1RVFH

Fab complexed with intact human rhinovirus
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
119
structure length
119
Chain Sequence
b'QGQLQQSGAELVRPGSSVKISCKASGYAFSSFWVNWVKQRPGQGLEWIGQIYPGDGDNKYNGKFKGKATLTADKSSTTAYMQLYSLTSEDSAVYFCARSGNYPYAMDYWGQGTSVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN
publication title Neutralizing antibody to human rhinovirus 14 penetrates the receptor-binding canyon.
pubmed doi rcsb
molecule tags Virus/immune system
total genus 16
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 1996-09-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rvfH00
3WKMH 4LPUA 3NN8A 3ROLA 1Z9OA 5JO5A 4OI8A 1G7IB 1T5XA 2B5IC 3FFCE 5C0BD 3SJVA 2BCKB 2NY2D 2FWOB 1KELL 4ZFGL 1MHPH 3BSZL 1RFDH 4GKZB 3A6OA 3G9VA 3QIWA 4DVBB 1PLGL 2NXYB 5I18L 4Q6IB 3HKFA 3KDMA 4MDIB 3G6DH 4PJBE 2YXFA 5FHBL 3FHQA 1Q1JL 5IW3A 1CD1B 5JW5B 4ZDHA 3D2UD 3THML 5KSUA 1X7QB 4KK5D 3L95B 4D2NA 1JTPA 3REVB 5A3ID 3QPXH 1C5DB 2P8PB 4J3OC 3UDWC 2F53D 3MA9H 2AXHA 4CNIB 4DN3H 3DVFA 5GGTH 5F1NA 1ERNA 3MRQA 4GBXC 2FBOJ 4TULL 5L0QC 4X99A 5EC2B 4BZ2H 1OB1A 4TOYH 1JFQL 5L2KD 3DURA 1V05A 4N8CL 1U8KB 3BQUA 1XGUA 2XPGB 5BVJB 5MEQA 4LLVA 1F13A 4RAUA 1L7TH 2E6QA 3EOYG 4K3EL 2FR4B 4FTVA 3U4EB 2BNUA 1OGAA 2C1PB 4KJYB 4OGXL 4FABL 2FEEL 1FAIH 4PJ5A 4X5WB 1LWRA 4O2EB 3WNNA 1BJ1J 2X4TA 3RA7L 1NUDA 5IEHB 1T4KA 5DJDA 4MAYD 2DJUA 3FB5A 3VGFA 4ERSH 1YC8A 4Q74A 5A2LH 2J3SA 2X4SB 1MCSA 3HPJA 3VFTA 5I1CL 5IWLC 2RGSA 1GZPB 3TO4B 1VERA 2BSTB 1GC1L 4QTIH 1ORQA 4OLZL 3IDUA 2BVPA 3KPPB 5T1LB 3PP3K 1KYOJ 1RZJL 2JJTC 2E7MA 2R0LH 1C16A 1QSVA 5EIVA 5C0CB 5D1XB 2H9GA 4DOHB 4FFWD 4JFHE 4O9HH 2ED7A 1K3IA 3MOBH 4X5XA 1EHNA 2DI9A 3ELAT 3HA0A 3BP6A 3B8SA 3G5ZB 3N9GL 2FX8H 3OMZA 3R4DA 5FO7A 5C8JA 4MNQB 5I1DB 4P4RB 4LNVA 3AB0B 4QHLA 1OTSC 4U1KB 1P7QB 1DUYA 1F3JA 5C0GB 2EDTA 2X6MA 4OFIA 4AQ1B 5FA3A 4NHCH 4RFOH 3C6LD 4JZOB 4NC0B 5T3XL 1UM5L 4PRAA 2FHFA 1Y0LB 1AKJB 4MJIB 2VDQL 1IM3A 1FG9C 4F57H 2MPAH 1IC5L 1NC4D 1AE6H 1WSST 2YPVH 3VMNA 4N8VB 4M7ZB 1MQKH 1MQ8A 3PJSB 3MRLA 3SCMD 5HD8C 1N7MH 2YWYA 4NQCA 3FKUS 3CXHK 3ZLQC 2W0LA 4WJ5B 4XNQB 4WI3A 3IB4A 3RY5A 5D7JB 1MHHB 3GMMB 5CGYC 2Y25A 3NIGF 3T04D 1M1SA 1NGWA 2XN9A 1BLNB 1YEDB 1INDH 1JGVH 3AU1B 1GGCL 3DXAA 5D1QA 1UWXH 3G5VB 4Y4HD 2EH8L 3CVIL 1MREL 1LILA 1UZ8B 3KPSE 2ADJB 4KQ3L 4ZYKB 4P5MA 4NPYB 1LEKB 4PJ8D 2L7JA 2J2ZA 4QYOB 5F9JA 5DHVB 5GGVH 4WI2A 4JZNB 5TE6H 1N3NA 1SEBB 5E2VH 3DLQR 1MWAB 1TTGA 3LKPB 4G7VL 4JB9H 3BRGC 3CXDL 3OGCB 4POZD 4Z7VA 1J86A 2KQMA 3QXDA 1T22A 1B3JA 2HFFA 1ZT1B 3MJ9H 3O45B 1T66D 1W72A 5L9DL 2X4QA 4J3SA 4KV5E 3B2VH 3ROOB 4IHOA 2YKLH 3WFHA 4WU5A 1XZ0B 5BV7H 4LKXA 2VZ1A 4HHAB 5DJCA 1QFPA 2UZYB 5GGUA 4MXVE 2AJUH 2AV1A 3PABA 5KSBF 3LHPL 1UXWA 5ENWA 3ARVA 1BP3B 5CZVH 1KIRB 2QQKH 4D94A 1LO0L 1T0MA 3QA3A 1CFSB 1GGBL 2ICWJ 4IOFC 4FMKA 1RJYA 3MLUH 4JDVA 4LRNL 5D7IF 3U9PH 5DT1H 5K9QG 2H8PA 1XCTB 3C5ZC 2FO4A 2R2CA 3TIEB 2AEWA 1H3UA 4WIQA 3MOAL 2UZIL 3FAWA 3I75B 5JO5B 3ARDC 5JW3H 3VU2A 3B8YA 4N0FA 3TNMB 5B8CA 3SJVB 3M17A 3L5IA 5CZKA 1DQQA 2XFXB 3O4LE 5ILTH 4K94H 3BO8A 5I74B 1AHWB 1NJ9A 3I6LE 3RI5K 3BE1H 1EHLL 1QUNA 4QF1A 1VESA 1U93A 3W9EB 4E5XB 3F58H 1WQVT 3S36X 1BQLH 5D5MF 2XT1B 3G6JE 3PF2A 4ZDHB 4JM2D 4DQOL 5EH1A 2V7HB 5ISZA 4Y16A 5L7XH 2DJSA 4FQCL 3ULSA 3G08A 4L8BB 5DK0A 4WDIA 4QRQB 1UWEH 4MA3A 1W72L 3QDGA 1K4DA 3MRQB 1U8PA 1XGPA 3ZKXC 2NW3B 1C1EL 3TYGL 4RZCB 2Y72A 1OB1B 1NGQH 1MLBB 2NTSP 3HRZA 1RV6X 4MVBC 4JHAL 4M1CD 5CEYA 3U1SH 4RAUB 2A2QT 1NDGB 3RP1A 2P24B 4OD1L 2O26U 2G5RA 1NBYA 3PQYD 4KI1A 5MEPB 5F7MC 4D0CB 3ZHLA 4DW2L 2HJFA 1UH2A 3Q5OA 4OLVH 3GBNL 1KGCD 4FQJH 1E27B 4GAGL 3QI9C 4YQXH 4YHLL 3I2CL 4Z0BL 4OM0L 1JHTB 2V5TA 4YDLB 5F7DB 4Y5YB 2CRIA 2NXZC 1RUKL 4YZFF 5F88B 1IQWL 4KUZH 5DHXB 3RIAF 5IVXA 4OFKA 1N64H 4LSSL 3WHE1 1ORQB 3SE8H 3WNOA 35C8H 2BVPB 3LDBB 2B0SL 3L3JB 2I07B 2EYTA 5F1KC 1Q94B 1RZJC 3QIWC 1MEXL 1RJZB 1M7XA 3IETB 1I1FB 3O3EA 5ITFB 3RNKA 2H9GB 1CZ8L 2EYSB 5D2NA 5I1IH 1SJVA 4CMMB 3RWEA 4ZOAA 3QRGL 4OZFH 1B9ZA 1FL6A 4P2OB 2R2EA 5FO7B 3X13A 4PRPA 2B20A 2AJZA 1L0YA 4ETYA 5JHLL 3QCTH 1M6OA 2IANE 1S9VA 1GH7A 4DGIH 1ZANL 1CFBA 4JR9L 4KGLA 4UIKL 5DDHA 1PQZB 3Q1SL 1VKXB 5FB8A 2YN5A 4WGWB 1S7TA 4XC1L 3HE7A 4GBXD 2R0WH 4XP6H 1A64A 3BQUC 2VQTA 3LV3A 2APVA 4PRBB 2DAVA 2F58H 3MLSL 3LQAH 3LQMA 4M6NL 2DQCH 4Z8FL 4BZYA 3EYSH 3FRPG 4AH2B 2OM5A 3DUUA 4PR5A 4ZSOE 4PD4K 3WJLA 3VI3E 3QNZB 4G3YH 2AXJA 1PEWA 1NGWB 1XFPA 2R0ZL 3SDDD 1EEYB 5D1QB 2P43B 3FO1A 1FFOA 3CH1A 3U7WL 4Q0XH 1YJDC 5KVFL 1GJIA 3W9DB 1OWRM 4XZUA 1X5FA 2J8HA 3WUZA 4UQ2A 1ZMYA 4R90L 3RWGB 3PP3H 5K9KB 4MCYA 2Y36L 2X4UA 5ESAB 2COQA 4JGUA 1IEBB 1EPFA 1G7MA 5C86A 4XNMA 3GKZA 4QNPE 3P0YL 3CC5A 3O81A 1EUTA 2HTLC 4I2XB 5DRZB 3P4MB 4HT1H 2BY2A 3VFNA 3TH2T 1JYNA 2ZUXA 3G9AB 4OF0A 2VXTL 1QHPA 1T03H 1A6AA 4IHOB 5FOJA 3WFHB 4L5FH 4RISL 4RMQA 4YFDB 1BZ9B 2IADB 5GS1A 4Z9KB 4LKXB 4YDVA 1D6EA 3U0TA 4I0PB 4PJXE 1X4ZA 3N0PB 3PWPA 5HGGS 5TJWK 3PABB 3GKWL 1M7DA 3ULUL 3TBYB 5H94A 1BQSA 5C71A 4W4OA 3KLAB 1AIFB 3BIAX 4N0UE 1EGJH 3BP5A 4L8DA 3QA3B 4LVHC 1QBBA 5CEZH 4U6VL 2DIJA 2ADFH 2FO4B 5J8OA 