5T1KD

Cetuximab fab in complex with cqfda(ph)2strrlkc
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
220
structure length
215
Chain Sequence
b'QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSAASTKGPSVFPLAPSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CETUXIMAB FAB LIGHT CHAIN
publication title Natural and non-natural amino-acid side-chain substitutions: affinity and diffraction studies of meditope-Fab complexes.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
total genus 45
structure length 215
sequence length 220
ec nomenclature
pdb deposition date 2016-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5t1kD02
4O2CA 4R8WL 1HHIA 4PJDB 1CL7L 3DURA 3ZSSA 1X5AA 2AQ3A 1FRGH 3B2UC 2C3VB 2VC2L 2MPAL 2NYYC 1RZ8A 3MREB 1P1ZA 4R97B 3MRRB 3WDIA 3QEGH 4X6CA 2I07B 3KPMB 4JFXB 2AGJL 5DFTA 5E7BA 1MFNA 2Z0BA 4DJMA 3SEPA 5IQ7L 1JNJA 15C8H 2FL5B 1DQTA 3MV9E 2ZOLB 5DJXA 5GS0C 5IEKA 3U82B 5FV2A 5EO1A 5SWZD 3QAZC 2UWEE 5EG6C 1I7UB 2BY3A 2ZJSH 4P5MA 5L7XH 4PRDA 3MOAL 3LV3A 4YXHH 1TZGH 1JHLL 5T5FL 3N9GL 2DLFH 1KIQA 5EUKB 2EYRB 4PJ5E 2VLKD 4MQXD 1FCGA 4KJYB 1MHPH 3DX9B 4J8RB 2N1KA 4F33A 3F5WA 1DE4B 3QXAA 1I9IL 2VIRA 3C5ZC 5DMYA 3WSQL 3CJJA 3GSOA 2P44B 3MRLA 5ILTH 4NWTL 1SEQH 3ME0A 1YEGH 3RGHA 4NKOA 3CU7A 2HN7A 4NT6A 3T3PF 3QUMB 2V5SA 3ZKQD 4TYUA 4FQ2L 2Y4SA 4RMRA 3NCYS 2QSCL 1CCZA 5C07B 2B4CH 4UILL 3QIWC 1LE9B 1CWVA 1OGTB 3MRNA 4PP2B 2Y1VA 5JORB 3PABA 4S0SD 5IFHH 4KZEL 2AV1A 2D7TH 1BAFH 1IGTA 4LARH 1HSBB 4JFFA 4EBQL 3K74B 3LQAL 1P2CB 4M7LL 3KAAA 4FABH 2Q7YB 1HH9B 1EUTA 1RZKC 1YMMA 3FT2B 3BESR 1E27A 5B39A 4NZTL 1OAUL 3FQRB 1LO5A 1DQQA 4P5TD 4KQ3L 3B3IA 4G8EB 4YXKH 1DUZA 3GHBH 3QIUB 1ZS8A 4AG4H 4DN3H 4JY4A 3GSWA 5T5NG 3QPXH 1U3HC 5CP7B 1RK0B 4WI8A 2XA3A 1JCKA 1G84A 5C0EA 4BH8A 3FQNA 4LGSB 4U1LB 1CT8B 3SE9L 4Y5YA 4NSKB 4JFDE 4GBXD 3MC0A 4OZHE 2CLVA 2NY0B 4LPXA 5CUSL 2V7NB 4A6YB 4WW1B 5DLMH 1ORQA 1T5XA 3SGJA 2DQFA 5FYLE 2CPCA 4GAGL 4U6YB 4XVUC 1YMHB 2NY5H 4QTHB 1U36A 3RWDB 3T1FA 1ZLSH 3KLSA 1YEFH 4C54A 4OCNC 5JOFB 1JGVL 2E9JA 5DJAB 1XF1A 4NRYB 4JFPB 4LHUA 1G7QA 5A1AA 3MYZA 4POUB 1YJDL 3M45A 3QHZH 4ELMF 1B4JH 3E6FA 4RX4A 4A6YH 1KG0A 4F7CA 1C5BL 2Q8BH 4E41E 2G2RA 4RFNC 4LF3A 3LN9A 1QLEH 5DHYB 4K23H 5EBLB 3HE6C 4X9GA 3BI9X 4GMTH 3ZKMD 5IROC 5J6HA 3GUTA 1CE1H 4S2SA 2R2BB 3OG4B 3VXUA 3ZDXF 1U91B 1R5IB 4DW2L 1CD1A 3PWNB 2AI0H 5IVXE 2XQYK 4XBGB 2IADA 4DUWA 2YUVA 3MSPA 4KTDL 4DEPB 1C5CH 1JRHI 2VDKL 4IOIA 1UM4L 1IEBB 1T1YB 1ZANH 4Y16A 4F7PB 1AGEB 5A2JH 2C3HA 3W9EA 1KTRL 1NMCC 1U2HA 1A7PL 4Y89A 4P3CL 4YBLB 4XNYH 3M8OL 3HG1E 3NPSC 3LKQB 2HKFL 1FPTL 3KPQA 1BD2A 3GI9H 3WJLC 3PUCA 1G1YA 5F7NC 2PYFA 3FO0L 1J1PL 3GKWL 1FVCA 4PGEA 4YR6A 5LWYH 1ITBB 1UEMA 1S78D 1HKLL 4KTEL 3DECA 3PNWA 1B6DA 4RMVA 5CIPA 5E0QA 1JPFA 2RJMA 4PJAA 4RFOL 4BFBD 4JJ5B 1LEIA 4RNRB 3SDAD 3EYVB 4R3SB 3O3AB 4HZLA 3GNMH 1YEEH 1CDHA 1WCBB 4PRHB 4PV8B 4Q58C 4AQ1B 2CK0L 4KMQA 1T80A 2IF7A 3O9WD 1Q72L 1IM3A 1JV5B 4CNIA 3KLHD 5D2NA 2ZUYA 4IRZL 5C0BA 2VERN 3T8XA 1MUJB 3FQUB 4HV8B 5JHLL 4KROD 4O2EB 2M26A 1GAFH 5DQJA 2XG4A 2CSPA 2XA8H 1IGFL 5EU5A 2I60H 1GZQA 4WW2C 4X7FC 3RNQA 3W82A 3B6SA 4ZS6D 5LAXB 1GGBH 4NUGL 4RWYH 3WIFA 3U6RB 1SJEB 3OKLB 4F37K 5I1DB 5L2JA 3NA9H 3D39A 3BWAA 1IBGH 1AY1L 4HGKC 4Q2ZA 3TYFA 5H2BA 3QDGD 3DSFH 5SX5H 4NN7C 1KTDA 2PCPB 4FFZH 4JKWA 3O4OC 1DBJH 3MLVH 3KPPB 1YC8A 5E99H 1KJ2B 4Z8FH 5IQ9A 3T77B 5JXAH 3GB7A 1J8HB 1Q8MA 5I1JH 3R06A 2VZTA 4HHAA 1JWSA 1CTOA 4C56B 4FZ8L 4JHAL 1JN6B 1GOGA 3QDMB 2R39A 4HH8A 2JB5H 3KXFA 4P0DA 2VLLA 1GPOH 1KF9B 1N5YL 1KGCD 2R56L 3ARFB 5FK9A 2XXCB 1KJ2H 1HI6B 1UXSA 5FGCB 4QRTA 4WU5B 3RWJA 4UT9H 4DGVH 3QCUH 3PWPD 3DMMA 3LEVH 3OXRB 3UJTL 3TN0D 2QKIA 3RUGF 1I7TA 4TTGA 5DEFB 2EKSB 2A83B 4PRNA 1F3RB 4IOFD 32C2A 3QI9C 1OW0C 2H3NB 1OF2B 2ERJC 2GK2A 2FECI 3GGWA 4I0PD 1VKXB 1NCCL 3BUYB 4UMGA 1YUHA 3KPSD 2CGRL 3V4VH 4GKSA 3V5HB 3RVTD 3KPOA 4OF3A 1FDLL 1S3KL 3BEVA 1Q9LB 1NFKA 4YXLH 1INDH 4LKCB 4KV5F 1N4XH 1XF2B 4LRIC 3QEUA 3V52L 3U9PL 4NKIH 2Y5TB 1T83A 3MOQA 3OSKA 5BZWB 2AABL 1IC1A 5I71B 1RZKL 3HAEG 3LIZL 2EDRA 3ARXA 3EIFA 3P2TA 5BS0D 2X9YA 4U3XA 3BDYL 3NACH 1CLZH 4LDEB 1NBVL 1DN2A 2ORBL 4JO4H 1ZHBA 3EO1A 4HKZB 4JZJA 4P3DB 2X4QB 3HNTH 2J6EA 1MIML 1EA9C 1GZPA 4QTIL 5DFWH 3QNZB 4M1GL 5CSZB 4HWNA 5LBSH 2BY0A 4PJEF 4RDQF 4LVOB 2XZAL 5E5RB 3STZA 1QYGL 3IJYA 4F9LA 5B4MC 4Q9RH 3AGVA 4X98B 3VI3F 4DGIH 2FR4A 3DRTB 43C9B 2X42A 2BERA 1QBLH 3OKMB 4LIQL 1T03L 5JZ7D 1IMHC 3MYJB 4JQXA 1DP0A 4JG0L 2VDOL 5IHUH 3IFOB 4YHZH 4X7SH 2HVJA 1JUFA 1DBKL 5ADOL 4NZRH 5HSFA 4WUUE 1BZ7B 1NEUA 1UB6B 5EU7E 2CLRB 4Z7WF 5C1MB 5CGMA 2PXYD 4YUEL 2EH8H 4Z5RB 1BFOB 5T1MB 3CLFH 3S34L 2PTVA 4W6YB 3TT1L 3RGVA 5FKPB 5D7SH 4K3HA 1QPXA 1QKZH 5CZXD 3OKOA 5CINH 3ZE0E 5B38G 4MXWL 1H15B 3HZMB 4CVWA 2OTWB 4EN3D 1WK0A 3HFMH 5JNYA 1Q9KB 4QF1A 2VO5A 2W59A 3QCTL 2FRGP 4OGYH 3MRDB 3MACL 2P47B 3ALXA 2R23B 4GQ9L 4QGTA 3MJ9H 2YD3A 3ZKXC 4ZPTB 1BP3B 5HHOB 3WNLA 1FZKA 3FN0H 3QFDA 2NNAA 5FGSA 2YA2A 4DKDC 3G5VA 1ZHLB 3F62A 2WAHA 3BH9B 3MODL 5DC9B 4X7EC 1E6JH 1YNKL 3BEWB 1IC5L 1UH2A 3VFUA 2VN7A 3GJFH 4UDTB 3PJSB 2BP3A 