1H9VA

Human fc-gamma-receptor iia (fcgriia), monoclinic
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
172
structure length
172
Chain Sequence
APPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSRLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system, membrane protein
molecule keywords LOW AFFINITY IMMUNOGLOBULIN GAMMA FC RECEPTOR II-A
publication title Molecular Basis for Immune Complex Recognition: A Comparison of Fc-Receptor Structures
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2001-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13895 Ig_2 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1h9vA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1h9vA02
2YUZA 4FQXB 1T80A 4K71C 3U9PH 3RI5F 4KI5C 5JHDB 5FA3A 2UV3A 3IDXL 2OZ4L 4XBEL 2GTWA 3P77B 1MY5A 4YHPB 2DTML 5CLTA 4MJ6B 1QLFA 1M7DB 1U95B 1JYVA 1JK8B 4OLEA 4IS6B 3VDAA 2VH5H 2Z31C 4NUJB 3MNWA 4F37F 2KUTA 32C2A 5FGCB 1ORSB 2B1AH 4K8RD 4KK8C 3WLWC 1FAIL 2D7QA 3GMQA 3FHQA 1S7TA 3G6JE 4DOHE 4POYA 4OLVL 5KG9A 3MACH 4FNLL 2N7BA 4PP2B 1YEIH 4Y5XB 3VXOB 4UNVA 2PXYC 1J0YA 2W9EL 3PF2A 4DAGL 5ALCH 3GI8L 3QDGB 2Y1VA 1G9EA 2ZSWA 4WI9A 3ALPA 3IKKA 2VAAB 3CLEL 2NY2C 3KAAA 5I8OH 5J89A 1ZHLB 2Z8SA 5CJ5A 1G6RB 3CDGB 5D6DA 1TQCB 1I7RA 3SDCB 4DZBA 3SPVB 4LU5H 2Y06H 3C5ZB 3O2DH 3E3QC 4YHKL 1T0NB 3ZDYF 3ZSSA 4YK4C 5T1MB 1AE6H 2CJUH 2H2PD 3CLFL 3I3BA 3SGJC 1HZHL 3NABH 3PGFL 4GUPB 1ZTXH 1QSFE 3FO2B 3DBXA 5BOPA 4Z8FL 1DEDA 1VACB 1YN7A 2EDTA 2YS4A 3VFGH 3TV3H 5FM5O 5BJTA 5GS1C 1BFVH 1LE5B 3V5KA 1B0GA 1X5KA 3RWHB 5J12C 3HI5H 4XWOD 2DIAA 3G5XB 3H3PH 1F6AB 1ZLVH 3FB5B 2HJFB 4KK5C 1Z2KA 4LPCA 4MNQA 1FV1B 3MOBL 3L5XH 5F9DC 1B6UA 5IMLB 3HE7C 4F7EA 1DUYB 5ADOL 4HFUH 3UTTE 3WJLC 4LSPH 5ICZB 4GAYB 3FQNA 5F1IB 1MHEB 5AWNH 1TJGH 1RZ8B 3LQAC 3GSUB 4OZIB 3VFRA 3D25A 4P46C 5CIPA 4POUB 5ANMA 3UMTA 5K33A 1FIEA 1FQ9C 3V0VA 2YD8A 3KPSB 1Q0YH 1UWEL 2CRMA 2YEZA 2FCBA 3LS4H 1AGCA 4GBXC 3QDHA 1E4XL 4Z7WE 4NC2B 5JIIA 3MRQB 1X9QA 3K2UH 5IM7B 4X8JA 3FT3A 4YO0B 1IEBB 1U8JA 2XWJB 4H26A 2OI9B 3L3OB 4XP9H 3REWA 2Y5TB 4JG0H 5FO8B 4ZAKB 2L7JA 3PWLA 3VA2C 4G8GA 1I3RB 5IFJA 1A6VL 4KXZI 3A67H 2GY7B 3S35L 4G9FD 1HHIB 1FIGL 4GQ9H 1NCAL 1IKFH 2ZUSA 3PABA 5DD3L 1BIHA 1YEFH 2MNUA 3VMNA 4RFNB 1JGEA 3PGDB 4OF8A 3QG7L 2BVQA 4HIXL 4QHMA 2ZPKL 3AS3A 2UYLA 3P4NB 3GMPB 1R5VB 3LS5L 4J23A 1UZ6E 5KSAD 2FJFB 3ZTJG 2EH8L 2Z92A 3M17A 3TF7C 4NHCL 1MLCB 3PP4L 3P4MB 4XVTL 5CINL 1LEKA 4G6FB 1J18A 3PWVA 3CH1B 1F3JA 2H2PC 4NJAL 3UC0H 3WLBB 3RJDA 3PWPA 3DARA 4PRPD 4N1CA 1HDMA 1ZHNA 2HTLC 3QPXL 3KDMA 3DGGB 3O9WD 4HMEA 5GS2H 3MLUL 2A6DA 1FLRL 5HHOD 1JNNH 1T7ZA 1NBQA 1B2WL 1HIML 3LB6C 4QRSA 5GGSY 4XP1L 3CFIC 1NGQH 1XF4A 4AMKH 4AYFA 1I9RL 5HBBA 4K3JL 2WANA 3GJFK 5DMIH 4A2LA 5F6HJ 1BEYH 1ZS8A 2BVPA 4B53A 2IFFL 3T4AA 3HAEA 4OQTL 3H9ZA 4PRHA 4OD2A 2XPGA 2VXVL 5EU5B 4ETQB 4U1JA 5LWYH 1DDHB 3I84A 1JPFB 4YNYB 3L3HA 2DQFA 2OJEB 1F11B 3BSZL 1EMTL 4YIQB 3BH9B 3EDJA 5E6IB 1WBZB 2Y7QA 3WUZA 4KY1L 1L0XA 3UXFA 4DN4H 4ZUVA 5EU6B 2H3NB 5IFHH 2YC1A 5CGTA 4PRAB 3OBAA 2UZIL 4P4KA 2X44D 2JJUA 2WBJC 4X0KB 3DOSA 4ELKB 2LABA 5HDQL 1IARB 4KH2A 1UWXH 3MBED 5L8LB 4YHYB 4JE4B 3MGOB 3FRPG 5EWIH 4NRZB 3RBSA 3SY0A 4PB9H 3AGVA 3N1QC 5CJOH 1ZMYA 3ARDD 2DL2A 4LOUC 1M4KA 2VLLA 1CXHA 2WWMC 2H45A 5DXWA 4CDHA 4JFZH 5FYJE 2Q1EA 3S8WA 1MI5D 1MIEL 2EDWA 1INEL 3WNKA 1VKXA 3HI1B 4KQ4L 2J7LA 1QZ1A 2HKHL 3MLYH 2P24B 1K9TA 1MFAH 3GKZA 1RK0A 1LMKA 3NTCL 4JPIA 2OJZH 4PY7A 4PJHB 3KYOA 5TE7H 3SE8H 2HWZL 4NRXB 4DQOL 2ED9A 4G8EA 5A2FA 3OKLA 1D5BB 2R2HB 3D87B 3S4SG 4WWID 5FYKH 1QNZL 2AI0H 1VFBB 3ZHDA 3OAZH 4JFDA 3Q2CA 3C9NB 3AS0A 4UINH 1OWWA 5TQ2H 3X12A 2HLFD 3BZEA 1CGTA 2FH6A 4WDIA 1JL8A 3D0VB 4UAOC 2OZ4A 1FVDA 3FQXA 2MQ3A 4N8VG 4XP6H 2NYYC 3TT3L 3DNKA 5MEOB 3RX5A 2VDRH 4FXGB 4U7MA 3EFDL 2Z8WC 4EDWH 2HJLB 1NGZB 2F54D 4FFWC 1U3HB 4K9EH 2NTSP 5MERB 3OXRA 4QRRA 4ZXBD 5JXEC 1JWMA 4QOKE 3QXAB 3JVGA 1KB5L 2V17H 2GW5A 5JQ6L 4IRJA 4LAQL 1S7QB 2Z8VC 4KWUA 4PRPE 3C87A 1ZLWH 1JRHH 5JLZA 4MQSB 43CAA 4JFED 4RA0C 1T3FB 5LXGL 5HHOE 2MCPH 3BP6A 2ICWI 1I4FA 1A7RH 1PFCA 1ZE3C 5I1GL 2XA3A 4IOFD 2DM7A 3W9DA 4JKPL 4HQQH 4V1DD 12E8H 4QHKI 1KTRL 2D9CA 4RGOH 5AYUL 4K55A 4RZCA 4XPFH 2GITB 5HYJD 2GFBA 3ARSA 1YECL 4I0CC 4ODTL 3TZVA 5ISZA 3TJEH 4TUKH 2ENSA 4OZ4B 3N9GL 1P9MC 3ULVF 5C7XL 4OT1H 5T1KA 1LP9E 3NCCB 2J8UB 3VXMD 2YD7A 5TE4L 1EXUB 2AK4E 2EDHA 2V5RA 2BOBB 2P5EA 1A7QL 4G8IA 4Z7NE 5CJ8A 2CO7B 3BWUC 1KLFA 4WFHD 1G7QA 4KZEH 3NZHL 3WS6A 5C0GB 5IB5A 1VENA 4YXLH 4HKBA 4PJCE 4NGHH 3LCYA 3M1BA 1UGNA 4PY8J 1E27B 4PGJA 4TSCL 3ILPA 5L2JB 1R6VA 1SQ2N 1FNLA 4XP4L 2Z4QB 3OTTA 3T0WA 5C3TA 1KEGH 3ZTNL 1LO0L 2H6PB 4HDIB 4QXUL 5I19H 4M8QA 1X5GA 2JELL 3VWKB 1RJZB 3F12B 4BH8B 5BVPH 5BO1L 4WWKD 5GS0L 2VOTA 1TCRB 2J8OA 4WRLA 4ERSL 3K2MC 4MJ2A 1MI5E 2GJ6E 3IDJB 4P23D 2YOCA 4MA8H 3SBWC 3U7WL 2NY3B 1CT8B 1QSVA 4MCYA 4Y0GA 3QDMB 2W9DH 1TDQA 2DQJL 2DQDH 2UVEA 3NIDF 5GGTL 2AEPH 3IDMB 4FQ1L 1NGPL 4ZFOL 3NH7H 4O58L 5GQBA 4HIHA 5IV2B 3MBXH 4X9BA 5MENB 1MAML 5KVFL 4YFDB 5IEKA 3FFDB 1T21A 3MRBB 2OXHA 3NFPA 3DMMC 3RFZC 3H2WA 2P46B 4H5SA 4M6NH 