3S36H 3RVXD 2E27H 1K5NB 1JZ5A 1OM3L 1UKTA 4PYGA 5EU6E 1AD0B 5T5FL 3TVMA 2DLIA 3E6HB 4KVNH 2ZUYA 3L1OH 3D18A 4JN2B 3LOWA 4PV8A 1NUNB 43CAB 2B4CH 3BKML 3CPLB 4NGHL 1JMZA 2Y07H 1NCBL 1NJ9B 3CX2A 5KOMC 3KJ6L 5CGYD 3MLXH 3T4AB 3PDOB 5E8EA 4X9IA 2BOCA 2HH0H 1U93B 5BOPA 3HI1A 3LMJL 5D96B 5LWYH 3EKCA 4OLWH 1KG0B 1KJMA 3FFDA 4OV5B 5AD0A 3IJYB 3JUYA 1KCKA 3ULSB 4L4TD 2DQIH 1JNNH 3TA3A 2ARJA 5K9OA 5JW4R 4QRPA 4NUJA 4G5ZH 4D8PB 3K1KC 1E4JA 2DI7A 1U8PB 1XGPB 3FCTA 4P9MH 2F53E 3GSWB 43C9A 1M71B 4RDQG 3MO1A 3DIFB 2CK2A 4M8QB 3BDYH 3AGVA 4I48A 3ZT7A 2VDLL 4X7TA 2QEJA 3RWJB 3LS5H 1MUJA 4OZFG 1PSKH 4LVOB 1BZ7B 3RWHB 4NM4H 4DKFL 4HWUA 4NSKA 4NM8L 3OB0K 5DUBB 1JE6A 2WWKO 1YPZA 5E6IA 1WISA 2NZ9C 5JIPA 3ARSA 4G8GA 5D9SB 3ZKSD 1V7ML 1G7QB 4UDTB 1U8HA 3QDJD 3SDYL 1OTUC 5A2IH 2F15A 3QJHB 5DJ2A 5ACMA 3C5ZD 3RPIA 3ZE1E 5B8CC 3B9KB 3ARDD 4X98B 5MEND 1VADA 4K07A 1FCCA 3Q3GA 1J0ZA 2R1XA 2VITA 5C9JA 2DM4A 5DJ8B 1T20A 4YR6A 4JFED 1JPFB 3INUL 1IKFL 1C7SA 3RWEB 4BSVB 3QEQD 4HG4J 3K74B 3V5DA 4JANB 1CBVH 4WV1A 4RNRB 4Y16C 4PBVC 1JBJA 2AJZB 1UEYA 3CZFB 5DJZA 1M6OB 1FZOB 4GKOA 1I75A 5ID0A 4G6JL 5GHWL 4XCYA 1YYLL 1FFRA 2E9IA 4I4WA 3FHAA 4K3DH 4QRRB 3Q48A 3D69A 4KHTL 5DDHB 1DLFL 5FIEA 1TVBB 4CDHA 3BPLB 5FB8B 1S7TB 3ZO0A 2QQNL 4W6XB 4UT6H 2YC1B 3HZMB 4LPCA 3NVQA 2EDHA 3LV3B 2WW8A 3MBXH 4KI5C 5CJQL 2G9HB 5DI8B 3IJHB 1NCWH 1I7RA 1WEJL 4MVBD 4X83A 3DV4B 4P59H 1A7OL 4K9EL 1CR9L 5CMAA 3FONA 5F1IA 2X89A 5CSZB 3G04A 4IBLT 3KLDA 2GK2A 5DRXB 4PJDA 3RJQB 1A3RL 4JREB 4GW1B 3WDJA 3B5HA 5MP6H 15C8H 3CFDA 3BAEL 4BQBA 1FFOB 1FZMB 2RB8A 3PWLB 4XXDA 4P9HC 3BKJL 5B3JF 1Y18B 3IVKB 3QCVH 2A77L 3QIBA 4JKLA 3MR9A 3L3IB 3VXUA 1MVFA 4C55A 4NUGH 5J3HD 3SDXA 5D2NC 5L88L 4JFXB 3CFKA 1G7MB 1FL5B 3T8XB 3QIWD 4FQXC 1NAKH 4G6KH 3CC5B 3VH8A 4JQVA 4WHTA 2CPCA 3BFOA 1X9QA 5DURB 4LOUC 2Z92A 4Z7UA 4RBPK 4NBZB 4NFDA 4KAQL 2C26A 2VWEC 4M7JL 4PFEA 3V4UL 4LQ1A 5HVHC 4HPOH 2NY6C 5DS8A 1UH3A 4NNPH 3BI9X 4PJGB 3HE7C 5T3XD 5KW9L 5H94B 1N4XH 4GO6B 3ULUC 4LGSB 1JJUA 4PP1D 4NJAH 1P5UA 4XPGH 2Q1EA 5E94B 5HYJD 1IM9A 2IBZX 3VFRA 4HKXA 1PG7L 3C09C 4FNLH 2OJEA 4XNUL 4HX1A 4UQ3A 3WIHA 3VXTA 2A6IB 5DFVC 4GAYB 4GFTB 3T0AA 4HIEB 5AAWA 4FTVD 3TVMB 1OGAD 1UWGH 3WXWL 4CJ0A 3WJLC 3IDXH 3TESA 1PW3A 2M2DA 3J8F7 4LPVA 1J8KA 1G6RH 5DGRA 4P46B 4PJFE 3SBWC 5EU5A 4OI7A 4D0DA 1S8DB 5E5MA 3C60B 2BOCB 2OZ4H 1CL7H 3HC4L 4HS6A 4QHUA 1T89A 2O61A 1QO3B 3STLB 3NMEA 2AJXH 3JWOL 4MAYB 4GXUM 3L3GA 5I1AB 3S34L 2EKSA 4U6YA 4R4BA 1WZ1H 5AD0B 3CUPA 1RK1B 1TJGH 2BNRA 4PBWD 5I16A 4MNHB 2CDEA 4RGOH 4F8QA 2BK8A 5IIEA 3HE6A 4NUJB 4QRPB 3P11H 3UZEA 2HFEA 4LLDB 1MNUH 3K81A 2UWEB 4JPKL 3HZYB 2HTLD 1KULA 4Z78A 2AJ3A 4I77L 43C9B 1SJHB 1JNHB 2H1PH 5GS1C 1QOKA 1T1YB 4EDWL 3IAPA 4Q9QH 4X7TB 3HB3C 2DKMA 5FYLD 5CWSB 1KTRL 5D1ZD 1U8LA 1FH5L 2AJYH 2F19H 3DX8A 4I5BA 4W4OC 1MLCB 2ZZUT 3SKJH 3JV0A 4NSKB 5D6CB 4EIGB 1KEGL 3WIHL 4UMGA 3C6LB 1NEZB 1F4YH 5EOCH 5M94B 3PQYE 4NQCD 2E9WA 1MCLA 2YPLA 3LPGA 2F5AH 1DEEA 5KS9B 1PEZA 2LU7A 1AD9B 1NC4B 2JCCE 1E0OB 2FIKA 3VXME 4HV8A 5I1KL 5D2LB 3MYZA 1PY4A 2IALA 5I8CA 1A8JH 1VADB 4GUPA 3MXVH 3E3QC 5C9JB 3E6FB 4H88L 1JK8A 3O4OB 4GMSH 4KXZI 4R9HA 1T20B 4OCWH 3UTTB 2XN9D 2F9BT 1WWWX 5E03A 1PZ5A 4YR6B 3WL9A 5IHBA 1MCWM 4GW5B 1MFEH 1KYOK 1VACA 1QRNA 1WAAA 5GRZA 4ZQKB 1YUHA 3I85A 5K59E 1V8HA 3C87A 4NQDD 2L7UA 3OKMA 3WD5L 3TA3C 4LSRL 2FJGA 3KLHD 1MCOH 4TSCL 3O9WA 3D9AH 2OJZH 2P5EB 4Y19E 3EO9L 5ESQA 5MEOA 5E9DE 3TBTA 2ZWLT 4UI2A 2A9NH 2DD8H 1ZVYA 4ZS7H 2Y5TB 4FZEH 5BOZG 4Z7WA 3UZVB 4JKPL 2XI9A 3C6SB 4JJHA 3VRLE 5ALBL 3AS0A 2BXYA 3T0EB 3FONB 3EYFB 4K9EC 5TF1L 2HKFL 4M1GL 4GKNA 5E6IC 4H20L 1U8NA 1ITCA 2KQNA 3OB0H 4MA1C 1QFWH 4WWKA 1CFTB 4AZ8A 3L3HA 2KBGA 4HS8L 3TBVA 1RSFA 2NZ9D 2IGFH 4TUKH 4HFUL 4XXDB 4BFGA 1CYGA 1U6AL 1N5YL 5JOPD 1YMMD 2O5ZL 4NNYA 5D72H 1S9YB 4ZNEE 4UT9L 5B39A 1AQKL 2Y7QA 2EDJA 2HJLB 4G7YH 1RJLA 4X8JA 3BPOC 3LN4A 3NIFE 3C5SB 4IRJA 1EHXA 5JPNB 2F74B 3CFKB 3T77B 4U2ZA 3EOAA 3JWDC 1HH6A 4ONFH 3VH8B 3BPNB 3QCUL 4WV1C 1A0QL 1MJUH 4RGNC 4GG8A 1XIWA 2Z92B 3F65A 1I3GH 3VD4A 4ZOCA 3WO4C 1UM6H 1JGEA 5SWSA 5ISZD 2R2HA 1BQHG 4KMTH 4N0CC 2XWBB 4Z95H 4JY4B 5KBNC 3QEUB 2NX5B 5DQJA 5FCUH 3O2DH 5KVMC 4F33A 4IS6A 1XR8B 2VISB 4PP2B 2YXMA 5D70L 4XP4L 1CDBA 2ZCKH 5F6HI 3IDIA 3WLWC 3ZDYF 4UQ3B 3EFFB 4HGWB 4PUBH 1QFWM 1MCHA 4M1DL 2DN7A 2FSEB 1OY3B 3MRMB 5IESL 4Q9CA 4NZRL 4LLQA 3RWCB 1DSFL 3D39B 3OXRA 4LLUB 4QT5A 4YEEA 1V3MA 1EH9A 2ZKHL 5A16A 4PJIB 3VJ6A 3T3MF 4U1MA 5CINL 1Y6KR 1BX2A 4WY7H 3MV8D 4DEPC 2BHYA 4ZD3L 1KIPA 2F54E 3T2OA 2CDFB 4HS6B 3A6CH 3QIBC 2OQJA 1CLYH 4KQ4L 3GSNA 5EZLA 4PJGF 3AROA 3JWOC 1EK3A 4MAUH 1W8NA 2AW2A 2J4WH 5FK9A 1VENA 5FKPB 1A1OA 4G8EB 2V2TB 4K71B 2WNGA 2BNRB 3FN0L 3IT8D 1U8MB 3UTSA 5C2BH 3CSGA 4P4KA 4FQXD 1LO4H 3HE6B 5HDQL 1MCPH 2NY3C 5DJYB 5EORL 4PRPD 4DOHE 2ENSA 3F5WB 4UIMA 3U46A 4RBPH 4EKXA 1P1ZB 4C56D 5GGVY 3S3JA 5J6HB 5KVDH 2V17H 1HXYB 1R3HB 1AO7B 4X6DB 3I02A 4MSWA 4Z7OE 4I5BB 2A1WH 2NY6D 3RL1A 5CCKH 3NAAL 1TNNA 4ODWA 1T3FA 6CGTA 2CK0H 3HE7D 3LSOA 4XAKD 1MFDL 4HF5L 3U4AA 3ULUD 4EXKA 2VERN 5I1JH 2H26B 4MJIE 5EZIH 3H9SD 4LLMB 3CMOH 