1RVFH

Fab complexed with intact human rhinovirus
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
119
structure length
119
Chain Sequence
QGQLQQSGAELVRPGSSVKISCKASGYAFSSFWVNWVKQRPGQGLEWIGQIYPGDGDNKYNGKFKGKATLTADKSSTTAYMQLYSLTSEDSAVYFCARSGNYPYAMDYWGQGTSVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus/immune system
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN
publication title Neutralizing antibody to human rhinovirus 14 penetrates the receptor-binding canyon.
pubmed doi rcsb
total genus 16
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 1996-09-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rvfH00
3BKYH 5J3HC 3IDMA 1AKJB 4FXKB 1T7YA 4UT9H 4BFIB 3VGAB 4UDTA 2BC4B 3JUZA 4JPIB 2HMID 1IGFH 3CDGA 3BWAB 3IDXL 1P4IH 3E6FB 4NFDA 3WIHA 3W9EB 4IRZH 4HAFA 3O3AB 5DQDH 5CP3H 1D5BB 3DETC 2FZ3B 2Q3ZA 5ICZB 1QOKA 5J1SC 4N5ED 3MLVH 4K7FA 4NKIH 3HN3A 5D1QB 3ZLQC 3WEXB 1U3JA 2HRPH 3LMJH 4Z0XA 1N6VA 3SDAA 1WFNA 5ESQB 2J6EL 3WDIA 4QOKB 5FXCH 3QXWA 2C1PB 5EUKA 5J1AA 5IMOB 2GY7B 3GIVB 3VG0H 2B5IC 1D9KA 4LEOA 4Z9KB 4AMKH 1GRWA 2BVOB 3L3OA 3JXAA 3FAXA 1KJ2B 1L9NA 1AE6H 5IW6B 1J88A 3LQZB 3CVIH 4YQXH 5ADOL 2E6PA 1DVFA 1OQOA 1G6RH 2VERN 3SPVA 1RZ7H 1RIVH 3DWTA 5ELIA 5AEAA 1K2DA 1WK0A 3GM0A 2JIXB 1E4XH 1QFWM 3O41B 3ZYOA 1RUMH 1XGUA 2VLKB 2E27H 4UTBL 1P2CA 4J3TA 1DANU 5ISZA 3MV7A 1D5ZB 1E28B 1S9KC 4OLYH 3UBXB 3MV8B 2PW1A 2CUIA 5C0CA 1RZGB 4LKXA 1YNKL 1NCCL 4I9WE 1PD6A 5FCUL 5IJKC 1I8LA 1FRGL 4YLQT 4W70A 4Z95H 1CVSC 1MCOL 5IB2B 3B5GA 4Z6AT 4MA7L 1GIGH 4ZPVB 1MLCA 2BSSA 1HKFA 1OB1B 5IEKA 4Z7UB 3FZUC 5DD6B 5LQBH 2CMRL 2QSCH 2VXUL 3BPCB 4JM2D 5I16B 1N6QL 4P5TA 3PQYA 1NC4D 1C1EL 4S1RL 1RY7B 4TUOB 5ADPH 2EZ0D 3ILPA 3I6LD 1XH3A 4MB4A 4ZYKA 3CH1A 4PG9B 1SJEB 4CBPA 4H20H 1JWSA 2NY5L 4X7EC 4G7YH 1T5WB 3VA6A 3ZKND 2WUCH 1MLBA 4LLMB 3H7BA 1ODAA 2R1XA 4N1HB 2ITCB 5EO0A 4AYFA 2FH6A 3DV6B 1CD9B 3GSWB 4X99B 1IAMA 4F9PC 1DN0A 4K3JL 3C2SA 4PRAB 3GI9L 4N0YL 1OCWH 3LVEA 1F90L 3EJJX 1Q9KA 5HHOD 4RMSA 8FABA 4QRPA 2EDFA 3IFPA 4TSAH 1UEYA 5T1LB 3UAJC 1MUJA 1ULVA 5IB4B 1Q9OB 5CEZL 3PIQB 1WZKA 2J7LA 1OOAA 2EICA 2NTFA 1OM3H 1WWCA 1PY9A 2DS4A 1MCNA 5ALBL 4ERSH 5DHVA 4MLSA 2J12B 2NY6D 4S0SD 3FRUA 1VGKA 3O3BA 1DQLL 1RK0A 4PP1D 5LAXB 4ZTPL 3ET9F 1W72A 3LRGA 5DJ0A 1LK2B 4FQCL 4WV1C 3SE8L 4U1NB 3V6OC 1MJJB 3FO2A 1BIIB 3KYNA 2BRQA 3KJ6L 4OTXL 1PG7L 1DDHA 4NSKA 5CEYB 3C5ZC 2UZIL 1BD2D 1NBZB 5DWUL 5L8JB 4Y4FC 1J87A 4P0DA 5IMLA 2ZCLH 1AQDA 3PWJB 4LBEB 4WU5A 4O5LH 2QQKH 2VDKL 4JFXB 5IMMB 4ZNEA 2EYTA 3CU1A 4ZS7L 3E3QE 2F19H 3NMEA 1N5YL 1CDIA 2C4XA 4ODXA 5C0EA 5J12B 1T83C 5J11C 4KTDH 3L3IB 1U58A 5K9OB 3BGFB 4L8DB 4MGXA 2PW2A 7CGTA 4CL7A 4I3RL 1WGOA 2NY2C 2Y06L 3SKJL 4HPYL 4XCFL 1TXKA 4MQTB 4P48A 5E2WH 3NIDE 3QXAA 3GSNB 1KLUA 2VQTA 1WEJL 4GW4B 4KMTL 1J86A 5I1KL 3PWVA 4D3CH 4NHCL 1OT1A 5F7MC 4GKSA 5D6CA 2ZUSA 5B38G 3T8XB 5F71A 3GJEB 2HKHH 1WJ3A 1ZVSA 1S9YA 2UYLB 4PB0L 2H9GA 1HK6A 4Z7VA 5B39G 2VDOH 2VQ1B 4FTVD 4Y4HD 4LCUB 4HWZA 5C08B 4BH7A 1FP5A 4LCYA 1H8SA 5ID1A 2CQVA 3IDYB 2H32A 3PGDB 4U1MB 5TH2B 2O61B 1JZ3A 3UYOD 3MLRH 3OKKB 4ZO8A 3LKNA 3OJMB 1SVZA 3LEYH 3V6FB 4ODUB 2EE9A 3VXOA 1R3KA 4E42A 4HHAB 5JOPD 4HZAA 4BSJA 5FA3A 5D7IA 4JFDD 1GVIA 5E8NB 1DQML 1VEOA 3AY4C 4HS3B 1TZIA 3C2AH 1S9WA 2ZOLB 1A6AB 2F5BH 3A67L 4OB5H 4ODVL 4UDUA 4NQXA 2L7UA 4MQ7B 4UIKH 4XTRD 1D6EA 4GXUM 5GRZA 2PXYA 1CE1L 2AABL 4E5XB 3EJZD 3TH2T 5A43C 2FX9L 1JF1B 5CGMA 3EYQC 3GBNL 1J8HE 4OFYA 1AO7A 1FHGA 2YBRB 1WC7A 5CGTA 4HT1H 5JORB 4QGTA 4F7PA 4WUUB 4PRBA 3IJYB 4BUHA 4C56B 1GOGA 3ZYJA 1F02I 3MRFB 1FYTA 1NL0L 4WWID 3IT8D 5LXGH 2PO6B 2BFVL 1Q9WA 1ORSB 4JY4A 5T1KB 4HBCH 3BD5A 3HUJA 2VLLA 4FXGA 4QRRD 4MQXC 4G5ZH 4LPUA 2Q6WA 3BH8B 1W0WB 4NOBA 4NZRH 2FL5A 4R4FH 5CHNA 1YEFL 1KLFA 3PHQB 5MENB 4QRPE 4I3SL 4HQQH 3RWDA 2F15A 1H9VA 1L0XA 3FQNA 3VFSB 1ZS8B 1CFBA 5IHBA 3WFBL 1KJ2H 1QBML 3NPZB 3RA7H 2ATPB 1KOAA 3LQAH 2O5XL 4EBQL 5CBEA 2ZUQC 5I8EB 1MFNA 3DYPA 1MCWW 4LIQL 1KPVA 2EXYD 1I1FA 4XP4L 3MNZB 4JY5L 3LEXB 4HMCA 4WY7L 1YYMH 1ACYL 4HMEA 1NGZB 4PJDF 1ADQH 3HC0B 5C9JA 1KJVA 3MV8D 4P2QE 3OKDB 1KSRA 4M3KB 4XVJH 4P57A 1NDMA 2NX5D 3IVKA 5IFJA 3OTTA 5EA0L 3S35X 1J5OL 3GMRB 3MRRB 4F58H 1KIQB 4M6NH 1DQTA 4I18A 3L3JA 4JRYA 1G7HB 1T20B 3BDBA 1N7MH 1OSZA 4KJYA 5H35A 4JO4H 4X4ME 1EUUA 1IQWH 2BX5A 1OVZA 1JGEB 4XP5H 4L4JA 2CLZA 4BSWA 3WUWG 4BKLB 3AS1A 5CINL 4IIQC 5E8EB 4KUZL 1CDCA 1P4LB 3GSQA 3HZKB 5DJAA 5D96B 2A83B 5T3XE 3KPPB 4OCSH 5KANG 4HV8A 1IBGH 3FB6A 1X5YA 3QFDA 4GKZA 3NCFB 4Z7VE 5MEPB 2V2XA 4KKBD 4G9DB 2VKWA 3C6LD 3V4PL 3QIUD 3EDKA 4PJ8D 1BZ9A 4R8WH 3MXWH 1FGNL 2DTML 2VXVH 1IAKB 2ZJSL 3TBSB 2DQJL 5HI5C 2VDPH 2ICEA 1A7QH 3W39A 4FFZL 5D7IE 2R0LH 2R8SL 2IPUK 4MAYC 4U3HA 3QPXL 5FGSA 4OZHB 4HKJB 3E8UL 2D3VA 4NKQB 4RMRA 3EHBD 3Q6FB 5JOFB 2K3TA 1CLYL 4JFQA 2DQEL 1WIUA 4GAYB 4PJAA 2XNAB 3EKCA 2A0LD 2E9IA 4X6BA 4X98A 4AIOA 5HPMB 1XGPA 1A7OL 3MR9B 1I1AA 3HAEA 4R90L 1E0OB 1T3FA 2LU4A 3AS2A 2BHYA 1NGPH 3P2TA 5I1EH 3KDMB 4MJ6B 4K55A 2OTPA 3I02B 1MCRA 5FO8A 4U6YB 1IGCL 1SJHB 4LCCC 3HUJE 5CEXA 5DVKA 3U48A 1N64H 1R24A 4XNUL 4M5ZL 4ZPTA 3WD5L 3PDGA 