1RVFH

Fab complexed with intact human rhinovirus
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
119
structure length
119
Chain Sequence
QGQLQQSGAELVRPGSSVKISCKASGYAFSSFWVNWVKQRPGQGLEWIGQIYPGDGDNKYNGKFKGKATLTADKSSTTAYMQLYSLTSEDSAVYFCARSGNYPYAMDYWGQGTSVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN
publication title Neutralizing antibody to human rhinovirus 14 penetrates the receptor-binding canyon.
pubmed doi rcsb
molecule tags Virus/immune system
total genus 16
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 1996-09-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rvfH00
3MRKB 1EUTA 3KXFD 4ZO9A 1ITCA 1U3ZA 1Z3GH 2H32H 4X7EC 5T5FH 4G8FB 2VERN 4GKOA 1QFUH 1JP5A 1ZWIA 1A6VH 4AY0A 3VFPA 2NY1C 4KU1A 3S96A 3ZT5A 3QWOB 2JCCA 3ES6A 1XFPA 3ZSSA 2ZUTA 1Y6NR 1FVCA 1I1AB 3PHQA 5I30H 3LEVH 2EXWC 3UJTH 2AABL 5IK3A 2FIKB 3LKPA 5C09B 3JWOH 1RIHL 1LD9A 2OL3B 4XNZB 3I9GL 1JNJA 3VFTB 5JUEH 3KYKL 2IANA 3ZE2F 2V2TB 4QXWA 5C6WH 4QYOA 4GW4B 3UTPE 4OAWA 1MJ8L 2V2XA 1H8OA 5F7DA 1JWSA 4KJQC 3EOTL 2ZG2A 5EIQA 1BVKB 3WKMH 1Z9SA 1HIML 5DI8B 1VPOH 4OZFB 2OTWA 3SGEH 4NKDB 3V4VL 4BH8A 5HVWA 1S7QB 3T2OA 5DVMA 4PRIA 2E7CA 4PJ5A 4MJIA 3TN0C 4TVPL 4NQVA 5DEZA 3A67H 1UVQA 4HK3J 3FQNA 4LQFH 1L7IL 2KPNA 3TV3L 3SKJH 2YMXL 1P6AB 5DJAA 4GMTH 4XVJL 4MQXC 1AH1A 1WVZA 4XCEA 3VD9A 2VQTA 5IQ7L 5HD8C 4AIZA 2LVEA 3AAZA 2L7UA 2OM5A 5FCUH 3FMGH 2A6DA 3IJYA 5I1KL 5KAQG 1B2WH 2Z35A 1EHNA 4M43H 1X44A 4JY6B 1P53A 2D7QA 1GC1C 1N5AB 3DYMA 5I2IB 5LGJB 2GJ6D 3F8UB 3HMXA 4JFEE 4ESKA 2CRYA 4WFEE 1AR2A 1H15B 1LEGB 2NY1D 1H5BA 4HEPG 1T0MA 3FKUS 3GBNH 3WJJC 4GG8B 1JJUA 1AR1C 4HPOH 1SJEA 5I1LB 4ONHB 4CMHC 1LDPL 2EXWD 3UO1H 5D1QA 5HPMB 3GEWB 5FYJH 2DQHL 3GSRA 4PUBH 1JV5B 3PQYA 4LSUL 5J13C 3SDXB 1YQVH 4J6RL 1QBLL 3V0WH 1TQBC 3SOBH 5EUKA 4P5TC 1CE6B 5DJ8A 3THMH 4KKBC 4LHUD 2X40A 5ERWA 3P0YH 3VFVA 3MLYH 4KJQD 3ZL4H 5DTFB 1JGEB 3MNZA 5IBUG 3R06A 3D69B 4NOBA 4MJ5B 4M48H 1WFOA 3H0TA 1I9IL 3VFUA 4U3CA 2VUYA 3G04B 4KVNH 5B39G 3TN0D 1XF2A 1N5YH 3MGOA 3QEUA 5HI5C 2W9LA 3BPCB 3Q2CA 2VLRD 1PKOA 3CDCA 4K71B 3P73B 5D5MB 3VGFA 4JDVB 4HAGA 2O61B 4KJPC 1MFEL 2PN5A 4X6FB 4QKXB 1OAYH 1ZT1A 2X4TB 1JPFB 3W9EA 1U8PA 4EQ2A 4Q58C 5I8KL 4AT6A 2Z8WC 3CU7A 4H25B 3ROLA 4WTZA 1KUMA 5DO2D 3ZE1E 1KN4H 2P42B 2V5RA 4NQDB 2KBGA 2GKIA 1AR1D 3QFJD 1JFQL 5SWZD 1VGKB 1F3DH 4C4KT 4RNRA 1OD7A 3BP7B 5I66A 1A6TB 2V7NB 4HLZG 1CIUA 1MY5A 4LLUB 2ESVA 2OXGA 3P11L 4PBWD 4P5TD 3QUZD 3FL7A 3BWAA 4HD9A 1R3LB 4L4VB 5IMKB 1P7KA 3LRHA 1Q0YH 4Z7UF 5C2UB 2VLJE 3MRDA 5BZDA 4P3WA 4Y2OA 1U3JA 5DLML 2QKIB 2QSCL 3WEXB 5HI5D 2A74B 4XVTH 2EH7H 1U8LB 5L0QC 3LRGA 4U1NB 1HN1A 5IOPB 4WU7A 3MOBH 5BS0E 3UZQA 3C5JA 4DCQA 1HINL 1TJIL 5JPMA 2KH2B 1S78C 3RZCB 1NDMA 2EDDA 3AREB 2H6PA 2OR7A 2HKFL 5KTEL 3GKWH 1FVDB 4X9HA 1MHHA 4KK6D 2DM2A 2VTFA 5E1AA 2BSRA 3FRUB 3TBWB 2Y6SC 1R5VA 3ARRA 5JUEL 5DJ6B 3FN0L 1FAIL 2DS4A 1JNLH 2R0ZH 3SBWC 2R4SL 3O6LH 3DRQA 4N8VG 4ZFZB 1IGFH 4OZGB 4U2YA 3QXUA 2XKSA 5IHZB 3EDFA 5T1LB 4L3EE 3FT4A 5CSGA 2VLLA 1BD2B 4KKAC 2KZ1B 3C60D 2HA1A 4KK8D 5F88B 3U9PL 3TBTA 4JO3L 1XR9B 4YHOH 1I8IA 5DA4A 1CDYA 5EWIH 5INCA 2P24B 4LCCB 1MCNA 4R9HA 5JDSA 2FBJH 3MLWH 1A3LL 2R1WA 2CLZA 3KR3L 3A67L 5CP7B 4Q6IA 1DN0A 5DFVC 4QRPA 4C55A 3OJDA 3DUSB 1BQLL 1T22A 3WFDH 4MJ6B 5FKPB 4M1DL 5I73B 1T6WA 5JR1H 4X4ME 5CJ8A 1E4KC 2D7MA 2P46B 2P8LB 1QR4A 3F7RA 4JQIL 2ZP0T 1ZHBA 1EBPA 5AD0A 3D0VA 3L1OH 5EU5B 5I18H 1NCBH 4V1DA 5D9SA 3L3KA 4D9QE 3VG9B 1OAXH 2P49B 3I6LE 3U7WH 4E42B 3GBNL 2HH0L 2X2YA 1X4XA 3ARGD 3KLSA 1JI2A 4WUUE 5EO1B 4U1JA 3ZDXE 1MH5A 3GMOB 2XPGA 5KBNC 5DJDA 1QSFA 2Z31C 2CR3A 3KXFE 1S7UB 3OHXA 4F7PA 5GGVL 3BD4A 1NSNH 5MHSD 4F8QA 2Y6SD 1MELA 5D7IF 5DWUH 2IPTL 3JTSA 4PRDB 3VDBA 5DC4B 3THML 4MQSB 1P84J 4HGWA 2EXYC 4WJ5A 2RB8A 3EYVB 3A6BH 4DVRL 4QNPF 2OQJB 4P49A 3V6ZB 4KKAD 4M48L 4OGYH 3EYUH 1UM6H 3DX6B 1C1EH 5GS2D 4NKMB 5INDA 4U6XB 4HWBL 3SDCC 1BIHA 4NJ9L 1ADQH 5D7JC 2W60A 2H1PH 2H3NA 1E4XL 1DVFC 3HZYB 3KJ6H 2R2BA 3CCHA 5DFVD 1KEGL 1BZ9B 3P40A 4MAYA 2VDPH 1MCBA 4R0LA 2ATKA 2JKXA 5F9JA 3J8F7 3TWCL 5C6TL 1RFDH 4AG4L 5GS0L 5D93B 3K4AA 2Z91B 1LMKA 3JWOC 1U8HB 5EBMA 3VWJB 4KJWC 2AAVA 3SDDB 4R97B 3QRGL 2NW2A 1HHIB 1RJLB 4TUJA 1IAOA 12E8L 3GGWB 4HSQA 3W11C 1BJMA 3G6JA 3TEUA 4GQ9H 4WI6A 5SX5K 3T2QA 3MZTA 5EBWB 2BJMH 4DW2L 1QHPA 2YPLA 2OZ4H 2Z31D 4PJAB 1XIWC 3B9AA 4NO0D 3TO4C 2QV2A 2AJ3B 2DLFH 3T04D 1U58B 2NTSP 3GBML 2GJ6E 3QWOA 5I0ZA 1INDL 2GIYA 4ELMB 4LEOB 1HH9B 1I1AA 3WXVL 5CJXC 3FAWA 1QYGH 3IDXL 2EXYD 4R2GB 4HT1H 4OGAC 3AUVA 2FIKA 5C09A 1Q0YL 4XPBL 2ENYA 2OL3A 4FFYH 5D2NB 3H9ZA 3VFTA 5A2IH 4N8CH 3PGFL 2V2TA 4GW4A 3SDCD 1ONQB 2HAZA 1JPSH 2BVQA 1MFBL 2PXYB 3N85H 1UZ8B 4ZSOE 5D7JD 4OUUB 3QI9C 3VXQA 1BVKA 1RJZB 5FDWB 4OZFA 5EZLB 1NPUA 4NKDA 1NC4D 2Z93B 3CXHJ 2ZKHH 5L88H 3ULUH 3MXVL 2PYED 4M6NH 3HNVL 3UTOA 1A1NA 4PGDB 5L8LB 4FTVD 1CXKA 4PV9B 3BISA 2NY2C 1U2CA 3LQAH 1TETH 2VLRE 3IU4L 5CJQL 5I1IH 5ESVB 1IC7H 3UCRA 4Q9RL 1F2XK 3LQMA 3W11D 4Z8FL 2IPUG 1TLKA 1YY8B 5I8OH 4S0SD 3QUXB 4R4NC 4JY6A 3TO4D 5LGJA 5I2IA 4D9LH 1LEKA 5I9QC 1LEGA 4WGVB 4NNXB 5DVNA 2NY5L 4XT1C 