5D4JA

Chloride-bound form of a copper nitrite reductase from alcaligenes faecals
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
335
structure length
335
Chain Sequence
AAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Copper-containing nitrite reductase
publication title Redox-coupled proton transfer mechanism in nitrite reductase revealed by femtosecond crystallography
pubmed doi rcsb
source organism Alcaligenes faecalis
total genus 93
structure length 335
sequence length 335
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2015-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5d4jA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5d4jA02
1HAUA 4DPAX 1JZFA 2ZXWB 3EH3B 6PCYA 1J9SA 3X2QB 4YSQA 2GHZA 5B7FA 3JT2A 3T6VA 4F2FA 2PCFA 4P5SA 2HX8A 1A3ZA 1JZJA 4YSEA 2EINB 2HRHA 1ET5A 2Q5BA 1IC0A 3C75A 2XYBA 1FWXA 9PCYA 4DPCX 2RACA 3JTBA 3OQRA 1MZZA 3S3BB 5ANHA 2IDFA 4YL4A 3DTUB 1GS6X 3EF4A 3FPXA 5I6NA 1CYWA 3FT0A 8PAZA 2JKWA 3WNJA 4FA7B 1AZNA 5PCYA 4M3HA 4CSZA 3QJTB 4E9RA 2BW5A 2IDQA 4KO7A 1UATA 4QLWA 2YQBA 4HCGA 1AS6A 2BO0A 1E5YA 1RKRA 3EHBB 4KOCA 2XLLA 1PY0A 3S8FB 4Q89A 3FQ2A 2PCYA 1R1CA 1BXUA 2PPCA 3FQ1A 4KNTA 4BWTA 1ILUA 3ASOB 1A65A 5B3SB 1N70A 1NZRA 5F7BA 4DP1X 2VSMB 1MZYA 2AFNA 3PXLA 1HAWA 1AG6A 2XU9A 4CSPA 3QJRB 1NIEA 2ZWNA 3QJVB 1BEXA 3IN0A 4N8UA 1NICA 3NSCA 4YSDA 2J55A 1WS7A 4WTQA 1KCWA 2XVBA 1JVOA 2EIJB 2N0MA 2VW4A 3X1NA 4A2DA 3FSVA 5B1JA 3NJNA 3S3DB 4ENZA 5I6MA 1T5KA 4GP8B 3TBBA 3PAZA 2CCWA 2XX1A 3X1BA 4UANA 3PPSA 3TASA 3WKQA 1X9RA 3ZX1A 2BWIA 1V55B 2IWFA 2X87A 1I53A 2JXMA 2UXGA 3CG8A 2LLNA 2YXWA 2H47C 1NIDA 4HIPA 4YSTA 1A8ZA 1ID2A 1VLXA 2XWZA 1XB8A 2FTAA 2J56A 1BXAA 3PLYA 1RZQA 4HAKA 2GBAA 2H5UA 1AZCA 1GY2A 1SF5A 5IY5B 1GS7A 2XXFA 1ZDQA 5FC9A 2I85A 1SFDA 1JOIA 3FSAA 5I6OA 3T6ZA 1NIAA 3SBPA 3NYKA 4HCFA 3GDCA 3KW7A 2UXVA 2BZ7A 3AG1B 1XMEB 1JXFA 1PNCA 3FSZA 1EZLA 1JXGA 1MDAA 3FYIB 3HEIB 1ZDSA 1FFTB 1JXDA 3EH5B 3NSFA 4G7RB 1A4BA 3WG7B 1ZPUA 1SFHA 2B3IA 1GYCA 1ASOA 4DP0X 1KCBA 4DP2X 3FU9A 1W6LA 2VW6A 3GYRA 2FQDA 1OCZB 3AG4B 4UAHA 3WIAA 1AZBA 2GB2A 3QJQB 1KGYE 1XB6A 1J9QA 1URIA 1PAZA 2YAOA 1NTDA 3S3CB 1JZIA 1E30A 1JZGA 2MRYA 1IBZA 4DPBX 3ZDWA 4GXFA 2EIKB 5D4JA 1ETJA 5I6LA 1FA4A 1WAEA 2HLEB 2AZAA 3H4FA 5B7MA 7PAZA 4DP6X 