5T33H 4LLAA 4LPXA 3N1GC 3GUTB 3WYRA 5DFVD 5H2BB 5JNYA 4K3JH 3PGCB 3O8XB 1S5IH 4NKMB 2UWEF 3LKNA 5E2WH 3GNMH 3KR3L 4MNGA 1WZMA 2W0FA 2FGWH 1ZGLM 1IARB 5CKAA 1JK8B 3MBEA 1TPXC 4RA3A 4UNTA 3QUXB 2FX9L 5F9OH 4Y5XA 1OPGL 3RNQA 1H3TA 4WFED 1YUHB 3NFSL 1U3JA 5BS0A 3PL6D 4WEBH 3MLRH 4JFEE 2J8UA 3SDDB 5H8DA 1PBYA 1EA9C 1F90L 3WSQH 2GSGB 3VWJB 1CF8L 1YN7B 4HUNB 4NO0B 2X9WA 2EECA 3T2QA 5GRJH 5FYKL 1MF2L 2JIXA 4ZTOL 5KS9F 4NIKB 1FYTA 4ZUSA 2FBJH 3O6KH 5IJVB 3OR7B 1OAQL 5D2LF 3TBTB 4MZ3A 1TQCB 4P57A 2VXVH 1QFUL 1UJTA 1TJIL 3HHRB 3LEYH 1BD2E 2GW5A 4XT1C 1BGXL 5SWZA 3VFUA 3TWCL 3CIQA 2OLDA 5E08L 4DKEH 4FQQA 5IMKA 1ES0B 2W9EL 3X11B 4OF5A 2VABA 3MRIB 3RIFK 5DWUL 4WO4D 2MJWA 3GGWA 4OI9A 4LHJB 3I50L 3L3HB 3SPVA 4YAQA 1FNAA 1ZLVK 2D9QB 5ANMA 1BJ1H 2WMPA 3STZA 5CGMA 1B0GA 3RX5A 3ALPA 4O02H 1VEMA 5B39B 2CMRL 4EDXB 1ZLSL 4JPIA 5HHQA 4JO3L 4EI6B 3ULVF 1VFBB 3BGFB 3LRSA 5MI0B 3RJDA 4DKAA 4F7PA 3EOAB 4M48L 2YEZB 3KXFD 5TQ0H 4PTUA 4X4YA 3SJVE 3WNLA 4XP1L 1NCAL 2HN7A 2VKWA 1PKOA 4X4ZA 4HKZA 4YXKH 1J8HA 2PTVA 4ZXBC 1NQBA 4OBSA 3CFCL 4I13B 1CDCA 1YMHA 5GGTA 1QLFA 3P73B 2AEPH 3UYRL 4B7LA 4CU6A 1AFVH 2YD4A 4HMEA 2R2HB 3O9WC 1JN6B 3LS4H 3RZCA 3QEHA 2OS7A 5HGDA 4G43A 3TA3D 5A2JH 1LK3L 3N85L 2C3WA 3DBXB 4GRLC 1YEGH 3PHOA 1M05B 1I1YA 3FT3B 4HS3A 1HSBA 4IS6B 2X70A 3ARBA 1A6WL 1P9MA 1P4LB 4L4TB 3ES6B 4TSBH 5A1AA 4WW1B 3OJVC 4JDZA 1HH9A 3FQTA 1F58L 3IFPA 5T3XE 2VR9A 2ZSVB 3MREA 5I8OH 4ODSH 2N4IA 4G8FA 4XMLL 4EIZC 1A9EB 3BD5A 3SE4A 4U0QB 2VL5A 2C3VA 4S2SB 3VI4F 4WWKC 1TZGL 2GFBB 3DWTA 2PYFB 3OXRB 4QT5B 1FFQA 2HVJA 2BX5A 4FTVE 4W68A 5F9WC 4PJCA 4G8GD 1OGAE 7FABL 1LEIA 4PJ5E 3QISA 3GSQA 3IYLW 1J0KA 1SYSA 3QG7L 4IRJC 3WXVH 5D7SH 3RQ3A 3H3PL 1MRDH 3NGBC 4RWHA 2EDQA 1CDYA 4XMKH 3QDJB 3OBAA 3MNWB 1KCVH 3MRRA 4CVXB 3D25A 2VDNH 1EJOL 2WBWB 3QPXL 4KDTA 3MA9L 3L5WA 5FF6B 4G42A 2AV7B 4GG6A 1YQ2A 3L9RA 2BMKA 3UJTL 1XIWC 5MENB 4FQ2L 4U1NA 1GGTA 2R29H 5KAQG 3EJZD 1GRWA 1CLZL 4DVRH 2NY5L 3IS0X 4MQXC 5IV2B 1AXSB 2J5LC 5SX4H 3I02B 1A6UL 4PJIF 4I3RH 5D71H 4HKJB 1EO8L 1I7TB 2XG4A 4ODXA 1H0DB 3IFOA 1L7TL 1R3IH 2FHBA 4H25B 4K7PH 4ODWB 3T1FA 1IKNA 2PR4L 3EUUA 3VFWA 4EOWL 1UACL 1T3FB 5ELIA 3OAUL 3LSOB 4FP8H 4WFHD 5TFSL 2X1QA 3STBA 1S7RB 2R4SH 3TCLB 4P2QA 3IS1X 1FPTL 4HH9B 1SBSH 4HJJH 5EUOA 4YXLL 3EO1A 3UPRA 1SY6H 3O6LL 2GTWA 1R5WB 4D9QD 3TPKA 3NACH 5ITBL 4GRWB 4WU7A 4TUJA 2JB5H 3DROB 1JTOA 3H3BC 2D7TH 2JK5A 4K23L 1FGVH 4IRSC 1JZ4A 3MBEB 4JO4L 3MLYH 3MRCA 4CRPA 2R0LL 3JWNC 4F9PA 5AWNL 1QKZH 2P7TB 4JFDD 4YHKH 4X6DF 4PJEB 2CLRA 3AXLB 2H3NB 3F12B 3QQ4B 3MOBL 5B38G 3L3DB 1BBDH 3S98A 3QIBD 3QH3A 3BEVA 2FX8L 3KYOA 3DXAE 3FB8A 4HG4K 3GSOA 1MRCL 5ACZA 4P4KC 1E6JL 2X9XA 3GHEH 3P30H 4GXUN 5C6WH 4NO2A 5IF0B 4RFOL 4LCIL 3L7FA 4X6CF 5I17A 4ELKA 1HEZA 5EO9A 3I3DA 1CWVA 2NY3D 1EBPA 2YBRA 4LU5H 2PCPB 2OL3H 4OQTA 1KJ2L 4Z7VE 5IKCA 1UKSA 1AE6L 3VA2C 4IOIA 4A6YA 4I8DA 3EDFA 1Q9KB 2NPLX 2AKRA 5E99H 4XNYH 4KY1L 4YH6A 2IMMA 4NJ9L 1ZT4B 3VXRA 1E4XH 3MX0A 1LK2B 2FX7H 3DNKA 2ZUTA 5ADPL 3TJHC 4N9GB 4BQ8A 5C0AB 1FZKB 3O2WL 3ARYA 1J1PL 2D0GA 4L3AA 5ERWB 3H9HA 2XACC 4QHKI 5EU7C 4YAQB 3HG1B 2NY0C 1YZZA 1X44A 4YHNB 1CT8A 1TJHL 2DI8A 1VA9A 2YA1A 1D6VL 1RMFH 4Y5VC 1IBGL 2JJVA 4DGYH 3WO3B 4TVPD 1IL1A 1JPGB 4RIRB 4OCRH 3TT1L 4JKWA 4BH7B 3LRSB 2VYRE 4Y5XC 3F7RA 1P6FA 1WCBB 3QFJB 1KIUA 2Z31A 5GGVL 1SQ2N 2AVGA 4HWEH 1P7KA 4YHYC 3BX7C 5TE6L 3RGHA 5JORA 1U91B 4PJAB 5I2IB 2HN7B 4P5KA 4FG6D 4Y8AA 4HKZB 3DMMC 3S37X 5IHUH 4J7RA 1T1ZB 2ZUWA 4FZ8H 1GHFL 1WBXA 2IJ0C 2O5YL 3I9GL 3RZCB 3UTQA 1A6TA 3DHMA 5HGDB 3SQOH 2XV6B 5C0RH 1IFHH 5BV7L 8FABB 4RX4A 3PHOB 4LKCA 3BXNB 3OHXA 5ISZE 3OKNA 4J3WA 3ARBB 4OQTL 4RSVA 4N90D 1L9MA 1F4HA 5FDYA 4A6YL 3S3SA 1G7HA 1NCDH 2C1OA 5CSGA 4TRPL 3WNKA 2X9YA 4WEUD 3QDGE 5IB1A 1F8TH 4L29A 5F1OB 3PIQA 3QDMA 4MJ2A 3WIFB 3KYMA 5JHDA 3MREB 1A7NH 1CVSC 1QQDB 5DUPL 2C3VB 1MJJA 4MA8H 4JZJA 5ECJE 5KSAA 5FGSA 4J12A 4KI5E 4NRXA 4LNRA 1ZWIA 4XVSH 4YHMH 1JV5A 4X9FA 3KG5A 4XPHH 3MA7B 3DPBA 4NN5C 1KSRA 1I9IL 1HQRB 4G9DA 1EFXB 1ZLVH 2A74B 3UPAA 1I7ZA 4X80H 4EQ3A 2VLKA 4IDJH 2YN3A 2R56H 1Q0YH 5J1TC 2HKHL 2V2XB 5EU4B 1I8KA 1NBQA 2WBKA 5FUOH 5DYOA 2FJHA 1NMAL 5CJ8A 5IVXE 1SMAA 4OZFA 2UYLB 1F6AB 3LPFA 1DUZB 4E0RA 3ARXA 4M61A 1QRND 3GIVB 1A4JA 4HQQL 4S1QL 5GGRB 3M1BA 4QXGH 1KN4L 1WWAX 3S35H 1R0AL 5D2NE 1UGNA 2NY5C 1E28A 4ZXBD 3X14B 5CJ5A 1VGEH 1NGQL 1QRKA 3W39A 3VFMB 1KJ2B 1NGXA 4PRPE 3ZDXE 3O9WD 5KVEH 1P9MC 3Q5YA 1JRHI 4GRLD 3IDNB 5MERA 5LXGH 3NFPB 1RIUH 1DQLH 1FO0B 2FYYB 2YRZA 3QIUA 1S9KC 4LBEB 4Z6AT 1IGTA 1A1NA 4XAWH 1G7JA 5ICXB 2Q86B 4A2LA 4OAWB 4OKDA 3MV9D 2KH2B 3SE4C 1QEWA 4RAHA 3EO1B 4ORZC 2YHGA 4XGZB 1KF9B 5IB5B 3ULUE 3X3FL 1WICA 4TQEH 4HWZA 2YA2A 1MIEL 1N64L 4RMWA 1GGIL 5FO8B 5C92A 1MI5B 4WWKD 3BKYH 3V79C 5F89B 5EZJB 1U3YA 1ZVSA 2IPUK 4BSWB 3GMOA 1QVOA 5C0EA 1C08B 2W1NA 1M4KA 5T1MA 1FL3B 3QG6A 5C09A 3IXAA 5BZWA 5I1IL 1I7UA 4OGAC 3KPNB 1JCKA 3ARGC 4KC3B 2GJZA 4PB0L 3WIIH 2WM0A 5C08A 4H0GA 3KYOB 4Z18A 1KELH 1RUML 1YY8B 3NZ8A 4ZFGH 3BSZH 3GSOB 4Y4KB 4NFCA 3A6BL 4KDTC 3CSYB 5I18H 1FE8L 1YMMB 4YDKH 5FHBH 2WBJD 5HPMA 3QEGH 1Q1JH 4HJGA 