3KJ6L 4YDLC 1OOAA 2P46B 4HJ0C 3VRIB 4NM8L 1YNTA 4Q7DA 1BFVH 4YDIH 1G7HB 4FXGA 3L3HB 5H94A 1IGML 1TTFA 1K4CA 4G6JL 5I1CL 4JE4B 2FEEL 4ISVB 4LSTH 1AXSB 3GJFK 3HR5A 5D2LF 3WE6A 3RJDA 1A9EA 5GGUA 2IAMC 4BH7B 3S35L 4YGAB 2QQLH 4G8GD 3BZEA 1JF6A 1NJ9B 1OQXA 3KNBA 5IG7B 3U7YL 5H37G 2EYTA 2VZSA 2YD4A 2GAZA 2D7MA 4FQIH 4YHKL 5I76B 4GSDL 4DZ8B 4I0KA 3F7QA 4P2RB 1WTLA 1HXYB 4TUOB 3ULVL 4APQB 2X44D 5GRJL 3FQTA 2GKIA 3GI8L 4GW4B 3C08L 4Y2DD 3GM0A 1L9MA 4MJIB 3EO9L 4OM0H 1OCWH 3ZYIA 4GRWB 1L9NA 5K9OB 1CFVL 3VXSD 5DUBA 4MNQD 1GC1H 3Q48A 4U1NA 5JQ6H 2BXZA 3TNMA 1MJUL 1PD6A 4G8IA 3BE1L 3V6FB 5KSAA 4D0DA 1OWRM 3JZ7A 1Z9SA 4M43L 2GITA 4F9PA 2LE9A 2GJZA 4FFYH 1URLA 4N0YH 4Z77A 3L7EA 1RJYA 3BKCH 4L4TA 1G7IB 1KV3A 4PB0H 2J8OA 4HZAA 2XY2A 4GRWH 1N6QH 5JDSB 5D1XC 3WUWG 4MJ6A 3HZYB 1DEEA 3KYKH 5K9KB 3QHTC 5JW3L 3TBSB 3BKYL 4MB4A 5CMAB 4P23A 3BW9A 3KWWB 2F54A 4OLVL 3MLSH 2Z93B 4NO3A 4NHCH 5FKAA 4L8CB 5HGHB 3BDXA 5GSVB 3GRWH 1GVIA 4L4VE 3DXAD 4UTAL 1X3DA 2YEZB 2AVGA 2CKBA 3NMEA 4PJCE 5HHXL 4JRXE 3VWKC 4EUPG 4F15C 5MERA 5DD3H 1HSAB 2W9DH 4XCCH 2EKJA 3IU4H 4OIIL 2A77L 4X5LA 3QHFH 1AD9A 1FGVH 3OGCB 5GZOC 3RAJL 4DKEH 3G9VA 2R4RL 5E8EA 3AAZB 1T1ZA 3QIUD 4YHYB 1FE8L 12E8H 2DN7A 3HRZB 3LMJH 2BNRE 4PS4L 4RMSA 2VB5A 2W0FB 3CU1A 3RP1A 3O6FB 1HHGA 1HYSD 2VJXA 4K2UH 1ND0A 1JWMA 3PL6A 2NY0D 4Y4FB 1IAIL 4MAYB 5I1HH 3BAEH 4FG6C 3F58L 4HG4J 2VZ1A 1QEWB 4V1DE 1RUQL 2GTZB 1BECA 4LLDB 1PY4A 1X7QB 4MD4A 5DD1L 3E8UL 4M4PA 4RGND 1MCEA 3L3OB 1A7RH 1YEDB 5J89A 1J0IA 1NC2A 4X4ME 1F00I 4JPKH 3HMWH 5CJXA 3EYFB 4O58L 1V3MA 4G5ZL 3EZJB 4XBPB 3U0PA 2DD8L 4NNYA 2R1WB 1ZT1A 5HI5C 2XQBH 2VXSL 1CFTA 2NY7L 4EI5B 4CADB 1T7XA 3PG2A 4DVRH 2W65B 4D8PB 5IB3A 3MRKB 1U8QA 1JPGB 1AGBA 1CXLA 4LBEA 5EH1A 2BVPB 1I3RA 3B9KC 3QUYD 5ANMA 5CZVH 3BVNA 5DO2C 5C6PB 3MBEC 5IMKB 1XF3B 1VFBB 4KK6D 5C0FB 3V5KB 1DVFD 3C60B 4HPYL 4B5EA 4LLAA 1XIWC 4Z7UF 4LDOB 1G6RA 4ZYKB 1W72B 1I85C 3DTXB 1MCQA 2VSCA 5DI8B 3TPKA 3ALPA 4OZHA 4KUZL 4HWBH 4PV9A 4JY6A 5GRVL 1MEXL 4AEHH 3NPZB 4XCEA 1MFAL 1QBBA 3QWOB 4OFKA 1UJ3C 1C1EH 4J4PC 5CZKA 1MRCL 2BSTB 3VD9A 3ZE1E 4ZFOA 1FL5B 4XT1C 3WHXA 25C8H 5DRWA 2F58H 2FHBA 3DVGA 4GQPH 4Y0GA 4M6NH 1AP2A 1CVRA 1DN0B 4Q6IA 5EOTB 4KDTA 4OT1L 3QQ3A 4UIKH 3RQ3A 3TO4A 1D6VL 5FYJH 3CZFB 1AQKH 2FLBT 2ADFH 4CU7A 1IM9D 4MD0B 2R0LH 1HE7A 3HC0B 5J1AB 2NY1B 2C3GA 4L3CA 4OCYH 5DURB 2V17L 5DHVH 3EJYC 5KSBB 4X8JB 1EXUB 3CVHH 4GXVH 5EFIB 4U0RB 3LH2H 2EE9A 5L6YL 5D7JC 3D6GA 3H3PL 3ROLA 4K55A 2F74B 5IVXA 2BXYA 4GXUM 5IESH 1FNSH 3UO1H 3SGKC 4CMMB 4HJGB 2AJZB 1G9MH 5E5MB 5TDOB 1FYTE 5AZEH 5EN2B 4HQQH 4I48A 5FHBH 3L3DB 3LKOA 3MBXL 4K3JH 5E1HB 2P1YA 5ICYB 2BNQA 3JVGA 1MPAL 2NZIA 1GOFA 2Z91A 5GZND 4FQQB 5GISL 5K93A 5BOPA 1EEZA 2XWTB 3WIHA 3SDXE 1VFMA 4OGXH 3NZHL 5E4EC 5TDNA 4FQXC 2E5EA 4ZAKB 5F7DA 2OJEA 5IR1B 1MY7A 4UI2A 1BOGA 4Y1AA 4JFED 4C56D 3FJTA 4NPYB 1LP9E 1V3KA 4ODWA 5KS9E 1WT5C 3QDMD 4NQDD 1NGZB 5J7CC 4ZO9A 1YC7A 3WFZA 2XNAA 5FEBA 1K8DB 3QCVH 3D18B 4ODVL 5INCA 3WIIH 1TZHB 3ARFD 3NCYP 3HI6L 2X05A 2YZ8A 4HUKB 3K7UA 1JWUB 4P46B 1II4E 2DKUA 4FP8H 2YUXA 4H26B 2UY7A 1V7ML 5A2IH 1TQCC 4HKBA 4O51A 2O61B 4WUKL 1AQDA 2RHEA 3GSUB 5JPNB 1MFEL 1PLGL 1S5IH 3GMPB 5ETUB 1T2QH 4ETQA 2Y6SD 3DX6B 4WTXA 1UKQA 4U1IB 3HI5L 4LFHD 4PGDA 3QUXB 4N9OB 2K7QA 5FB8A 1TNMA 4Q74A 3SE8H 3MV9B 4ZO6A 8FABB 1T1XB 2EDBA 1J5OH 5TFSL 4OIBA 2FO4B 1FO0H 3B9DA 4OQTL 4A2LA 5IOPA 1A3RH 4X0KA 3DHMA 1JTTA 1SBSH 5T3XH 1JMXA 3N1MC 2F19H 4LSRL 3RZWA 2Y07H 3QEHB 1CL7I 2R69L 4HWEH 4KZDH 1X5YA 4PJ5B 4U7SA 2R0WL 4EJ1C 4BKLA 4GMSL 4QRQB 5MEOB 4JDVB 4JB9L 1P69B 4IDJL 4NQEB 5EU6A 4PJ7B 3BP4B 4K3GA 3TESA 3MGTA 3ZKMC 5F71A 5IWLC 1T7ZA 4O9HL 2NXYC 2PR4H 3IU3B 3RDTC 1KB9K 1PDKA 4RWHA 3R1GL 4D9LH 2PYEA 4U2YA 2YD6A 2FD6H 3CFJA 1REIA 2HFFA 3AY4A 1CLYL 3FT3A 4YC2B 5EU3A 3DARA 3U46B 4X5XA 2A9NL 3U4BH 1JZ8A 1NAML 3HC3H 2R0ZL 3S37H 5F6IC 3MRIB 4PRPA 5HHVH 2VABB 43CAA 4P9HC 1DSFH 1CFSA 3UJJL 3UAJC 2WIIB 3VFTA 1TTGA 4RQQB 2CDFA 2JJSC 1I1FB 1T7WA 3KYMA 1L6ZA 4NYLB 5JMRA 1BVKA 3OPZH 3PQYD 2XFXA 5DVMA 4DKFH 3QO0A 3O3EB 4PR5A 3P4NA 2C4FT 4JZNA 3VXOA 4LIQE 5IIEA 3GSNL 1RIUL 4U1GB 4MA7H 3MRQB 4P4KB 1HHJB 3P3YA 3SCMA 3QWRD 1WC7A 1BHGA 5DD6A 4QOKD 2R0KL 4OZGA 1IT9L 1MFBH 1RUMH 4WI4A 2Z8SA 2HTLC 4NNPH 3EO0B 4L3ED 4PJHA 5JXEA 5EOCL 1OB1B 2IFFH 3JTTA 3UJIL 3VRLF 4IRJC 35C8L 2DS4A 3OV6A 2YBRA 5DJDB 2ATKA 4WUUA 2AJUH 2C1PA 3QBTB 4LOUD 1RAMA 1KPVB 1FNLA 1TTUA 4HUUB 4U6HB 4OV6F 3TZVA 5BXFB 1G9NC 2HT4D 3O8XA 5T1LB 1JL8A 4DCQB 1ZVSA 3MLUH 1X5LA 1CE6B 1ERNA 5K9JH 4CBPA 3TBVA 2F15A 1V7NH 1DQJA 1MCLA 4NBXB 5IEHA 4R2GC 1H3PH 3WLBB 3GHEL 4JM2A 3MLRH 4GO6B 5CWSA 4MJ5A 3TT3L 1KCLA 3LHPH 1A7OL 5DEGA 1CGTA 5E95B 2HJFA 3TFKC 2X4OA 1BBDH 4HC1L 4OLYH 3TA3C 4XPHH 1OL0A 4XPBH 3HAEB 3UCRA 2FIKA 4LPCA 4L8SC 3L5WB 2R4SL 3DYPA 5SWSE 1CFQA 1D6EA 5FF6A 5I18L 1EV2E 3HG1B 1A3LL 1JNHA 3K4ZA 3BRFA 3VJ6A 1M7IB 5BW7C 3TJHC 1JZ2A 3RTQB 3TN0C 1PG7W 1N8ZA 2C4FU 4IHOA 4NM4L 4TTDD 3TWCH 4I0PC 5BV7L 5EWIH 4MA8L 3NAAH 4KKBC 2XWBA 4O2FB 4OZIF 5DJ8B 1J11A 4QGYA 4YEFA 5IK3B 3WN5B 3B9EA 3D85B 2H8PB 5INDA 3PWLA 4ZFZB 4OLEA 3U9UB 2RFXB 1A6ZA 