2YAFA 1QLEB 1OE1A 4FAAB 1NPJA 3G5WA 3AZUA 2H3XC 2VM4A 3CVCA 4DP7X 6PAZA 4HZ1A 4GY4A 2P80D 2CALA 3T71A 1ASPA 3CVBA 1A4AA 2VW7A 4QKTA 2FJSA 1NINA 4YVUA 3X1FA 4DP8X 3DKHA 3OMAB 1OE3A 1A4CA 2AVFA 2BP0B 1V10A 1J5CA 4PCYA 5PAZA 1L9RA 2VM3A 4JHVA 3U25A 2BP8B 1CYXA 5AKRA 1PZAA 1PLCA 2BP0A 4X4KA 3FSWA 2IWEA 3FS9A 1AQ8A 2QPDB 2YARA 4A2GA 1WA1X 4MFHA 2BP8A 1OCRB 3FU7B 2FT8A 1OF0A 3QPKA 2OV0A 3TU6A 3AY2A 1IKOP 4UF7C 4HALA 3PCYA 1L9TA 2XX0A 3ABKB 2BWDA 2DYSB 4W1TA 5E9NA 4F2EA 3V9CA 1PNDA 5TK2A 1W6WA 5I28A 1TEGA 2HRGA 3FU7A 4AKOA 3T6WA 1OCCB 2XV2A 2UXFA 2E86A 3ABLB 4BWUA 2QDWA 1GY1A 1OV8A 2W8CA 2IDSA 1SNRA 2BHFA 2AZUA 4YSPA 3SBRA 2R7EB 3N2JA 4GP5B 2YAMA 1JVLA 2PPDA 3ZIYA 1ET8A 3NP3A 4YVNA 3T6XA 3OD3A 2WO2B 1ZIBA 4AZUA 1M57B 5B1AB 1YLBB 2R7EA 2X88A 1AZRA 4PAZA 1PZCA 3FYEB 1AS7A 4ZK8A 2CJ3A 1AACA 1ADWA 2W88A 2YXVA 1BXVA 2B08A 4HHGA 4YSSA 2AANA 1F56A 4KO5A 1TKWA 1AAJA 2YAHA 2OCCB 4A2EA 4YSCA 1TEFA 2FNWA 3ERXA 4P5RA 2UXTA 2FWLB 1ZIAA 1BQRA 2GC7C 1AZUA 2IDTA 2GI0A 2J57A 1E67A 4HHWA 3BQVA 1PZBA 3NJIA 1E5ZA 2VN3A 3AG2B 3NSDA 1X9UA 2IWKA 1WS8A 3CVDA 3L45A 1PMYA 2WSDA 4WKXA 3UABA 1ZV2A 4E9YA 1DZ0A 2UX7A 2QT6A 5D4IA 4BWWA 3N55A 2GSMB 2OJ1A 2PPFA 4BDVB 3NP4A 1NWPA 4G70B 3NJLA 2MTAA 1NIFA 2IH9A 2XXGA 2J5WA 1PF3A 1NIBA 3WKPA 2DWSA 3NJGA 4W9ZA 4E9XA 2IH8A 1N68A 4NB7A 4E9SA 1BQ5A 2CAKA 1GR7A 1CC3A 3HB3B 3KW8A 3X1GA 3FQYA 3ABGA 4DP4X 4E9QA 3UAAA 3SQRA 1MG2C 4NAJA 2FQEA 2ZOOA 1XB3A 3IN2A 4G7SB 3EH4B 4KO9A 1NDTA 4DP9X 3TA4D 3QJSB 1AANA 4A68A 5AFAA 4F7KA 4YSOA 1L9PA 1GSKA 1AG0A 1JZHA 3PAVA 3TBCA 2YAEA 1NWOA 3T9WA 4HCIA 1J5DA 4G71B 3H56A 1PLAA 5I6KA 1NPNA 1MG3C 4N4YB 5LDUA 4Q8BA 1KBVA 1OOWA 2XUWA 2DV6A 2JFCA 1DYZA 3WNIA 2VMJA 3DIVA 1CUOA 1BYOA 5I26A 4DP5X 3UAEA 2VSKB 5D4HA 2UX6A 2IDUA 2BZCA 4YSRA 1KV7A 1BAWA 1IBYA 4AI7A 2Y69B 2PPAA 3IBOA 3WI9A 1OE2A 3SBQA 3NJHA 3NSYA 4KOBA 5EHFA 1ILSA 1SHXA 3FPYA 4KNSA 2TSAA 2HX9A 4TXVB 5B1JC 2FT6A 3V9EA 4G7QB 1WA2X 3PAUA 4NERA 3BVDB 1AR1B 2CUAA 4G72B 2YAPA 4A2FA 1JERA 1AOZA 2QPEB 5I5JA 4E9TA 1SF3A 4RH4A 1PLBA 2DYRB 4AKPA 1M9WA 4L0PB 1BYPA 1EHKB 4GYBA 3MBWB 1OCOB 1KDJA 2IAAC 2HZHA 3D12B 3QQXA 4EF3A 1RZPA 4A66A 1J9RA 3NJMA 3AG3B 5B1BB 3IE9A 1B3IA 1L9QA 3OMIB 3GXUB 1QNIA 2PP8A 4KNUA 3UGEA 3ABMB 3AW5A 2DY2A 2QDVA 1SHWA 2PP7A 1KBWA 1HFUA 2PP9A 