1CXKA 5F3BB 4YXKH 2ZCLL 3PL6B 1YPZE 3FN3A 4GRLD 4H88L 2O5YH 1D5XB 4ZPVB 5KSUB 4HBCH 2V7NB 1C1EL 2A1WH 2OMNA 3IFLH 1U8PA 4JFHD 3HNVH 3CX5K 3EO1B 4JN1L 2NLJB 4U6HB 4KU1A 2GCYA 1JN6A 2C7UA 4X5LA 4FQPA 3D3VE 2X7LA 3L1OL 2E7HA 2X09A 3V4UL 2DB8A 2IAND 1KENH 1W8OA 4NFDA 4OM1H 3TBTA 3ESUF 1MVFA 4PJIE 3B3IA 1ZA6B 3GO1H 3OF6A 5D7JB 1QBLH 5F6IB 1CLOL 3IAPA 3TA3B 3WO4C 5DF0A 3WSQL 1V05A 3RVWD 3MRNA 4XPTL 3IGAA 4J12A 1VDGA 3KPLA 3ULVH 5JIHA 3WV0A 2V5SA 4NQEE 3M8OL 2APFA 2VITA 5GRWA 15C8H 5DS8B 4NKDB 1J05A 2DJUA 4MS8C 1A14L 4GKZA 5DJYB 1NAMA 4L5FL 1NFDA 1FORL 2XZQL 4OQTA 5E9DD 4Z7UE 1AC6A 3ORJA 1EH9A 3O0RH 3PIQB 4JFPA 3EYVB 5GS0C 3DVGA 1C12A 5JO5B 3QZWG 5C09A 4MCZB 5IHBA 2GSGA 3MYJA 2GT9B 4NQDB 1HK6A 2NW2A 4X5WA 2NX5D 2DQCH 5F93C 4DUWA 3BPLC 1C16A 2X4OA 1RULL 2G75B 5IQ7L 1QR1A 2ZUYA 2APVA 4OGYH 4Y5YB 1RK1A 1CFNB 1UA6L 1YQVL 4I77H 2BY2A 4F15C 1YEKL 5I1EH 1RUML 2EDJA 3JWDH 4GAFB 3ABZA 3TBVA 3RWFA 1P7QA 1KPRA 2K7PA 3ECBB 3EDFA 2MOVA 1J8KA 3VWJC 2B1HL 5IJVA 3UBXG 5DR5H 2NXYB 5D7LB 4PLJC 2R2BB 4PJAA 4YUEH 3QUML 4C56A 1N4XH 3KYKL 2QSCH 4WTZG 2B0SL 5HI5D 2VR5A 1BVZA 3PV6B 4L3CA 2A6JB 3SKOB 4P2QB 4S1SL 5FM4A 5ID1A 4G3YH 4GMTL 4LEXL 4JY4B 5EULV 4TNVK 4X6EA 4Y4FB 1G7LB 4N1HB 4CN1A 1I9EA 2W0PA 3KXFA 1N5AA 4MJIB 4Q0XH 3MNZA 3BZDA 5SV4A 1IAOB 4K94L 3W2DL 2DLEA 4EI6A 3GIZL 1RZ7L 2ADFL 4L8BB 4N5ED 3BOVA 4M1GL 3GMLB 2FD6H 2IPKB 3UROR 2DICA 4AT6B 3MV8D 4PJ5D 1M6OA 3X14A 3HI6L 1D9KC 3Q5YA 2CIKA 4JFHE 4LGSB 5DRZA 1EBAA 1QTYT 1IAKA 5E2UL 1WWAX 2VLME 4TRPL 5I30L 4FS0A 4I8DA 4A6YL 3WHXB 3HUJE 5DUBA 3Q5TA 4IOIB 5CBAB 5HI4D 1KB5A 1A9EA 4JQVC 2NY7L 1EEQA 2A77H 2NY1D 5C0ND 1OSZA 2JCCE 5I8KH 4EUPG 1DCLA 4POZD 1BZ9A 2OR8A 3LRSA 4J3XA 3X3GL 3RWIB 2GEEA 1XAUA 1CFSA 1P4BH 4HWUA 2WSKA 1U36A 1QYGL 3GJFB 2DLHA 4MD0A 5DRXB 5FUCC 2J5LC 1HKLH 5FKPA 3UPRB 4GRWE 3C09C 4JPKL 2DQHL 1DBBH 4IMKA 3K3QA 4EI5C 4J6RH 1JUFA 4PJXA 5GGVL 1B4JH 1NBZA 3U1SH 1P7HL 4LVOC 3PWUA 3MRCB 1YA5A 5F89B 4RRPA 2E3VA 4HS8H 1T4KB 4I13B 5C08D 4NPYA 4HJGB 5E9DE 4JPVH 4LCCB 4XMLL 2FSEA 1W72B 3EO9H 1KOAA 1DEEB 2BC4A 2J4WH 5DGRA 4H1LG 4QHUA 1E4KC 1T20A 1I3GL 1EEYA 1H3XA 1XGYH 2FX8L 3I2CH 1WEJL 3RUGE 5I2IA 4PJFF 4LIQH 3L5WA 5IT2L 1SJVA 3QRGH 4FHBD 5KW9L 1JBJA 4IMLB 4MAUL 1IGYB 2N4IA 5BRZD 3QUYD 3QUKB 3MV9A 1HH9B 1IAIH 1A7PL 3CXDL 5J4MA 3E6HB 2E27H 3W0WD 4NRYA 5EZJB 4K94C 3L3GB 3K8KA 4XPBL 5DUML 4DUXA 4EKXA 1CGSH 3Q1SH 2V9TA 4LSDA 1QBML 4YDIL 4JRYA 5HYSA 1FBIH 1UKQA 3DYPA 3R1GH 3ARGB 2YPLA 3EGSA 1U8OA 4MZ3A 3GJEA 3VFNA 1NC2B 5KSVB 2Q7YB 3UTSB 3REVB 3ZL4L 2FBJL 1KC5H 4QWWC 43C9A 1YZZA 5CEYB 3H0TA 2DD8H 5GGTA 2HVKA 3QIUC 1AY1L 4P5TD 1AKJA 2PTTA 4ZFOA 1J9CT 5ERWA 3U0PA 1JHLH 1RIVL 4BQ6A 1BVKA 3WYRA 4J4PA 5DUPL 1UENA 5B39G 5FA3B 2IAMC 2J3SA 4Y4HD 1G9NH 1XMWA 3UBXI 4XCCL 4EIGB 3VWJA 3ELAT 4FABH 1V7ML 1QLFB 5EBMA 2OR9H 3S88H 3MV8E 4P5KB 1CLZH 1KF9B 1LNUB 4K3DL 4BA8A 3QNXA 4DGYH 2DWEA 1JPGA 2ESVB 2RB8A 1A3RH 1N8ZA 3CSYB 32C2B 1N64L 1CDGA 4JRXA 5KVEL 5EZOH 2WM0A 2GQHA 3GMQB 5HYFA 3GBLA 3NFSL 1DN0A 2R56H 1ZA3A 2PKDA 2WK2A 2B4CH 1FVEA 1YQ2A 3GI9L 4P2CG 1M1SA 1EDQA 1GHFL 3CDYA 4OI8A 4LSUH 2BMKA 3VXUD 2V2WA 3DX7B 2VTFA 2ZSWB 1GL4B 1G0YR 4MSWA 4BYHA 4ZMAT 2PYEE 2CK0H 5ELIA 4K23H 3R8BB 3QIWA 4N68A 2PCPA 3HLAA 4MNGA 1HYRC 3TH2T 1MCWW 5DRNA 1UKTA 5FDYA 4CADB 4XC1L 4GMSH 1PLGL 3WE6A 1J7VR 4OV5B 5KJRL 2FR4A 3QUYC 2OSLA 6CGTA 4HH9B 2BY3A 2YMXL 5TDNA 1GGBL 4XB7A 1RURL 1IGTB 3FAWA 1U2HA 2NZIA 5BJTB 5C08E 1IGMH 1YY9D 3FO0L 3JWOL 2XA8L 4GAGH 3EZJB 3V5KB 3V7AG 1B0GB 5E8OA 1H8SA 3DUSB 4NO0D 1RZFH 2ZSVA 2FEDC 4GW4A 3P11L 3ARED 1S9YB 4MNQB 1QFUH 3BKCL 4BSWB 2VXSH 1EK3A 1KXVC 5IHZA 2Q8BH 4OUOA 3GB7B 5D7IE 3RNKA 5IQ9A 1OGTA 4JPWH 4R9HA 3VFRB 2W65A 4OFYD 3D25B 5CIPB 1RZKH 5ANMB 3VXRA 4QGTA 3V0VB 3A0OA 3W0WE 5HSFA 1E6JL 5KS9E 2CUMA 4M93B 3WMSA 4PBVC 4ODBD 1MCNA 1QKZL 4Y4HC 1AGCB 4PGBB 1H8OA 1U3ZA 1GH7A 4WI5A 1FG2A 3SJVE 1LO2L 3TT1H 4ODXA 4CRPA 3V6ZA 3GBNL 3WO3B 3QO0A 2D0GA 3HC0A 4GO6B 1IGJA 1E4KA 3V52H 2BNQA 4X8JB 3FT3B 2BDNL 1Q9KA 4PJGE 4H26B 5DD6B 4JAMA 5T1LA 1C5CH 2UZYB 4KKBC 1RJYA 2DBJA 5I1KL 1I7UB 5DJDA 4G8GB 3KPRD 4BZ2H 1KIUA 3IU3A 1CF8L 4XBPA 5DYOA 1F4AA 1KELL 5JA8B 4EVNA 2AXGA 3PABB 4UDTA 3SQBA 4WEUD 1JGEB 5GS2D 4KTDL 1A6TA 1CN4A 4GXVH 2MHAA 2BVQB 1IBGH 4QHMB 4O00A 4Y2DA 3VI3F 1OB1A 1PEZA 2UYLB 3U0WH 2DIBA 5KSBA 1EUTA 2Z92B 2EC9T 1KULA 3M17B 3MNVB 2CUHA 2QADB 3S35X 1CCZA 1UG9A 1KN2L 1H3PH 3PWVB 4CNIA 1F3JB 1Y6MR 5C2UB 5K9JL 5J56B 4LHUB 1ZLSL 4AH2B 2ORBH 2WUBH 3U46A 3QB7C 4O2FA 2JJTA 3MA9H 5TPWH 2Q3ZA 1DL7H 4O4YL 4XI5D 2IPUK 4JFFA 3OXSA 3KDMB 1DE4A 3B2VL 5B8CC 1YY9C 3T09A 4BQCA 1S9KC 2EYSB 4YHOL 2X89A 1KJ2H 1YMME 1A6PA 3JWOC 4WFFD 2AJXH 4I0PC 3TIDA 1QLEL 2IAMA 4RGND 4NZUL 4JM2C 4Z7VA 4K7PX 5L2KA 1DUZB 4MQTB 3GSQA 1NPUA 2PUQT 1UH3A 1A3LL 1WAAA 1NANI 1ZANL 4JQIH 1U8NA 1TJIL 6FABL 1B90A 4UTBL 5SX5K 2ZOKA 2Z31B 4OFKA 1OPGH 4PP1C 4IM8A 3V7MA 4YC2C 3GSXA 1ZS8B 3QQ9C 2BVPB 2W0FA 3PQYA 5CP7B 5C70A 2Y23A 1PY4A 3HAEB 2VDKH 3MRDB 1EFXD 2ERJB 4U33A 2XPGB 1BGXL 4Y16A 1FZKA 2PXYB 1BD2A 5D1QC 4U1JB 5AUMB 5AAWA 3B5GA 5IHLB 3L3HB 3UTPD 2DQFB 4HIIA 3RZCA 3TFKD 1Z0NA 