLD 2GTWB 4ENEC 4LCIL 4PJ8A 5DD3H 3FT2A 3DO7A 3PL6C 4PJDB 3LRGA 1I1FB 1S78D 2BFVL 3GRWL 3LQAC 2VMFA 4NKOB 3LHPH 5IFJA 3O6FB 4F33B 4OGYL 2AJVH 1BQHG 4HIHA 2DJSA 4C56D 4NDMB 2EC8A 1OL0A 3HC0A 4Q6IA 4NFCA 4N0RA 1WWBX 1G7MB 1T03L 3QPQC 3LSOA 3SDCA 1GPOL 4L3CB 1YECL 1KN2H 4LASL 4DUVA 1X5YA 1UVQB 1NC4A 4KKNA 2N4IA 4P59L 5ACMA 3NIDE 1EAJA 1OAYL 1NFDA 2PYEB 3GJFB 5EBLB 4PRIB 4HZLA 5E9DE 4YDIH 1A6WH 1AXTL 3LKSB 1DEEA 3P4LA 4JPKH 1LEKB 2F5AL 4LLAA 3NACL 3SQOL 3VDBA 4WO4D 2X1WL 1JPSL 4U1SB 4OF8A 1QNZL 4OQTA 3QUYB 4DKEH 2ZCHL 3RKDD 4XP6L 3L3KA 3SGKA 4ZFFA 3KPPA 4HUWA 4R97B 4YHML 1S9YB 2DQIH 4OZGF 4PJ7E 1QACA 3UXFA 1M7IA 2GITB 2I07B 4XBGA 5AAMA 4OAWB 2QBWA 1YY8B 2NY6C 2J7LA 2I5YH 4XHJC 4M6NH 3TBYA 1A7RH 2HMIC 4P2CG 4PRHB 5I0ZA 3LEYH 5H94A 2RQ8A 2Y72A 3JWDH 3LV3B 4DUWA 3HPJB 3HNVH 3I50H 1AFVL 4XRCB 3R0MA 2ICWA 3DUSA 3UTOA 5EWIL 1IBGH 3EYQD 3KYAA 2J8OA 2PKDA 4KGLA 1A4JB 4ODXB 3KYNB 4XMKH 5HHVH 3MNZA 1P6AB 4ZYKB 3CSGA 2VZVA 2NW2A 4YFLI 3K81A 5HGHA 3GMLA 3TN0C 1NGXA 4Y4HB 4B50A 1OVZA 2J8UE 3F58L 3FT4A 5T5NF 2ZUXA 4KAQL 5AUMA 2DQDL 3IF1B 2DQCH 3RNQA 3QUZD 2DICA 3WIFA 1L7TH 5IR1B 3X12B 2FJGA 4G80B 1TZGH 4DOHB 2CLVA 3WLBB 1KCSL 4ZQKB 4JFXB 1PLGH 3FO9A 1AHWC 4KI5C 4MCZB 4QHUB 2WBJC 4YNYA 2OJEB 35C8H 3N50A 1FORL 2CIIA 3GHBH 4KPHH 4Y5YB 1BEYH 3FQNB 3VRIB 3L5WA 2EDFA 4KHXL 3ZE2E 5ITFB 2YC1A 3PWPD 1QR4A 3MUJA 4QHNA 2Y23A 1JWSB 1D9KD 2NQCA 3MLWL 3RNKA 5HDBE 1GGBL 4JRXA 4Y2DD 3S35L 5IW6A 3OSKA 2HKFL 2G5BB 5HHOD 1LMKA 2R1XA 1KB9J 4TVPE 2VISB 5J13B 4JFFE 2ZKHL 4PRAB 1ZT7A 4PJHA 3QIUC 3KLDA 3KPSA 3QDHA 4G3YH 3LKPB 2NR6C 4UI2A 1UXSB 1YZZA 2YS4A 5HHPB 5T1MA 1XCTA 4NRZA 1ZV5A 3QIBB 3MJ8A 1HHJA 8FABB 3ARRA 2XWTB 4MJID 5GS2D 1F3JB 2IFGA 4HFWB 1NAMH 5AWNH 4APQC 3K8MA 2R0ZL 4PD4J 1A1OB 5FO9A 2Z93A 2GSIB 4LRIA 4MNQB 4QRSB 1JE6A 1OTUD 3NCMA 5LQBH 1CR9H 4NQCA 5KSAA 4Y5XC 2ZUSA 4OTXL 3BYYA 5KS9E 5C86A 3L3OA 4OF0A 5TE6L 3D18B 4M8VA 5DRZB 5HGAB 1IAIM 3ES6A 3K2MC 5EUOE 3MLYL 3FB7B 4GW4B 5JQHC 2GJ6D 1J8HE 2V7HA 2FL5A 2J4WL 1A0QL 1Q72L 3S88H 3GKWH 3I6LE 2QSCL 1IQDB 4UU9B 3RGVD 4HD9A 1ADQL 1W0VB 3SKUD 4XBEH 1L6XA 1WIOA 1N2RA 1S7RA 1IGML 5HSFA 4JZOA 4WFFE 5JPMA 1U8KA 3MLTA 2AABL 3O3DB 5ISZA 2B1HH 3PV7A 4ELKB 1MFDH 1T7VA 1NDMB 3OAUL 4TSCH 1DR9A 3VE0A 4Y2DB 1F6AB 4RNRB 1JYVA 1XH3A 3CDYA 1OPGL 5IEHB 5BV7H 5C09A 4R26L 3RDTB 4WUUA 3UPAA 2P5EE 3VD7A 3WUZA 4P5KA 1RZKH 5JLZA 5IMOB 2ITDA 5CAYB 5C6WH 2JJWA 1KUMA 4NM8L 4EOWL 4WWKA 4U6HA 2PXYA 1T7ZA 4P2OA 3DXAD 5GS1C 1U8JA 1IGTA 5ID0A 4K2UH 1CXKA 1DBAH 4MJIB 2HT2C 3UDWA 1HH6B 4CVUA 3WFCL 1U91B 3FL7A 3PWUA 2GTWA 4PJDA 1I1FA 3H2WA 3CNKA 4ONHB 4NKOA 3MRRA 1KB5L 1INDL 1QA9B 3O6FA 4F33A 4ZFGH 3FN9A 1Y0LB 5I6XB 4Q74A 2EH8L 4YXKH 4EXKA 1NCCL 2GHWB 3NN8B 3BDYL 1OGAE 1N7ML 3AM8A 5F71A 1KCLA 1ULVA 4UT9H 4JO2L 4L3CA 3TCLB 1F8TH 4KDVA 1JK8B 1UVQA 2GJ6B 4NJ9L 4GG6F 2PYEA 1KTKE 2IFFL 5EBLA 3LS4L 4U7SA 4PRIA 2YBRB 1B0GB 2Q7NA 5D71L 2C4FT 2FB4H 2CKNA 1FVDB 1LEKA 1RZ8B 5IMLB 1UCTA 1AI1H 5FF6B 4U1SA 2F19H 1AGDA 3MA7B 4WJ5B 3QUYA 3CX2A 3LEVL 4FP8H 1FZMB 3WFDL 1RMFH 5IB1B 4X80H 4FFYL 3T0EB 1S9YA 1XZ0B 1LQSR 1V3LA 2GITA 2I07A 4OAWA 3SKNB 1YY8A 3WKNA 1I8IB 2AXHA 2MQCA 4V1DA 3INUH 1CDBA 1XT5A 3MLUL 1V7NH 5CIPB 2ZJSL 4JR9L 4FABH 1T7WA 2OS7A 3DMMD 4I2XE 1Q1JL 2JCCB 3LV3A 3HPJA 3VMNA 2VIRB 1SEBB 4M6ML 1JPGB 4OCXH 5I1CH 3QB7C 5J1AB 5JOPE 3DXAB 4XTRC 4XRCA 4XCFL 3QCUL 2OMBA 3BUYB 4XAKD 4LSRH 5EPMB 1A4JA 4ODXA 3KYNA 4HJ0C 5L88H 3FN0H 5CEXB 1SBBA 3MRKB 1QSFB 4Y4HA 4GXVH 2Y6SC 3QPXL 3CSPA 2DIJA 4ZPTB 1JPST 4PJXF 2J88H 3IF1A 3BQUC 4R0LB 3TJEH 1KB5B 2W9DL 2XTJE 5E5MB 1H3PL 3MODL 4TYUA 1ZGLM 1VEMA 4BUHA 3X12A 5IR1A 4G80A 3MRFB 3P4MA 3WLBA 4ZQKA 5EBWA 1XMWA 4JFXA 5EU6E 4BZ1L 1JZ8A 4MCZA 4QHUA 4JQIH 4XNYH 1EHXA 4JVPA 4NZTH 4Y5YA 3FQNA 4XPBL 5ITFA 3O6MH 4HC1H 5DEZA 3VG0L 1C1EH 1CGYA 3OKOB 3BZEB 1IILE 2B5IB 4LEOA 1H8NA 3PGDB 4JFOB 3B2UD 4XX1G 5E9DA 1N5YL 1KLUB 4JE4B 2BNRD 2DRUA 1IAIL 1OAQL 5I2IB 3MCLL 3NCJH 4F9LA 4POUB 1CLOL 5IKCB 1OWWA 4JKWA 2Z92B 3UBXB 3TJHC 5JIKA 2FO1A 3ARBD 2VLRD 4HMDA 4PRAA 1Q94B 4L9LC 3VJ6A 5F8QC 3MNVA 1F6FB 4UT7H 3LKPA 1BGXH 1NLBH 2YPKB 1GRWA 1UXSA 2P24B 3TM6A 4AYFA 5HHPA 3O0RH 2FEEI 3GI8L 4PJ7A 4LRNL 4WCYL 3EO0B 1T0MB 1U8LB 1P9MA 3FO0H 3CK0L 3QIBA 5F7DA 4GAYB 4GQPH 2C3VB 2VR4A 4NP4H 4QOKE 8FABA 1EX0A 2XWTA 4H26B 3IKKA 1F3JA 4WDIB 5EC2B 3QCTH 4ZDHB 3MBEB 4HFWA 4E41D 4FQLL 2DB8A 3MLVH 1A1OA 4MNQA 4QRSA 5KVEL 3FQUB 3B9AA 1NC2B 2VZ3A 1ZHKB 2VR9A 3K2UL 1DL7L 3HMWL 3T2OA 4YHPB 5DRZA 4O02H 3HNSH 1A1NB 1CIDA 1CZ8L 4EQ2A 3FB7A 1KJ3H 4GW4A 5GXBB 3NGBC 1OGTA 3FO1B 4K8RC 1FJ1B 1JYXA 1JNHB 5FDWB 4GBXD 2MPAL 4Y4FC 1GOFA 3SKJL 4HWZB 1IQDA 4UU9A 1U8MA 1VPOL 