1AS8A 4A2HA 1TU2A 4K9JA 2FQGA 3MX0B 2XV0A 2BW4A 3CDZB 4BXSV 3ZBMA 2TSBA 4E9VA 1RCYA 1ASQA 4YSUA 7PCYA 1KYAA 1L9OA 3NT0A 3NJFA 2NRDA 3QJUB 4M4RB 3IEAA 3CDZA 5AZUA 2EILB 4AKQA 1WA0X 3CZUB 1SJMA 4KO6A 1E65A 1BQKA 2HX7A 1AIZA 2EIMB 3OM3B 1KDIA 2YAQA 1J9TA 1SDDB 5A7EA 2A3TA 1QHQA 1PCSA 2DWTA 3OMNB 2PLTA 2XV3A 3UADA 4A67A 3FU8A 1W8EA 4YSAA 2I7SA 1GS8A 5B1KA 3NJJA 1SDDA 1GW0A 3UACA 4JHUA 2GC4C 5I5IA 2I7OA 3X1EA 1CURA 4BK5C 2Q9OA 5TK4A 5F7AA 2CBPA 4BDVA 2HXAA 2GIMA 2Y1AA 2WO3B 3H4HA 2FQFA 4GP4B 3RYMA 1L9SA 4E9WA 2PPEA 4JKNA 2FT7A 5B7EA 5I6PA 4AX3A 4BXVA 5I5MA 1IUZA 2ZONA 2P80A 1ET7A 3NJKA 1JZEA 3S8GB 3ASNB 1M56B 1V54B
chains in the Genus database with same CATH superfamily
2HA1A 1XZWA 1UYWL 3ARYA 4XAKD 1BAGA 1QO3B 1BQLL 2ESVB 3JV4A 1DJYA 3ESVF 3T6VA 1U92B 1ZANL 4HPYH 5KOMC 1IX2A 1Q90A 1ACYH 1UOLA 2X9ZA 4M1GH 2N01B 2ZSWA 4I87A 1ED3A 2EDQA 1MJ7H 3JWNC 2E0PA 1DJSA 3MLVL 4WU5B 2ALAA 3HVDA 3FUHA 1CFBA 1V3KA 4WWKD 1XL4A 2FX9L 4FNTA 1TJIL 3IM1A 3MUJA 1MZZA 3WXWL 4XMLH 2G75A 2CK0L 1KEML 4QXTA 2W07A 2JCCE 4FNSA 4M7ZC 5HHOB 3PDOA 5MENB 3NFNB 4LRIA 5J1AA 5A6MA 1IJNA 1FH5H 4XAWL 4XXDB 3IFOA 5T8IA 3TIDA 2XKSA 2BP5M 4I0PC 3TTSA 2B4CL 4AG4H 5CSZA 4I1PA 5HJDA 3QA3B 3BKML 2H2PD 2YD7A 3TT3L 1FVCA 2YQBA 2P8LB 1RZ8B 3EDEA 3JWNH 2EDWA 2Q20A 5LN4A 1MVUB 2IPKA 5ABDE 5A3ID 4KX7A 4QIRA 1GW6A 3HAEH 4V1DD 3T77A 2PPCA 2YQ3A 3L2LA 3LH8A 4WI9A 3QR1A 3QFJD 4PJAF 1V7NH 5FYLE 5IHZB 1QW8A 2F54D 5IOPA 1HWHB 3VFNB 2ICCA 3X3FH 3PXLA 4R7NB 4OZ4A 3T3PE 3S5ZA 5K1VA 4AEHH 2Y25A 3ARBC 4IJTA 3JTTB 2DQHH 4WFGE 5FS5A 1CK0H 1Z9OA 3H3BC 5GRZA 3KL5A 4QRBA 2G0LA 4UZUA 1LO0H 2N0MA 1NBVL 4FNLL 4FFTA 2VN5A 4XCCL 3TBBA 5FUOH 1B90A 1RIUL 3PAZA 4AQEA 2D7MA 3QIBC 2F53A 2VXVL 4Z9KB 3NZUA 3U36B 4MJ6A 5C8JB 4NZUH 2NY1B 3DIFB 3RWEA 4TL5A 5JHDA 4TOYH 3EFFA 1M1SA 1RIVH 4I4WB 4FQ2H 1CICD 1JF5A 3CG8A 4OZHE 4UDUA 3BUPA 4ILDA 2H47C 2BOBB 5JMRA 4QEGA 4G9FD 4BCZA 4XI5D 1YMMD 2FD6H 1BXAA 1N10A 1XSIA 5IREA 2D0GA 5IW3A 4KI5D 1LP9A 2WLZA 1TLMA 3VFTA 4PRPB 5JLZB 2WBXA 4XPFL 1BECA 3C5JA 3SKOB 3SDXF 5FGBC 1DHKA 2WXIA 3IPEA 1EEZA 5D2NB 1MFCH 2DS4A 3HZYB 2HRPL 2ZXDA 4Y5VC 2CUIA 3II2A 43C9A 4Q9CA 3T6ZA 2X4TB 1I7UB 3PABB 5I15L 2OPCA 2X70B 1WFOA 2CJSA 3EJTA 4KMTL 5TH2B 3WTYA 5JIPA 1HCFX 1KT2B 3KVQA 4XVUC 3VMOA 1ZDSA 3DO4A 