1H9VA

Human fc-gamma-receptor iia (fcgriia), monoclinic
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
172
structure length
172
Chain Sequence
b'APPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSRLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LOW AFFINITY IMMUNOGLOBULIN GAMMA FC RECEPTOR II-A
molecule tags Immune system, membrane protein
source organism Homo sapiens
publication title Molecular Basis for Immune Complex Recognition: A Comparison of Fc-Receptor Structures
pubmed doi rcsb
total genus 28
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2001-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13895 Ig_2 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1h9vA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1h9vA02
5DEZA 4LP4A 1JNLL 1CVRA 4WI8A 2IH1A 5EBLB 2I25N 3VG0L 1KTRL 1MEXH 2BCKA 5CSBA 4CN1A 4OIIH 3ZTJH 3B9KD 5EH1A 3DRTA 4F7CA 5E6ID 1U93A 1A4JA 4WUKL 4MJ2A 1IM3A 2O5YH 2OZ4A 4P2RA 3KJ4C 3FT3A 2XFXB 5D6CB 3K2UL 4ZTOL 4NQCD 1E4XI 4XPHH 1NFDE 2YZ8A 3ARVA 4R4BB 1CLYL 2V9RA 3VWKC 2O26U 3EO0B 5D6CA 4N9GA 5IB3B 2FHBA 1ZA3A 3PWVA 1RAMA 1MFBH 4HS3B 1XGYL 2EIEA 2WINB 1FJ1A 3C5JA 5ACZB 1DLHB 3T0EC 3B43A 4X98A 4JG0L 2P8LB 3GMOA 4MNHA 1RZGA 3V6OE 3OTTA 3T4YA 3GSXA 4TSCH 4MDIB 1KPRA 2VRAA 4RISH 1S7SB 3ARBA 5L8KB 1JNNL 3DUUB 5IB4A 2IPTH 1SMOA 5I8OL 2YN3A 3QUZC 2AGJH 4HK0B 1T83C 4NC2B 2VN4A 2YS4A 3QNYB 4JFQA 2F8VA 2R2EB 3NCJL 1NLDH 1JGLL 1RK1A 3W82A 3LRSA 1UADC 1PG7L 3JUZA 4X4ZA 1AP2A 1OAUH 4LHUG 2ZCHL 3LV3A 1U8LA 2KQMA 3CAFA 5FB8A 1GZPA 1QBLL 5FHBH 4Y1AE 1AP2B 1MIML 2O5ZH 4P2OC 5IMKB 1AD9B 5JXAL 1MJJA 4PLKC 1MPAL 1LO3L 1WZLA 1S7RA 3DOSA 4XVTH 3L3OB 5HXMA 1G6VK 4PS4L 2FATL 3GI9H 4B7IA 3CCHA 5D1XD 4WU5B 1FDLH 2G2RB 2KDGA 4M8QA 1BQHB 5JUEH 2AK1L 4J3VA 3SPVA 2ZSVB 3BWAB 1LO4L 1FDLL 3AXLB 3MRFB 4LKXB 4MJIE 3RWCA 4N0UA 3KYKL 5D7JD 2OQJA 4L8SA 3CFIC 3KPNB 3WL9B 1QLEH 1CL7I 1DBJH 3V0WH 4M6MH 1UH4A 1D5XB 3JWDH 4F2MA 5DD5H 3O3AA 4I13B 3QQ9C 4PJBF 5FYJL 2YXMA 1UM5L 5IMOB 4QCIB 1UWGH 3DMMB 3P40A 4GBXA 4XI5C 5J06A 4NIKB 5BS0E 1Q9KB 3BP7A 3FCTA 5ACZA 5CSGA 2B1HL 3RVVC 2DWDA 2R1XB 1FCGA 3STBA 4UOW0 4P9HL 4YK4C 1HYSC 5ETUA 3ZMRA 5GJTL 3FFDB 4NZTH 4CGTA 5ILTH 4G8EB 4JPIA 3KPSA 1M6OA 1WTGT 4N0CD 1SJVA 3MODH 4DN4H 1UZ6F 4JE4B 2EYRB 3DXAD 4J4PC 4K7PY 3OX8B 4XNMA 1R3HA 5E2UL 1I4FA 1SBSH 3TA3B 3MODL 5FO7A 5E94B 5DURB 5GGRY 4NCDA 4HW6A 1AGCB 1JN6B 3EKCA 3HPLB 4GAFB 3IKCB 1QLFB 1U3HC 1OAYH 3MYZA 2B5IB 3DBXA 1U3JA 4FQLH 1OAYL 1KT2B 3S36X 3M17B 1NC4B 2FO4A 2XZCL 5CEYB 1BM3L 4UI2A 3P0VL 2ZG3A 5JDJA 1HOCA 4GKNA 2LE9A 2NY0B 4LHUB 1Q72H 4UU9B 4Y4HB 5E5RB 5JO5A 4MCYB 2HLAA 2IWGA 3V5KB 4G9FB 4CUCA 5F7FA 4F7EB 5TGBA 1VGKA 4I3GA 4FQXC 4X4YB 1MCPH 4JO3H 2R1YA 4RMSA 5LJYH 4DQOL 2P8PB 2Y5TA 3JTTB 3KYOA 3MJ9A 4UDUB 4YC2C 2A6DB 2NCMA 4JN1H 3G5YA 4IMLB 3G5VB 4ZD3H 5KSAC 1G9ML 1R24B 3NACH 1K8IB 5C0JA 1YEFL 5HD8D 4GFTB 2EDHA 1OW0A 3ROLA 3QUMA 3CC5A 3G5XB 4JY6A 2EEBA 2WLYA 4P9ML 4XCEA 4J3OC 1FYTB 3RNQB 4JFEA 1A21A 3I6LD 2X4OA 5FV1L 3PQYB 4IOIA 5I9QC 4E42B 4UZGA 3H7LA 5I2IB 4MJ6A 4PJFE 3IDIA 4GRWB 2QKIB 3F7YB 4XBGA 3FT2A 3TO4D 2XZQL 4PRHD 1AO7A 1D5BA 3IDUA 4MA8H 4PJ7A 4NBXB 4B53A 1IZKA 1M7DB 1MFAH 4YHOL 1FL3B 5IM7B 3RAJL 5EZLB 1G1CA 5I8KH 1BMGA 5CKAA 4FQLL 1X5IA 3SCMA 2F5BH 2N56A 4JKMA 3P2TA 4HAFA 1WZ1H 5BXFB 4DOHE 3RWEA 3MACH 5L8LB 4ZUUB 1RY7B 4K8RD 5E8NB 3C08L 1CGTA 1J1PH 1XGUB 5LVEA 4OZHF 4PJGE 3DJ9A 4KGLA 5GGTA 4K71B 7FABL 4Y19B 1ACYL 4N0UE 2DF3A 2HJFB 4HH9B 1ZGLB 5DR5L 3S36L 4ZPTB 1KGCE 4X6DF 4CVXA 4F7EA 3BGMA 1F58L 3I6KB 1DEEB 2D7TL 4YHIA 2OTPA 1RULH 5L8JB 5FYLD 2GJ6B 2WBKA 5EUOB 5DHXB 3U4AA 5DO2C 5HHNB 3UBXA 5F3BB 3OF6A 3SE3A 3VDBA 1A6ZB 4PJ5D 4WU7B 4QRQB 5DJ6B 5JIPA 2WQRA 4PJ9C 1BQLL 1EZVY 1E4WL 3L5IA 5FHAH 3U0WH 3FQNB 1XEDA 3WO3B 1CDHA 4ZFOA 4HHAA 2ZNXA 3GNMH 1P7KB 1QA9B 1CFSA 3THMH 3ECBB 4UT9L 1KXQE 3RTQA 5KVEH 4JANB 2XQYK 1RK1B 4FQXD 4X7FC 3FHAA 3GMQA 4IRJD 4ODUA 3OR7A 3VFPA 3PV6A 3VI4E 1XF4B 1CXLA 5EBGA 4KFZC 4QTIL 3CXHK 5ESQB 4OCXL 3D2UA 5HHXL 4KJYB 3WO4C 2HVKB 3ZTNL 3TBVB 3EO9L 4KZEH 1B6DA 2EH7L 5FA3B 1NC2B 1NDGB 1W72L 3NCBB 2NW3B 3B2UC 1EXUA 3O6KL 4DKAA 4JKPL 4YFEA 3DO3A 2X09A 4Z7OF 4FXKA 1UJ3B 4OCWL 3E8UH 3VXMD 5LCVL 3O6KH 5I1KH 1A7QL 4JM2D 3MGTB 5KN5B 3QCVH 4LSTH 1XZ0B 1P4IH 1G7PA 3BZFB 5GRXG 4PBWD 2OBGA 1FN4A 4L8SB 3GUTB 5I1DB 4L8BA 4S1SL 3O6ML 3MLWL 2NLJB 2F54E 3LDBC 3FRUB 4URTB 1S7UB 5IW3A 5JXED 1AIFA 3QXAA 3SO3C 3DRTB 3KHOA 4OZHA 3RVWD 3TT1H 4K55A 1FCCA 1F00I 1BPVA 2B4CL 1RJCA 5KSVA 3OB0K 3KPTA 1U8IB 4OUOA 2NY2D 4BQBA 1CF8H 2X4SB 5LBSH 3ZL4H 4KMQA 2Y72A 1FGVL 1A3LH 3MLRH 4Z7VB 2NY2B 5DD6B 4P23A 4ONOA 4RMQA 5CLWA 5IGXL 5DQ9A 5KSAD 4X7DC 4XCNB 5ID0B 3KPOA 3JWDC 4UT9H 5BO1H 1J05A 1DFBH 2AP2A 5C08D 3UBXI 3S3JA 5IROA 5JQHC 1EUUA 1HSBB 3JXAA 3RDTD 3B6SB 4IHOB 5D6DC 3T77B 3LPFA 1JP5A 4J3TA 5C09E 4KJWD 5J89A 4LPXA 4HK0A 3UYRL 1T80A 3AM8C 1BZQK 2XG5A 4XP6L 4HS6B 4JVUA 3HZKB 5F93C 3DX6B 1KJ3H 4M43H 4QGTA 2IBBA 3QUYD 3EFFA 3L9RB 2D4DA 4U2YA 1HK6A 2WQ8A 6FABH 1AFVH 1X5JA 5K93A 4AEIH 5L2JA 3BP5B 1U6AL 3QUYB 2OTWA 3QH3B 1N8ZB 2CK0H 4HX1A 5CD5D 1T5WA 4RA0C 