4G6FD 5D2NB 1W0VA 2YA0A 3NA9L 4OLVH 4ZO8A 2XQBL 2HJKA 5E2TH 1OAKH 2QHRL 3IFPA 2YD6A 5I8OL 4ZAKD 4NNXB 4NC1E 4ELKA 2RCSL 4YEFA 1RUPH 4HFUH 1NDMA 4KMTH 2YWYA 1F6AA 4RNRA 2GY5A 2KKQA 3IU4L 1AXIB 4JHBA 1I9RH 4F9PC 5IEHA 3QG6B 2QQNH 3WYRA 2BCKA 2AK1L 2BJMH 3RDTA 3QXVA 2JJTC 1DQDL 1GGUA 2KUTA 5IFAH 4C57C 4ZUTB 1ZA6B 4G6JH 2YUZA 5IMOA 1EEQA 2X4NB 3ARTA 2O5XH 4F57L 4JO3H 1X5GA 2DLGA 4RA3A 3DRQB 3GIZL 1QFWI 3WKML 4X9IA 1MFEH 3SGEH 5I0DA 2XKNB 2YD4A 4J6RH 3LZFH 2FX7H 3TLRA 4MXWH 1HH6A 3T0AA 4KVCL 1U91A 4D3CH 3ZHKA 4X6DB 1JGVL 3TYFA 1SBSL 1BPVA 2UY6A 1U3YA 3RBSA 4M6OH 5CILL 4E41B 2OR9L 4ONHA 4Z7WE 1QA9A 1BJMA 2AJSL 2V5YA 5BOPA 2VR5A 2HWZH 3U0PB 1HIMH 3NN8A 3T2NL 3QDMD 4OLYL 2X9YA 1MIEH 5T33H 5DD1L 3TEUA 1YJDH 4LEXL 3FQRB 5HYQA 3TCLA 4YHIB 3E1F1 1JK8A 2ADIB 3EFFA 3DI3B 4M7JH 1KACB 2PO6D 2GJ6A 1F90L 3O2WH 3LH2H 1M05B 4HJGA 3RWCB 5TF1L 3O8XD 5KS9A 5KVDH 1IGIL 4TNVF 1QBML 1B0GA 5D96C 1IQWL 1QSEE 4CAGA 3IDMB 4KI5F 3UJIL 5EUOA 1FVDA 1J8HA 1RZ8A 5C0CE 5IMLA 2HLAA 3B3IB 4XVSL 1CK0H 3E8UH 1LO4H 5DO2D 3MA7A 3OMZA 4WJ5A 4BFEA 5JZ7D 1I3VA 5IVXF 1FZMA 5GGVL 3KPRB 4OF6A 4YHOL 2DMCA 1MNUL 5IB1A 4UMGA 5I71B 2ICEB 4D8PB 3T0EA 1MCOH 2Z0BA 3H42L 1JRHH 3VXQB 3CZFB 2EC9T 1RZ7H 4K7PL 1HXMB 5K9KB 3SKNA 1I8IA 1P7KA 2BVPB 4Z7VE 2VDRL 3ARDB 2C3HA 3MLZL 3PP3K 4DK3A 1DN2A 4RRPG 2DAVA 4GRMA 1F58H 4CDGC 5CIPA 1JPFB 2XNAB 3STBA 1DZBA 4KHTL 5E6ZA 3RKPA 3NFNB 2JCCA 1LHZA 1RUQL 3U4EB 2VIRA 3C09B 4FQPA 4DJMA 5HPMB 5A2LH 1JPGA 3MFGB 5J1AA 4HT1L 3VW3L 5D7JC 4RDQG 1F4XL 2A6JB 1Z5LB 2Z31D 4L3EB 5HYJE 4BSVA 3Q5TA 5JHDE 1QRKA 4YE4H 4S1RL 5CEXA 2YMXH 3MRKA 1QSFA 3HFML 2JB5L 3PHSA 4GFTB 4OZIB 2W65B 4ZPTA 3QDMB 3DX9A 1INEH 4KROB 5I9QB 1L7IL 5TQ0L 4BA8A 4M1CC 2P47B 4HIXH 4R0LA 2ATKB 5B4MD 4QHMB 3PXHA 1QYGL 3DHMA 5E5MA 1AP2A 4XI5D 4UIKL 2PO6B 3MRFA 5IEKB 3UMTA 1XIWC 2OP4H 3NABH 2HKHH 3ZKNC 4HF5L 4J23A 1DLHB 5TJWK 2E8ZA 3MV8D 4WEUD 2DQTL 4UNVA 2V2TB 3OKOA 4IRSD 4P99A 1N3NB 3S36L 3QNXB 3MRBB 4IOSD 3VFOB 3DGCR 3PGDA 4JFOA 4ORGB 2P5WD 3FQTB 2FZ3B 2AVGA 5I2IA 4PV8A 5DJXB 3GSWB 1A14H 5GISH 5D6DA 2D0FA 2Q7YA 3UBXA 2Z92A 2Y1VA 3LN5B 4AG4H 4D9LH 4QHLB 1Q94A 5FK9B 4G7VH 3T1FB 2BX5A 3GMMB 4GMSH 4KMLB 4Z9KB 2YPKA 4OGAD 2P24A 3Q6FB 1ZGLB 1OARH 1MCJA 3H3KA 3VRJB 3BW9B 3H9ZA 4ZOBA 3EO0A 1U8LA 2NXZC 3ULUL 1CCZA 4GAYA 3T65B 2C3VA 3PF2A 4D0CB 3L5XH 3CUPB 2EDKA 3TBSB 4Q9RH 5EC2A 5DR5L 4ZDHA 2WIIB 5AG8A 3MBEA 5AD0B 3RVTC 4NQDD 3ULUD 3OZ9L 4HS8L 4N8CL 4XP5H 5IHBA 4I2XA 2OXHA 3NCCB 2AK4D 2X2YA 5LXGL 4FTVD 4PY7B 4NRXA 4N90E 3QCVH 1NC2A 4FQ1L 5E2UH 3MNWB 4P23C 1DSFH 2DQGL 3I6KA 1ZHKA 4V2BA 3P0GB 5HYJB 4PP1C 2VXUL 3G08B 4TSAH 4YHPA 4QTIH 2I9TB 5E03A 4BUGA 1A1NA 4NBXB 2ZNXA 1UH4A 4TULH 3FO1A 4Y1AB 1FJ1A 1NDGB 5I1GL 1JNHA 4IRJC 5K93A 5FDWA 1BWWA 1JTOA 5I8EB 5J12B 2ZSVB 4PJAE 4HWZA 1A8JH 3CAFA 5D2NA 4R2GC 1HKFA 3NA4A 2VL5B 1L0YA 2EKJA 2JJVA 3WIHH 3V7AE 4YDKL 1KXTB 2C3GA 4HBCH 4NNXA 5EU6A 5HHNB 2D7NA 1JCKA 1I3GL 3SHSA 4LCCC 4GKZB 1FGNH 1QFUH 2CRIA 3QG6A 5MHSD 4LDOB 1KN2L 4DTGH 1A2YA 4U1MB 4ETQA 4XC3H 4QLRA 2WNGA 4JCLA 4MVBD 3OR6B 1KIQB 4ZUTA 4KVNL 5F3HB 3IRZA 4Z7OF 3QUMH 1YYMH 4JZJC 4OIAA 4RGNC 2X4NA 2PTVA 4YX2L 1UH2A 4EIGB 2X6MA 4YDIL 2DD8L 3JZ7A 1A6WL 4HZAA 1ZK9A 3VXRB 5DTFB 1KIPB 2D7QA 4TPRL 3DUUB 2MQ0A 1FBIL 2XKNA 4XP9L 4K9EL 3REVB 3RUGB 4UDTB 1HNFA 4X6DA 4GAGL 5DSCB 2MTPA 4M7LH 2NZIA 4CN4A 1FNSH 3SGJC 4HGWA 2X1OA 2DQEL 5MEOA 2IMMA 1YEKL 1JGEA 3TA3D 4O2FB 2SEBB 5I8CB 4WENB 3HAEG 2BXZA 3FQRA 3FB8A 1AO7B 4M6NL 1RIUL 1QRNE 1WITA 3BN3B 1UKSA 2EEBA 3BSZH 4YHIA 2ADIA 3L3IB 4YBLC 3LEYL 3O4OC 5F9WC 4XPGH 3HE7B 1WZ1H 1M05A 3RWCA 1T89C 4GOSA 3V4VL 5A3ID 5SWSB 1BZ9B 3I50L 1T1WB 1U3HC 2VXQH 5I76B 3IRPX 5K33A 3IDMA 4OLUH 1IBGL 2X1XR 5DD0H 3VXUE 4GRWB 2P8PB 3B3IA 1ZVYA 2R8SH 4FRWA 3KPRA 5IWLC 5D1XD 5DT1H 1MELA 3X11B 4U1NB 4D8PA 5JDJA 1RZJL 3EJJX 1IKNC 2WANA 3KS0J 5CSZB 1DN0B 2JK5B 3VXQA 3CZFA 4LPCA 5CZXD 3RA7H 1HXMA 5K9KA 4ZS7H 2R1WB 3QEQD 1WBXB 3PNWB 1L7TL 2BVPA 3ARDA 5SWZD 1FYTE 2F54D 1JPFA 2MHAA 2DWDB 3QFJD 3VMPA 2XNAA 3GJFK 4ZUWB 5HHMD 4M93B 1ZS8B 4F7TB 4GRLD 4Y19B 1DQQB 1Z0NA 2OZ4H 3GJEA 3U4EA 1QPXA 5HPMA 4KPHL 3O3AB 1BEYL 1CICD 3V9FA 1JFQH 4CU6A 5E1HB 2A6JA 1Z5LA 2G75B 4L3EA 3VCLB 4W6XB 2LU3A 3ZL4H 3ZSSA 1EVTC 3SPVB 3D9AH 3JXAA 2E9BA 4JPWH 5E94B 3OL2A 2X89A 5GSVA 4P5TC 4OZIA 4AL8L 2W65A 5C6TH 3QDMA 3P30L 5KSVB 3ZKQD 4G3YL 1JHLL 4XWOD 5DRXB 4MAYC 3X3GL 5B38B 1A3LH 1A6PA 4FQXB 4KJWD 3KPNA 5FGCE 1BJ1H 2PO6A 4NBZB 4A6YA 4QEGA 4U0RC 1WBZB 2DM2A 1BVZA 4H88H 1KC5L 4KTDH 4RMRA 3ZE0F 3LEXB 3HZMB 2F53E 1DLHA 1JNNL 1NAML 3NVQA 1B90A 2ZUTA 4OM0H 2V2TA 2DM3A 3QNXA 3MRBA 3VFOA 4G8GB 4ORGA 3FQTA 2FZ3A 3V7MA 1D5BB 1PZ5B 5KOVC 