4PGBB 1KLFA 3GMLB 3DUSB 5I2IA 5CSGA 4GRLB 1OTUD 3D2UA 1XZ0B 4U31A 1VGKA 4Z95H 5E00A 3ARWA 4NHUB 3H0TB 3K2UL 4XAWH 4AEIL 3DIFA 3SE4C 4PRIE 2FJHB 5DJYA 2GJJA 2O5XH 4J7RA 1RZFH 2WBJB 5JUEH 3IDMB 5AUMB 1KCSH 3BFOA 3AREC 4FN0A 2W60B 5B38B 5IFJA 4UU9A 1Z3GH 1JHKH 4HEME 1U41A 2XT1B 3GSVB 4LLYB 4E42B 1IGYA 3V8CA 4F37F 5C09E 5HYJD 4XPGH 1NFIB 2BJMH 3NCEB 4Z7OF 1QFUL 3HLAA 2FWOB 3LZFH 3H7BB 3MR9B 3WS3B 5HBBA 1KXTB 1SY6A 3ZZ1A 3CK0L 1DQLH 4Y19E 2G60L 4LCCA 2J88L 5F1IA 5B3JE 2NW2B 4MAYD 3WKMH 4IOSD 4XP5H 4LEOA 2GTWB 4I13B 2VTFA 4PRAB 4POZC 2CD0A 1HQ4A 4X4XB 1D5MA 3PIQB 3D3VE 3KDMA 5DQ9B 3U36A 5L8JB 1FZMB 1K5NA 1FJ1A 4JRYD 4GG6F 3IFPA 1WBXB 5HJ3B 3G5XA 1ZWIB 2DIBA 2B8OT 1BBJB 1SMOA 3QJFB 1MI5E 2F8OA 4F7MB 1J1XL 1MCBA 3OAUH 1I1AD 4QNPF 3GMQA 4Y4KA 2VYRE 3C6SB 1BVLB 4EN3C 3AS1A 3EGSA 3O3BA 4RISL 2IANE 1R3IH 3L9RB 2DYPD 4JY5L 3B4NA 1NMBH 3A6CH 1WICA 4OGAC 5CEZE 4KH2A 4EI5D 1H5BA 5GGVH 2VXUL 1NL0L 1S9YA 2Y7QA 3X3FH 4K7PH 1SM3L 5FUZL 2Q3ZA 1XGUA 3P77B 2J5LC 1EZVY 4FTVD 3TIEB 2P5EE 3UTSD 5DJ0B 2OI9B 2DL9A 3C60D 3G08A 4I3RL 2J4WL 5F9WC 3IDXL 3WNOA 4BSWB 1IKFH 5IGXH 4KU1A 4NWUL 5FYJD 3CSYB 3ARGC 2FGWL 4G9DA 4WO4B 3ET9F 1A6UH 1S7QB 2Q20A 3TCLB 1KPRA 5D1QA 3BPOB 3T3PE 2OBGA 5DFVD 3QH3A 1T1WB 5M95B 3MRPB 4N8VB 4R97C 3PWJA 2JJTC 4YQXL 3H9YA 1S7SB 4W4NA 1QZ1A 4MS8C 3IXTB 4TOYL 4YIQA 2DLEA 3MRGA 5IKCA 3FZUD 3EYOB 1NGQL 4LSVH 1XF4A 4GG8B 1XH3B 4KXZI 3MV7B 5T1KB 5KAQF 4LLWA 2EIZB 3HPJB 1T21B 3L3IB 4XMLL 5ACLA 1L7TH 4YPGA 2HAZA 1DUYB 4JVUA 4N0UE 4EUPB 3JWDL 5CBAA 4PGJA 1XCTA 5ADPH 1KCUH 1OP5K 3I6GA 4GLRH 2APFA 1MREH 3W2DL 3VFPA 3SDDB 1UADC 2QHRL 1KBGH 4ODTL 4WNQB 1RZIB 1BF2A 3FO1B 5IBUG 4ZS7L 1Z0NA 3S5LB 3HNSL 3CLEL 4D3CH 4XMKH 5TQ2L 4WDIB 1LD9A 1T04B 2DM2A 3BP5A 4XRCA 1TCRB 4FFWC 2DM7A 4XCFH 3GMRB 2IPUK 1FVEA 1ZGLP 4JQIH 2V5TA 5FO8B 1FH5L 1QRNE 3DROA 5FGRA 3D48R 5EZJB 1A2YA 2Z4QB 4XAKE 1UYWH 2NTFB 1ZA6B 5C0IA 1FORH 4W81A 2EDLA 1SJXA 3LVEA 1CICB 1U8IA 3PHQB 3D1MC 4X6EA 6CGTA 3HZKA 1XR9B 5L2KB 3VGFA 1TJGH 5C08D 2Z35A 3I9GL 3FMGH 3O11B 1FGNH 3T2OA 4CW1A 4S1RL 4BQ9A 3MRBB 4AH2B 1P9MA 1TJHH 3VXMB 2NX5B 1NGPL 1QHPA 3VFOA 4RGMB 5ERWB 3QQ9D 4MDJA 3C6LA 5E9DE 2AV7A 3V0VB 4BK4A 5T1DL 3QFJE 3X14A 3QIUC 1ZE3C 2X89D 2RCSH 1MCRA 5HVWA 4OFYD 1JGDA 3MLXL 2DWDB 4ORGB 5A2LH 2WQRA 2ATPB 4JPIA 4BELD 5C0AD 5T3XD 2APVA 5GGTL 2EZ0C 3VFWB 4Y5XA 3VWJB 1UB5A 3OR6B 2WUCH 4K94C 4YFDB 3TBYA 2Y23A 1HYSC 3RWEA 4FXKB 4QRRD 4LPTA 2NY0C 1IKNC 3CC5A 2X4SB 2XN9B 2CQVA 2BNUB 2ZOKA 4NQVB 3VXRE 3TLRA 4P5KB 4G80B 1CXFA 4XMPH 3RY6A 1M4KA 2FEEI 2OQJA 5J4MA 1WBZA 3R4DA 3ELAT 4P2OA 1EIBA 3RL2B 2JIXB 3MRFA 5F9OL 3T2QA 2GFBB 3TVMD 1BWWA 5AWNL 1MJ7L 3MFFB 3O2WH 5KVGH 4PYGA 1Q0YH 1MRDL 3BX7C 5E2VH 5LXGH 1FNGA 4NQUA 3UTQB 3ULUL 4D2NA 4JCMA 3LDBB 1B2WH 4O2CB 3OB8A 1HHIB 4JQVC 3SO5A 1GGYA 4PUBL 4NQED 1UWEL 2JCCB 4KI1A 1SYSA 4CU8A 4PJIF 2X7LB 4NO0B 3V6OC 1U58B 3ARQA 3ILPA 3K2MC 4JR9H 2ZUTA 4WHYH 1P1ZB 2QADD 4L8DA 4TNWF 4RCAA 2R2EB 2D9CA 1N64L 4K9EC 5EZIH 1H3WM 1I9JL 1OAQL 3LN5B 4DEPC 3ETBF 4HIEB 1QLFA 2FX7L 4X6DA 2BSRB 2RBLA 2GSIB 5D7KD 4NJ9L 5FIEA 3LSOB 5E6IB 3A6OA 5F9AC 2OK0L 2MPAH 4GRWF 1HINH 4YBLC 3V6ZB 4L4VB 1WEJL 4F58H 3CDGA 3FCTA 4PJCB 4JRXB 3AU1B 1XR8B 3LV3B 2ZKHH 1X5ZA 3CSGA 4FQPA 3RJQB 3QZWB 4MVBD 5DJZA 5DVLA 4HIHB 4XCYB 1OAYH 3KR3H 5J13B 2CRZA 3QXAB 2XWJB 2DQJL 1F8TL 5KVEH 3MLTA 3ARYA 3AXLB 1BQUA 2BNRB 4EOWH 4LHQB 1R0AL 2XXMB 4OLZL 3DETD 1W0VB 1MVUA 5T5FH 4DZBB 4TSCH 4OZFG 5GSRB 1G6VK 1N3NB 1AGFA 4FQHA 1FRGL 4HBCH 1T0NB 1JZ4A 4P4KD 4HH9A 5IMOB 5FA3B 5KSUB 3JWNC 1WFUA 3OGOE 1B0GA 3WYRA 1H0DB 3QEGL 1I8LC 2FHCA 3QIWA 1A4KA 1P84K 4MX7B 4U1JB 4YO0A 3X11A 1RIVH 1UFUA 4V1DB 1BZQK 3O3DA 4WFED 1DQMH 4CDGC 3IVKA 4HX1A 2R1YA 3HKFA 1PEWA 1IGTB 2V9TA 3QXDB 4N1HB 4JFFB 4BSVB 3SKJH 1X5GA 4FQ2H 15C8L 2AXGB 1KELH 5HGBA 3RUGE 2AP2A 3ES6A 1CDBA 3VH8G 1EO5A 3VE0B 4UILH 1S7UA 1K3ZA 1FG9C 5GRUH 1OGAE 4OCRH 4HD9A 2ZJSL 5L7XL 4YXHL 1DQQB 1I8KA 1TZGL 2DAVA 2AK4A 2M1KA 2R1XB 3OKEB 2YMXL 2P42B 3T65A 2DLFL 5FOBB 3FQWA 3LQAH 1IAII 1MHPL 2G5RA 4KV5E 3VXQA 3HPLA 1J1OL 1U3HA 2OR9H 2CXGA 5F7HA 3Q5OA 1U8PA 1G9EA 4TVSa 1A6TA 5E2TL 4WEBH 5ILTL 1FSKB 3H9HA 5C0EB 1Z9LA 1SEQL 3HCVB 1YEGL 3OF6A 1RY7B 1P4LB 2CLVB 5ENWB 1JI2A 3MJ7A 4AT6A 3MV8A 2DQCH 3AS2A 2B4CL 3S9DB 4JN2B 4WWKD 1NCBH 3RY4A 1K8IB 3ARFC 1IGCL 3P9LA 2D7PA 2UV3A 1X6LA 3SGEH 5IFHL 4PJEE 2D7TL 4N1EA 4LARL 1CFNA 4U1MA 3SOBH 2N4IA 3IDGB 3TO2B 4LHUB 3QNXA 1G7QB 3VI3E 4FABL 1A4JB 5FOJA 3EOAB 5FM5O 1F11A 1KG0B 2W92A 3QXUA 5D7LA 4PREA 4TPRH 2BOCA 3L3KB 4YXKL 3GHBL 3GDBA 4HS6B 3VXNA 1JGVH 3HE6A 4AG4L 3KPRD 3KPLB 1QG3A 5IROA 1H3TA 4DN3L 2O5YL 1KLUA 3EDEA 5SWZE 4F57H 3QPXL 3FHQA 4X83A 4K8RC 5C0CD 1F90H 2Q6WA 4PJ8B 5I71C 3DUUB 5EO0B 2VLKE 1HQRB 5JW4N 1O7SA 2APBA 1CGWA 1HNFA 1OD7A 2F5BH 2WBJD 3VGEA 3N1QC 5DLML 1RU9H 2NY5L 4X99B 4OKVB 1ZLSL 2DQEH 2HA1A 3DHJA 1P7QB 3PP3H 3WJLA 1I7ZA 1A1OA 1YEFL 1CDCA 2O26U 3M1BB 4LVOC 5SWSA 4D0BA 3U7WH 3UYOD 1GJIA 5LGKA 4XTRC 4PGEB 1QSFA 2HT3D 1ZK9A 5HVFB 3BGAA 2B2XH 3QHZL 3SDXB 5DK0A 1YY9C 4D9RD 2M2DA 2EDTA 2JLLA 4TSBH 4CN4A 1QLEL 1U8KA 3UTTA 5HHMB 3WHE1 5MEND 2NY6B 