3WE6A 3X12A 1S3KH 2HLAB 3V5KA 3G6DH 2BY1A 1FHGA 2YPVH 3MV7D 3LRGA 1IC7H 1MAML 5IR1A 5CUSL 2CDEA 4XAKD 4YIQA 3G5YB 4RMWA 2YWYA 4YH6A 3S4SA 2VIRA 1IEAB 4TVPL 4N8VB 3L3KA 4XPGH 1LEIA 2RFXA 3UJIL 5C0FB 1YY9D 4P23C 1UG9A 1N6VA 1QFWH 5INDA 2FX9L 1XF3A 5DI8B 4XNQB 5DK0A 1JPSH 3BP6B 3O2VL 4OTXL 1L6XA 4CDHA 4X7TA 2EE2A 4NN6C 5E2WL 1KTLA 4C56A 2R1WA 3PHQB 5SWSD 3V6ZB 2ORBH 4QRSB 3VXNB 5B38A 3LIZH 4X6CF 1ZE3C 5TDOA 3J7HA 4MSWA 2Z92B 1PKOA 3VXUA 1UA6L 3KPLB 5F9OH 3N9GH 1J1OH 2P5WE 4EXPX 4TVPE 5HPOA 2IFFL 4W68A 1IGYA 5AWNL 5CMAB 4P2OB 2ATPB 3H7BB 4U6HA 3D85A 4DFHA 2VSDA 1IQDB 2P7TB 1D7FA 3MV8A 3CFDB 2BSRA 3TO2B 2LFGA 5HHMD 3MRLA 4NM8H 3VJ6B 1T89C 1RZ7H 2GTWB 4GRLD 4HUWB 4MNGE 5I6XB 5JOPE 4WNQB 5ISZB 2DQIH 3FMGL 5EUKB 1CIUA 4IJ3C 3VFMA 4OKVB 5GS0L 1KN2L 1XGTB 1KCRL 5B8CC 1WCQA 1X4XA 1CTNA 3N1FC 2DQGL 3MCLH 2ESVE 5DT1H 5BMFH 2R0KL 4Z7UB 4FXGA 3FQUB 3T2NL 3LN5B 4X80L 2CQVA 2XWTB 4H25A 3KPPB 1WBXB 3DX9A 2HFFB 3SQBA 1NGZB 3IDYB 1CDYA 4H20L 1IM9B 2OI9B 2YPLB 3P9WB 5DWUH 4Y5VA 1WBZB 5J11B 3QXWA 2VH5H 2F58H 5GGVL 4ZXBC 4L3CA 4PGEA 3BYYA 5J7CC 3GM8A 2VDKL 3D2UD 4LOUD 4LLWA 3QDGB 4G9DA 4M7JH 5HHQA 3MRJB 1Z3GL 2ZOKB 1KJMA 1ND0A 3ARPA 3D39A 4LVNC 4QRPE 3Q0HA 2VKXA 4XZUA 4QRRE 3Q6GH 4PRDB 4R2GD 3VXMA 1B6UA 4MNGB 3DX6A 2PYED 2QQQA 1T2QL 2GK0A 3FB6B 4ONGH 1YYMH 1TMCB 1A6WL 2JF1A 3VGGA 2YMXH 1IEBA 4MA3A 1QR1A 4KHXL 5D7SH 1MOEA 5I1AA 2IPTL 4OZFB 5CJXC 2X4TA 1ZWIA 3X3GH 4LKCB 2FSEA 4M03A 5I18H 3HE7C 3P0YH 4WY7H 4XTRC 3PABB 4LGRB 5ALBL 1MUJB 4LHUD 3TBYB 2VLLB 1T04A 2NY4C 2X1XR 3QIUD 5GS3A 3EYSH 3BKCL 3TN0B 1AIFB 2P7TA 3SE4A 1KPUB 1M7XA 4D3CL 1A47A 1MVUA 4KJQD 2GJJA 2W59A 4Y5XC 5ITFA 4LLVA 1EERB 1IC5L 3RUGF 1OF2A 4IS6A 5CBEA 1XIWA 3G6JA 3TIEB 1FNGA 1QFUH 4YC2B 1JV5A 2MQ3A 3GO1L 4HFUL 1UZ8B 5FIEA 4WRLA 2GCYB 5GS0D 2LQRA 5SV4A 3U4EB 5EU6A 4KZDL 3PDOA 2VXQH 4K07A 1YEHH 3UDWC 4WVRA 5F1NA 3MRRB 4OTXH 2VDKH 43C9B 2FH8A 3D2UB 3UBXB 4EN3B 3QHTC 5ETUB 2E6QA 1YDPB 3TV3L 4U6TA 3DMMC 3DYOA 1U95A 2E9JA 1Q0YL 2IANE 3JVGA 1U8OA 1PKQB 1LP9E 1ZXQA 2JKXA 5T5NF 4E41A 5EO9B 5I66A 1ND0B 4F9LA 1C8PA 2DI7A 4M02A 1KB9J 3G9AB 5FGCE 1PG7X 3VXUE 5TE6L 1XGQA 1FFNB 1OCWL 1MCNA 4XNZB 3P73B 3BDYH 1UZ6E 2B1AL 3QSKB 4WEMB 3HFML 5CJQL 4I3SH 1ZGLM 4GW5A 4Q9QH 1J10A 2V2XB 4I3SL 1LEGB 5IB5B 4QHNB 1X5LA 4O2CB 4KV5E 5B38G 1B4JL 3FO1A 4KUCF 4AENA 3WN5A 1F2XK 2KZWA 4NN5C 4D3CH 2C7UB 2UVEA 4HKJB 5EG6C 2ITDA 3LN4B 2OZ4H 4WO4B 3OJDA 3STLA 1IC4L 4F8QA 5A2IH 2MWCA 2YD1A 4P5TD 3RPIA 4CN4A 3C9NB 4Y0GA 1NUFA 2AJZA 1N0LA 1GPOL 3QUMH 2JJTA 3QI9B 4GMTL 4PJFB 4EI5D 1DQJB 4KJPC 4U1SB 2X4OB 3TZVC 2HT3D 2P5EE 1N59B 4QXUL 3CDFA 5DS8A 1VFBB 2AEPH 4UINL 5MERB 4BQ6A 4FHBD 1MCOL 4X6FB 4Y16C 2F74A 5IHZB 3GJFH 3ZE2E 2QKIA 5JW4R 3FB8A 4DCQA 1F42A 1RFDH 4U2ZA 2F54B 5FYJH 3H42H 3AU1A 5D8JH 1EO5A 1WBYA 5TQ0L 3WDHA 4NQDA 5TDNA 2NR6C 2NY1D 4WFGD 4QNPE 3BN9C 4JRYB 1B0GA 3SDDD 3O41A 4Z7WA 2FIRT 1C5BL 4WI3A 3PWVB 4LCWD 4JLRB 4U1IA 1WAAF 1NJ9B 4AMKL 3GJEB 3BQUD 1LE9A 1BIIB 2PN5A 4JFOB 3MRQB 1S7VB 4JHAH 3OKNA 2FD6H 4G6MH 1HHGA 4N90E 5DGRA 5LGKA 1AKJD 4ISVB 5I73C 2YPLE 1K3ZA 1EHNA 1RIUL 4UAOC 3UX9B 4OKDA 3RBGA 3ARQA 1QLRB 3AGVA 4XTRD 3TWCH 3MLSL 3WV0A 3ES6A 1JGVH 2VJXA 3SBWC 5FO9B 4GKSB 2K1MA 3IJSB 4EUPB 3C5ZA 1BVKA 4LLUA 3O6FB 5H94B 2YPKA 3GB7A 1LK3H 2P5EA 1LO5A 1MJUL 2IQ9L 5HGDB 3MV11 3LQAL 2FBJL 4ENED 4Z7QE 3HE7A 3JVGC 2Q6WB 1LEIB 3QDGD 1T1XB 4PGBA 4XVUC 1SY6L 4NN7B 3K7UA 1XF1A 3RTQB 1MLCA 3L3DB 1CLYH 4LSRH 5EOCH 2RAMA 4ZFFB 1S9VA 3H0TA 3DUHA 1H3UA 2E8YA 4ZAKC 2WW8A 3KG5A 1WFNA 5JORA 2ZOLA 1ZLVK 3TV3H 4RA3A 1U58B 4DVRH 4KRLB 3FO9A 2L7JA 4HXBH 3WJJC 4WUUE 2PXYA 1SBBA 3NIFF 5E00B 4GAJH 1IEBB 1JHLL 1MCLA 2VXUL 4XP9L 2GSIA 4RWHA 3T3PF 3VFTA 4MJIB 2C4FU 3CH1B 1BBJB 4Q2ZB 3RKDD 2AI0L 2HRLA 2PNDA 1GZQA 4RRPG 2DI9A 3D3VA 3ARDC 5A16A 4G6ML 3V5DB 4WJ5B 5I1GH 3PIQA 1KJ2A 5DRWB 1FN4B 1CFVH 5FK9B 1G7MB 4JFDA 5SWZD 3O2DH 4F9PA 2P44B 3R06B 3T0ED 4PG9B 3QBTB 2IJ0C 3BVNA 2Q76A 1CFVL 1NCCL 2DLIA 1PVHA 3JSSA 1OGTA 3LSOB 2EZ0D 3RX5A 1A2YB 1C5DA 4LMQE 3BVNB 2Q76B 4TSBL 1I1FA 1LD9A 4PP2A 1MHPH 2PKDA 1DBKL 4IRZH 4KV5F 3F5WB 5I16A 2ZUSA 4EBQL 3MUGB 4FQHB 1NCWL 5FOJA 3UJJL 5DMKB 1S9YB 1A9EB 3N1MC 2FJGB 4M7KL 2D2OA 3MLWH 1J0YA 1GHFH 1A6TB 2FX8H 2EDDA 3ULVE 3VFPB 3DNKA 2C4XA 3MFFB 5E2VL 3KS0J 5DMGD 3DVIA 3JTSA 1PD6A 1L6ZA 4OLYL 5DD0L 3INUL 3L95A 1DQML 5GGRB 2UZYB 2VLME 1QFWL 3EOAB 3OKKB 3VH8B 2BNUB 3D6GA 1KG0A 1L9MA 4HJGA 1C08A 4HXAH 4QRTB 4YQXL 2BNUA 2WWMC 1AHWB 2VDQH 2E7HA 3IVKA 4ZOBA 3HPLA 4OFKA 3HB3D 4POYA 5SX5K 3KYOB 1EAPA 2R4RL 4QWWD 2H2SC 4EDWH 4NKOB 1KLUB 2OTUB 1INDH 2AJVH 2WNGA 4K8RL 4V2CB 1FLTX 4GG6F 2HWZL 5L0QB 4EZMA 3PGDB 5B22A 3BWUC 3IJYA 3WS6A 3E6HA 4QRRA 2Q3AA 4P5KB 1FZKA 4HT1H 1W0YT 2F5BL 4X98B 4AIZA 2XWBA 1CE1L 3WUWA 5C0FA 1GCFA 4YHLH 5DD3L 4FOMA 1FYTD 2L0DA 3QCVL 3TNMB 3SGEI 1FNSL 5F1KC 3WXVH 2A2QT 2VWEC 1KENL 3BIAX 1RHFA 5DK0B 4JQXC 3AMLA 5LGJB 4DW2L 1YECL 4E0RA 2R15A 4D0DA 4S1SH 1YJDC 4DZ8A 2V5RA 4M6NL 3LKOA 2XXMB 2Y25A 1EFQA 3ZDYF 1CDCA 3DECA 1P7QB 4PJFF 2F54A 4JFXB 2C1OB 3WUZA 4Y19A 4C83B 4PJ8D 4LVNB 4YHNB 2P43B 2PYEB 4DGIH 4XBGB 2ZSWA 2H45A 5DF0A 2VITB 