5DHVH 1BFTA 2WLYA 1PYWB 1AR1D 1ZA6A 5IVNA 3THMH 3V6ZA 1CFNB 3LPWA 2YBRB 1MWAH 1FHGA 5SWSD 3KS0J 1U8JB 3VD7A 4QRTB 3H6JA 4XP6L 1OT2A 1DR9A 1PD6A 3LQZA 2CKNA 2EKJA 3VWKB 2HJKA 2F8XC 4BKLB 3MV7A 1J5OL 2E6JA 1B0RA 5IW1A 4YPGA 4JFQB 2WLZA 4JLRB 2WANA 4TULH 3TV3L 3WUWG 1IAKA 1H15A 4BH8A 2CO6B 4K55A 5H37H 4M7LL 5KOVC 4ACPA 5EIIA 5DMGC 2XZCL 3PWPE 4KKLD 2ZUVA 1TDQA 1U2CA 4G3YL 4RQQA 1OSZA 3FFCA 4JFOB 2WINA 5LKNA 3S37H 4OGXH 4FABH 1MH5A 2MCPL 3RWDA 5IFJB 5CIPB 3GEWB 5I1CH 2XXCB 3HTLX 4IRSD 1GSMA 1P4BL 1DQML 3U2SA 3JTSA 1GC1H 1VEPA 2ZG2A 1TVHA 4P5KB 4OLZH 1ITBB 4PV9A 2VXQL 4G80A 1RZJH 5I0DA 1NMCB 3E3QE 3ISWA 3FTGA 2G5BA 1F00I 3BZEB 1S9WB 1WBXB 1JF1A 5IFAL 5EPMA 1GXEA 3UTSD 1A2YA 4M4PA 5D7LA 4PGBA 3PDDA 1Z5LA 4BFIB 5BV7C 1ND0B 3Q6GL 1NDMA 3N9GH 5DEZA 4NT6A 3UXFA 3OHXB 2EEBA 3LB6D 4JJ5B 1FNHA 2P48B 3HS0A 1G7HB 2QR0B 3CDGA 4R26L 4QRPE 4YIQA 1U3HA 3CAFA 4N5UA 4HAFA 3V52L 2VDQH 5FGBA 4CW1B 2VUYA 4O2FA 3DETC 4PJAF 3VGEA 4KROB 5DGQA 3LH2L 1IC5H 3R1GL 4HUWB 5JDSA 3VFGL 2CD0A 2PXYA 4O2CB 1K8IB 2RQ8A 3BGMB 3EBAA 3FT2A 2HRPL 3DYPA 1N2RA 4K94C 5JLZA 1AC6A 1QSFB 4NKDA 4YX2H 1CQKA 5DZOA 1YPZE 2HH0L 5E1AA 3VXQA 3P77B 1CDGA 3H9SB 4G8GE 4H5SA 2Z31C 3JVGA 5DYOB 3QP3A 4J1UB 1LP9B 2X2YA 2PO6B 1IQDA 2FH8A 1GGCH 4F7MA 2YUVA 1ADQL 4L3EA 1BPVA 2EH8H 3CVIH 1MREH 2CRMA 2WQ8A 2DLFH 5DEFA 5BS0D 1KXQE 4KQ3H 2Q76B 3UTTE 4FQIL 1BFOA 3DMMD 4NQVA 1E28B 2CKBA 4QOKA 4QGYA 1KTDB 1MCIA 4G7VH 1TCRB 3CXDH 4M3KB 1HHGB 1CE6A 3PL6B 4RGNE 5DMKA 3PGFL 4R97B 1EV2E 3GZKA 2NW2A 2EDXA 2DTSA 1JTTA 5L9DH 5IMOB 5C6PB 4Y2DB 2GCYB 2IBZY 2DQEL 2DWDB 1FFPA 3UTPD 1UCBL 1MVUA 5DEGB 3OKLA 4ZODA 1J0IA 1KT2A 3MXWL 3PP4L 5SWZD 5TDNB 4UDUB 1QEWB 4YBLC 1UKQA 1XR9B 3LHPH 3SKMB 4JZJC 1Z0NA 5KSAC 1RAMA 1D5MB 5ICYB 1MFNA 1LO0H 2P8MB 3DGCR 4TPRH 1GGBH 1CLOH 4LRNH 4HIXL 5GJTH 3RPKA 3MUHL 2YPKB 3BHBA 4D9QE 4PY7B 5E1HB 2Z91B 1U92A 2LABA 3MOAH 2UZIH 4JDTH 4UNVA 5J13B 3IXAB 4PJDE 5H37G 4WO4B 1NGPL 3VFVB 5CLWA 3LN9A 1U58A 3IJSA 4MQTB 2ZCHL 4EUPB 1VFUA 5DJ0B 5B4MC 5HHNB 4LCYB 1JMXA 2ICEA 3FQUA 1EHLH 1AGEB 5J12C 4APQC 3GJEA 3HPLA 1D9KA 4ZO8A 5HPMB 1LE9A 4OF3A 3VXUE 4XPTL 1QSEA 3SDXE 2CKBL 2EC8A 1LD9B 3V6ZB 1J8HD 1PKQB 4DQOH 3QNYA 3N50A 3ARFA 1T2QL 1U8QB 1XH3A 2K7QA 5CD3A 3KXFB 2C3HA 3QUMB 1RZKL 4FQCH 2L4OA 2Z8SA 3AY4A 3ESUF 3NCCB 4X0KA 3MV7B 1B0RB 1W72H 2FO1A 5DRWA 4U49A 4LLYB 2CLZA 1D5BB 3QIUC 1C1EH 1HHJA 3TYGH 2XA3A 4JRYB 5EBLB 1MRFH 1S9XA 5TDPA 2VXSL 4J3TA 4HXAL 4JHAH 4O5LL 4QXWA 2HAZA 3EIFA 4TTDC 1DP0A 2I24N 4U3CA 5EU3A 1OSZB 1HKLL 4OD1H 5MP6L 2BVYA 1G6RA 2FGZA 5DRNB 3GSVA 5FECA 1FFNA 4DW2H 1QTYT 3GBNH 3QUZB 1UADC 5F9AC 2OZ4A 4GAGH 3C8KA 4YHLH 3I2CH 4OFPA 4Z0BH 4OM0H 3NPZB 1U2HA 2DQFA 3RTQA 1RUKH 1IQWH 3ZKQD 3RY6A 3MACL 4LSSH 4E41B 1TVHB 2E6PA 4CGTA 1DLHB 2X4OB 3GI8L 4PJIE 4OGAD 2B2XH 1MEXH 3ARGD 2GK0A 3ECBB 4XBEL 1UVQB 1CZ8H 3ARQA 2E7HA 1F11B 5D7LB 2ICES 1XAUA 3QRGH 5D7KD 2ATKA 4R6UA 1UZ6F 2FJFB 3CZJA 4NT6B 2R2BA 4MMXC 3BPCA 4XX1E 4GH7B 2BNRE 5JHLH 3QJFA 1N4XL 2M26A 4WGVB 3SKOA 4YIQB 4MCZB 4NN6C 1ZANH 4OKVA 3W5NA 4JR9H 4Y1AD 3OAYK 4UIKH 5D93B 4N90E 4OD3L 1Q0XL 1KPVA 3Q1SH 4KK6C 3DHJA 3K7UA 3HUJF 3MROA 4XC1H 3GFUA 5JDSB 1JWUB 1AO7E 2IPTL 5ESVA 3H0TB 2ZNXA 1GGYA 4P2QD 5DMGD 3NCEB 4X6BA 1G6RL 3FT2B 2B4CC 1UB5A 3L3OB 3MLSH 4XXCA 1X5YA 1T5WA 1SYVB 2A83A 4LRIA 1XF4B 4M6NH 3MJ8B 4NKDB 4Z8FH 1DBBL 4M9PA 5JPMB 2OZ4L 3V0AC 3M45A 3S5LA 2HTKC 2YPLE 4UT7L 2CDGB 4OZIA 2FEDC 2OBGA 4H1LB 1W0VB 3FOLA 4OJFL 2R0ZH 2XTLA 4FQLL 4F7MB 1TITA 1G7PB 1RHHA 2EE9A 3U7WH 5KVFH 3BUYB 2IQAB 4RGOL 3PV6A 4V1DA 4DTGH 4R90H 1YC7A 4GSDL 3GRWA 1JPST 2PF6A 5AEAA 1K85A 1I1AB 4JFDB 4ALAL 1QRNE 1WAAE 2H1PL 1G0XA 4Q9QL 4KJPC 3KPOB 4LSPL 3CK0L 4ZUWA 4R7NB 4DGVL 3JV4A 3TFKC 4LSQL 5EC1A 2VXTH 3JZ7A 1U3HC 3SKJL 2MOVA 4RISH 5HDBF 3KPLB 5BXFB 5KN5B 1LP9F 2Z8RA 4JFFB 5FGBC 1EHAA 5IVZA 5T3ZL 1SM3H 3GKWH 4NYLA 3CFEB 1DFBL 2WUBL 5EBWA 3ULUH 3MNVB 2QSCL 2UUDK 4X6EB 4D0BB 2PXYC 2SEBB 3AFLA 3TPUA 1HHKB 3DETD 2DJ4A 5IT2L 4XNXL 1WBYB 1LO2L 1FRGL 3BHBB 1R5VA 3BP4A 4U6HA 1OM3H 1CGWA 1YEFL 4NQUA 1UENA 2XNAA 3QXTA 4YBHA 4KKAD 2ITDA 5GQBA 4Q7DA 2DWEB 2DB8A 5J11B 4H26B 3BKMH 3UTZA 4HFWA 2EIZA 3R06B 3P9WB 4DK6A 4NGHH 2VAAA 1C12B 1IT9L 1NCBH 5GIRB 1PG7X 1CGSL 3KJ6H 4CN1A 3EYVB 3MUJA 4WNQB 1OGTB 1XF2A 1KN2L 3LMJH 4F15B 3GRWL 4YHPB 2XTJC 3P4OB 3F8UB 3QHZL 5FGCB 4H0HB 5CD3B 1XH3B 5F96L 4PJXA 2VN7A 2IPUG 1NFIB 1X5LA 3HC3L 4RWYL 2DD8L 4G6AC 5M95B 4I0KA 4ZS7L 4RX4D 3O11B 1QP1A 2H41A 4NNXA 4PRIA 1JZ7A 2A6JA 2XG5A 1HHJB 1EXUB 4U3XA 4EEEA 2PTTB 3GSRB 1HE7A 4MD0B 2HFGL 5EU6A 2VDLH 5CGTA 3GMLB 1HIML 4KZEH 5EN2B 3LKRB 3WFBL 5JHDD 4DKFH 4ZFOB 3MRHA 4U6TA 4PGDB 3MRGB 3OKKA 2IGFL 1NAML 3RUGB 4K7PY 4TUKL 4NM8H 2B1AH 5FECB 4TTGA 5KSAD 2BSSA 5HI4C 3V6OE 5JXAL 1KCLA 3OAZH 1ULVA 3QWOA 5H35B 2BJML 5TE7L 1V7MH 1ZGLA 1S7SB 2W91A 3L5HA 2VLKD 3WFCL 4MJ5A 3MV01 5F44A 1JHLL 4FQHB 2LU3A 1AGDA 3VXSB 3KJ4C 4XRCA 5HYFA 1UM6L 1IJ9A 1KLUA 1D9KC 1BOGB 3INUH 2VLLA 5B4MD 2VO5A 5IW6A 1QSZA 1TQBB 3V0VA 4RRPG 3LZFL 3KVQA 4APQD 4Z95L 2GJ6B 3ARFC 1EAPA 3BPCB 3MJ7A 1DVFA 4MZ2A 5ICZA 3AY4C 3D85D 1EJ6A 4G6JH 5GHWH 4AEFA 2HYMA 