4GMTL 2VAJA 3GKWH 4Z18A 1G7LB 2L0DA 5KS9B 1LP9B 1BLNB 1KB9J 4I18B 4IMKC 1D5ZB 2AI0L 4KTEH 1HDMA 1RUAH 2EXYD 4MDIB 1FLTX 1DCLA 5D2LE 2WM0A 5DTFA 3VFMA 1A7NH 3ZYOA 1JPTH 5CIPH 1C5CL 1IFHL 4JZOB 1PX4A 3GBMH 3MRHB 1FG2A 1F3DH 3DV6A 4G6KH 4OI7A 4FNLH 1GZQB 4WW2A 4EDWH 2JJUA 3GMMA 1YPZB 3BO8B 3FOLB 4M61A 1JHTB 4S1SH 4Z7VE 3X13A 4N90D 5D1ZD 2PO6D 3E3QC 1S7RA 2P8PB 2VLRA 4KJWD 1BJ1J 2EEDA 5LWYL 3OKNB 5D6CA 5C09A 2XRAH 4GRMB 3RNKB 3T4AA 1NC4A 4NUGH 5IMMA 5EIVA 3R06B 5TE6H 3S8WA 2KH2B 3T0ED 1JWSB 4JN1H 4OM1H 2HT2C 1UEYA 3LKSA 1EEUA 5EPMB 3GNML 4Y19A 5GS2H 1YEEL 2DWEA 4LEXH 4O00A 4LCWD 1C5DB 5DRNB 3KXFB 5IF0B 5C0GB 2JTDA 1ETZA 4FQJL 2IBZX 4MYWB 3S36X 4QCIA 4MJ2A 4LOUC 3LQZB 5DJCA 1LNUB 1L7IH 3IKCA 1BZ9A 4QRTB 1ZLWH 3RWJB 1OTTD 3BQUA 4S1QH 4J1UB 2YD9A 2VLJB 1GAFL 2XA8L 2H2SC 1I7TB 2I60L 5I0DA 1T66D 4HWZB 4PRNB 4KJPD 2IPTL 5I8EA 4RWYL 3QI9A 2FGZA 1OW0A 4EXPX 2CDEA 1ZLWK 3NA9L 1YUHB 4U3HA 5DQDH 5F3HB 4PJXB 4GW5B 1ONQA 1IBGL 1WIOA 2FEDD 1RJLA 4APQC 5LGJA 3DSFL 4GKSB 3RWIA 2NXZB 4FFZL 1PZ5A 1DBJL 5EBWB 3FAXA 3MLVL 1OAKH 3VDAA 5F3BA 4JRWA 1R24B 4Y4HA 5E99L 5T1KD 4Z8FL 2OX5A 4LRIA 5JXAL 3QEUB 5I1JL 2DQHH 4JFOB 4ZUVA 5JIKA 2R2HB 3W9DA 3EOTH 3EDFA 3BH8B 2CGRH 1UC6A 2LU3A 4MSWB 5ESQA 2GI7A 2JB6B 2LVCA 4I2XA 1EAPA 1FDLH 2V9QA 2ZCLL 4YLQT 2IBBA 2JB5L 1HZHH 5J3HD 2FJFB 1GPOL 2AKRA 1FNHA 5SX4I 1D5IH 3D5OF 3QUZD 3RL1B 1BM3H 4I1NB 1S9WA 1RK1A 2AABH 3DBXB 4PJ7F 3U83A 4MB5A 1KCVH 4UT9L 4JG1H 3QCUL 4DGVL 1UXWA 4NBYB 3QXVA 3LEVL 3STZB 1S8DB 1I7RB 3EW3B 2X4UA 2P24A 4WU7A 3HS0B 1EJ6A 4R0LB 1HYRC 4XXCC 3T2PA 1G7JB 3CX2A 5K33A 3VD5A 5DZLA 2J6EH 2OR7A 2XZAH 3ARUA 2ARJQ 1PQZB 2X1OA 3SJVA 1Y18B 4YXLL 1INDL 1H8SA 1S7TB 4NO5B 1N4XL 4HIJA 1WQVT 5IVZA 3D69B 3G6JB 3ZO0A 4IRSD 3WLWC 4L1DA 1TPXB 4BFIA 2A6JB 4JGJA 5IB4B 3QDGE 3DGGA 5D72H 4ZO8A 1ZKAA 5JOPD 5ADOH 4MNGA 4NGHL 1AD0A 4JHZA 4YHYC 4YDJA 5TH2B 5BQ7A 3NACL 1CLZL 2P8MB 3S3JA 4JO4L 1M71A 2H6PA 3QUKB 1EHAA 3GZKA 3HNTL 3S96B 3O6FC 2ITCA 3VWJD 2BMKB 1EDQA 1SEBA 3RBSA 1FZOA 3BISA 4R96A 3VCLA 4Z7UE 5LBSL 1NEZG 4Y4FC 1NLBH 2X4RB 4MAYC 3QFDB 3L3JB 2XTJD 4Q9RL 1JYXA 4ZUUA 3I3DA 3QT2A 4DGIL 1KGCE 2XZCL 4GKZA 1MLCA 3LN4A 5LJYH 5BVJA 1QBLL 3J7HA 5LGHH 5DJ6A 1MHHA 3JV0A 5EC1A 5IHUL 4YHZL 4LLMA 4X7SL 2JIXD 2VDQH 2W9EH 4NZRL 4ZXBD 2AEWA 2HVKB 1CXHA 1NFDB 5FUCC 1OSZA 5H94B 3SKUD 3MODH 1K4CB 4JKLA 1VERA 4M62H 1IAOA 5HHQB 3T09A 1HILA 3KPSE 3QEQA 3O0RH 4CVZB 4H25A 3VH8A 3HR5B 1J9CT 3CLFL 4DVBA 4EI5C 1ODAA 2J1KA 4ONFH 1Y6NR 2IAMA 5D7SL 2PUQT 1QKZL 5CINL 2YUZA 1JNLH 3UZVB 1OY3B 2CKNA 2YPKB 5I1CH 1AI1H 4UUJA 3DVNA 4OGYL 3C60C 4KPHL 1QD0A 4ZFFB 2RR3A 3MJ9L 5BS0E 3BSZL 3IYLW 4G9FB 1RFDH 4XNZB 4X5WB 4KVNH 2GJ6A 1KOAA 4NQTA 1A5FH 4PRIB 1Q94B 1E6JL 2ICWJ 4HS3B 2VISA 3X12A 1F3JB 5IBUB 2ADIA 1D9KB 3H42H 1D5BB 5DUBB 2OTPA 4MCYA 1U8MA 1MCOH 1BOYA 1I1RA 1BFVL 4YDIL 5H35B 5C7XL 1FFPA 4XX1E 3C08H 3FQXA 4PJFA 5B8CB 5EZLA 1AO7A 2BHYA 4QRSB 1RJZB 1U3JA 2FDBP 1VFAA 4KKCD 1J05A 4HUWA 2DMBA 5HY9A 4XC3L 1M7DA 4YNYA 2NY1C 3VG9B 1F4WH 2QR0A 3FZUC 5D1XA 2QQLL 2E9BA 5IB1A 4FQIL 5F89B 3U0WH 4P23B 1OAZL 4U0RC 4HKJA 2F54B 2W0LA 1FCCA 1CD0A 1CLCA 4JFFD 2PW1B 3GSRA 1PGRB 1T3FA 2ITDA 5JOEA 1U92A 2BZDA 1MI5B 3FO9A 5E56A 5GXBB 4ZPVA 4U1HA 1YMMD 4D94A 5MERB 3HHRB 1WAAA 1J0ZA 3RVVD 4MA1B 4OM0L 5D4QA 1FFOA 2KQMA 2VL5B 2IANB 2ZSWB 3DRQB 1GC1L 4NQCE 5E8EB 4TSAH 2P5WB 3HMXA 4EVNB 5I16B 2E8ZA 1JTPA 3VGAB 5HHXH 2F8XC 3HMXL 3VXTA 4ZAKC 1RZGB 5B21A 3CFIC 1P5UA 3OKDB 4FFYL 2DJUA 4N0YL 5DRZA 2A77H 4KRPB 2CKBH 1WV7T 3BKCL 1TXKA 2P5EB 3ZKSD 1U3YA 1W0WA 4PB0L 1INQA 1J10A 4EI6A 2WP3O 1N6QL 1OM3H 3KYKL 3KS0J 3RI5K 1WIPA 2HFGH 3BGFB 4OAWB 1QA9B 2E3VA 3ZHKA 2ICEB 1YZZA 5F9JA 3KJ4B 3N0PB 3MLSL 4E5XA 4NHCL 5E8OA 2NY3B 5JIIA 4P46C 3GRWL 3O3UN 2YPLA 2XYCA 1PSKL 2PF6A 2VN4A 3JV4B 4LHUD 4I77H 3JV5A 3L6FA 2NY4B 4W6WB 1LMKA 3QJHB 5DD3L 4XCCL 4P2QA 4RX4D 3IU4L 1H8NA 4K7FA 4HFUH 3QHFL 1FGVL 4NRZA 4ODHH 1U9KA 4DKEL 5GIRA 5CEYB 4LCYA 1NCDH 1HCFX 3EUUA 5IB3B 1GIGH 1U8QB 3C09B 3VFNB 4LLVA 1MWAA 1I3RB 12E8L 1AC6A 3B9KA 4G5ZH 3VXUD 3LMJL 1KTLB 3QUXC 4UBDC 4XNMA 3MBEA 1JGEB 5DMIH 3QA3A 4OFPA 5C70A 4PGCB 4JCLA 4MNQE 1R3HB 4M1CC 3BP7B 1IGJA 3SDCB 4A2MA 4K2UL 3GSQB 1XIWA 1DLHA 3ARRA 3JUZA 4Y16D 1UENA 2ZNXA 4N0UB 1I85A 1N6UA 1S5HB 4JPVL 5I1HL 1DEDA 1XFPA 3BAEL 5F1OB 2MKLC 4Z0XB 4F7TB 1KIPB 2FNBA 2V5RA 1UJ3A 4RIRA 4J4PA 3ZL4H 3GJEA 1P7QD 3TPUB 1BD2D 4IMLA 3WFDL 3VI4F 1A7RL 4BZ1L 3WXVL 2FX8H 5GGSB 1NCNA 5I1EL 3NN8B 3LEXA 4KUZH 1G6RH 1MEXH 4OZFB 1QRNB 3QQ3B 4N5EC 1MFAH 2A1WH 3FFDB 4LNVA 1RD6A 2X1WL 2ZCHH 3D25A 2DMKA 3LKRB 1C16B 5HYIA 1MRCH 2XQBL 3B8YA 2GCYA 3UX9B 4HAGA 3U79A 2BY2A 4JFYA 5E8PA 2COQA 2A73B 1K4DB 2IMMA 5HHMD 4DVRL 3DXAE 4WHCA 2DI8A 4YC2C 2Z31B 1G7PA 3VRLE 3THMH 5FYLH 5BCAA 1B0RA 2CLZB 4H8WL 1BFSA 3OQ3B 1KNOA 5CZVL 1CGYA 3P73B 1JE6A 1RZJH 4ODUA 2VSDA 5D7IF 2BVQA 5D7JA 5SWZA 2EDJA 3MO1A 5C0BD 4XBEH 4JVPA 4ELMB 3SGKA 3REVB 1P4IH 2WINA 4M6MH 3L5XH 4HIIA 3RKDC 1XGPA 2BX5A 5E9DB 4HWBL 4AEHL 3QFJB 3W0WA 2X41A 2QJDA 5GS2D 2JK5A 1U95A 3D39D 1AXTH 2G75B 25C8L 4AEEA 3V7MA 4U1GC 3N85L 2G5BA 2F58L 4ALAH 4P4KC 4H20H 4M6NL 