3ZLQC 3IB4A 5EN2A 3KLHD 4QRPA 2QKIA 2Y7QB 4WHTB 5DQ9A 5IOPA 1IGIL 4XNXL 1NCDH 4PLNC 5C6TH 1V5JA 4TSBH 2Y6SD 3A6CL 4P4KB 4I2XE 1MSPA 4YK4B 4L4VE 3QBTB 2H1PH 5DMGD 1T7WA 3IXTB 3PWJB 5AYQA 2R8SL 4S1DD 5D70H 3CSBA 4XPHL 2J6EA 5EPMB 1LO4H 1LK3H 4JO3L 3HG1B 3EO0A 1J11A 4HEPG 2EO1A 4ODHH 5FDWA 5EBLB 3VFWA 2FIKA 2AJUH 1G7MA 3QFJE 5J12B 1PG7H 4KVNL 3S36X 4DFHA 3CSGA 2OQJA 4ZSOA 1W0WA 2EECA 1IT9H 3HE7B 2F5AH 5F7UA 4PY7B 2Y25A 2FZ3A 1JYNA 1D6EA 1B9ZA 4G8EB 4WO4D 3OKLB 3LZFL 5D2NE 1JFQL 4P46B 3E2HC 5FGSA 5CZXD 1OGAD 2JB6A 3QQ3A 5BZWA 1XGQA 3X12B 2ZJSH 3ISWA 2FO4B 1LDPH 4WDIB 5CSZA 4ZUSB 2X6MA 2G60L 1FVDB 3FQXB 2V2XA 5F1NB 1CGWA 1NAMH 2CMRH 2EDLA 2QQKL 5DQDH 2RCSL 4LLWB 3ZDYE 1I8IA 1KIQA 3L3KB 1D6VL 4R2GC 5IHUH 3K4ZA 3OXRB 2OS7A 4G42A 5F21B 1FZJA 1ND0A 3K7UA 1R24A 2NXZB 4KDTA 3D9AL 5C07B 1YYML 1QVOA 1QRNA 3PV7A 4XWGL 4G6MH 5F1KC 5HHMD 4XPGH 2Q6WB 5ICYA 5MI0C 1OY3B 2X1OA 5TFSH 1TZGH 43CAB 4ODSL 4FQ2H 1GOGA 3BP6B 1I4FB 3KLHC 3GKWL 3ZE1F 4RGNE 5J1AA 3RNQB 1A0QH 4RZCB 3STLA 4HS3A 4CMMA 2GFBB 3TWCH 4G80B 4XH2A 5ISZB 3HPJA 4C57C 4MD4A 4HXBH 3RA7L 3MV7E 4XCFH 3IYLW 4ALAL 5T1KB 1YJDH 3B9KD 1KJMA 1PY9A 1MH5A 3QUXD 2ZOLA 4KQ3H 3WFDH 4QXWA 3MGTB 4G8IB 5DJAA 5FYJL 2YK1L 1X5JA 1N2RB 5IB5B 4HKBB 4LF3A 4ORGB 3X3FL 3M1BB 4F2MA 3MC0A 4P3DA 1OAUH 4XPAL 3MOQA 1ONQA 1H0DB 5GRZA 4JM2A 4GS7B 1T0MA 5IBUB 3OKEA 4I3SH 1MCPL 5DQJA 5HHXL 1KTDA 1P53A 4S1QL 1Z3GH 2IPTH 3QCUH 2VDQL 4MAYC 4M7KL 4M8QB 3SO3C 3WBDA 4MJ5B 1RU9H 5KANG 3Q3GA 3NCJH 5SX4H 4Q9RH 2P5WA 3T0ED 1R0AL 3MLRL 5FYKE 1KCRH 3UJTL 1R5WB 2CKBL 4PRDA 1I1AC 3E6FA 4NC0B 5ACZB 3L3DA 5L88H 1KEML 5GS3A 3BQUA 1XIWD 3ULUF 5L6YH 5AZ2H 5FKAA 1LGVA 1RIHL 1J0KA 5DSCA 5E08L 1JF5A 4MCYB 4N8VA 5DK0A 2XTJB 3ARBA 2EIEA 1ITBB 1EO5A 3J8F7 3QNYB 5ALBL 1LE9A 2WBJB 3C5JA 4HXAH 1WICA 4O51A 5ESQB 2P49B 3TNMB 1QFWI 2UUDK 4NKMB 3BP5B 2HFFA 4Z5RA 3OAYH 4HIHB 1YEGH 3G6JA 1Q72H 3CXHJ 4NJ9H 5HY9B 1T21B 2L4OA 3NMEA 2XNAA 3MRLA 2DLFL 5F7DA 1NFKA 3UPAA 4HAFA 4NN7B 1WWBX 1YEJH 3WJJA 2V5TA 3N1FC 1J1PH 4JHBA 2HG5A 3V6OE 3WIHL 4OGAD 4XVJH 5J3HD 3VE0A 1WV7T 4NN6C 5EU3A 3QEQE 1DVFD 1DBJH 1TZIA 2GCYB 3N85L 4W4NA 3WD5H 1JN6B 5DJCA 4FN0A 4YGAB 2FL5A 2IGFH 5I18L 5F7YC 2QHRL 3TO4D 4KTYA 1QSFA 4HC1H 5JW5A 1HEZB 2AXJA 1NCCL 5I1CL 1SEQL 5HHME 2FB4H 3SE3C 4PS4L 1ZVSA 3VGFA 4XAWH 3TBTB 3QFDA 1IFHL 3SDDD 3B3IB 3VXSD 5LAXB 4MDJA 5D1ZC 5EZIL 3DVNA 3U48A 3BP4A 5C3LD 4UAOB 2OXGA 3RTQA 3MRNB 3IGAB 3T1FA 3KPLB 1IILE 5HHNA 2MQ0A 1WBYA 2NTFA 2PTUA 4P59H 3UTTA 5JW3L 2FWOB 1I1YB 4LARL 1SBSH 1KCSH 4LK4A 2VITB 1HCFX 3RVVC 1OCWH 2OBGA 3KNBA 3BPNB 4KJPC 3BW9B 4M5ZH 1YEDA 1QA9A 2GY5A 4OCSL 4RGMC 3KHOA 1UC6A 3CFBA 2VLKB 2C3VA 1NFDB 4WUKL 1M7IB 1XEDA 4F3FA 4ZFGH 1OLLA 2NY4B 2BRQA 1N7MH 3B8YA 1MFBH 2VZUA 2X1XR 4HZAA 3QCVL 1UH4A 4Z7WA 1PAMA 5EORH 1EERB 4JHAL 4NWTH 3F58L 2GSGB 4WV1A 2FDBP 2VMFA 2NW2B 4X5WB 2HVJB 4OD3L 5DO2D 2X4OB 2XFXA 3IJYA 1EBPA 4R3SA 1ED3B 3QDAA 4CVZA 1G1YA 1RK1B 2FLBT 4JN2B 5DEGB 5TGBA 4WUUD 3UYOD 5SWSB 3GK8H 3GSOA 1QFOA 4ODUB 2G5RA 3T0EE 1CGXA 5J6GB 4L8SA 1YC8A 1A6AB 1B3JA 1P7QB 3O45A 4V2CB 1KPRB 3ULUH 3MJ9A 2RAMA 4KPHL 5GSRA 5KSBF 1NDMA 1U58B 3OKDA 1MFDL 5I0DA 3LN4A 1V3KA 1EAJA 1F3RB 3V8CA 5FHAL 1TVHA 4QXTA 3T08A 4DGIH 4PJAB 3FHAA 2FECI 4P9HC 1DLFL 5J3HC 4C56B 2GTZA 4YX2H 3O2WH 1DVFC 1YUHA 2OL3H 2VDMH 4L3CB 1BVLA 2VLJD 2B5IB 4E41B 3U79A 3EOAB 4TSAL 4OTXH 1BFOB 1W0YT 4X6EB 4KHTH 3LMJL 1ADQH 2DRUA 1TJHL 5KANI 4PGDB 4O5LH 2XQBH 1N5AB 3GUTA 4R26H 2JK5B 3THMH 3SDDC 4EI6B 3SDAC 3RX7A 2H8PB 4N9GA 3V4PH 5F7MC 2DQTH 3KYMB 1I9JL 2VR4A 3F7RA 1JYWA 2X9XA 4NIKB 4W6YB 2LU7A 2W9LA 3GHBH 4KXZH 5DHVA 3D39E 1IAKB 3JZ7A 5KVGL 4PRBA 3ULVE 1HHHA 2DI8A 2PW2B 1RMFL 3VXTA 3WFCL 4N8PA 5IUSA 5J57B 1OAZL 4BKLB 2F53E 3I9GL 3FO1A 3K74B 5H94A 1KB5B 4Z76B 1LQSR 3WFEL 1D5IH 5HHPA 1P2CB 4MQXC 3EBAA 1MRDH 5IWLA 1P69B 3DMMB 4TUOB 2BX5A 2EH7L 3U30C 1J10A 2VNCA 5BZDA 1CZ8H 1CFSB 4OIBA 1O7VA 1Q1JH 3S37X 5KOVC 4HX1B 1GZQA 4Z9KB 3QZWA 4CU7A 4MD0B 3MTRA 5D1XC 4Y1AE 5E2WH 3I6GA 5DO2C 1H3TA 1HXYA 3BIKA 4FQCH 5SWZD 1CL7L 2AABH 8FABA 3CC5A 2EDKA 4XMKL 5D2LF 1A4JA 1OVZA 3WEXA 5BV7C 1JUFB 5TF0A 1MFEL 4H8WC 4PJXB 1L6XA 1F8TH 1UB6B 2VXTL 5IVZA 2D4DA 3UJJL 4PYGA 3OAUL 4NSKA 2PTVA 3OKNB 3GHEL 5IR1B 5EU4B 3QHFL 5EOCJ 3OJDA 5F6HI 2XICA 1IEHA 5C0CD 1HI6A 1R3LA 2IALB 2LFGA 3MO1A 2BC4B 4FFZL 3BJ91 4P49A 4DKAA 3MLPA 2K7QA 4J8RB 5D1ZA 5DD0H 3O6ML 1T20B 3KPMA 3WO4B 5JPNA 1GSMA 3ZMRA 1EEYB 1CK0H 4CBPA 1CS6A 3TBSA 1CDHA 1KLUB 3NIDE 1OAXH 5I2IB 3GMOA 1H5BC 3BE1H 1MCJA 1VPOH 5DWUH 3BAEH 1DR9A 3MV9B 4WU7A 1FH5H 4J3SA 4OM0H 4WUUE 3BD3A 4CN6A 3MV11 5BS0E 3MOAH 4LL9A 4NN5C 1MHCB 3BYTA 1SMOA 4LVHC 3TO2B 4NYLA 4F7TA 3CFKB 3JV6A 3L9RA 2CKBA 4OJFH 3EHBC 5C6PB 2YPLB 3EGSB 3MZTA 1YDPB 4NCC1 5KSAA 3VFNB 4AIOA 3M07A 4YDLC 3QIBC 4YEFA 1DBKH 2Q76B 2EDRA 1U92A 2VLJE 5C0AD 4KVCL 3MROA 43C9B 1AGDA 2AGJH 3H0TB 3PNWA 3BPLB 4QOKA 1UM6H 1MIML 3GSNA 2HVKB 5EO0A 1AKJB 2PTTB 3C8DA 3I75A 3LV3B 5DFVC 1DSFL 3EUUA 4PRPA 4F15B 3HRZA 1ZHKA 1X5AA 1UYWL 3O9WA 3STZB 4OCXH 1ZXQA 1L7IH 5HHOA 4EN3C 4AEFA 5EO1B 3F5WA 2APBA 2KQMA 4K3HA 3BEVB 3VWJB 1P5VA 2FO1A 3QJFB 3UAJC 