5I1LA 3P9MA 1JWUA 4OBRA 3QFJE 4OGAD 2A9NL 5SWZE 1U41A 5HPMA 4KHXL 4PG2A 4WW2F 2VOTA 4X4YB 1JI1A 1JV5A 3U36B 3SDXA 2UVFA 3RVXD 1UCBL 1CE6A 4CMMB 4MVBD 3MV01 3UBXI 4F58H 5E08H 3MA7B 4HLJA 4HKZA 5DTFA 1JGEA 2JJWA 4CKVX 3PWPD 5BRZA 2EEAA 3D69A 4OD1H 1BAFL 4MJ5A 5C0JA 2CK0H 2HFEB 4CAGA 3TIDA 2DYPB 4KPHL 2BHYA 3RAJH 5A43C 3V0AC 3TIEB 3NCBB 3L1OL 4WV1B 2UWEB 3KPRD 1NCBL 1OGAB 4NZRH 4O5LH 1ITBB 1OAXL 3U7WL 4OZIE 1K2DB 2JELL 5D5MA 3D18B 1F4AA 4JDVA 2O61A 1AFVH 4X6FA 2ZCHH 1QO3B 3U7YH 2X4TA 1KFAH 2X1XR 3HMXH 1A6AB 4PY7B 4TSAL 4OKVA 4QHLB 2DBLH 4DKDC 4H25A 2CO7B 4OZFG 3RDTA 4NHUB 3A6BL 3FN3A 4NQDA 5FYKL 5L9DL 4QWWC 1VGKA 4RFEB 5CZVL 3BP7A 4Z7VE 4CDHA 3E2HC 1A6TA 4LLUA 4UINL 3QAZB 3L3HB 2XKNB 4GJTB 2VXTL 5EG6C 2VZVA 5KAQF 3MV7B 5LQBL 4LSDA 3FQRB 1L9MA 4F57L 4DZBA 1RULL 5E6IB 3NH7H 5JPNB 3IU3B 4U33A 4G7VL 4JHAL 1JE6A 1I1FB 4L4VA 1A3RL 1SHMA 2NX5B 1RFDL 5HYSB 5DJYB 2EDEA 3UPRA 1DBBL 5A16B 5D2LA 3OMZA 3CH1B 1MIEL 1EO7A 3T4YB 3CC5B 3ULUF 4YE4L 3RL1B 5EUOF 2A74A 2VZSA 4JRXD 5J8OA 1RJYB 3O81A 4JPWL 1OTTD 1KIRA 5EU6D 4U1NA 5IOPA 1MHEB 2YN5A 1RIUH 2H2SC 2BHZA 5ESAB 3LPGA 5IW3A 1KCVH 1NAMA 2AQ3A 2WWKT 2WBJC 2FYYB 4Q9BA 3WDJA 4G5ZL 2DQUH 4JRYA 1FVDA 3UBXA 1M6OA 4P2RD 4RX4D 4Y5XB 3FRUA 3RIFK 3WSQH 4FFYL 4QWWD 3S4SB 5MHSE 3TZVD 5DJ6A 3VGBA 2F53D 1AJ7H 4M1CC 3N85L 1F02I 4ZFZA 4LSTH 4XVSH 5IWLA 5T1LA 2GITA 5DZLA 5FEBA 3RUGB 1S7RA 1A6WH 3BAEH 1BD2A 3EYFB 1FO0A 2IH3B 1XR9A 4PTUB 1QLEH 5AZ2L 3ULUL 1NBZB 4L1HA 5CWSA 3D6GA 4XB8A 4A6YA 4EUPA 4K8RH 4F2MB 5CP7A 1OSZB 3S5LG 3BSZH 2JJTC 4DVBB 3NIDF 4TOYL 4XNUH 4WY7L 3K3QA 5TQ2L 3AMKA 1J1OL 4DAGL 1YEGH 3DUSA 5IB4A 1OF2B 1GPOL 4MJ6A 5FKPA 3NFNB 1WBZB 1R5IB 1IGYB 4OT1L 2IFGA 2P8LA 5I8OL 5FM5M 3P4OB 4Q97A 1N3NA 5MI0C 5H37G 4V2BA 2H2SD 1P4BH 5EU5A 3S37L 4ZFFB 1L4IA 2VZ1A 4E42A 2WBJD 1ZLWK 5C2BL 1FORH 1MCLA 2R2CA 1HXMB 3GMOA 4HMEA 4P99A 4LLAA 1WT5C 1S7UA 4HGMA 3R8BB 3DO7B 1G9ML 2YSSA 5TE6L 4FQXC 3HPLB 5B4MC 2DQDL 3F6LA 5M7QA 5CIPB 1N6QL 2IADA 5F7EL 2A6IB 1DP0A 4OQTA 1NC2B 3EYVA 5DUMH 1RIVL 2OQJA 3V6ZA 1DLHB 1WISA 4OD1L 4W4OC 1RMFH 4ODBD 5DFWH 4Z95H 1I3RA 1MCQA 3DX6A 3SKMB 4XCNA 4UUJA 1LP9E 2JIXD 4NKMA 4ZUUB 3VFSA 4HZLB 2X4OB 2J8HA 4JJ5A 1N8ZB 1NUDA 2A83B 4WWID 3HZYA 3V5DB 4D8PB 2WW8A 1OAZH 3GMMA 3C2SA 2XA8H 4IJ3C 3UBXG 4QXGH 2HYMA 1AFVL 4KMTH 4ZO7A 1OGTB 2E27H 4XC3L 4TNVK 2Z91A 4G9DB 2DD8L 3FO2B 3F5WA 2PYEE 4XH2B 4JANB 3VWJA 3CLEL 3HR6A 3SDDA 5GHWH 5J1TC 3L3OB 4FTVE 3KPSD 1ZLVK 3SQOL 4EI5B 3M8OH 1T4KB 4M7ZC 1IT9L 2F15A 1IAIL 3FB8B 3T3MF 3NCMA 5JXAL 3MBEC 1D5IL 5I74C 4W4NA 3FO0L 2DF3A 4EUPG 1NAKL 1CL7I 4G8GD 4GS7C 1FVEA 1UH3A 1JWMA 1S3KH 4FQXD 5EC2B 2FSEB 4JFZH 4ODTL 4ELMA 4IRJC 4LEOA 2X4QB 3C5ZB 4RFOL 4X5WB 5JW3L 3WIIH 3LQAC 4OCRL 2EKJA 3NFSH 4XP6L 4RMQA 2FWOB 3ESVF 1T80A 5D2NA 4YHMH 3WXWL 3RGVB 1KYOJ 1IGMH 1ONQA 5FM4A 2PXYA 2XI9A 2MQCA 3RTQA 3GNMH 2BOCB 1G9NH 3T0VA 5FDWA 3EDKA 3GHEL 3PWPE 4NM8H 2Q6WA 4WWKB 3CFKB 4UT7L 4L8BA 4Y1AD 3O6FB 5GJTH 5E2VL 2VSCA 4PGDA 1KCVL 2GTWA 2BVTA 2PCPB 3DX7B 3KPRE 4PV9A 2BCKB 1YMMD 2VLKA 1YY9D 2DQUL 2VL5A 1FRGL 5ESVA 3RP1A 4GO6B 3Q5YA 3KPPB 5DHVA 1RUPH 2EC9T 4HIXL 1CD1B 2OXHA 3MRPB 5GS1B 4Y4KB 5BVPH 3QJHB 3WSQL 5KZCB 1NGPH 1G7PB 5GZOC 1YY8A 5TPWL 4MD5B 4LSSL 1F45A 5GGSY 1A7RL 4XNYL 1G1CA 4JPIB 3MLRL 4ETQB 3B3IB 4XVSL 4QO1A 3UTTD 3VW3L 4YFEA 5E8OB 4KRPC 1FNSH 5F9WB 4IRJD 2JJUA 4MGXA 4QT5A 5HHOD 2OL3H 5CD3B 3IGAA 5KVDL 3VXOB 2WM0A 4MNHB 4QHKI 3QBTB 4X6DB 2FD6L 3U36A 4EN3D 1BBDH 1U92B 5EULV 2DM7A 1MF2L 3EFFA 2FR4A 2OJZH 1BJ1H 3BJ91 1TJHH 3QB7C 3AY4A 5HHXH 4OZFH 4DTGH 3AS3A 4QTHA 2W9EL 3K4ZA 3RWHB 4HCRL 4LFHD 5HHMB 2X4RB 3B43A 5D1QC 1RSFA 3IKCB 4G8IA 3HR5B 5ELIA 1NFDA 1Y6MR 3BVNB 2DYPA 4QHUA 4BK4A 2IAND 2GT9B 4K2UH 2D7OA 2HLAB 2Q20A 4MA1B 1P4BL 2UWEA 3DVNA 4ODVH 4WV1A 1WK0A 1HEZB 1OGAA 2G2RB 4U49A 2DQCL 1B4JH 3QT2A 1K2DA 4JRXE 3D18A 2VXQL 3MFGB 2FLRT 3CXDH 4MSWA 5EU6E 1KLGB 4J7RA 5ITBL 3UXFA 3WHXB 3AS2A 1DUYA 4GXVH 2WQRA 3LKOB 4MJID 1BQSA 4PRPB 4PY7A 1FIGH 4QHLA 5DD1L 5EBLB 5TGBB 3SE8H 2BNQB 5T1KD 5DJZA 5IFHH 4EZMA 2X4SA 4ZUTB 1QFPA 2X89A 3TT3H 1CLZH 4KRPD 4NHUA 3OZ9H 2ZG1A 2EDYA 1DBKL 3OPZH 4BQCA 5J0BA 4Z95L 4X80L 1PG7X 3HC0B 1I8MB 2J6EA 2F53E 3L3HA 1W2KT 2XKNA 5KVEH 1SJHB 3MV7A 2EYTB 1YEDB 3FQRA 4HV8B 2EDTA 5E6IA 3IU3A 4QHMB 2R23A 4HUXB 5HYSA 4FQHB 2E27L 3MRCA 5DJYA 5D1QD 1BJ8A 4M93B 1K8DB 1MLCA 1CDUA 4NKIL 3CH1A 2VZOA 5GHWL 4CGTA 1RZGB 4MNQD 3RL1A 3AC0A 15C8L 1LO5B 4JAMB 1RJYA 1PBYA 4L8SC 2XWBB 3G6JF 4PJFA 3GM0A 2RIKA 1CFVH 1H3TA 4LRNL 1Q9LA 3MNVB 5FOBB 3KAAA 5IVXF 4K8RC 2A1WH 4PS4L 4JGJA 5I1JL 2FYYA 4JFZL 3D48R 4OM0L 25C8L 4QXTB 4XPGL 4X4XB 1IC4H 4RQQB 5FHAL 1MRFH 1V5JA 3B9EA 1ZVYA 4Y5XA 2I07B 4UT9L 1RQ5A 2VDKH 1CIDA 4KGLA 2FHCA 3EKCA 5L6YH 5GSVA 1WWAX 3WNPA 3OKYA 5SV3A 1IGML 1FL6B 2ZPKL 2GK0B 3NGBB 2XRAH 4JKKA 4I18A 4UNUA 5GRUH 4FS0A 1RURH 3L5HA 2VR4A 4XGZB 4UB0H 2YEZA 1UXSB 1NBZA 1C5CH 5GJTL 4HKXA 3S88H 3QJFA 1OSZA 1Z5LB 4DVBA 5HGHB 1HCFX 2ESVD 2XACC 4L8DB 3WIHA 4NN6B 1BVLA 2IWGA 1AO7B 4N9GB 3ILQC 3HG1D 4XRCA 4N0CD 1OF2A 5KANI 5SX4I 1SEQL 3NFNA 3CZJA 1MCWW 4DGIH 1MFCL 1T0NB 1X5JA 1WBZA 3FT2B 1IGYA 