1A0QH 3PGCA 4KK8C 4RAVA 5ISZA 3U30B 1CYGA 4FQXA 4UIKL 5IJKC 5FYJL 1BQHA 4RRPA 5I75B 4KKLC 3VXRB 1MFCH 2ADFL 3NFNA 2HWZH 3MFGB 3PWUB 1WT5A 3OX8A 4AY0A 3FFCB 3CMOH 3OJMB 1R3LA 2QTEA 3KXFD 1WUNT 3NZHH 1P84J 3M17B 3QDJA 3CVHL 1HHKA 4GXVL 3LH2L 4R7NB 3WIHH 3MOBH 2Q76A 4QT5A 1MJJA 4L8BB 1DL7H 1OVZA 1FNSL 4OZIE 3BN3B 1KJVB 1IAKA 5D2LA 1ZT4A 3DMMD 3QIBB 4ZSOB 3L5HA 1KB5A 1HEZA 1JBJA 3MPCA 4GKNA 4QXTB 1G9ML 2IMNA 4X80H 3E6HA 5CHNA 2IQAB 4MMXC 1QQDA 1KIRA 5AZEL 1KB5L 3O4LB 2EO9A 2Y72A 2EXWD 4HQQL 5FHBL 3ARSA 4K3JL 1ZSDA 4QRPA 4R7DA 4YE4H 1T0MA 2NXZD 4GAFB 3GMNA 3VRJB 4S11A 3SBWC 1CG9A 1AGDA 2R2CA 4HUMB 4Z7VA 5IHZB 2B1AH 3D0VB 5FB8B 4JJHA 3CCHA 1DBMH 1QTYT 2OMBA 3MNZA 4HUNB 5HYSA 3HUJB 2P49B 1YYMH 4I4WA 4HKXB 3WUZA 3FB5B 3RTQC 4Z7OE 2HP4A 2VZOA 3SY0B 3QCVL 2DQTH 2KDGA 5CGYD 3WIIL 5J0BA 4N1CA 4YHLL 4DKAA 4FQ1H 4UT6H 1QSVA 2FSEA 4KHXH 4OV5A 3IETA 5DS8B 3WN5C 4UQ3A 4FP8L 5CJ5A 3C2SA 4X6CF 4BQCA 5FV1L 5ITFB 2R69H 5HVHB 5IWLA 1X5KA 3MGAA 3RDTA 2XPGA 3LAFA 4Q97A 3K1KC 4GRLC 4GG6E 2VQ1A 4GMSH 4HLZH 4LKXA 1S5IL 1NAMB 1T2QL 4ZNEA 1Z0MA 4IDJH 2J8UA 5EU3B 4QNPE 3QDHA 3MLWH 4X5XB 2OYPA 3CFKB 1FYHB 3EJZD 4GUPB 2WBJC 2OJZH 43CAB 2AXJA 3CFEA 1F13A 4O9HH 3SE8L 1MHCB 2DOCA 3RUGB 5HI3D 3RZCA 1J5OL 2BVUA 5I0ZA 5KJRH 3TCXA 1FO0L 4HW6A 3RGVD 1A3RL 3RU8H 1OGAB 2JJSA 1CDJA 1N59B 3U7AA 1SBSL 2X4TA 5T3XL 1YN7B 1XGRA 2Y07L 3KYNA 2A9NH 4PPTA 3CPLA 1W8NA 5E1AB 5DJ2B 4HWEL 4KZDL 1ZGLA 3GSNB 4Z9KB 1RPQA 3SKOB 4C56E 1QFWM 2E7CA 2VOTA 4BQ8A 1GHFH 5JW5B 5B22A 2GY7B 3HZVA 3QDME 4NQDE 4NN6B 2XIDA 1MQ8A 4LNRA 3QNYB 4P59H 3PXHA 5T3ZH 5LQBL 1UQSA 1FVDB 5IV2A 5IVNA 3WFHB 1UACL 2H26A 3UYPA 5FGCE 2PR4L 5F21B 1KLGA 2EXYC 2ZP0T 2WWMC 4D9LL 1BVZA 5TDPB 2FD6L 4NRXB 4ZO7A 1UVQB 1B4RA 3STLA 3MROB 2V5YA 4IRJA 5J8OA 4PJEB 3U4BL 3IAQA 5J6GB 2NCMA 3B5TA 3HC3L 3S37L 2H32B 3CFBB 3FB8B 5HHVL 1R6VA 3ARDA 4J6RH 2MOVA 2R0KH 2RQ8A 3DV4B 4XVSH 1DSFL 1F58L 1P7KB 2GT9A 1FN4A 1TNNA 2A6DA 1EBPA 3K3QA 3O45B 1T4KB 2NW3A 4GOSA 2D2OA 1MQKH 3TBVB 2JE8A 3OPZL 4Z7WB 3IS0X 1KFAH 2OI9C 5EBMA 4DKFL 3L5IA 4KI5F 4AIZA 1VACB 3LY6A 2EO1A 5CWSB 4ZUSB 4MJ5B 3BKMH 4X9IA 3O2VH 4JFZH 1BX2B 4MA7L 2GUOA 4PLNC 3FKUS 1LEKB 5M7QA 2X4OB 3TA3A 2VLKB 3P0GB 2HG5A 1RUKH 5K9QG 4L8SA 5T33H 4WO4C 1MFBL 1RUML 3G5YA 4JM4H 4NNPL 2HTKD 5ID1A 4PJBA 3BPOC 4OB5H 5BW7A 3KYOA 1PAMA 5KSAD 3RWGB 3LKPA 3UBXA 3RBGA 5BV7B 2EYSB 2GSGB 3TN0A 1TFHA 5I8KH 3CSPA 2AJUL 1ACZA 2QBWA 2GYSA 5HPMA 1F6AA 1KEGL 4I0PA 4L4TD 5F7YC 4LSQH 3QRGH 1A3LH 2XWBB 1SVCP 1QSEA 5HHPB 4RAUB 5HYFA 2KPNA 3MLUL 5K9JL 1QR1B 1XGQA 1A6ZB 2X2YA 4WJ5A 4P23D 5EU7C 1JYNA 1V7NL 3BKJH 4LPWA 1SYVA 3GBNL 2F54D 2DLHA 3CUPA 1H3PL 1BIIB 3OR7A 1PYWA 1O5DT 1VGKB 3MLRL 1AIFB 4OKDA 5F93C 1GCFA 5HGAA 1B9ZA 2NZ9C 4P5TB 3MRJB 2ZUVA 1A3QA 3SDDC 2CK2A 3SQBA 5EO9A 1BBDL 3PQYE 2ESVA 4JFHE 5DHXB 4XPHL 4XPBL 3P0YL 5D93B 3AREA 3RIAK 5J3HC 5TF1H 4DTGH 3HNVH 5KOMC 5IFJB 4UU9B 4TULH 3KPTA 3H7LA 5HHOE 4UIMA 3SN6N 1Z5LB 3IFLH 3UDWC 1QR4A 3E3QE 5FM5M 3S88H 2C5DC 4GBXB 3BZFB 1HOCA 1N26A 1NEZB 3HLAB 1Z9MA 5DDHA 3VFGH 4L3EE 3TWCL 2F53B 4JGMA 4U1KA 5EWIL 2IQ9H 3NAAL 3W11D 4XWOC 1BMGA 1CICC 3PHOA 2CXKA 3IJHB 3AB0B 3PF2A 3IGAA 2SEBB 5C0JA 5C0DA 5I8CB 3IDJB 1NANI 2H2PC 1V5JA 3QQ4A 5I1GH 1TCMA 3ECBB 3KDMB 4ODXA 2BOBA 3W39A 1FJ1B 4RGMC 5F88B 2NY3D 4WI5A 1NC2D 5TJWK 1SY6H 4XAWL 4WI2A 4HXAL 1F4HA 2YSSB 5C3TA 3VFSA 2O5XL 4U0QB 1YPZF 1RZFL 5JUEL 1KCSL 1JF5A 3EGSB 3TNNA 1LK2A 3SKMA 1UZ8A 2ZSVA 1Z3GL 4F7EB 3VWJC 1JHKL 1CN4A 5FHAH 3UPAA 3IRPX 2D03H 4J3WA 3ARVA 4XH2B 4LFHG 4I5BB 4XPGL 1JZ7A 3E0GA 4NQCA 5DGQA 2BJML 4MJIE 5BRZA 2D7NA 5KAQG 3NIFE 2P8LA 3LZFL 4GRWE 3F65A 1ZT7A 1B6UA 1O0VA 2LAAA 3DO7A 4U6XB 2JELH 3GO1H 2VXUH 3PP4H 3TBTA 3G6AA 5IHBA 3WKML 1SM3H 4XP5L 2FBOJ 4HUVB 2K3TA 3MJ6A 5HD8D 3ARGA 2NLJB 3LB6C 4JDTH 3FRPG 4J3UA 2BC4B 5I66B 4YWGH 5SWQB 4WV1B 3S3PA 5FYLD 4P57A 3LDBC 1T7VA 3IDXH 2WQ8A 4PJDA 3SDAB 1UZ6F 3OAUL 2BRRL 4N68A 1Q9WB 4MCZB 1VDGA 4CU6A 3MREA 2FGWH 4G43B 3MRRA 3TO4D 2JJTA 2YA1A 3RVUD 4PJXF 1R3IL 3O9WB 2VKXA 1NMBL 3A6CL 2LU7A 4R4ND 1IJ9A 2I07A 5JA8B 4JFXA 1JFQH 5JPMB 5E2WH 3X3FL 4K7PL 1Q9OB 4KROB 2EE2A 5FUOH 3VFRB 2FL5A 1U2CA 2ZOLA 3DWTA 5E6IC 1NSNL 1G7MB 1CF8H 1EEQA 5KVFL 4OD2B 3BP6B 2HLAB 1UKTA 1NDGA 4XPAH 1KC5H 4EZMA 3BN9D 4PTTB 4Y7MA 2O5ZH 3IDNB 2ENSA 3HTLX 3P4LA 5HYJE 5IW1A 1IKFL 5IGXL 1C12A 3QDGB 5EUKA 3VFPB 2EYRA 3JXAA 3OZ9H 5A2FA 1QO3A 4KJYA 3DX9A 4J8RA 5J13C 1DE4A 5E8NA 3X3GH 1R3JB 5CLTA 5JHDA 3WJJC 3TP4A 2BNQD 1E4JA 1A6UL 1ZV5A 4RFEB 3RX5A 2YC1B 3QRFM 3WS6C 3QUMA 2AJVH 3G9AB 3G04A 3ZKNC 4Z7UB 1M05B 2VWEE 1BQLH 3CFDB 2PTTB 5C07A 3CLEH 4TNVK 4JRYE 4YDVB 1T2JA 3TBWA 1LE9A 1KEMH 3MJ8B 1OGTA 4XCNB 4AIOA 2BSSB 3LQAC 4Y1AD 5JORA 3MNVA 4OF0A 1S9XB 5FUCE 1RIHL 3J8F7 4Z7NF 2XG5A 1ED3B 1HSBA 3FFCD 4QRUA 3PWPB 3BZ4B 1P2CA 4LSVL 3G6JF 2VXVH 2Q7YA 4CW1B 1HH9A 4XP6L 3FT2A 1WZKA 2E6QA 3QO1B 1L7TL 3RVVC 3DNKA 3FQRA 1PBYA 4OCXH 5F1SA 3KPSB 1KCUL 1QBMH 3F8UB 3QIUA 1MCIA 1T22B 4ZFGH 1KBGL 1WLHA 1PY9A 4FTVE 5HYQB 3I9GH 3UTSE 2ZUUA 4RAHA 1R5WA 1JNNH 3O4LD 5CP7A 4D3CL 1RK0A 1FSKC 4U1LA 1CT8A 3MNWB 4KI5C 2YPVH 2VXQH 4FFVD 4JQIL 5BS0B 