1HILB 5B22A 4LFHD 4LSUL 4H26A 4K8RH 1T0MA 3O6FD 1JMZA 1FO0L 3GMLA 3QFJA 1F6AB 3QIBA 1WBZB 1AR2A 1DUYB 4D0DA 1B2WH 1RUKH 1ZWIA 1RJLB 1FNHA 2B0SH 4PGDB 1SM3L 4M43H 1BMGA 2OTUB 4Y2DA 3LH2L 4EIGB 5TFSH 5D2NE 43C9A 1IAIM 4PTTA 1VENA 4G3YH 5HGHA 2YXFA 4IDJL 1AGDB 3EO9L 5I76A 5DRZA 2NY1C 4OF6A 2OYPA 2SEBA 4U1IA 1D5IL 1TJHL 3N1QC 5DEFB 5CUSH 3B8SA 1EBPA 2ILLA 3HZYA 1NANH 1RZKH 5LGHH 3REWB 3DMMB 1BFOA 4FFYL 2JB6A 5CSBA 4XAKE 1CDUA 2X7LB 4DOHE 4HZLB 2Z4QA 3T3ME 5IOPA 3DGCR 4XP9L 2LAAA 3QNZA 3S4SA 3L3KB 3KPOB 1VGEL 3V5HB 2DKMA 3KJ4B 1ZT1B 2Q76B 3SGEH 5HYQB 4R6UA 5FM5M 1LE9B 3NACL 5CZXC 1G0YR 1JPSH 4KZDH 1HH6A 5E6IB 2CUMA 3NOIA 3TJHD 4G6FD 2FEEI 5GGTL 1A7PL 3TBTB 3MCG1 2I5YL 5IT2H 1UJTA 5GHWL 3MLUH 4R7DB 4WI8A 1U8LB 1D5XA 4RZCA 5FOJA 5H2BA 5BS0A 5T5FH 3UTPE 3DVNA 4N0CC 3ARGC 3JV5A 3TIDB 1A3RL 3FQXB 4EXKA 4AQ1B 4JZOB 1JE6A 2BNRD 2NY5C 3K8MA 1JIBA 3MRGA 5IHUL 1ZSDB 3MRLB 1WZMA 2IFFH 5I19L 4N90D 4XPGH 3EUUA 4PV9A 5EBMB 5CZVL 3OGCB 4CGTA 1MVUB 5EORL 4GG6A 4JANB 4U2ZA 35C8L 3O8XD 2KQNA 3DXAB 5HHME 1XF5A 4XGZA 1GOHA 1O5DT 2I9TA 4JY6B 1F4XL 5D7LD 1G0DA 5EUOA 3P3YA 3P4LA 3TBWA 2Y7QA 3EYSH 3QUKB 4ZSOE 5IW3A 1H15A 1LP9B 3FB5A 3SKNA 5JHDA 1IL1A 3T4YA 3QH3A 3HMWL 1F3JA 3WS3A 1UJ3C 1JGDA 3ZYIA 4NQCB 2O5YL 3IDGA 1EEZA 1CBVL 2QLVB 2R4RL 2F54A 2CRIA 4LLAA 2H3NB 1NMBL 2Y36L 3B3IB 3PGFL 3QJFA 1QSED 2D4FA 2HH0H 4I5BB 5JA9A 4MZ2A 2DRUA 5I1AB 4LSVL 3HB3D 1FPTH 1NGXB 4G7VL 5D1ZB 1E4JA 3BVNA 4N9GB 4QO1A 3LKRA 3OX8A 4Q9CA 4WUKH 1GGCL 3CFBB 4QYOA 3GSUA 5E7FA 3CFJA 1LHZA 5CILL 1S7RA 1QFUH 4R3SB 2ERJC 3DTXA 4MNGE 4JHBA 4WTWA 5DLML 4YE4H 1XZ0A 3BZFA 4OI7A 4PY8I 5L9DH 4Y5YA 4DVBB 4UB0H 2KL6A 1ZHBB 2IAND 3QHZH 1U8OB 3X14B 4GO6B 2J8UB 1MCWM 5I1HH 1JPTL 4PGZA 4Z76A 3DGGB 2OI9C 4Z7UF 4RIRA 3HPLA 1FYHB 4WEMB 1ZA6B 1UG9A 5GS0D 4KPHH 4Q6IA 4LVHC 4O9HH 5GS0H 4LOUD 5B4MD 3V6ZA 1EUTA 5DRXB 4OD3H 2Q7NA 3RAJL 3AB0C 4QNPF 3K4ZA 2JJVA 3E6HA 2FSEB 1QBLH 1FZKB 4IOIA 1F6FB 4NQSA 3PWLA 1LWRA 3MBEB 2W1NA 1KTDA 1NBVH 4PY7A 2XTJB 3HE6A 4JM2A 4CJ1A 3KVQA 4HH8A 4HWEL 1IGJB 5GS1B 4P4RB 1I9JL 4NZUH 2QL1A 1O7SA 3VI3F 1DBMH 1HHHB 1RURH 1KELH 4XNQB 1YPZA 3G6JA 3PL6B 5FUCE 4LDEB 1BWWA 3DO7A 3D3VD 3N50A 2HRLA 4KKCD 1S5HB 1MH5A 4MXVE 3BPLB 1B0GA 2MQ3A 3RY6C 2NY3C 3T65B 1I8IA 2IPKB 3L3HB 4NBZB 5C0DB 1NUGA 1KEGH 2FHBA 2OK0H 5DC9B 3QEHA 1EJ6A 5FKPB 5IVOA 4MXQC 2UUDK 4XMPH 5EUOE 1F11A 2NW2A 2YD6A 1OAYL 2QADD 4R7NA 4YHZH 5FOBA 4MD0B 3SDCD 2Y6SC 5LGJB 4Y19B 1YEHH 2ESVB 3BJLA 3ULVL 5EU5B 5CAYB 4TOYL 4AY0A 1INQA 3KXFD 3EOTH 2H6PB 3U4BH 2G9HA 1XCTA 5BQ7A 3EIFA 1JWMA 4APQD 1BD2A 3QHFH 4LFHG 1WUNT 4QRUA 3DMMD 3QCTL 2EE3A 1MHCA 3P4NA 3DV4A 3UTQB 1ZEAH 4PJDE 4XC3H 3NGBC 3C5SA 4MDIB 2X40A 1J1OH 3V0VB 3PJSB 1CF8H 5I71B 5LGKA 4U31A 3QRGL 1UKSA 2PN5A 1BM3L 4CN6A 1KN4H 3MLYH 4PFEA 1U8NA 4G6ML 3ESUF 4QXGH 2HG5B 3H9SA 5E6ID 5C2UB 3T77B 3RDTD 4DGVL 4ELKB 4S1QL 2XY1A 5I8CA 4PLOB 4F3FB 4NCC2 2P8PB 3D18B 5C6TL 4PRHD 2R9HC 3ILQC 1UQSA 2XPGA 1KB9K 1F58L 3RZWA 3WLWC 4OZIB 3WL9A 4PJGB 2Z31A 1N4XH 1FNGA 3HTLX 2J5LB 3WIHL 3MRDB 3MOAH 2L7JA 4LARL 4X80L 3U9PL 4Y4HA 3PE9A 1LK3L 2A9NH 5KVEH 4O51B 3PWNA 4RA0C 3CZFA 2QQLL 4XNZB 5DFVC 2HFEA 1I9RL 3DXAD 2FGWL 2ZSWB 5CSGA 5HYIA 4CW1B 1X5FA 2ZCHH 1PDKA 2BSRB 1KNOB 2IMMA 1FNEB 1R5IB 3DOSA 3I6GB 2FGZA 4JFDA 2FBJH 2CGRH 1YQVH 3FQUA 5SWSA 4E41B 5T3ZD 2DQIH 1S78D 4R4BB 4U1SA 5ACMA 4PJXE 1IC4H 3LD8B 5T3ZH 4JQVC 5LVEA 3UC0L 1QQDA 3PWPB 2DQGL 1QR1B 1RK1A 1U8QB 3I6KA 3S96A 2ZUXA 4HWUA 3VGGA 1FG9C 3H9ZA 5I73B 3I6LE 4EI5C 4D0CA 3I75B 3TGXA 3DX9B 3MFFA 1EJOL 3VFNB 3KLAB 4LVEA 4PRNB 4KXZH 4NM4H 4I0PA 3FB7B 4LSPH 4HH9A 4OSUL 5TE4L 5JXEC 1LNUA 2DMKA 4M8QB 5GPRA 5D2LA 3HNSH 4HJ0D 4HIXL 3IDUA 1ACZA 4QRRA 4HUVA 2QQNL 3SEPA 4JJ5B 3WIFB 5SWQB 4Y16D 4LP5A 3RTQC 3RWCB 4NJAH 1K6QL 4PJEA 4RAHA 3WN5C 4X4XA 5HHOE 2ED8A 5MHSD 1IKFL 2A74A 1A1OA 5I75B 1MHEB 5JW3H 2Z9TA 1JZ6A 1CXKA 4QT5A 2PTUA 2MOVA 3U2SB 4P4KD 4PYGA 2V2TA 3VWJC 4M1DL 3KYOB 1X7QB 2HP4A 1QBAA 2P5ED 5SX5K 4ZQKB 3RGVB 1YNTB 1C16A 1IFHL 5I1CH 2AJSL 3WE6A 5C2BH 1MAMH 4XH2B 2AI0H 4M1GL 4L8BA 1P53A 2BNUA 1U92B 2BMKA 2DLEA 4ONHB 1BD2E 4OIAA 2DAVA 1A6VH 4IS6B 1EH9A 4MJ2A 4JDZA 1RSFA 3CH8A 3FN0H 2EDHA 3IU3A 4ZFZB 3QUMH 1WT5A 4LP4A 4LHUD 4XAWH 5MP6H 1EO5A 2E8ZA 4N5UA 4KI5C 2NX5A 4OGAD 4L8SB 3MXVH 4KKLD 2FLBT 3CPLB 2IBZY 1NSNL 4NT6B 4DN3L 1K5NB 3RL1B 5J3HD 5I17A 1GOFA 3RZCC 1GCFA 4U33A 1HXMB 2AGJH 3MUHL 4Z5RA 4P2OC 2G5BB 3K81A 1I1RA 3JTTA 2XTJD 4KMLB 1N0XH 4K3DL 5C1MB 3DETD 3MCLH 1BP3B 4QTHB 1KG0A 3WDJA 5EZIL 4K94H 2X9YA 5E2VL 1Q38A 3NZHL 4QHMB 1S7QA 2X5PA 2NR6C 4JE4B 2X9XA 1W72L 3NFNA 4P2CG 1OY3B 4TSCL 4FTVE 3CFKB 1FFOB 4M62H 3VFGL 3NFSH 1BQHB 2YD9A 3QIUA 4Q9BA 3IFNL 4UU9B 2LQRA 4PJ8A 1MFDL 3ES6A 3QO0A 3EFDL 3Q0HA 4OZHF 4K2UH 1YEIH 1XGTB 1DANT 1EHLL 5F3HA 5IUSA 5GSRB 1R5VB 1U8JB 4HF5L 3LN4B 5JOPE 1HEZA 4JFDE 4G6KH 3O11B 3S97C 5C0RL 2FO4A 4D2NA 5F7FA 2WZPD 1U41A 2AJ3B 2VE6A 1SEQH 4RMUA 4W4OA 1EFQA 2X4TA 5EN2B 3RX8A 5EZJA 1P6FA 3IF1A 3OXSA 4ZO7A 1T03L 3SCMB 2ESVD 3TVMA 5INDA 2JJSA 1Q1JH 1G9EA 2Z35A 5KSVB 1IJ9A 5T3XL 4JN1L 3O9WC 3TA3C 5DD3H 4LEXL 2JLLA 3EZJB 4DJMA 3ARVA 3NPSC 