5F7WC 3QHZL 1NH6A 5GRYA 4IM8A 1NAMH 5FK9B 3V4PH 2DQFB 5IHUH 3P4OA 4Q6IC 1SBSH 2BY3A 3T0BA 2X1OA 1FNFA 3KPSE 4ZFFA 1J1XH 5D1XB 4K8RD 2WMPA 3LZFH 2BHUA 4GRWB 5BMFH 4I3SL 5HYSG 2J8UB 2ORBH 3NCEB 2HFFB 1DQLL 4PJDB 3U30C 1BFVH 5DT1L 3KLHC 1IAII 3DO7A 1EJOL 3DUUB 5HJ3B 4G8GE 4HKJB 3HPLA 1ZSDA 2OJZL 4LU5L 3T3PF 2A6IA 3AU1B 1FO0H 3LEYH 1CGUA 1A6ZA 5AUMA 4O2EB 3R0NA 5T3ZL 4UV7H 2EYSB 1DLHA 4A6YH 4EUPH 3GZKA 1YPZE 3BYYA 3SKMA 4ZUUA 3EAKA 3MV9B 3DLQR 4HZLA 3GK8H 2X4OA 1WAAA 4QHKJ 5HVFB 2A83A 4MD4B 3OKEB 4ODVL 3V5DA 4KY1H 5H94B 1OAQL 3D39A 1P7QD 3QG7L 4KTDL 1VB9A 5D6CB 3TFKD 1FPTL 1OGTA 3KPMA 1CI5A 4Y1AE 4XWGH 4G9DA 3O9WB 4UILL 1GIGL 4XH2A 4JANA 1A1OB 1L0QA 5E00A 3ESUF 1NGWA 3UTSB 3L3OA 1O5DT 1IM3A 3PNWB 4QRPD 1YMME 4MAYC 3MC0A 3U6RA 4LSPL 4R0LC 4JM4H 2VABB 1CLZL 2EDWA 1MCWM 4AEEA 4JFQB 4P3CL 4NBYB 1G9NC 1KC5L 2XKUA 5A2JH 3RVWC 4O02H 1J8KA 4LP4A 1D3CA 1CXLA 3SDAB 3KLHD 3V6OE 3IT8D 3OF6A 4OQTH 1F90L 3U79A 1OHQA 4OV5B 3UTTE 4V1DD 5IW1B 1U6AL 2X4QA 2VMFA 3MZGB 3NAAL 4X5WA 5HHOE 1U3HA 1INQB 5JNYB 4ZUWB 1UACL 3HNSH 3Q1SL 1HHJA 1MQKL 9CGTA 2ZCLL 5D2LF 5DMGD 3RGVA 4DGVL 1RU9L 2EDRA 2BSTB 5JZ7D 2AV1B 1DTUA 4QRSB 1LE9B 2Y9RT 2JCCE 1I1AC 4JFFD 4FQ1H 4ZOCA 2BOCA 3ZYOA 2ADGB 5E8PB 2G5BA 4P9HC 1NKOA 1D5XA 4H20L 5C71A 1H3PL 4XNZC 3PXHA 4WWKA 3GSWB 2V17H 3CFKA 4ISVA 1P4IL 4M62L 4HUUB 4ACPA 3V5HB 3P9WB 3OWEA 1LE5B 2B2XH 4CN6A 3EOBB 4JVWA 3O6FA 3QHFL 2IANE 4PBXA 1SM3L 1FNEA 2DQTL 3DX7A 2PCPA 5GRJH 2WBKA 4L29B 4O51B 1A1MB 4P2OD 4ZTOH 2HT4D 3OGCB 3NFPB 4DKEL 4MAYD 3RWIB 2QSTA 1MRFL 3MJ9L 1FE8H 1K3IA 2BDNL 3MRPA 4ZOBA 5GS1A 5MEQB 3QJHA 1G7PA 5EOCL 4MD5A 4QRTA 4Y4HD 4MJIE 5IB1A 4ALAH 3BI9X 4JPIA 1L0XA 4UDTB 3RNKB 4JG1L 3UEZA 4ETQA 4Y16B 1FCGA 4IMLB 5E8OA 4OFDA 5I1GL 1NGZB 1CLOL 1F4YL 1FSKB 4UTBL 2BRRL 3ZDZE 4XZUB 1XGUB 4RWYH 2HWZL 4UB0L 5IW6B 1PX3A 4X6DA 4HDIA 5KSBB 3EHBC 1ZLSL 1U92A 4X4ZA 5F89B 1KCRL 2VR9A 3WS3B 4B7IA 1FC2D 2Q7YB 4OLUL 2F58H 4QCIA 1RZIA 3V4UH 4AEHH 2DQEL 1I1AD 2JLLA 4YDVB 3RWHA 1NMAL 1V05A 3NTCH 1GYAA 2VH5L 5IJVA 3QDMB 3QIUB 1OWRM 1DUZB 5B38B 2X05A 4PG2C 5C09D 3IKCA 3MNWA 3HR5A 1KTKE 3BVNA 1PZUB 5IHUL 1N0XL 1CBVL 4W6WB 1RZKC 4JO2L 5DD3L 2GT9A 4LVOB 3S36X 2HLAA 1IGIH 2G2RA 4MNQE 3IS0X 4GW5B 4RGOL 5DHVH 4ODWB 2ZOKA 4UOW0 5LAXB 1H3WM 4KUCF 4PGBB 2APTA 3I6KB 4XHQA 3VDAA 4MAUH 5KANG 3WHXA 3TBSB 3GI9H 3W5MA 1ZHLA 4ZXBB 2JE8A 1I3GH 2OP4L 5HYJA 3RIFF 2O5XL 2BNQA 2Y07H 5DRXB 5TE4H 1FO0L 3H9HB 2D3VA 4JY5L 3EO9L 4ZUTA 2IAMB 2H2PD 1FP5A 1TDQA 3HC0A 1AC6A 3CU1A 1I8MA 2G5RA 4RAUA 5F7LB 4LLYB 5FO8B 1MCJA 2YOCA 3QEHA 2EYTA 1YEDA 3QUKB 1U8QA 5D7SL 2YA1A 3W0WA 4J3SA 4MZ3A 4QHMA 2XQBL 1RUKL 5DQDL 3MRBB 3GB7B 4HUXA 1G7HB 3GRWA 2BNRB 3MUHL 5GGRY 1R24B 1K8DA 5FAAA 4GRLD 1CL7H 4S0TD 4G7YL 1AP2B 1RZGA 1T89A 4KAQL 3B9VA 1LO5A 3VE0B 3HG1E 4K3DL 2X9XA 5BVJB 3LKNB 4RAVB 2XWBA 4PGEB 5GGSB 2CK2A 5ANME 5A3IC 5JHDB 2Q87A 1MREH 4FFZH 4NRYB 3BZDA 2PTVA 4ZPVA 4NUGL 3RWFB 1A9EB 1X6NA 4X4XA 1RVFH 5EU7C 3QUYA 3FOMB 4RQQA 3WDIA 1OPGH 3HUJE 1VGEH 1WFTA 3ARVA 1H3UA 1W0YT 2YPKB 2I07A 4LIQL 1CXFA 3B9KD 3WHE1 4XVUC 3RZCC 3ROOA 1RZJL 2ADIB 1QUNA 1MRCH 1FL6A 3OQ3B 5B3JE 4KMLB 5JA8B 1F6AB 4PP1D 3VA6A 1KELH 2E7LA 4RBPK 5K9JL 1ACYH 1Q94B 4R3SA 2ADFL 1BP3B 2FJGA 3BGFB 4PJ7F 1QP1A 1N6UA 1T04A 3F7QA 3O3EB 3QNXB 4K07A 3DHMA 4FABL 4R26L 3MOAH 1KXVC 1Z5LA 5IWLC 3H3PH 1UADC 5KS9E 4L8DA 4PJGE 4ZTOL 4TNVF 1AO7A 2C3VB 3S8WA 3C6LD 4F7TB 3IFOA 4L4VD 1RV6X 1PJ9A 3FT2A 3QQ4B 1CFNB 3E6FA 3OGOE 3W39A 5CJOH 2DQFA 3NBNA 2NY6C 4ALAL 5A3ID 3S35X 3SPVB 1HQRB 3QEQB 3VFNB 1J0IA 4H26B 2BVOB 3MLVH 3VRIB 5D1XA 2SEBB 1OP3H 4NM4H 2VN4A 4Z76A 3CFIC 5I73C 4PJXB 2J8UA 1JVKA 2HFFA 4OF6A 4RWYL 2VLJB 4Z7OE 3BRGC 3DUUA 5HY9B 5HJ3A 1D5MB 4YR6B 2CRMA 3IXAB 3ZTNH 1BIIA 4HKJA 4BZ2L 3RZCD 2DKSA 1ZHNB 4Z7NE 2NZ9C 3ARED 3T0XA 5CKGA 4V1DE 1JGVH 3AU1A 5IVOA 5HDLA 3NTCL 4O2EA 2EYSA 3DOSA 2ZUWA 5HGBB 2HKHL 2X9YA 1CFTB 3DVIA 1NFDF 3WIHH 5EZOH 4DUXA 4MXVF 3LD8B 4LDLB 4P4KD 4RA3A 3BZFB 1A7OL 4MD4A 3OKEA 5FCSH 3VI3E 2DKMA 5FO9B 4JFFE 1WICA 5T1LD 5H94A 3QCUL 1XGQA 2AK4D 5DJXB 5BO1H 8CGTA 4WEBL 1ETZB 1BD2D 5D6CA 2NLJB 2EE3A 4NQXB 1ULVA 2FX7L 3PWVB 4MAUL 2XA3A 1LQSR 3O9WA 4ZQKB 1A47A 4WCYH 3JTTB 5IF0B 1A1OA 5JIKA 4YDKL 1I3GL 3GKZA 3UTSA 4JDTH 4W6YB 1X5KA 1PX4A 2BSSB 2Y06H 2QEJA 1NLBH 2A6JB 2VABA 2JJSA 3CSYB 4L3CB 4LLDB 4JFQA 4KTEH 4OD2A 2H9GB 3VRLF 5D93C 1XGRB 4KDTA 2QHRH 4UIMB 5E8EB 1MHCB 2R29H 3VWJC 3SDAA 2YD6A 3SDDC 5HDQL 5DEFB 4I0CC 4WFGD 2VUOA 3BEWB 5C70A 5C92A 3DHJA 1NEZB 4OV5A 3QXDB 1UJ3A 2NZ9D 3BDBA 1CYGA 3V6BR 1T03H 4LSVL 2O93L 4U7SA 5TFSH 1INQA 4XP1H 2NY7L 2P8PA 4ZUWA 2BRQA 2ZUXA 4NDMB 3A6CL 4YHZL 5JMRA 2YD1A 4JO1L 4RFNB 2AV1A 2IMMA 4NC1E 2Y72A 1WJ3A 3AXLB 3BN9C 4JREB 4R2GC 2ADGA 2V5SA 4YDIH 5E9DA 3ALPA 3CFBA 3N1QC 3GMQB 4K7PH 4YK4C 5T3XH 1XF5B 2R39A 5C07A 5C09E 5D2NC 3QUMA 1QBAA 1LO2H 4PJFF 4MNGB 1LE5A 3VXMB 3EOBA 2XN9A 2PXYC 4M7LT 1T21A 2VDOH 3RTQC 32C2B 4L29A 1A1MA 1G0YR 4PJ8B 5GS0C 3C8KB 4BZ1L 1AI1L 1FL3B 2J88L 5GISL 3NFPA 3RWIA 1FNGA 1CGSL 3R4DA 1G7LB 3NZHH 3MUJA 4HJGA 4ZOAA 1G6RL 3GSVA 1PD6A 3I50H 3T2PA 3MV8A 2ZCKH 4UDTA 1XCTA 4XPHH 