2CG9X 2VMEA 2W38A 3FB7A 2WNKA 1JV5A 4POUB 1KB5L 1LTXA 3GI8H 5E9DB 5IB1B 4J3BA 3D18A 3VWJC 2V0AA 1CD0A 1LD9A 2VRAA 2COQA 3DPBB 1W0VB 4JO3L 1FBIL 4GW5B 3LDBB 3QI9D 5KVDE 1YEEH 3GYRA 1FZKB 3LH2L 1YPZA 1UM5H 2DTSA 1AKJD 2GIXA 4AYSA 1IGIH 1BVNT 2K3TA 2P7TA 3DC0A 3LKNB 3IFPA 5C2BL 3QXDB 2R2EB 3ALWA 2SEBB 4LSTL 1ACXA 1VFAA 2ZX5A 4S2SA 1DL7H 2A9BA 5AAWC 5KG9A 2GUOA 3M46A 2V4LA 5FGBA 1D7DA 2NX5A 1TQBB 1RUMH 4OGXL 1VCBC 1XCTB 2R9HD 4K3JH 1MVFA 4NO5B 5IQ9B 4X9FA 1FNGB 5IR1A 1P4IL 1B6UA 1SQMA 3CX2A 3OXSA 5EBGA 1RUAH 5LBSA 1C8QA 4DFHA 4PJDB 1Q1JH 1J8HD 1S7QB 5CCKL 3E6FA 3IFNH 1RSYA 2W9DL 2Y2TA 5DVOA 3TVMA 4OW6A 1GZHC 2YWZA 4WEMB 4GY4A 4WIQA 2DQJH 2BNQE 3VRIB 5F9WB 2HFEA 1Y6NR 2AI0H 3CVBA 1A4AA 2OYKA 1NGYA 1SUHA 2EO1A 2JMRA 3AT0A 5DQ9B 4APQC 5JHLL 4JCWA 2WXHA 4F20A 1H5BA 1FPTH 1EANA 2OMWA 1W2KT 5CD5D 4WU7B 3NZSA 5AAMC 5IJVA 1MLCA 5I73C 2WXMA 3N42F 2DM7A 3HW7A 5BRPA 1RUKH 2ICWA 3A5VA 4TNWK 4Y89A 4M5YL 1CL7H 4TSCL 5DMYA 1M9SA 3ULUL 3C09C 3O6LL 2BP8A 2P48B 5LG1A 1BAFH 3UJTH 4H8HA 5AKVA 2A6KA 1JWSA 2G2RA 2YRZA 4ERSH 4L3EE 2VDOH 3GLZA 1M05A 2NQDA 1DO5A 5TK2A 1E40A 3GMMB 1GZHA 3O2VH 4LSSL 4FQJH 3L81A 1IC7H 1BD2E 2L7QA 1SNRA 4JFOB 4GBXC 4U1HB 2FGWH 3QJZA 4M61A 4MX7B 4QRPB 5IBLC 2YOAA 4XNMB 2VLRA 4PRHD 2G9HA 4IMLB 4BZ1H 1LMKA 4BFKA 2EH8H 1R3LA 4MTMA 4HEPG 1CMOA 1EDYA 3Q2VA 3L5WB 2CMRL 1YNLL 1QLFA 4DGIL 3T8MA 2OULB 1Z32X 4LBEA 1D5IH 1K3ZA 4HHGA 2ZYSA 4M8UA 1RZJC 2W0FB 3DYMA 5KBMA 3CSFA 1LDSA 2OI9B 2BSEA 3OJ2C 1A22B 5ESVA 1MCKA 5LNDA 2KQMA 4EOWH 2GT9A 3EYOA 1YG9A 4NC1C 3INUL 4APXA 1SEQH 4Y2OA 4P5RA 4LP8A 5B38B 3HB3C 2GC7C 2QQKL 5AENA 1AZUA 2YA1A 3IDXL 1X6LA 2KS0A 4MQTB 2OFQA 3AVEA 1OAKH 3MRNA 3QULB 4HJSA 2ZWSA 1SY6H 1TPXC 2FBJL 4ZO9A 2GIYA 4LGRB 3G7TA 1ZA3B 2A1WL 4IQHA 1E6OL 4OZFA 3WV0A 3NSDA 3NDYE 1TITA 5EPMA 3UTQB 3CK0H 3RHWF 4LARL 2QZQA 4HFUH 4L1LA 3NPSC 2VL4A 3GMPA 4FMKA 4LAJH 2IH9A 5J4MA 3F7VA 1K6QL 1IVLA 1NIBA 4NO3B 5F0LB 2LABA 3P4MA 1JNLL 2YZ1A 1HINH 5KN5A 3QCTL 1OGSA 3RA7H 5DK2B 5CXPA 5E8NB 5JOEA 1NCCH 4DSYA 4E9QA 5D55A 4R97B 5J9PB 4PU2A 1QA9A 2W81C 1J1PL 1W72B 3O6KL 3CCHB 1NDTA 2XRAH 5DD1L 1QFWL 2VXUL 1F8TH 3JV6A 5GZND 1T3FA 2WVUA 2ROYA 3CSBA 1AANA 5ILTH 1ADQL 4MWFB 5DHXB 4F7KA 3UZVB 3LJ3A 1MFDL 5C09D 5C08B 3B2DC 1RZ7H 3W5NA 2F58L 3AB0C 3N0PB 3PAVA 3F7QA 