1IKNA 3OHXB 2YD7A 2V7NA 4WW1A 4ZQKB 2F5AH 3ULSB 4OTXH 4H1LA 4U6YA 3LPWA 1YMHA 1UYWL 4QTHA 1CTNA 4B0MM 3RWDA 3V8OA 1FORL 1JYVA 2H1PH 2J2ZA 4P2OB 1NFDF 1U0QA 1AGCB 4RGOH 5JOFA 1YJDC 1TJGL 5DJAA 1E4WL 5MEPB 4K3EH 1M6OA 3FMGL 4JFPA 1P5VA 4GJTB 3T4YA 2WWKO 1LDSA 5CD3B 5L8KB 4BFEA 4YHPB 4GAYB 1U8NB 3TH3T 3W81A 3DX8B 5DHYA 1MIEH 5EU6D 5GJTH 2YWZA 5F9OH 1CGSH 5DRXB 3V6OA 4HWUA 2RCSL 3ULVF 3WNNA 4IM8A 3H9SA 2R2BA 5MEQA 1U91A 1R5IA 2PXYB 3U4EB 3PWNA 2L4OA 3MUJA 3ULUH 3FTGB 2BY1A 5ICZB 4XBGA 4POYA 4PJ8C 2PYED 3VG0H 2WUCL 4ZTOH 4Z78B 1T1YA 4F7PA 5F7LB 4H0HB 1AGEA 4X6DB 1RMFH 1JVKA 4PRPD 3A67H 3RHWK 5T3ZD 3LKQA 2MQCA 4XMPL 1N64H 3NBNA 1F02I 3QPQC 4KHTH 4YAQB 5F44A 1RVFH 5EB9A 1OQOA 3F6LA 4WHTB 4KK9D 1NBZB 5KVGL 5E2VL 5LXGL 1CDGA 5GS0H 4JJ5A 2VQUA 4RNRA 1KN4L 3EYVA 5I74B 4R3SA 2NY2D 3O3AA 2ICES 2NY6C 1AGFB 1WCBA 3BMWA 4FQHB 4PRHA 4PV8A 2MJWA 3Q3GB 4JR9L 4I18C 2PETA 3EFDH 1I8LA 1FL6B 4OF8A 1JV5A 1R3KB 5EZIL 4HFWA 5JXED 2APTA 4OLZH 1MUJA 3FQUA 4HV8A 3P0VL 4F8TA 2YD1A 1KYOK 5IB5B 5C0AE 2OZ4A 4G8GB 5T3XE 1HINL 5LAXA 1IQDB 5H8DA 1VCAA 3U6RA 4F58L 1S7UB 3OKLA 3NA4A 3TZVD 5I1DA 3O8XD 4QRRE 2VNCA 2ZKHL 4XP9H 2DB8A 2PCPA 3KPPA 5ABDE 1BGXH 1V3JA 1KJ2A 1OAYL 3KR3L 4HXBL 3VXQB 2ADGB 5KVEL 4Y2DB 1J8HA 1U8PB 2YS4A 4JM2D 4EOWL 1NUFA 3T08A 5JTWA 4ERSH 3VXSB 4MNQB 4C56A 1Q1JL 2OCFD 2YMXH 4TSCL 5E94A 1JN6A 4HBCL 3QDMA 4JPWH 4AT6B 1J1OH 3BXNB 4XVTH 4B41A 5TPWH 2HMID 5E2TH 1RIVL 1Z9OA 4NQEE 4WU5A 5E08L 4Y8DC 4PJ7E 4LVEA 1DQML 1I1CA 4HMEA 5A3ID 5I30H 3SKJL 1LE5B 3OXRA 1KELL 4YHIB 2EKSA 4PP1D 2A83A 4NCC2 4QHNB 5KVMC 2H3NA 1OF2A 1VKXA 5GRUL 1IGCH 2X9XA 3BUYA 4OCRL 3ORJA 2AJ3B 3DPBA 5D7LB 3N1PC 3ZDYE 2BOCB 5FA4B 1AKJA 1FP5A 2NXZC 3VXNB 1AJ7H 3NABH 3V5HA 2BDNL 1Q9LA 2AQ1A 1YY8B 2MQ3A 3DXAB 4F8QA 3CX5J 1I1YB 1XF2A 5ICXA 1CU4H 2OR9L 3G5ZB 1E4XH 4PB9H 2VR4A 3D2UD 3MUGB 4WEBL 2Y5TA 4XP1H 3S4SG 5BZWA 3RA7H 1SJHB 3EDJA 4IJ3B 5KSVB 5GRWA 3HN3A 3P4OB 1BEYH 2O5YH 4X4YB 3S36L 1I75A 1ZHNB 4U6VH 2CUHA 2D31A 2DQCL 3MTRA 4KKNA 4HKZA 4LASH 4P3DA 2X4QA 2P45B 1NCBL 1FNEB 5GGVY 3QNZA 3FRPA 3CXHK 4E9LA 4XB7A 5KZCD 4K7PY 3RVWD 1A1OB 5DR5H 1DZBA 3IB4A 3NIDF 2ZZUT 3I3EA 4F9LC 2ZUQB 3S98A 3SOBL 5D9SB 1SMAA 1KCRL 2P48B 4M7ZB 1IQWH 4PD4J 4X98A 4JO1H 3R0NA 3DRTA 43C9A 3E2HB 2J8HA 4PLKD 5CJ8A 2E6PA 5LVEA 4WFEE 2F53D 5DK0B 4R0LC 3OKMA 3D87B 3MYJA 1OLZA 5I8OL 2VDNH 3IFOA 1VSCA 4PLOB 4TPRL 4RGNB 4RA0C 3MXVH 1BZ7A 1UB6A 5EZOH 1T5WB 3RFZC 4F57L 4IMKA 4ZUWB 1F90L 1F2QA 1HDMB 1Q38A 2D4DA 4ZNCD 1TPXC 1BFOA 3ISWA 4WI7A 5T1MA 3BRGC 5DTFB 5EU4B 3BOVA 4HJJH 5FKPA 3U1SH 2EICA 4Y4KD 4QXGH 2OXGA 3HZMA 1H15A 2DJSA 4LL9A 2OTWA 4OZIB 2F5BL 1LO3H 1Q9KA 1RU9L 1DJSA 3BHBB 3QUYB 3WD5H 3ESUF 4E0RA 3MRDA 5TGBB 2R23A 2Q86B 1DVFB 5DT1H 2DQEL 5F7MC 2HRPH 2VUOA 4NBZB 4NNXB 4ZPTA 7FABH 1IFHH 5C0NC 5HHOA 5HDBF 3CH1A 5CILH 1NANH 3U7WL 1VFUA 1NCTA 4YBHA 1DR9A 1ZHLA 5JIPA 3BH9A 3QWRA 4MXQC 3VGHA 2B2XL 3P4MB 5IBLC 2R9HC 1I4FB 5BVPL 3BEWA 4CMHB 4M5ZH 4M6AA 1BIHA 3IDIB 4UDTA 3PJSA 4CKVX 1U8LB 4TSBL 3ZLQC 4PJGA 3VRIA 4G3YL 1G7HA 3L95A 3L3HA 1FZJB 1RUAL 5HGDB 2EE3A 1IEHA 4JDZB 1AXSA 1BFTA 2YUWA 1A7NL 4MNHB 1JPTL 5DEZA 1G0DA 3KPRE 4BH7A 1I8IB 1IM9B 3BQUB 1DANT 5JW4Q 3GBML 2A6KB 5DWUH 4DGYH 4KJQD 1CGVA 4G6KL 1CLOH 4JO3L 4WGWB 1NJ9A 5C0CE 4FNLL 1QNZL 5I76A 5IG7A 4DZ8A 3ULVC 4FQJH 4EDWL 2ZUSA 4S1DD 3UZQA 2VZUA 4F3FB 5EIIB 4P2RA 4TUOA 3A6BH 3D9AH 4GG6B 4APQA 5LGJB 4S1SL 4XNZC 3QULB 4GW4A 4Y4HB 4DK3A 2XRAL 2W1NA 4J3VA 3WFCH 2IPTH 4MJIA 2Z92B 5F8QC 3WNKA 1XAUA 3NIGF 4ZUVB 3HB3D 5TE6L 3HUJF 5K9OA 1D9KC 1WF5A 4OM1L 4JN1L 4TQEH 3VW3H 1SQ2N 2HYMA 4LEXL 5EA0H 4CGTA 5B8CC 2X4PB 5FDWB 1WISA 4D9RE 4XNXH 1JTOA 1L7IL 2AEIT 1G7IA 3MRCB 3N1FC 1PJ9A 4JFEB 1RQ5A 1UXWB 2MMXA 4PTUB 1WWBX 4S1QL 5JDSA 3VG9C 4NQDB 4TVPE 1UM6H 3HZYA 2ZCLH 3TBSA 3HRPA 5CMAA 4P23C 4HCRA 4NQSA 3KWWA 1KJMB 4XXCA 3NZ8A 4JFQB 3PGFH 5DQDL 2Z93A 3FONB 5GSVA 4KK5C 5CEXB 5C71A 4LQFL 3SJVB 1OAKL 4J12A 1OARL 2YEZA 4W70A 1YEIH 2G9HB 4HIJB 4NFBA 1HSAA 2EDYA 4MA1C 5EORH 1DANU 2DQHL 1JPSH 4U1SB 2IH3B 1NCWH 3EOTL 1Y0LB 1CBVH 3OGCA 4LSPH 4N90E 4PIRF 4XXDB 3C6LD 5DK3A 3AAZA 4ZG1A 4PLJD 3QG6B 5HPOA 4X7CC 3U2SB 2DLTA 4ODSH 3O6MH 3VGAC 2DMCA 3QR2A 1HZHL 3RVXC 2MTPA 3T0EE 3O6FA 1D5IL 2YHGA 1BM3L 4KRPC 1SEBB 2Q7NA 3VCLB 1F97A 2EE6A 5HVGB 1KCVL 4EDXB 5HYEA 4BJLA 4Y4FA 4JG1L 4MAYA 3S6CA 4NGHH 1QLRB 2Z8RA 4OZGF 1KT2B 3NCJH 1OP9A 5KG9B 1QEWA 1MLCB 3LN4B 2GTZA 1C8PA 4LLDA 3BGFC 1MCSA 1X7QA 4PJHF 3KJ4C 2HLFC 4P2OD 3VI4E 1YEDA 2NY3C 2J6EL 3O6KL 2AJXH 4C59B 4DFIA 1HH6B 3ULUD 4NKDB 3EYFA 1OSZB 4XBPA 4NFDA 1WFNA 2NY4C 2XZCH 5D5MA 1NPUA 2R1WA 4K71B 1HILB 5HI4C 4H25B 5EULV 5MI0B 4K3DH 1I3VA 5D72L 4CADA 2FB4H 2W65A 4D8PA 4X9BA 3MRKA 3C09C 3MV7E 4HPOH 2ADJB 3B2UD 2LTQB 2BVPA 2NYYD 2BVYA 2ZNWA 5AZ2H 4UOW1 5IMKA 3V4PH 4JM2F 1XF3A 1VFBA 1ZAGA 4UUJB 5D7IE 3V5KA 3SDCC 2BVOB 3MCKB 3INUH 4ZYKA 1OP3H 1A6VH 1NLBL 1W72A 2ID5A 3DTXA 4X6FB 1FAIH 1IC4H 1CXEA 5DI8A 5GS0D 3RWHB 5HD8C 2IEPA 3GJFB 1TZIB 2WMPA 4J2XA 1VA9A 3PQYB 4NDMB 3QWOA 3BPCB 4KPHH 2BSTA 5LGHL 2ADIB 3T0BA 3MV01 1WZLA 1FL5A 3BSZH 1OP3K 3IDUA 3RIAF 1VFOA 2VDQL 1U8MB 1ZA3B 2W9EL 