1CR9L 4G8IB 3VXUB 3GSWA 3C08L 3U7YH 4FA8A 4HPYH 1X6NA 4XXCA 4YGAB 5T1DH 4X8XA 1IAKB 3LRHA 4PUBL 3EKCA 4QHLA 1ERNA 3S35X 4WU7A 1S9WB 2YXFA 3GNMH 2X4TB 3GMMA 5SWZB 4QRUA 2F54B 3Q6FA 1ZGLA 3MO1B 5IB2B 2VXSL 3VRJA 4M8QB 2A0LD 4NHCL 1RIVH 3VG9B 2LV4A 3T65A 3HCVB 3MRJB 4D0CA 1FYTB 3CUPA 2E5EA 2W9LA 4RCAA 3TBSA 3UTQB 3ORJA 4MYWB 4AM0B 1MCQA 1Q9WB 4OCRL 4TQEL 2NY2C 3IXTB 1SMOA 3S6CA 1UM5H 4U2YA 1SY6H 3RTQD 3WL9B 4NUGL 2DMKA 1I1AB 3MNWA 3ABZA 2EDHA 1AQKH 5HYJA 3WDHA 2V5SA 4OFDA 3DROB 3ROLB 2IPTH 2I9TA 4XP1H 1RZKL 3DVIA 3MZTA 4AEHL 4Y1AA 3RWEB 2D4FA 2L4OA 3K4ZA 5JXAH 3FMGL 2IAMC 3BRDA 4MWFA 3V52L 2VLJE 2IANB 2YK1H 2C3XA 4LVHB 2VL5A 5HGDB 3TBTB 1T5XB 4NKMB 4X4MA 3BP5B 5DWUL 3VD5A 4TUKH 3S34H 1H5BB 4I4WB 3C60D 3I9GL 2ED9A 3FO2B 5HHNA 1EO8L 4YXKL 3ARFD 5D1QD 4M02A 4GKZA 5FYJH 4PLNC 4IIQA 5BRZD 3AS1A 4HS3A 4FNLL 1JUFB 2H41A 1F8TL 4U1MA 2BHUA 2VAAB 1W72L 3B5GA 3OR6A 3QRFM 5F3HA 4J4PC 4DAGH 4LSTL 5CEZL 1BBJB 2GJZB 5FM5M 1XF1A 3W39B 1ROWA 1MJ8H 2Q76B 5DTFA 5FHAH 3VXRA 4IDLA 4C56E 3K46A 1PG7H 2BY3A 4M5YH 3ZLQC 1KIPA 2ZWLT 3ARSA 2V5TA 3DUUA 3ESVF 3REVA 3RUGA 2VZSA 2FWOB 3OB0K 4OKVB 5DSCA 5D93C 4DW2H 4G7YH 5I16B 4FFZH 1OY3B 2HT3C 2XXCB 3PIQB 4HWNA 3RTQB 4GMTH 4XNZC 1IAII 3NOIA 1WCBB 2GSGB 2SEBA 5I8CA 4P48A 2VLKD 4DFHA 2A9MH 3AS3A 2ORBH 1AO7A 1BF8A 3ARED 2VDMH 5JW4R 3L3IA 2F8VA 1JIBA 3HE7A 4PRPD 3EDEA 5GS3A 1KG0B 4RQQB 5FECB 1AY1H 4HWUA 4OCXL 5SWSA 1BZ9A 1T1WA 4PJ8C 5I76A 1K3IA 1C5CL 2HLFD 2R9HC 3NCYP 3EJYC 2VUYA 5BMFH 2UWEF 2P8PA 2IH3A 4NO2B 1XR8B 1NSNL 2V17H 3MJ9H 3FN0L 2WUCL 3C9NA 1WWAX 1QP1A 5CSGA 4Q6IC 2W0LA 4ZNEA 4PJAA 3X11A 1EFXD 4U1NA 4GXVL 3ARFB 1CYGA 5CSZA 5I8KL 3VXSD 3WNOA 1DN0A 2JK5A 4JY4B 5D1QB 1B0RB 3MJGX 2YRLA 3BPLB 6CGTA 1A7PH 5BRZB 4ZTOH 1PQZB 2XQYK 2R1WA 3PNWA 2I24N 5F6HJ 4K23L 5L2KD 4JVUA 3GK8H 5LJYH 1MCIA 2NW3B 2DWDA 5F88B 3QQ4B 4ZUWA 1N0LA 1ZS8A 4I77H 4F7TA 3P77A 4Y19A 1DQQA 2DN7A 4DQOL 4WI6A 1JZ6A 3QDJE 1A22B 3O3AA 1W72B 3WLWC 2AKRB 3SGKC 1LP9B 2WBKA 1MCNA 1MCSA 4C58B 1FO0L 2PW1B 1YEJL 1BIIB 4GAFB 2F9BT 5C08B 3VCLA 3RAJL 1IM3B 3SPVA 3LPGA 3LN4B 3ZDXE 3ZDZF 5E94A 4UT6H 3RIFK 1G7JA 1Q9OB 1ZT4B 3KXFD 5DD5H 4GG6B 3NH7H 2HAZA 4XZUB 3UYRH 5GGVY 2VDQL 4H8WL 2CQVA 5KSVA 2VLKB 1BGXL 5GQBA 5DRXA 4DGIL 5B38A 3PWPE 3AREB 1B88A 3LQZB 5KSBE 2CO7B 1PKOA 4FQXA 3VWKD 4K7PY 4JZNB 1MRDH 1CL7L 5IHZB 4P2QD 1JZ4A 3O3BB 1WBZA 1AGFB 3FCTA 1KCKA 1BOYA 1T3FB 1X9QA 3DTXB 4YPGB 1II4E 3LEXA 3HZMA 1NMCC 5IIEB 4QNPF 2QHLA 2BRRH 1J0YA 2A1WH 5ALCH 3MLVL 4P9MH 1F2QA 4G8GA 1D5BA 1PZ5A 1EFXB 3RGHA 4G8IA 3VXUA 4NHUB 4HLJA 1KF9B 5F6IC 3VXSB 5KZCB 3LKRB 3HTLX 1IAKA 1LK3L 3HNSL 2WAHA 2D7TL 5J11C 1KJ3L 2NXYD 4LAQL 5TE7H 2X4TA 1UWEL 2F54A 3HE6B 3LQAL 5BS0B 5DZOA 4XPTL 1TFHA 5IB2A 4Q97A 1NMBH 2H3NB 4M8QA 1JTTA 2OL3B 4ENED 1CFNB 1MI5D 4OLVL 4AY0A 1BD2D 3HCVA 3PL6D 5IP4A 3MRJA 3Q5YA 1FYTA 1KGCD 4U1GC 4M5ZH 3UTQA 4AM0A 2XZCH 1MCPH 3QI9B 5I1EH 3IXTA 4JKLA 4PJGE 3X13B 2O5YH 4LGPB 2ESVD 4JFDB 3QPQD 4HFUL 2YSSB 5D70L 5FV1L 2IBZY 3QDJB 3WL9A 1A3QA 2EDEA 1E4XL 3V4PH 1FO0B 1I1AA 3KXFB 4X6FB 1SEQH 4WVRA 3IETB 4RBPK 2DQHH 4WUKL 2RJMA 4NQXB 4CJ0A 3DROA 3ROLA 4HHAB 3BRFA 3ARWA 1RUAL 4UILH 1G7IB 4O5LL 4Z8FH 1J5OL 4KK5C 1PD6A 2O5XL 3CXHJ 1P84K 3RWEA 2IPUK 5FYLH 3BUTA 5IV2B 4LAJH 4P2QB 2NCMA 1ZE3C 4MMZC 4TUJB 3U82B 4LCWB 2FX7L 3HZVB 5FGSA 1MWAA 3O4LE 1QPPA 2IANA 4LRIC 2Y36H 5HGDA 3TBTA 1T5XA 3L95B 2Z8RA 4NKMA 3BP5A 4I4WA 5BXFB 4LVOB 2NY6D 3FO2A 1FC1A 1G6RH 3VXPB 3BEWA 2EDRA 3TNMB 1F4WL 1U6AH 4GQ9H 1LWRA 4JHZA 4XNQA 5C0BE 2FBOJ 1WFTA 2P46B 1F3DH 2YZ8A 2NXYB 5ENWB 1L9MA 5F96H 1DDHB 1H3TA 3QDGB 3O11A 4I5BB 2GJZA 2P43B 5C7XH 3NZ8B 3WFHB 3W39A 2EIDA 1A4KB 2Q76A 4R4ND 1AE6L 4JM4H 1CS6A 1BD2B 3IU3B 3PL6B 1CK0L 4XNUL 1LO4L 4HKZA 5DVMA 4O51B 4WFHE 3TN0D 3EFDH 2FWOA 3P9WB 1MUJB 3L5HA 1N5AB 2BVQB 4P49A 4DVRH 2A9NL 3GM0A 2Y07H 3L6FB 2EE9A 5F1IB 3ILPB 3PIQA 3W0WD 4YFLF 1ZMYA 2CDFB 4WGWB 3C5ZB 1XGTB 2X7LB 1WCBA 1YEFL 2FCBA 2GSGA 3BZDA 5J8OA 1DQLL 4JM2F 2YPVL 1F58L 4KI5D 3A67H 4WWKC 1H8OA 2WBJD 2PXYC 3MUGB 4P2OC 5ITBL 2XFXB 5ICYB 1KG0A 4RQQA 2DBLH 4NNPL 3UDWC 5FECA 3K4AA 5F9OH 1X5ZA 2D7PA 5IJKA 5FUZL 3HUJE 3ULVC 1NUDA 1DVFB 3MREB 1UCBH 4LIQE 2HFGH 3JWNC 4NO2A 3QBTB 1C5BL 2W60B 5I75B 1IARB 5EU5B 3CFEB 4YE4L 1OP5H 3FB5B 2BNUB 3AM8C 3VI4F 3H9SD 2D2OA 2DQJL 4MCYB 1ACZA 3ZSTA 1MFCL 1JGLH 1NMAH 1WGOA 1G9NH 5GJTH 4GT7A 3ARFA 3QIUD 1LD9A 1YPZF 4MB4A 5D1QA 4JY4A 1B0RA 1CLCA 2NR6D 3ZTJG 4L4JA 5BRZA 1CDIA 4L29B 4IS6A 1PQZA 3CVIH 2EZ0C 2EYTB 4QRTA 1C7TA 3KYKL 4FQCH 3LKQB 3UC0H 5JOFA 1VGEH 3P11H 3SE3C 4K7PX 4U33A 1WZMA 2NW3A 4J8RB 5FXCH 5KTEL 1EERB 5C0BB 5IM7B 2CUIA 3QUYC 4APQD 1IC7H 3VFGH 3ZYJA 2AKRA 4RFOH 