1KN4L 2OJZL 1ETZB 1LO0H 2W0LA 4PRPB 3BQUB 1OW0C 5JZ7D 3SCMB 1TTUA 2CGRL 4FA8A 2X4NA 2EDXA 4MAUH 5C0CD 2QV2A 1I8IA 5EIVA 5F7DA 1CD8A 2NXYB 3Q6GL 2PUQT 3MRFA 2DBLL 1QYGH 2C7UA 4LLQB 3BZEA 5GGSB 1SBSL 4LNRA 4O58H 4WWKA 2ZUWA 4K8RC 2VL5A 4H1LB 3MV9B 3PWNA 4PG9A 2MNUA 4QHLB 1UCTA 4QT5B 1RZJC 4YHZH 5ANME 4YFDB 3C9NA 4OKVA 3CK0L 4JZJC 1KPRB 2WBJC 3U9UB 4O2FB 3O6FA 9CGTA 1UM6L 4NQEA 1NBZA 3C5ZB 4NBYB 5T3ZE 2XYCA 4TYUA 3VXQA 2FWOB 5T1MA 1E4XL 4MYWB 2VABA 1MY7A 1D6EA 3HE6A 4R0LC 3RWIB 3I75B 4KDTC 4MJIA 3LKSB 2HJLB 2YWZA 4NZUL 1NKRA 2KKQA 4POZD 3GSQA 5D7IA 2V5TA 3MMEB 4IDJH 1Q94B 4MLSA 1CI5A 4HUKB 1MAMH 2YUVA 2A38A 4R0LA 4K94C 5FGCB 3VXUB 4LIQL 4IRSD 3RY4A 4Z7WE 1XZ0A 2GJZB 1B0RB 3N50A 3IDYC 4H1LG 3IKCA 3BEVB 4O02L 4P2RD 1U8HA 2OJEB 35C8H 3KWWB 3MRHA 4M4PA 4TVPH 4XPGL 3LQZA 5CHNA 2EDOA 4U6VL 2ED7A 4XPFH 4WI6A 2ATPA 5BV7L 1RJYA 1U8HB 4Q6YA 5TF1H 4HWUA 4Y1AA 2ZPKL 2NLJA 1P6FA 5I1DA 3ELAT 2X1OA 4KJYA 5DSCA 5CJOH 1CR9H 3BE1L 5J12B 3ARGA 2VLRD 3OKLB 1FL6A 8CGTA 2F53E 1N5YH 2EEAA 1U8JA 1U42A 1FE8H 3QIUB 4U1NA 1UA6H 5EUOF 2ZG2A 3FZUC 2AK4A 3JV5A 3OSKA 3U48A 4FFWD 3BXNB 1G1YA 3LIZL 5HHMB 3O8XA 3MA9L 1QFWI 4TPRL 1FZKB 1K6QH 3RVXD 3T3ME 3TEUA 1GXEA 2FX7L 1BX2B 5I8KL 1K6QL 1U9KA 4Y4FD 2VE6A 4M7ZB 1FRGL 3BPNC 4RGNC 1KYOK 3T3PE 1YNLH 4XAWH 2YR3A 4CNIA 4XHQA 1MQKH 4NN5B 3L3GA 4Q9QL 4LSVL 1JNHA 4JAMB 5H2BA 1JWSA 3V0VB 5KS9F 4Y5VB 3HRZB 4U1HA 2AKRA 4WW1B 2VYRE 4R96B 3P3YA 1Q1JL 2VUYA 1CFTB 5D72L 5DZNA 1CQKA 4HUUB 4PD4K 5CZXD 5HYSB 4NNPH 4OB5L 3RL2B 2ZUVA 4JM4H 4P2OD 1NANI 4ONHA 2RCSL 3V79C 3JWNC 4QHUA 4HFWA 1KLGA 1FNHA 2VZ1A 4LPUA 3V8OA 2OTWB 3QUYA 4MHHI 2A6JB 2ZSWB 5FYKE 4OGAD 3RPKA 1YEGL 1DANT 1J8HA 4V1DE 4D0BA 4QRPB 5IMLA 4KVNL 1I1AD 3OZ9H 3IU3A 4UDTA 2EC9U 4M1DL 5DJZB 1BOYA 4ZQKA 4PRPD 4FABL 2NW2A 1ZEAL 2W60A 2Z91B 2VLRB 4MXQC 4ODHH 1OSZA 5L88H 1XH3A 3DTXB 4PJ8C 1ZOXA 1R3IL 1WFTA 1BP3B 4ZO9A 4O2EA 1UM5H 4CVZB 1FPTH 4H1LA 2BNQD 1JGDB 3WJJA 4JGUA 4U1LB 2D0GA 4HC1H 2IBZX 4HBCL 3MRNB 1KIQB 4AENB 4KHXH 3D5OF 3T0WA 1FYTA 2N7BA 4XVSH 3CZJA 1W2KT 5ITBL 4M5ZH 5EOTB 5LXGH 1C16A 1RUAH 1SEQL 4NKDB 4IIQB 2VB5A 2ZCKH 4R4ND 4FNLL 4JHAL 1JI1A 4KPHH 4JY4A 5C07D 1AXSA 3U46A 1KEMH 5I1HL 3C6LA 4YHNA 1KCLA 1DN2A 4GJTB 2LV4A 1ZLSL 3ULUL 2DIJA 4QHKJ 4LCIH 3QUXD 2VDOL 4HKBA 5CZVH 2Y6SC 2EE6A 5EZJA 2D31A 5GS0H 3WCYA 3PGCB 4XCFH 2MHAA 5AD0A 4XCEB 4D9RE 4PJAA 1SJHB 1NMBL 3B9KB 4ZUSA 1UVQB 4JM2B 4C56B 3P4MB 4NN7C 4NRXB 5IJKA 4OZFG 3T0EE 3HAEB 5D2NA 2IPUK 12E8H 5EBMA 1DDHB 1F6LL 3R0NA 4LFHD 2F53A 1X5AA 1QFUL 3IDJA 5HPMB 4S0SD 1FLRH 3GGWB 5CIPA 4EVNB 1UJ3A 2HKFH 4NP4L 3MV8D 2F58L 1MCBA 2H32H 3QXDB 4P57B 3G6JF 3IAPA 1FIGL 3LEXA 4K3EL 1LE5B 1WQVT 4XMPH 3E2HC 3QPXL 4PY7A 4XPBH 1TDQA 4JG0H 5J11C 2EXWC 2YPKB 3GB7B 2J1KA 3BP4B 2X4QA 4I0CC 4HIIB 5ITFB 4FQIL 5J57B 4WUUD 3QCUL 4KAQL 4LPWA 1YY8B 2X4RA 1DUYA 4KHTL 3U7YH 1J0HA 1U8MA 2CR3A 5C0EB 3X17A 2J8UB 4IMKC 2D7PA 2IPUG 3Q1SL 5DUPH 3OKMB 4WV1A 2R2HA 2XPGB 3QDGE 5I71B 4KPHL 2JB5H 4GOSA 3IXTA 5FUCC 1KEML 5I1HH 1JL8A 4PRHA 4E5XB 2AXGB 3I75A 2V2TA 3S34H 1FVCB 5BW7A 4Z8FL 2Z8VC 4APQD 3P9LB 4PTTA 1N8ZA 1OTTC 4NO2B 3SCMD 3VFVB 3MRGA 2P46B 3TWCL 1DQQB 5KOVC 1HSBA 2NY4B 1JWMB 1IBGH 1NMCC 5C9KA 3BEVA 4GG8B 1CFBA 3CCHB 4M1GL 4PV8A 1ZSDA 1B0RA 2I07B 1T1WB 1A9BA 3CDCA 4GRLB 3BO8B 3ALWA 4RMTA 1IC4H 3TH3T 3T1FB 4B50A 3LEVH 3NZ8A 1K4DA 1RJLB 1HHHA 2F15A 3AMKA 2VDML 4NGHL 4H5SA 4TTDD 1F4AA 4XXCC 4ORZC 4ZAKB 3CSBA 5F71A 5JNYA 3V4UH 5EBWB 4D9RD 3RVVD 1DQLL 4IDLA 5F7EL 1I1AC 1RFDL 5FCUH 4M9PA 3WFDL 2VITA 5IQ7L 4JEGB 4X7TB 1S78D 1DQLH 1XCQB 3MLTB 5E8PA 4WJ5A 2DICA 3NH7L 4PRBB 1JWUB 2A0LC 3D0LB 4K9EL 3X14A 5D7LD 3ULVC 2X4SA 3NIGF 5CAYB 1JPGA 5C0AD 4RIRB 2JCCB 4O51A 1T2QH 5DEGB 3GZKA 4QXWA 3WEXB 3QT2A 3HA0A 4DJMA 4MNHB 1BAFL 1J0KA 1HEZA 3VGFA 3BW9B 1EMTH 4PJXE 3QDMD 4WTZA 1FYHB 1CXEA 1U95B 3VD5A 1HDMA 1H8SA 3QULB 3U7WL 4UT6H 1TTGA 4P2OA 1F6AB 3K4AA 3L7FA 3B83A 4EI6A 2BZDA 3EO1B 4MD5B 2DQUH 3PWJA 2XZAH 3HCVB 3HI6H 1CFTA 4OD3H 3GSUB 4KY1L 1S9VB 3OKEB 1I85A 1UVQA 4JM2A 2Z8RA 5F9WB 2BSRB 3TO2A 4MSWB 1HQRA 2DD8H 2ICEB 4HKZA 1K5NB 3MFFA 2ADFH 3VFGL 1GGCH 1TVHB 5JO5B 5T1KD 2I60L 5D2NE 4HZLB 3R8QA 1GGTA 2IQAA 4R6UA 1A6AB 1YDPA 4PV9A 3RZWA 4OCRH 2AABL 1ZT7A 3A6CH 1YNKH 1NLBL 4OCYH 1AR1D 1MQ8A 1D5ZA 4Q7DA 1A7NH 5TPWH 2QADD 4ZUUA 3IRZA 2VXQL 3CPLA 3VFWB 1T0NB 4NFBA 2XWJA 3QDJA 5A3ID 5KTEH 1OY3B 4YXKH 4DVRL 4X5XB 3JWOL 4EJ1C 4HIJB 3S4SB 2BC4A 4HKBB 2W9EL 1DBMH 2E9WA 3RWHB 2E3VA 1T0MA 3CX2A 3TESA 3G08A 3BPCA 2VAAB 5TDPB 5CEXB 2AI0H 4DEPC 3PP4L 5D1QB 5BRZD 3MX0A 5BW7C 5E4EC 2GFBA 4OCLC 4OLZL 3MLPA 4X6FA 1DN0A 2A9NH 4WFFE 1MI5D 2I5YL 2ZCHH 1E6JH 5ALBH 2A9NL 5I75C 2FJFA 5C1MB 1JGLH 2QSVA 1A1NB 1IGMH 5IFAL 1BJ1H 1LK2A 3SKOB 4PRAB 2ZCLH 1MPAH 3FO0H 1W72H 1ZHKA 4HMCA 2O5ZL 3L5HA 1Q0XH 5DS8B 5IBTH 5MEND 2Y23A 5J1TC 3QDAA 1TETL 3X13B 1FSKB 1H8NA 1J1PL 1WITA 5JUEL 1LK3L 1UQSA 2KZ1B 3BT2L 4PS4H 1CVSC 3TA3D 3GFUA 3KLHC 1UM4H 3QCTL 1PZ5B 2LVEA 2UYLA 3FB8B 2GTZA 1CXIA 3OMZA 1ADQL 3RHWF 1UH2A 1CDUA 1H0DB 3QEHA 3VJ6A 4Y4FB 1AKJA 1E28A 4AJ0A 4OZIB 4Q6IC 4YXKL 4FFVC 2UUDH 3JWOH 1N64L 2WINA 5HY9A 3M1BA 1YYLL 1T66C 