1GGCL 4Y16A 1NLDL 2R0KL 1FH5L 1Q0XH 1NGZA 1O0VA 1YYMH 2Y7QA 4NFDA 3BKJL 4XZUA 4HS8H 5SX4H 1XGUA 1B4RA 3O3BB 3GIZL 1S5HB 3IXTB 5KSBA 2YXFA 4GSDL 2WLZA 4LPCA 5F89A 2FEEL 4XAWH 3GJFA 5I8EB 2R8SL 1MI5A 2QQKL 2VN7A 1IAKA 2AGJH 4LMQE 3IDYB 2NTFB 4YBQC 2APXA 1S7VB 1EEZA 4MA8H 2GK2A 5CCKH 4X9BA 1Z0NA 4R2GD 1CFQB 1DUZA 5KVGH 1F58H 3GIVB 4UU9A 3RA7L 4U0QB 5AYUL 3G6AB 3CFDB 1J0YA 4CVXB 3HAEB 3OXRB 5DMIL 2WANA 5ADPL 5KSAD 3WFBL 3B9DA 3HI6L 3PABB 3AY4C 3HFML 3OB0H 2PXYD 2NZIA 3ZT7A 4JHBA 4GW5A 2PO6D 2OLDA 4ODWA 5LAXA 4NM4L 1D9KB 4PG9A 5I19L 5GS0D 3MCG1 3G5VA 4WI4A 3I6KA 2B7DT 2WWMC 4YHKH 5EFIB 1B6DA 5CGYC 4MXQC 2QJDA 3TBSA 1ZGLP 3TNNB 3ECBA 4WV1C 4ZXBA 5KVFH 3L5WB 4QTIH 3KYMA 4BKLA 1JGVL 5DRXA 3H9HA 5TDNA 5D5ME 5GGTL 5M95B 3MUZ1 3GSOB 2IAMA 5B8CA 1BGXL 4LHQB 3SY0B 2X5PA 4IHOB 4TPRL 1KB5B 5EZIL 2AKRB 3WIHL 1NUNB 2FX9H 3QUXD 1NCUA 4ORGA 5LXGH 1WAAF 4EKXA 5AG9A 1J0KA 3QWRA 2CKBH 1X7QB 3MGAA 2CLVA 4YBQD 2PYFA 5KG9A 3OR7B 3QO0B 4GLRH 3WJLA 3MRBA 5F7MC 4KQ4H 1N64L 4XP9L 3PGCB 3T08A 3QAZC 4JN2A 4QLRA 1R6VA 2FGZA 4JDTL 1AP2A 3UPCA 4E5XB 2EDNA 4WI8A 4MJ2A 5E6IC 1PEWA 4EIZC 4MA7H 3GMNB 4KQ3L 5BVJA 4L4VE 3WLBB 1KJVB 3LKNA 1MLBB 4OLXH 4RAVA 3KPQB 1FLTX 1EH9A 2WWMD 4PGEA 1NCDH 5GGSA 1WFNA 5CGYD 4MXQD 5JHDA 4TSCL 1U3YA 3H7BB 4QXUL 3CX2A 2P8MA 1A9EA 3SE4A 3I6GB 3ULVC 1IGCH 1CE1H 1HHHB 1S7SA 4OTXL 3FOMA 2Z92B 2AEPL 5EU7E 2M1KA 2AV7A 5DR5L 2FL5B 5MP6H 4Y5VB 3SKNB 4KC3B 4JO4L 2AJXL 4OI9A 1BQHB 2ADIA 4HQQH 4HWEL 5DZOA 1SYVA 2FEDC 4S10A 4JN1H 3HMWL 1F6AA 4RISL 3MRQB 5FA4A 3GRWH 3HTLX 3DETC 4WENB 3LS4L 4K7PL 4Y5XC 3N9GL 1GGIH 2E6JA 4Z0XB 3CFCL 3EYOA 1NGQL 3HE6B 3JV0A 1LO2L 3O3EA 3V52H 1V3KA 1YEHL 1MIMH 3X13B 4I18C 4OZGE 3EOAB 5FHBH 2C3VA 3F58H 4K23L 2AK4E 5E6ID 1HILB 1BD2E 2D7NA 2IBBA 4GBXB 4F7TA 1JZ3A 5ICZB 5ID1A 1O7VA 2NX5D 1KJ2L 3QQ4A 1CFNA 2D03H 4YXLL 1HKFA 1MOEA 3SPVA 2F5BL 5GQBA 1HQRA 3QEQA 4H26A 2WSKA 1INEL 2BVOA 1S9XB 2CPCA 4RRPA 3KYAA 3VRIA 3P30H 4DZ8A 1KXTB 3I75B 4JY4B 3C60B 5E1HB 3ULVD 3LSOA 4YHPB 2NCMA 3NN8B 2Z8RA 4B50A 4APQB 5CILL 1KNOA 2VLJA 5E5RB 2DQJH 4MX7B 3UC0H 3OG6B 1D5MA 5AEAA 3IXAA 1AQKL 4IOIB 4JZNB 3MRNB 4WFGE 1NCWL 1ZHNA 4AH2B 5FYKD 2ZWLT 4YPGB 4F3FB 4HW6A 5CCKL 1A7QL 5DD6B 1I75A 4QRRE 3T77B 5KVGL 3GMRB 4LF3B 5GGRB 5HGBA 2P48B 5JQ6H 2KL6A 2FB4H 4X6CF 4GAGH 4XNXL 2Z8VC 3BZFA 1M7DA 3EZJB 4OZHB 1YECL 4KJYB 2LTQB 5I1AB 1NCCH 3BGAA 3KYOB 5I1DB 1ETZA 5IESH 3SKUD 3WE6B 1MJJB 1B0GA 4NQXA 1BWWA 5F9AC 2ZSWB 1R0AL 3K8MA 4ZQKA 2R0LH 4V2CB 3JTTA 5IF0A 5DRZA 2AI0H 1TZHB 2A6KB 3MX0A 4GRWH 3DECA 4ZG1A 3KPTA 4NZUH 4L3EA 1JMZA 1YN7B 4L3CA 2F5AH 1HSAA 1SY6A 4LNVA 4KVCH 2H9GA 4P5KB 1EAPB 5ALCL 1U8NB 4JM2A 4UIMA 5E8EA 1MHCA 1H9VA 4OLVH 5DMJB 4U1KB 3FQUB 5DEFA 5HTSA 5KVMC 3TYFB 5LXGL 1QFWL 1OT2A 3RY5A 3V5KB 1R3HB 2X44D 4EI5C 1NEZA 2ADJA 2CKBL 3IKKA 2C26A 2CH8A 5CZXC 3E6HA 1L6ZA 4RBPH 2CLRB 2E9IA 3WD5L 1QNZL 3G5XB 4X4MA 1FIEA 3QCTH 4MMZC 3TJHD 1X3DA 1NANH 4CUCA 5F7HA 4PJAE 1DANT 3C2AH 4XMPH 4GG6F 3LVEA 2V9RA 5L2JA 3BE1L 1J8HB 4O00A 2YD3A 2D4DA 4XP5L 2FO4B 3AXLA 3ZKMC 4ELME 3U4AA 2UYLB 2MPAH 4DN4L 1NC2D 4WUUA 4ONOA 2DRUA 1KCUH 3GMQA 2M2DA 5DD5H 3QQNA 2IBZX 4PJCB 4N90D 3HC4H 5D2NE 3RGVC 1OQOA 1D7FA 4WI9A 1QQDB 4F9LC 32C2A 5E56A 5LGKA 3MRIB 4PJ8A 4W81A 4NQSB 2XFXB 1UCTA 3C8KA 4ZUVA 1FL3A 4PTTB 4NCC2 5E2WL 5L7XL 1HZHH 4WWKC 4UT6L 2CIKB 4WFHD 2VDLL 3DNKA 5F44A 4S1DD 3O6FC 1P9MA 4HS3B 4JZJB 5MP6L 1P69B 4IOFC 1N4XL 2W9DL 1K85A 5KSUA 4I8DA 1JNNH 4QY8B 1JYNA 4HQQL 4F7CB 4JN1L 3RVTC 1EO8H 5B3NA 1PVHA 1RAMA 4EI5D 1DL7L 3NIGF 5I1HH 4YZFE 5CZXD 2Y36H 1JK8A 5GS1C 2C7UB 3LN4B 2G75A 4Y4KC 3TF7C 3O2VH 1FDLH 3IXTA 3DX8B 4G6KH 1SQ2N 5E2TL 4M8QB 4OF7A 1MIML 5I8EA 2ZOLB 4MLIA 2W91A 3AS1A 5F9WC 2C1OB 1QSEB 1S7TA 4BJLA 3C5ZD 1S7VA 2CDFB 3C9NB 3QUMH 3ZKMD 2LU7A 1G7QA 1D6VL 5D4QA 3QDJB 1QR1B 3MROB 1T7XA 5ACMA 3G6AA 3PGDB 3QO1A 3CFDA 3OXRA 5F7NC 3CMOL 3RGVD 5HDBF 1NEZG 4XMKL 5ICYB 4BFEA 2X4NA 3MV11 1LO4L 2DMBA 1ROWA 4YX2H 1TTUA 3UJIL 1MWAL 4XCCL 1T2XA 4WWKD 5C3LD 4XPFH 1KTDB 4MA1C 3MYZA 3L5WA 1TCRB 4JPKH 4LHUA 3ZKQD 1KJ3L 1TTFA 5DK0B 3H9YA 4JVUA 1MAMH 3RVTD 4TN9A 3TCXA 3WFCH 1FZKA 4WHCA 2C4XA 5ABDE 3TH4T 4IDJL 4AK1A 4Y4KD 1GAFL 4IHOA 3GJFH 3SY0A 5ACZB 5KZCD 1KB5A 4X6BB 3DSNA 5AWNL 2AKRA 2ARJQ 1LNUB 2EDJA 3PJSB 3QXVA 1A4KB 1X7QA 4PYGA 2VXUH 5I1EH 3T2NH 4WFFD 3Q48A 3MA9L 3QO0A 2IH1B 4HHAA 1JZ5A 3RZWA 4TULH 3TM6A 4M7JH 4ZD3H 3PGCA 4WVRA 2B1HL 1HH6B 1OAUH 1R3IL 2BNUB 4PJIB 3ZKSD 5LKNA 3DIFA 2XICA 4URTB 5IQ9B 2FGWH 2WUBL 3U1SH 1MWAB 4BFIA 4I1NB 3F62A 5HHMD 5SWZA 2Q3ZA 1S7XB 1KJVA 4G8EB 4M93C 4MXWL 2NX5E 3WLBA 5DMKB 3KPQA 2CR6A 2DOCA 1TVBB 1P5VA 1FYTD 1BX2A 1U2HA 3H7BA 1T89C 3OKDB 2VL4A 4KRMB 3Q6GL 3QUZA 3OKMB 1JIBA 2GEEA 1T5WA 2I5YH 5D6DA 5KJRL 3ULVE 2Z92A 3FONB 1DQJB 1MFDL 5IEKA 3HB3C 3QPXL 2FL5A 4Y5VA 1RUAL 2K3TA 3SKNA 5I6XB 3K1KC 4PRPD 4U0RC 2FECL 2HVJB 2XZCH 3K8KA 1BQHA 4OZIA 4Y89A 2BNQD 4X6EB 4JRXB 5FYKE 2AEQH 2MPAL 4EVNB 1C5DA 4J3UA 2OTPA 4NZTL 4XPAL 3GSNL 2AJYH 1ZA6B 2VAAA 4Z0XA 2E8YA 3HE6A 2DWDB 4JDZB 2GSGA 2OR9H 5ID0B 2XWJB 4LHUG 3WNKA 4L1DA 4QGYA 1CTOA 2BY0A 3NGBC 3FO1A 4OLYL 1XZ0A 2HJLB 2E7LC 