1LP9A 1I4FA 2PW1A 5EH1A 5I1JL 1BIIA 3O81A 4R97C 1MSPA 3U4BH 5C08A 5DMYA 4ODTH 4B5EA 4AEIH 2XT1B 1FZOA 4U3CA 3QIWB 5DFTA 4YZFF 1Q9OA 5MEPB 1ZT4A 4O58H 2NX5E 4HPOH 1CFQB 1RURH 4D9LL 5DJ6B 4XZUA 1BJ8A 3MGAA 4G7VL 4JO4H 1OAXL 1TQCB 3WNLA 5CUSL 4XVTL 2FJHB 3LQZA 2H8PB 5BZWB 1OARL 1IKFH 4MQXC 1MHEB 2WBJB 4XNXL 5T3XL 2CLRB 4JZNA 1WAAE 4YQXL 3BOVA 5IHZA 3O3BA 4H20L 1EV2E 1AGFA 5EORL 3HAEH 4YPGA 3TYGL 2VLRE 5IIEA 1B4JL 3D39B 3RL2B 2ZUQB 4Y4HC 5DUMH 2ZCKH 2IBZX 5E95B 5HJ3B 5C0JA 1R3IL 2FX9L 2BMKB 1EFXA 3QIUB 2E9JA 2UUDK 1MCCA 2R15A 3LKRA 3RIAF 4QTIL 3B9VA 4IJ3B 5I66B 1BFSA 3P73B 5E6ID 1CFVH 3HE6A 5BS0A 2VC2H 1UA6H 2YXMA 4P2RD 2EIEA 2VDPL 4MA3B 2EYSB 2H3NA 4X9HA 1M7DB 2OL3A 4QXTA 1ZEAH 1CFNA 5D2LB 1I9IH 4WHTB 4H1LB 2BDNH 1EEZB 4M1GL 4APQB 3EYUL 5IFHH 5CHNA 4M7KH 2Z9TA 5IT2H 2JIXB 3OKLB 4I3GA 3WJLC 3QI9A 3GFUA 4HBCL 4OF7A 4WV1C 4F9LC 1FFRA 4Y5XB 4JFDA 2FGWH 2YSSA 1F45A 3QDJA 1J1OL 4RFEB 2AP2A 5GS0L 2BHYA 5HD8C 4X6FA 3NTCL 4WW2F 3IETA 4EXPX 4N0FB 2AV7B 1NGQL 4HHAA 1NAKH 1XGUB 1P9MC 3IJYB 4XT1C 2BSTB 1G7IA 4AIOA 4BK4A 2NX5B 5AAWA 4DGVL 5IV2A 2CR6A 3BX7C 5I1HL 1HEZB 1C8PA 4TUJA 4OZHE 4LCWA 3BH9B 5DUPL 3HZVA 2APWA 1DBBH 1I8KB 3L95A 3B8YA 4Y16C 1UADC 1OD7A 1PJ9A 4YXHH 5BXFA 1BP3B 4O2EB 1MPAH 3VXPA 1CDUA 2KL6A 3OAZK 2PTUA 3TNMA 3MV9D 2XTLA 5H2BA 5JORB 1T21B 3MOAL 5AG9A 1D5ZB 3D1MC 3K1KC 4F15B 3HPLB 5C1MB 5IVZB 1GL4B 3WHE0 1FG9C 1NCWH 1NFDF 4QXWA 4LSSL 5EO1B 2DKUA 2G9HB 1TJHL 4XTRD 1DDHA 4PRDB 3QDGA 4I5BA 1FNFA 5C2BL 5EIQA 3GSRB 3NZ8A 4OLUL 3WFHA 1A4KA 4PJCE 4HJ0D 3MOQA 1CLZL 3CSYB 1BD2A 1WIPA 1CE1H 5DHVB 3KYMB 4O51A 4POYA 3WD5H 1MUJA 1N5AA 2BVQA 2Y6SD 3VXNB 5DT1L 3D3VE 2ZCLH 4ZXBB 4JO1L 4A2MA 4XH2B 3L6FA 1H3WM 2R4RH 3QHTC 3BQUD 1XGQB 5F1IA 3UBXG 2D7OA 3ILPA 3RDTC 3ZT7A 5EZIH 2FHBA 4ZMAT 2CDFA 5BW7C 2O61B 1KTLB 3C5ZA 2R56H 2PR4H 3EJZD 4L8SC 4OQTH 1XGTA 2X7LA 5AYUH 4ZTPL 3PWJB 3IDXH 4XC1H 5CJOL 1IEBB 4E0RB 3A6CH 3SCMA 3CSBA 1IM9D 4X5WB 3ZTNH 3VI3F 1GOHA 3BDXA 3MUGA 2XFXA 3MRIB 2V9QA 1A3RL 2Q87A 1ZVHA 5ICYA 1OCWL 1JWUB 2VWEE 4FQ2H 1YNKH 4D94A 1JFQL 1FYHB 3GSNL 1DVFA 3MREA 1PX4A 2HYMA 1PEZA 4KUZL 4B7IA 3D85D 2ENYA 5EU5A 3CFEA 5E0QA 3FB5A 3TJHD 4JPWL 4MCYA 4NPYB 3KWWB 4M43H 1PSKH 1ZGLP 3CLFL 2R0WL 5CCKL 4X6BB 3LOWA 3MV9B 1RU9L 4GG8B 4L29A 2CPCA 2NNAB 2EYTA 4FZEL 3LKQA 1AR2A 1GOGA 5CZVH 5DVNA 5CD5D 5FGRA 4X99A 4HIEB 2QQQA 1NEZB 4JRYE 1ZTXL 4J8RA 2D0GA 1FE8L 2GAZA 1MRCH 5C0BA 5IM7A 1QSVA 4H88L 1CBVH 3TH3T 4OM0L 4JKPL 3T0EC 1WEJL 2QLVB 4I0PD 4K8RL 2YKLH 1BVKB 4NN5C 3AY4A 1DBJH 1T0NB 4PJIE 3QIWA 3B9KA 5B3JF 3BQUB 3P0YL 5MEPA 3AAZB 3U9UB 1CFQA 4NN7C 3G6JE 4PJHF 4K8RD 5F1SA 5KW9L 5DJ6A 4KKCD 3D3VB 4Y4FD 5J89A 3THMH 1E6OL 3MV8E 3ZDYF 4RWHA 2FJHA 1KT2B 1IM9B 4NSKB 1MHEA 2WBJA 2P5WE 3NFSH 1ORQB 4EZMA 2CLRA 3QHFH 2GJJA 2WLZA 2I27N 4ODVL 4RX4A 2XZAH 4Q7DA 3L1OH 4RMUA 5CSBA 5K59F 3UTTE 2BNQB 1K8DB 3D39A 4MAUL 3RL2A 2E7CA 1O7SA 5CEYB 1FH5H 1UM5L 1WWWX 1SY6L 4ZS6C 5DMIL 4RFNC 5HJ3A 2ARJB 4MQ7B 1MJ7L 3QFDA 4E5XB 2BMKA 4L9LB 4R0LC 1LGVA 3GSNB 3PWLB 1RV6X 3KLAB 3QIUA 3I3DA 3QULA 3OGCB 1UH3A 2IPTL 5ALBL 4PTTB 4M9PA 2FH6A 4U0QB 1ZANL 3QRGH 5I66A 4PJEB 4NQDE 3ULUE 5DJYB 3QUXB 3P73A 4UOJA 2AK4E 4MA3A 2EYSA 4JKMA 1M7DA 3OKKB 4FTVE 4JQVA 1BWMA 4X8JB 1ZOXA 4WHTA 3E0GA 4KDTC 4H1LA 1EEZA 4JJ5B 2J2ZA 2B5IC 2YK1L 2G60H 3QO0B 2AEIT 1NGPH 2JIXA 3OKLA 1A47A 5D6DC 2YN5A 4YH6A 4Y5XA 1M71B 1FV1B 5FYJL 3B83A 4RFEA 3DJ9A 5EA0H 4PYHA 1QFWH 3NGBB 3BP6B 4N0FA 5GRVL 2AV7A 2BOCB 3CFDB 5FYJD 4Y4FB 3IJYA 4DAGL 1N8ZB 1HINL 2BSTA 4AH2B 3BJ91 1JBJA 2WQRA 3FRUB 3K74B 2NX5A 1DE4B 3MBEC 1R0AH 4QGTA 2VH5L 3JUYA 1XGYL 3BH9A 1SJVA 1JMZA 5MHSE 5EZOL 5CBEA 4PJDF 1OP3H 3ULVF 1I8KA 5E08H 2A6IB 5FHBH 4M00A 2GCYB 4FFZL 4ODWA 4O2EA 5HHXL 4XCYA 1T21A 1IC1A 1D5ZA 2IQ9H 2ORBL 4MXQC 4WI8A 5ICZB 3ULVH 2I25N 3HPLA 5IVZA 3DYMA 3T1WA 3PABA 5EO1A 4XWGL 2G9HA 3WS3A 5D2NC 4L4TE 4PRDA 2XTJC 1QBLH 5D7JD 5EOQL 3V4UL 1FGVH 4AEFA 1HQ4B 3GSRA 2X4QB 5GZOD 1QG3A 1CL7I 5IVNA 5DHVA 5JHLL 2GI7A 3WUWA 4KZEH 3CH8A 3LCYA 1CQKA 3GJFH 4MJ5B 1NCBL 2FIRT 3U6RB 3VXNA 4ZXBA 1WJ3A 4I9WD 3IKCB 4NWTH 3U2SB 4XH2A 4M1CD 1XGQA 3U79A 4ZTOL 2D31A 2NYYC 2O61A 1MCKA 5E4EC 5E7FA 4M7LT 2VRAA 3WIIH 3PWJA 4JRWA 5MEND 5IVOA 3MJ6A 4OZGE 1HE7A 1XIWD 1KSRA 1UGNA 4PS4L 1DLFH 5FOJA 3U9PL 4KC3B 3QXAA 3ZKND 4XAWL 5D96B 1A6ZB 1UACH 2W59A 3MRIA 3PG2A 2FEDC 4ONGL 4LF3B 4OZFB 4PG9B 2VTFA 1JWUA 1EGJA 1KXVC 1LILA 5I1KH 2IALB 3FB6B 4PYGA 1Z9OA 3ZO0A 3OGOE 5I17B 4JQXC 3QEQE 4LHUB 2OTPA 3BKMH 3QFJE 4OF3A 4NPYA 3KWWA 3NFPB 3QXUA 5EUKB 4QRQB 5DD5L 2YEZA 1NCAH 3KJ4C 4X6BA 1IT9L 3TF7C 1YMME 1FAKT 4ERSH 3S96B 4GG8A 1A7NL 3BE1H 1IGFH 2NNAA 3PGFL 4QY8B 1E4XI 5DYOB 1LK2B 