2R0ZH 5DVKA 4R4FH 3DXAB 2C4FT 3WIHA 4WENB 2VQ1B 1EHAA 1JPGB 3OB8A 4FQXD 1MRCH 4R97C 3VG9B 4M62H 1N8ZB 2A9ML 4N8CL 4DZ8A 5JHDD 5HXMA 4JRXB 4WI2A 1T1YA 1DN0B 1ETZB 1LP9A 2I5YH 4G6AD 5FGBC 2AK4A 3RKPA 2A38A 1MCRA 2OYPA 1NDGA 4OSUL 5IVXB 2BMKB 2R29L 2VDPL 3SDAA 1J1XL 1IZJA 1FP5A 4MSWB 2FATL 3BRGC 1P7KA 2ADJA 4PJCA 1MJJB 3N06B 3QIWB 5ACMA 4H1LA 4MNGB 4MB5A 4OF3A 5DRNB 3O6LL 2Q86B 3VFPB 5L0QB 1HQRA 1F3DH 1ITCA 3JXAA 1D9KB 1DQJA 4MDIA 3WE6B 4QRUA 1T89C 4QF1A 1Z5LB 3QDGD 4DFIA 4LIQE 4YWGH 1JGDA 2G9HB 2OSLB 1IM3A 3MBEA 5FB8A 5D8JH 4ZFZA 1IC7L 1BAFL 3W81A 2AJSH 1E4JA 1R3IL 4AZ8A 4ZO7A 4JDTL 1K6QH 3SDCD 3HC3L 1KCKA 3C5ZD 5C0CE 5E8OB 2J88L 2OMBA 3ARDA 4LEOA 3JV4A 5HHVH 1U9KA 5FYJU 1MI5A 5T3XD 1QACA 4APQC 4Z0XA 2WUCH 2GJ6A 4N1EA 3PWPE 4KV5F 1U8HA 1J8HB 4KAQH 1OAQL 3CVIH 2SEBA 2CPCA 5IHZB 1NMAL 4PY8I 1CDBA 3C09B 3Q6GH 1CFQB 1T5XA 2I25N 3RNKB 1OGTB 1ZWIB 5IQ9B 4EI5B 4CVWA 3HZYA 5TJWK 4TTDD 2ZP0T 4KI5F 4YBQC 5E8EA 3W9EA 2X42A 3VXRB 3WIIH 2CDEB 1FO0L 3GGWA 1KCUH 4LVOB 4JM4H 1UXSA 5F1SA 1MF2H 3O3UN 1VEPA 5JZ7C 2ZNXA 1QSEE 3GFUA 4U1IA 1VCAA 1G7IA 1FG2B 2PN5A 3DROB 3SE9H 1YPZA 4ODXB 3V6ZB 4HFWA 4QTIL 1OW0C 1IC4L 2CK2A 4YHLH 2VKWA 1DFBL 2OM5A 3MFGB 4MB3A 2MTPA 1IGJB 2J8HA 2VZ3A 3CFCH 1BMGA 3HR5A 5GRJH 3QUMB 1Q9KB 2WP3O 2Q7NA 4FQXC 4NP4L 3RWJA 4JAMB 2E6PA 5T1LB 3KPSD 2F54A 3KPQA 3G6AA 3QHZL 4YHIA 3SOBL 2Q87A 4ZXBA 5DJDB 1JV5B 3GNML 3IU3B 4ZD3L 4XBPB 4LHQB 4XP5H 5DYOB 3K8MA 5B22A 4EVNB 1MHPH 4GAJL 1SJHA 3SGKA 5F3HB 1EVUA 3NCMA 1CQKA 1DBAL 5E56A 2OP4H 4PJIA 2X4QB 3ARPA 5D7KE 1KFAL 4L3EE 1AXSB 4LRNH 1I8LA 1VADA 1FZMA 4ZAKD 5EG6C 3BKYL 4MVBC 3T2PA 3WFZA 3IS1X 5FUOL 4LQFH 1FRGH 4ZTOH 5ADPL 4IDJL 4YDVA 4X9HA 4NQEA 4XB8A 1TMCB 2Y4SA 4YHNA 5T5FL 2HFGL 1AJ7H 1CR9H 4M02A 4ZO6A 4L4TB 3LEVL 4O2FB 1UWGH 4RAUA 2EYTA 4GOSA 3QIUB 3MJ7B 1ZOXA 3VXMA 4A6YB 3UP1A 5I9QC 1TQCC 1UEYA 1J86A 5DD1H 1DE4B 4JDVA 3LPWA 3CD4A 1PKQB 3MR9B 5DK2A 4ZUUA 4KHXH 4Z7UA 3F7QA 5IROC 3BDYH 4G6FD 1F3DJ 1FCCA 5F7FA 2IAMB 2LU4A 3EIFA 3IKCB 3SE4C 2I60H 4Z7VB 4TNVF 3RIAF 4PJBF 3VH8A 1A2YB 4PJFE 3ZE0F 4I1NB 1U8NB 3CVHL 1C7SA 4JFDE 2ZOKB 3MLVH 4NZTL 1IRAY 4TPRL 4XBGA 1CGUA 4LLDA 2HMID 3LHPH 4TTDC 2P45B 4LKXA 3PQYB 3BI9X 3JTTA 3IDUA 4P2RB 1FDLH 5CUSL 2Y72A 1X5HA 4FQHB 5CHNB 4Y16B 4HPYL 5FCSH 1BD2B 3U9PL 2VDNL 4W6XB 1Q38A 4JFOB 4WFGE 2AJZB 4WWKA 4HIIB 4QRRE 5EN2B 4QRPB 2QKIB 4BFEA 1IQDA 2AP2A 5BW7C 4P23A 3ZKMC 5IOPB 1MELA 2DI9A 5HHQA 1S7WA 5I16A 2VH5L 4YGVB 4B7IA 5ENWA 1JCKA 2BVTA 2XG4A 2B1AL 1KTKE 2NNAA 4ZS7L 2PNDA 5I1HH 2Y9RT 3T65A 5E6ID 1YEIL 4AEHH 2Z91A 4GKSA 3DSFH 2MWCA 5EU6D 1F4XH 3IXAB 5DVOA 5ALCL 1AGBA 3WNNA 5C0BB 4XHJC 3DV6A 5JOPE 4FG6D 2XRAH 2IBBA 4BK5A 5A43C 4ZAKC 4GRLA 5I8OL 3DJ9A 4FFVC 2JE8A 3TCLA 4UT9H 4QXGH 2DWDA 1U3JA 3VRLF 2OQJB 4LU5L 4DW2H 1W0WB 1X7QA 3O2DL 2DQUH 4NZJA 1S7SA 2EEBA 2P5EE 1G7PA 4L9LA 2CJUL 2FZ3B 4X6CB 3NABL 4X9GA 1WFTA 3DX6A 1D6EB 1ZTXL 1F4HA 3HUJA 2EDOA 4JHWH 4HKZA 2BOCA 2XWTA 3GSRA 1GZPA 4OCRH 2A83A 4NC1E 1GGCH 2IANA 2NY5C 3VFGL 3TV3L 2JCCA 3TVMC 5BZWB 1J1OH 1BFVL 2DTSA 5DZNA 5L8KB 1XGUA 1K2DA 1X4XA 3O4LD 1G9MH 4FA8A 3QI9A 3HI5L 4W81A 5ITFB 1FE8H 3H3PL 4CW1B 2DJ4A 4PLKC 5F44A 3L5XL 4OKVA 3MA7B 1F4YH 2ZUQB 1T2QH 2HN7B 4HFUL 1DQMH 2F8OA 4LSPL 5HVWA 4G42B 5E0QA 4XMPH 4X83A 1OSPL 1ND0B 5AWNL 1R24B 1TNNA 3ZKXC 1QVOB 1QRNB 3NA9H 2DKUA 3LDBC 4QTHB 1ZLUK 4PUBH 3K1KC 1Q0YL 3WUWA 3VGDA 1CICD 3LS4L 4X7SH 4U4BA 5E9DA 5F70A 2C3HA 1U3HD 4J1UA 2R1WA 3KLAA 3K2UL 2F9BT 3LQAH 4EDXA 2FX9L 2ZZUT 4KROC 3STLB 4CMMB 3ROLB 3MJ9H 3CX5J 4XNUH 4XH2B 4XP9L 2X4RA 3QULA 4YAQB 4MD4B 2YD5A 5JW4M 4JG0L 5FV1L 1A22B 3X13B 3GMRA 3U82B 5EIIA 4UT7H 3FB8B 1BBDH 5CZKA 3I3DA 1S9VA 1KJMB 3A67L 5IBTL 2EIBA 2ZOLB 4UTAH 4L8CA 1IKFL 5GISH 2D9QB 1AH1A 1NCBL 2OX5A 1KGCD 1YEFL 3RAJL 1NCWH 5DJAB 3B6SA 2HFEA 3O41B 4IRSC 4LASL 4UDUA 4K8RH 4F2MB 4I0PB 1MCEA 4NFBA 4C4KT 4JM2B 2DOCA 3MRMB 3U9UA 1AQDA 3OKEB 1NAKH 2NZ9D 1UQSB 5LGHH 2X41A 3RJQB 1KTDB 5JMOC 3UC0L 1MCFA 3W82A 1CI5A 1JZ7A 4KK9D 2QEJA 5IBLD 5ID0A 5E8DL 1A9BA 1NLDH 4D2NA 4OLXL 5DD5H 4M1CD 2UZXB 3WFHB 1NBYA 4PRDB 1FO0A 3DV4A 3LIZH 5D1QB 1JNNL 3VI3E 5GZOD 3L3DB 3O3BA 5C0RH 4I18A 4U6YB 3BPCA 2CO6B 5IB4A 1NGQL 4AMKL 5BCAA 1WZ1H 3MV8A 2ZKHL 4N8VB 5DK0B 5GHWH 3TYFA 2CIIA 3ARBB 3VWKD 4UUJB 1LE9B 4G6JH 1GJIA 4O51B 5DMIL 1TFHA 4LMQE 1BEYL 4RMRA 4Z5RB 2GAZA 4E42A 3G6JB 4DOHB 3BGMA 2DLGA 4GSDH 3V6FB 1JWSA 4LPUA 4OLUH 4NM4H 5C09E 2XNAB 2NY3D 1ACYH 2IG2L 5LWYL 3MOBH 2WLZA 2EDFA 4PJEA 3AXLA 4D94A 5E99H 3O4LE 5DC4B 4K7PY 2PYEA 2R1XA 2NCMA 3LVEA 1HINL 2HG5B 4NNYB 5CJXC 4DN4L 4H0IA 5IFHL 3VW3H 5MEND 5FOBA 5EUOB 1MWAA 4LLQA 1TZIB 3V8OA 4G7YH 3U83A 3PL6D 3ALWA 3X17A 2X9WA 3H8NA 4E0RA 2H32A 2RFXA 1ZVSB 3S3JA 5A16A 3UTQB 3QFDB 3E2HB 5C08A 2XXCB 1BOGB 2XZAL 5CJOL 4MNHB 3I50H 1H9VA 3R8QA 4JFZL 3DVNB 1TVDA 3BP4B 5JR1H 1AXTL 1RY7B 5F9JB 3TN0A 1DJSA 3BH8A 2YD6A 3WDHA 3KXFE 3MLYL 5DLMH 1PBYA 1AP2A 4PBXA 5HHNB 4G7VH 1MFAL 1WBYB 2NTFB 3RWCB 3UTTB 4R2GB 5IW1B 5I1JH 2OJZL 1IZKA 1UT9A 5GGQH 3UDWA 3OJVC 1NGXA 1HNFA 4LNRB 5D7JD 3CVHA 5TE7L 4R4BB 2R39A 5D7IA 3SE8L 4RWYH 1YEDB 5D2NC 5INCA 3TA3D 4BQBA 4N0CD 