4JUTA 3ZL4L 4XOCA 1J5DA 4LHUG 4QGYA 3WBDA 2D2OA 3ETSA 3AXLA 4N4YB 2YEQA 4L29A 3MRPA 1N7ML 1MH5B 5AOMA 5E7FA 5EB9A 3HZVB 4YQXL 5L8LB 1CUOA 3IJ9A 5AVTB 1I31A 1SXCA 1NAML 4CC4A 4OF0A 2ZAIA 3F12A 3B83A 4NN5C 4G6FB 1KIPA 4IBWA 1JZ6A 1P4LA 2BZCA 4PP1C 4YSRA 4BH8B 4XE5B 4WZ9A 1XX9C 3B3BA 4RFNC 3BAYA 2Q87A 1NKRA 4EI5C 4UDTB 5ADOH 1M4KA 3V52H 2MPVA 5DJ6B 3HI5L 4W6YB 4OIFA 2DICA 4KNSA 3PIQA 3JWOH 2GAZB 4F9PC 4C83A 4HXBH 2QSVA 3NPZB 2DIJA 3WGUB 3ZLQC 4ENEC 3BX7C 4LOEA 5F3BB 4NO2B 3QCUL 4A2FA 2EUVA 3RL2B 5BRZA 4NN6B 1HSBB 4E9TA 1FGVL 2WUBH 3WMQA 4ZNEA 1TZ8A 3O3AA 4JFQA 5DZAA 3VGAC 2W0PA 1OW0C 4ZT1A 3UTOA 4FEMA 4CBPA 5SWSE 4PB0L 2AHIA 5HHVH 4H8WH 1S7VA 4KMQA 2PR4H 5J11B 1HN1A 3TPUA 2RH0A 1PKOA 2VR8A 1PAMA 3VRLF 4HKZB 4KNUA 4C56B 3Q8AA 3EDKA 2ZXAA 1ND0B 1IJ9A 3HZKB 2ED9A 2EICA 2DYPD 1MQ8A 3V0VA 1NMBL 4L37A 4YLCA 2EDYA 2FB4H 2IGFH 4AJYV 3UG5A 5D2LB 5I19H 4F9PA 3OSKA 4WEBL 4XX5A 5MI0C 2Z1KA 3BO8B 1ASQA 2J88H 2EIZB 3FHEA 1T21A 4QMEA 3GRBA 2GSIB 3SKMA 1OALA 1FSKB 4FOMA 3U6RB 2GUYA 3APMA 3VWKA 4KK8C 1BQKA 1BEYL 4Q0XH 5CEZD 3ELAT 1HYRC 2NT1A 2O5NA 5C0RH 3SKJL 3P4LA 5AVRB 5LGYA 2UZYA 1KDIA 4JPIB 3U9PH 1HC1A 1Q8MA 3DLQR 2OJZL 3B2VH 4UOW1 5J6SA 5AALA 4UNIA 1BX2B 4IBUA 3CDGB 4YDLB 4XNBA 3C6SB 5A2KH 3ESNA 5FKPA 1WWBX 3AABA 4Z7NB 4G82A 3CVHB 3FU8A 2FCBA 2VLJA 4LGPB 5BW7C 3MZGB 3VCLB 4H40A 4JFFE 3HBZA 2N7AA 4LLQA 4HXAL 3SQBA 2VN6A 3G5VA 4UM9B 5I82A 3FT2B 4J3SA 4G6KL 1J48A 3K8LA 3OTTA 3MLXL 1I3GL 2CO1A 3PHQB 3RL1A 3UEZA 1Z0MA 3WY2A 1WDAA 2DQIL 3QDGD 4DO5A 3ATAA 3V6ZA 1N0LB 5BQ7B 2QHRL 1EXUA 1BGXH 4DK5A 1I1CA 4ZO6A 3P77B 3GRWH 5KS9F 3LEXB 2FQFA 2NNXA 3FT3A 3OLIA 1GOGA 4A37A 5IIEB 2WW8A 1WC7A 3NRPA 2OSXA 3RZCA 1MXGA 4JPVH 1MCDA 1L0XA 3WFZA 1BQLH 4QRRA 3LQZB 2VIRA 5HI5D 4L9DA 2V7NB 1Q0EA 4KAQL 3GSNL 4WV1C 3G5XA 1JZEA 3V4UL 3FZUD 4CNIA 3US9A 4P23A 2E6JA 2J25A 4M02A 3BI9X 4XPTL 4HKXA 2WV3A 1RJLA 1XGTB 3MU3A 3V7MA 5JDSB 1XR9B 3QFJB 2HTLC 4OLZL 4XX1E 3RE0A 1LEIA 4P2OD 2HJFA 1SLVA 2F54B 3BVUA 2XPGB 4LSQL 2X41A 3EYQC 3CU7A 2ICWJ 2FX9H 2HWZL 1UFGA 1BM3L 2Y3NA 4LCUB 4HUWB 4MNHB 2D31B 4NO0A 1ITCA 1Q94B 3WXWH 2HVBA 1FYTB 2V2XA 1T2QL 4RNRB 4FLQA 5D7IF 2YD2A 4OFDA 2AAVA 4WI2A 1ODAA 4R96B 4ZOBA 1UCTA 2X4NB 2CHNA 3V0AC 4BSVB 2N1TE 2HTKD 1JRHL 1RQ5A 2ROXA 3PHSA 4LOVA 2B4CH 4P57B 5EH1A 