1MQ8A 2NXZD 2UVEA 3IAQA 3RY5A 5KG9B 4XMPL 4HIEA 1J1PH 1NUNB 1EVUA 1NEZA 4AT6A 4LCIH 3T4YA 4JG1L 2C26A 5BJTB 5FA4B 2A77L 1YDPB 4O00A 3RVTD 1KCVL 2BFVH 3GRWH 4OGYH 2AJYL 3NIDF 1WLHA 1YC7A 5E24E 2BRRL 5I71C 4NC2B 2A1WL 2XI9A 4EBQL 4L4TB 1T03H 3L3DB 4P23D 1YECH 4LASH 5D9SB 4PP1D 1T0NA 1EBPA 4XPAL 5BZDB 4P59H 3BQUA 3OR7B 3ARDC 3FONA 1OAYH 3AAZA 5DURD 4KJPD 4IRJD 3U36B 5C0AE 3D3VA 5TE7L 3X3FL 4J3OC 1AXTH 3QQNA 3UO1L 1A64A 2F5AH 4PJ7F 4Q9CA 3C09C 5L0QC 1KT2A 3NACH 1IM9A 3Q3GB 1QBAA 4NSKA 4R2GD 3N1PC 1EMTL 1QNZH 1U8PB 2EH7L 3EDKA 5GGRB 3V6OE 1ORQA 5EZLB 5T3ZL 4ESKA 2ZCHH 1GHFL 1QLFA 3AXLB 4K3HA 3N1FC 4YHMH 1W0YT 1JF5A 1AKJD 2BNQA 1K8DA 5I1EL 4WTZA 1ZLSL 5T3ZD 3OKMA 5CEYA 5LGKA 3DWTA 4KROC 5I9QC 2ARJA 4HX1A 4MQ7A 4E5XA 3A6BL 3RI5F 1B3JA 3GSNA 1WTGT 3PWLA 3DECA 2I9LA 3KLAA 1A1MB 5IESH 5D5MB 3MLXH 3AFLA 3OGCA 4RGND 1PKQB 5HYSB 4PTTA 1LEGB 4UILL 1AFVH 3UZVB 3DIFB 5GZNC 2NXZB 3REWB 4PJEA 5EWIH 3QUXA 3BJLA 4LNVA 3TESA 1RD6A 3BIKA 3EO9L 4EDWL 2GFBB 4NRYB 1T1XB 3OKKA 4X8JA 3ZTJH 5CBAB 3VWJA 1EHLL 5FYLD 3QO0A 3F58H 4JRYA 4LKCB 4JLRA 1MHHB 2DQDH 1RIHL 2VERN 5BQ7B 4XXCC 4P23B 5J1TC 2QQKH 1M71A 1XF5B 4JFEB 4OCSL 4M1DL 2HTLC 1FV1A 4GQ9L 3ZE2F 2ZG3A 3M1BB 1BBDL 4URTB 3EBAA 3BP6A 3FOLB 4NQTA 1KCSH 1Z9SA 3OB0H 4LLDA 1INQA 2BOCA 3CFDA 4Y4FA 1U8QB 1U3HD 2NY1D 1N8ZA 1JP5A 1OSPL 4AH2A 2NY0C 4KHXH 1JV5A 3FRUA 4UIMB 1FQ9C 4PB9L 1CGSL 4JM4L 4JAMB 5C0AB 3F7RA 3I85A 1GGBH 4Y5VC 3S35H 4P46D 2HKFH 3DX6B 5KANG 2D7MA 3EHBC 3GMQA 3SDXB 2E6PA 4OCNC 3O2DA 5ESAB 1NFIB 2A6IA 2ZKHH 3Q1SL 1KJMB 3B6SB 2GCYA 3GHEL 4QXGL 1X5LA 1ZLWH 3RBGA 3TT1L 1UQSA 1U0QA 2JJTA 3UTTA 4OD2B 2KQMA 2ZUUA 5B38G 5ICZA 1XFPA 4JZJB 4U49A 1J0IA 5HGGS 1G7QB 4GSDH 3KPLB 3QDAA 1H15B 3ARVA 5KS9F 3MV7B 2GY7B 5F9OL 5JNYB 3O6KL 1HQ4A 5EUOF 2R0ZH 4YJZL 4CBPA 3PWVB 1D5IH 4U1IB 2X4QA 5I1AB 5J06A 1GJIA 5F3BB 3WO4B 4NGHL 3LN9A 5EIVA 3H9HB 1AC0A 4P5TD 4PLOB 4XGZB 4MJ5A 4OTXH 3NIGF 1MJUL 5TE6H 3UPRB 4IIQC 1GC1C 3FFDB 4JM2D 1NMAL 4ACPA 3P4OB 4PP2B 2X4PB 1ITBB 5T1KD 2B2XL 2XN9E 2J4WH 1TVHB 1A0QH 1Q72H 1J0HA 3SBWC 5IGXL 2BVTA 3O4OB 3UC0L 5F9WB 1G7HB 3DBXB 4JB9L 4O2CB 1S7SB 2QSCH 1P4BH 1I1RA 1ADQH 4HK3N 1T83A 1IGMH 1V3MA 4R4BB 5F7HA 1A6ZA 2JCCF 1X3DA 1LNUA 2VLMD 3N85L 4OZFA 4PG9A 5H37G 4ODSL 1GYAA 4NZRL 2AABH 4MQSB 2APBA 1KTDB 3S97C 3FB6A 2Z35B 5IW1B 4FFVC 5CIPH 3OAUH 4FXKB 1U3ZA 4YC2C 4QRRE 1OPGH 2CSPA 3QG7L 4LHUA 4R26H 4ELMB 5HI5C 4HIJB 4KQ4L 3O2VH 1LDPL 2H6PB 3NFPA 2VLLB 3IAGC 4JGUA 4QRQA 4HH8A 3T0DA 4AJ0A 5C0NC 3TPKA 1YNLL 2RGSA 4NM8H 4EOWH 3HE7C 4HXBH 1C08B 4QY8A 1NPUA 5DYOA 1JF6A 1LK2A 5TF0A 5KG9A 5DJAB 4MNHB 4PJXE 3PQYB 1P7QD 4FZ8L 5IB4B 2IEPA 3PUCA 5BJTA 2X4OB 3TO4D 5EOCJ 1YDPA 2CKBL 3GSOB 4DZ8B 1J0ZA 1KB5H 3CDGB 1INDH 1MLBB 5C9JB 1ITCA 5ABDE 3RVWC 2H2PC 1NCCH 1N7MH 1KYOK 4L4TA 1CTOA 4CMHC 2ZCKL 4P5TB 3L3DA 5A43C 3LPWA 2EYRA 5D9SA 5ERWB 1YQVL 5BZDA 2A73A 4NJ9H 3OR7A 1U95B 4J3TA 1KIRB 5L8JB 3CJJA 1FPTL 4MAYB 4R3SB 4YHLL 1FL3B 2IFFH 3LS4H 3SOBL 3H7LA 3U36A 5F72S 4W6WB 4WI2A 3RL1A 3CCHB 4X0KB 1CFVL 1EO7A 5C07E 4D9RD 2EDNA 4U0RB 3IXAB 2IAMD 3F7VB 1U8PA 1UEMA 5GGRA 4HJJL 3LEVH 5EZLA 3WFDH 3VFWB 3AXLA 4Z77B 5IFHL 3O45B 5DFWH 4P3CH 4NQUA 4PLKC 4D9QD 1MAMH 3JV5A 3MLUH 1HQRB 1WUNT 2ZJSH 1F11B 5AZ2H 3CMOH 3BEVB 4JR9H 1NFKA 1A1MA 1MI5E 2HFFB 4QRRB 3PDOB 4J4PD 4YBQC 5CD3B 5D5MA 4FQXC 4TNVK 1Q1JH 1KGCE 4M6MH 1PKQA 5HYSA 5C3LD 1LEGA 1S7VB 3DIFA 4XCFH 3QCUH 4AENB 1WQVT 4KFZC 5FUCE 4E42B 2ESVE 5IMMB 2GFBA 4L1DA 1I1CA 1MY5A 1T1XA 3CXDL 4GLRI 2NY2B 2CJUH 5E2JA 1YN7B 3QPXH 3W9DA 2HT3D 1JL8A 2YD9A 4MA7L 1MHHA 2VNCA 5BQ7A 1RJZB 4UOW0 1XF5A 1HSBA 2W9DH 4JFEA 4WHDA 1H3PH 3MODH 1FNHA 3M1BA 4KKAD 1RI8A 3WJJA 2FHCA 4TN9A 1W8NA 1VSCA 5C3TA 5IQ7L 5T1LD 1CI5A 4IMKA 1KPRB 4BZ1H 4RAUB 2YPLD 4JFHE 4GJTB 4P0DA 4OZ4B 1U8QA 1BMGA 2R1YB 4PJ8D 1O0VA 4KMQA 3EJYD 4UIMA 1JNLL 1NBVH 3QH3B 1BVLA 1N5YH 3F7PC 4JAMA 5C0AA 4Q2ZB 1IAIH 1OAQH 4MD5B 1CXLA 3NZHH 3NPSC 4UDUA 3WS6C 4X6DF 3DX6A 2Y7QB 3SDCD 1RK1B 1QO3B 3SDXA 3K1DA 2ZCLL 2GT9B 5ESAA 1YQ2A 1NC4D 1I1AC 1KJMA 3B6SA 2DI8A 4ORZC 5GPRA 5FCUL 2PF6A 1AJ7L 4OQTL 5F89B 3GI8H 4LRNH 3MCKB 4GUPB 4OD2A 1JZ2A 2FHFA 4GKSB 5FYKU 5D7IB 4CGTA 4JZJA 1U58B 2FNBA 4MX7B 2OJZL 4P2YA 4MDIB 3WE6B 1LO3L 4KV5F 2VJXA 1G7QA 3WFBL 3WLWD 3KPLA 1H15A 5I15H 3MV7A 3D2UB 2E6QA 4FQLH 2QR0B 4LVHC 4WI3A 3W0WE 3PWVA 4LMQI 4U1IA 5I1AA 5D93B 2EDQA 1JZ7A 5KVEH 3KHQA 3SGJA 1ETZB 4YK4B 3H9HA 3QP3A 5EU3B 1IC5H 3K2UH 4EN3C 5GRXG 3UPRA 4KI5E 3S3SA 1DL7H 3HMWH 3FFDA 4G9FB 2XY1A 4NKIH 1CZ8H 4PP2A 3T77B 2X4PA 3C5JA 2NTSP 1RAMA 2R39A 5C71A 5IVXE 3MMEB 1TVHA 4TOYH 3TCXA 2MPAH 5GJSL 3FFCD 4TTDC 5CZVL 1G7HA 3DBXA 1MAJA 4O2CA 1S7SA 1A6TB 3V5DB 