5IB3A 5GS3A 4OM1L 3HLAA 2YWZA 4BZ1H 1FAIH 1ZHKB 4MAUH 4M7KH 3T09A 1SVCP 3FZUD 2MQ0A 5BXFB 43CAA 4XNXH 1M4KA 3TYFB 2NXZC 1TCRB 4TRPH 5HGDA 5D7JB 3QUZC 5JNYA 3WKML 4NKMB 3O6FA 1U93A 3F6IA 2I25N 3ARDB 3DVIA 3B9DA 1R5WB 3ULSA 4GRWH 4XPHL 1FFPB 3DIFA 1MQKH 3WNOA 3ZT6A 5C0ND 1P7QA 3OQ3B 3PF2A 4ETQB 4ONFL 1RULH 2NNAA 4OBSA 4QHKI 3WFCH 3BD3A 4HDIA 3ELAT 1EV2E 1WTLA 2D9QB 5EC1A 2XTLA 4RFEB 3OJDB 1ED3B 3CSYB 1FBIL 3BWUC 4QHLB 1RUQH 5KG9A 4HK0B 3MV8E 1U8PA 4Z0BL 3LEVL 4FZ8H 1JZ8A 1EVUA 1YMMB 4IHOB 4JHWL 2DMBA 1IGTB 2XQBL 3UAJD 2NX5E 3IKKA 1NCUA 1PQZA 4JKPH 3I9GL 4E41D 3RWHB 5JW4N 4JFYB 5ANME 4Z7UE 1TJGH 1HOCA 2B2XL 5KVGH 4FHBD 2WMPA 1HH9B 4GRLB 1RZJL 4MWFA 4NBYB 4Z7OF 5KSBA 4Z8FH 3VWKC 2A6KB 3NCYP 5IV2A 3NA9L 4L3ED 4QRQB 5ECJE 2ADIB 2QKIB 1DBBL 3C5ZD 5AD0A 1G7PB 1MFCH 2XOTA 3P40A 3QCVH 3UYRL 4QNPE 2DJSA 3L5WA 4Y4FD 1G1YA 1JNJA 3WS6C 4JZJA 4X7FC 1S7VA 1RV6X 2GY5A 3OKNB 1NGWB 4L4VB 2EDXA 5J8OA 4XZUB 3SOBH 3JWNC 4M4PA 4UNUA 4OUUA 3LDBB 5EFIA 4LASH 4FP8L 3GJFB 1JI2A 3LQMA 5DQ9B 4AQOA 2BNRA 1GGBL 3ZYZA 2NY2D 3HZVB 4KROB 4WI4A 2HWZL 4R0LA 1X5JA 5HD8D 1U3HC 3F58L 4GAGL 3OXRB 4RDQF 4X6DB 2HJLB 1ZT7A 1LP9F 3O8XA 1UH3A 3VCLB 3NCMA 4JVPA 4PV8B 1A4KB 1U9KA 3PNWB 3QG7H 2DBLL 4TPRH 5HDBF 1W8NA 3B9KA 5D7LA 4DZ8A 2VXTH 2YZ8A 2R1YB 1P6AB 5GGSB 3RGVD 5IVXF 5DJ2A 2WINB 4Y5VB 2EE2A 3GMQA 3OHXA 3RPIB 5B8CB 5ACZA 5I30H 3SJVD 4EUPB 2A1WH 1DE4B 1MFEH 3RY4A 3TZVC 4B0MM 3ULVC 3M8OH 4JPWL 2YPVH 1JK8A 4LCWD 3B5TA 3EDFA 4X6EB 5EO1A 1ZGLM 1TZGL 1A1MB 2W60A 4DFHA 4HPOL 2W9DL 2ZKHL 4RFNB 4WO4B 1QNZL 4EDWH 1HINH 5T1DH 3FMGH 4PJHA 3EYQD 2CDGA 4U4BA 5DJ8A 5C07B 4M61B 1CFQA 2H2PC 3VH8G 3IDJB 3MUGA 1MFAL 3QEQD 2ORBH 4NWUH 4PBXA 3CZJA 2EYSB 1FE8H 4XMKL 2Z91B 4JFFD 1NGYB 3NN8B 2R2EB 2KDGA 5IM7A 1BIHA 2J8UF 4UZGA 2CK0H 5CCKH 2IH1B 4JRXB 4POYA 5F96L 2LV4A 4Y8AA 5DK2B 4LHUG 4MQXD 3IXAA 2GI7A 2GFBB 1KXTB 1UM6H 4PJ7A 3LZFH 4RMWA 2IANA 4MMZC 3RVXD 1V3LA 1XF4B 3MPCA 5EZOL 1RHHB 2VSCA 4EN3B 4LKCB 5JXAH 1PEZA 1MQ8A 3L95B 4AL8L 1VA9A 1HKLL 2ZUTA 4RNRB 5DMIL 3VFWB 3OSKA 1V3JA 3X3GL 2VKXA 3OR7B 5I6XB 2O5ZH 3UPAA 1B6DA 3C9NA 3RY5A 5GZNC 4L1HA 4CMHC 4RGNC 5KSBE 4WIQA 1BREA 4U1KB 5FEBA 4OT1L 1S8DB 3C8KB 1VADA 6FABH 3S5LG 4O58H 1MI5B 1HWHB 4DGIH 3G5VB 3Q6GH 5CD5C 4OF7A 4AENA 1U8MB 4WUUE 2A73A 4UTAL 3VE0A 1U8KA 4C56E 5SX4I 4LPYA 4YPGB 1H3UA 1KBGL 3CU7A 4LMQI 5IBLD 3CSPA 4FQQA 4XHJC 5L2KB 1REIA 5CIPB 3BKCL 2BNRE 4ODSH 3ARXA 3C8HA 3WV0A 5D5MA 3TP4A 3FQWB 3EO0A 1C5CH 3D3VA 1I7TA 2F53A 4N90E 1KPRB 2C7UB 3BSZL 4LSQL 5I1GH 4RRPG 3JWDL 5DUBA 4GQ9L 4J3SA 2JCCA 3FO0L 5EH1A 1CICB 5GIRA 4LF3B 3U82B 5EC2B 3O3EA 3ULUF 3UTZA 1GAFL 4M7LT 5D7LE 2AQ2A 5EOQL 5I1IH 5FGCB 2NXYB 4YXKL 4ZFGL 5I1LB 1MY5A 1L7IL 5IBUB 1AI1L 5GJSH 3U36A 4UT7L 4PD4J 3TF7C 3EOAB 3U79A 4N8CL 2FDBP 4J1UB 4UV7L 1Q9LB 1TVBB 4PJCA 1GYAA 5DT1L 3RL2A 3MA7B 5FHAL 4BK5A 2YC1A 2D7TL 4GS7C 5HI5D 1QEWB 5ICYB 3FFCA 4BZYA 3MRNA 2E9BA 4MS8C 3GHEL 4HKBA 3ZDZE 2V7NA 4MAYD 2XZQH 1AD9B 1ZTXH 4EDXA 2XKSA 1QSEE 3BKJL 5EU7C 4JDTL 3LV3A 1OAXL 4X5WB 4NO0B 5IQ7L 5KSUB 2ZCKH 4K3EH 2YUWA 1AGEA 1OGAB 1S5IH 4PJHE 3HR5A 1YDPB 1NFIA 2LTQC 1ITBB 3F7RA 3P9MA 2BCKB 1EMTH 4PJGF 3MRBB 4CADB 3EYVB 2FHCA 3RDTA 4GLRI 1GL4B 3UTSB 4YX2L 3QDJB 2P8LA 3IDXH 4HKXA 4CMMB 3GSRB 2R2BA 4MCYA 4TUJB 4Q9QL 2F8OA 5BVJB 3TC9A 5TDNA 1QVOA 2Q86A 3ZKXC 2VUOA 1A9BB 3X13A 2IANE 5KS9B 4NKIL 3GJFH 1T89C 5L2JA 4MJIA 2VABA 4LPXA 1PZ5B 3BRDA 2J6EH 1A6WL 5FYLL 3VXMB 1Q72H 4PRPB 1A1NA 3K4AA 1RPQA 3ZE0E 1CT8B 4RAVB 1FZMA 1I8KA 3MGOA 4OZHE 2VIRA 3FOLA 3DHMA 2YXMA 4G8EB 5ADOH 3T0EC 4OKDA 2NY1D 4P5MA 3QQ3A 3QSKB 2K7PA 3CVIL 1NCNA 1FJ1A 2YUVA 3JBG7 3D39A 4Y89A 1AGBB 1AP2B 3L7FA 1MPAL 5EOTB 1IC7L 4GSDL 5IEHA 2W0FA 3FKUS 1IQDA 3QPQC 4UTBH 2H26A 4HC1A 3AXLA 1CL7L 5C8JB 2XICA 1CDHA 2BOCA 2RGSA 1YNKH 2EDYA 1NCCH 1AIFB 2X44D 5D5ME 2N7BA 3B9VA 4XT1C 3UP1A 5F1IA 5C0AA 3D3VE 1MCOH 1WCBA 4Z7NF 4MA7H 1IEBB 1BVZA 3RIFK 3JTSA 3LKSB 4DWHA 1N0LA 2P4AB 4YR6B 3GSVA 5CZXD 2WWMC 1CZ8L 4MXWL 3O45B 3GHBL 4UBDC 5F7EL 2JCCE 3QNYB 4Y16A 1CDBA 2CMRH 3T08A 1GGYA 1C1EH 4S1RH 3F7QA 4JLRB 4XWOC 5ITFA 4P4KA 1TTFA 3ARGD 4N0CD 1YYLL 3GM8A 4XCNB 5HHXH 4G8IA 4RA3A 1AXIB 1A6PA 2IAMC 1JWUB 3J8F7 5J9PB 3S6CA 1YNLL 3VH8A 1D6VL 4P99A 2V6HA 4PRIB 2NY5H 3VMPA 1WICA 1MNUL 4WW1B 4FQXC 3L3GA 3KXFE 1OAKL 4NQUA 1Z5LA 1RQ5A 1IM9D 3K46A 3LKPB 2VLJA 3ZMRA 4JDVA 4EN3D 3KLSA 4K3JH 3GI9H 3QUMA 1IGYA 5GGSY 3FO9A 5F89A 1MREL 3KHOA 2XQYG 1F90H 2AQ3A 4LHUA 2ENSA 2GW5A 5A2JH 3TNMA 5CEZD 5F44A 3QA3B 4M1CD 2D0GA 3QIWB 4FQIH 1X9QA 4YHIA 5CEZH 5F9AC 2OTWB 1QA9A 2VL4A 5ALBH 5DJDA 3G5ZA 2GTWB 5DHYA 1YC8A 3WFHA 1OM3L 2ZNXA 4ZUWA 3V0WL 4M93C 4PRHE 1ZA3B 3SE8H 1Q94B 3G6AB 3U0PA 3KJ6H 4OTXH 1PG7H 2FB4L 3G9VA 4DFIA 1C12A 4F33B 1G9NL 5INCB 2UZIH 5DWUH 3O6LL 2E3VA 2HN7A 2AXGB 2VL5A 1T0NB 1MRFL 2CIIA 5HGBA 3BRFA 2R2CA 3MRPA 2VDKH 4U6HA 5CIPH 2NYYD 1Z9SA 4ZS7H 4HFWA 1OT2A 1N5YH 1Y6NR 2C1OB 4DK3A 4X7TB 1UT9A 1XMWA 5FK9B 3DXAE 4I3RH 4BQ9A 1CICD 1FO0B 2Y06H 3OJVC 3SKJH 4KTDL 4HPYH 4XCFH 3C6SA 4RBPK 3V8OA 2Y9RT 4HUUA 4P9HL 5AAWA 1M7IB 2NXYD 1WEJH 4I18C 4KMTH 5T3ZE 3MV9B 5I1KH 3ZDYE 5DZLA 5GRYA 1LP9E 