5LNGA 1NBYA 4FFYA 3MRHB 1CZ8L 1A21A 4X7TB 5KOVC 1T1XB 3ILPA 3MLSL 3J2PA 3QUXA 1MDTA 1Z5HA 1CYWA 3ME0A 1E3FA 4YX2L 3UTTE 1DVFA 4DKDC 1D9KC 3GSRA 4DTGL 1FIGL 4FFVD 4KUCD 1PPIA 3HE7B 3PWVB 2HFFA 3MFFA 3QQNA 2BY1A 3ZKXC 5I1GL 5JZ7D 1MOEA 3QJOA 1S5HA 5HP5A 1QEWA 1E5YA 3BGMB 2NLJB 1T22A 1PY0A 3O4LB 3QDJD 4TLKA 1BXUA 1TQCC 4J3VA 3S34L 1YUHA 3BN3B 3OKMA 3BDYH 1MEXL 4FNLH 4LEOA 4XCCH 4N2HA 3LVEA 4IDLA 4NN7B 4X6CF 5DS2A 1HDMA 5E4AA 5DT1L 3GJFA 3QJRB 4H0LC 4U1IB 1NIEA 2XWBB 4OCLC 4XP4L 3S5YA 5F1IB 4P9HH 2CPUA 4Z5RA 2BVEA 4P5KB 3GNML 4PGZA 1T5WB 2GJPA 3V5HA 1K5NA 2P1YA 4RAUA 3WIHA 5K9QI 1N8OE 2HT2D 4ENZA 4JY6B 4ELMA 4ZDHB 4J2QA 3VI4B 2XX1A 3SYPA 3L3JA 3VXRD 1GC1C 2BSSB 1E5AA 3OLDA 2Y7MA 1HU8A 3L4ZA 1ZS8A 5ESQA 1V55B 2YFNA 3SO3C 4PJEA 4PJ5D 2DQDL 1AKJB 4J3WA 2X0VA 5D1ZD 2VL5A 3ZIMA 2ODIA 4JMNA 5IB5A 3FFCD 1FDLH 1ID2A 4EIZC 1BF8A 1DBML 1BZ9A 1VLXA 2XWZA 1UA6H 4DVRH 5ICZA 4P48A 4RMRA 2X0UA 2QR0A 2H4EA 2HFTA 1ZGLB 5KVFL 5JIHA 3EGSB 5KYWB 2V9RA 3JZ7A 4KMTH 4ALAC 2B0SH 1MQKH 5IY5B 1UXMA 1AD0A 2NXZD 4LCWB 3K80A 3WNKA 1QZ1A 4MMYB 1XCQA 1NCJA 1Y1UA 1HEZA 1ZT4A 4FC3E 4UZGA 3D9AH 4Z7IA 2HT3D 1U8KA 3CIAA 2YRLA 4N3UA 2AJZB 5IQNA 3GDCA 5D1QD 2BZ7A 3NACL 4PJIA 4A63A 2VDRL 5C2BH 4XMKL 2IFFL 3MUGB 1KJMB 1B0RA 3EH5B 2NNAB 3VRJA 3BAXA 3BVXA 1YA5A 1RJYA 1ZOXA 4HV8A 4YZFF 1W6LA 1DEDA 1T1YA 5DUJA 3OPZL 2KMWA 3GPEA 4CU6A 2AK4A 4XP1H 1L4IA 3WTUA 5TE4L 3ZO9A 1VHPA 2XV6B 3ZTEA 4R7DB 3S3CB 1TUPA 5EZOH 1RU9L 4KQ3L 2DWDB 3UBHA 1INDL 5GZOD 1H8LA 3DV6A 1JYVA 1TJHL 1O6TA 4LVOC 5AOLA 3SE8H 5JHLH 1QSED 4YDZA 3H4FA 3A4DA 1WQVT 3FT4B 4XBGB 7PAZA 4HJGB 2RCSL 1E2VA 3E6HA 2FJUB 2QADD 3DTXB 3MPCA 1ZAGA 5C3LD 5EZIL 1XO8A 5IROC 2DLFL 1QFOA 3HHMA 3WMSA 3VVVA 4L0ZA 1T83A 4ZMLA 3Q5YA 1OGAA 1VZHA 4X4XA 4BKSC 4M5YH 3AY4A 2XZCH 4M3JA 4TSCH 1JGUL 4DP8X 2DQ6A 5I71B 1YNTB 2B3RA 4KKPA 4JN1H 4AIOA 3CN2A 1LK2B 2NY4C 4EBQL 2YC1A 2QSTA 5PAZA 3EH2A 1J0ZA 1SBSL 5JIQA 1M2VB 4KDWA 3WTWA 3FSWA 2NYYD 3EBHA 1ZJBA 3WJLA 3UAJC 3ZJAA 5F7YC 4FZEL 3N6YA 3FS9A 1NLDL 3P54A 5L88L 3U0WL 1QSFD 5DMIL 4H5SB 5KYXA 2XI9A 2QGEA 2XWEA 3BEWB 4MCZB 2XWCA 1O5PA 3MI6A 3W56A 3PFQA 1E6JL 2KPNA 4YE4L 3US1A 1L9TA 1DUYB 1NGPL 4GEJA 5H4ZA 4DK6A 3KYNB 1B9ZA 1MW0A 5IROA 2CMRH 5I28A 3MV8E 4DGIH 3FU6A 3S4SG 4HH8A 1MCOH 4B9YA 1E9OB 3ATFA 