4RIRA 1T2JA 2AV7A 3CFBB 5FYKL 2VZTA 4Y88A 2AI0L 3RU8L 2C3VB 3ARUA 3W0WA 4MX7A 1DQDH 5KS9A 3ARTA 1K4CB 4UINL 5TQ2L 3ULUD 4C59B 3SJVA 5J11C 3GSNH 4X6FB 3L6FB 4NJAH 3SO5A 2Q8AH 2QV2A 2X5PA 4XP6L 4K7PH 4DVBA 1INQA 3W11C 2VDRL 2VN7A 1A6WH 3F62A 4PJGA 4K9EL 4EUPH 1DQLL 1WVZA 2XFXB 3IJYB 4RAVA 4R3SB 2V17L 4CVZB 1U8MA 1BZ7A 1GIGH 4NT6A 4YBLB 5DMKB 2CKNA 4XVSH 3VCLA 3G9VA 5F72S 3LKSB 3PUCA 4LCUB 4JANB 1JRHL 2HT3C 4R8WH 4RMUA 2XQYK 4NQDD 5GSRB 3VFSB 1W0VA 2MCPL 5DJXB 3OKDB 1H3UA 4RNRA 4HZLA 5F9OH 5IESH 4QXTB 4IRSA 4Q2ZB 4HQQL 5I0ZA 12E8L 3RWDA 3VFMB 3CDCA 2GTZB 4RGOL 3IU4H 4I4WA 3P40A 2JJSA 4XPFL 4OZGF 4Z95H 4X4XA 3EJYD 5E95B 3UO1H 4OZFB 3MRFA 1MAKA 3GDBA 2BSRB 1BVLB 3BD4A 1GGIH 2W07A 4AG4H 5CD5D 2IH1B 1T22A 3TJEL 1BFTA 2H26B 1MNUH 1KJVB 3HB3C 4OT1L 5GZNC 4PGEB 4MAYB 2YRZA 5D7LD 4ZYKA 2IC2A 3GUTB 2AJVH 4NO3A 1XR9A 4OIIH 4MWFA 1MUJA 1J88A 4X4YB 2GKIA 3CUPB 2YD9A 3B2UD 4LLUA 4PJDF 3ZE1E 3MRIB 1YMMA 1EHNA 4YXLL 4Y2OA 2P8MA 1KG0B 1UJ3A 4NGHL 1JGLH 4P2QD 1ZHBB 1HHJB 5GJTL 4F8QA 3D0LA 4Y4FD 4AM0A 2BK8A 1F6LL 2MSPA 5DHVB 3S36H 4LSVH 4PJ9A 2ADGA 4MJID 4NQUA 1I1RA 4JZOB 2P43B 4PRBB 1HHHB 5D7JC 2EIDA 1T2XA 3VXTB 1KEGL 2X10A 5F6IC 5I19L 5D6CA 1FVCB 3TA3C 4JRYE 3CCHA 3FO1B 5H94B 1N5YH 1TETH 1VFMA 4FQQA 2DS4A 5HGBB 2E7LC 3P4OA 5HHPB 5KVMC 1M7XA 4X99A 3FFCE 1FGNH 1ZV5A 1XR8A 3AMKA 1J5OH 4ONOA 1A1MA 4AIXA 5BZDB 3NTCH 4M48H 1HSAA 1K5NA 2D7TH 1OTSD 1AR1D 3D2UA 4MA8L 5FM8A 4YDKH 1GZQB 4OUUA 5CJXA 3O3EA 2OCFD 3FAXA 2W9DL 2JIXB 4NN6B 1HXYB 3BIKB 2DQDL 4K9EC 8FABB 2AEPL 2NY0C 4AJ0A 1A4JB 3NH7L 3WXWL 2EXYD 3AM8C 5BOZG 3MBXL 1X5XA 4L4VA 5IVZB 4M7LH 1REIA 4OFYA 4JG1H 1WITA 4JFXB 1B88A 1JF1A 1X44A 1S5HA 4NSKB 4X5XA 4M6NL 2XTLA 4UZGA 1VGKA 1NANH 3OJ2C 2ARJA 4QRTA 3C6LA 4D0BB 4RMWA 3ULUE 4U1KA 3I6LD 5DMJB 2HT4C 4Y5YC 5HD8C 5D1ZB 3CMOL 3I3EA 4HBCL 3QFJA 4XXCC 5JPNB 2UY7A 3CJJA 4QY8A 4BZ1H 1U93B 2A1WL 3TEUA 4IOSD 3IFLL 2O5ZH 4Q97A 3AAZA 1LD9A 3HNVL 5CD5C 4NCC2 2EKJA 2FJHB 1V7NH 4XNYH 3DETC 1Y0LA 2NXYC 5IVXF 3MCG1 5EOTA 3KPRA 4TN9A 1QSZA 4IBLT 4BQ8A 2XT1B 1KENL 4RGMB 3L5JA 1ZEAH 4WHDA 4DKDC 3OB0K 4OM1L 5AYUH 3AS1A 4NYLB 4F7TB 3GO1L 5HJ3A 1QBLL 3L9RB 1JTOA 4NO5A 1FGVH 4PREA 2CKBB 4XAKD 1PVHA 1JGUH 5KSAB 4YQXL 3NACH 2MKWA 3ULVL 1BIIB 1X5IA 4QNPF 1K8IA 5DTFA 2Z93A 1AGDB 3PNWB 15C8L 4QOKB 4AL8H 4IIQA 4BFGA 3GRWL 3SCMC 3OWEA 2XV6B 2I9TA 2X4NB 2F74A 4KGLA 1I8MA 4PRPB 3ARGD 1JWUA 1GCFA 3HRZB 1BQUA 1NLBH 1I75A 3IDIB 3O9WB 1NC2D 5EOQH 4UQ2A 5B4MD 3G04A 3UTSD 3O0RL 3ARFC 3F5WB 1OTSC 4WI3A 1UEMA 4BSJA 5C9JA 4Q6IA 3TBWB 2XKUA 4U1MA 5H35A 1RUPH 5JOFA 3QEGH 5IGXH 4NKIH 4L3AA 5K59F 3NN8B 3JWNC 3MRRA 1K3ZA 4MJIE 1N3NA 4LFHD 4FXKB 2DQCL 3DUHA 4DZ8B 2XIDA 5F96H 1Z0MA 2EXYC 4OGYL 2R9HD 4P99A 2GK0A 1VEMA 3IDYC 4I77L 1LP9B 3BUYA 3IVKA 5I1EL 4F7MB 3U4AA 3BT2H 2F8VA 2AK4B 3JWDL 3AY4C 1ROWA 4TYUA 5I17A 3U0TA 4HULB 3SDAB 2ESVD 4WHCA 1P7KB 5B38B 2ADJB 2DQJH 5DR5L 4PJCB 3WIFA 5JORA 4YUEL 1N4XL 1KPVB 3P9MA 4O58H 4JY5H 1BP3B 2QSCL 1IAIM 1HQRB 1BLNA 2R2EA 3TLRA 2R69H 5A2LH 2XXMB 1DQJB 4MDIB 2AK1H 4QRUB 4QF1B 2ITCA 4G3YL 1NC4A 1MRFH 2EE2A 2DMKA 1IM3B 4HIJB 1HYSC 1WUNT 3MRJB 4RBPH 3QUZA 5MP6H 5HPOA 2AERT 1T66C 4ORZC 3CU1A 1XF5A 1A6ZA 3FZUC 3HCVA 5KSBE 1OP5K 4QHNA 3ESVF 4U1LA 3V4VH 1CFBA 5A3ID 4P2OC 3U30B 4GXUN 3LKRA 4LEOB 3JV4B 2FD6L 1S7RA 4F9PA 4Z0XB 1G1CA 2GJ6B 5INDA 1U8HB 3MX0A 1IC5H 1S3KH 4PTUA 1UM4H 3D18B 3HR6A 3ULVC 5D1XB 1LO5A 2R15A 3KPPB 3VXNA 2MJWA 5CCKH 3ZT6A 2ILLA 5J0BA 2C1OB 3TM6A 1Q94A 3JUYA 5IB1B 4PJEF 3QH3A 5BV7B 2DKSA 3HZYB 1CLOH 4WO4A 2D7MA 1NL0L 2ED7A 5E8EB 3AM8A 3W9EB 3HE6A 5L2KE 2BVYA 2HTKC 1B6DA 2IQ9L 4BUGA 2CH8A 5I8KL 4MNQD 5B4MC 3CNKA 1UXSB 4Q9QH 2P8LA 1OGAA 1AIFB 1A1OB 2X4SA 3HMWH 3TIEA 2JLLA 5C8JA 4HK0A 1WIPA 2DDQH 5IJKC 1YPZB 4ZOBA 4XAKE 4HFWB 3UCRA 1P4BL 5F7LB 4P4RB 4HS6A 5DJ6A 3V6OA 3VFTA 1ORQB 5JNYB 1UZ8A 2D7OA 3H3KA 3QEQA 3RWJB 3E8UH 1HKLL 2CGRL 1AQKH 4CVXA 1NCTA 3G6AB 2R9HC 1DBBL 4NQXA 4J6RL 4KK6D 3DO7A 1B4JL 5L9DH 1GOHA 3U1SL 2FEEL 3D3VB 3SKMA 2E7CA 2MPAH 5GGRB 1BM3H 4PIRF 3LSOA 4JPVL 4PJIB 2V7HA 5I6XC 4LVHB 3FT4B 4KKCC 4LDOB 1SYVA 4DUVA 3EO9L 2J4WL 1XCQA 3RBGA 1QFWH 4TQEH 3OKKA 1NMBH 2VUYA 1FZMB 3LQZB 4MMXC 4OZHF 4G8GD 1TVBA 1XGYL 4EXKA 2YRLA 5CGYC 3VFOB 1SY6H 2YKLH 1YEKH 5D2LE 4YDVB 4R96A 4LIQL 4NBZB 3QRGL 4NQEB 5A2KH 1AI1H 2AXFB 3QIBB 4LMQI 4LQ1A 3RKDC 5CBEA 3MRPA 3O3DA 3U4EB 5GGUA 4WNQA 2VISA 1IAIL 3KPOA 1BOYA 4RAUB 3S97C 1FNGB 1S8DA 3B9KA 5D6DC 1EUUA 1KTLB 3QUXA 2E27L 4ODVH 4NZDA 3WN5A 3QO1B 2CLZA 1F13A 1GPOH 5DK2B 1BX2B 5KTEH 4XCEA 2UUDH 3IFNL 5DDHB 1CGSL 1KIPA 1WTGT 1FBIL 4EN3B 3ARFA 1ZT1A 2BCKB 2BXYA 3KS0J 4LHUD 5GGVY 4C58B 3R1GL 1RJLA 3BWAA 3VH8B 1G0XA 2PETA 1G84A 4X6CF 4HWZB 1M05A 4GG8A 5FXCH 3VXQA 3QXTA 4U2ZA 4RFEA 4D8PA 1KC5L 4K94H 4OI9A 3NZ8A 1MREH 4R97B 3GIZH 4WU5A 1V3LA 4LLDB 2DD8L 4UV7H 3RPIA 2C3XA 2ADFH 4LKXB 1IC1A 2EEAA 2I9LA 3MLXH 1IEAA 3DRTA 4JZNA 4F57H 4KMTH 3SDXB 1JHLL 4JY6A 3T0EA 1GGUA 1NKOA 3TH4T 5TDPA 1S7VB 1JHKH 5FYKU 5FYLD 1G9NL 1LVEA 2OTWA 4YLQT 3VI4F 1A1NA 2Z31D 4FABL 1LWRA 3VFUB 2A6KA 5E8NA 2OR9L 1E28A 3S88L 3S37H 4KK8D 2XKSA 4P23B 3VA6A 4DGYL 5HHQB 