4UV7L 5T1DH 3GBLA 3JV6A 1IAII 3OX8A 4KHTH 2ESVA 1DLFH 5FYKE 5I6XB 4LASL 1AGFA 4F58L 2NY1C 5IEKA 2QQNH 3JBG7 3KAAA 1H3PL 1OWWA 3QIUD 4OZ4A 3CLFL 3VCLA 1X5IA 3WNPA 2Y4SA 5F6HJ 5CJQH 3TZVA 3DVIA 4L4VA 1P2CB 5EFIA 3DVNB 1GYAA 3JUZA 4PRHD 1HWGB 1WEJH 3EO0B 3C2SA 1QBLH 1LNUB 3N1MC 3L7EB 1A7OH 3D0VA 4K9EH 4TTDD 4XMPL 5E8PA 1ED3B 2PETA 4HIHA 4XCEB 3BW9A 4L8SB 1EEQA 5HBBA 3O6ML 2OX5A 1CLYL 1RZGB 3UBXI 2Q6WA 4OZIB 4EI5A 4ODUB 1LO5A 3VFOA 3RTQC 3FOLB 2D7OA 3RY6C 3LKSB 3BAEH 1EEZA 4GRWE 2D7MA 3C8DA 4LAJH 2H32A 4KRPC 4MNGE 5C09D 3BKJH 5C0DA 4FFYL 4V1DB 2A77H 3BT2L 2GITA 1KTLB 1WIOA 5C08D 3ZMRA 4ZFFB 3KWWB 1BBJB 5L88H 4PGJA 4Q9RL 4PJEE 2VXUH 2D7PA 3VRIA 5JQ6L 2I25N 1HI6B 3SGJA 5BS0E 4G9FD 1ZHNB 3PE9A 2V17L 3MZGB 2GAZB 5EG6C 1KOAA 4O58L 4F37F 3S4SB 1J7VR 1DCLA 4HEPG 2IWGA 4JRXB 3D0LB 3SDAB 2W0PA 3F6LA 3V4UH 4XHQA 1ODAA 4IDLA 4MD4A 2WBJB 4ORGA 1JRHL 3FQRB 1FYTE 1ONQA 5EOQL 5HHOB 5CEZD 5HDLA 3OAYH 1XGRA 1VHPA 2KKQA 4OIIL 5T33L 5JUEL 3CU7A 5T1KA 3UTPE 5F3BB 5KW9H 1TETL 1G9EA 1CICC 2RFXB 1EDQA 3GJFA 5FXCH 3HC0A 3QULA 5SWZE 1I1RA 3BOVA 1PG7H 1NAMB 3PHQA 2R23A 1X5KA 1WWCA 4XP9H 1GVIA 1XGQA 4V2BA 2OR7A 4OGZA 3KPRB 3FFCD 3FO9B 3RWIA 2XNAB 4JAMB 1KB5A 4LGPB 5FDWA 5C0AE 1Q9LA 4Z0XA 2MKWA 4PGEA 3WXWH 2OR9L 4OSUH 2X05A 3GSUA 4LIQL 1WGOA 2YD5A 3FOMA 2LU4A 5ANME 3F7YA 4MWFB 2HTKD 2DLGA 4UTAL 2EDDA 2EDRA 2FEDD 1S7QB 4UU9B 1CDIA 3HC4H 4B5EA 5CP3A 1YNLL 1XF2B 2CSPA 4NDMA 2GSIA 3DTXA 1G84A 1KPRA 2ZPKH 3JWOH 1SJEA 3S34H 4NCC1 1HQ4A 5LGJB 2VOTA 3FB6A 1XGTA 3AMLA 3TT3L 1BZQK 5KG9A 3QXAA 2VKXA 1N6VA 1CDJA 1R3KA 5JDJA 1OAYL 3TNNA 3LEYL 4Y4FB 4MDJA 4JPKH 4JKMA 3C9NA 2R1WB 2A6JB 3PGDA 4KJPD 4C59B 3MRBA 3GB7A 4EDWH 1LQSR 3D6GA 1SJXA 3K8LA 4WW2B 4S1RL 3HZKB 1VGKB 1U3HD 4Z7QE 3BVNA 2DS4A 1U41A 5I1LB 1LEGB 3O3DB 2ERJC 1FH5H 3TO2A 2YOCA 4WTXA 3MC0A 1G9NL 1FC2D 3C5JB 1KEGH 3LN5B 2PXYD 3HI6H 3MRNA 3BH9A 3MYJB 1FN4A 1KB5L 4D3CL 2IH1A 3BIKB 4POYA 1X5AA 5DD6A 3B6SB 1H5BC 3DGGB 1BWMA 1OVZA 3VXNB 1QLRA 3IF1A 2VLJB 3OV6A 1JGDA 1S7XA 1HK6A 1KUMA 1CFQA 5I1KH 4CMHC 3AREA 5DVNA 4BYHA 3Q6FB 4JFHD 4PJCE 4L9LA 4H88H 4IMLA 5ETUB 4XRCB 2YWZA 3DX9A 4L8CB 3EYOB 1YEEH 4F7TB 2BHUA 4UOW0 4GQ9L 4L3ED 2V6HA 1NEZG 4R3SA 2BVOB 4WTZG 4C4KT 4XPFL 2B1HL 3SKNA 3FB7B 3RRQA 1VFMA 4Z7NE 3RUGF 5ICZB 4PGCB 3IDJA 4QOKD 3CLEH 2FL5A 4LSRH 1WFOA 3RHWF 4HK0B 1OAUL 4QRUA 4TSCH 4KTDL 3FQNB 2LTQC 3OXSB 2VDRL 1NCUA 1A3LL 5ID1A 3MTRA 4G6AD 3RVUD 3EO9H 3AAZB 4YO0A 4M6OL 3FO2B 5F6IB 2EDKA 3QAZB 1KJVB 1YQVH 1W2KT 2JCCA 2VMFA 3GMNA 4BQ9A 5ALBH 5E56A 4WFFE 2YMXH 5TF1H 2R15A 2HKFH 4XPBL 2OTWA 4M1GH 3VRJA 1BVKA 2BVQB 4P2QE 4H20H 7CGTA 1NPUA 4GMTL 4S0TD 5EUOE 4U1LA 1LE5A 4HS8H 3U4BL 4JO2L 2QADC 5HI4D 4AIOA 4OFYD 1EEZB 2FZ3A 3ZTJH 1KCVL 1U6AH 2VDNL 5KSBA 2O5ZH 2GEEA 1AQKH 4X6FA 3D3VB 1P84J 4GXVL 3QO0A 2VDKL 2DQGL 2R29L 4PJ9A 4EN3B 2VUOA 5D7IA 5JMRA 5GS2H 1UG9A 1BF2A 3VRIB 5TPWL 4NP4L 2OTUA 3D1MC 4QTHB 4XCNA 3QUYB 3X17A 2F8OA 3QCUH 1D9KD 1A0QH 5E9DA 4WFGE 2HLFC 1D3CA 1EO7A 5KSVB 2G2RB 1DVFC 1QSED 4QXTB 2X4PA 3H8NA 1DE4A 3ARFD 4AIZB 1X4YA 2IAMA 4HKBB 2FB4L 3F7VB 3VFPA 5DD3H 5SWQB 1MCBA 1FZJB 1IEAA 1XGRB 4B0MM 5EZOL 2EEAA 5AZ2L 5T1KB 2NY4D 2I27N 3ILPA 1WTGT 3TZVC 4HJ0C 4R0LB 2BC4B 5HHXL 2NY1D 5D70H 4Z77A 4P2RB 4XP4H 3VH8G 4J8RA 3TJEH 4AT6B 1WBZA 2XICA 1FDLL 4M1DH 2AXGA 3VXRE 5HGBA 1I4FA 3MLYL 4MD5A 3CCHA 2R8SH 5BRZB 3ZTNL 5IESH 3O4LD 4NZRH 4CU7A 4LCWB 3H2WA 4EI5C 5I1HH 1ZA3A 1G7IA 3GSUB 1DSFH 3I6LD 3HNTH 4OTXL 1KLGA 5GS3A 3W11C 2PTUA 1D5XB 2ZKHH 4LVEA 3WCYA 2BCKA 2FWOA 5CINH 3U6RB 1CD0A 4GKZA 5I75C 3RTQD 5E8OB 3TIDA 4ZD3H 4DVBA 4Q6IA 4KQ4H 3CFJB 5L6YL 4MDIA 4UAOC 4KRPD 1CD1A 1MCCA 5JW5A 5I73B 2CLVB 4U6XA 3SGJC 1X7QA 4B53A 4LU5L 3L95A 3FN0H 3SO3C 2R4RH 3EGSB 1U8IB 3REVA 3G5YA 1X4XA 2XWTA 4UINL 3WEXB 1C5DA 2P8PA 1I8IA 5HDQH 4CNIA 5LBSL 1AGBA 5EORH 3ALXA 3PGDB 3WLBB 4RGMB 2HMIC 5KZCD 1GOGA 2OSLB 1DTUA 5EC2A 4PJ7B 3B9VA 4HUUB 5I71C 4C83B 5DHYB 3UJIL 1SMOA 1LO3L 1BVLB 4HWNA 1U8KA 4U4BA 4OCYL 5GGSB 2C3XA 2XPGA 3FRUB 5BVJA 4XX1G 5HHPA 3L5JA 3NAAH 2FR4A 4Q9BA 3U4EA 4JGMA 5I19L 1LHZA 1MFDH 4HF5H 3QDME 1CICD 4HBCL 1OLLA 1RMFL 4O2EA 4X5WA 4C4KO 5JHDE 3BH9B 4Y1AB 5GXBB 4QHKJ 2A0LC 2ITCB 3SDCA 1FN4B 2Z35B 1P4IL 3TN0C 2X4SA 5JA8B 4HGMA 3IF1B 4HWEL 4OD2B 1BVZA 1GZPA 1T0NA 5BMFL 3TO4A 2BSTA 1MELA 1NMBH 3KR3H 2AJVL 4I3SH 3KPPA 5T1LA 4Y88A 3ZE0E 1OOAA 1QSFE 3LD8B 4WW2F 2VR5A 2FX9H 2VLKE 5C0CA 1OPGH 3TM6A 1JZ6A 3RKDD 2LE9A 3NFSH 4LF3B 2DQHL 2IAND 1R3LB 3G5ZA 2VTFA 4MNQA 5I1DA 4Y0GA 5HHMD 1F90H 3NTCL 1CF8H 1P7QA 5C0GA 1TNMA 3P2TA 3ZTJG 1NCDL 1T21B 1KEML 2ZOKB 3OG6B 5FYKH 1MF2H 4JZOA 4ZTOH 3KS0H 5DF0A 5ID1B 4XH2B 5I1GL 4YO0B 1TTUA 1AKJA 4G6FD 2Z0BA 1OAQH 1FSKB 3UJJL 5I30H 1MCQA 4KJWC 4N8VA 3SY0A 1QFUH 5IK3A 1TJIH 3PJSA 1BGXH 3TWCH 4P3DB 5CJOL 2MMXA 2E7CA 1K4CB 2OTWB 2W9EH 3MOQA 2OK0L 2R9HC 3IU3B 4WJ5A 5IMMB 4Z76A 4YHZL 3ABZA 4XNQA 5DWUH 4S1SL 1KXTB 2AGJL 1Q0YL 3I50H 2EH7H 3BN9C 3RGVD 5HTSA 1MHHA 3GMMA 3EOTL 3BKCL 4ZNCD 4GRWH 2FZ3B 1BLNA 4UTBL 1YEDA 4X7CC 3AREC 5J6GB 1QG3A 2OXHA 3AU1A 3G5VA 4L9LC 4PRNB 4X6FB 2CMRH 2J8UF 4RFEB 1UZ8A 4JO3H 1X5JA 1T1XA 2ADJA 4NQEB 