4Y4KC 1JJUA 3HI6L 4WDIB 3QQ4A 2EIBA 3ARRA 4RRPA 4I1NB 4YGAB 4D3CL 4QY8B 3OKMB 3X12A 5D9SA 4PB0H 4PJ9C 1A21A 4U1GB 1IAOB 2VUYA 5HDBE 1AGCA 3UTTB 4EI6A 3PUCA 5IIEB 3QQNA 1Y0LA 5HHNA 1TITA 5IJKA 4Y1AD 2R23A 5I8OL 2X4RA 5IVXE 4XCEA 3WKNA 3DRQB 4M6AA 1FL6B 2YWYA 4NO0D 4LNRB 2DI9A 1QLFA 5E8OA 2RB8A 3LPFA 3GMNB 3SGDH 3W5MA 3AMKA 3D0LB 1DQMH 3A67H 3O4OB 1FVCA 3CVHA 4ODVH 1X5XA 1DQQB 4QHUA 2AW2A 1CE1H 2AABH 3QZWG 5MHSE 1K85A 3Q5TA 4P23B 1P9MC 2F5BL 4HLJA 2FX9H 4JG1L 3UTSD 5ID0A 5I9QB 4G9FB 3GBNH 4PP2A 5ILTL 3NCBB 5F7WC 3O81A 3KPRB 4L3CB 1HHJA 3UDWA 4OQTA 3HZMB 4ZXBB 2P5EE 3DX8A 1YEGL 3BEWA 3VFRB 4HT1L 2AQ1A 2GSGB 1NL0H 3STLA 4XVSL 1QPXA 3WDHA 4F9PA 2LU7A 1C5DB 1K8DA 1P84J 4NUJB 4QTIL 3QRFM 2J8UE 1I1AC 3BP7B 4X4YB 4U0QB 2QV2A 4H8WL 2DWEA 2WBJB 3F7PC 2JJUA 5CD3B 4HIHA 4WI2A 3AREB 3CFEA 5BV7C 2PCPA 1T4KB 5K59F 3DSFL 1YEFH 3B6SB 5CGYC 3TN0B 4I3SH 5IROC 3MNVA 2M2DA 3DBXB 5EZLA 3N0PB 1ES0A 5HHPA 3SGDI 1ZHNB 4H1LB 2IADA 3WFBH 3LKQA 4HQQL 1QBMH 3BYTA 2OZ4A 1KYOJ 4HUXB 1BECA 1K4DB 3KR3L 1FL3B 4HBQA 1BJ1J 2O5XH 2XTJE 3QWRD 4EBQH 5J13B 4WV1A 3V6OA 3EGSA 4JO3L 2P8MB 4OI8A 1Z9LA 3OBAA 4OLXL 4LIQH 4XP4H 3RJDA 3C5ZA 4JY5H 1FNAA 3E1F1 4WY7H 2X4UB 4Y4FA 1ACYH 3RUGA 5DEGA 3C09B 4F2MB 3G6DL 3GIZL 3ZL4L 2AJUL 5DJYB 5A2LH 1FL5B 4X6DF 1JUFA 4P3WA 3BX7C 3EYUH 1CFTB 1BBDL 2QR0A 1YJDL 5EA0H 4TULH 1J5OH 4M7ZB 2X89A 3F5WA 1KCVL 1FCCA 3P11L 3TBYB 5IR1B 3OB0H 5EBWA 1OP5K 3LN5B 1YZZA 1EFXD 2FIKB 2DIJA 3BEVB 1NEZA 3G9AB 2EXWC 1OAZL 4YNYA 2R9HD 2VDRL 3ILQD 4OZFA 1HHGB 1N7ML 2ATKA 2ZPKL 3WLWD 4JO4L 4PJ5D 3V7MA 1IQWL 4HUWA 5CINH 5I2IB 1CFVL 3VXSD 4PJIA 4KUZH 5DF0A 4MNQB 3BE1L 5D8JL 2A6IA 1VFMA 5DJ6B 1KCUL 2ESVE 5KAQG 2FJHA 3U4EA 3QAZB 1OSPL 3V4PH 1ND0A 4OCSL 1MAKA 1IBGL 3ARFB 3MRJB 3VFPB 5JQ6L 5DFVD 3SJVA 1PSKL 5DRWA 4LLQB 1FGNH 4IDLA 2DTMH 2A6JA 4LCWA 2X4SB 2ZJSH 1FIGL 2DQJH 4CNIA 2V5YA 5BJTA 3SKOB 4WCYL 1HSAA 3U30C 1EAPA 4G8GD 3FT2B 4FFZH 4OF8A 4JFPA 2VXQL 2R8SH 5L6YL 3AAZA 3HS0B 3QPXH 1MCJA 4NO2B 3E8UH 3C5JB 3QUYB 4OFDA 2XG5A 4EI5D 1CLYH 3QULB 3TPUB 2DQEH 4GRWE 1I7ZB 4I4WB 3QG6B 4MD5A 3GMOA 2I26N 4JFFA 3DNKA 1A7OH 1MRDL 2HA1A 1GZPA 4KRPC 2KKQA 3EFFB 5JXED 2Z0BA 4R90H 4RGMC 4DGYL 3BW9A 1MF2L 2ICWJ 4PJGE 1UXSB 5J6HB 1Y6MR 1BJ1H 2VLRD 4JQXC 3GSXA 1U6AH 4P5KA 2BVQB 2JTDA 4F37K 3RTQD 5CMAB 3LN9A 4XNUH 2ZG2A 4J8RA 2XYCA 4M5ZH 3STZB 1XR8B 3D48R 2ITDB 4Y7MA 2UVEA 3WD5H 5ABDE 5J89A 1HXYA 4LSUH 3QDGA 3VWJD 4R2GB 4NN5B 1FO0H 4HGWA 4ZAKB 2V5SA 3QHTC 1JPFB 4E41E 2G75B 1KN2L 2YPKB 3K74B 3MV9D 1SM3H 5HVHB 1A9EB 1UWEL 2FEEL 4N0UA 3V6OE 1OTUC 2VYRE 4L3EE 4BFGA 3MGAA 5IB5A 5C09D 3U7YL 4NKOA 5DK3A 3IGAA 3FONB 4EOWL 1RUPH 4IDJH 1BBJB 3MCKB 3RUGE 5JPNA 3EO9H 3G04A 5TFSL 3BHBA 2QEJA 5ENWA 3K8KA 3CXHK 4FXLA 1D5IH 1TJHH 1EEYA 4KI5D 4ONGL 5K9KB 4UI2A 3GB7A 1OD9A 3ZSSA 4Y5YC 1GJIA 2MNUA 2NZIA 2C3VB 3RZCD 3SE3C 1PX4A 1JHTB 4P2OD 4NCC1 4PJFA 4XP9H 3WFDL 3QJHA 3K2MC 5IWLC 2BSTA 1VGEH 5HSFA 2CO6B 1NLDL 3U0TB 2CXGA 1BFVL 5C0BA 5EWIL 2Z8WC 4Q6IC 4Z7NE 3MFGB 4ISVA 1HQRA 1JFQL 2NR6D 3P0YL 1OLLA 4PJIE 4X8JA 4ZMAT 1A7PH 2BK8A 4MQSB 4RX4A 3VFTB 2VLMD 1CGTA 2I5YH 2P43B 3OPZH 5GHWH 1LDPL 4ZXBD 3IXTA 3VFOA 4UDTB 3M45A 2O26U 1G9MC 4BJLA 4D0BA 3VDCA 2P5WA 3QZWA 1JYNA 1A3RH 1KTLB 3RVWC 3AU1B 5IHUH 1M71A 5F7LB 1TIUA 4AEIL 1R3IH 3MOQA 3BQUC 2ZWLT 5I19H 3ARED 3FCTA 1KXQE 3BGAA 2XY2A 5CZVH 1F5WA 4D9LH 1LO5A 1AKJA 4BFIA 2WANA 3SDAB 5EORH 2BC4A 2IFFL 1N8ZB 1YEKL 2V17H 35C8H 4LVOC 3B5HA 4XPGL 3BWAA 2D03L 5EUKB 5J1AB 4NNYA 3L7EA 3O3AA 4V2CB 1BEYL 3LHPL 3SDXA 4PLJD 1D9KB 1F4XH 1QRNA 4LEOB 3VJ6B 1BQUA 5L88H 3QEQE 5IFAL 3GNML 5D1QA 3T2NL 3WEXA 4H5SA 3O9WD 4JFFE 3TA3D 1DVFB 2JJWA 5DJXB 4DZBA 4HIJB 3VRLF 1J0HA 1A6UL 5KS9F 4FN0A 3ALWA 5BOPA 2O5YH 2OL3A 5IMOA 3TBVA 1HSBB 1CBVH 1XGUB 3GIVA 4WFHD 2R4RH 4LCCA 2VDML 1NMBH 2BVOA 1A4JB 1P2CB 2Y36H 1I3VA 2E7BA 1G9NC 3PGFH 3BPOC 1ZMYA 2NXZD 2PW1B 4U7SA 4YDLC 4EIZC 3BKMH 5IW6A 2KBGA 4LSVH 3QUZD 5C0CB 4LKXB 2VR9A 4UT6L 4G7VH 2RQ8A 3H3BC 3B8YA 4XP6L 4HK3J 5D93C 5DZOA 3O41A 2ICWI 1GGCH 5FM4A 3FT4A 2VLKA 1AJ7L 1CVRA 3EYFA 2FRGP 4F80A 1NMCB 5IEKB 5CILH 1IARB 1E28A 4UOJA 1QFPA 4RQQB 4P5TB 2DMCA 2R2HA 3QDMD 3QXTA 1PG7X 5DD5L 4UOW0 2X4PB 5DLMH 1J8HB 3ILPB 3QCUL 5IB2A 4E9LA 1XH3B 4ZYKB 5F9JB 1RUAL 5HGAA 1X5HA 5DD6A 5H8DA 1NCDH 3IAPA 1JPTH 1VFOA 5I16A 5EO0B 5ETUB 3QHZL 1FLRL 2GJZA 5FYJL 1XIWC 4YHKL 3VW3L 5JW5A 2WV3A 4IJ3C 4TUOA 1DN0B 1Q0YL 5HYJA 4GAFB 4KV5F 1A14L 4PG9A 3BZ4B 3RAJH 3MRCB 4OAWA 1QHOA 4O9HL 1BJMA 3QUYD 2AK4D 4QRPB 1T5WA 2X1XR 4LLMA 3IFPB 4Y0GA 1I1YB 1UXWB 3GSWA 4X99A 1KFAL 2YRZA 4OFVA 4HWEH 1I9JH 3ALPA 5DHVB 3QXDA 4K71B 1VGKB 3BN3B 4WEUD 3ARGA 3O3BB 1RK0B 5T33L 5IF0A 4FFVC 1W72B 2FHFA 4UQ3A 2XKUA 5F8RC 3KYNB 4IRSC 4WTZG 2Z93A 4OCRL 4NSKB 1U3HD 1ZOXA 4WI5A 5T1LA 4O2EB 1Q9OA 4P2QB 2CK2A 1IM9A 1IGML 1AQDB 5I15H 5GSVA 4WU5B 5F21B 1LO0L 2EYTB 4ODXB 4WJ5A 4ZD3H 2GK0B 4KHTL 2EC9T 1BIIA 1U58B 5E2UL 3SDXE 1FV1B 4LPCA 4QXUL 2PW2B 4KH2A 4FQHA 4A2LA 2IGFL 4C4KT 3DUUB 4X6CE 3NIGF 2XKNB 1QP1A 3D69A 5K59E 3PWJA 3QXAB 4LBEA 2NY7L 3TZVD 1KLUB 1E6OL 1UJ3A 3ULVD 4WFGD 4JFXA 1FORL 4Y5XC 3PWVB 1KCLA 3ULVH 1CIUA 