3VFGH 5HGAB 3RUGE 1DQMH 4GBXA 4LPUA 5ICZA 2IFFL 1QPPA 3DBXB 5T1DH 2ATPB 3X14B 4Z7VA 4PRBB 1GGBL 1MUJB 4I4WB 4J4PD 1FGNH 1JNNL 4NN6C 3U4EB 2HN7B 3FQTA 1RUQL 1PZ5B 4Z7WB 2V6HA 1D6EA 4FRWA 3I75A 2CKNA 4JY4A 4BZYA 1GH7A 2DB8A 3C60A 4YHPA 5A2LH 4APQA 3VH8G 4MX7A 3O2VL 3HB3D 3KYNB 3O2WH 4G6KL 2WLYA 3O11A 3U4BL 4IOIA 5F9OH 1KLFA 4JZNA 3MRNA 4XCYA 5CBEA 3ELAT 5D1XC 2UUDH 4AH2A 5IROA 3FHAA 4F3FA 4WW1B 4Y5YA 4M4RA 4IEFB 3VXNA 3OKLA 3GMRA 4HK0B 4LF3A 4OLZH 4R90L 5GGRA 3S37X 5FGRA 1WWCA 3ETBF 5CMAB 4OZHA 1UWXH 4BQ6A 4XI5C 2CGRH 5I1AA 4X7DC 2ID5A 3ARGA 3KYOA 3BZEA 1F4WH 3WE6A 1NJ9B 1MJJA 3MLUH 5J3HC 4G6MH 4LLQB 2DQIH 1AD0B 2YZ8A 3L5XH 2ZSWA 2CDGB 4N90E 3SE9H 5C0DA 1WITA 1TZHA 2JK5B 4K3EL 5DD0L 1FBIL 4P59L 1AO7D 2O5ZH 1FG9C 4MCYB 4FQLL 3WFCL 4NHCH 4XWOC 1FLRH 3PWLA 3F12A 4P5KA 1EAPA 2K1MA 1UB5A 4WFHE 1CK0H 2A77L 3O9WC 3QXWA 1OARH 3QIWD 2XXCB 3C5SB 1YMHB 4U1KA 4AL8L 3FQUA 3IDUA 5CSZB 3TYFA 4L4TB 4GKSB 1R3HA 1YEFL 2JJSC 5D1XD 4IS6A 2BMKB 1DANU 4KFZC 4LBEB 4R4FH 4KZEH 3V7AE 2CLRA 4KDTC 5DF0A 1ZKAA 1PYWB 4JKMA 5F9DC 4TULL 2CQVA 2VQ1B 3NABH 4M7JL 35C8H 3SDAC 4BA8A 4NNPL 1W0VB 2XZAH 2WINB 1J8HA 1S7WB 3AGVA 3L3GB 2FO4A 5FYJU 2UYLA 4XI5D 3BMVA 2CJUL 3J7HA 4K3JL 3NIDE 4S1RL 5BV7B 3MLXH 4ONGL 1CDIA 4ODHH 5J3HD 2QADC 4HUVA 5I75B 4NO0A 4ZDHA 3MRGB 4G8GB 3MV9D 5K9OA 1B0RB 4EBQH 4U3HA 3MCKB 4FZ8H 1EFQA 4DWHA 1SY6H 3MRIA 2DTMH 2XFXA 4NQSA 3TNMB 4DGYL 3NA9L 4PTTA 4JVPA 4PJHB 2R1XB 4YXHL 3TT1L 1KIUA 4YIQB 2Y5TB 2CIKA 4XWOD 2DMKA 3IB4A 4LHJB 4LARH 5DJCB 5FUZH 4HS3A 3O9WD 4JZJA 5C8JA 2BVUA 4HPYL 3LN5A 3BPLB 1TZGH 1I7RA 4ZMAT 4QY8A 4HJ0C 3UTSD 1UB6B 4F7CA 5BXFB 1J1PL 2JB6A 3CSPA 1KCSH 3ZKXB 3KVQA 1U8MB 1A02N 3RU8L 1NC4A 2P5EB 3MLSH 2B1AH 3BD5A 2PYEA 4R4BB 3DMMB 3DX8A 3SDAD 3ILPB 3MCLL 4NJAH 4FTVA 3QZWB 5ENWB 1CVSC 4Y16C 2ZOLA 4PR5B 1NBVH 1AHWB 4N0RA 4ZNCD 3CDFA 4JG0L 3ZE1F 2C1OA 3B2UD 1QSEA 1ZVSB 3C9NA 2CDFA 3WMSA 4WFFE 1DQML 2F19H 3HRZB 4POZD 2DIBA 5FUOH 5T1DL 4N0FB 1QR1A 3MROA 4MQ7B 2X4UA 3DV4B 3PGDA 5IBTH 4X6DE 4ZTPH 1XGYL 1RUML 3TO4A 1FGNL 2EDBA 3BHBB 3G5ZA 4R8WH 5ICYA 4OCMC 3BKYL 3MFFB 5TH2B 1JHTB 2ZSVA 1MNUH 1DQDH 4KK5C 1JGDB 2MKWA 2JB5H 5C9JB 4YEFA 4H88H 4AMKH 5HHME 5TF1L 1TJGL 3B2VH 4EN3B 5TE7H 5MENB 1XF4B 1FYTE 1EJ6A 4L5FH 4PJEB 1P1ZB 4LVOC 2FLBT 3STLA 5DK0A 4OFIA 3GO1H 1X5GA 4HJ0D 1JRHH 3CNKA 3GSXB 1VESA 3LH2L 1IEAB 1EAJA 4RZCA 5J06A 3V8OA 3FOLB 4C56B 5HYIA 1NEUA 3F7VA 1QBBA 4NWTH 1VEPA 3FB5B 1XGTB 1YDPB 1JHLL 5E5UB 3EUUA 3IAGC 4X6BA 1Y0LB 4YXKH 3WFEH 3RWDA 3X3FH 4ZXBC 4PRPE 3QULA 2FATL 4P2QB 2EZ0C 2UZIL 3FFCB 3KPRA 4ODXB 2GAZA 1LNUA 1KG0B 4Y16D 2BNQE 2D4FA 4LKXB 5EOQH 4WNQA 1AE6L 5FECA 2IAMC 5ILTL 2HMIC 5B8CC 4ETYA 1EGJL 3C87A 2IH1A 3G6DH 4G6ML 3ZZ1A 5K33A 5IHLB 3VRJB 1BBJB 5IV2A 1H3VA 1HH6A 2B5IB 4Q0XH 3F65A 4OF3A 2DTSA 3T1FA 5SWSB 5EIIA 1T66C 1KJMB 1BZ7B 4KK5D 4NHCL 3V8CA 4K94L 3QDMD 3QIUD 3GI8L 3TJEL 1S7XA 3I84A 4PLJC 1G0DA 3EYSH 5DMKA 4X7CC 4CVZB 3CJJA 1OARL 2IQ9H 4JM2F 5EOTB 2CXKA 1A4JA 3MR9A 1TVBA 3BPNB 1A22B 3MRLB 2MCPH 3OKDA 5CAYB 3DX9A 4XBPB 2FHBA 1CICB 2I9TB 1DEEA 1EMTL 1PLGL 3D25B 1KB5H 3FCTA 3HNTL 3FONA 2V7HA 4FNLH 5FGBA 1C5BL 4IIQB 4NKQB 4M7LH 3BP4B 2HVJA 1MRDH 4ZXBD 5C0EB 2YPVL 4MNQB 3SE4C 2EZ0D 4JRXA 1YJDL 3FB6B 2R4RL 3T0WA 4EVNA 4Z0BL 2EKSB 2IAMD 1HSBB 1ZA6A 5D1ZB 2H26A 4ODHL 4XCFH 1YUHA 2DWDA 1MCPL 4JDZA 4PB0L 1A7NH 5ID0A 2RGSA 1VA9A 1EHLL 5JW5B 1CU4H 2J1KA 4FZ8L 6CGTA 1H8SA 3CDGB 2HJLA 4HEME 3LRSB 1JZ8A 3OAUH 2DTML 2HTKC 4NUJB 4NN7B 1T66D 1EFXB 4G3YL 3BGFC 2OI9B 4OD3L 5CEZL 5HSFA 1UM5H 1I9RH 4RX4A 1V7NL 3INUH 2NY0B 1KN2L 3DBXA 5C0RH 2ATPA 3X14A 3TO2B 5FUZL 2BNRD 2L0DA 4G42B 4PLJD 3TZVA 2F53A 1F8TL 1MUJA 4I4WA 1LK3H 3KNBA 4LCWB 5TQ0L 2DL9A 5ISZB 5FGCB 5HXMA 3VCLB 2HN7A 5C1MB 2YWYA 5TDOA 4Z7WA 4K55A 1AO7E 1PDKA 4HBCH 1LO0H 1SVCP 5E2UH 1MJUL 5CFHA 4YBLC 3L7EB 3TYGH 4OCXL 3K80A 4PIRF 4LPTA 4U1IA 3EZ8A 2HFGL 3KPLB 43C9B 3KYNA 4CADA 5JHDD 1GHFL 1C7SA 5HVHB 4WTWA 3T0EB 3OXSB 4WI5A 3HG1B 5D7LB 3LS5H 1A6UL 4WW1A 1AGCB 3DRTB 2EIBA 3FO9B 4GRWE 4GXUM 2W38A 2AERT 3D0LB 3L7FB 2J8UE 1Q1JL 2DLEA 4HK0A 5DHXB 1RZJC 4PJDE 5C86A 5IR1B 1A0QL 4DUVA 2VDNH 4ZTPL 2QBWA 1GZQB 4LLWB 3LPFA 4DQOL 4DJMA 1OAKH 1REIA 1T2JA 3OSKA 3OX8B 3DV6B 1MNUL 5CBAB 1MCEA 1EDQA 2EDHA 4X8XA 2GTZB 1UEMA 1NJ9A 3K4DA 1WSST 3MBXH 1DE4A 4YQXL 4LLQA 4JPVH 4ZS6C 1AD0A 1T83C 3E8UH 4P3DB 1X5LA 5E99L 1N59A 4KUCD 3LD8C 3MV9E 2ZUVA 4XP4L 2R69L 4UAOC 3CVHL 4O2FA 1CLYH 1JRHL 5DVOA 4MZ2A 3L5JA 1VACB 2IG2H 4JFPB 1MEXH 3ARTA 2A73A 2BXZA 3ARBD 5C0GB 2B0SL 1YYLL 5KN5B 3EO0B 4YXKL 1JCKA 1YMHA 2NNAB 4R6UA 2LQRA 3D9AL 1ZANH 1E4JA 4L4TA 4GKSA 4UNTA 3QEQD 1VEOA 1RK0B 3BOVA 3FAXA 3IDJA 3T09A 2O26U 3ARDB 2YXMA 4LBEA 3MLZL 4NQTA 4JM2C 2CIIB 2D0FA 1A7PH 1CVRA 1I9JH 5GJSL 2QQLH 1RY7B 2VQ1A 1UWEH 4G6AC 2ICWB 4BSJA 4X0KB 4ZYKA 1IZKA 1KBGH 5JXED 5IP4A 1J5OL 1DQTA 1S7WA 1AD9B 3S3SA 3L3GA 4M7KL 4FP8L 2CMRL 1FFRA 1KPRB 4X9FA 1WT5A 1WTGT 4G8GA 5K9KB 4RFNC 4JRWA 5JO5B 2PR4H 1KENH 5E8DH 4ELKB 2J8OA 1GGYA 4JREC 4XC1L 4HJJH 4PFEA 1F4XH 3MLTA 4S2SB 5GS2H 2DDQL 4AENB 2R1XA 4CDGC 2Y5TA 1OOAA 2ICEB 5DUPL 3WNNA 1YPZA 4FNLL 4P46B 1ZT4B 