4ZYKA 4QGTA 4NPYA 3K2UL 5D7IB 1LEKA 4F7CB 2VDOL 2BY1A 1NFKA 4QYOA 5DHVA 5C09E 4ELMB 4M48H 1XGYL 4JZNA 4KJQC 3IDYB 4LPYA 1MWAA 3LKPA 3DV6B 5C08E 4XP1H 4LEOB 1FNSL 1NC2A 4P23B 3OGCA 3F7QA 3LRHA 4M93C 3CFCH 3WHXB 1ZT1A 5FYJL 3O45A 3UYRH 5F9DC 3GM0A 2IAMB 2BVUA 1RIUL 2ZNWA 1TXKA 1FYHB 5B39G 3W0WA 3ROOA 2DQUL 1XZ0A 3WFDL 5DUML 3VFPB 1LK3H 3N85H 1RD6A 4HHAA 4GW4B 3RDTB 4PRID 5D5MB 1FVCB 1WCQA 4JPVH 5IFHL 1N8ZB 3K3QA 5B21A 1WTLA 3MV7E 4AG4L 5EU6D 5SX5K 1F58H 3NPSB 4PPTA 1I4FB 2FHCA 4JRYE 4UUJB 1XCTA 4XMLH 3CVHB 3TIEA 3MNZB 1ZKAA 4HBQA 3RBGA 3I75A 1TZGH 1ZA3B 1NLDL 5F7NC 1KLGB 3TNMA 3WIIL 3HAEB 4PJHF 2XFXA 5C3TA 7FABH 3VFSB 1AHWA 3TIDB 2XY2A 4F2MB 5D6DA 4M9OA 1QR4A 2XKSA 4YDKL 3ZKMC 3QG7H 4NQTA 3QZWB 4PJ9C 3W9EA 2Q3ZA 4E5XA 3VW3L 3H3PH 3U9UB 3QEGL 4YK4B 2ZUUA 3UYOD 4U6XB 2AI0L 3MODL 1MWAL 2V7HA 4GS7C 1CK0L 1FLRH 3G5YB 1EJOH 2XWTB 1NANI 5B22A 3O3AB 4M4RA 5I76B 1I8IB 4L8BA 3UJTH 4QRQA 1AGBB 3K8KA 4FQ2H 1F5WA 1YA5A 5CUSL 2HLFD 3V5HA 5CEXB 5HHVL 1CLZH 4N68A 1G7LA 2NY5H 1OHQA 2NW3A 4IEFB 5D7LE 4RZCA 4D9RE 2EICA 4N5ED 2BNQA 5EO1A 1MLBA 1RU9L 1ETZB 1A6UH 1MFBH 2PYEB 1K8DB 4U0RB 1EO8H 4X4XB 2ESVD 4HK3N 5HHPB 1NDGA 4AENB 2VN4A 2P24A 4EOWH 2PR4H 1UACH 2XA8L 5E6ZA 3D85B 3EDJA 1ZHBB 3OAUH 3S37L 5MEPA 5TFSH 2FECI 3UCRA 5CHNA 4D0CA 4HJ0D 4L4VD 3EFDL 5JQHC 2LFGA 1FPTH 3GBML 2XZQH 4U1IB 3SDCB 4TVSa 4OZHB 1H9VA 2GT9B 5GS0L 1E27A 5HI3C 1JNJA 4YXLH 1JHTA 3O6LH 5F7DA 2CUHA 1XF3B 3NIDE 5F7HA 1T0NB 4Y5YA 5ITBH 5F88A 2R1YB 4K23H 2P45B 4EI5D 3L3JA 2I07A 1VEOA 4JO4H 5I1EL 3MGOB 3RBSA 1Q94A 5AWNH 4PJ7F 5IHLB 1RY7B 2NXYC 1RJZA 4Q6IC 4GG6F 2D4DA 3IETA 1ZAGA 1I1FA 5ITFA 2EYSA 4NN7B 3MZTA 2DM7A 4CMMA 4P2OA 1HILA 4LSVH 5AZEL 4L3EE 1MRCH 2VLRB 4UV4L 2X4NB 3RY4A 1E6JH 3MCLL 5IOPA 2CQVA 1RZ7L 4LHUB 4JKKA 4LCIH 2XTJE 3W82A 5F3HB 4QOKE 1PQZA 3WS6A 4LMQI 1VKXA 1CVRA 3VD3A 3DRTB 4G9FB 5IBUB 1KJ2H 3VG0H 2YSSB 3SY0B 2HMID 4OZGB 1GPOH 5GRUL 5IK3B 2YUWA 1L7IL 3QO1B 4YC2B 4PRBA 3T0BA 4P5TD 1WC7A 4KY1H 3HI5L 5DVLA 4MJ6B 4NJ9H 2J7LA 1O7VA 3PWVB 5E2UL 3N1FC 4Z76B 3VGAB 4YX2L 5LCVL 5ADPH 3FT4B 4V2CB 4HGKC 3O2WH 1J1PH 4AH2A 1K6QL 2DTMH 4UBDD 2OI9B 4HZLB 3QNZA 2DMCA 4LPWA 2A0LD 1IRAY 4RMRA 4XNZB 1TJHH 3TO4C 1EEYA 3TN0D 1D6VH 5CBEB 3SGDI 2H6PB 4BA8A 1IBGH 5C0FB 3W9DA 4ZAKB 1T1XB 2DLFL 4CVWA 3TT1H 1FJ1B 3NBNA 5KVGH 4KHXH 4GQPH 3RWGA 3T3PF 5D1XC 5K9KA 1J10A 5ESAA 4UOW1 1NFDF 3T2NL 4K7FB 1IEBA 4O51B 4QY8B 3LKQB 3OKYA 1NC2B 4I2XA 1FORL 5DRZA 3AB0C 4PJBB 3P4MA 3JV5A 2V7NB 2QHRL 3BH8B 3DSFL 4MXWL 5F7YC 1HXMB 1GHFH 3EJYD 3I9GH 2O5YH 1WUNT 3DVGB 3OKEB 3W0WB 5EDXA 1ZHKB 1QSEE 1QPPA 1BZ9A 2IADA 2VL4A 2P5WB 4BK4A 3D5OF 3I6KA 3TBWB 4I0PA 4YPJA 5EBMA 1MAJA 4OQTH 3ILQC 1R24B 4OQ1A 2Z93B 4A6YH 4LGRB 4M7ZC 3TBYA 3KLAA 4TRPH 1AIFA 4TPRL 1CLOL 1C7TA 2R0KL 5GJTL 3S88L 4KJWD 4ELMF 4PTTB 4KKBD 2QKIA 5FUZL 5HXMA 3VGDA 1T6VN 5IHZB 1H3GA 5DUPH 1K5NA 2P8LB 3AUVA 1UA6L 1AD0A 4JDTL 1RJCA 1I3RA 3H9YA 3E6HA 5D7JC 4S10A 5EOTA 1TFHA 2R9HD 4JN2A 3V5KB 43CAA 1FP5A 1I9IH 2HG5B 3CPLA 3SGKA 5IQ7L 4MB3A 3ZYOA 3BN9D 3IGAB 5J0BA 4DWHA 2O93L 5I15L 4Q2ZB 3T4AA 5HY9B 3GMRB 3PDOA 5JZ7C 2OMNA 3LEVL 5CIPH 2YD7A 3ARED 2HKHH 4LCCB 1NMAH 1KG0A 1M7IB 4OV5A 4ZTPL 3IJYA 4CAGA 3MLVL 4HCRA 4N0RA 4HQQH 4S1QH 3EYUH 1KN4H 5GISH 4D8PA 3V5HB 3RU8L 1UB6B 3BD3A 4ONGL 1R0AH 1G7LB 5HJ3A 3GSWA 5E8DL 1KCUL 1M71A 1MRFL 3KPQB 2BNQB 5EO1B 3DIFA 4M8QA 2EO9A 4BQCA 3DX7B 4F3FB 4ZUVB 3RWJA 5C7XL 1U95A 1A1MA 4HUXB 1BZ7A 2HT2D 4ZUUB 3RWHA 5DQ9B 3B9AA 1MY7A 4FXLA 4XP5L 5CHNB 4FRWA 5DUBA 2VH5L 5SX5H 3VXMD 1A7RL 3CX5J 3H7BA 3T0WA 4RRPA 3ZDZF 5T3ZE 2D31A 3LKOB 4M43H 5GS0C 2HFTA 5GZOC 5D9SA 4LSUL 4RDQF 4UDTA 1G7QA 3OKOB 3X3FH 4I3GA 3C08L 3QJHA 3WN5B 1MIEH 3UBXB 1GC1C 1GGIH 3ORJA 3BP7B 3MLWL 4NQSA 3B9KA 2O5XL 4X98A 5I74C 1AHWC 4U2YA 2B2XL 4KKCC 4UZGA 5D6DC 1DBAL 1J88A 2X10A 5DJ8A 1JPFA 4HDIB 3OJDB 4KXZH 4OZIE 2XQYK 1IGJB 1N5AB 4PB0H 1BWWA 2WWKT 5J1AB 4BSVA 1HILB 1RUMH 4JANA 3ZKMD 3T08A 3KPSB 4RNRA 2DIAA 4HCRL 5FUCE 3A6BH 4LLWA 4Y19D 1FE8H 1OSPL 3CZFA 5IOPB 3K4DA 4MHHI 1FZOA 4HMCA 4OZHF 4V1DE 5C07B 1JYVA 3S9DB 1UYWH 4RCAA 1VFAB 1S7VB 5E9DD 5INCB 3BRDA 3EZ8A 5HDOA 1L0XA 4FXGB 4TNWK 4TNVK 1IGYA 4LVNB 5HHME 4QRRA 1F4WL 3RVTC 1NGZB 1TVBA 2UVEA 1AQDA 2YC1A 5HYSB 3HZMA 3CFBB 1NCTA 1O7SA 1J5OH 2G9HA 3OF6A 1LDSA 3Q0HA 1WC7B 1S7UA 5DI8A 2IH3B 3IJHA 3TV3H 4WUUB 3DV4A 5FV2A 2DYPA 2JF1A 2V5MA 4ODHL 3U36B 4M7LH 4OCXL 5CSZA 5TH2B 3BEWB 1DQTA 4N1CA 2XZCH 1ZT7A 4HWBA 4H0IA 5DRXA 3NCYP 3TEUA 1OW0A 1N6QL 1VPOL 4GW1A 2Y06H 4YDLC 1BEYL 1FNEB 2NY4B 2R69L 4Y5YC 3O2VL 1RQ5A 2BDNL 1RZIA 1MFAH 5HI3D 2F8VA 4N0YH 1A47A 1FZMA 1RUPL 2BOBB 3C2AL 2MCPH 3LDBC 3PWLA 1Y18A 3RAJL 3ARPA 4AK1A 3IVKA 3AS2A 4DTGL 2AABL 1YNKH 4OV6F 3L3IA 5C0IB 3ME0A 4DZBA 3SGEI 1A3QA 1P84K 2VQ1B 5DLMH 4JFXA 3D87B 4OZGF 5INDB 1P4BH 1FL5A 3T8XA 1DQMH 3OPZH 2NXYD 4CJ1A 4P2OC 2E7LA 1BQHB 2VXQH 2W65A 1MHCB 1OF2B 2CIKB 4OF6A 5IFAH 4DN4L 1X5XA 1OTSD 5LAXB 4R2GB 3Q6GH 3WS6C 4MYWB 3I6KB 1HINL 4JY6A 3WKNA 1AI1L 1JWSA 1SM3L 5EBMB 2ZCLL 4KZDL 4PJGA 1U9KA 1FCGA 2FCBA 3AM8A 3O6FB 1A6PA 4R26H 2YD9A 5E94A 1D5ZA 4YDJB 4PRIE 2QKIB 3V52H 5JOFB 2A6IA 