1GY1A 4LDLB 1JZDC 5CINH 1TQVA 2FHCA 2LU4A 4H0HB 3HKFA 4Y4FC 1ECZA 4MJ4A 4QRUB 3LB6C 1J1XL 4EXKA 3LQMA 2NY6D 3T6XA 5FA3B 4FMFA 4HK3J 2DBLH 3VU2A 2GBUA 3MACH 4GS7B 2ZJSH 2HG5A 3EJCA 1NCTA 5KANI 1T20B 1ZKAA 5CEXA 2W88A 3O11A 3JXAA 4XVSH 3UAJA 2WYIA 3GSOA 1YQ2A 3ISRA 4OQ1A 1UZ8A 5D7JC 3VD1A 3T6QC 4IRJC 2A1WH 4EN3B 3QDME 3NQIA 5DLLA 3DX7B 3FFDB 2XN9D 3N5AA 5C09B 3FQTA 3GB7A 4LXFA 4LARH 4IRSC 4KJPD 4WUKH 1A6TA 1FNLA 2NW2A 3BUBA 5D72H 3FQXB 4QCIB 3MNZA 3EYUL 2YGQA 2K7QA 1WBYA 1JWMB 2A6JA 5KVGE 2C7UA 1I75A 2AJYL 3FUEA 2YUVA 1YYLL 3SN6N 3C87A 2VN3A 3OHMB 4Z0XB 1UD8A 4X7FC 2VO5A 3A24A 3CVDA 4FHKA 3W38A 3HG5A 4Y4FA 4D7PA 4R84A 4TNFA 3DUUB 3W39A 2Y2YA 3PWJA 2VDQB 5D4IA 3HUJA 1A4JB 3FN0L 5A6IA 3O3EA 5AW4B 4JFHE 3O6KH 5EZJA 5HI4D 1RZGB 1F4HA 3MNVB 3PWPB 3PY9A 3GSVA 4KKCD 3WKPA 3BN9C 3Q6GL 4TVPL 3WEMA 4PGEA 5C0FA 5IQMA 2E9WA 2UY7B 1KYOJ 3V10A 1I1YB 2BPBA 1EV2E 3BUYA 4DP4X 5D7JA 1LNUB 1NCDH 3ABGA 4IRJA 2F58H 1SHMA 3TZVC 3D2UA 4YGAB 1N67A 1TZHA 3ZL4H 2DQFA 3EH4B 3FFOA 4KO9A 1C7TA 1FN4B 2EDTA 2EDRA 2FX8L 2KQNA 4F7EA 5ESAA 3MV7E 1OP5H 4O02B 2VISA 4XXWC 1F5WA 1QBML 4B96A 2G60H 1NAMH 1GSKA 3C8DA 4UTAA 4YN3A 1AQKH 4BIKA 5D9SB 3KPPB 2NOYA 3LN5B 5E56A 4QY8B 3ZE2E 4YNYA 5IMKB 2MNUA 4HH9A 1JGLL 1T66D 1CLOL 4PV8A 1M7XA 5GGSY 4MJ5B 2UZPA 4HWEH 1EEQA 4NI6A 4JFSA 4WWNA 1ACCA 2OJEB 3RWHA 3U83A 1ESOA 1PG7H 1UKQA 3FCTB 4PRNB 1BYOA 3RG1C 3DROA 1NCUA 2P5EA 2MCAA 1UM4H 3BWAB 4X6BB 1SXBA 4NKOA 5IQOA 2VLKA 4OB5H 1RK1B 5F8QC 2BM3A 1FGVH 3ZKQD 4PJ8C 4PJBA 2BSTA 3TCLA 1TMQA 4Z7QB 3T1WA 2NSQA 4JM2A 4LLUA 1FC2D 3HS8A 4OQTL 4PB0H 3MSPA 3LN4A 2FJGB 3HFFA 4JKPH 3MJ8B 4TUKL 5JDJA 1YJDL 4XXWA 4IBVA 4YXKL 5T5NF 3LZNA 4XP6L 4ZYKA 1RMFH 1KEGL 4MNGA 4HWZA 3QUZD 3HVNA 2OYPA 4R0LA 5KBPA 4H26A 4PGDA 4OZIE 1LO2L 4KK6C 1BYPA 1H9DA 1DLFL 4WGVB 4EF3A 2NY3D 1GOHA 4RFEA 2HLAA 5DO2D 1I9EA 3EUUA 4ESKA 4D9RD 1LL1A 4V1DE 3N1QC 4KKLD 3C6LD 1R0AL 2V7HB 3QWRA 4DN4L 5IWLA 3EO1A 3REWB 1SXZA 3NCEB 4POZD 3WDIA 2R1WB 3MRGB 4JGMA 2YBRB 5AZ2H 2Y7SA 2BIOA 3BWSA 1IQWH 5CJXC 1AO7E 2WAQA 3GD1C 3SKJH 4KVCL 4GRMA 1EVUA 3ZOAA 4AY0A 4A04A 3QR2A 4FQIH 1G0XA 4RGOL 3QRGL 3S9DB 3ZUCA 5EUOA 2WLKA 1TG8A 5T3XL 4KZ0A 3NJFA 4M4RB 4I77L 4M9OA 3WFCL 4C58B 4L5FL 3CFDA 1T4KA 1U8LA 3TJHD 3BRFA 4E42B 4JHAL 3IMUA 3MZTA 5E8EB 2X7LA 3DSNB 