1QSEB 3BQUC 4R90L 4HGKC 2Z31C 3PXJA 4LMQI 3T0VA 4RBPH 1ZHLB 5DJ0A 2YC1A 2AW2A 5JHDE 4TRPH 1XR9A 3WJLC 5HI4C 4C56D 4HXAL 4N8PA 2R56L 5I8OH 1M6OB 1JTTA 4OIAA 1YN6B 1MLCB 2WUBH 3LKNB 2A0LD 1FO0B 4JPKH 1G9EA 1U91A 3HI1A 3PGCA 3GMPB 1YEKH 1KIPB 4KI5C 4P46B 4HWZB 4NUJB 3B9AA 2W91A 1UWEL 2YA0A 4AMKH 3JWOC 4S1RH 2H26A 2Y7QB 2J88H 4RSVA 2VAJA 3ZZ1A 4J23A 5DYOB 3RAJH 3R4DA 4L4VB 4AT6A 4FFYL 2CKBH 1C08B 2VXTH 5CIPH 3BKJH 1Q9OB 1T3FB 2XOTA 4Z0XA 5JLZA 3RVWC 1QRNB 4QGYA 4ZFFA 5IBLD 1J12A 3SE3C 3Q5OA 3VD3A 1UT9A 1WWCA 4W6YB 1QBML 1YQVH 4FFZL 1D5ZB 4G9FD 4A6YL 4M4RA 5T3ZL 2X4QB 4XWGL 2W92A 4KTDL 5CUSH 5GRZA 4BM7A 1UENA 5ERWA 1JYXA 3KNBB 4UIMA 2UYLB 1UACL 4NPYA 4G8GE 4K23L 3MLTA 4KRMB 5LBSL 3RKDC 3T0EA 1DQMH 4LGPB 5DXWA 4UBDC 4K23H 4C59B 4NDMA 3BXNA 2ILLA 1FL5A 1QUNA 5HI3C 43CAA 4N8VG 4DVBB 3ZLQC 4PB9H 2G75B 1C1EL 1L0XA 5MEQA 3QUKA 2J4WL 3FL7A 5T1DL 5A3IC 2HLFC 3DO7A 2BSTA 1N4XH 2CKBB 3HS0B 3PWPA 4PB9L 4JO4L 2ZJSL 4TQEL 2J4WH 3RGVB 2XA8L 2PTVA 4OM1H 3PGFH 1ZHBB 3FB5B 2MQ0A 1G6RL 1HCVA 3H9ZA 1BQSA 3Q5TA 3HC0B 4AM0B 3L5JA 4S2SB 1FE8L 4U1SA 3LEYL 1C5DB 3C2SA 4IIQC 3RWDA 3DIFB 4K3DL 5DLMH 4TUJB 5ELIA 5IMLB 4QXGH 5SX4H 3HI1B 4L9LA 5F96L 1L7IL 2JIXD 5IVZB 1G7HB 2AJ3A 3LN9A 2BJML 2EH7H 2BVOB 4JRWA 1IGIH 3D85B 3DVGB 2LU4A 3X13A 5F96H 3WFBH 1DVFC 1A6UH 4Y5VC 1Y0LB 3OKYA 1ZLWH 1A7PL 1NC4A 1QEWA 2AJYH 4EXKA 3H6JA 4GRWF 3NIGE 3Q5YA 1ETZA 3TBWB 3PHSA 4LSUH 4Y5YA 5IW1B 4IRZL 4J4PD 3UPAA 1SJEB 1Y18B 3GSNL 3VD7A 1I8IB 3D9AL 3ARDD 2NY6C 4NOFA 3IDXL 4NZUH 5HGGS 2DM4A 4G5ZL 4GT7A 4AIZB 4XBEH 1E6OL 3WFZA 4W6WB 5FUOH 1U92A 3RU8L 1ZLUK 1GOFA 4KDVA 1UXWB 35C8L 3OJDB 3MSPA 1SJXA 1DZBA 2VLJE 4GMSL 4MNQD 3UAJD 4OZHB 5BS0A 4MNQE 2FZ3B 3QEGH 2EH8H 3IFLH 3GI8H 4U6YA 5FYJU 5FYKH 3MGAA 3SN6N 3QEGL 5I17A 1KCSL 4QHNA 4O5LH 3FQXB 4Z7UA 5FM4A 4BFIA 4D0DB 3KPSD 2CH8A 5LGJA 1LO5B 1RU9H 2VMFA 1HINH 5F9JB 2NTFA 1R3IH 5L2KB 5EBMB 1NCNA 2BK8A 4JPKL 2P45B 5F9JA 1XGPB 2DMCA 3AY4C 3EYOA 1BF2A 1NAML 4WI5A 1J1XL 4R2GB 5DK2A 4B5EA 4MS8D 1PLGH 1DVFA 1G0YR 1T22B 4ODVL 5DQDL 1ZT1B 3CK0H 4A2MA 1PLGL 1D5IH 1EVTC 3H7BA 2YKLL 1MLBA 4YZFE 3PABA 3SDAC 1R3HB 4WTZG 5C86A 1BBDH 5GISL 1CFNA 2HVJA 2D0FA 2QL1A 5KSUA 4PY8I 3K8KA 1CE6B 1CG9A 4CJ0A 1BFOB 3HAEA 4CMHC 3ME0A 2UWEA 3CDYA 4X83A 3W81A 1QRKA 3OJVC 3QFJE 4QHMA 4A2LA 4MHHG 4HHAB 4RMUA 1K5NA 2LU7A 3D9AH 5ALCL 2V5YA 3KLSA 1T7ZA 3WE6B 1A22B 1UKTA 4OUUB 5F7LB 3K74B 1S9WB 5HGBB 3OL2A 1SEBA 3RI5F 4OAWA 4BZYA 3QFDB 3O3AB 3S5LA 4EI5A 3H8NA 2Y07H 4JFED 5FKPB 5C2UB 2ADIB 2VABB 3GSNB 4WGWB 4MD0A 3MNWB 1G9NH 2F19H 2X42A 4JZNA 2DJSA 4H8WL 3W9DA 4KVNH 4ZYKA 3MNWA 3P4OA 4JO2H 5F6HJ 3VGDA 3DUSB 5DJ2B 3GIVB 5EN2B 4I9WE 4PGEB 1RUKH 1INDL 3F62A 1W72A 3QA3A 3IXTB 1JZ2A 1VENA 4G9FE 4Y16D 4G42A 4X9IA 3GHBH 3ZE0F 4E42A 2E7CA 4JQIH 5ITBH 3MPCA 3QIUC 1D5IL 1J88A 4MNGA 4DGVL 1AC0A 5JNYB 1BFVH 4XPTL 2QADB 4RZCA 3RWFA 4MAYC 2NY1C 5IW6B 3QRFM 4NQXB 1BBJA 3F6LA 3LHPH 1I7ZA 2O93L 1PY4A 2FCBA 5CJQH 2J6EL 1IGYB 3T1FA 4M7ZC 5E8DH 4Z78A 2VLRA 1X44A 3BO8A 2W07A 1X6NA 3MJ8B 4HULB 4OLVH 5GXBB 5D72H 5FCSH 5EBWA 2BDNH 4Z7OE 1A1OB 2WM0A 1CDIA 1WLHA 1P2CB 3MBEB 4GW5B 3SOBL 2P5ED 1IL1A 4OT1L 1R24A 1YY8A 5T5FL 5D1ZA 5C70A 1JNHB 4JAMA 4JPWL 1M7IB 4P5KA 3G6JB 5FUZL 1N3NB 4XNQA 4NP4H 5DHYB 5DJAB 5E9DA 4M61B 5D93B 1MELA 1PKQE 4WW2B 1G9NL 4BFIB 1A7NL 5KVGL 3LPGA 4DQOH 3WMSA 3KDMA 5L9DL 3I85A 5DDHB 1FG2A 2OK0L 4TSAH 4UNVA 5I9QB 1P6AB 1YPZF 3L3GB 1HOCB 4CW1A 3L3JA 4K3EH 5FCUL 4PD4J 4EOWH 2PXYD 4JR9H 1MRDL 3EJZC 2IALA 4N0FB 4JCMA 3L3JB 4EI6B 4KHTH 3U7YL 3RWGB 1A3RL 3RY5A 1E27A 2AQ2A 1MFCH 4KQ4L 4HPYH 1RUQH 3CPLB 1VGEL 5J8OA 2PW2A 1ZMYA 5KW9L 2H6PB 1G7LA 4Z0BH 2VDLH 4KI5F 3QFJA 2VISA 3IFOB 4PLJC 1N7MH 1DEDA 4AL8H 2UWEE 5EZIL 2OSLB 1NBZB 5F9WC 4P3DB 3MLYL 4PV9B 4WUUB 3AVEA 3DRQB 3MOAL 2ZCLL 2IAND 4YHML 1ZVHA 2VR5A 1L9NA 3U0TB 1BVKB 3CX5J 5C08B 5A2JH 4X9GA 3AS2A 3WXWH 4Z8FH 2IADA 2ITDB 3BUYA 3RKPA 2DQJL 1TZHA 5BRZE 5JW3H 4XHJD 3Q2CA 3FQWB 4H25B 1A7BA 2V2WA 4JZOA 2DTML 4LCUB 5HVWA 3ROLB 1NBVL 1FVDA 5GRJH 1ZV5A 1KFAL 3A6CL 3QJFB 2VZOA 3HE6C 3C6LD 3EHBD 1U3ZA 2WBWB 5KVFL 3GIVA 5EN2A 3OPZH 4PJAB 1JK8A 4Z7UE 1YQ2A 3VXRA 3WHXB 1U8LB 4Z95L 4P99A 1FL5B 4RCAA 3WFCH 4FP8L 4L9DA 3GKWL 3B4NA 1HWGB 2LTQB 3A0OA 3D87B 5L7XH 3WFCL 2BSED 1MAKA 5GRVL 3WNOA 5J0BA 1VFOA 4DZ8B 4Z18A 5KVDL 1S7RB 4WENB 2YXFA 5E8OB 1JJUA 1BD2A 3THML 4AEEA 1NCUA 1P4LB 4DUXA 4OAWB 1YJDL 1A6WH 4PG2C 5I75B 3LAFA 3LEXB 3BUTA 4IHOA 4NO5A 4HGMA 4W70A 2FIKB 5EIIB 1MCHA 4BUGA 4H5SB 1IAOA 4NO0D 4QF1A 4R7DA 4Y5YC 1P1ZA 4AY0A 4OSUL 4Z7QF 2PYEE 4HWBH 3C5SA 2OLDA 3LKOB 1S5IL 4ZSOE 5AZEL 3RUGB 4PJIF 4KY1H 4QRRD 4WU7A 5DJ6A 3UTPE 4QRPD 4LASL 1QEWB 2VN7A 2EYRA 1JFQL 3MQIA 5JPNB 5B21A 4IBLT 3LPWA 3OAYK 5F88B 4WUUA 4LLUB 5EO1A 2D7OA 4XB7A 5CJ8A 5C0EA 3FO2A 5F6IB 4HWZA 1IC5H 4PJ5B 1PX3A 1R0AH 2XTJE 3PP3H 4KU1A 3MNVA 4NFCA 2NQCA 5GQBA 1HHKA 3K2MC 4R4NC 3REVB 2X4PB 4YDVA 2WANA 4KKAC 1YNKL 4S11A 5DA4A 3R1GL 3REVA 1AHWC 3TFKD 1SM3L 1J86A 1INQA 1S8DA 3C09B 3VH8A 2HTKC 3CZFA 5BCAA 5L6YH 5K59F 1OLZA 3INUH 4LLDA 4Y19D 2F5AL 3ILPA 4M6OH 4F7TA 1P9MC 2ZP0T 4AEFA 1I3RA 1UGNA 4WHYG 5EA0L 2B0SH 