4GKSB 5D6CB 1B3JA 4TOYH 1LD9A 2FATL 4KDVA 2ZZUT 3BOVA 3HE7C 5K9OA 3JWOC 1ZVSB 1S9YB 2H9GB 2PYED 4Z7VB 2V7HA 1EBAA 4HWZB 4BH7B 4LCYB 5ID1B 5TE7L 3HPJB 3QCTH 1F42A 2LAGB 4GW4A 2H2PD 1IMHC 3B43A 1J1PH 4KUCD 2APWA 3K1DA 3LKNB 3EW3B 1G7LB 3VXOB 1WAAF 1YJDC 1R3KB 4ORZC 4E42B 4UNTA 1VKXB 3QRGH 1OP3H 3TO4C 1BM3H 5FA3B 5D7IB 1SYSA 4XCCL 4G6MH 1TZIB 5ESVB 1S9WB 2DLIA 4UDUB 4NQXB 1NBYB 4DGVH 4S1QH 5FV2A 2AJXL 3OMZA 1D6EB 2PXYB 1JHLL 1W0VA 5C6TH 3OKKA 1ORQA 3V6FA 1F58H 4QF1A 4KI5F 1AO7B 4HHAA 5HI4C 3PP4L 3S88H 4GMTH 1VFUA 4BZ2H 4F7PB 1XCQA 2RCSL 3WIHH 4WWKC 5E8NA 4HS3A 1NCBL 2MCG1 3OKEA 4LARH 3U9PH 1U0QA 1A6AA 4NRYB 1KCSL 4HMDA 3D87B 1LK3H 3PGCA 3DYOA 2X9WA 1UM4L 2YN5A 1DLFL 1Q9WB 2HFFB 2RBLA 4JY4B 4MA8L 2QQLH 4P2YA 2VITA 3HUJB 2NQCA 2VLLB 5KVEL 2OM5A 5GZND 2FGWH 4RGND 2Q6WB 2VZVA 2KQMA 5JORA 1ZLWK 3V95A 2ARJQ 5CHNB 5E99L 2ZCHL 4XXDA 3MRFA 5CD5D 1FSKB 3RWDB 3FQNB 4TTGA 5IJVA 1MJ8H 1TPXB 3DUSA 1XGRB 1ORSA 3UC0H 3BJ91 1G7IB 4S2SA 2DQGH 3QDAA 4L4TA 4AIXA 4NKDA 2EDWA 3VGEA 5T3ZL 4DUVA 1NLBL 5CBEB 3BH8A 4OGXL 3WNKA 1W0WA 1GC1L 4W4OC 3OG4B 4GBXC 5D2NB 5TPWH 3B4NA 5EPMA 1KPVB 1EJOH 1I1FB 2B4CC 5IBTH 4A6YA 4NYLB 2VDLL 3PHQA 2VXSL 4JO2L 5C0FB 5ISZD 1PGRB 3MV7D 4NWTL 1I7UA 4OSUH 4B50A 1BZQK 1KJVB 2EEDA 3TVMC 1ZS8A 3WFEH 3FQRB 4HC1L 5C0CD 3RY6A 1FDLL 4JRWA 1A02N 2ATPA 5L0QB 4HIXH 1NDMB 3IVKB 5IFJB 2OMBA 5HDQL 2QQNH 1CS6A 1BVKB 4DOHB 1K6QH 5KSAC 3L3JB 2MSPA 1IKFH 1NGZA 1OSZB 2AP2A 3D2UB 5H35B 5CEZE 3OKDA 1T7XA 2EDKA 1YEJL 4P5TD 3PQYD 5JPMB 5JW3L 4BSWB 1BF8A 4M1DH 5A2FA 2VISB 2A9MH 4FZEL 3UX9B 1MI5E 3S9DB 3QWRA 2LFGA 5KN5B 3GMRA 3GSQB 1A3QA 4YBQC 4MS8D 1IFHH 2GHWB 2PTVA 4HV8B 3FB6B 1NH6A 5MERB 1T20A 4M1GH 4GKZB 2V2XB 1QLEH 3EAKA 2EDOA 2AI0L 4WW2C 4AJ0A 2COQA 3ZKSD 1BZ9B 3QWQB 3VD7A 4BKLA 4HG4J 5E8EA 1T04B 1T22B 4LSSL 1P4LA 3MMEB 3VI4E 5ESAA 3QUML 3S7GA 1EZVY 3H42L 1NSNH 2ICEB 5D1XC 4DN3H 4YBLC 3OGOE 5MEPA 5HHMB 2D2OA 2Q8AL 5HI3D 3P30L 1KCRL 3TIEA 3SDYL 2DM2A 2W0PA 1EXUB 4K3DH 4N0RA 2EDBA 5CJQH 3IS0X 2AGJL 4ZFFB 3S36L 1IAKA 5EBLA 4JFQB 4PJAB 5EZIH 1I8MA 4X6BB 3VXSA 5E2VH 2P7TA 5TGBA 3NZHH 3MCLL 1XGPB 4Z18A 1VACA 4S0TD 2R0ZL 1RAMA 3HAEB 1G7MA 4K23H 2X05A 1T3FB 2E7MA 3DX6B 2PUQT 4TSCH 5DD1L 1J05A 3VFGH 5IHLB 1X4XA 5GS2D 4EQ2A 4UAOB 3IFNH 1CXEA 1U8IA 4NPYB 1MFDH 2BDNL 1FIEA 4ODBD 4Y1AE 3EFDH 5E9DD 5GS2H 1FNFA 5I1DA 2CIKB 4JVUA 3BH9A 4GAYA 5CEXB 4CVUA 3VD3A 1EHLH 5K9QI 1R3LA 1UFUA 2EYRA 2YUZA 1R24B 3REVB 4ZDHA 3W2DL 3MR9A 3ZT7A 1Y6KR 4G8GA 4ZPTB 5E08L 1J7VR 5C0RH 1CLOL 1MCPH 4JQVA 5EIIB 1T0MB 4M5YL 5B3JE 3SY0A 4YEEA 3GMLB 3QIBB 4ZTOL 3WMSA 2DKSA 1AQKL 3I02A 4P9MH 1SEQL 1ZWIB 3QPQD 1T03H 1UH2A 2Y1VA 4K7PH 1GPOL 3I84A 3UTSE 4Y2DB 5FM8A 1EO8H 3P0VL 4MNGB 4MD4A 1DBJH 43C9B 4L1DA 4PTTB 1B4JL 2VWEC 5F6HI 5JXEA 1CG9A 1HILA 3BUYB 2YD4A 4U6XB 5I76B 5DRZB 4LEXH 5GRUL 1CGYA 3VRLE 2SEBB 3NZ8B 2WWMD 1DFBL 4OM1H 5KS9E 1MCBA 4OJFL 5F7YC 3TYGL 4RCAA 3HZYB 3RTQA 2H32H 3WN5A 2JB6B 1RI8A 2UWEA 2Z4QB 4PGBB 5B39B 1QO3A 5IOPB 1LO4L 4XWOD 3X11B 1AGDA 1UENA 1H3TA 3QNZB 3S4SB 1MCQA 1KB5B 4LLYB 3BN9C 1UVQA 3VWJA 5DSCB 5EDXA 1XAUA 5DMKA 3OKLA 3CVHL 2C4FU 3QWOA 3MRMB 2R1WB 4HS8H 5DEFA 4XPHH 4DCQA 3DO3A 3L5XL 1HH6B 3DURA 4OFYD 4ONFH 4KJWC 1AO7D 4LIQE 3CCHA 1W2KT 2WBKA 2H2SC 3WFCL 1D5XB 4RZCB 1FYTD 1BOGA 4OLZH 4OQTL 3L3KA 2CDFB 1N2RA 3DVNB 1ZT1A 2Q76A 2V2WA 5SV4A 4Z0BH 2Y5TA 3MRQA 1LE9A 2OMNA 4NC2B 1ZXQA 2WQRA 4K7PY 3MRGB 5F9OL 5JO5A 4TVPL 2XQBH 4LGSB 4FZ8L 3P77A 3DECA 3RZCA 4PV9B 4R7DA 2AXHA 5E5MA 1U8LA 4EVNA 4GG6B 3I9GH 2W38A 2OJZH 1T1WA 1VESA 4C58B 2Z92B 2CLVB 2B2XH 4TUKL 4XGZB 1HHKA 3TIDA 1RZJH 2WWKT 3FQXA 3V8CA 3NA9H 3MRIA 3SDDB 5EUOB 3TBWB 3QDHA 4PJ5E 1DBBH 1ZSDA 2OZ4L 2Y7QB 4YHYC 3UYRH 1SBBA 3VXSE 2VC2L 3FB5B 3MBXL 2NY0B 5CJBA 1DUZA 3SKNB 2XZCL 5GGQL 1MVUA 3CSGA 1IL1B 1I3RA 2X4NA 3QCVL 3QH3B 3T4YB 1F3JB 3WS3B 4RSVA 3VDBA 1H8NA 1JGDB 5DFWH 4KDWA 3IDGB 4NHUB 2F54B 3CX5J 4OLUL 1QSFA 4XNMA 2MFNA 3SOBL 1TQBB 2VTFA 5DMGC 4GRMB 1A6ZB 1XGQA 1WQVT 2HWZH 3QJFB 4F9LA 4WHYG 5HYFA 2JB5H 3F58H 3WCYA 3GDBA 4W4NA 3MJ9A 4GAGH 3ROLA 2AEPL 1NUNB 4PJDB 3NIDF 4G8GE 4JRYD 1JCKA 2CPCA 3VXUD 4NQCA 1DEDA 4Y4KD 1I85C 2EKJA 1SBSL 2GEEA 4QYOB 5E6YA 3GSUB 2DBLH 3CFJB 4PJ9D 4BK4A 1HDMB 1S9XA 4WHCA 3UYPA 3IDIA 5I1AA 4AZ8A 1HE7A 1AH1A 2ZP0T 3O9WA 3TA3A 2EIZA 2A6DA 1ZLVH 1WCQA 5D1ZA 4ETYA 1XZ0B 5BRZD 3BZFB 2VMFA 1K9TA 3CFBA 4LK4A 2BY1A 4K3GA 5ERWA 2ZG1A 1A5FL 3UTOA 5I30L 2VLRE 1TZGH 1UADC 4M02A 3F62A 1BAFL 3T0XA 3UJJL 4HPOH 4QCIB 1JNNL 2W9DH 2ZKHH 1C08A 4ZUVA 1QNZH 4Z76B 1JN6A 2EEBA 3KHQA 5EU6D 2ED9A 3QISA 4ZS6D 2UWEE 3QQ9C 1X4YA 5JMOC 1AHWB 3H8NA 3V6ZB 4XI5D 1MFAH 1TENA 1UCTA 1K8IA 3E6HB 3RNKA 4IOIB 3G08B 3B9EA 3PWLB 3X14A 1D5MB 1WAAE 4NN7B 3MV9E 3B2VL 5K9QG 4PJXB 4ELMA 3HE6B 1VPOL 4JM2B 1B4RA 1J10A 1NC4B 3TH3T 1G7QA 5F96H 1I1AD 1XF1A 3STBA 5C09E 1RU9L 2H41A 3E2HB 4I48B 3HAEH 2RIKA 3HRZB 3UTTE 2HJFA 4YO0A 2BY2A 2HTLC 1YPZB 4LL9A 4XX1G 2MKLC 3S98A 1CD8A 4DQOL 5EG6C 1U91B 4KI5E 5CGYD 5BZWA 4O2CB 4KKAC 2APFA 1T1YA 5EZOH 4I13B 4X9IA 2UV3A 4R9HA 3DO7B 4FNLL 3BAEL 1IGJA 1MH5B 1HKLH 4N0FB 1B0GB 3Q5YA 2HT3C 5DMIH 3V4VH 1I8IB 5BW7A 