5DJCA 1LK2B 4PREA 2IBZY 3KJ4C 1T2QH 1KTLB 4LSQL 1V3MA 4OB5L 2X4PB 4JKPH 1FGVH 2E7HA 3CX5J 4PJ8C 5E2JA 4D3CH 3ZTJG 5ICXA 5BXFA 3CSBA 4OZIF 1FG2A 5A2KH 1X4YA 1ES0A 1EEYA 3BKCH 3QWQB 2RJMA 1P9MC 4Y1AA 2B4CL 3FQXB 4F7EA 2EC8A 1GC1L 1F42A 4R4BA 5EO0B 3VFOB 1DR9A 3ILPA 1EERB 4PJBB 3IF1B 5CEXB 3DWTA 2F54B 1LEIB 3GUTB 1AHWA 4YEEA 3OAUL 1YEKL 7FABH 4RGMB 1XH3B 1ZA3B 3FN9A 4GFTB 4Z7QE 3HRZA 4OQ1A 3N06B 1KGCE 4N0FA 5C0RL 4MQ7A 3DV4A 1F2QA 2J5LC 4Z7VF 3V6OA 5KSBE 4P2YA 4FG6C 4TQEH 3LHPH 3BHBA 3NPSC 1KACB 1X4ZA 1L0YA 3UTTA 3IDYC 5TH2A 4IBLT 1JHTA 4XBGB 4Y19B 4HXAL 4GAJL 1JGDA 3HS0B 4J3XA 1LO0L 3VXUB 1BECA 1CR9H 3QDME 2YD5A 1NL0L 4FZEL 4YDLB 4F33B 3TH2T 3RJDA 1MPAH 2VIRB 4EN3A 5MENA 1XF4A 3VXMD 3STBA 4DN3H 4PJEA 1P1ZA 3MJ7B 4J3VA 1CTNA 4KI5D 2YWZA 4CW1B 3EYQD 4HWUA 2BFVH 4PJ8D 5JW4Q 1D9KC 3L3DB 1IEAA 1X5YA 1I3UA 1QEWB 4HUMB 4U6HB 4C56A 1IKFH 4TUKH 3NCYS 3FB5A 1XGTA 1D5ZA 4P0DA 3I2CH 1YDPA 1LDSA 3ORJA 2RR3A 1Y0LA 4PBVC 2IGFL 3CFEB 3DJ9A 1PFCA 1JN6B 2R2EB 4LKCA 3PP3H 4P2QA 4POYA 3RX5A 3LMJL 1KG0A 4UTAL 1QTYT 4D0DB 3MSPA 1MFNA 4F37K 4F7MA 3U82B 2IF7A 1UKTA 3M17B 5DVLA 1TQBB 1WC7B 1OSPH 2Q8AH 4KZDL 4MB4A 1BHGA 1S8DB 4U1MB 4H5SB 3VRJA 4LLMB 2DM4A 4PD4J 1BBJA 5IT2H 4RDQG 4FG6D 3Q0HA 3ARYA 1LILA 5T1KA 4JCMA 4NT6B 3QFDB 1NCAH 1K3ZA 1DLFH 1NFIB 2X42A 1E0OB 2ZNXA 5DQJB 4ZFGH 1ZGLM 1U0QA 2XZZA 4NRXB 5FV2A 4Z5RB 4CVZA 1V7MH 2DJ4A 1OM3H 5EOTA 3WHE0 1BZQK 1WQVT 2BNRE 3KWWA 4BQ8A 3QXTA 3PF2A 4IMKA 3OJ2C 1IBGL 5DO2C 2AK1L 2EE9A 2P4AB 3GMLB 1E6JL 4R7DB 4X98B 1CICA 1D9KD 2R56L 4O4YH 5T33L 3D25A 3QCVH 1TVDA 4HFWB 4JB9H 3VFRA 5I15L 5CINH 1VADB 4D2NA 3P4NA 2E9BA 4BM7A 2EO9A 4GRLB 4IIQA 4Y4FD 5JHDE 3MACL 3QUZC 4MNQA 1KBGL 3KDMB 2MJWA 1W72H 5D6DC 3FB6A 3QG6A 4LQ1A 5D71L 2EKSA 3CPLB 4YFLF 5TF0A 3HZKB 4Y5VC 4YHLH 2HTLC 4L3AA 5D72L 5J89A 4N0YL 2QSVA 3P0GB 4ODSL 2AS5M 1AC0A 3QR2A 1LO3H 3LRSA 1NUGA 4LFHG 4J1UB 4NUJA 4U6TA 2ICWI 2GUOB 1YNLH 3HE6C 1I9EA 3H9SB 1R3KB 3PV6B 5IBLD 3TO2A 3B9KB 2YK1H 3PP4L 4G42A 1LP9F 4MS8D 1JHKL 2AJZB 1U8IA 1IFHL 1JPTL 4PB9H 2OK0L 5L0QB 3DGGB 5ISZA 5JOPD 1ORQA 5IKCB 2DQGL 1FGVL 2D9QB 2ZJSH 3ZE0E 3RVVC 3IFNH 1M71A 4KK6C 1TITA 1K4DB 4GBXC 2P43B 4U6VH 1CGWA 3VI4E 4AJ0A 3L7EA 1DBMH 1DQQB 2W59A 3GSUB 43C9A 2AXGA 2ZNWA 1Z9MA 1DSFH 1VEMA 1XGPA 1UYWH 4KWUA 5HI3C 3QEQE 4QF1B 4PLNC 2YUXA 3OXSA 5LWYL 3C60C 7FABL 1OB1A 3HG1A 3PDDA 4KK8C 1U8OA 3C6LB 1AGCA 3DRTA 3FO9A 4I3RH 3O41B 4PJXE 4APQC 4L8SA 3ZYIA 5GPRA 5SWQB 2KKQA 3O45A 1Q72H 5IR1A 1FV1B 5ANMA 1YNTA 4Z6AT 4KV5E 3OL2A 2HTLD 4LCIL 1GZQA 3FTGB 4LDEB 4LLWA 1TMCB 1GZPB 5IROC 3ABZA 3UYRH 3O2DL 4RMRA 1K6QH 3TCLB 3OX8A 5C7XL 4Y5YC 2V5YA 2DI8A 3HUJA 1CR9L 5EORL 1W8OA 1Z3GL 3HE6D 5T5FL 3TC9A 1QFUL 4OIIH 4DN3L 1A6VL 4LGPB 5LGHH 4F15C 2LTQC 2WBWB 1ZT7B 3ARGC 2YRLA 3RVVD 5JORB 4TTGA 4RAHA 5I30L 3LEVL 4TUOA 5K59F 4C58B 1VACA 3CXHK 4JFPA 3UJTL 5CKAA 4GBXD 2MHAA 1RPQA 3JWOL 1WZKA 2D7TH 2F8VA 2FO1A 5KN5A 3MTRA 2GW5A 3FB7B 1I85A 2BXYA 4P4KB 2Q8BH 5MEPB 1CZ8H 5KS9A 4HMCA 1I7ZB 4PJGA 1K9TA 3VDCA 4NP4H 4U1GB 4G6JH 1RK0A 5HI3D 3WO4B 4NRZB 2AK4B 3WKML 5BCAA 1P7QA 1VPOL 1PG7H 2IPUK 5EO9B 2FJHB 1WCBB 4OM1H 1CGTA 2CIIA 1EEQA 5FA3B 4APQD 4MDJB 3Q5OA 4MCZA 4UBDD 3B4NA 2ICWA 1L9NA 4WTZG 3RVUD 4PJ7E 1HYRC 4LQFL 3ZTJH 2Q76B 3SKJL 1AD9A 1NCAL 4X5LA 4GMTL 3SCMB 1KPRA 3WKNA 1IVLA 1WGOA 4ZFGL 3EFDH 5E7BA 4UQ2B 5AAWA 1DVFB 4YHYB 2AJVH 2WV3A 5FCUL 1WZ1H 3FMGL 1F3RB 3T65B 5A2FA 3U46A 1B2WL 5K9KA 4GRMB 5JO5A 4M43L 3IFPB 1P4LA 4ELKA 1HYSD 3HC3H 5AZEH 1NGYB 1K8IA 1HWGB 1RHHA 2P1YA 2LU4A 4S2SA 4O4YL 2ICES 4HPOL 4AENA 4QRRB 5HBBA 1HNGA 1JGUH 2ICEA 4L8CB 5GGUA 3UO1L 4P46A 3NIFF 5FYJL 1ZT4A 4PUBL 3D2UB 1R3JB 4GW1B 4MNGE 3HZMB 1YQVL 4MD0B 3VXME 2VXVH 2EE2A 3V0WL 1IILE 1KPVA 4Z7UB 1UXWA 3SOBL 4KI5E 2X4PA 4N68A 4JFFA 3V7MA 1N7MH 3P0YL 3MLYL 1W72L 3ZL4L 1G84A 5J57B 5J11C 5D7KD 3OAYH 3KS0J 3PV7A 2DICA 5IB5B 4LMQI 2PW1B 1KIQB 4JZJC 4NO5A 4RIRB 4YHLL 3FQXA 4ZS7H 4R7NB 5EO0A 3VFOA 1N5YL 4KVNL 5CEXA 3IF1A 2ARJA 1A3QA 1BEYH 3ISWA 4LOUD 4P2OA 1LEIA 3GUTA 1LO3L 3JV6A 4N5UA 2YRZA 5BV7H 1MVFA 3MRJA 1ZA3A 1AXSB 2XZQH 3MRRB 1OAYL 3H3KA 5D96B 2D31B 3B83A 1U95A 2YK1L 4Y4HA 1AXTH 3EIFA 1YA5A 5F72S 1J8HD 2ZJSL 1Z0MA 4XBGA 2X70B 4HUWB 1B90A 3HS0A 3QA3A 1T7VA 1KN4L 3FZUD 4ZNEA 3MRKA 5IMOB 1A21A 4Y8DC 3VD5A 4F33A 2ICWJ 2NY2B 3RWGB 4OJFH 4G8FA 2VIRA 4Q74A 1DSFL 3MJ7A 3CLFH 1QKZH 3WFHB 1O7SA 4I0KA 1S5IH 1YEEH 3AROA 1V8HA 1QEWA 4U6HA 4FXGB 5ALBH 2RQ8A 4HH9B 3GMPB 3CD4A 4D94A 3RVXC 3CFEA 5KSAB 3WYRA 2AXHA 1QBMH 4MVBC 4Q9QH 2J4WH 4F8TA 2PO6B 4M5ZH 4D0DA 4XVTL 3BH8B 2EH7L 5DI8A 3VXRB 3HPJB 3EOYG 3HI5H 3M17A 5I1CH 1WC7A 4LP5A 3MOBL 1OP9A 1S7QA 1KB9J 4ZFOL 4LASH 2NQCA 3TP4A 2BOBB 4LLMA 4PJ9B 4I48B 4KKLD 4EOWH 4HBQA 3MRFB 3RX7A 5D7IB 4NT6A 3QFDA 2V5MA 4KTYA 1QSED 3GKWL 3B8YA 4TTDC 5DQJA 2I27N 3VGDA 4NRXA 1MVUB 3JWDH 4Z5RA 4M61B 2FH8A 3QDJD 4YGVB 1FFPB 2P5WD 4HG4J 1QLFB 1TZIB 1JNLL 2R0ZL 1N5AA 4EDWH 3HZVB 5JOPE 3O6LL 4BQBA 1XCQB 2IBGA 1IGFL 1RZ7H 3EGSB 1H15A 4L9DA 4GG8A 4R7DA 4X98A 2HG5B 2VDMH 4ONHA 4JR9H 1MJ7H 3RGHA 4YHOL 5EWIL 1VADA 2FBJL 3MLWL 2IPKB 5C0FB 4GRLA 5E5MB 4M1GH 3H42H 