3UJTL 4NKDB 1VPOH 3DSNA 5DMGC 1GAFL 3JVGC 1EZVX 2IBBA 3NA9H 3C8KB 3V79C 2XQBH 3HG1E 4PJ8B 4R4BA 3FT2B 2RB8A 2AXGB 2E3VA 3JV6B 3H9SE 2QHRH 4N0YH 4Y4KC 5I8OH 1WICA 3HMXL 2NY3B 3BD5A 1KTDA 1QR1B 2RCSH 1KN4L 1P6FA 1L4IA 3WEXB 1ZVSB 5JXEA 3I02B 5IWLA 4WI4A 4HMCA 3LSOB 3IU4H 3G9AB 4ELMA 2VZOA 2AK1H 3DVNB 4OJFL 4KRLB 2DLFL 3GBLA 2H6PA 4OZIF 1DQDH 2VLLA 5CS7A 1A6VL 5CINL 1RZFH 4F57H 3QUKB 3THML 1C08A 4X7SL 3SE9L 3I3BA 3S5LB 1WC7A 5DJAA 4MNHA 1JMXA 3G5XB 5FO7B 3PQYA 4QT5B 4U6TA 4KVCH 5IB4A 5IJKC 4DFIA 5GGRY 3QHFL 5BCAA 1SBSH 2UUDH 5CILH 1WZKA 4JRXD 2OR9H 4HUWB 2QSVA 3T2PA 3GSOA 4DZ8A 4EI5C 4IHOB 1MLBA 5C9JA 2AJSH 1WBYA 2WK2A 4YGVB 3T2NH 4OLYH 3RVUC 5ACZB 1FH5L 1KJ2B 3ARGC 3KPSD 2IWGA 3DX8A 4P5TA 4LEXH 5DD1H 1XF4B 3BPLC 4I18B 1JHKL 5ERWA 4CW1B 4U3HA 1F90H 4N0UE 4PJFE 1U95A 2DTMH 1KIRA 4KK5D 4MAYA 2JTDA 1IGJB 1FL3A 2H32B 1K4DB 3QRGL 3O9WB 1ZXQA 3FFCB 4JG0L 1IQWH 2R0KL 4KGJA 3OTTA 3UJIH 5EBMB 4X0KA 4PGBB 5J1SC 3IXAA 4XVSH 3TT3L 5GRWA 3F7VA 2AJXL 2XN9A 4LARL 3S4SB 1NMCB 5GGVH 2NW2B 1MNUH 3VFWA 4PGEB 4Z77A 4JANB 4NQCD 5KSAD 4EVNB 3O45A 1NGPL 3WSQH 4HV8B 3H42H 4K7PH 3RNQB 3WIFB 4HCRA 2VDRH 5F6IB 3MLZH 1RZIB 4P2RE 1MEXL 3Q2CA 3WXWL 5J11B 4I3RH 1F11A 4N8PA 4Y2OA 5DZLA 5J57B 3BEVA 4KHTH 1YEGL 4QRRA 5CD3A 5L7XL 3PDOA 3RWDB 4YNYB 1RUQH 2CR3A 3RY6A 3UTSB 3VH8B 2CIIB 5I30L 2LU4A 1KFAL 1S7VA 4HT1H 2YC1B 2AJ3B 3V5KB 4ZUVB 1F4XH 4OM1L 1RY7B 4WO4C 4E42A 5ISZD 5IW3A 3RNKB 3HS0B 5GGUB 4S1RH 3HFMH 2JB5H 2P7TB 5EU4B 1YN7A 2QADB 1TZHB 4WUUD 5E08L 2CRZA 2FD6L 5E8NA 1L7IH 5TQ0H 2FX8H 2F58L 1QYGH 5F7FA 4JCMA 4Z7NE 2J6EA 5DZNA 3BPNB 4U1LB 4UIKH 5JA8B 4YDLC 1XCTB 4WWKD 4NRZB 2PXYD 4M3JA 4P2OD 5FCSH 3ULVL 1QSZA 2HTKC 2R0LL 3GSQB 1KPRA 4LSPL 4RAUA 3RVVD 4OZ4A 4HF5H 4XXDB 1S3KL 2R1YA 1J05B 3VXME 1FGVL 1GC1H 5EN2A 5HDQH 2X09A 3ULVD 5LGHL 3T3PF 2X40A 4PB0H 4HIIB 3O6FD 4G42B 3QH3A 2Z93B 1P7HL 5DLML 3QI9C 4Q2ZA 4K7FA 4MD5A 3UEZA 1CLYL 3RUGF 3MXVL 1GZPA 5F8RC 1CGXA 2Y7QA 5I1DB 2VDOH 4S10A 3FN3A 1QO3A 3OV6A 3KYOB 2GT9A 4NWTL 3ES6B 2CO6B 2DI7A 1J8KA 1TJGL 1XR9B 2V7HB 2EZ0D 2PYED 1D6VL 1UB6B 1UB5B 4PRID 5F89A 4BZYA 3WIIL 3MCKA 1UZ6F 3HI6L 3TZVA 4GKSA 3IS0X 1MVFA 4BZ2L 1ODAA 1U58A 1S7RB 4MX7A 3BRGC 4MDIA 4X6CB 3QUYD 4L9DA 4FQJL 5DR5H 1P69B 3MGTA 1CDYA 3D2UA 3K0WA 4X6EB 3OZ9H 5K9OB 4HS8H 1OHQA 1T22A 2QR0A 3LIZH 4L8CB 3C8HA 1K5NB 4GRWF 1D9KC 1SJHB 3HR5B 5DUBB 4LU5L 2F74A 2FGZA 3L7EB 4LVOC 4FQ1H 5C8JB 4ZUUB 5EU3A 4V1DD 4PJAF 5KVGL 3B2VH 2VXUH 2DYPB 3BPOB 4G9FA 2OK0L 1OB1B 4B7LA 4UV7L 1GGCH 3T77A 2GTZB 4GRWH 3QQ9D 4ERSL 1JGUL 3MMEA 5ADOL 5I1GH 2EIBA 4MQXD 3F12B 1IJ9A 5A40E 4XP4H 1A6TA 1AGEA 3V5DA 3BGMA 4NKDA 1X6LA 1F00I 1FLRH 1IGCL 3C8KA 2W38A 3NIFF 4TTGA 3SE8L 1FNGB 1K3ZA 4XPFL 2AXGA 4H1LG 3JV6A 2XV6B 5ETUB 3MRRB 4YDKH 3B8SA 3LKNA 5HVWA 4Y4HD 5IJVA 5FGBA 5SV3A 1QR1A 1I3GH 5JPNB 3TH2T 3G04A 2P8MB 3WEXA 4MQTB 1ZVSA 2HG5B 3I02A 5HVGB 1OTUC 4YFEA 1MLCB 4HDIB 2N7AA 3W82A 3DVNA 4X4YB 3C5ZC 4LQFL 1X5JA 2J5LB 2AAVA 4KVNH 4BH8B 3SCMC 1RJLA 4DN3L 5MP6L 4YX2H 3QUKA 2DD8H 3CU1A 5E6YA 3RGVC 3S5LA 4TPRH 3G5XA 5FO7A 1FBIH 1AGDB 4XP9H 4D0BB 4QT5A 1HHHB 4K9EH 1HCVA 5E9DD 4GAGH 2CK0L 5E8DL 3PWNB 1DVFC 2DKMA 4KZDL 2VZUA 4IDJL 5I75C 2ED7A 2DQEH 4IHOA 1ZT1B 4YBHA 2BSRB 1YEKH 4YGVA 3VGHA 1KCUL 4QRPE 5ACZA 4LL9A 3CIQA 1KJ2A 1FAIH 5J0BA 2DM4A 4V1DB 1TNMA 5HD8D 1XF4A 3MX0A 3ZE0E 1RIUH 4I18A 3FTGB 4CW1A 5B39B 1I7RB 5IESL 3SDAC 4MNGB 3QIBD 2FIKB 3MLXL 1IGJA 2H32A 3V4VH 1K4DA 4J3UA 4Z0BL 3O9WA 2LTQC 3FFCA 1CD0A 4WFGD 3MRNB 5EBMA 4PGBA 2EO9A 3OBAA 4M03A 2F15A 3S4SA 4MNQD 5E70A 2LVCA 4Y16D 4PGEA 3WUWG 3CFBB 4JANA 4RIRB 4EVNA 1NLDH 4PJ5B 1RZJH 1G84A 4HV8A 3AY4C 4ODUB 3HG1A 5I1IL 4PJ9C 3QIWC 3B9KC 5JDSB 2QQKL 3HMXA 1ZLUH 2VUOA 4G8FB 4JEGB 5H37H 4LSVH 1RZIA 2ARJQ 1TQCC 5F70A 2HFEB 1WT5A 3P4MB 1QD0A 5EBWB 4L4VE 4F2MB 1M7XA 5F1KC 3Q48A 3RWDA 3GGWB 3UTSA 3VH8A 4G8EB 2ED8A 5DRNB 3TH4T 1BZQK 2AJ3A 3V5KA 5TE4L 4ZUVA 3VFTB 4OIIL 5BVPL 4LEOB 5JIHA 1KPVA 5E9DB 4WHYG 3PDGA 3HS0A 1CVRA 2ZUQC 2BP3A 5GGUA 4WV1B 2IG2L 2P7TA 5EU4A 4TVPL 3S9DB 4AL8H 3RDTD 1TZHA 1EEYB 3OJDB 1I85A 3VJ6B 4JDTL 2OI9C 5FYJE 4NM4H 3MNVB 5JIPA 3P30H 1BF2A 2C5DC 3BKYH 1JHLH 5JW5B 3X3GH 4TVPD 4IJ3C 2LVEA 4U1LA 1DUYB 4LFHD 4PJ7B 1V8HA 5LAXA 4UNTA 5F7DB 1UWXH 3GSQA 2XXMB 1NEZG 1ORSB 3DO3A 3SKMA 3M8OL 4RMSA 4GSDL 1KC5H 4XXDA 3F7QA 4JPIB 4JQVC 2EXWC 1J05A 4ZSOE 1JNNH 4PJFA 1RSFA 4UQ2A 1H8SA 4HIIA 4G42A 1D5IL 1C7SA 4AIXA 4DN4L 3FHAA 3IDYB 4Y16B 2VDKL 4K3GA 3C08H 5I1DA 2AV1B 4JVWA 5JUEL 5C0GB 4PUBH 3KYOA 4HAFA 4NFDA 4DKFL 4AEEA 5DHXB 1XR9A 1GSMA 1OGTB 4GH7B 1UB6A 2KZ1B 3V2AR 1UB5A 2J8UB 3AMKA 1AIFB 2BY0A 2VXSH 1P84J 3L5JA 4GKNA 4R6UA 5CGYC 4NHCH 1U8MB 