1FGVL 3K7UA 2RAMA 3X3GH 5DC0A 1HHHA 2VAAA 3VWKA 4WHTA 3QFJD 5HY9B 2YHGA 4B7LA 1TTUA 4WVRA 2P49B 2AK4A 3PL6A 3WS6A 3B9AA 3CFDA 4YZFF 4R7NB 1PJ9A 1S5HA 2DI7A 3DX7A 2HJKB 4NZTL 5FOBB 2VLME 4D9QE 4HS6A 4Q9RL 3T65A 4O58L 4UTAH 2NY6B 4YC2C 1JGVL 5JIHA 1U95A 1GSMA 1KBGH 1INQB 3HMXA 3MLWL 4HD9A 2G9HB 1LEIB 5BQ7B 4OBRA 2XXMB 3BKCH 4G43B 1JWMB 1BD2B 3P4NB 1MHCB 4MD0A 2AV7B 5LGJA 4Y19A 3BSZH 3C5SB 2BNQD 4LSQH 4FQ2L 3JWDH 4GQ9H 3FO0H 1E4KC 1ITCA 2H6PA 4C4KO 1JHKH 5DO2C 1L0QA 4BSVA 1A2YB 2D7QA 3VXRD 5EOQH 1IC1A 4YXKH 3WO3B 1YQ2A 1L7IH 2EDNA 1AI1H 4GJTB 4V1DA 4Z7VF 3BPNB 5I8CB 1EZVX 3UTQA 4N8CH 4POZC 4NN6C 3TZVA 4UV7H 3VXPA 1RMFL 1UQSB 4OKVA 5FGBA 5DT1H 2MHAA 5FHAH 5BS0D 3WL9B 4I0CC 1J11A 2FIRT 3TT1H 1RVFH 2Z31B 1EHNA 3I3BA 4WFHE 4NNXA 1QD0A 5D71L 2OX5A 3U46B 3WIIL 2HG5A 4FTVB 3GHEH 4Y4HB 5D7IF 5KW9H 3C60C 2XT1B 3BKJH 3KPSA 5E2TH 1IGIH 1OAXH 3PWNB 4JFZL 3D18A 2W59A 5IQ7H 2FX7L 4MJ5B 4LVNC 5JDJA 32C2A 3JVGA 4OZIA 1G6VK 1ZLUK 2XACC 5FKAA 5GGVL 4KRPD 4DUXA 4JFDB 3FQUB 1UB5A 2J4WL 5CKGA 2FCBA 2DLFH 4LQ1A 2VH5L 4O51A 2BZDA 4NGHL 4ELME 1KXVC 1NC2D 2W65B 1QQDB 3QDME 2X4OA 4X9GA 1JNLL 3HFML 5JHDD 4ORGA 2ZSWA 4Q9QH 4PREB 4NP4L 3HUJF 4KC3B 1T1ZB 1B9ZA 2F54D 3MFFB 2OL3L 5E4EB 1FQ9C 3PP3H 4I0PB 1KGCD 2WLYA 4HH9B 3F6LA 3HI5H 4R4BA 5FYLD 1LNUB 1TFHA 4YFDB 1SHMA 1A6WH 5FYLH 5HJ3A 3PWPA 5H94A 5KTEL 2APTA 3SO3C 25C8L 1NFDA 2Z8RA 4QRRB 4KJPC 4YK4B 5DD0L 1Q72L 1I9IH 3HRPA 1BOYA 1OTUD 3VFNA 7FABL 3O0RL 2L0DA 4NO5B 1R0AL 4I3GA 2A74B 4UUJA 1A1OB 4ZOAA 5FDWA 1AR1C 1UB6A 4YAQB 4QT5B 1M6OA 3ARBC 1TVHA 1J0ZA 4F7MB 1HNFA 2CH8A 3BGMB 4M8QA 5I18H 3V5KA 4LCIL 2V2TB 1AC0A 4ZUSA 3DVFA 5DUML 1QFWI 1MPAH 1IC7H 4PTUB 4GSDH 1DEEA 4WFEE 1CFSA 5F88A 4JJ5A 5DVMA 3WIFA 3RWCA 1C16B 1B0RB 4GUPA 1DBAL 1F4YL 3TO2A 2FECI 3OAZH 1CL7H 3WE6B 1K3ZA 3RNQA 1KACB 2YMXL 4L8BB 5FFLA 1MHEA 2BMKB 3T3MF 1FVDA 4JDZB 5JIKA 4ESKA 3IU3B 3IKCB 1RIHL 3KYOA 4Z78B 2Y07L 3T3PE 1T5XB 4NOFA 5JW4M 1X7QA 4OD2A 1VFBB 1CZ8H 5I0ZA 1M7DA 2NX5B 4MXWH 3LRHA 3GHBH 3NCCB 2FWOB 1U8HA 5F7EH 3K0WA 5I17B 3N1FC 4K7PX 5ANMB 5F9WB 4ONHA 5IFHL 4P46C 3HE6D 2I07A 1G9MH 1WFTA 1YYLH 3IU4H 4IRJC 1KG0B 3ULVE 4WFGE 3RVWD 3W5NA 3RFZC 4N1EA 1YNLH 1D6VH 5DK0A 5HHXL 2DQTL 4NC1C 1MNUH 1S7QB 1OAKH 3WO4C 3NFNB 2G2RB 2PYEE 3UDWC 3BIBX 3C6LB 1JMXA 5GGUB 3ARYA 1CL7I 3QIUB 5FUZH 4OFPA 1TMCB 4PJ8B 4TNWK 1MREH 4U1JB 3R8QA 5F3HB 3D9AL 4GQPH 3F12B 4XPBL 5DUPL 1PEWA 2X1PA 4GKNA 1BQLL 4F7TB 4PJAF 1SMOA 3UPCA 1PYWB 4HGKC 1G0XA 2FO4B 1JGUL 3HAEG 3CFKA 2D7MA 1BQHA 2VE6B 5AYUL 4UU9A 4FQIL 2NY4C 2X4TB 4P3DA 1ROWA 3IF1B 3OXSB 3V0WH 9CGTA 3LIZL 3CDCA 4GKOA 1JZ5A 1L6ZA 2F74A 5GSRA 1KENH 2FB4H 1G9NH 3MO1B 3FTGA 3O6LH 2Z35B 4G80A 1T89A 1HZHL 5KZCD 3O11A 4WEBL 2PTTA 1MRFH 3RBGA 4WU7A 3TFKC 5IB3B 3GBML 5TF0A 3HLAB 2AXFB 3P9LA 5E9DA 3ZHDA 3SCMA 1OD7A 4UV4L 4JR9L 4CVWA 2GJ6D 4RGNE 3O2WL 4Z7QE 4MNHA 3T0EA 3GGWB 3NCYS 3QUXC 5JNYB 2EE6A 3QI9C 4O00A 4D8PA 4P9HH 3O3DB 3H9SD 1ZAGA 3K8LA 1HWGB 3O6FB 1U93B 1BHGA 4RWHA 4OUOA 3ULSB 3HI6H 3DIFB 5T1MA 1URLA 3CK0L 3R1GL 2NNAB 5DJZA 4YHMH 4FQLL 4NZDA 3IJHA 1XIWD 2Z31D 5HHQA 4NRXA 1HIMH 3N1PC 4KU1A 5EC1B 3JUYA 3IETA 5I8OH 1BJ8A 4HWBA 5ISZE 3MV7E 2V9QA 3S4SG 2Z8VC 2IBGA 3Q48A 1R5WA 5C0CE 1F6LL 3BO8B 3VG9C 4ETQA 4L29B 1CR9H 5EU3B 4IMKC 1PQZB 4MA1C 4RFEA 1ED3A 5SWSD 3CSYA 2JK5A 4X7SL 2L4OA 2YSSA 1E4WH 5DJCA 4JG1H 4CDGC 4ODTL 4NM8L 4FFVD 5KSBB 2IAMA 3PQYE 5ILTH 5D6DA 4IRSD 1YMMA 5IV2B 3MLTA 4IHOA 4IOFC 3ABZA 1IGTA 2BVPB 5AD0B 4FQXA 2EDEA 3L5WB 4G6FB 1YEGH 4JZJB 5SV3A 1S7VB 2OR8A 4UMGA 1MJUL 1EK3A 3KPMA 4XVSH 1TQCB 4I0PD 3RWHA 4MXVF 5C71A 4A6YL 2F9BT 4QTIH 5EU7E 5FF6A 4OUUB 1Q0XL 4H8WH 4GG6F 4GH7B 4R97B 5KVDL 4WI9A 2A6KA 1A0QH 1H5BB 2BNRB 1KC5H 1INDL 2ADIA 1G7PA 4R0LB 5J06A 3WXWL 5A16A 2C3WA 3DSFH 5EUOF 1P5UA 3NCEB 4XX1E 4JQIL 1NGWA 3RVUC 3X3FL 4L4VA 1ZT7B 2JJTA 2WWKO 4XZUA 4Q7DA 3O8XB 3UPRA 5F6IC 3ARQA 1JPST 4MDJA 3KR3H 4W68A 2BHZA 3T0DA 1UWXH 2YEZA 4NCDA 2RFXA 1FC1A 4JO3H 3B9KB 5D7LB 1QSVA 4OLXH 3SGJC 3JWOH 4XPAL 5BCAA 3L5HA 5DJ2B 3CLEL 3ZTNL 4X6DA 2HJLA 2FJFB 3OHXB 5ACZB 3G6DH 3GIZH 3ZL4H 4B7IA 4YZFE 4XPTL 2AJUH 4AH2A 1N5AA 5JHLL 3ZTJH 1A4KA 3V7AG 4NQVB 3PNWA 1BLNA 4IEFB 3TO4D 1BBDH 1YJDH 4UQ2A 2K9UA 4DEPB 3QXUA 2CJUL 2W60B 3MRHA 2J1KA 1KCVH 1HYSC 1YY8A 3EYUL 3P11H 2R1YA 4ZNEE 4YGVA 1QSEB 4TULL 4RMQA 4JAMA 4Y5VA 4J6RL 4L9LC 4XWGL 3RPIA 4HEME 2BY3A 4PJHB 4EUPA 1OAZH 1QYGL 2VDRH 5BZDB 3VXUA 2ZPKH 1CFQB 3O6KL 1MVFA 3MUGB 4Y4KA 4U3CA 5HI4D 4X6EA 4LSTL 1CFVH 1OF2A 3LKOB 4I2XA 5L7XL 1A1MA 4WWKD 3BE1H 5D8JH 4PJ9A 4LRNH 1RFDL 4WO4A 1X5IA 1KCUH 4OFIA 5BMFH 5IM7B 3TCXA 1OSPH 1PBYA 2DL9A 1JP5A 5JQ6H 1PSKH 5BRZA 5C07A 2VDQL 1N3NA 3IXAB 1QLRB 3GMMB 2VZSA 4PG2C 3M1BA 3W0WD 3TJEL 3WHXA 2BJML 4PGJA 1PZUB 4PJ7B 1FIGH 4CVZB 2Z91A 1FVEB 2IANB 4WCYH 2YR3A 2R2EA 4JREC 2VXQH 1RZIA 2V9TA 2ZOKB 3CAFA 5EU6A 5MI0B 4JRXA 5L6YH 4F15B 5AZEL 1P9MA 4PJXF 4JM2F 5DK2A 1U3ZA 5MEQA 4Z7WA 2W92A 3VGAC 1UACL 4GBXD 2VB5A 1ETZB 4X9HA 1A6TA 2FJGB 2X6MA 5IKCA 1XF4A 4I9WD 3UROR 1NQBA 1MRDH 1OTTC 1VADB 1YPZF 4LKCA 4B41A 3TVMD 4DGYH 1AO7E 2D0HA 2HAZA 4QXTA 1MF2H 3ZDXE 4AENB 4NQDD 5D1QC 5FUOH 