1BQHA 4BK5A 3PP4H 3IFPA 5H8DA 2NTFB 2HP4A 4I3RH 3WLBA 1I8LA 3TBVA 1JMZA 3LKQB 5C0CA 1G7JB 5DGQA 3O3DA 4BKLA 3TIDA 1JTOA 4HGWA 3LEYH 7CGTA 4TVPD 3B3IA 3GSOA 4NHCL 5H35A 2DIBA 3JZ7A 3NGBC 2EE3A 4DN4L 5KW9H 1RMFH 2B1AH 4Z7NF 2Y36L 2I5YH 1OGAD 4WGVB 5DUBA 4HWEH 1LILA 4ZS6C 5IEKB 1OTUC 1AHWA 4LASH 3SPVB 5JW4N 5FYLL 2CDEB 1RJLA 4OI8A 1Y6NR 1XMWA 3O6LL 3PIQB 3KPQA 5DRWA 2DRUA 1E4KA 4ODWB 2A77H 3S96A 1QSEE 5DHVB 4EBQH 1GPOH 1Q0XL 2K9UA 3U9PH 2K7QA 5I66B 1I1FB 1LD9B 1KCVL 4PP2B 1DN0B 2W65A 3PF2A 4ZODA 2AKRB 1FIEA 5C0IA 2CRYA 4P23B 4P2QE 4HS6A 4UMGA 2BY0A 1IAMA 3RDTA 1AJ7L 3NCEB 2RB8A 3VG9B 4NQTA 2ICWA 3H9YA 4MJ5B 3CSGA 3MV9E 3SCMC 1HH9A 4KWUA 4M6ML 1NEZB 4F9PC 5I1JH 1R6VA 4N90D 4UTBL 4ZS7H 3BUYB 1G6RA 4JRXE 4P9HH 4ODXA 5FA4B 2GYSA 4CU8A 2P5WA 5ENWB 4JZJB 3MRBB 4FZEH 3LN4A 3STLB 1FFNA 4LLYB 4F8TA 3KLDA 2WBJB 1DCLA 1PW3A 4BQ9A 1YEKL 4HUUA 2GTZB 4U1KB 1FNAA 4MQXD 4NHCH 2JB5L 4QHLA 3CXDH 4X5LA 2E7LC 3BHBB 3DMMD 3RVTC 3VW3H 5E8EB 5GRUH 2OTUA 4GUPB 3TVMD 4ODVH 1FV1B 5C09D 2HFEA 2NY5L 5BVPH 4CMHB 4YNYA 2I9LB 4JKPH 3LRSB 3CNKA 4X8XA 1C7TA 1BHGA 2MMXA 5CWSB 3VFNA 4MWFA 1JPFA 3TBTB 3WNKA 5DTFA 1A5FH 3EBAA 4YX2H 3IXAB 5J1AB 3MMEA 3T4YB 5DVKA 2NY6B 5EU5A 4L5FH 4OV6F 1LP9F 4DGYH 1QNZL 1MI5A 1VKXA 2BNQE 1U2HA 2RHEA 3HZYA 1QNZH 1MI5B 2KPNA 2GJZA 2YBRA 1LDSA 5DMKA 4PRPE 1BD2D 2M1KA 1R5VA 3QXTA 5GJSL 1MWAA 3W0WD 5D7IB 1OTSD 1I3VA 4QO1A 3FAWA 5T1DH 1D3CA 4F7CB 3QO1B 1QLRA 3IAQA 4H8WH 3DGCR 3FOLB 4I0PB 2HJFA 4HH9A 1IRAY 2VDNL 2VXUH 3O3EA 5F3HB 1I7RA 3W11D 4JPVH 3S6CA 4KK5C 1AR1C 1ULVA 3DARA 1KV3A 5DMIH 4M7LL 4R8WH 1TENA 4JPVL 4MX7A 5GS2H 1V8HA 3UZVB 3O2DL 2BJMH 4HPOL 3KR3H 2NXZC 3CMOL 1XAUA 3T65B 3RIAK 3TN0C 2XI9A 2A1WH 3KJ6H 5I1CH 4M1CD 4NNXB 2GUOB 4MZ2A 2I60H 1U58A 4HJ0C 4CN6A 1Z9MA 2OL3B 3PXHA 3MACL 4JJ5A 2XPGA 1MHEA 5C0BA 1OHQA 3KPPA 1V3KA 1INEL 4BSVA 1IE5A 2UY7A 4OCYL 4XCFL 3PG2A 5HGHB 5FYLE 3HMXA 4G6AC 3W9DB 3FQWA 4KI1A 4BQ8A 3GK8L 4NO2A 1GZQB 1P7HL 1EA9C 3P9LA 1PEZA 4N0YL 1KGCD 1VKXB 3Q3GB 4PLKD 4OT1H 3OHXB 3SKMA 5C0DA 4FQPA 4I4WB 4YEFA 4PJ8B 5IF0A 2OL3L 2YBRB 2XG4A 1DTUA 4NQDD 3VXSA 5KVGH 5D5MA 2VDQL 5L9DH 4ESKA 1PG7W 1V7MH 4MA1B 1I9IL 3OZ9L 4MZ3A 4HV8A 3JBG7 3RVXC 3P77B 3F58H 4ZAKA 3I6GA 4LHUA 1CBVL 4PB0H 4EOWL 5E08L 3QWRA 2FYYA 2VAAA 3HZVA 1NCAL 4LVEA 1ZA6A 4F37F 1EIBA 1QBAA 1VB9A 3M45A 1A9BB 2EDYA 3CFJB 4P4KB 2NTSP 4Y4KB 4OCXH 5HHXH 3FCTB 2XQYG 2ARJA 2FZ3A 1K4CB 3E1F1 2PF6A 1AD0A 2Z31D 3QUXC 5E7BA 3FRUA 4GBXC 1P53A 3LHPL 3PWPD 3G08B 3NFNB 1G7IB 3VFSB 1MRFL 5DHYA 3HE7D 4G6KL 1F6AA 2DQIL 3FMGH 3L7FB 1G7IA 3HG1B 1SJHA 5DR5H 4X6DE 5D71H 5C0CE 1N59A 1NAKH 1LO2H 1OSPH 1U3YA 1WC7A 1SYVA 1AGCA 3L1OL 5GGTL 1EHXA 3MLXL 4NC1C 5FUCE 3TCLA 1LO2L 1OSPL 1AQDA 3DVFA 3W5NA 1CF8L 2FR4B 4XCNA 3CSYB 5E99L 3FOMB 3T8XA 3VCLB 2RQ8A 2MCPH 5FO8B 1H5BC 4Y16B 5B4MC 3MV01 1A6AA 5HHME 5AEAA 2DLEA 1BOGA 5DWUL 1AXTH 3VMOA 3MRBA 1NCDL 2X1PA 2X4TB 4I4WA 5IF0B 1V7ML 2EXWD 2NW2B 4YHIB 3ZKMD 4ODXB 1HILB 4X4ME 1MNUL 4HIEB 1ZHNB 3CH8A 2FB4H 4RGOL 1UQSB 1MUJA 3TBYA 4L3EB 2BERA 1NBYB 1JUFA 1GL4B 3WIFB 4RGOH 1FNLA 2HYMA 1Q9WA 4XPBL 1ZGLA 4OJFL 3IDJB 3MJ9H 1VHPA 5JTWA 4YDIH 3ZYIA 3HI5H 2PTUA 4PJDB 1AKJB 1E28B 4P9HC 1AY1L 5GPRA 4TVSa 5J56B 4BKLB 4YXLL 3HI5L 5EU7C 2YMXL 1J1OL 1KCUH 2VQUA 5CFHA 2FX7H 4N0RA 4O4YH 4Y2DD 5I74B 4PJAE 5HYJA 4GW4B 1Y6MR 3ZE2F 5C6WH 4APQC 2L7UA 5D2LB 3SY0B 4IOIB 1KJ2B 1A1MB 4X99A 4PTTB 4MA7L 2IG2L 4R9HA 3SDAB 3NIDF 2AJZB 4KK6D 3HI6L 2NNAA 1KENH 2NY2C 4JM2F 4YHMH 5ALCH 5AUMA 3MLSH 4GG8A 4GAYA 1JHKH 2DJUA 3WKMH 1Z9OA 4UV4H 3EDDA 1HZHL 3MLXH 1D5MB 3TM6A 4KKCC 1LEKB 4P2CG 5JW3L 4RFEA 2LAAA 5IM7A 1BVLB 5DRNB 4XAKE 4MQTB 3SE9L 2V2TB 4AG4L 2DQCH 5FA3A 5CINL 4QHMB 3IFNL 2BSSA 4FQ2L 3P11L 4TNVF 5I76A 5F7WC 5FUZH 5JPNA 3LRHA 3AREC 4N1EA 4PY7B 1AGEA 2CLRB 3OAUL 1SEBB 1I1CA 2HT3C 3ULVD 4MLIA 3C5JB 3WYRA 2DQTH 3QUYC 4GRMA 2D9CA 1S9XA 1EK3A 4CU7A 1WEJL 1WF5A 2GW5A 2W9DL 3A6BH 1JPST 1J0ZA 1ZHLA 4LBEB 5C0ND 3EDKA 5EU4B 3CU1A 5E5MA 5AYQA 2ED9A 4BELD 4Z0BL 1W8NA 3Q6FA 4XC1L 1DUYB 5C0BE 1E6JL 4RAVA 4Z6AT 5JZ7C 2AV1B 4PJ5A 2OJEA 3KWWA 3MRHB 4N1HB 2VZSA 3FHQA 4YNYB 4ZPTA 5IHUL 2DTSA 2V7HA 3G6JE 1U91B 1I3GL 2ZOKA 1NPUA 2XICA 2FHCA 4CAGA 3FONB 2ED8A 1Z5LA 2XZAL 5T1LB 1AXSB 2Z4QB 3HZMB 3GMLA 4X6EB 1X3DA 2FO4B 5CEYA 4X4XB 1A8JH 4UT7H 3HZVB 3VXSD 5IJKC 1MCKA 2FATH 3RWFB 3QULA 1TNNA 3C60B 4OBRA 3ZHDA 4NOBA 1U36A 2F54D 3RIFK 1NUNB 5KS9B 3IYLW 4FG6D 5IJVA 5ADPH 2XRAH 3FTGB 5C09B 2EDEA 4NGHH 4M9OA 3ARRA 1NLBH 4RFNB 4KZDH 4U1IB 3UTQB 4M48H 1OT2A 4DEPB 1MCCA 3BMVA 3V52H 5HDOA 2ZG1A 1VADB 4F15B 1XCQA 2EDLA 4JO2L 4JFFB 3T0DA 1CQYA 3D3VB 1BQUA 15C8L 3GMNA 3MRNA 1WWBX 1NGPH 4FQJL 1AQKL 1KCKA 2W9DH 4ZDHA 2V7NA 4YDIL 32C2B 1SYVB 2R2BB 4ALAL 1T66D 2UUDK 1C7SA 2PYFA 3EDJA 3NGBB 5BOZG 5B8CB 5SWQB 3ZE1E 1HKLH 5E2UH 4JFHD 3O8XC 5LAXB 1J8HB 3X3GL 4P23D 4CW1B 3G5XA 5BVPL 2YPLD 1RUPH 1RIVL 4LLMB 3HC3L 3MLYH 3WNPA 4OFVA 4Y8AA 2AS5M 1ZHNA 4QOKE 4PUBL 3RWDB 5HTSA 4XNMB 1IQDA 3JV6A 4ZXBB 2YZ1A 3MJ6A 4P59L 3EUUA 1VERA 4IRSB 1IGFL 3WSQL 4GS7B 3EYSL 4G8GB 3I2CH 4Y4FC 4KI5E 1MEXL 1IGFH 43C9A 2GI7A 5JR1H 3T1WA 1Q72L 1V3MA 3F65A 2VLJA 1ZT1A 