5GGRB 5CD5C 1EGJA 1DN0A 1FFPB 3OXSA 2XKSA 3H2WA 5EOTA 1OTSC 4PJFB 4XPFL 2MHAA 4NC2B 3JTSB 4M62L 3AM8C 4QOKB 3CZFA 4H88H 4G6MH 3SPVB 3O0RL 3ZT5A 5E03A 2JKXA 1LO0H 4R4NC 4OUOA 2BSED 5L2KE 4MD0A 4L3EB 4ONFL 3VFVB 1M7DB 1EFQA 1X5FA 2YZ1A 2Z31C 5J1AA 1JNLL 5C7XH 3B5HA 3VXME 2NX5E 3CAFA 5KSBA 4X8JA 5C9KA 3GMOB 1EXUA 2HFEB 3QIWD 1AI1L 5EFIA 2VXTH 1JK8A 3RY5A 5D8JL 1DDHB 2F74A 3DUHA 4OIAA 5E7FA 3P30H 1RFDL 4XC3H 4CMMA 4YJZL 4KVNL 5C2BH 2V6HA 4HJGA 2AJZA 4XZUB 2WZPD 4ENED 5E5MA 5TDOA 4ZPVB 4PJIB 2E6JA 4FMFA 1ADQA 1A5FL 3ZE2F 1OAZH 3L3DA 3BUTA 5ICYA 3H42L 1XGTB 3B8SA 2AK4D 1NKOA 2XN9E 4D0CB 4OUUB 1I3GL 4FQQA 2XTJE 4P2CG 1MCOL 3V95A 3U30C 1N7MH 1U3HD 3VXTB 4ZAKA 3EYSH 5DYOB 5I75C 4G6AC 2CUMA 3OF6D 2V7HA 2YXFA 4NPYA 1QVOB 1NGZA 1F4WL 2VRAA 1GOHA 4MXVF 1CDUA 3MV8D 1K8DA 3N1GC 3BMVA 3HMXH 3MA7B 4ZODA 1TZHA 3U0WL 1GRWA 3ARZA 1DLFH 2EEBA 4C4KO 4LMQE 2JCCE 2UZIH 1S7WB 3FO2B 1JWUA 3QIBC 4N8VG 4P46A 3I75B 2YPLB 4OLUH 4LLUB 1L0YA 1YQVH 3SHSA 4X6CE 1QFWH 2IPUG 5FO7B 4H26A 1TQBB 4P2QB 2O61A 4UNVA 5D7LD 3MMEB 3GSUA 5JPNA 5GIRB 1MCWM 3GMPA 5ETUA 4LCYB 2IPKB 4TSAL 2NR6C 2YOCA 4D9QD 3DX6A 4FFVC 1PSKH 4U1IA 4C83B 5TF0A 1NBYB 3QUXA 3QA3B 3MV9A 5EIQA 8FABA 1T1XA 2FO4A 5F6HJ 1ES0B 4N0CC 2CKBL 5JA9A 3F7RA 2UWEA 3C5SB 4L29B 4PY8J 4WGVB 4NC1C 3S5LG 5IMLB 4YHMH 4PJ9B 5HYJB 3QEHA 5E5UB 1OM3L 1YN6B 3ROOB 5HDLA 3V5DB 4PJ5A 2HFGL 5F8RC 3PDGA 1MWAH 1E0OB 1CK0H 4RIRB 3ARBB 3BDBA 4QRQA 3F7YB 5MEOA 1I8MB 2GY5A 4JDVA 2XICA 4EQ2A 4PJ7A 2ICWI 1YECH 4JPVH 4NO2B 2OSLB 1U8JB 2UYLB 4I77L 1QSFD 3FB7B 5HVHC 3O81A 1A6PA 3IU3A 3Q0HA 1AR1C 3PWVB 4YHNB 4XWGH 4HFUL 4JRYB 4JFFE 3BD5A 2VDPH 4ODHL 3SE3C 3WFDH 3K8KA 4TNVF 2XY1A 3AY4C 3UTTD 4RZCB 3P9MA 4BZ1H 1NCDL 1PVHA 2Y36L 3WXVH 1GIGL 4QHKJ 3GIZH 3U46A 1I1AB 1YMME 5I1EH 4BFGA 3T2NH 1A21A 3MRIA 1KNOB 1E28B 2VABA 5DMIL 4LPVA 2DYPB 4ESKA 1WVZA 3PGDB 4TUJB 3MO1B 2WIIA 1EZVX 3K8MA 4RQQA 3FL7A 1I1FA 3IRZA 3FRUB 1TETL 4H8WH 3RWCB 5D96B 1S7VB 4ZOCA 1EJOH 1AHWB 3V4UL 2D0FA 4FTVB 3VXPA 4OI9A 2JK5B 3UTSB 4KI5E 2MCPH 4PG9A 4OD3H 3ZL4L 4BYHA 3B9VA 4NN6C 5EC2B 2V2TA 2UZYB 2FX8L 2VLRD 1ZOXA 1YYLH 4IIQB 3PGCB 4JFDA 5C09D 3WEXB 4RAVB 4ELKB 4OI8A 1EUUA 1D5XB 1G6RL 1NC4D 3Q6GH 2DQIL 2A1WL 5IJKA 1BQHB 4WHYG 2ZCHL 2OMNA 2XTLA 1LO2H 3EO0A 4HGWB 5DHVB 5JXEC 1OB1A 4L9LB 2V2WB 3CVHB 3QDAA 3N85H 3THML 5FYLL 4EKXA 1IL1B 5DJDA 3FAWA 3ZDZF 4ZFOL 4GLRI 3QDJB 1CQKA 4TN9A 1RZJL 4EIGB 4CAGA 5FYKH 1WITA 4HUUA 4U6HA 5BXFA 4PY7B 4XBEL 1FFQA 5T1LA 4DCQA 3BQUD 3ZT6A 1KYOJ 1KB5B 3OAZK 3PE9A 3VXUE 5KTEH 1P4IL 2CJUH 4E41A 4M6ML 3L5XL 4GKNB 2RAMA 1JGUL 4FOMA 4V2CB 5ALCH 3QI9D 1EEYB 3FT4A 3P9WB 3NTCH 4UOW0 3WLBA 1AXTL 3C9NA 2CO7B 5ACZB 1J12A 4QRPB 4R7DB 4QWWD 2CIIB 3VGDA 5GPRA 1TVHB 3S4SB 3SBWA 4ALAL 4Y4HD 4WWID 4H20L 1A0QL 1WZ1H 4MQXC 2C4XA 3HAEA 3ABZA 3REWA 1MSPA 1NUNB 4IBLT 1KB5H 4ZUTA 2PTUA 3L5WA 1BD2E 3QZWG 1MFCL 3HG1A 3UTZB 5HYSB 2HWZL 3ULUF 1EHXA 1M7IA 3CMOL 3RTQA 5BV7C 5I1LB 1F4XH 4PP1C 1A9BB 4H0IA 1MNUH 1IZKA 2LV4A 1YQ2A 3WIHL 4X9HA 3MOBL 2I9LA 1RHHB 5HHME 3H3KA 1DL7L 2FSEB 4O2FA 3C5JB 5DJ8A 2PNDA 4Z76B 5B4MD 2AS5M 5IK3A 4CDHA 3D85A 2H8PA 3UYRH 1BPVA 4ZFZA 4WFHD 4Y5VB 3U9UA 4O4YH 4X80L 5C08B 2RFXA 4PGBA 3FN9A 5D2NE 3GMLA 3EKCA 3DUSA 3C8KB 4GRLA 4YHLH 1XZ0A 4MWFA 4X6DF 4XC1H 4I3SH 4NHUA 4P5TC 4YE4L 3H0TA 2CIKB 4MLSA 2UZXB 2X70B 4C4KT 3NVQA 3SJVD 1H9VA 1L6XA 2FJHA 1YPZE 5EOQL 5B39G 1FO0B 3IDMA 5AUMA 2B1AL 5D93C 5B38A 3D39E 4N0FB 4HIXH 3MCG1 3RZCB 1CXKA 1DBML 3HI1B 5C0AB 5IBTH 5JR1L 3GSVA 3KG5A 4MA3A 4C58B 1NCUA 3IAPA 4E42A 1YYML 1EK3A 2X4TB 4GBXC 4QRRB 5D6DC 3ZYJA 1NFIA 1XCQB 1MY5A 3P11H 4O02H 5C2UB 2FWOA 2DQTL 5AD0B 3H7BA 3MR9A 4LVHB 3CXHJ 1AFVH 1A6AA 4FQ1L 2I27N 4UT6L 1B90A 2IWGA 4R4BB 4OBRA 2NW2A 2AEPL 4KHXL 4P9HH 3AB0C 1S9VB 3KXFE 1LK3H 2GTWA 1KENH 1M7XA 4PRAA 3TVMB 1HN1A 4X4XA 3PIQA 5DQ9A 2DQDH 1FZMA 3BT2H 4LMQI 1WBXA 2MKWA 5HJ3A 1ZWIA 1XGYH 4U49A 4HJ0D 2VLJE 1BBJA 5DMJB 3QJFA 4LHUG 4F7MA 3UPRB 1UZ6E 5LQBH 2X1QA 3MLWL 1VADB 3O2DA 1LEGA 3C6SA 1BVLA 4OSUL 1KUMA 1UACH 3IJSB 3VMOA 2OJZL 3EZ8A 3ARDB 3QEQD 2QADB 4PJXE 3L9RA 4WFGD 4FXLA 5KJRL 1K2DB 3FB6A 2DBJA 4TUKH 3RU8L 2IAMD 1VEPA 1NDMB 4AMKH 1E6OL 3B43A 2GK0B 4YX2H 3NFPB 2OTUB 1U6AL 3TIEA 4JAMA 5DJ0A 1J88A 5EBMB 1BJ1H 4Q6YA 2QSTA 1GHFL 1F58H 4BSWA 5I1AB 4P59L 3BIAX 5CCKH 4OF5A 2EDXA 5T3ZL 2GJ6D 4HK3N 1G9NH 4G8FB 3NCCB 1PKQB 1JJUA 1S78C 4R4FH 2VDLH 4WO4A 4WV1C 1IAMA 2HJKB 3W5NA 2EECA 4Q9QH 1S7QA 5AAWA 2BCKB 3K4AA 3TCLA 3GBLA 3R8BB 3SDAC 2RGSA 3LKPB 5GRXG 2EDHA 1WBYB 2CDGA 4Q9CA 1T1WA 3MRPA 1WIUA 2DBLH 1AO7D 4N8VA 4QYOB 4YEEA 4J6RL 4MD5B 3WUWA 3O9WC 4XVSL 5HHNB 4PRBB 4J3OC 4HEPG 3KLHC 1KPUB 1QSEB 1RURH 4Z7NE 5D1XD 4KROC 4O5LH 4HUXA 1TVBB 3G6JE 1XGQB 1XH3A 2VZ3A 3OL2A 1MLBB 3MV7A 5T1KA 1MQKL 3JWDC 2EIZA 3HPJA 1T21A 3L3IA 1N0XL 2A74B 5DC0A 1KFAL 4HK0B 4OCSH 4ZS6C 1KEGH 1DUYA 1PYWB 4EUPA 5MHSE 3VDBA 5HGAB 3T3MF 5FECB 3BKML 3O2VL 4JFZL 5BMFH 4OLWH 4QHMB 3V0AC 3SDDA 3SGEI 4WNQA 1FV1B 1RZIA 3FO1A 3S5LA 5KN5B 1RUKL 2WIMA 5T33L 2EDKA 3GBNH 1IARB 4WDIA 1T04A 5GZOD 4JM4L 5KW9H 1TCRA 3UDWA 3GMRA 5A40E 4OB5L 4AM0B 5FO8A 3M07A 3MGOB 3MXWL 4BK5A 