4S1QH 4FQIH 5IEHB 3KDMA 4I2XB 2FX8H 3WFDL 4ZFOB 1RK1B 3O6KH 3CPLA 5JR1L 3TLRA 3HZKA 5I6XC 5FGBC 3QNZB 3G04A 5EA0H 5I18L 1KCLA 3UPAA 8FABB 3BPCA 3PHOB 1FZMB 1OTTC 3P73A 4HX1B 4J1UA 2GUOA 4TTDD 1JZ7A 5EN2B 2HRPH 1KIPB 1JPFA 3H9SA 1YPZF 2MFNA 1NSNL 4H0GA 3B9KA 5IB2B 3KPOB 2AJZA 5DWUL 4FMFA 3DGGA 1AIFB 2PETA 3C08H 4AEIH 2X09A 4RDQF 1FFOB 1WBYB 4UMGA 1U93B 1K4DA 4PP2B 3FRPA 1HK6A 5T5NG 4WO4B 1DQQA 4OGYL 3EYUL 3P2TA 2X6MA 1UM6L 3GSUA 3TZVC 2WAHA 3ARFB 1C1EL 4B0MM 1WEJH 5DJ2B 4JFYB 4M00A 2V7NA 1SYSB 3DSFH 3SO3B 1ADQL 1Q9WB 3KJ6L 1VFBB 2H1PL 1WFUA 4QF1A 1QRKA 2G60H 4QGTA 2VDPL 3SDYH 1J0HA 1R3LA 3C6LA 5IMKA 4TRPH 3O41A 2YKLH 3LIZH 4HUNB 5DYOB 3JWNC 5DRWB 3EW3B 1GZPA 2QKIA 1KPUB 4JCLA 3WEXA 2HJKB 2NMSA 3TCLA 1CG9B 4U6YB 1U8LA 1PG7W 1MCKA 4GQ9L 2EDQA 4NKOB 2BJML 4ZO8A 5JIPA 2OZ4L 2YUZA 1WWBX 3S36H 5E94B 3RZCA 1FNAA 2DLFL 4KKNA 4WW2B 4GXUN 1QKZL 3AREA 4OZHE 3WL9B 4XBEH 4XB7A 2JCCF 5HHVH 1MCRA 1ZT7A 4GH7B 1FN4B 3E3QE 1QYGL 4FQCH 4HT1L 2DL2A 3BIAX 2EYRB 3TBWA 2DBJA 3FB7A 4N8CL 4YNYB 4P4KA 2AJSH 1P2CB 4LK4A 3ZT6A 1JPSL 4OZGA 2VE6B 4HXBH 5IHZA 4NRZA 1I1CA 1MFAH 2AK4A 2YD9A 4OI7A 3M07A 5D7KE 3U7AA 5F88A 2FJHA 5JHLH 3PWJB 1WCBA 1BOGB 2ZKHL 5DXWA 5FA3A 5FYLH 3X12B 3BGMB 4MDJA 5L88L 2P24A 4LCCA 4M6NL 4POUB 4U2ZA 4I0PD 4KHTH 2IEPA 3H8NA 5DHYB 5MERB 3LQAL 1TETL 4BYHA 3FRPG 2J12B 3SCMA 5I1IL 1E4XI 2ZZUT 1IC7L 3WDHA 3KS0H 2I26N 1GOGA 4X7SH 2V2WB 1F97A 1KT2B 2MWCA 4UQ2A 3OKNB 1E4WH 1H0DB 3BW9B 4HUKB 2VDQH 3MYJB 1G7IB 3NCCB 3T65A 3OBAA 4JKLA 4RCAA 4GRMA 4C57C 3H6JA 6FABH 4IJ3B 3IFPA 4D9LL 3LN9A 1J8HE 1OTUD 1ODAA 3SHSA 4U1HB 4YWGH 3D5OF 3BT2H 3U0WH 4QRRA 4JR9L 5EO1A 1N6VA 2G9HB 5BV7C 4NGHH 1YEJH 5I75C 1R3JA 4PJCE 3M45A 3HZMA 1MCSA 4ZOEA 1OW0A 4OZ4B 4PRDA 4Z7UA 4M1GL 3H42L 5DC9B 4X99B 2BSED 3NOIA 3MGTB 4F58L 5E08L 1QZ1A 5DS8B 5JDJA 1M1SA 2L4OA 3SQBA 5GS3A 5EUOB 2CK0L 4RIRA 1ZTXH 4Z9KB 4F37F 4U6XA 4R7NA 3RAJL 5JTWA 3BPLC 2NY3B 5IBUB 3S9DB 4L4TD 5IMMB 1P5UA 3FFDB 4NZRL 4OSUH 4O5LL 3ZKXC 2W0FB 3LKQB 1BZ9A 2NW3B 4KGJA 3WCYA 1ZWIB 2V9TA 4OGXH 4OLWH 5B39B 3V2AR 2ZCHL 3MRRA 3U7YL 4U31A 5TJWK 3AB0B 1KFAL 4LL9A 3PHQB 3HMXL 1U8HA 4WUKH 4JQXA 1RZFH 5HHNB 2DBLL 1R5WB 1AHWC 4OCSH 3PWUB 1YY9C 1HHIA 3R1GH 1RJLA 4P57B 3V0VB 5C0BD 2X70A 3GGWA 3BKMH 3OAZH 4HUWA 1GJIA 1QSEE 1RI8A 4UQ3B 4OAWB 5IGXH 5JOEA 1L7TH 3PXJA 2I60H 1CDBA 1JWSB 2H8PB 5EBWA 3QDJE 3V6OC 5F1NB 2DAVA 3S35H 4PJAA 5EIVA 2P5WE 1PY4A 3WS6A 2AJ3A 2YUVA 2OSLB 3IFLH 5E70A 4BH8B 1U58A 4F80A 5LBSH 1IGTB 1HI6B 1HH9A 1T7YA 3NH7L 1MCDA 3FQNB 4TRPL 1B3JA 2Q7NA 4HWBA 4HH9A 4EN3C 5DJAB 3JWDC 4XCEB 5KSAA 4FQ2H 4LVNB 1UZ8A 4J3WA 4OUUA 2PO6A 2A6DB 5F7UA 1RJZA 2Z35B 3BH8A 3KPNB 3BJLA 4OGZA 4JQVA 4Y8AA 3HPJA 5EZLA 2QQQA 5IFAH 3HUJF 5HI4C 1RIUL 2Z93A 1H5BB 2P5ED 4DKFH 1T0MB 2QSQA 4H8WC 1J0ZA 3DMMD 4I48A 4KDWA 1YN6B 5BOPA 5B3JF 4KDVA 3PQYB 5D7IA 4PRAB 5EUKB 5LCVH 5ERWB 3CSGA 1MVUA 1VFUA 4M61A 4O2CB 3S34H 2GCYB 4YGVA 1DBAH 2MNUA 1IM9D 1FFPA 3QUXA 3R06B 1AJ7L 1TZIA 2B5IC 1UKQA 3HZVA 2VWEE 4PJIE 3SGDI 1XCQA 4LSTL 5KS9F 4PJGF 1TTGA 3H0TB 2W07A 4P9HH 1A14H 3P4MB 4NNXA 1A6WL 1TPXB 3CZFB 5HHPB 1XF2B 3BAEL 2HG5A 3MGOB 5CJ5A 2Y1VA 2Y25A 2X7LB 5JHLL 1QLEL 3Q5TA 4N8VB 2APFA 4X4YA 4IMKC 4OFPA 5MEND 2LE9A 3BPNC 5C0FA 1F00I 4K8RL 4LPWA 3BSZL 1MCFA 1ZT1B 4XNUL 4CMMA 1JF1B 3W9EB 1ZOXA 5IEHA 3MA7A 2ITCB 1CICC 3S6CA 1YEGL 4FQJH 3CK0H 4C56D 3ROLB 4UIKH 4YDJB 3A6OA 4K9EH 1E4WL 5HI4D 2HFEA 1FYTB 4UOW1 4IIQC 2XNAB 3TIEA 4P2QD 3FFCD 1IJ9A 3BO8B 4Z7NF 2EIDA 8FABA 5I66B 1FZMA 3MUY1 1A7BA 4YWGL 5HDBE 1FORL 1T3FB 2D0GA 5EN2A 1QO3A 4NC2B 3S98A 2APVA 1KIPA 4QRUB 4YLQT 5IB2A 2DWEB 4FN0A 1A6AA 5C0AB 2OTUB 2AABH 2XOTA 1AIFA 1RIHH 1UENA 3VI3F 3I9GH 5SWSD 4NN7C 1OP3K 3MRDB 4H0HB 4U3XA 1Q8MA 1WBYA 2XQYK 3KYKH 2VKXA 1U93A 5DUML 4LNRB 3HKFA 4PP2A 1MJ8H 3VGHA 1GCFA 4XHJC 1HKLH 1RMFL 3R0MA 5DK2B 3EOTH 1RZKH 1T6VN 3ARFA 4D9RD 4N5EC 4RFEA 1VKXB 1ZTXL 4JFYA 1XF3B 1HIMH 1T0PB 1SYSA 4OUOA 2MKLC 1SMAA 3AMLA 2YC1B 1VFBA 4DCQB 1OAZL 2OYPA 4Z7WE 1LWRA 5JPNA 2XA8L 1CICD 4QXGL 1I1FA 1NDMB 4KMTL 4OLWL 2B8OT 2NX5A 2YMXH 1SBBA 4JLRB 3LQZB 5DRWA 5A16A 1X6LA 4WUKL 1MHHB 1YJDC 1TNMA 1JNHB 4NC0B 5IQ7H 5E1AB 3T4YA 3MOQA 1IRAY 4PV8B 3CC5A 3T0EC 1KPUA 1R5VB 1ACZA 3M8OL 3RJQB 4N0CC 5I1KH 2EICA 3SJVB 1CG9A 3OKOB 2HRLA 5IGXL 1L7TL 2QHLA 4WHDA 1MHEA 3DVFA 5D1ZD 2FZ3B 2FBOJ 1U8KB 1JYVA 5ESAA 3TBTB 1S3KL 4UI2A 4CJ1A 1E27B 2GJZB 5INCB 1OP5H 5C9KA 4LSUH 2MQ0A 4J6RH 1QBLH 3WIIL 2ERJB 1B6UA 2PKDA 1EFXD 3NFSL 4EJ1C 3I3BA 1EO5A 2C3GA 3B5TA 2NY0D 4XHJD 4N0UB 3EJJX 3S4SA 4YHML 1T22B 4N5ED 3ZDYE 3NPZB 4LCWD 4WI7A 5ISZD 4TVSa 1I9IH 4D0CB 4JFHD 3GNML 1G9NL 3RUGA 4NM8L 3D0VB 3EYFA 3VFWB 2IH3A 3PWJA 5D9SB 4PTUA 5EC1B 4HIEB 1I85C 3U9UB 5T5NF 1MFEH 2XTJB 4F2MA 2XPGB 4OCLC 1QSFB 1EIBA 4L4TE 4NN5C 3OHXB 4F7PB 5DHYA 5JOFB 3T0ED 3TFKC 5D7LD 2V2WA 1KT2A 1RUPL 1R5IA 2EO1A 3KHQA 5E7FA 3OKNA 5BVPL 1CT8B 3BW9A 1NGPL 3QIWB 3MYJA 4LPXA 4HGWB 3S34L 3D1MC 3HCVB 1G7IA 4WJ5B 4EXPX 2A38A 3OB8A 4AM0B 2OBGA 3QNYB 5FYLD 1JFQH 3IDNB 1L6XA 1X5FA 4P9HL 5CEZD 5C0BE 4U1HA 4YHIB 1FNSL 2E6QA 3BEVB 2OL3L 1TQCB 4P23B 2W60B 3P11H 2G9HA 1HXMA 3R8QA 