1F3DJ 4LHQB 2H9GB 4X7SH 4G9FA 5A2LH 5IVXA 5CD5C 3FT3B 3MO1B 1NBVH 3TYFA 2PXYC 3C8HA 4RAUA 4KTDH 4R97B 3LN5A 3L3IB 5B39G 2DYPB 2ZKHL 2H1PL 1KXVC 4JDTH 1HQ4A 3L5XL 5FYKU 3NBNA 1A02N 1DBBL 1LP9A 3HPJA 4JCLA 1QFPA 1QBBA 1UB5A 2DYPD 1YN7A 3L5XH 3GKWH 4YHPB 2MSPA 1T03H 3IB4A 4Y1AB 2PR4H 4PRHE 2HFEB 2FNBA 4GG6A 5FO9A 5C7XH 3BEWA 2D31B 4K2UH 1KN4H 2OJZH 3ECBA 1JNNH 4XGZA 1FZJB 2HAZA 1WISA 1IAIM 2MJWA 4E0RB 5DUMH 5ID1B 3PV6B 1JPFB 3TBTA 2ZCKL 3PJSB 1IM9D 1QYGL 5TJWK 4OF3A 1I1YB 2EDTA 2GIYA 1PY9A 4IOFC 4MAYA 3I6LE 3TYGH 2F74B 5IHZA 1G0XA 5K9JL 4PRIA 3GMRA 1L7IH 3S98A 1EO8L 2NY5H 5MEOA 3DUSA 2VDOH 1U8KB 5F7YC 1EFXA 1RIUH 2XA3A 4NO3A 4ZXBD 1RURH 1T21B 3NIDE 4YHKH 4WI4A 3RGVD 1OP9A 1AGBA 2CKBL 1UJTA 5CS7A 2BP3A 3VXUD 5BQ7A 5KZCD 3HUJB 3HRPA 2XZCH 5IV2A 2GK0B 3FB6A 4J4PA 3TJEH 1J8HD 1WUNT 1G6RB 4CKVX 2HRPL 1X6LA 1XCTB 3RWEB 3WIHA 3OJ2C 3C5SB 1GZPB 1Q8MA 4M7LT 5F6IC 3TCLB 1YPZA 4LU5L 5CBAB 1JZ8A 4TUKH 1KCVH 1QACA 2BFVH 1NMAH 4HIHA 4M8VA 1IT9L 4FMKA 4KTEH 2X89D 1JYNA 2H2PC 4HAGA 5DZLA 1P4LA 3QEHB 3EOBA 4MNQA 4XXCA 1LVEA 3FKUS 3VH8G 5J6HB 3BZEB 4ORGB 2L4OA 1CU4H 5TF1L 4ODTL 4YQXH 1VFAB 5FYKL 3TH4T 4GAJL 3BRGC 4FQJH 5DRXB 3U2SB 3TPUB 4MGXA 3NZHH 4NQED 3RFZC 5I1JL 1ZLUH 4YZFF 2NY7H 3IDMA 3BKYL 4O2FA 5GGQL 4AEHL 5LQBH 1G6RH 1A9EA 3BKYH 4N5EC 1S5HA 2FD6L 5ESVB 3C6LC 3FJTA 2QLVB 1XF4A 1FZMA 1B0WA 4OGXH 3AAZA 1Q38A 4IM8A 1DVFD 4L1HA 1CZ8L 4U1JA 3IJSA 1BFTA 1I3RB 4KK8C 1N26A 3KYAA 1ITBB 2YD4A 2JB6A 4U7SA 3HC3H 3FFCE 4B0MM 2DQUL 4Q6IA 4XP4L 3GMRB 2R4SH 1Q9OA 5JLZB 1CCZA 3BZ4A 2A77L 4RDQG 4KK9D 4HD9A 2AJYL 1MHPL 4UU9A 4QRRB 2A6KA 2WIIB 5IKCB 2YHGA 4YBQC 4G80A 3QIBB 3VA6A 1GIGH 2GSGA 3QG6B 5T3ZH 3D3VE 1MFDH 5DO2D 2E6PA 5JIHA 3WUWB 2V6HA 1GIGL 5HVHC 2DLFH 1GAFH 4MVBC 1N6UA 1J9CT 3VXTB 4JFFD 2ARJB 1R3KA 3VRIB 3NN8B 1GGYA 3DV4B 4YR6A 3M07A 2B4CH 4KJQC 2EIZA 1O5DT 5F7EH 5HYQB 3BIBX 4R3SB 1YEFH 2FDBP 3WHE0 1MF2H 3QIUA 3AM8A 1H3PL 1ES0A 2GKIA 1ZWIB 3S9DB 4JO1H 1DSFH 1RIHL 5BJTA 5FEBA 4I77L 3VGBA 1R5WA 1N4XL 1RZIB 5B8CA 2XIDA 1K8DB 4G8GA 3VXRE 1MHCB 2ZNWA 4PJEA 5CILL 4HXBL 3NCYP 3PWLB 1CFQB 4PJIA 4OQ1A 3TH2T 1RUKL 4YPGA 3ZYJA 2BVEA 2CRZA 4L3AA 3S8WA 5DQ9B 3WD5H 4Q0XL 5JW5A 3JV4A 3U46B 2BVQA 3EAKA 3RDTC 4APQB 2CK2A 1ZTXH 4LAQL 5DI8A 1D6VH 3SDAD 4YXLH 3FRPG 4HSQA 3L7EB 3EO1A 1GRWA 2G9HA 1J1XH 5BZWB 3K0WA 2GITA 1WFUA 4XWOD 2P1YA 1II4E 1EEQA 4U05A 2FJGA 5LG1A 1BBDL 5GISH 2BNRD 5IBUG 2AXHA 2CDFB 2A1WL 2Q86A 5IBTL 4JRYD 1GYAA 4HFWB 4NQCE 4DN3H 5C6TL 5C0AB 1IQWH 3EOAA 4P4RA 1OB1A 2LAGB 4NSKA 1BZ9A 4H0HB 2FRGP 5DJZA 1UM4L 3QDMB 2H32A 2BHYA 3TNNA 5E1AB 5I1LB 2G2RA 4Z7UF 3MUZ1 4JN1L 3SJVD 4QEGA 4K7FA 1GSMA 1HHHB 5HHOD 3DX8A 4YO0A 2DKSA 3LMJH 2GK2A 1TJIH 3VDAA 4TRPL 2VE6B 4GRWE 1JPSL 5EPMB 5ICXA 3IFOA 3UROR 2VQTA 4OQTA 3BPOC 4RISL 4NQEE 1S7SA 3ARBB 4ETYA 5E08H 3TP4A 1BQLH 5C07A 1U8QB 1JI2A 2AJVL 1IGJB 1EFXD 5E9DE 4MAYB 2NY1B 3C8KA 4I2XE 2R8SL 3RIFF 2BCKB 2XQBH 4G6JL 3BRDA 3OGCB 5HI5D 2Q8AH 3O3DB 4TPRH 4F9LC 5I71C 5GSRB 1BJMA 3AROA 4X8JA 4F7MB 2IFFH 3JV4B 5GRUL 4UNUA 2HWZH 4YHZL 3GSRB 4PREA 3NTCL 3OAYH 2J12B 5C0RH 3OB0H 2FECI 3EO9H 4X9BA 5F3HA 3NTCH 4YHLL 4RAUB 3SDDC 2X41A 4GRMB 5JOEA 4R7DB 4WFED 2VR9A 4JHWH 1YMME 2X89A 1CLZH 1DDHA 1Q1JH 1CK0H 4MD4B 3GSNH 4GRLC 3SDDA 1BVZA 1YQVL 1S7VA 3CVHH 1JHTB 1M05B 1IC7L 1ORQA 4NCC2 2MKWA 4K9EC 4ZNEA 2R0WL 1A7OH 1H0DA 2XFXA 4FQCH 3CLFL 4YR6B 5FM8A 2J8UA 3TVMC 3EZJB 4LSQH 4FXKB 3IF1A 4M1GH 3LKRB 2BXZA 4N0YH 3BGMB 3MROA 2XKUA 3CLFH 1JMXA 1NGYB 3RU8H 3ARGC 1QSZA 4RGNE 2SEBB 2VZUA 1T04B 4JRYE 4EN3C 1KSRA 4GXUN 4JRXA 3UCRA 3LMJL 3TPUA 5ESQA 5E1AA 5HHNA 4ZTPL 1VFAA 1JWUA 3D0LA 1BEYH 3ARZA 2HMIC 1NBQA 2VQ1A 3KPSB 3QDJE 4EN3A 2AERT 2EDJA 5M95B 3V4PL 3BZ4B 4DGIL 2R0ZL 3MV9A 2DWDB 2R1XA 4QT5A 5C71A 5F7KC 1NGZA 4KMTL 3OAUH 3O11A 1N5YL 4FQ1H 5FKAA 5TQ2H 3MLVL 4K94L 2AK4E 2N4IA 1JGEB 1EJOL 1F4YH 1UWXH 3QDGA 4G9DB 4JJ5B 5HHQB 3NAAH 4BZ2H 4WEUD 4K7PX 3MCG1 4ELKA 2QR0B 2Z4QA 4PJCE 1IAII 2VC2L 3IFPB 5FFLA 3CFKA 3NVQA 4WWID 2CK0L 1EO7A 4Q97A 1MQKL 4GS7C 5CBAA 4UDTB 4AH2B 5I0ZA 3ULUE 4D9QD 3CFKB 3VWJD 3QWOA 3M8OH 1Y18A 1LGVA 3QEQB 3W11C 4IDJL 4Z7VF 4YDKH 1MCJA 2IG2H 3BJ91 5EFIB 1MCPL 1Z2KA 2RIKA 1EVUA 3FB5A 5E00A 4QOKD 3D3VD 5HGAA 4ZUVA 2OQJB 4FQQA 2R0KH 1TCRB 2X9XA 3ETBF 4JFEB 4JFHE 4R26L 1G9MH 2I26N 1DL7H 5B3NA 5IBLC 2ZWLT 1KLFA 5FO7B 1BEYL 4U1HB 4XPHL 1UWXK 4XH2B 3PWLA 2JK5A 4GMSH 1HXYA 4C54A 4F15C 2DB8A 3FFCD 3BD4A 1H5BB 1NCBH 4XPFL 5I30L 5GZOD 2ERJC 4MXVF 5L6YL 1NCBL 1KT2A 1UEMA 3S37X 3OGCA 3CSYA 3ULUD 2Z92A 4UIKL 3PQYD 1KACB 3BAEL 3H9SE 5ICZA 2NYYC 2HTKD 4K2UL 5J6GB 5DQDH 4CJ1A 1HHJB 3KR3L 4I3RL 2EEDA 5ICZB 4BFBD 2GITB 4JQIL 1EGJL 1WEJH 3K80A 5MP6H 5HBBA 4GKOA 2J5LC 4OFPA 2OX5A 4QRTA 2CIIA 2COQA 4DKFH 2VC2H 4NC1E 3BH9B 2APTA 3DSFL 5GZND 3MR9B 1OP3K 3SDXB 2VZVA 4MB4A 5F89B 1KYOJ 4U33A 4PJHB 3WHE1 4D0CA 5DURD 1MCFA 1GOHA 4ONFH 1R3KB 4DTGH 5CSZA 4IRSC 1YMMA 4CVXB 2EDWA 1RIVH 3OG4B 3VXSE 3BIKB 4LPYA 4Y4HA 1MRFH 4JQVA 5CGYD 1QFOA 2HT2C 1ORSA 5JXAH 3DSNA 3QDJD 1S7WB 4YIQB 1TZIA 3WS3A 3U36B 3EHBC 3V9FA 1QR4A 4MWFB 3FQTB 1C16B 1OAQH 3RTQC 4V1DA 3MRQA 4KKAD 4NNPL 4PJ7F 4X6BA 5JPMA 