1FZOA 2A73B 5DQJA 3ARZA 5C0JA 4HLZH 3VFWA 1NAMA 3VE0B 2VZTA 2ZUUA 1E27B 1FYTE 4NIKB 4YDJB 5C86A 4FQQB 1U6AL 1GZQA 2GSIA 2FEDC 4J7RA 4U1KA 4QRSA 2DQUL 5D5MB 5IROA 3MLXL 3FB8B 3D3VB 4J12A 1J0JA 1U8MA 2F53B 2WNGA 3U0WL 3LQAC 5DUBB 4PY8J 4YPGA 4I77L 4JM4L 2JCCB 1KN2H 5GIRB 1CXFA 2WM0A 5K33A 3O3EB 2LE9A 4YBQD 5L2KA 1UWEH 4AK1A 3UTZB 4KTYA 5DGRA 3LS5L 1P7QD 3U7YH 4ODHL 1IAII 4EOWH 2QADB 3U36B 5D72L 2H8PA 4PJBA 1LO3L 5AYQA 2C7UA 2EDJA 3SDCB 4PJCB 3RL2B 1I75A 1RUPL 2WIIB 2YC1B 4LF3A 5AZ2L 4ONGH 4OF5A 1ZVHA 3KXFB 4GW5A 4JGUA 2DYPD 3RWFB 3MRNB 4RWYL 4HKBB 2EH7L 4APQB 5I1LA 2V7NB 4EDXB 1WBYA 4EKXA 3LV3B 3WFDH 1TVBA 1AGEB 3N85L 1UZ8A 2BNQA 3HR5B 3MA7A 4QKXB 1NLDH 1NFIB 4JRYE 1BFVH 3VXUE 2IEPA 4DKEL 1UZ6E 5EWIH 4LAQL 3KYKL 3F7YB 4WTXA 4I2XE 1JFQH 4OCXL 3P0YH 4M6OL 4L8CA 2AEWA 3VXRA 4KHXL 1JBJA 1OW0A 1LDPH 3RDTB 3P4MA 5FA4B 4U1LA 4X5WA 2P8LB 5E8DL 3OPZL 3DSNA 4HKXB 1OGAA 4PRHB 1UCBL 4MCYB 2V5MA 5BRZE 5I66A 5E4IA 5LWYL 1QVOB 2Q86B 2YPLD 2GT9A 3BMVA 4AEIH 2BCKA 1YY9C 4YHNB 1A3LL 1OPGL 3O4LD 3EYVA 4MJIB 1TETL 4N68A 1R3IL 3QDJA 5DVNA 1NDGB 1YEKH 5HYSA 5FYKD 2YS4A 5EU6E 2D03H 1NPUA 1MIEL 1FH5H 4D9LL 4Q74A 3MJ9L 2D7OA 5FYKH 3GSRA 1BEYH 3LHPH 4TUJA 2V17L 4BH8A 1FZMB 1KJMB 3MGOB 5IFAH 3GNMH 2P48B 3T2NH 2HT2C 2BOBA 1X5ZA 2QTEA 3B9KD 4OLEA 1MSPA 5I0DA 4FMFA 5L88L 3EYOA 4P5MB 2FH8A 4PJAE 3QQ3B 5FV1L 1A6UH 1J9CT 4JQXA 1NC2A 2OP4L 4PRPA 1SYVA 4U0RB 3L7FB 3WNNA 4RAVA 3L1OL 2W0FB 1WBXA 2VDMH 1OLZA 4M9PA 4FMKA 1IQDB 5I74B 2H26B 3AXLB 5J12C 5SWZD 1CD0A 2BOCB 4G8EA 1JYVA 4YBHA 3BGFC 4UT6H 3RWJA 5IVXB 3S34H 4K8RC 3ZE2F 3AM8C 3MGTB 3BN9D 4XP6H 3BKML 5C0AB 3KPQA 1CGWA 5DGQA 4XCYA 1WCBB 4YHOL 1U2CA 1CGVA 1S3KL 3JTSB 3TT3H 1AJ7H 3GSVB 4WI6A 4QXWA 3G5YA 1WFUA 4KJWD 4JN2A 4Y16B 5E8PB 1CIDA 3QFJE 3MODL 4J3OC 4P59L 3ZTJG 1KIUA 4XVUC 2H2SD 3CUPA 5DD5H 1CDGA 3MREA 1S7XA 5ITFB 5E00B 3IDNA 3QCUH 4P4KB 1U36A 1IEBA 4PJBE 4G8IB 1RUAH 3IDYC 3ARTA 3VH8B 3MYJA 2P5EB 3W9DA 2QSTA 1JZ7A 3BP6A 5FYJD 3SE3A 1LEKB 4X5LA 2VO5A 4JB9L 2DD8L 1IRAY 1FLRH 5FYJH 4YHKH 1NCDL 4JLRA 3VW3H 5L8LB 3VXQA 1K4CB 1S7TB 4X0KB 5IWLA 3QUMB 1Q0YH 1IGYB 4XCNA 3FO9B 3T04D 2OXHA 3ETBF 5F89B 1A14H 3IB4A 1IEHA 1JWUA 5J9PA 4LHUB 2BNQE 4PRIA 4TNWF 4XC1L 3KG5A 1JI1A 1LE5A 3LKPA 4YHIB 1LO2L 1OWWA 4GOSA 1KFAH 1QA9B 3VXRE 2D7PA 5DJDB 3G5ZB 5DHYB 4PLNC 2ARWA 5DTFB 2AJYH 2PO6C 5T33H 4OD1L 4ZUWB 5DMGD 3U0PB 4O02L 1TNMA 4QRTB 4OLVL 4KAQL 4OCRH 3JV6A 3WBDA 1AFVL 3BQUA 3CSBA 4GMSL 5BS0E 1JTOA 2GIYA 3QIWA 3HMXL 2HN7B 1IGMH 2OTWA 2CLRA 3S5LB 5HGBB 3WLBA 4M03A 3MRPB 3HI1A 1LO0H 4U6HB 1LDSA 1F00I 1QRKA 5I15L 2F53D 4X9BA 4KK6C 4RGOL 2CRMA 1HQ4A 2B5IB 1MRCL 4H0HB 2RHEA 4KHTH 1Q94A 1V7ML 2GITA 3G6AA 3L6FA 5E2UH 4GG6E 4JFED 4AEFA 4R26L 1P1ZA 4QXUH 3HNVL 3ULUL 4ZD3L 3K3QA 2IGFH 4HLZG 1LQSR 1T0NA 2NY7H 1A7NL 1E6OH 3FQTA 4JKWA 1FORH 2H45A 2C1OA 2P46B 1A7RH 4X7TA 2FLRT 1MIML 3QQ4B 2FATH 5CWSB 5JHDE 3X12B 1IVLA 4GFTB 4NNPL 4G6JL 1DQDL 1AGCB 1ZVYA 2F54E 4S1SL 5HHNB 1DSFL 3FFCD 4Q58C 3QQ9D 1KV3A 5TE7H 2DN7A 2D4DA 1KGCE 1CTNA 2X4RB 4N8VA 4XCEB 4P2RA 1T7WA 4H0GA 5FYLE 4FA8A 4XP1L 1SEBA 2X4QA 2V9RA 4WDIA 5DI8B 3NABL 3RVVC 5E8OB 1J1PL 4QY8A 1V8HA 1BZ7B 5AWNL 1IAOA 3V7AE 4XCCH 2OCFD 2GJ6A 4JFOA 5IIEA 4NUGH 1FVCB 3JV4A 5D96C 1E6JL 3CJJA 4QHUB 2AJXH 5TDOB 3N9GL 2EKSA 2HLFC 5GISH 4XBEL 1JHLH 1ZGLP 3P73A 2ADJA 5ID0B 4GRWB 2XWJA 2HTLD 1B88A 4LNRA 5A40E 4KK9C 4RISL 2HVJA 3PP4H 5ICXB 3RRQA 1RZFL 4KKAD 2B1AL 2R4SL 2RCSH 3SKMA 3WFZA 5F3BA 3D0LA 3N1MC 1NCBH 3DX8B 3S88L 4GMTL 4BZ2L 1XIWA 1KCSH 4KK5C 4KTEL 1DQQA 3OAYH 3O6ML 1UM4H 5D4QA 1DLFH 5CSZB 1K8DB 4F57L 4MA8H 5GS0C 2VZUA 4MJID 1XFPA 3NIFE 4G9FA 5FM5O 1W8OA 4RAUB 4KFZC 5JW4R 2AAVA 2XA8L 3CFEB 5IVZA 5KSBF 2PCPB 3R06A 3HZMA 5E99H 3GFUA 3H9YA 3BZEA 2GSGA 3MNVB 1OAQL 1N26A 2IADB 3LKQB 2EO1A 1F2QA 1JNHB 3LRSB 1FNSL 1MJ8L 2WBJA 3HCVA 4WV1B 1NLBH 2NW3A 4OGXH 2AJVL 3D39D 3EGSB 4IRSA 4KVNL 4U05A 1GC1H 4L3EB 5DC4B 2D31B 3C5ZB 2VDLH 1G1CA 3TN0A 2M26A 2VXSH 4Y4FB 4DKDC 5JR1L 3RUGB 4JO2H 2GTZA 5DEGB 4NWTH 5TPWL 2WIMA 5IBTL 4J3UA 1YPZE 2DM3A 5MEOA 3G6JE 4HC1H 4H1LA 1FDLH 1IT9L 3D85D 2IG2L 3ZKMC 1JZ2A 1A64A 1JUFB 1X5LA 4POUB 3WFEL 3UZQA 5J11B 1MEXH 4NFCA 5C0AD 3UJIL 3M17A 2QR0B 2AJZB 5HDQH 2P8MA 3J7HA 4YDKL 3F5WB 4BQBA 2NY2B 3UO1L 5BO1L 4F7CB 2X4UA 5EBWB 5B3NA 4QHKJ 1UC6A 4DK6A 2DDQL 4F2MA 1ONQA 3HC3L 4HFUL 4POZD 1DR9A 3V2AR 5JW4Q 1YEJH 5J6GA 1F4AA 2JELL 4H25A 2XN9D 4OZFB 4Y5XA 2ATKB 3LSOB 1R3JA 2YD2A 3T0BA 4HUWB 4FZEH 4PGCA 3PHSA 3TCLA 3HE7A 4PLKC 4PJIB 2FD6L 5IQ9B 3GSOA 2G60H 2VR4A 2A9ML 4PGEA 4OI9A 1JPGA 1WF5A 2FJHB 3C60D 3U4EB 1XF2A 1M05B 3ZDZF 2LVCA 1ND0B 2ADGB 3DMMC 2KZWA 4NQEA 2Y5EA 3SJVB 2VLJD 1HHGA 1H3GA 4KGJA 1QLEL 3KWWA 4PJHF 2A6JB 4LCWB 4MLIA 3TO4A 1FFQA 1WWAX 2VJXA 3G5XB 4HX1A 4LSSH 4MNQA 5BJTB 3KJ4C 1HSAB 3H42H 1EAPB 2PR4L 1V3MA 3RIAK 4JFPB 4QEGA 1SY6A 5E6IC 3AAZB 2GJ6E 2Q8AH 3P30H 1KCRH 4LQFH 3SDYH 3N06B 2HLAA 3U1SL 3AVEA 3H9SE 3S36H 3ZHKA 3QEQB 1DN2A 1MHHB 5CLTA 1ZLSL 5CJQL 5E0QA 4MD5B 3SKOA 3GMOB 4WWKA 2N4IA 4JFFB 5C92A 2B8OT 1GZPB 1CD1A 2BRRL 2BHUA 1YEEL 2R0ZH 4PJ7F 3FT2A 1I4FA 2MPAL 2DQDL 2KPNA 3BW9B 3HS0A 