1P4BL 4S0TD 1IMHC 4PG2A 1B4RA 1J8HD 5IROA 5TDNA 1BOGB 1IAMA 3TP4A 3MRQB 2HJKB 1BAFL 4X6CA 2GIYA 3IFPB 4I9WE 3I6LD 4OCRH 1A5FL 3K7UA 4TQEH 4X6EA 5K9OA 3T0ED 5DK3A 2AEPL 5JW4M 4L8CA 3B2UC 1K5NA 3UTPE 4Z78B 1SJHA 3HR5A 4WTZG 5DUBA 4NUGH 3L7EA 5C8JA 5MENE 5IQ9A 3D48R 2BCKB 4ZUUA 3O2VL 2W1NA 3NCBB 3ETBF 2DYPA 2R23B 2UWEE 3MRLB 1OB1A 4L8SB 5DC0A 4Z7UE 2GTZA 5LBSL 4F15C 1I75A 4AEHH 1BQSA 1FRGH 1TENA 1UT9A 4JFFB 3F12A 2GEEA 4HXBL 1CDGA 3FMGH 3VDCA 4BM7A 3Q6GL 1A7OL 1JPTL 3IFLL 3V52H 1U8IA 1VDGA 2R2EB 3TYFB 1FNGA 1JTPA 1L0QA 2CDEA 1S9XB 4TRPL 5ETUA 2IQAB 5DWUH 1QSFD 3BP7B 5B8CA 1QKZL 3QUMA 3I9GH 1LP9F 2MKLC 1EO8H 5JPNA 4LLWB 3MBXL 4OSUL 4ZXBC 2P8MA 3X14B 4JGMA 4ZOCA 2HG5A 5D7LE 2DQFB 1MLCA 4HDIA 3VXMA 4FNLH 2P44B 3OJ2C 5HYQB 3ARQA 1UXWA 4BH7B 3GZKA 4X4YA 4ODBD 5EO9A 3EFFB 1PGRB 4OLZH 1M4KA 3R4DA 1LO0L 1W72H 5K9JH 2C7UB 2VO5A 1OGAD 4PRNB 4X7FC 4HJGB 4BH8A 4J1UA 4CN1A 5KS9B 4LSTH 5CEZH 3A6OA 2NY7L 3SE3A 5GS0C 5EUOB 4JDVB 3MACL 1J8HB 2HLAB 1G9MC 1RUKL 3WBDA 5I73B 4D0BA 4KXZI 1HHHA 4HSQA 3VGGA 4J3WA 4GXUN 3PWNA 1YEDB 2HH0L 4KY1L 3IGAB 3MRDA 3ALPA 4P3CL 4WNQB 1ZT1A 2DF3A 1UM6H 2BSRA 4PJBE 4X5LA 4NN5B 3MTRA 1HDMB 1Y6MR 1DANU 1P7KB 5D1ZB 3RJQB 1MAML 3OWEA 4HLZG 4JHWL 1N6QL 1TPXC 2CDGB 2NY4B 2JJSA 4GRMB 3EDFA 4NN7B 3DVFA 3FTGA 5AZ2L 4ZFZA 2RAMA 3CMOL 5B39A 2GUOB 2MCPH 1I7RA 3TC9A 4MNGA 3UROR 2FIKA 2DIBA 2V5MA 2P5EB 1CXHA 1QEWA 1C5CH 3MRNA 1NCDL 2EEAA 3MBED 1N0XL 4OCWL 15C8H 4BSVB 1NSNH 2YA1A 3MFFB 2WUCH 1C16B 4R7NB 5JOPD 2CJUL 4TSBL 5IB3B 1NC2D 3AUVA 3CFBA 4RIRA 4CKVX 4PJ5A 4Q0XL 2OZ4A 2E9WA 5KVFL 5I8KH 3DX9B 4ODUA 4RGNE 4RFNB 5T5FH 2OL3H 5JDSA 3BXNB 1GGYA 1R3KB 3B43A 4MXQD 4K23H 4G8FA 4XCNB 1AP2B 1R5IB 1WZLA 1OGAB 2HFEA 3G5YB 4XVJH 1UEYA 2C1PB 1OP5K 2ICWI 3QHZH 4F2MA 2XTJD 4DQOH 2AXFB 3GGWA 3O8XC 5FYLE 3ZDXF 4G8EA 1EA9C 4TUOB 5DRNA 3DETD 4OZFG 1FO0H 3V6ZB 5FM8A 3VFTA 1YEJH 5EU6D 1NBVL 3EIFA 3RAJH 4XCCH 3UZEA 4PV8B 5ANME 3NZHL 4OLXH 2R29L 4GKOA 3WJLA 3D0LB 4WV1A 4M48L 3RHWF 2HT4C 4LHUG 2Q7YB 2EKSB 1EEYA 3OJDA 5EU7C 2NYYD 2VDQH 4H8WH 1GIGL 5JW5A 1KOAA 2BXYA 4DGIH 5E2WL 1DUYA 3OXSB 5KJRL 5KN5B 3B9EA 3QUXC 1CL7H 3GBML 2FEDD 4HQQH 1ORSA 2WBWB 4MHHI 1I7TB 4JPIA 5I15L 2YD3A 3WXVH 5C0RL 3VWJC 2R2HB 2W0FA 3ARPA 4I2XB 1G7LA 3JTSB 4UV4L 3CFKB 3J8F7 4NRXB 1WTLA 3RRQA 4S2SB 4W70A 4Y16A 1YYLL 3CU7A 4HEME 2KQNA 1IC5L 3I6KB 2AV1A 5C0GA 3FRPA 1LK3H 3OJVC 4NKIL 2D7TH 2RIKA 4P4KC 3Q5OA 3QWRA 4LAQH 4NWUH 4KK8D 1UWEH 3FOMB 2J8UA 3LQAH 4TOYL 4XPTH 1AIFA 2AQ1A 3P3YA 3MLRL 1IVLA 4PY8I 2MCG1 3QEGL 1VENA 2XTJB 1BOGA 1NKRA 1BLNB 3MRQA 2XOTA 2V2XB 2AEQL 2Y5TB 4FMFA 4N0YL 3IVKA 1NJ9B 3KPRD 4ONFL 1CU4L 5EU6B 4L4VA 1IEAB 2IC2A 3TV3H 4Z78A 3EOTL 5D70H 3IDNA 2FECL 1E4XH 3TGXA 4NZUL 4Y88A 5C70A 2BVEA 3RIAK 1A2YB 3ARDD 1E4WH 3VA2C 4ETQB 4WUKH 5CFHA 3AU1A 3LS5L 2R23A 5BW7A 2H9GB 1HH9B 5E4EB 3MRLA 4L8SA 1RUAH 3EAKA 5HXMA 4O5LH 1RZFL 1J5OH 2B1AH 1CG9B 1YEIL 2EXYC 5HTSA 3VI4E 5HYSG 4RISL 4JFFA 1NGZB 1J1XL 5ILTH 3NPZB 4CMMB 1YPZE 4JFPB 4F7MB 4U3XA 5BO1L 1GGIL 2BOBB 2ERJB 4L3ED 2R2EA 2NTFB 5DJ0B 3RX5A 1S9XA 2QSTA 4HGWB 2IQAA 2X89D 3BP7A 3VFNB 3GMOA 4QOKB 5MEOB 3F7YB 4UINL 1JGEB 5DFVC 3WFEH 4LLWA 1F4WH 3X14A 4KROD 5EULV 4A6YL 1CDHA 2DQFA 1FC2D 1AR1D 3FB8B 4OV5B 5JQ6L 1QFHA 3KJ4B 1QFOA 3KNBB 4BH7A 1PZUB 1S5IL 3ARYA 2C7UA 3FJTA 2DTML 4PRNA 5E5UB 5GZND 4TNWF 5ID1B 1G7PB 2FATL 1T83C 3DUHA 1L9NA 1MCFA 4G43B 3WNKA 2ID5A 4FG6D 4YZFE 4QHKI 1AE6H 4JDVA 3U7WL 4XNUH 5D7SL 1HN1A 4X7EC 2X1PA 2UZIL 4CL7A 1U8OB 4LCUB 2A9NH 2X4SA 4YPJA 1YEDA 3Q0HA 3IGAA 3WSQL 4WNQA 2YD1A 1Z6JT 4NO5B 4HUMB 3H7BB 2HTLD 3RPKA 4HUUB 1HDMA 5IK3B 1X5FA 1YEFH 2RFXB 5D1ZA 3DX7B 1DQLH 3UJJH 4D9RE 3V95A 2CDGA 1PYWA 2YPVH 2VABB 2AJZB 2MHAB 5CGMA 3IFNH 4I3RL 4G6AD 2GUOA 3W5MA 5ITBH 2ZG1A 3GJEB 5L0QB 4NNPH 4PBWD 1S7QB 2P5EA 4UQ3B 2FYYB 1JWMB 3VGBA 5FUZH 4Z7UA 1QHPA 1A7QL 5J9PB 4FQIL 4D9QE 3JUZA 1C5BH 5D2LF 3MR9B 3MFFA 3ARZA 1S9KC 3EHBD 3GKZA 1C16A 1S7WA 1NBZB 4R7NA 5GSVB 2DQJH 5IB3A 1MFCH 2EEDA 3BH8B 5HYJD 3MRHB 2UYLB 3TA3C 4L3AA 2FX8L 3ALWA 1YY9C 3BXNA 3KYKH 4I13B 1R3KA 4H1LH 4Z7WB 4Y1AD 4FXLA 4XCNA 3W9EB 3KPNB 1F4HA 1R5IA 4DWHA 5DQ9B 1SM3L 1FG2B 1OGAA 4HGMA 3G5YA 4A6YB 2C1PA 4OD3L 5KTEH 2ICCA 5D7LA 3KPMB 4NQEE 1I9JL 2AXFA 1VGKB 2A6KB 1J12A 3RZCB 4TUOA 3TVMB 2BC4B 8CGTA 1GC1L 2EICA 4MS8C 3FZUC 5D6CB 5HDQL 4KDTA 4EEEA 3LMJH 4KRNA 4PB0L 3JWDC 3T0WA 3V6ZA 5I1JH 4WFEE 4WY7L 1KEML 5DJ2B 2EDLA 1QSEB 4KTEH 4CNIB 1YEEL 5DJZB 5D1XC 3MXWL 1CT8B 2PETA 3D0LA 1E6JH 5C0CB 4H0HB 5INCB 1GH7A 2VDOL 2B0SL 3KPOB 2ITCB 2EKSA 2YPLE 4WU7B 1OAXH 3ZYIA 4QF1A 5CUSH 4QRUB 4U7MA 5LGJA 4XVTH 4U05A 2VL4A 1HSAA 3PP4H 3OXSA 4PJBA 5KN5A 3W81A 3VXRD 4XNXH 