5I8KL 5I1IH 3P0YH 5J56B 2I26N 1JMZA 4RA3A 1NGYA 4YDKH 5EZJA 1R5VB 3UMTA 2W9LA 5IW6A 2NTFA 4WWKB 1U8HA 2UVEA 1GGIL 3WNPA 3NGBB 3B83A 4LSQL 3QRGL 1CICA 3PHQA 4UNUA 1NFDE 2X1XR 3LRSB 1XR9A 5L2KA 3GK8H 3RWFB 2C9AA 2A6IA 5C0JB 4KDWA 3O11A 1HXMA 2DQUH 1KN2H 3MRBA 4AH2A 1JI1A 3WBDA 3VXMA 2NX5A 3BKJL 4IOFC 4ODXB 5FM4A 2FZ3B 4G7VL 1QFHA 2VQTA 1EMTH 4LCUB 4U4BA 5ERWA 3V0VA 5DK2B 4H5SA 2YPLD 1VPOH 4WW2F 1T20B 3RVTC 4H0GA 3ULVE 4DUXA 3KPRB 5CBEB 1FAKT 3R0MA 2DWDA 4ORGA 5L9DH 2ATPA 3QWQB 4P2QD 2AXFB 5TF1L 4DTGL 3HNVL 5C0CB 4TULL 4G9FE 5HI5D 5AAMA 3IFLL 5KVDH 4LSDA 4FXKA 5GRZA 3S88L 4HXAH 2X4SA 2XN9A 3KLAB 3PXJA 3S7GA 3B9KD 3EDKA 1VGEH 4DN4L 2BNUA 3PDOB 5DO2D 4NQVA 5C9JB 5GGSY 4P5KA 4G80A 5EUOB 3VFGL 3WL9A 3TIDB 4HK3J 5B3NA 1MAKA 1YEKH 2IQ9L 1XIWD 4OFDA 3EFFB 4LRNH 4P2OC 2DRUA 1UH4A 3RL2A 4PJ9D 3ULUC 1IEAB 3I02B 2GFBA 4UDUB 1FL3A 3LS4H 2HJLB 3RPIB 1QSZA 5I1GL 4AJ0A 3UTQA 4L4TE 2CRIA 5MP6L 3ARBD 4J4PD 5ID0B 5GS1B 1INEH 5JZ7C 2AAVA 2BHZA 5IVOA 4NKMA 2JCCA 3I2CH 5E4IA 1SY6L 2MCG1 1ORSB 2X7LA 4NO0A 1U58A 5A2KH 5MENB 2PXYC 2F54E 2ARJA 2ICWB 2R2EA 3MRMB 4XHQA 5F72S 3LN5A 1WFOA 3OWEA 5FHAL 2GHWB 2D03L 4HIEA 2BSRA 2BRRH 5CZXC 2GSIA 3MLYH 5IM7A 3EJYD 2KQNA 3LSOA 5E6IA 3PV6B 4M48H 3V6ZA 1OT1A 4L4VA 1NDGB 5D7JD 4GW1B 4PJCA 4JRXA 2J7LA 2P5WE 3AU1A 1XR8A 2JELL 3GO1L 3L7FB 1CIDA 3PP4L 2GEEA 5IW1B 4U3CA 1C12B 1NLDL 3OJDB 3QZWA 4NZJA 5D1ZB 1MHEB 1KCKA 2PO6B 2PW2B 3GEWB 1QO3B 4HIHA 4XCYA 3W0WD 1NSNH 4JDTL 2DIJA 2Q3AA 5JLZB 5E8NB 2XWJA 3DOSA 4P99A 5KVFH 4YWGL 4YH6A 5A16B 3O41B 2IALB 5JHDB 3WJJA 3H3BC 3AXLA 4P2YA 2BNRA 4KY1H 1X5HA 5DA4A 3C2AH 1UJTA 3T0EB 1W0VA 5I74C 3IDYB 4DZBA 4HS8H 3WS6A 5GSRA 4NQXB 1N3NA 2FYYB 3G04B 1T0NA 5FYKD 5IMOA 5FA3A 5ISZD 5KSUA 4LCWB 4QHLB 5F1NB 2D0GA 4FQXD 3LKNA 5HTSA 1H0DA 4U1JA 4MX7A 3TBWB 4V1DA 4AL8H 1JFQL 2APWA 5E2WL 3MNVB 4I8DA 4JANB 1CS6A 5IT2L 3QXDA 4QRUB 4BSVA 4KMTH 2E8YA 1OPGL 2QQKH 2AXGA 5FUOL 2VAAB 3ESVF 4X4MA 4ENEC 2XKNB 1CF8L 3QDJD 3VE0A 3QUMH 4XPAL 1KC5L 2C7UB 4QKXB 2DDQH 5HDQH 2O5ZL 2AK1H 3E1F1 3LS5H 2R1XA 3OKEA 5JO5B 1RIHH 3I6KB 3EBAA 5ANME 1OP5H 3GIVB 5FOBA 2VDML 3OZ9L 2N56A 4M3JA 1MCPH 2I25N 4M93B 3X3GL 1R5WB 4XP6H 4Y2DC 5BO1H 2P7TB 4X7TB 4HDIB 5DMKB 4UOJA 4QRPD 3HCVA 3OKYA 1MRFH 5D7IB 2F8VA 3DYMA 1P4LA 1HHHB 2B4CC 3VGBA 2AJVL 3BGMA 2C1OB 5ENWA 4F2MB 3UPCA 1BQLL 1XEDA 1J86A 1A7BA 3IXAB 3L1OL 4JN2A 4MB3A 4OZ4A 3TJEH 4H1LB 2DTMH 1K8IA 1WJ3A 3KS0H 3Q2CA 1KEML 5IB2B 4OLXH 3QUZB 3UZEA 1MCFA 3KHOA 3NIDE 2WNGA 3TV3H 3BPNB 3QP3A 5C6TH 2FX9H 3IDGA 1A1NB 2VITB 4K94H 4BSJA 1M6OB 2VXVL 3TO2A 3HE7B 1A4JA 2V5MA 3T4YB 3VDCA 5DD5H 3EOAA 1U93A 2VE6B 3L3GB 4N9GB 1A1MB 1BQSA 4XNQB 4OCXL 3U0TB 1NH6A 2ENYA 3L3KA 4AENA 2QSVA 4HS6A 4H1LH 2KL6A 1QBML 3SKNB 3KPLA 2R15A 4ZFGL 1E4WH 3H9SB 2R29H 5MEQB 1JNNL 2NXYD 3RDTD 3CXDL 4ELME 4IRSB 4PJ8A 5FO9B 2W07A 3DUUA 1ROWA 4XPTH 4IJ3C 5EO0A 4WCYH 4XHJD 2VKWA 1HQRA 2YPVL 2FJGB 2VXQL 3DX7A 2NY5C 1ZHKB 5BJTB 3BD3A 2F5AL 3ZDXE 3TF7C 3RZCD 2BNQE 4OTXL 4JHWH 3UAJD 4J3TA 1A14H 4X99A 4OKVA 1FYTA 2FBJL 2X6MA 4L4JA 2B7DT 4KWUA 4LLQA 1P7QA 2H1PL 4MMZC 3M1BA 5HDBE 4RGOL 4URTB 1X4YA 1N5AB 2ZUQC 4K9EH 4PJFF 1LO4H 1CDYA 5KBNC 4KKAD 4M7ZC 1MAJA 3H9ZA 4K3EL 2XTJB 2IC2A 2XZQL 3MUZ1 3QISA 3E2HC 1VESA 2H9GA 3SDXA 4Y1AE 4P48A 5C8JA 3FFCE 4RGNC 4OCWH 5GJTL 1MIEL 5ESAA 4X6BB 4ZXBB 4RMQA 1CGSL 1DQDH 1G7LA 2JF1A 3WFEH 1LP9A 5KS9A 3SGDH 1BLNA 2CMRH 4I18A 1DBAH 1D5ZA 4LQ1A 1NGXB 4UINH 4UQ2B 4MDIA 3WDJA 3SDYH 5I17B 2IBGA 2X1PA 1DTUA 2HTLD 1L4IA 4HFWB 4OBSA 4ZSOE 4YGVB 3VG0L 4ZTOL 1KN4H 4JZOA 4FMKA 3DURB 4IRJD 3MRHA 3PV7A 1RMFL 2VDRH 4M7KH 4ORZC 1TMCB 3O4LE 1WAAF 3A67L 3QUYC 1RZ8B 3ARDD 2FIRT 5E2UH 3DLQR 4X6CB 5EOCJ 1YPZA 4KK6C 4OGZA 1DVFC 4M1DH 5BZDA 1TJIH 3BO8A 2ED8A 4KHTL 5CAYB 3FOLA 1RVFL 1JHTA 3FOMA 4JREB 3P0VH 4PBVC 3ZTJH 2P8PA 5DJXB 3OKNA 5IEKB 4MQ7A 2IFGA 5DZNA 4GRMA 3RNKA 4NCDA 5J1TC 5EO1B 3NIGE 4R2GD 3WV0A 4Z0BL 4CMHC 1K6QH 1SHMA 3HUJE 2OZ4H 5AG8A 4NC1E 5GS0L 5GQBA 4P5MB 4PRDB 5SX5K 5EPMA 5E94B 1JPST 3TFKD 1KIQB 4AK1A 1C5DA 3TA3D 5DRNA 4F33B 2W0KA 3F5WB 4HXBH 5IF0A 5C0GA 2VIRB 3C5ZA 5E6YA 3EFDL 2MNUA 3GSOB 4W6XB 3MRLB 3LQZA 1LNUA 5EU6E 1TITA 4NKOB 1Q1JH 4M8QA 2HN7B 4NT6B 3BQUC 3TJHD 4J1UA 3DGCR 4UT7H 2VLJA 4PG2C 4CVXA 4HWZA 2IG2H 2Y5EA 1YEHH 5C3LD 1H8OA 4KC3B 2PYEE 1WFTA 3MRNB 5F3HA 4KKBD 1FBIH 1FFRA 4PJXA 5E08H 4GW5A 3PABB 1QSED 1AKJB 2AV1B 4XP9L 4QWWC 1J0HA 4PRPE 5EBWA 1BGXL 1R24A 4Y4HC 5T3ZE 2DI9A 2V2XA 4M8VA 5ICXB 1YMMB 2VLMD 4JFOA 2OP4H 1E27B 2R2HA 3BYTA 5B39B 3BZDA 3BH8A 1MFDH 4PYHA 4YZFF 1LO5B 4ERSL 3O6LH 2O93L 3ZT7A 3B3IB 4MSWA 4BA8A 1DUZB 5GZNC 2JB6A 4WEUD 2BDNH 2Y25A 1ZS8B 2ESVD 4JPWL 1JYWA 4JY4B 1J18A 2D31B 3GSWB 4UAOB 3ARED 4XVTL 2FJFA 4L5FH 3BJLA 5TPWL 3RL1A 1MCDA 4BH8B 3FQNB 3DBXA 3MQIA 4Y5YB 4ZD3L 4K8RH 5HGGS 5JW4R 4X9FA 5I30L 3RX7A 1S8DA 1TIUA 4OZGE 1I7RA 3S36H 1KJ3H 1G1CA 1ORQB 1T5XB 5GRYA 3X17A 2DQFB 4PJHE 3HS0A 4R0LA 2W91A 4HBQA 3R8QA 1G7JA 3T1FB 3K81A 1A22B 5F7UA 3WNMA 2BVEA 1AJ7L 3NABL 4G7YH 1LDPH 1PQZA 4JO2H 1Y18A 1LILA 1KCRH 4POZD 4LU5H 1S7TA 4NO5A 2A0LD 3D69A 4KRNA 2DI7A 1CU4L 3G6JA 3OKKA 2B1HH 3E6FB 1E4XL