4P5MB 3UDWA 4N8PA 1BBDL 3SDXF 5F9JB 1TJHL 1VSCA 4X99A 5CIPA 5HHXL 3MGTA 2WUCH 4DTGL 4PGCB 5DS8A 1NC2A 3ZO0A 4LRIA 4J2XA 2NW2B 4PJHE 4IDLA 4P46C 5EUOA 2QSCH 1IAOB 4UOJA 2HLFD 2LV4A 5DMGC 4N1HB 5JZ7C 5JIHA 4K2UL 5D70H 3KLAB 3G6JB 1N8ZA 5IMMA 4G9FD 4F9PA 2YPLB 3CDYA 3FFDA 4D8PA 1B4JL 2W0FA 3LKQA 1U8JB 3Q3GB 1HINH 3ARDD 5F6HI 2NW3A 1TJIH 1LGVA 5D5MF 5IVXB 3CXDL 2XQYG 5EU4B 2Z0BA 5B39A 3S4SG 2HKFH 1T1YB 2P5EE 4G43B 4GXVL 3FO2A 5KTEH 1ND0B 1MAJA 1FIGL 3O8XB 3OB0K 5HHNA 4P2OC 3PDOB 3SE8L 1R5WA 3PWUA 2HT4C 5IFHL 4P57A 3V0VA 4EI6B 4EI5A 4RGMC 1T4KA 3TT3L 3FN0H 4UQ3A 1FAIH 3OZ9L 3FB8A 2BVQB 2R4SH 1BLNB 2X41A 2HVKB 3OPZL 1HKLL 2H8PA 4Y4HC 1II4E 1RZKL 3VXQB 5F1NA 4BK5A 5I8CB 1RD6A 4YBHA 2OSLA 3U9PH 3BUYB 4JO3H 5KVEL 5EC2A 2FSEA 4CU7A 1IGTA 2IMNA 1HI6A 3VXPB 1A3LH 3C5ZA 1S9VB 4NQCD 5FDYA 2ZUSA 3KR3H 1A1NB 5DJ0B 2IJ0C 1Q9OB 2VISB 3OKKB 4DFHA 4YDLC 2GYSA 2FWOA 3ZMRA 4P46D 4XXCA 2MOVA 1BQLH 3LEXB 3MRHB 5FUCC 5L2KD 5MENE 4M1DH 1CFBA 4PJEE 3BN3B 4NC1C 4IRSD 1CQKA 1Q9KB 4F9LA 1I4FB 4JQIH 1CFSB 2R15A 2B4CC 3KPNA 3DURB 3QDGD 2EIZB 2XY1A 4C56E 4YHNB 1J0JA 5F3BB 1LEKB 5F6IB 1CFVL 3FQWB 2BY1A 2HH0H 3P9MB 1T1WB 1JWUB 1YN6A 2EC9U 4P2QE 3FFCE 1QA9B 2A1WL 2BCKA 2F54D 5GGVH 2BVYA 5EPMB 1DJSA 4PRAA 1BQUA 2EDKA 2IPTH 1IC4L 5F8RC 3KPPA 1CD1A 4Y4KA 2GY7B 4O2CA 2VDKL 4UDUB 2ZUYA 2GCYA 1NUFA 4HKZB 5L6YL 3E1F1 4K9EC 4DVRH 5BRZB 3B3IA 5C0JB 1MAKA 3TIDB 2XRAL 4OZGF 5SWSE 3P4MA 4HWBH 4Y19D 4ZAKB 5GRUL 3CZFA 2H2PC 4NJ9H 3WUWB 5HHPA 3VXUD 5CD3A 5I76B 1RURL 1E4XH 1BPVA 2X7LA 3VXOA 4MNHA 3L95B 1KEGH 4N8VA 4D9RE 2RBLA 4YUEH 1J05B 5CZKA 1C5CL 5C0NC 4MQXD 1UM4H 5C08B 4BH7B 3S88L 2UZXB 5C6TH 5DC0A 3TWCH 4AG4H 2HP4A 4WTXA 5GS0H 3DVGB 1JF1A 4S11A 1PY9A 5HD8D 3V7AG 2ITCA 5A40E 3IAQA 1M4KA 4OKVB 3QRGH 3EJYC 2X4RA 4DGIL 4PRHD 3BQUB 3S5LB 4YDJA 12E8H 4U7KA 1NAML 3RDTB 1G7JB 1FYTA 4GRLC 3V4PL 4RA0C 1SBSL 3VD4A 2XNAA 4DW2H 3PIQB 5JLZB 1EA9C 1HEZA 3BO8A 1J1XL 2PW2B 3LZFL 1FCCA 1OY3B 2XYCA 3T0DA 5BMFL 4DOHB 1U36A 1EHXA 2ORBL 4Q2ZB 3GBMH 1SJXA 1T3FA 2P47B 2VB5A 5J6HB 1KLGA 1INDH 1BFVL 4QRUA 4KKBD 4DZBB 3WXVH 3LKOA 2DWEA 2KQMA 3IDXH 1T5XB 4PRPA 5FIEA 2OTUA 5C0AA 2D9CA 2E7MA 4JGUA 5AAMA 5TGBA 5EBLA 2X1WL 4XPBH 3UPRB 2WUCL 4K71C 5D2LB 2HT3C 5A1AA 3MUGB 3PGFH 3LEYL 3TVMB 5DURB 4LNRA 3A0OA 4J3TA 1WIPA 1MFBH 4UV7L 3TPUB 4A6YL 4HIIB 5DK2A 3B9KC 1C16B 2N1KA 5I17B 1VKXA 3IETB 1XF3A 3GK8L 3UMTA 5D70L 1KIRB 2QQNH 2VAJA 4KJPD 4LCWE 5C0ND 5ISZE 2YC1A 1SJHA 5FGCE 4PP1C 4HCRA 2XG5A 4KY1L 3MXVH 4JFHE 2YA2A 4HV8A 2E9JA 3HNVH 4K7PY 2Z4QB 2DLHA 5J56B 1NAMB 4JEGB 5IVNA 3EJYD 4FQHA 4OF5A 4ORZC 4JLRA 3LQZA 4XWGL 4JRYB 3IU4H 5CJQH 1RHFA 4XX1E 1YQ2A 4Q9RH 4PPTA 1CGXA 4J4PA 1JNHA 3UBXB 1M6OB 3C09B 4PV8A 4Z8FH 5JQHC 1VFOA 3T0EE 4JM4L 4JAMA 3C6LC 1JMXA 2Q86B 1TFHA 5D7LE 3OKOA 3SJVA 5F7FA 5CSBA 3I3EA 5F6HJ 1MCIA 4TVPD 2OCFD 4O02L 1NMBH 2GITB 2FZ3A 1S7RB 2NY5H 1U8KA 4PJAF 5ADOH 4OQTL 3MNVA 1FO0B 5FOBA 1ZMYA 5B22A 5FYLE 2A9NH 1E27A 4KHXH 2GJZA 1Z9OA 5CWSB 5CEZE 4ELMF 4A6YB 4QXTA 4EUPB 2HT3D 2NY6B 2X1QA 1UCBH 2J6EH 1N0LA 4KXZI 4JGMA 3HNSL 3H9SD 3PHSA 4N0UA 5IB4B 2R2HB 4KUZH 1FFQA 1PSKH 2DLTA 2I24N 3AREC 1BAFH 3V9FA 4HC1A 2GK0A 4D0CA 3AM8C 4KPHH 4FQ1L 1N3NB 1F6LL 1WV7T 3VFWA 1S78D 5FFLA 2V17L 5EC1A 4HIEA 4XGZA 5E8NB 2JELH 3U9UA 3QRFM 2B2XL 1UXSA 2GSIB 4P4KC 1N26A 1JPGB 3MXWH 1J88A 5HGHA 4U1GC 5GRJL 3ULVH 2EDFA 4G9FE 3WO4C 1EV2E 5JOFA 2J7LA 3SGDH 4N9GA 2YSSB 1MQ8A 4TSAH 5E6YA 2HFTA 4YZFF 3VA2C 1T0NA 2IADB 1FE8L 3ARBB 1DEDA 3HA0A 4LCCC 3X3GH 1CT8A 3QIWA 3HCVA 4AYFA 4AEFA 5FK9A 4AM0A 3HLAB 5FYKH 3QNYA 5L9DH 4RMTA 3IDNA 1I3RB 4XCNB 4UUJB 5CZVH 3SCMC 2BVEA 3VFSB 4YHIA 4UINH 4JJ5B 3BEVA 1BVZA 2VXTH 4P23A 3MQIA 4NO2B 1F3JB 4YHYC 5LQBH 1EZVX 4PJDA 4F57H 4P5MA 2CUIA 1RULH 4YUEL 3GMMB 4KROB 2WIIB 4G7VH 4JHAH 1UM4L 5E03A 1A3RH 5FB8B 3VG9C 2LVCA 2UVEA 1M7XA 2F58L 1DBBH 3F5WB 3V4UL 4AEHL 4PGCA 4JFDD 4NQCE 4E41B 5J1AB 3ME0A 1MIEH 4YE4H 5CP3A 4OFKA 3MV9A 1OW0C 4CJ0A 4JPWH 5L2KE 3KLAA 5DZNA 1IGIL 4OF0A 1MCHA 2UWEF 1OVZA 3RIAF 1YNKH 1U8JA 3Q3GA 1I7UB 1FVEB 3QDGE 3GM8A 5IVXA 1JWMB 1XR8B 2NY4B 5EU4A 1X9QA 1JGLH 3RBGA 1T1YA 3UJJH 3GHBH 1OTSC 4G43A 4G5ZH 1ND0A 1A8JH 3GI9L 1TNNA 3O8XA 4PJBE 2RCSH 4YK4B 3PDOA 1XMWA 2N7AA 2Y07L 3PNWA 2F54E 5TE4L 4EI6A 4DK6A 3W5NA 3SCMD 1IAMA 3WIFB 4OCYH 1BLNA 2HVKA 5D96C 1JZ6A 3RTQB 1DVFD 4JQXC 5F1OB 5CIPH 4R97C 4PJ7B 5I8CA 2Q6WB 2QQNL 3BUYA 2E5EA 5AZ2H 4L8BB 1KCKA 5CGTA 5IW1A 3VXPA 4Y19E 1S9VA 1TENA 1JTPA 4WHYG 5DJ0A 3OKKA 1Q9OA 2GTWB 2VISA 3QISA 4KJWD 4QRRD 3BPOB 3VXUE 4TOYH 4ZNEE 5JNYA 3ZHLA 2VLKB 3GJFK 4WY7H 5TQ2H 2XXMB 5KW9H 5KSVB 1J1OH 4DAGH 2VL5B 3WS6C 3D2UD 3VMOA 3LEXA 3MRHA 1GPOH 5CHNB 3DXAB 2UY6A 1CL7L 5DHVB 2AQ2A 5FUCE 2YHGA 2BSTA 4OT1H 4QRSA 1LE9A 1Q9KA 43CAB 4B5EA 1I4FA 2FHFA 1CFSA 4EXKA 1XIWD 2PTUA 5E8PA 3DURA 2EIZA 3ULVF 4WU5B 4YHNA 4PRHE 3S37H 5F3BA 3GSWA 1NMBL 4HUUA 3S3PA 4WEMB 3V5HA 3FQWA 5KSAC 4QT5B 1OTSD 3U0PB 1PKQB 5ADOL 5C2BH 3IGAB 1MREL 1T1WA 1WZMA 4FFZL 1JUFB 2PO6C 2EEBA 1QA9A 4O51A 2ZG3A 5BQ7B 1G9MH 5EPMA 4JQVC 3OGCA 2Z8SA 1RVFL 1Z2KA 5TE6H 3EFFB 2FR4B 3SGKC 1OPGL 3KG5A 1VGEL 2DQDH 2J6EL 3AVEA