3CLEL 2X1QA 4EUPG 1A1MA 1V7NH 1A1OA 5DJXA 5EU7E 3VRLF 4XPAL 4PGCB 5GGVH 3BHBA 2EYTB 4GBXD 1V7NL 2HKFL 1JGDA 4ZYKB 2CUIA 5GIRA 3RJDA 1IKNA 5AUMB 4CRPA 3TGXA 5JHLH 1DQJA 2W0FA 3ARSA 4OZ4B 4WFEE 3O3BA 2O61A 1N64H 4M48L 2W0FB 4OCSL 4F57H 5ANMB 3PL6B 5ESAB 2BX5A 3ARDB 5DVNA 3FN9A 5JIIA 1HH6B 4Q2ZA 5CZKA 2W38A 5HYFA 1QHPA 1XR8B 4RWYL 3QPQC 3HC0A 5LQBL 1NC4D 1TZGH 2MPAH 1HKLL 4ZS6D 1DE4A 1OTUD 2P24B 2EYSA 1T7XA 2QQKL 4J6RL 1IEHA 3LOWA 4LKXA 5GZOC 1SYSA 2HFFA 5IVZA 4NZRH 1KXTB 3MV7B 4HG4K 3NABH 4PUBH 4OLVL 3ABZA 5E8DL 1I9JH 3GMOB 2D7QA 5GGSA 3HN3A 4ZUWA 5H2BB 4JREC 1KTKE 2VLKA 4KGJA 3V4VL 3VFUB 2WMPA 5JR1L 3Q6FB 2WBJD 1N2RB 4L3ED 3H9SD 3TFKC 2A73A 3S5LB 3SJVE 2VZTA 2VERN 4GKZB 4P5TA 2GUOA 4MXQD 5BS0D 4Z5RB 4NQVB 2ZUTA 1MFDL 3VDCA 1RVFH 2E9BA 3RL2A 1BZ7A 2XRAL 4KUZH 1DLHA 4F80A 3LEVL 1NCDH 1AD0B 2OXGA 5J1SC 1QVOB 2QJDA 2CLZA 5TFSH 1DBBH 1NUDA 1PAMA 1I9EA 1KB5H 3HC4L 5E5UB 4LCCB 1NMAL 3GM0A 4PRIB 1LMKA 4XNXH 3FAXA 3MREB 1IT9H 3HRZA 4JKKA 2EKSA 4MJID 2E6JA 2WIIA 3O9WC 5IKCA 3SGDH 2Q7YB 3OHXA 1PYWB 1JCKA 3G9VA 1T03L 1CU4L 4XP9H 5IVXE 2V7HB 1KPUA 3VWKB 1RZJH 1AQDB 2R1WB 3V6ZA 1EAJA 4NKOA 1S7UA 2MPAL 2J2ZA 3TYFB 4LARH 4AEHH 4GUPA 4LCWA 4NJ9H 4D9QE 4UTAL 2X4UA 3O0RL 4N0CC 3TBWA 1JIBA 1N3NA 5E9DB 2MTPA 3BDYL 3E6HB 1G7PB 1S5IH 1DP0A 1JZ3A 3QUZA 1FZOB 3DX7A 5IG7A 4GG6B 1YMHB 4U1LA 2AK4D 3SOBH 4OF0A 4PJHF 1JF6A 2CDGA 5C2BH 5HHOB 1VADA 2CD0A 4F2MB 4ODSH 2HFTA 5GSVA 3QCTH 4FQ2H 4HDIA 4NNYA 3IDMB 2QHLA 3P11H 4NKQB 2CO7B 3S36H 1HXYB 1WICA 5BXFA 1NAMA 5KJRL 3KPRD 3I84A 3HMXH 5IP4A 4I0PC 1CGSH 5C0IB 3ARFD 1HI6B 5IHBA 3VE0A 4JHBA 3ARBC 1J18A 4O51B 3PL6A 3DI3B 5FF6A 4X6CA 4UINH 3TCXA 5FAAA 3DWTA 5IOPA 2GT9B 3JUYA 4S2SA 2G9HB 3B6SA 4NSKB 4U49A 2OR8A 5C7XL 3WS3B 1DEEA 3MBXL 2MFNA 4L9LB 1IGCL 2X70A 2VDPL 3QHZH 1FQ9C 5DC4B 4O9HL 4I18B 4PJAF 4EDWL 3U7AA 1IZJA 3STZB 3SEPA 2JCCF 1WC7B 4D0CB 3NCJH 1J87A 1KIRA 5DEFA 1I1AA 4YHPA 1I3GH 1T6WA 2QR0A 1D6VL 5SWZB 2PETA 4HGWB 3MOAH 3MNZB 2BC4B 4N9GB 5DD1H 4HPOH 4UT6L 3D0VB 4G8FA 5CWSA 4NNXA 3O4LB 3MJGX 4WNQA 4XRCA 4GAGH 5JW4Q 3L3IA 2XY1A 5KSBB 3CX5K 3IU4L 4P5MA 5DUBB 3QWOB 3FONA 3VGEA 1VGKB 4NDMB 5ANMA 4HIEA 4OIIL 2WWKT 2OZ4L 1NEZG 5GRYA 4JHWL 2F8OA 3DETC 5E9DD 2FJHB 4NT6A 1KIUA 1PFCA 3EYQD 1VEPA 3KPMA 5CJ5A 3RWHA 5GIRB 3ULVH 4CVUA 1YEJH 3OR7B 4OV5B 2YK1L 1EFXB 4LSQL 3EYFB 2FBJH 2NX5E 2Y6SD 5D4QA 3SGJC 5TFSL 5KTEL 3ES6B 1EUTA 2APFA 5J12C 4LLDB 4FP8H 3HB3C 3SDCA 4HWBA 1QRNE 3ALXA 3GUTA 4S1QH 2DM2A 1OT1A 4WW2A 1IKFL 4U1MB 3BPOB 4BK4A 3PJSA 3ZDXF 1IJ9A 4F3FB 1AXTL 4KDWA 3WL9A 3QAZC 4K9EH 4FQXB 1UB6A 4LP5A 1Q94A 4WIQA 3NA9H 4WI9A 1Y0LA 2HH0H 2BY2A 5D8JL 5J9PA 3BDXA 5KAQF 2A6KB 4P4KC 3U0WL 1BLNB 3IT8D 4YWGH 3U1SL 1NGWA 3RZCA 5I76B 1BREA 1HIMH 3ULSB 4D8PA 5K9QG 4UQ2A 1AR2A 4K3JH 2IGFH 2HT4C 1D9KD 5F21B 1IFHH 3CFJA 4P4KA 4G7YH 2BNRE 4L8CA 3SO5A 1BD2E 1ONQB 2NY0C 4HJ0D 4E9LA 4Y4HC 5FYLH 2WBJA 4P0DA 4A6YA 3ZDZF 4ISVA 4Y2DA 1XGUA 4XP6H 2Y36H 4YHOH 3SDDB 4TTDC 4DK3A 3IU4H 2A73B 1T1YA 4LRNL 4LLMA 3SE8L 4NYLA 4ZFOB 4U6XB 4QNPF 3O6LH 3VXQB 1A0QL 2YD9A 1CE1H 5D1XC 3PUCA 3P0VH 2E7MA 3VG0H 2P47B 1KJMB 5C0BB 5TE4L 3WIHL 4OZIA 1UEYA 3V6BR 3TJEL 5HDLA 3TVMB 3UTZB 2AXJA 4M7KH 4ORGA 4G6KH 3X11A 1YZZA 2GJ6A 4FFZH 5EUOA 3T0BA 3P0GB 5J6HA 5DVOA 1CL7H 1UYWH 3FFDA 1GH7A 1NCWH 3KVQA 3EW3B 3X11B 3HAEH 3PNWA 4PJHE 4OGYH 4Y16A 1HSAB 1CN4A 3ORJA 3RL1B 1R3LB 2DJ4A 4YBLC 3UTSE 4OF5A 3QHFL 1HWHB 3IFNH 4HUNB 3SKJL 3U30C 3C60A 2R2EA 4M62L 5EA0H 1T0NA 2WP3T 1JHLH 5EFIA 1YYLH 3CUPB 1E27B 2IF7A 3UZEA 4IMLA 3G5VA 4LCWB 5B39B 1NCAH 1IGCH 4NO0A 3IS1X 3DV4A 3CIQA 5E7FA 5CP3H 2BVTA 5CP7B 2ADGA 1DQQA 3E0GA 1JF1B 3QUMB 3WN5B 4UILH 4JFFA 4X0KB 4LAQH 4QRPA 4MJ4A 2GFBB 4PJ9B 5HYJB 1I8MB 1LEGA 4QYOA 2CIKB 4JFPB 4PJEB 1Q9LA 1K8DA 1IKNC 4HLZG 4UB0H 5E2JA 2PO6B 5FYJD 1BJ8A 5D1ZD 5ERWB 4GAGL 3MRRA 5D7IE 3KPLA 4JFDE 4LSTL 1UM6H 5CKGA 5I8CB 3VFSA 2VL4A 3OKOB 4Y7MA 5D7LA 2UY6A 2Y5EA 5CGTA 3V95A 4PJBE 4WDIB 4I1NB 1KTLB 1INEH 3O6MH 4PGDB 5L2KD 1R5WB 1RZIA 2Q8BL 4HCRL 1VESA 1CICB 2NY0D 3L5WA 3P4MA 5D7IF 3GSUA 3O2WH 4U1KA 5GJSH 5GSRA 4EIGB 2B7DT 4XB8A 1OGAE 1RUMH 3L5WB 5FO8A 4X80H 3V5HB 4IRSA 5I1IL 2D7TH 3L95B 1G7LB 1YY9C 4YPGB 3K8MA 1FV1A 3NCYS 4XPAH 4HKZB 1V05A 5D5ME 2QBWA 4ZSOA 2F19L 4AQOA 4H20H 2NZ9D 2FX9H 4ETQA 3OXSB 5IGXH 2VO5A 1NL0L 4FG6C 1E4WH 1TITA 4TUOB 5FHAL 4HS3A 1TCMA 4MD5A 3VXSB 5F3BA 1UJ3C 1RU9L 1X7QB 1Z3GH 1J8HE 1RSFA 1VEMA 4MVBD 4Y19E 1OGAA 1NJ9A 1P1ZB 2O5XH 2R69H 2YUZA 3P9MA 3RWJA 3HMWH 1VEOA 1F11A 2Z93A 3BGFB 5LKNA 1U93B 4NKMA 2EC9T 1CZ8H 6CGTA 1NBYA 3GEWB 2XNAB 2MCG1 1EPFA 1MFAL 3T65A 3SJVA 4CVZA 1JF1A 3BSZL 5ICXB 4KZEL 4PLNC 4OLUL 3KJ6L 4P2QB 1IVLA 5AYUL 3QR2A 2R29H 5DQJA 4F33A 4BFGA 1M71B 1LWRA 4BA8A 2KL6A 1QFWM 3DXAA 4PPTA 2YPLA 2D9QB 3NCFB 2MQCA 1DQTA 5I1LA 4LFHG 4MQSB 3VE0B 1F6FB 5C0GB 2C3GA 1WT5C 4X7EC 2FSEB 5EU6D 2CLVB 2AJUL 1I8KA 4NBZB 5JDSA 3QNYA 3L6FA 3FO9B 1CYGA 4C4KO 4OZ4A 4MB5A 4MX7B 5BQ7B 5DRZB 4OQTL 3W5MA 4PTUB 5B3JF 3LV3B 1FBIH 2DKMA 3NN8A 5F44A 5IQ9A 4PJ9D 4L4VE 3O9WB 3OB8A 3CFDA 4ELMA 3T08A 3MRGB 3QXAB 4P9MH 1GGBH 3QXDA 1W8OA 2X9YA 5MEPB 1OAKL 4XNXL 3W39A 5ICYA 