4GAYA 2XZAH 5HD8D 2APFA 4HIEA 5J9PB 3LH2H 3R1GH 4E42A 3VFGH 2HWZL 4HWBL 1BF8A 2D4FA 4CN4A 1I3RB 4PJBF 5EOTB 4JG1L 1CXHA 3QDAA 2F54D 1PFCA 1DL7L 2HRPH 3BJ91 2AK4B 4P46A 3F6IA 5D1QC 5CSBA 1S8DA 2DF3A 3IDMB 2D9CA 4ETQB 3C60A 1DJSA 1HHHB 4AEHL 1FNGB 1QO3A 5TE4L 3STLA 4MAYA 2DRUA 5T1LD 5I1AA 4J4PA 1G9MH 5DJAB 4L1DA 4LARL 5C0CD 1RK1A 1ADQH 3WJJA 5D1XD 1I8MB 2Q87A 4MNHA 3BRFA 3KPMB 2YD1A 5EULV 3LIZL 4LLDA 4FQIH 3VMOA 2UWEA 2MSPA 3HZYA 4ONHB 5HJ3B 4MNQD 2NLJA 2K3TA 1J1XL 2ZSWB 1SJHA 1JNHA 1P7QD 5CILL 1T1YA 5FYJD 4I0PC 4WEMB 1KFAL 3PGFH 5IM7B 3DJ9A 5CWSA 1U95B 5GRVL 4KZEL 1A1MB 3NCJH 3QNXB 4MJID 1AKJD 1L0QA 2E8YA 1INQB 1MLCA 2DQEH 3VDCA 1KLFA 1UCBH 2Q7NA 5D6CA 3ILQD 4JO1L 2B1AL 5DMYA 2ESVE 3C6LA 1NEZA 2X1OA 3MXWH 5HVWA 3PP4H 4ODBD 3H7BB 2E7BA 4WTZA 1RVFL 2D31B 4IOFD 1RIHL 3GI9L 2NY7H 1A4KB 5KS9A 4L4VE 2ZP0T 1AD9A 1MSPA 1NC4A 3MGAA 3ZHKA 1ZTXL 2CJUL 3RI5F 5JOEA 3OQ3B 3FQWB 4HIXH 5DK2B 4IM8A 5KANI 4NQSB 5D2LA 3SGKC 4I18B 4PB9L 5D7JD 2XQBL 4NCDA 1FV1B 4ZSOB 4GAFB 5C6TL 3E6FA 5F1SA 3UTTA 2AEIT 1KC5H 1UM4L 5D96C 1HHIB 4GW5A 3ALWA 1NGPH 4OUOA 4G8IA 1R5IB 4ZQKA 2ZCHH 4LIQE 3RGVB 3BZFB 3VE0B 5JZ7D 4LQFL 4HW6A 4MS8C 5BCAA 1BIIB 4LLWB 1XMWA 4M3JA 1X6NA 3VA6A 5T1DL 4TUOB 4XPTH 1KCRL 1IGYB 5CLTA 2CKBH 1UFUA 1T2QH 2P5EA 1BD2D 2AS5M 2MQCA 1AQDB 1RZKH 5DZLA 5CJXA 3DO7B 3UTOA 2JJUA 1KENL 1HWHB 4ENEC 4MJ4A 4LVOC 2Y5TA 5BQ7B 1OP9A 1S7UB 1QBLL 3C6SA 2I9TB 1Z3GL 2DYPB 1J1OL 2MQ3A 2WP3O 3T0EA 4FXKB 3EYFA 2A73B 2VXSH 1ZT7B 4HXAH 4O5LH 1FGNL 4N0UB 4YBQC 1CFTA 1T1WA 3E8UL 1HKLH 1ACZA 3HR5B 5FFLA 3QDHA 3HNVL 1RZIB 4NKOB 3U83A 3QI9D 4KUCD 3DX6B 4M5ZL 3B9KC 3DO3A 3AS3A 3IRZA 4ZS6C 2NXZD 1S9YA 2HJLA 2EXYC 5I66B 3SJVD 4DZBB 1TZIB 3C5SA 5BRZE 3SE3A 4KV5F 1PZUB 5JPNA 3ZKNC 2F74A 1RULL 4BK5A 3T77A 1A5FL 2VXUL 3MACH 1CGYA 4RAVA 4KKCD 4JFPA 5GZNC 4ISVA 3T0DA 5A40E 5DXWA 1IAOB 3GI8H 5ALCL 5C0BB 1BFVL 2W65B 2VZTA 4MXVF 2NY2B 2CRZA 4XBEH 1V7NL 2N7BA 2AEQL 4XB8A 2EC9T 4QHMA 1DANT 1T7VA 4IJ3B 2XWBA 2NZIA 3QB7C 4JY4A 3S96B 4P2YA 3BPLC 2NNAB 4JY6B 1ZS8B 3D2UB 1JWSB 3ULVL 3QEUA 2NX5A 1SBBA 2GI7A 3DECA 2ORBL 5FM4A 1XR8A 2VISA 5K93A 3RVTD 4PP2A 2NYYC 2F53B 1D5ZB 2HA1A 5BZDB 1UJ3A 3EFFA 4HGWA 4OD3H 1Q0XH 5C9KA 3BQUD 4XP9L 5T5NF 1C5CL 4LDEB 2FSEA 2YZ1A 4E42B 4MQ7B 5L2KB 3MRMA 2IPTH 3ARWA 3WFZA 1OW0C 4YHIB 4PJ5D 4JREC 1JI1A 1FG2B 3RWCA 4OSUL 3B2UC 2A9ML 2JB6B 3G6JF 3D39A 5IJKA 4LLUA 2LQRA 4KK8C 5EO0A 4GAJH 2ID5A 3V4PL 4PJIA 1DBBH 1T2XA 2CDFA 1RK0B 2AP2A 4LPTA 3TH3T 2KZ1B 1S78C 1EFQA 4UT7H 2ZPKL 1TENA 2EYRB 2APBA 4JPWL 3BDBA 4OJFH 5DJ6B 4FQLH 5FKPA 4G8EA 2V2TA 3T0VA 2E7LC 1B4JL 1C5BL 1U8MA 2WZPD 1MJ7L 5GSRB 4ZFZB 4GSDH 3U30B 4YHOL 5DJYA 2DM3A 1EZVX 3B5TA 1NKRA 4ALAH 4L3CB 5JR1L 2NLJB 3F5WA 5DD0H 1P1ZA 2GYSA 4JQIL 5J6HA 1HXYA 1R3HA 1AO7A 3BWUC 4D9LL 4K2UL 4X6DA 4Z5RB 1EERB 4LSPH 4GOSA 1OARH 3CK0H 4KK5C 4PLJC 4XCFL 4AEEA 4RFNB 4XB7A 4NBXB 4DGVH 3AM8C 4LSQH 3NIGE 4YGVB 3WFEL 1B6DA 1LMKA 4JHWL 3HI6L 1XT5A 2H26A 4MB5A 5T3ZH 4LLMA 6FABL 2XWJB 1DEDA 1V3LA 3GJFK 1DFBH 2EDOA 2WUBH 3T3PE 3TVMC 1I9RL 2QSCH 4X6CA 3GUTA 5H2BA 3PGCA 4U1JA 3O8XA 4JEGB 2XKNB 3IFLL 1ZXQA 4NKMA 3SCMB 4XNXH 4NO5B 4P46C 5IT2H 4ODVH 2C7UB 1LO2H 1FRGH 4NZDA 5B38B 2QHLA 2WAHA 5BVPL 3C60C 1YEFH 2YA0A 4Q6YA 3QUXA 1YEEL 1EMTL 3DXAD 5D1QD 3PXHA 2VZ3A 4OLUL 5E4IA 3O41A 4MAYC 3CU1A 2VZVA 4G8IB 4J4PC 1ZVHA 3O0RL 5IB4B 2Z8VC 1IT9H 3WJJC 3QUKB 5BJTB 1CGSH 1YEHL 1NBZB 5HGAB 3SDDA 5KSBE 2GSGA 3VWJA 3CLEL 3BYTA 1YN7A 4Y4HB 1KN2H 3GRWH 4NO0A 4X8XA 4DCQB 5F93C 4HIIB 2YK1L 5D7IE 3QHZH 3QHTC 4PJ8B 5F96H 2E9BA 2QQLL 5FV1L 3MFGB 4P48A 1CCZA 5IJVA 3OR7A 3HC3H 4RWYH 1T04B 1YQVL 2YD2A 1XCQB 1TVDA 1CXIA 3VI3F 3SEPA 3WE6B 2XQYG 2RIKA 4I0PD 5JA9A 3GIZH 1ES0A 2M8XA 5CAYB 2YMXL 2HFGH 3C6LC 5FM5M 3X11A 1YECL 4LAQL 3MRIA 32C2B 3V8CA 1HIMH 1T1WB 5D5ME 4Y2OA 3WFBH 1JP5A 1Q9WB 2ZOLB 5DSCB 4PG9B 4O4YL 4M7LT 2V2WB 3FQXA 4NRZA 1MPAL 1NAMH 1H3WM 4M6AA 4QNPF 2XXMB 1T83A 2ARJQ 4LP4A 5C0JB 5JXAH 1OTUD 4EDXA 2HVKB 3O4OC 2BJMH 4EI6A 5TE7H 1VFBA 3H42L 4PJFB 4X4MA 3PXJA 1JZ2A 4IRZL 2OTPA 1HDMB 5E2TL 2YEZA 4RAVB 4JFPB 3MRPB 4ISVB 3WFCH 2X42A 1CE1L 2P42B 3BD4A 1JHLH 3WS3B 4IIQB 1T80A 1P7HL 3V6FA 1NBVL 1DANU 1KACB 2VR4A 4MS8D 4AEIL 2JELL 2YD3A 3E2HB 3P73A 4OCSL 2ZUQB 4Y16D 5HI5C 4QHMB 5ADOL 3O3BB 5IUSA 3BJLA 1JN6A 5D8JH 2RCSL 3LZFH 4ZPTB 5DD3L 3DBXA 4JM2B 5E4EB 1QNZL 3ULVC 3QDGD 5CJXC 1M05A 3FT3A 3B3IB 5FHAL 3X3GL 1P4LA 3VXOA 4L4TA 3ES6A 1BQUA 4UV7H 3VG9B 4YZFE 4WW1A 3TJEL 1EO5A 1UJ3B 4OLXL 2NTFB 4LASH 4ENED 3V6OA 4F58H 4KI5D 4OF8A 3T0EC 2IMNA 2ZSVA 1MCWW 4M6ML 5GGQL 4HXBL 1IMHC 1H3PH 2R8SL 4MX7B 1A9EA 4NWTL 5EIQA 3W2DH 4CVZA 3CLFH 1IEHA 4S2SA 1J05A 2ADIB 5I1HL 2CXGA 1MCRA 2GFBA 4HMDA 2PYFA 3HNTL 5EO0B 3KYNB 4YBQD 1FC1A 1Y6MR 2Z4QB 1KPUA 4XMPH 3PQYB 5LGKA 2LV4A 4M8VA 2WUCH 3DI2B 2ICWB 3O6MH 2FD6L 4U1GB 3VXMB 3LRGA 3PWJB 4R4NC 3ESVF 3SE3C 3MUGA 1IILE 4ZS6D 3HLAB 1RPQA 4P2CG 3QDJA 1GOFA 1HN1A 1BHGA 3MNWA 5IB3B 3BPNC 4JQVC 1RZFL 2R4RL 4P0DA 4CVXA 4EQ2A 3ZKND 2ZG1A 4FFYH 5FF6A 2AV7A 3BT2H 3ARDA 1FBIL 5MENA 4R7DB 1WWBX 5GZND 2B5IB 1T7YA 5C0CE 1KIQB 4WCYL 4Q9RH 2AAVA 5EUKB 1HYSC 