5BVJA 2WINA 4ENEC 5K9KA 3HNTH 1A3RL 3FT2A 2F5BL 2PXYD 2BSSA 4KK6C 3MUGA 2NNAB 5EZOL 4HLZG 3F6LA 1ODAA 3CX2A 3VGEA 2R56L 3OGCA 2DQIH 3GZKA 4RMVA 1NJ9A 4DN3H 2Z91B 2NY2D 4GKSB 3C8KB 3HC4H 4TOYH 3MLZH 1MWAH 4PPTA 4WTXA 4U49A 3OG6B 3OZ9H 4XRCA 1KT2B 5HPMA 2O93L 2CK0L 2CDGA 4P2OA 4JGMA 4K23L 4XGZA 2DWDB 1DBMH 3IAGC 2VLRE 4PJ8C 4OAWA 3D39A 1X7QB 4WEBH 5BMFL 4GMSL 4QRQA 1S7SB 1SYSB 2FLRT 5D71H 1G7PB 4L9LB 4OIAA 3DX6B 3HG1D 1MPAH 3CU7A 5T3ZD 3R0MA 4JFYB 2XWTB 1GZPB 4WFEE 4B0MM 2A83B 1FYTD 1JNLH 3QDJB 2QADC 2FX8H 1IGML 1R3JA 4GAGL 1WEJH 3KVQA 1XGUB 1K2DB 2F19H 4NQCE 3OX8A 3HE7D 5F7EH 1AHWA 1RZFL 4E5XA 3QI9B 1Z6JT 4PV9A 3NPSC 1JPTH 4ZNEA 1EGJH 4YE4H 1S7UA 1KNOA 3WL9A 2EE3A 1QFUL 4ZOCA 1QUNA 5EC2A 4OKVB 2X2YA 4Y1AA 5C2BL 2VXSL 4P46D 4UB0H 1RZJC 4GRWB 2Q8BL 2CDFB 5F7KC 1JMXA 2I27N 4XPBH 1Z9OA 1CXEA 3BZFA 4GBXD 4GW5A 5CP3H 1RZKL 5CMAB 3WUWB 5DA4A 4O2CA 4IHOA 4J1UB 3TT1L 2QSTA 1G9NC 4D3CH 5D5MF 2O26U 2R1WB 1OTUD 1YNLH 3K80A 1K4DA 4KV5E 4O2EB 4EDXB 3L5HA 3BMWA 3V52L 5C07D 2ERJC 2D7NA 1U91A 3BO8A 3RUGB 5HVHB 3LKPA 2X4RB 3GIVA 1C5CL 4NNXB 4NDMB 2YUXA 2R0KL 1RIVH 4HUWA 5EIIB 3F7VA 3Q5OA 4KI5E 3MXVH 4BZ2L 3H42H 3AROA 5CZVH 1S9VB 4WUUA 4M6AA 4Y5VA 4DTGL 5BS0A 3K46A 4P4KC 5I9QB 4EBQH 3B6SB 2HFEB 5E6YA 4DCQB 4GXVL 1QQDA 1KLGA 1T1ZB 4UDUB 1NFIB 4AIZA 1IBGL 1JZ4A 5ISZD 1IQWH 1FNEA 5EUOF 4HF5H 4JB9L 4UILH 5DZOA 5T1KD 2IMNA 3NFSH 2BFVH 3O8XC 5CSBA 1CFTB 4QLRA 3GI9H 1AQDB 1HH6A 1H3PL 4IDLA 2VLJA 4ELMF 2HTLD 4N90D 5IKCA 4N9OB 2ORBL 2WUBL 3N1GC 3IFOA 1F58H 3MA9L 5TPWL 2ZCHH 1DL7L 2E6QA 3LB6D 5GSVB 5MHSD 3BZ4A 3G5ZA 1NBYB 1FO0B 1U8LA 1KJ2L 1FPTH 4WW2A 2A0LC 2AJXL 3O3BB 1OM3H 3E3QE 3IJSA 3G6DH 2VIRA 3QA3A 1ZVHA 4NQSA 4I48A 2MCG1 4UIMA 3QQNA 1KXTB 2CIIB 3L7FB 4JQIL 1U3YA 1BQHB 2Z0BA 4HGKC 2KQNA 1OPGL 1I85A 3JWOH 2XA8H 3HG1E 2GAZB 4E42B 4K3GA 4X4ZA 1KUMA 2MQCA 2VDKL 4PV8A 4JKWA 1FFPA 1FYTE 1JWSB 1MCKA 3C5SB 2FGWH 2NY1B 2A73A 3JTSB 3ZKSD 1AGFB 3BKCH 4YR6A 3AXLB 1OTUC 2WBJD 4I9WD 1I9IL 5E2VL 3JVGC 4PJBE 2PYEB 2NXZC 5HTSA 4IRJC 1QHPA 3ZE0E 1NCDL 5C6TL 3HS0A 4TSBL 4LFHG 4PJ8A 3EYSH 4LLQB 2XKNB 1MJ7H 4JFQA 1V8HA 1J0JA 4WVRA 5HDOA 3OKOA 4C83A 2MKLC 2WWKO 4LOUD 2H1PL 2WWMD 4E0RB 3BEWB 4XCYA 3MCKA 4BH7A 1LO4L 2OTUA 4HT1H 1R3HA 4C4KO 5C1MB 3TZVC 1LK3L 3TVMB 3BX7C 5C0CA 4ODHL 2AJUL 4ODWA 3VGGA 1M71B 4WJ5B 3TN0B 3ES6A 1PG7L 4Q6YA 5F88A 4LSQH 2EYRB 3NAAH 4HUXB 3E0GA 2VQUA 3P9WB 5E70A 3FN0L 1IT9L 4MB4A 2F5AL 3WS6C 3OG4B 1RUQH 3CVHB 4FTVD 5D7IB 5FECA 2PW1A 3FCTA 5INCB 3ZKXB 2AV7B 4HHAA 3ARRA 4GS7C 3ULSB 3LDBB 3D69B 4U1SA 2D3VA 4MX7B 1AXIB 2NYYD 2EICA 4UOJA 1QSEA 2ZJSL 3KYNA 4OCMC 3SJVB 4FFWD 5DJ0A 3LEXA 3U2SB 2XN9B 1FJ1A 5E1AA 1N59A 1NAML 1R3KB 5JXED 2CMRL 5DQDL 2VKXA 1KACB 1G7HA 4GJTB 4F8TA 1INQB 2NR6C 2KDGA 4KROB 4S0SD 1GVIA 5C71A 3O11A 2VLKD 5IHUL 4ZUWA 3MMEA 4FQIH 1JZ8A 3B2VH 4M4PA 3CFJB 4RMTA 4N90E 4F58H 2NY4D 1WC7A 4YHOH 1HHGB 1U8MB 1BZ7B 4P3CH 1IMHC 3VCLB 4JO2H 2WIMA 4PYHA 2XTJC 1Q9WA 5TFSL 4Z77A 4S2SB 2EDQA 2XWBA 3S96B 1NBVH 3EJZC 1PW3A 1A3LH 5EH1A 4FQ2L 3PWNA 2VL4A 4L3EA 3OPZH 4HZLB 1NEZG 1A0QL 4IRSB 1BF8A 3IDNA 3RWDB 1EEZB 5J8OA 5SWSD 3D5OF 3MRFB 4AENA 3TWCL 3O8XA 2VR9A 3TC9A 1PQZA 2QSQA 3D1MC 1P7QD 3MXWH 3PHQA 4HXBL 3IETB 4NN7C 5JHDA 1HOCA 4XCFL 4JKKA 4ZYKB 1F97A 1RI8A 2X05A 4KQ3L 3WFDL 1BJMA 2P47B 4TUJA 1XR9B 4K07A 5JXAH 4MWFB 1QO3A 1U95A 3N1PC 3RWGB 4LLUB 2BNRD 2ZUUA 1YMMB 3FRUA 4H20H 1HCVA 1J0IA 4E41D 4I9WE 1OAUL 4NZRH 1IVLA 1ORSA 4X9IA 3VGAC 3D0LB 3LN5A 2D0HA 3VDBA 1A21A 4PJFA 5FF6A 4PJ9B 2R8SH 4PP2A 4G9FE 4Y5XA 4HWBH 4U6VH 1Z3GL 3HMXH 2IPTL 1XGPA 5D6CB 4W4OA 3CCHB 2ZUXA 1EIBA 3NCJL 4Q9RL 3O6KH 1NUGA 3P4OB 1GOFA 4OZFH 4EQ3A 4KVNH 1G6RA 1KCRL 5E2JA 3SDCA 1XR8B 3SPVA 3WKMH 2O61A 2H2SC 1TQBB 2L7UA 3C5ZA 3OMZA 5DI8B 4LHUG 3BPNC 5T1MA 5L6YL 3D2UB 5DA0B 5AZ2L 1IAMA 3TBYA 5C0FA 4GUPA 4DGVH 2ICEA 4HSQA 5IMKA 3O3EB 5EB9A 1RQ5A 4I2XB 2NY4C 3DMMD 5J13C 1P1ZA 3L3JB 1LE5A 1CLCA 4FTVE 1YEGL 4L4VB 1Q72L 4NJ9L 5DEZA 5HGGS 3BD5A 1JF1B 4YFLI 3G5XA 2VSCA 1S5HB 3BP7B 1F6AA 3FB5A 1UM5H 1RZGA 2FGZA 1VGKB 1XT5A 4UT6H 3KJ6H 2ARJB 4FXLA 3C6LB 5C0DB 5IMLA 4M8VA 2DJSA 1YEJL 5DK3A 1J1PL 4PG9A 4YHMH 3QFJB 5F1IA 3QXUA 3NA4A 4QY8B 5T33H 4XVJL 4JQXA 1RZ8A 3HAEG 4X7DC 1LD9B 1QG3A 4JVWA 4D9QD 1LEGB 2BJMH 1DBJL 5SV3A 3FMGH 2R0LL 1SHMA 3WD5L 2UWEF 2IGFL 3CFEB 3KR3H 4HUUA 5EOTB 4HC1L 4S10A 5D2NB 4N0FA 2FB4L 3GBMH 5IM7A 2XI9A 1KB9K 1BQSA 2W91A 4HV8B 5HJ3B 2B5IC 4HW6A 2DM3A 4PREB 3RVUC 1KJ2A 2P42B 2Y5TA 5J11B 3DX9B 1G7JA 3ARXA 4YFEA 4ALAH 5CEZH 5SWSE 4MS8D 1KCLA 2EXWC 1HHIA 1Q9LA 4P59L 4V2BA 1SBSL 1KCSL 1K8IB 5DTFB 1D3CA 1OCWL 1X6NA 4M5ZL 2YK1H 2YD3A 4IIQB 3WDIA 4M61B 1OWRM 4MXWH 2I9TB 5GS0D 2F74B 4CU8A 3EOTL 1I8MB 3GMPA 1R5VA 3HKFA 2L0DA 2YPLD 2FJFA 2EE6A 3MLTB 2COQA 4ZFGL 4UQ2B 3T04D 1N7ML 4ONFH 1JI2A 2BNRE 3PHSA 1MFBL 1H3VA 3P4MA 2C3WA 5EORL 1KIRB 5ESVB 4AY0A 4GW1A 5C9JB 1HSBA 2HAZA 1ZK9A 1HN1A 4NWTL 1AO7B 2AKRB 4U1MB 5H35B 4M7KH 5JOFB 1QFPA 3H9HB 3T0DA 3K4DA 1UVQB 3MRRB 2DQEH 3SEPA 5LCVH 1TPXB 2D2OA 3MLRH 5EU7E 1J87A 3OGOE 4DEPB 3MV7B 3VFVA 4JVPA 3S34H 3BUYB 3VWJD 3GK8L 5JMRA 3NFNA 4PLJD 1BWMA 3IRPX 3DXAD 