3AFLA 4D8PB 3IF1B 4KMTH 4TTGA 1NGXB 3PGFL 4M61A 4LOUC 1CR9L 3BE1H 2BSTB 5D7JB 4OF8A 1WT5A 5C09A 2CKNA 3A6BL 2BNQA 2XACC 4BYHA 4ELMF 3O8XB 3MA9H 3E3QC 2B0SL 4QXGL 1KEGL 4HMDA 4HK3N 3N06B 3I50H 3TLRA 4HEPG 5CEZH 1JV5B 4MXWL 1BF8A 1CICD 2DQFA 3LS4L 4XC1H 4RAVB 5DHVH 1A6ZA 2E8ZA 5I1CL 5D2NC 3OKDB 3UTTB 5E8EA 1IMHC 5ISZA 4TSBH 1YEDB 5EU4A 1H5BA 1T20B 5B3JE 5GHWL 4L4JA 3GRWH 3MV9D 4XVJL 4OD2A 1RZ7L 4JANA 5EO0B 1MIMH 5SX4I 3WDIA 2XKSA 1KIPA 4P46A 5IT2H 2JJUA 2ZUYA 4PJDE 5FOBB 4R97C 1F5WA 1TPXB 2Z9TA 2UVFA 3C60D 3ISWA 4HCRH 1GGUA 5TF0A 3S88L 3ZKXC 3MCKA 3TN0D 1XR9B 2HKHL 4OLYH 2VDRL 3W0WA 4XMLH 4YJZL 2IC2A 4FS0A 1CLCA 1L7TH 2DQEL 3VG9C 5CINH 1RVFL 1KTDA 3RWCB 2Y07L 3ZSSA 2G60H 2RFXB 5CSZB 5I30H 2ICEA 5CP7A 2ZSVA 1MCOH 5E0QA 4ZNCD 4OIBA 2OS7A 5JHLL 5EOQL 1RZFH 4TULH 3PWUB 1ZA6B 1WSST 1NGPL 1MY5A 1F4HA 3OF6D 3UPRA 5IW6A 2PR4L 3MRPA 2VLKB 3MUGA 5GGSY 4OJFH 4X6DB 2OI9C 3O3EB 4P2YA 1MSPA 2PYFB 3TZVD 3AY4A 4KAQH 1A6PA 2I9LA 5DJDA 5CEZL 2V7NB 2FEDC 1I7TB 2HLFD 1HI6A 1H9VA 1OTTD 2CMRH 4U3HA 4Y89A 4RQQA 2CO6B 5AG9A 2A6IB 1BIHA 1I9RH 1RK0A 1X5YA 1JGUL 1FAIL 4O2EB 2YD7A 2A6JA 3GRWL 1JWSB 1HNFA 1LK2B 3BESR 3N1QC 3V0VA 5C0BD 5A40E 4NPYB 3ZT5A 3O3BB 4AIOA 5CZVL 4NKIL 1ZVYA 1CFNB 3JV6B 4NQSB 4MA7H 1QFHA 2BVQB 4APQA 4XX1G 1ZT4B 2JTDA 3PQYA 1ZKAA 1WAAA 5F72S 4E41B 1MCWM 4TUJA 3L1OH 1JUFB 1A5FL 5ABDE 1REIA 4F7TB 5BMFL 3GO1H 1NFIA 3VMPA 4LK4A 4YDJA 1HH9B 5BV7C 1PX4A 3G04B 1ZHBA 5F9AC 4XT1C 4ODSL 3UDWA 3D39E 4KK9C 3MRDA 4C83A 2YRPA 5CP3A 4GMTH 5GRJL 2HTLC 4N0FA 3VI3F 4TUOA 2EDFA 5D7KE 3FOLA 3PDDA 4JRXB 2Z31B 1SM3H 2MHAB 3QO0A 3W2DH 4LL9A 3UTPD 4YUEL 2QADC 5TGBB 4NRYA 2UWEB 4CMMA 2CGRH 1A7RL 4NQCB 4L4TA 1FJ1B 3FQTA 4M7JL 4L8DA 3HE7B 2IH1B 1T4KB 1AE6H 3IXAA 4PJGB 5D1QD 1DSFL 1QZ1A 1RIHH 2BOCB 5J1AA 4JPIB 3SDXA 2FEEL 4I77H 1T0MB 4YGVA 4PJCA 3KPMB 1EGJA 2M8XA 3TBSA 4LBEA 3NFPB 1CDBA 1MH5B 2AQ1A 3BKML 3MBED 4EIZC 3OKMA 4WV1B 2CMRL 4P57A 4WDIA 1QSFD 4RFEB 2XKNB 1ODAA 3QEUB 3UTSB 8FABA 4NCC1 3RWIA 4DKFL 1AFVL 1PG7H 4OM0L 4PRDA 4LAJH 3VXMB 3I3EA 3OAZH 1YEIH 2JB6B 4P48A 2F53B 4NZRL 3S34L 4OM0H 3LKQA 4DUWA 4MA3B 5D93C 1QR1B 4LCIL 4LRNH 3SE8H 1T0PB 1IILE 3V4VH 5T1KB 3F6IA 3W0WE 4JRYA 4WW2F 5DRZA 3QRGH 3FT4B 1NC2D 4PY8J 1FFOA 2IAMA 4MDJB 1QO3B 2IANB 2DQCL 5E95B 5AG8A 3DGGB 3MV7A 4U6VH 4JZJA 3KLHD 5I1AB 2AABH 4I2XA 5E8NA 1ZANL 1IL1B 4ZTOH 2A83A 3WKNA 4DFIA 4Z95H 2QQLL 2AJXH 1BD2B 3MRCA 4KTEL 4C55A 4HG4J 2V5SA 3MO1A 1PZ5A 1DR9A 5E6ZA 4WO4C 3GDBA 4HUWA 3QEQA 3BX7C 5C6PB 3P30H 2ADJB 2W0PA 4FFVD 4KKCD 4ZMAT 5E70A 3FO2B 4ERSL 1IKFH 4M62H 1HILA 4OI9A 5JOFA 5F7DB 1DANU 4HLJA 3X14B 5HHPA 3RDTB 5MHSE 4BH7B 4HKXA 2YA2A 4OCSH 4UTBH 4ZS7L 1JZ5A 3FT2B 1SYSB 3TZVB 4JKLA 4X4XA 1TVDA 1UFUA 3GIZH 4PLJD 1QSVA 4O9HH 1AD9A 4MDIA 3BKMH 2FLBT 3RUGA 1C5BH 4DZBB 3V7AE 3HAEG 4WY7L 2EC8A 2XNAA 3WUWG 1VCAA 5LAXA 4J8RB 2DQHH 3PWPE 4CADB 3VGAB 4WCYH 5AZEH 2NY4D 5K9JH 5FOBA 2FEDD 4E5XA 4OD3L 4OSUH 4HWEL 1JZ6A 1EEZA 3QJHB 1W72B 4IRJB 2GAZA 1I1YA 4L4VA 5HI5C 1I7UB 2J3SA 4YDVB 2D4FA 4FXLA 1RURL 2H2SD 1JWMA 4UOJA 5C3TA 3PGDA 2FGWH 4PR5A 1R3LA 1DQDL 3LH2H 1ORSB 3DHMA 2A74B 3FOMA 1EXUB 3T8XB 3VCLA 1ZGLP 2YEZB 4UQ3B 5C2BL 3WBDA 1CLZL 4DGYL 3EYVA 2I9TB 3KYKH 5GS0C 2B4CC 2I27N 2Q7YA 3QUML 3RZCB 2YSSA 4KKBC 4FTVE 1S7TA 4NHUA 1KPVB 4WFHD 4NQDE 4J1UA 3QFJB 3TNMA 4HUVB 4X6CE 3ROOB 2H1PH 2ARWA 1N5AB 4UNTA 3IJYB 1P84J 2NY3D 3I6GB 4L1DA 1NFKA 1QA9A 4AYFA 1HDMB 2V17H 1FNEA 3JWDL 1JNJA 1EX0A 3HUJE 5DJYA 3BEWB 3MGOB 4WHYH 3BD3A 2B1HH 1X5HA 3B5HA 3C6SA 4EN3D 3TO4B 2CLRA 3KXFB 3HG1A 5ADOL 3PV7A 2QQNL 1J0IA 2VNCA 3TJHD 1Q9LB 2VDPH 3QHZL 3WFEH 1RZJL 3D1MC 2ITCB 4PJXA 3V2AR 3M17A 3O6FD 5JW5B 1BX2A 4MAUL 3PE9A 5K9KB 1ERNA 1WFOA 4ZFZB 2EE9A 4X5XA 4L9LC 5J13C 4NQDB 3QG7H 5BS0B 1EO8H 5HGHA 4I18C 3ARFA 1SVZA 3RI5K 5IFAH 2XN9D 1AY1H 2PO6C 2Q8AL 2GJ6E 5EUOE 4MA8L 1NEZA 2EIBA 5E6IB 3WHXA 1H15A 3HZKA 1LE9B 3AUVA 3AB0B 4JFEE 2P8MB 3DI2B 3GI9L 2BOCA 3VWJA 4I0PD 3NFSH 1T5WB 2UZIH 3DVGA 2YRLA 4I48B 4M00A 3JTSB 1MFNA 3UJJH 3HLAB 2DBJA 4PJXF 2E27L 5EO1B 3BH8A 2ARJQ 3P4NA 4PGJA 1FNSH 2R23B 3EJYD 5GRVK 5D1QA 4OGYL 3N1GC 3D0VA 4G8FB 1ZHKB 4ZPVA 3NACL 5FUOL 3IDIB 3QFJD 2P5WB 1X7QA 4LQ1A 5ENWA 4K7FB 2HMID 4ZQKB 1RULL 2YUWA 1EH9A 1MIEL 5D2LA 4KQ3H 3SY0A 4LF3B 3TNNB 4HS8L 4XC3H 1T6VN 5MEOB 3KYMB 1UWGL 4JO1L 5EC2B 5HYJD 1YEEH 5D7JC 4WO4D 3P4OB 3VXPA 5HYIA 5JPMB 4C56E 1NH6A 2DQDH 1A3QA 5CCKH 3VI4F 2C4FT 2AVGA 1FVDB 4PB0L 3BGFC 4Y4FA 5MI0C 1M71A 1FG9C 1MCEA 3UPRB 4MMZC 2YOCA 2M26A 1TZIB 5BVJB 1YUHA 2J8OA 3GKZA 2WP3O 2BRRH 3WS6C 1EJ6A 2O5XL 2R69L 1PSKL 4Z9KB 3FN0L 1CWVA 2BRRL 5DJ8B 4Z77A 4OZGB 1WIUA 2NY3C 4K3DH 3MRMA 3FN3A 3O4OB 4NWTL 2JCCE 1NC2A 2XZQH 3V5HA 3ARWA 2FL5A 3CVHB 4OLUH 4C58B 1YNLL 4XAWL 4ZUTA 1VDGA 3EOBB 5IK3B 2X10A 3F7RA 2VLJD 4UV7L 2IH3A 1BFOA 2Z35A 3K8LA 1FFOB 2IAMB 4MDJA 2I07A 3FZUD 4KUCD 2NPLX 3OXSA 3BP4A 1TTFA 1XF5A 3S97C 3B5TA 4M5YL 5FM5M 3MRLB 2J8UF 2H26B 2WIMA 4JO3L 3SKNB 3VA2C 1HQRB 1EEYA 1CT8B 3RY6A 2IMMA 1RJZB 5CBEB 3ULVL 2PO6D 3DUUA 3LKNA 3AU1B 3TT1L 1NGWB 5IB4B 3IGAB 2ERJB 1BLNA 5F88A 2KQNA 1J5OH 2QSCL 3LKPB 1C12B 3IGAA 1I7RB 4M3JA 1S9WA 4QXTA