5DD1H 3GO1L 1WVZA 4K23L 4GW1A 4U1HA 5K9JL 1JF6A 3T2OA 4WNQB 2BDNH 3MJ8A 5DYOA 3ZE0F 4CN4A 3W0WA 4I4WA 2IMNA 4J3WA 3TWCH 2R29H 3VRIA 4J8RB 1NCTA 3W2DH 4JG0L 1AR1D 3KLHC 3ARBD 5E08H 1CLOH 1HXYB 1S78C 1UXSA 2B1HL 5F8QC 5J6HA 4F9LC 4M5YH 1T21A 3DYMA 2E7HA 2R0KH 4ZTOH 1ZHLB 5SWSE 1MCPL 1AQKH 1HCFX 3KNBA 1BQSA 3ESVF 1WV7T 2ZUQB 3MRKA 1GPOH 4GBXA 3T1FB 3P0VH 4P9ML 4K7PL 2Q7YA 5IB5B 1B4JH 3GKZA 3IGAB 4TNVF 1EO8L 5TDPA 3BP5A 5JPNB 1DBJL 3G04B 5D5MF 3BHBB 1ERNA 3Q5OA 4NQDA 4OGYH 5GRUH 1V05A 2W91A 3QEGL 5JIPA 5ENWB 1DFBH 4DN4L 1EEYB 5D1ZC 1NJ9A 3OJ2C 4OJFH 3TYGH 3GB7B 4HWBL 1H3XA 4LGRB 4PRDB 2JCCF 1P7KA 5KSAA 3ALXA 5D2LE 4M00A 4QRRE 1LO4H 4P46D 3MCKA 2ADFL 3QJHB 1FNLA 4IRJD 3ZE2E 4PJEE 3UJTL 4WGVB 3CVHH 4HW6A 4OZGA 4IIQB 5K9KA 5F7UA 3L5XH 4PJCF 1HQRB 3SQOL 3DLQR 3HG1D 3BXNA 2C3VA 3H7LA 4HS8L 1YUHA 1JHTA 5J4MA 5F1NA 4AIZB 2IJ0C 5B21A 1X5AA 4HJGB 5F1OB 5JUEL 4AEEA 4WW2A 4D0BB 4OQTH 3QNXB 2P5WB 3QZWB 4CKVX 3U0TA 4TVPD 4OLZL 4XHQA 5F9OH 4HIEB 1M71B 4KQ4L 1AGFA 4TVPH 5F93C 1JZ4A 1CE6A 4OIIL 5D1XA 3NAAL 2DYPA 3OAUL 3FCTB 4QHNA 3L3DB 1LO5B 1IEAB 1KLGB 4MAYB 1EX0A 1OGTA 3MBEC 3DPBA 1CLZL 2NY4D 3EDEA 2XTJC 4G8FB 4TUKH 1U3YA 4NNYB 3L7EB 3W82A 4TQEL 3O2DH 3SDXB 1KTLA 4K94C 4UIMA 5GS1C 1H3PH 3A0OA 2OJZL 4E0RA 2AK1L 1QRNB 2UZYB 1H8OA 3AU1A 5BW7C 2AEIT 3VU2A 1CGSL 2OZ4H 2CDEA 4WHDA 4X6CB 2VC2H 4H5SB 3MBXH 4XB8A 4DZBB 2XZCH 4DTGL 5GGQH 4Z77B 3PL6C 1N8ZA 4FQ1L 3TFKD 4Q2ZB 2OL3B 3TBVB 3IFLH 3BPLC 4OLUH 4LCCB 2XFXA 1S9VA 4GAJL 3VJ6A 2X2YA 5GRVK 2VZ1A 3W0WE 2YPLA 4ZO9A 2A77L 1L4IA 1N59A 5CP7A 2X89D 5EBGA 3QUXD 3WJJA 4CVXB 3QI9D 5DJXA 3O4LA 2AEPH 4HIJA 1CU4L 1AXSA 4ZNCD 2I9LB 2JB5L 2IWGA 3OR6A 4X5XA 4R96B 3TESA 3KPLA 1TZHA 1HSBA 1SBSH 3FT4B 3ZDYF 4MSWA 3EYFB 4K07A 1UKTA 1A4JA 3GRWA 3T0WA 1MHPL 3ULUC 4OZFH 3RWIA 1YEDB 5CJOL 1RJZA 3GJFK 2BERA 3ORJA 1R3HA 4AEHL 2R2HB 2XRAH 4LSDA 3OKYA 4DVRL 3M07A 4ZFOA 2NY1B 5FAAA 3PABB 5F72S 4KDTA 1I1CA 4NQDE 1KIRB 5HGAB 2CUHA 1A5FH 2E6JA 2YD8A 2OJEB 1VHPA 5FGBC 1BAFH 1M1SA 2X09A 3UJJH 3HNTH 3OKOB 1JNNH 1Z0MA 2I60L 5I71C 4RQQA 3NVQA 5SWZA 1LEGA 2GJZB 2XA3A 5F9DC 3BIKA 5JW5B 2X4PA 3RWGB 1J8HA 2EDTA 3BIAX 5HYJB 3BP4A 1P7HL 5F9JA 4W81A 4OAWB 4ZOBA 4IOFD 5I1JL 4OZGE 2PYFB 1E4XI 3PDOA 5C0NC 4A2MA 1IM3B 1QKZL 3JVGC 3LCYA 4PD4K 3B2VH 1KT2A 2WAHA 5ETUA 4M7JL 3Q3GA 1VPOH 2J5LC 1T7ZA 5F1KC 4CU6A 4OLWL 3QXDB 3PG2A 5SX4H 3NTCL 3T4AB 3MOBL 4NJ9L 3TEUA 1RU9H 3ARGB 1T2JA 3BZ4A 5IF0B 3FRPA 4TVSa 3MRCA 4UQ3B 3DI3B 2IQAA 5KANI 4OQ1A 1WFOA 2Z93B 4DQOH 4XNZC 1NAML 1MAJA 2OSLB 4PPTA 1X3DA 2ZG3A 3NH7L 1I1YA 3RVUD 5TJWK 1UXWA 4FNLH 1IM9B 3BAEH 5GSVB 4W6YB 5BV7L 3WHE1 3FFDA 1T2QL 3ME0A 1FGVH 4M7LL 2AV1A 4LLWB 1X44A 4U49A 4WJ5B 3QDGD 3LD8C 3K2UL 3MLSL 3V4VL 4W6XB 4XBGA 1I3GH 4YDIL 4XRCB 4FQHB 1BGXL 3RU8L 2X41A 4O2EA 4P2QA 5I73C 3CMOL 3D69B 4ODWA 4NZTH 1U42A 1UJ3B 1HNGA 4Q9RH 1L7TL 2HVKB 2BXYA 1JGVH 2GK0A 1LD9B 3MLWH 1T7VA 1FV1A 1XT5A 2QBWA 1HYSD 4HIIB 2V7HB 4X4MA 2MQCA 3DUUA 1YC7A 5HD8C 5ALCL 2YPLE 2XKNA 3MLZL 2DIAA 3PV6A 5DS8A 2WUBL 3O4LE 2B39A 4LPVA 1KJ3L 1D3CA 1I85A 5I75C 3DVGB 1AY1L 3IFOB 5GRJL 4FQ2H 5KVFH 5FYKE 3DUHA 2YOCA 1ZLUH 3BT2L 4HJJL 3CLFL 2FR4A 4JFEA 1SYSB 1W0YT 5C0BD 1AD0B 2YD3A 2J88L 3UZVB 4GLRH 1JHKL 2ERJB 5IESL 3RGVC 4K9EL 3HPJA 2DJUA 2OXGA 2VWEE 4RX4D 1S7UA 3I85A 2E7LC 1W0VB 5IGXL 1RMFH 1ORQB 1G7LA 4QF1B 2IQ9H 3IS1X 3MJ7A 2AEQL 3RPKA 1VKXA 2QSVA 2P5WD 2ICES 1XCQB 1H0DA 4O2FA 1BPVA 5D71H 5C0GA 3WIIH 5ESVA 3OKEB 4EZMA 2OI9B 3TT1L 1RVFL 4L8SC 1CDJA 1NBYA 3A6CL 3PGCB 5SWZE 1QG3A 4JFZH 4Y1AB 3ARSA 4CUCA 4AM0A 2FX7H 4LVHB 1AKJD 2VITB 5KW9L 2C3GA 4GXVH 5E2TL 1IGIL 1EERB 3AB0B 5DVLA 4GRWF 2HTKC 5GGVH 3MACL 1OTTD 3EZ8A 1QRND 4XXDB 3NFPB 2VZOA 2J4WH 4NRYA 1V7NL 5D1QD 2VH5H 4NGHH 5IJVB 3DUSB 3QO1A 2HFFA 3FOMA 4S2SB 1QFWL 1JNLH 2EDQA 1P4BH 3HFMH 2DLFL 4L4TB 4UILL 1TTGA 4NKDB 2BVUA 1G7JA 3H0TB 4QOKD 1J12A 2FEDD 4NP4H 4LPTA 2FECL 5EPMB 1I7RA 4A6YB 1IILE 2OL3H 4FABH 3I2CL 3VFVB 3RVXC 1IKNC 1I7UB 2DWDA 5FYJE 4H88L 4PJ7E 1FZJA 1XGRA 3NCJL 2NY3B 1G7IA 3HC4L 3HI5L 1OQXA 5KTEH 25C8H 2JIXD 3IRZA 4LLUA 5DD0H 5D2NA 3KS0J 2CO7B 2VLKD 1YN6B 7FABH 4NYLA 3QEUB 2CKBA 3O0RH 4JFHD 3S36X 5KBNC 1R0AH 3SCMC 5C0FA 2GAZB 1I9IL 5E94B 3I50H 3FQRA 3RUGF 5I8KL 4FFWC 4LCIH 5GGRA 5DUMH 1A22B 2BY0A 3H9HA 3LY6A 4ENEC 2DJ4A 5I18L 5HPOA 5IBLC 2YKLL 1BVKA 5E1HB 5GGVY 1MCSA 1DBAH 1F4YH 3PHOA 1P5VA 4NRZB 5FECA 4JGMA 1FFNA 2YMXH 1CXHA 1QZ1A 3D2UA 3U9UA 4MCZB 5JPMA 4X83A 4OF3A 1NEZG 1AXTL 5EOCL 3NGBB 3D85A 4CU7A 2P24A 4OZFG 5D7JC 1RIHH 2Y07H 2VISA 3VRJA 1NGQL 2ED7A 1E4KA 4G42A 1EGJA 3GMPA 5KN5A 3BDXA 2GCYB 5HYJD 2F53E 5ESAB 3KLDA 4LLDB 1Z3GL 3ARDC 2W9EL 3LPWA 5MERA 4JFEE 4PJIF 1EFXB 1NCWH 3OZ9L 3TIEB 5IFHH 3RIAF 2AS5M 5E7BA 2XN9A 5CBAB 3HA0A 5EBLB 4PJ5B 1T04A 5IB1B 1T22A 4ZUTA 1I8MB 1G9ML 3MMEA 3VXSB 3D6GA 2DQTH 1FCGA 2P7TB 3IU4L 5TGBB 3UBXI 1J0IA 1YY9D 3RJQB 1VACB 5JLZB 3OB0K 2F8XC 5D6DC 3CNKA 3V6BR 4PJCE 1XF3B 4EXPX 1PKQA 3KYMB 1G7MB 3C60A 5FB8B 2XWTB 3PV7A 5T1LD 1MJ7L 3S8WA 1J05B 4AT6B 1FG2A 1U8IB 1EXUA 3FFCE 3T0VA 2DBJA 1Y18A 3ROOA 4ZFFA 5I1DB 4IMLA 3BH9B 5FUZL 4ZSOA 1R3LB 3D9AH 2EYRB 4XPBH 5JDS