3EZ8A 4UBDC 3U0TB 3ULUL 5E08H 1FNSH 5JW4N 5TE6H 2F54E 2VB5A 5ALBH 3ROOB 4IMKC 4B5EA 4DGIL 4JRXD 4O02H 4YX2L 5J9PA 3O2WL 3GMNA 5LGJB 4KMQA 1BLNB 2OL3L 2VDML 4PJ7F 3QWRD 3RL2A 1TENA 4OTXL 1NC4B 4JFEE 4ETQA 3ZO0A 4YNYA 3QUZB 4G8FA 4KHTL 3DO3A 2OJEA 1F11A 4YIQA 1ADQL 3BH9A 3FB6B 3L7EB 3QJHA 4WW2F 5C92A 4O5LL 2XQBL 4LBEB 4P9HH 5E6IA 4TVPL 4KRPC 4R26L 1D5MB 1XF5B 1A6ZB 4V1DE 5FA4B 3THML 3PJSA 3ET9F 3ZZ1A 1PSKH 5FUZH 4HJ0D 4U1LB 4PRAA 5HYJE 1Y6KR 1D9KD 3K81A 2DQTL 4X0KA 1H15A 3LKRB 2VDOH 3RY5A 4ELKA 3O6FA 3EYQC 3N85H 1S7RB 4OZGE 3GHBL 5I73B 4WI4A 5E00A 3VXME 5KAQG 4PTUB 5E2TH 4D9QE 2Q20A 4NM8H 4PS4H 3MGOA 2CXKA 4YXHL 1CE1H 3VXNB 2CLRB 4GRMB 5CKAA 2NY0B 2FRGP 4WFHE 1EO7A 4Y4KA 1Q94B 1S9XA 4X6BA 3QH3B 3V7AE 4HPOH 3ILQD 3TCXA 3EAKA 3HE6B 4X6DF 3HI1A 5IBUG 1MLBA 1MRDL 4LPTA 2PYFB 4PJDE 5J1SC 3ZDXF 2P8LB 1J8HD 2DAVA 2DM2A 4HK0B 1T5WB 2VJXA 1CZ8L 3O4LA 4N0YH 1P5UA 1RVFL 1Q1JL 4P48A 4PJHA 3V9FA 4HS6B 5DJ6B 1JMZA 5GGRY 4NRXA 4EI5D 2BHYA 3QEUB 1K3IA 1UZ8B 4M3JA 2BERA 5E2WL 3VXRD 3QEQB 1UB5A 2CRZA 4FQCL 4NBXB 4J4PC 2AABL 4CVXB 4RSVA 4R0LC 5ILTL 3SDXF 3C9NA 4NQXB 3TYGL 3MJGX 3DO7B 1F8TL 2KPNA 4QHLA 1J12A 3RP1A 3L95B 3EYOB 2EDNA 3WNLA 4JHZA 5ETUB 1LEIB 3BGAA 1S9WA 5ESAB 4F9LA 1YYLH 1CICA 2V7HB 5FK9B 3VG9C 5T1LD 5JOEA 1NGZA 4M3KB 4ESKA 2W92A 3FQTB 3RGVC 5MERA 3P9LA 5I75C 4TNWF 5DD0L 5I1LA 5BV7H 3PGCB 4H8WH 1TVBB 2Y5EA 1OAXL 4YBHA 5T1DH 4R96B 2YSSA 3BE1L 1T3FA 3FB7B 1VPOL 5DMYA 5DWUL 3DRQA 3BAEL 3ZHKA 5CBEB 3O3DB 1FH5L 1QPXA 1JJUA 5GGUB 4OM0L 3QIWC 3B9KB 1S5IH 3LQMA 3SCMB 1WCBB 3MOAL 1DQQA 3S5LA 2DIJA 3WN5B 4AK1A 4HJ0C 1EAPB 5L0QC 1EEUA 3C6SB 1HWHB 5HGAA 4KJWC 4XCEB 3O2VL 4U3HA 1CU4H 2NPLX 4KTEH 4X80H 2QQNH 2K1MA 3RVTC 4OJFL 3ARFB 4XVUC 4OZ4A 2B2XH 4QWWD 1RJLB 3SKNA 4L4TD 1M05B 3QIUD 2BRRH 4GG8B 1C08B 1QFHA 2ATPA 4PRID 3T3PF 5IEHA 4KRNA 3S3SA 2IANE 1DBKL 4M43H 4D8PB 3NZ8B 5IVXE 4WU5B 2AGJL 2DN7A 1CDYA 1UM6L 2YA1A 1BJ1J 2VDLH 3ILQC 1Q8MA 2IAMD 5CD3A 1JNHA 2PF6A 3IDYB 1E27A 3DRTB 1RIUH 4JZNB 4NUGH 3T0EB 4JY6B 3NIFF 2A6IB 5TDPB 3IDGA 4OCXL 1L7IL 4GG6F 5KZCB 4LRIC 2EZ0C 3HPLA 5KVGH 1ZGLM 1I7ZA 3PE9A 3WFCH 2R0ZL 2V5MA 2HRLA 2EDEA 2H6PA 5E8NB 3ZE2F 4R4FL 4IJ3B 3PQYD 3M45A 2XACC 3O81A 4JO4H 2WINB 3GM8A 4P2RD 4QNPE 3D85A 1ZKAA 1ES0B 3VWKA 5K9KB 1MRCL 1RJZA 3FT2B 3QCTH 3CMGA 4Y16D 3UJIH 4ONHA 1BD2D 3WNPA 3F12A 2BSSB 3DSNA 5JIKA 5CGMA 2CXGA 1E0OB 1FNAA 4BH8A 1PYWA 4JKMA 3RQ3A 4ZTPH 5FOJA 3RDTA 3OGCB 3PXHA 3WS3A 2I5YL 5IW6B 4Y19B 4PG2A 2O5XH 4HC1A 3MJ6A 2R4RH 1EHLH 5HGHA 5HGDB 4R4NC 1CT8A 2EDYA 5LQBH 4XRCB 5HPMB 2NX5E 5FUCE 2CDGB 4P2OB 3MV01 5I8EB 3IDMA 1U8IB 4Z78A 5DVMA 1XF2B 5CILL 1MFNA 4RAHA 3VU2A 5K59E 4B50A 1MFEH 4X7FC 4P3WA 4OAWB 1FN4A 3D39B 5MENA 3MLWH 3BIBX 3FFDA 2J6EL 5LGKA 1MCWM 4QRQB 3RZWA 1YNKH 4YWGL 5C0BD 5GJSH 2X70B 4Y2DC 4G43B 1KJ3L 5D8JL 2AJSL 2F53B 4FZEH 1AR2A 1D5XA 5KSUA 2FEDD 5F71A 1K6QL 4UQ3B 3FFCA 1T03H 35C8H 3V6BR 2J2ZA 5D4QA 3EO1A 5DFTA 2NLJA 3HHRB 3OX8B 4U6HA 5HHVL 4PV9B 5DVNA 1BREA 1TXKA 2JJTC 2WUCL 4AQOA 4Z7OF 2ZG2A 3WL9B 5EC2B 1C5DA 3BN9C 4KAQL 3CVIL 4Y1AB 3S98A 2HKFH 1T1XA 1K85A 4LPXA 5L8JB 1ZA6A 3Q6GL 4R0LA 5IVOA 3QAZB 4GW5B 4N0UE 1E4XI 2GTWB 3S6CA 4CUCA 3LD8C 3WIIL 2WQRA 2BP3A 1KCUL 3CIQA 4JM4L 4PJ5E 4ZFFA 1MF2L 4O2CB 3FQUA 5GRUH 1CWVA 4OZIF 5I6XB 3HA0A 3SE9L 3MNWB 1VESA 1I1FA 4BFBD 3RGVA 4YHLL 2IPUG 4KKBD 1S7TB 5KG9B 1QRND 3CFCL 5GRJL 1U41A 3H3BC 1VERA 5DJYA 1U91B 4PRIE 4Y16C 3LKPB 3EDEA 3GIVB 4M7LT 5F9AC 4HUWB 2OL3A 1RUAH 3F7PC 4PJEE 4FZ8H 3RZCC 3F7VB 5AZEH 1HWGB 4QO1A 3V0WH 2VN4A 4Y5VB 4XX1G 3KGRA 1MHPL 5BS0B 1ADQA 1I7RB 1NH6A 4MCZA 4DZBB 2OP4L 3MYZA 2A9NH 3QEHA 4NWUH 4LRNL 1IM9A 1QQDB 1KLGB 1JE6A 4AIZB 2R4SH 1FNEB 1N0XH 2BXZA 3DBXB 1CFNA 4U7KA 1P4IH 1T7VA 4LQFL 1FRGL 1HH6B 1YN7B 4ZTOL 3MRGA 4CMHC 4OSUH 1AJ7L 1CR9L 2JKXA 2VDPH 5I76A 3IFOB 1UWGL 4I0PD 1CTNA 5JW4Q 1OAKH 5C86A 2K3TA 5DD1L 4JM2D 5CJQH 3G5ZB 1YEHH 3U6RA 4OF5A 4KHXL 4F7EB 1T1WA 1MJ8H 1YEEH 5CS7A 3BDYL 4AEIL 4LPWA 2X1QA 5F7WC 1FHGA 2DBLH 4OZHE 3SKOA 1QOKA 4LRIA 4P2QA 3EOBA 2VZVA 2I60L 3FQNB 3QA3B 1B0WA 4NQSB 5BRZE 4PP1D 2QBWA 5DT1H 4Y4FA 2VZSA 1G7LA 4JKLA 4B41A 3QQ9D 3V5DA 1G6RH 4MHHI 4MJIA 1IAOA 2YEZB 1OL0A 3MLVL 3ZDZF 5E5MA 4HUMB 1OQOA 4UNTA 5D1QD 3LHPL 2J88H 5T3XH 3GMLA 2YWZA 1FDLL 1FFPB 4P57A 4AT6A 2A73B 2ZUQC 3T0BA 1MFCH 2NY6B 3ARBD 1KYOJ 1U8JB 1JIBA 1SJEA 3REWB 1NMAH 4U0RB 4KDTC 4X6CE 3PWLB 3OB0H 3CZFA 3HS0B 5IFJB 1LK2A 2AJYH 4PJ8B 2E6JA 4XTRD 5F7HA 4JFQB 3C8HA 1OP3H 3RWIA 5I1HL 4HWNA 1INDH 3OKOB 4C83B 4HG4K 5HVFB 2ADIA 4AEHL 4XCYB 3DSFL 4YHZH 4BH7B 1F4XL 3U7AA 3T2NH 2IH3A 3QPQC 3VI4E 1CQYA 1R3HB 2XG5A 1LEKB 2XRAL 3UPRA 4PB0L 4ODWB 4UT9L 4QXGL 3NPSB 4RX4A 5F88B 2BVOA 1V3JA 3J7HA 3PWPB 4GT7A 4DW2L 2DQUL 1HDMB 1ZHNB 2V2TA 3MRCA 2Y07H 3EYFA 2A6DB 4HJGA 3VXUE 4LCCA 5KN5A 2B7DT 5FECB 2PW1B 4JHWL 3WKNA 3QT2A 1DEEA 4ZS6C 4Y8AA 4OLYH 4HHAB 4OCRL 4QRSB 4CKVX 2ZNWA 1PG7X 1GGCL 1XF4B 2V9RA 5FAAA 3VG0H 4PJHF 1J1OL 4N0RA 1QSEB 3W5MA 5B21A 3UTTD 1G9ML 4KUZH 4R2GD 3HNSH 3LEXB 5DJ0B 4IMLA 1FE8L 1CLYH 4UV4H 3LKNA 1IGYA 1N59B 4HUKB 1G7HB 2E7BA 1H3GA 3T4AB 3IJHA 4GLRI 3DWTA 1F4YL 3E6HA 3SDYL 1HILA 