5JQ6H 4LOUD 5BO1L 3S5LG 1YYML 4LSTL 5IV2A 1AXSA 3IKCB 4O58H 1TZHB 4MNQE 4HKJA 2VLMD 1I7TA 2PW1B 3IXTB 3MRFB 1H0DA 5DFWH 5FYJE 4H25A 1HZHL 4OBRA 3ZE1F 1JRHH 1S7RA 2OL3B 5EOQH 3RFZC 1MFCL 3Q2CA 3TCLA 5KAQF 3KLSA 4HH9A 3OF6D 2RBLA 3B43A 1DQDL 4OIIH 3CFIC 1RUAL 5JUEH 1TETH 25C8L 4X6CB 1JUFB 5GJSL 3CX5K 4GBXB 4U1JB 1R5WA 5L0QB 1S7WB 1U3ZA 3S4SG 1IGFL 3DROA 4JY5L 1NMBL 4I3SL 2CIIB 3AVEA 3MRJA 2X41A 3B2UD 1QFOA 3ZT5A 4CUCA 4GRMB 4AM0A 5FOBB 1T89C 2P7TA 3V9FA 1CD9B 3REWB 3O41B 4PJEA 2OR9H 4ZO9A 3AXLA 2H3NA 3F12A 4LIQH 3QQ4A 3KPTA 3L3DA 3OWEA 2AJSL 4BUHA 1S78D 3GMPB 4K71C 1GZQB 2H32H 4QRSB 4UTAH 3MJGX 1FVDA 4NRYA 1YNLH 3QQ9C 3HE6C 4FQ1L 2VJXA 1NH6A 1RI8A 5IF0A 4C54A 2AK1L 5DURD 1YEJH 3TT3H 5DR5L 5GRXG 3CJJA 3RIAK 2V5SA 3WUWB 2B7DT 2PCPA 2WQRA 5IBTL 1OAYH 5I30L 4HK3J 2N7AA 4PY8I 1S3KL 1Q9KA 3UPCA 2XKUA 4OFVA 3PWPD 4NZJA 3DUSB 3HB3D 3RVVC 3W0WE 4NO3A 4PLJD 4W6YB 1ZT4A 5C3LD 4S1RH 1LK2A 4X7SL 1QLEL 1GIGL 2P5WE 3BMWA 4N9GA 5C0AA 2WWMC 4NHUB 1FZKA 2GUOB 4ZUTB 5ERWA 2EH7L 4X7DC 2VSCA 3HG1A 3GJFH 1MHEB 3O8XC 1G9NH 3FQXB 4NRZB 4YHNA 1AXTL 3TVMD 2H45A 5HYJA 2D7NA 2EEDA 1I9JL 4NWUH 1JPGA 2LVCA 4RIRA 4D3CH 1KB5H 5J89A 3QUXC 2K7PA 4P46D 4BH7A 1QA9A 3T4YB 1SEQL 1A7QH 1WCBA 3QFJA 3P9LB 3C60D 1P69B 1U91A 4PJAA 3WV0A 5FM8A 5I2IA 2F54B 4BJLA 4NZUL 3SDDC 3V6FB 5B3NA 4J4PD 1T1ZA 4PS4L 4QHNB 3VWJC 5CP3H 5DQDH 1G6VK 5FA4B 4GQ9H 5AYUL 4PRDB 3BZDA 4XPFH 2B1HH 8FABA 4QRPD 5GSVB 4DFIA 3BXNA 1TQCC 3OKDB 1NLBL 4JPVL 1A22B 3J7HA 3L5XL 3VXOB 1OAUH 4KTDH 1VB9A 4CADB 2VDRH 1A3LH 1NGYB 4PJFF 3WIFA 4U1SB 2DL2A 4M6OH 3FMGH 2BNQE 3ZZ1A 1CXFA 1QQDA 3B9DA 4CVZB 4U1HA 1J05B 1JGUL 2MQ0A 4WI8A 2PUQT 2WIIB 5E6ID 5JMOC 5D1ZA 2Q8AL 3L3KB 1QACA 2EDEA 1KPUB 3MA7A 1HQRA 4XPBH 1EFXA 1T83C 1DQJB 2A74A 3K4AA 5IGXL 1MCKA 1YDPB 2V9QA 3GMQB 4HH8A 4JM2F 4GMTH 3MUGB 1Z2KA 2V2XA 3BGFC 3RVXC 5EU4A 5TDOB 5F72S 5AAMA 4JO2H 3U4BH 5CBAB 5MI0C 9CGTA 1ZEAL 2P1YA 3UTTD 2UYLA 3L6FA 1F6AA 3C5ZB 2Q20A 1DUZA 1FLRL 3NH7H 2BZDA 2OXGA 3GIVA 3TYFB 4GXVH 5L8KB 1AH1A 3ARDB 1YNTB 2UZXB 1KTKE 2VDKH 2DQGH 3EW3B 1A14L 5GGRA 5IQ9A 4Q58C 5TQ2L 2I9LB 1ZSDB 3N06B 4RGND 5SV3A 5TPWH 4JFEB 4NP4H 3X14A 1ZHLB 1YJDL 5IR1B 3NCYS 3QEQB 5HI5D 1CGXA 1MFBL 4PGZA 3VFMA 1KJ2A 2RHEA 1V3JA 4AIXA 4N0CD 2P5ED 5JW4M 4NQDA 1Q9OB 2JCCF 3IDNA 3NFPA 3ULVD 5C07E 1FO0A 2FYYA 4LP5A 2FB4H 4LBEA 1DN0B 3V6OC 5B3JE 1E6OL 2Q86A 5ICXA 2XZQL 4OAWA 5EZOH 1UXSB 1JYXA 1X5GA 1BD2B 5AZ2H 3WLWD 4FOMA 5J7CC 4PIRF 3A67L 4XGZA 2BRRL 3T0ED 5HHXH 5IB5A 2X89D 3ZKXB 2NCMA 5FYLL 1MCEA 1WLHA 3HFML 2VDML 5FO8A 3MRJB 1FDLH 1MI5A 3NFNB 4WUUE 5K59F 1DBKL 5F89A 5EZJA 4BSWA 4AM0B 3AMKA 3I6GA 3ZTNH 1C08A 2B8OT 3CDYA 4YDIL 1FL3A 4OTXH 3KPNA 2D2OA 2VB5A 1YY8A 2KL6A 4LSVL 4R4ND 3VXUD 2W92A 3QI9B 4Y4KA 4OLYL 1FVDB 4NZTL 4NRYB 3NN8B 3CSYA 3ROLB 4QWWC 3MMEA 4JN1L 1YMMA 1T5XB 5L6YH 2NXZB 4QO1A 1HCVA 3VRLF 3IU4L 1PYWA 4X9HA 1QPXA 1F4AA 3OZ9L 1G1YA 1CFNA 1N0XH 3QHFL 3QIWB 2CUMA 5HVGB 1U8JA 4UINH 3FL7A 4OGYL 3VG0L 4I2XE 3KDMB 4QRTA 1HYSD 1GPOL 2GTZA 5LBSH 3V95A 5L2JA 3VWKA 4BKLA 4FA8A 4JFQA 2NX5D 5KSUB 1FO0L 4JLRA 1CXKA 4NO3B 3IFNL 4NKQB 4Y89A 4KMLB 1IM9D 3UJIH 2QBWA 1LO3H 3NIFF 5F1NB 2DTML 2V5RA 1T0PB 4OCYH 2PW2A 4G6ML 4JFOA 5LG1A 1IC7L 5I8KL 4X99B 4CBPA 5I19H 5F7WC 5HYJB 3SO5A 3DURB 4DJMA 2X40A 4HBCH 4GLRI 3MBEC 5IFJA 3BQUB 1XGUB 3CVHH 3D39D 5MEQB 3KYKL 4LLVB 5CIPA 1QA9B 1P4IH 1ZK9A 5KVGL 4KHXL 3EZJB 4FTVB 1W0YT 1V5JA 2BNUB 1OGAB 4HPYL 4PJ5B 5BMFH 3HUJA 3HAEH 2AJVH 2X4TB 2AK4E 1EVTC 4JHBA 1T4KB 5DJDB 3FB5B 1JHKL 3PNWA 4DUWA 4LFHG 3HPJB 3VFTB 3BZEA 3MV8A 1S9WA 4H8WL 1D5IL 4MB4A 2BNRD 4HD9A 5IP4A 3VGGA 4DK3A 2DQHH 5J3HC 3QQ9D 3HE6D 4BFIA 1ND0A 2VRAA 4CL7A 3MLZL 1C16B 4BFEA 2FH6A 3NTCH 4JJ5A 4HC1H 4L4JA 3DYMA 2QR0A 1WK0A 1CFVL 4X5XB 1KEMH 4FQXA 3RIFF 1AO7D 3B83A 3BP6B 5I1GH 2UY6A 5C8JB 2Y5EA 4CW1A 2DIBA 3BZ4A 4QHLB 1OLZA 3UMTA 8CGTA 1DUYB 1F3JB 4U1HB 4HUWA 4C56A 3UJJH 1QBML 2IBBA 3RVVD 3PHSA 5FA3B 4B41A 2EIDA 5E7FA 3NOIA 4O2CA 3TC9A 1K8IA 3T1WA 5D1ZB 3BGMA 4PRAB 5CJOH 3V4VL 2WWMD 3P4LA 5EA0L 3UYPA 1IM3B 4PP1C 2VC2L 2YPLD 4KDVA 1BECA 3ZL4H 2OK0H 1QSFA 4YHZH 3O8XD 4S1SH 2AGJH 3MRLB 3P77A 2AXFA 4LVHB 3SOBL 3H9SA 2OP4L 1LDPL 4P3WA 1OD7A 4NQCB 3EOTH 4J1UA 3BKCH 1LP9A 3B5GA 2GHWB 4U7SA 4OCNC 2PO6A 4OB5L 3EOBA 3L6FB 3QUXD 4UTBH 2YD8A 4S1DC 5GS2D 4Z7OF 3GK8L 5IQ9B 2Q76A 3K2UH 3EYUL 5GISL 2VDOH 3V7AE 2XN9B 1XGYH 3RZCC 5HSFA 3DXAB 3ZT6A 1KTDA 3VWJD 1WF5A 4KTYA 3IKKA 4P9HL 5F71A 2UV3A 1TCRA 1FNSH 1YY9C 4NO0D 1HHGA 4ODTH 1O0VA 5IB2A 3PL6A 4P5MB 3ARBC 5F9JB 5FYJH 3V0WL 4N8PA 4NQDB 4WENB 5IMOA 1N3NB 5FM5O 4Y2DA 3W81A 2GCYA 3S8WA 2DWDA 1CQYA 2DQUH 3WFDH 2VLME 4QRRE 5DUMH 4YFLF 4Z7VB 5DEGA 3WNMA 3QXDB 1NUGA 1T22B 2HFFB 5TDNA 2OMBA 4M43L 4UDUA 1W72B 1XR9A 3SKMA 2X4QB 2ATPA 2J88L 5IFHH 1D5MA 5ICYA 4WU5B 4AG4H 2P8MA 3ETBF 5D1ZC 5DJCB 5GGUB 4DUVA 1U8OA 4OT1L 2YPKA 5IMLA 1JF6A 2AV1B 1DBJH 4PY7A 2RR3A 1UXWB 2IG2L 2P46B 2Z91A 3I6GB 5ENWB 1T0MB 1NLDH 4JDVB 5LQBH 1RJYB 4XPAL 4WO4A 3VFVA 3QT2A 2EIBA 4R4FL 4EUPA 1K3ZA 2VSDA 2H8PB 3NCBB 1OL0A 4IRJD 5DJ0A 5HHNA 3UEZA 4LCYA 4RMUA 2X4RA 1AGEA 3MMEB 4KH2A 4XVUC 3VW3H 1UYWL</