5T3XH 4YQXH 3UYPA 2NY0B 4Z7VB 4H20H 3BGFC 7CGTA 4OGXL 4ZO7A 5EORH 4BQBA 1HKLL 4CJ1A 1I7TA 3TYGH 1FSKC 1TETL 3R1GL 5JMRA 4FFVD 2R2HA 1B4JH 1EJOL 1K6QL 3LIZL 4LP4A 4Y5VB 3JTSA 1NFDE 3CFKA 5HI5D 4PLJC 1OAZH 4S2SA 1R3IH 2FX9H 3MYJB 2BY1A 2K9UA 3OKNB 2OSLB 1AO7D 5I18L 3B2VL 5C0ND 1FZKB 5JHDB 1I8MB 1GGCL 3WJJC 4KK9D 3HE7D 4X5XA 5FKPB 5A1AA 4IMKC 3HLAB 4XWOC 1Q0XL 3FOMA 3WNNA 1NL0L 5DHVH 4N8VB 4KJWC 5TQ2L 5SWSD 3DURB 2DJ4A 2VDPH 4XP4L 3FAXA 4K71C 5DXWA 3HNTL 1FLRL 5B21A 4ZNCD 4U7KA 4MWFB 1T7YA 3MLSL 4M1GH 5DGRA 1BLNA 3EYUH 3GBNH 2V2XA 2O5ZH 2ZUYA 2Y5TA 3ARUA 1NJ9A 4R8WL 3RVWD 1MF2L 2H2PD 2K7PA 4DK6A 5JIIA 1IEAA 4PV9B 5D7KD 4OQ1A 3V6OC 3O3UN 1J1OH 4IIQB 3A0OA 4HS3B 1UKTA 4JHAL 5GS0H 4HKBB 3NTCH 1EGJH 1NGQH 5GGQL 2H9GA 1HH9A 1HHGB 4JPVL 2XWBB 4MMXC 4Y19D 3S8WA 1CG9A 4YIQB 1HHKB 4KKBC 2CMRH 4DGVH 1NGZA 3SJVE 5I1HH 4CMMA 1U41A 3BIBX 4JFPA 2HJFB 4GW1B 4F7MA 1CDCA 5DC9B 2VDLL 5DUPH 2BOBA 5INDB 2NTFA 5DJ0A 3WO4C 1FZJB 4PLKD 3OHXB 1DQTA 4YC2B 4JQXA 3VFNA 4WI9A 4QOKA 2WWMC 1KPUB 3F7YA 5TFSL 5ESQB 3MOAH 1FAIL 4JFZH 2C4XA 3TWCL 4LDLB 4OV5A 4IOIB 3KNBA 4YBQD 5IF0B 3DPBA 1AGBB 4FQXD 4LPVA 1OP3K 4LSSH 3QEUB 2DTSA 1TJHH 5BV7C 5ID1A 1G7PA 4JRXE 3RWIA 1CDJA 5C2BH 4HUVA 4G43A 5B3JE 2Q20A 1U8HB 2B4CC 3C6SB 1CLZH 3RX7A 1VKXB 3LVEA 4PJHE 4YDJB 2IH3B 1MQKL 3KVQA 3KPSE 4G8GD 1TJIL 3C9NB 5JXEC 1U8OA 4PJAB 4LCUA 4JO1H 4DKAA 2UZYB 3VXUD 4ZO9A 1NLDL 2X70A 3C60C 4CMHB 3VD4A 3LB6C 2PW2B 4NO5A 2OCFD 3H7BA 1F4YL 4HUUA 5IK3A 1HCFX 4ZTPH 2RFXA 3DX7A 1ZHBB 5HI4C 5CJOH 1FN4B 4LSVL 4OLWL 2VABA 1FP5A 2AJZA 1NANH 4GLRH 4Y8AA 3P77B 1A3RH 5L9DL 1OCWH 4NQCE 1FYTD 4ZD3L 1S7QA 3LAFA 3F6IA 4PJEF 1AD9B 4UQ3A 2FYYA 1JWMA 2ZUWA 4HKXB 4IOFC 3OJMB 3GSNH 5J9PA 4KUZH 4AQ1B 1T04B 4P4RA 3MR9A 1DQJB 4MSWB 1MCRA 2OR7A 1NBZA 3E2HB 1G7JB 3N9GL 1OTSC 1XF2B 2XY2A 1YPZA 1I1AD 2XA8L 3CLFH 5HI3D 3EOBB 2R0WH 5CCKH 3BH8A 3T4AB 3MRHA 2UYLA 5FFLA 1RU9H 4NM4L 1M6OB 1T66D 2L0DA 2KH2B 5CJQL 1A9EB 4N5EC 3BKYL 4FZEH 5E1AB 4KI1A 1IZJA 1MWAL 2GQHA 4Z7WA 4UTAL 1VFOA 3W9EA 4NCC1 5IBTL 5ISZE 1V3KA 5DQ9A 1FG2A 3WNPA 3U46B 1ZTXH 3MC0A 5MI0C 1FE8H 3EO1B 3KPMA 1QRNB 3FCTB 5C09E 3VA6A 1VGKA 3ZKXB 3SDDA 2A6KA 2IAND 2VKWA 1OP9A 3RZCA 3TVMA 2CD0A 2BC4A 1A6AB 2WM0A 5D6CA 1FNEB 2V7NB 4JKPH 3G5VB 2QKIB 1WEJH 4K8RH 2DDQL 2ZUVA 4XB7A 5DJ2A 4PREB 1FFNB 1QSEA 4CNIA 1QZ1A 1MRFL 4PGZA 5DJZA 1CT8A 3F5WA 3U83A 1X7QB 5C0CA 5INCA 3P0YH 4U1JB 3KPOA 5KW9H 2ITCA 3IDGA 3P9MB 4LSQL 4AMKL 1QLEL 5M94B 3QNYB 1E6OH 4PJDE 3ULVE 5GSRA 3RY6C 2L7JA 2P42B 3O2DH 4NQVB 1KLFA 3S5LG 4Z7VA 2H1PL 4Y4KD 4ODVH 1QVOB 4HLZH 1UJTA 3P0VL 1P2CB 4WHCA 1QUNA 3NPSB 4MAUH 4EUPB 4Y5VA 2PYEE 4J2XA 4W81A 3UBXI 4MJ6B 5E2VL 2AGJL 1T2QL 5DMIH 4PRIE 1MJ7H 2W91A 3MYJA 1XAUA 5E99L 3OKNA 2OSLA 2BVUA 1FZKA 5JHDA 1I8MA 5ALBH 5K9QG 3JWOL 3ESUF 1ZANH 3QJHB 3MOBL 5FKPA 3HLAA 3DSFL 1FRGL 4N8VA 1H0DA 4GO6B 3DURA 5EB9A 3VWKC 1C5DB 2EDJA 3S98A 2YR3A 1Z9MA 3C6LA 5FUOL 2EIZB 1MWAB 1FHGA 5FGCB 3S4SG 3CGTA 4PRHE 1FL5B 1W0WB 3D25B 3RQ3A 3RVUD 5B3NA 3BEWB 1LEIA 3OB8A 3ARGD 4PV9A 4EN3B 3OXRB 4UBDC 1C12A 3RI5K 2F53B 4LLQB 4XNQB 4UTBL 2BZDA 2B7DT 4HKBA 3X17A 4OZFH 1KENL 2X05A 4OLZL 1WISA 1BQLH 5K9JL 1TLKA 4OUUB 3SBWA 1N59A 3TZVC 3KR3H 2MWCA 1HHGA 4Z95L 1HINH 4OI9A 3ELAT 2XWBA 3O11B 4YIQA 3VH8G 1O5DT 1HHKA 2W92A 5AYQA 3VGAC 4B0MM 2HJFA 2VH5H 4RWYH 4GW1A 4HKZB 4MHHG 4Y4KB 3GSXB 1XGYH 1DBKL 5CEZD 4S1DC 5C08D 3MA9L 5EZOH 1K8IB 5INDA 5FOBB 2Z4QB 1Q9KA 4OD1L 1FZJA 3OHXA 4YK4C 4DOHE 2MMXA 5FUCC 3HC4H 5F97E 1KPUA 5HHXH 1UM6L 3MGOB 1V05A 5ESQA 1MIMH 4HBQA 1LO2L 4EJ1C 2YN3A 4LSUH 2QEJA 4IOIA 1JZ3A 5IF0A 4FFWC 1RULL 3QWOB 4MZ3A 1AGBA 1OF2B 2MCPL 4PBVC 3QEUA 4XWGH 1X44A 4U6YB 5EOQH 1T6VN 3V4UH 3K8LA 3E6HB 1ZLWK 2ILLA 1U8HA 4NBYB 1RUML 3C6SA 3GSVB 1VKXA 15C8L 2NY3C 4YDJA 5FGBC 1ZAGA 4EI5B 5JHLH 1NCBH 6FABL 3FKUS 1DFBH 1TTUA 3QAZB 5E00B 4C4KT 1MHPL 3BP4B 1LD9B 3ARGB 2VLJB 4POZC 5KZCD 5SX4I 4N5UA 3BMWA 4NN6C 5T5FL 3ARXA 2PW2A 4IS6B 4U6VL 5E4IA 4HUXB 2OL3L 2YUVA 3H0TB 1U3JA 4QRTB 4WFGE 1D3CA 1ZHBA 5JOFB 1FN4A 3HE6D 2HTKD 5BS0D 4PS4H 4XVJL 3U9PH 1ED3B 4XAWH 5D5MF 3QHZL 5DC4B 4MNQE 4GXUM 3U4AA 1E28B 3EDDA 1YJDC 4ONGH 1LE9B 4IBLT 3MYZA 1HILB 2QQLL 4HS6B 1AD9A 4LQ1A 1I8LC 4R4NC 1PBYA 1I4FB 1IC4L 1S7TB 4HKXA 3W2DL 3QI9D 1X5KA 4K94C 3PV6B 1T04A 4JFDD 4XCCL 3BDBA 1DQJA 1KYOJ 4MSWA 1Y6KR 3QDJD 4OLXL 1FZOB 3SJVA 5FYKH 4C56B 4EI6B 1XF2A 2BRQA 4P3DB 3S3PA 3H6JA 3EOBA 4JY5H 4I18C 1IT9H 5FA3B 3T4AA 3N06B 3BD4A 1M6OA 2ZPKH 4FS0A 1A7NH 2HVJB 1A9EA 4BKLB 3PGFH 4FQQB 2LU7A 2FECI 2WWKT 5E1AA 5FDYA 1HHIB 4XMPH 5GRJL 3O9WC 2APTA 5DVLA 4ZOAA 5F7KC 1UJ3B 2X44D 3U46A 4JG1H 2A77H 3EO1A 3CDCA 4HQQL 2BVYA 4LCWD 5HHOE 3KPQB