4PRHB 4ZUWB 1DQML 2NY5H 3MMEB 4OD2B 4UIKL 4RMQA 3P30H 3A6BH 4MA7H 4XMPL 3BQUC 3MPCA 4ZODA 3C60C 3NA9L 2HT2C 2OTPA 4PUBL 4KDWA 2GUOA 4M6MH 4ZUVB 3ARGA 4OLWH 4X7SL 1Q9WB 3ARBC 1A4KA 4Z77B 5I1IL 2YC1B 2XWBB 1NC2A 5KSVA 2Q7YA 3IFPA 1TIUA 4L3EB 1QLRA 1MQKH 4LCWD 4TPRH 3IDNB 1GAFH 3VGBA 4XTRC 4Z18A 3T2QA 3CDFA 3O8XB 3MJ9L 1PQZB 5D2LA 4XNUL 3MCLL 3LY6A 3PHQB 4PFEA 4BJLA 3GSWA 5D96C 4HPYH 3SY0B 2VDNH 3HZKA 2RIKA 1HOCB 3WJJC 4UT7L 2LAGB 3SQOH 2VLLB 1BBDL 2ICWA 3SGEI 1KSRA 4UTAL 4TUJB 1VKXB 2ICCA 5GISL 1QO3B 4P5KA 5JPMA 1LNUA 1NCWL 4XHQA 5D5ME 3FRUB 4LSTH 1RK0B 2ESVA 1XGTA 2J8UF 3ZT5A 3MJ8A 4K8RL 2ZUVA 4JPIB 3CSYA 4MXQC 3P0VH 4DKFH 3KYOB 4X8XA 4ZS7H 3LN5B 3RHWF 3KPRE 4MAYD 4AQ1B 4PJFB 5FF6B 1NAKL 4PGCA 4XZUA 4G9DA 5LGHL 5CLWA 2N56A 4JFDB 4L8DA 1XGPB 3DX7A 4MLIA 1I1AD 3L3IA 3BZEB 2HFTA 1SM3H 1NLDL 1PDKA 4HCRA 3RTQC 3FONA 5DD5L 3MUJA 4WCYH 2YR3A 5D93C 3HFMH 2O61B 4CADA 3LIZL 5EUOE 5C0RL 2DMCA 2OK0H 3DPBA 3UYRH 1HQ4A 4QRRB 1G9MC 4OV5A 1JWMB 3RWEA 1UADC 5C0FB 1WZ1L 3TBYB 4WY7L 4HH9A 4IRJB 2ICEB 4HJJL 5D7SH 5IMKB 1XCTA 5GHWL 4ELME 2PO6C 2Y36L 3U4BH 1VGEH 4G6JL 5C0EA 1IGTA 1MCIA 4OFDA 5JLZB 3C2AH 3N0PB 1FL5A 2BHZA 1P1ZB 2BSTA 1GC1H 3ZYIA 1ZGLA 4WFFE 5ICXA 3DUSA 4JR9L 3OR6A 3W9DB 4GSDL 4MD5A 4OLUL 4NM4L 1QRKA 4WV1C 2QHLA 1S9YA 1ACYL 1RZGB 4JZJA 5KBNC 5LJYH 4LCYA 4M7JH 2J12B 2JIXD 4BSWA 4XXDA 5E99L 3TZVB 1YC7A 2AXHA 2DYPA 4MLSA 1RUKH 4PG9B 1IKNC 4YBLC 1NEZA 3GB7A 1OSPH 2QTEA 1QBBA 3VW3L 1Z9LA 1E4WH 2VLRA 1JPSH 4KUCD 4L8SC 5CEZD 2DLIA 3MODH 2P5EB 1PEWA 4DKEH 4G7YL 3FRPA 2HH0H 1G7QB 3QISA 2ITDA 4PGBA 4HUUB 3UTPE 1TITA 5FYJD 1FL3A 5D1ZD 4N0FB 3ILPB 4OLZL 2HRPH 2FX9H 4C55A 3BKJH 1CDJA 3FQWA 3I50L 5DD6A 4NQCA 1KJ2B 2J1KA 4M7ZC 5JR1L 2X1PA 4K8RC 2DL9A 4LCWE 2D03H 1N6QH 1G7JB 1I7UA 3RVVD 4KJPD 1PG7W 5DLML 2X4PA 4G7VL 5IBTH 1FG9C 1CYGA 1OT2A 1Q9LB 3S4SA 5I1JL 1NCBH 4P9MH 5GGQL 3RAJH 3V2AR 1SVZA 1FSKB 1P6AB 3ZYJA 4RWYL 2ID5A 4LASH 1TLKA 3C60A 4HGMA 3JV5A 2HJKA 2WNGA 1DQDL 4GQPH 3MNVA 3TH3T 1CBVH 4JCMA 3GSNL 4GW1B 4NQTA 1HSBB 4X7TA 2Q8AL 4QOKD 4LHUA 1RFDH 2W59A 3B9EA 4K7PL 3CH8A 4AH2A 5GXBB 5JA9A 3CFDA 2M8XA 1F2QA 1JNJA 2DM4A 1A6WL 3MFFA 5IEKB 5E8DH 5IWLC 3IAQA 3NFPB 4OLXH 4LVEA 1IGCH 4H5SB 1MJUH 1OGAE 1SBBA 2IADA 2H9GA 2EYSA 4TVSa 1GIGL 3VFVB 4XVSL 4XWOC 4KKNA 2WQ8A 3NFNB 3I6KA 1DUZA 4OFVA 4R8WL 1U8PB 2ZKHH 5FHBH 4JO1H 3NOIA 5F1OB 5F9OL 5IESL 2X4TA 1RAMA 2Z31A 3BKML 4LVNB 3IU4L 5J9PB 2C7UB 4XC3H 3CAFA 2VL5A 3VGAB 3GMNB 4PBWD 4Z95L 4R90H 2X7LB 3UO1L 5CP7A 4NHUA 5D72H 1UH2A 3MRDA 1FC1A 2AK4D 1GGIL 3RL2B 4AG4L 1TNMA 3TPUA 4JDZA 2PXYA 2IG2H 5AUMA 1MNUL 3SDAD 5C9KA 1Q0XH 4BELD 4G8FB 1ZSDA 2GJZA 4RQQA 1ZT7A 3QJHB 5EZLA 2AJVL 4WHTA 1HINH 4UNUA 3PJSB 4OIIL 2YN5A 1VFAA 1EJOH 1H15B 1JZ3A 5KVDH 1JGLL 3O6FB 3W39A 5F8RC 1J05B 3S36L 4GKZB 4LSVL 3SGJA 5E00B 1NAMB 3IXTA 3PWJA 5CEZE 1F6FB 2JB5H 2PO6A 4MQXD 4RISH 5EPMA 2YN3A 5HI3D 4EEEA 4Y4KB 4JFPB 2XZAH 5J13B 1F2XK 3HG1A 1S9XB 4I5BA 4K7FA 4X6BB 3SKJH 5GS1A 3VD9A 1N5YL 1TETL 3DVGB 5EBLA 1C12B 1AXTH 5H37G 5KSAC 2GJ6D 1FYTA 4HLJA 5A2IH 1MLBB 5C09B 1FGNL 5EOCH 3PP3K 3P0YH 2W38A 1J5OL 3MYJB 5D1XD 4M48L 2D7TL 3HE7A 2LVEA 3O4LB 1C16B 5E4IA 1A64A 1QR1B 4PJBA 3WJLA 5EA0H 1IKNA 3AC0A 4YDKL 1MHHA 1UB5B 5HVGB 3O9WC 1ZGLP 4P46A 3RU8H 5C6WH 3TBVB 3RWFB 3FL7A 3NCFB 4RFOH 1F4WH 4QHLB 3U36A 5F8QC 5IJVB 4M7LL 4GBXA 2FO4A 4ZUSA 4JG1L 3GSVA 1A7OH 5F1NA 2YZ8A 1JTTA 1S9WB 1CICB 4LLWA 1N0LA 1F90H 3L3KA 1OAYH 3N50A 3H9SD 4KMLB 3P9LB 1BPVA 7CGTA 5ID1B 1YMHA 2WIIA 1DQLH 1T7XA 4D9LH 3LRGA 4HLZH 5I1LB 4BZ1L 2O5ZL 3D3VD 5C07A 3KXFB 3MNZB 2YSSB 4XNQA 2CD0A 3K4AA 2CQVA 3EDDA 4OGXH 3RVXD 1V7NL 2Q6WA 1OF2A 4XNYL 2R23A 5IFAH 3DRQB 2XZCH 4Z0BH 1EV2E 3RNQA 3EHBD 1CDCA 1DQQB 1ZEAL 3S5LB 1M6OB 1FFRA 5HYQA 3X14B 2CLVA 4NNPH 1R5IA 4KI1A 5HGAB 3BGFC 4U3XA 2CIKB 3B4NA 5DRZB 1NUFA 1FGVL 4G80A 4LAJH 4NQED 4JCLA 1BQLL 2FBOJ 3QIBD 3VD4A 1MY7A 3MBEC 3SKNB 1JGUL 5DUBB 4OFPA 4KZDH 3NACL 4JLRA 1O7SA 1A9EB 2ATPB 5IEHB 2UWEE 3MLSH 3EYUH 5DFVD 1OSZB 4WEMB 2E9JA 3GEWB 5HI3C 1BZ9B 3MGTA 3LRSB 2W1NA 2X9YA 3ARDC 4AL8L 3AUVA 1N2RA 4OFIA 3WNMA 5M7QA 3VXSE 4ORGA 4EN3D 5CD3B 1JNHB 5GJTH 4ZNEE 3TP4A 1NLBL 3UAJD 1H0DA 3NGBC 5EOQL 3IDGB 1YN6A 5FKPB 4URTB 3HPLB 4MQ7A 1DLHA 2DQGH 3BUTA 5IMOA 1I7ZB 1N6VA 4X7EC 1CDUA 3H9YA 1RUPL 2BY0A 1NBZB 3QEGL 5IGXL 4NKIL 2YD4A 4MJ5A 3D85B 3PWUB 1AFVH 3ZSTA 2WBWB 3HRPA 5EU7C 4ONHB 2R2CA 2YD2A 5F96L 4NPYB 2KBGA 4LLMA 1R5WA 5DVLA 1PYWB 2HLFC 1CFVH 1WWWX 2C1PA 4ONGH 4YFLF 5ACZA 2FSEB 4N5UA 3RDTB 3WS3B 1QFWM 4QHUB 3BT2L 4QCIA 3UBXA 3DIFA 1XGRA 2V5YA 2VXQH 4KRPB 5HGHB 1U6AL 3CK0L 3VGHA 4WTZA 3L5WB 3QNYA 1CIUA 2WBJA 4ZXBC 5ESQA 3VMPA 2AQ2A 3DI2B 4Z78B 3TNMA 3WXWH 3DGCR 4JY5L 4NKMA 4CJ0A 3BP5A 2F15A 1FN4B 3SGKC 5HY9A 4OB5H 4G9FA 1MEXH 2R69L 3RVXC 3BIAX 3GJFH 5L7XH 1EX0A 2AK1L 3BESR 4NRYB 1MRFL 4X9FA 4YDJA 5TF1H 1I8LC 4JRYB 5HYSB 5MP6L 3FO9A 4IOFC 4QKXB 2C3GA 3CMOH 3HN3A 1U8OB 4APQD 4OZFG 3FFCB 3GJEB 4LDLB 3V4VL 1EFQA 4M5YH 3B5HA 3DVFA 3H9SE 3BPOC 4OF6A 1W72H 4IRZH 2D31A 5I74B 2VLMD 1L4IA 4PJ7E 25C8H 4ZFOB 1C5DB 2E7MA 1HEZA 1IC5L 1S3KL 1UM4L 4UU9A 5ERWB 4YBQD 2VSDA 3QDJD