4GI8A 4Q2ZA 2YAQA 3I6LD 3QQ3A 4P2OB 1R9FA 4JDEB 1I3GH 4TM9A 5T3XD 2PYEE 4PR5B 4K7PX 2APSA 4Y9FA 5EIIA 1TXKA 3ARXA 1EPFA 2Z7ZA 4GQ9L 3I6GA 3UADA 2QHRH 4A67A 3UZQA 3H3KA 3IDIA 2MHAA 3CWGA 4GO6B 4PBVC 3K6SA 3P9LB 4YHNB 4KXCA 3BZFB 2W9EL 5CJXA 4U1KA 3UGUA 3B2UC 2BDNL 1MI5E 2O6DA 5HVWA 5AYTA 2HH0H 2Y5TB 4XOAA 1KG0A 1JD9A 4FI6A 1CU4L 2R1XA 1BZ8A 1ZT1A 2Y1AA 1D2PA 5IHLB 2NW3B 4JY4B 1A3RH 2VN7A 3CC5B 1OB0A 5DMGD 5E4EB 4RBPK 2ZE0A 5G2NA 3ZXAC 1AY1L 1CFQA 1LDPL 5GRUH 3CFJA 1V27A 3JYCA 2WWOA 2GJ6D 2CLRB 4BXVA 4IRZL 1WVZA 3WLWC 1EZVX 3Q2CA 1R3IH 1BM3H 4F9LC 1NM4A 4MVBD 4JZNA 3S8GB 4Y2DD 3PP4L 5FCSH 2FHFA 4LBAA 4U1NA 3ZL2A 1UXSA 4X0KA 4JL1A 1UACL 4NT6B 4KRPB 3QZWA 2OMYA 3ARFB 3D3VD 3WFBL 1JRHH 1UD5A 1QFWI 3IETB 3K4ZA 3NH7L 5FPIA 3O8XD 4PS3A 1CZ8H 3VXSD 4AQAB 2N4IA 4PREA 4UAOB 1ZRUA 5TDPA 1JZ8A 4YX2H 1JPST 2VSDA 5CMAA 4NQVA 5GS0C 1U0QA 2NY0B 3VGHA 4P46D 4ZFOB 1DQDL 4Z3HA 1E9QA 5GRXG 3SSGA 2FO1A 1ZLEA 1TVBB 4KHXH 3RWJA 3AREC 4PJGE 1BZ7B 3BFQG 3JT0A 3SGKC 1QD0A 2AITA 1WBXA 5B8CB 3K2KA 5IB3A 3VDAA 2H32H 1XF2A 1IGJA 3AMLA 1ES0A 4JJHA 5E1AB 4HOMA 1XF1A 1Y6MR 4M7KL 4QRSB 1A6AB 5D8JH 4XWOD 3BHBB 3OSVA 1JK9B 2DZEA 3CZKA 5DA0B 4HA1A 4F58L 4XP4H 1QUNB 3KLKA 4JANA 1OVZA 4OZHA 4JHWL 3KH3A 1EA9C 2XLLA 4WNSA 4NQXB 1YCSA 3UO8B 1T03H 2HVKA 2JIXA 4HW6A 3S5LA 3DVGA 2NXZB 5B39B 4RLDA 1U91B 3ZTCC 3QWOB 5DZOA 4IKKA 1AG6A 5D2LF 3DMMD 5K9JL 2XIBA 1G7IB 4CADB 4P5TD 2J55A 5H94A 4AQOA 1CIUA 4JG9A 1I3RB 1QHOA 2DI8A 3THMH 3IRCA 3NJNA 5T5NG 4QRQA 2EXYD 3ULUE 5I6MA 1KENL 4MKTA 1DBMH 2JXMB 4X7CC 3BUQA 4S1DC 3HG4A 3U7WH 1YEFH 1KXTA 1DUZA 1RPQA 5KVFH 5LN8A 4PRHE 5IMLA 4F7MA 3KDMA 3WHXB 4Z7NF 3QH3B 3QORC 5I1IL 4QJ5B 5E5MB 1E3XA 4P4RA 1V7ML 1KLFA 4KY1L 1W0WA 2R56L 3BVNA 1R3HB 5I76B 3GGWA 3WELA 1IGFL 3MRMA 3OXRA 2FTAA 4FXTA 4ZQKA 1FFNB 2XTJD 4JRLA 4KROC 1OB1A 1RZQA 3BVTA 1E5BA 3MJ9L 4JBSA 3E0GA 4Z7WF 3ZKMD 1BDYA 1MWAL 4YDIL 2VDRH 4Z7UB 4JKWA 2IAMA 4UOJA 3QRBA 4G9DB 4XMKH 2ZOUA 1MUJB 2QADB 4XN5A 3W82A 3WS6A 1NC4D 2I85A 2YD5A 4IOSD 3TCXA 2AJVL 5FGCB 3TC9A 3HPLB 3MBEC 1O7SA 3TT1L 5B38G 3SBPA 3I2CL 2W59A 4TNVF 4NKIH 3UAFA 1PNCA 1HS6A 5TE4H 1YYML 4KH9A 4TUOA 4AENB 5DHDA 3VJ6B 4W9IC 5GIRB 2BNQA 1IEAB 4KDTA 1PIGA 4Z7VB 1RU9H 1U3HB 3QIUB 4KQ3H 1ORQA 2B3IA 4UTBA 4R4NC 3ULSB 1ASOA 3GBMH 4N0RA 3DXAE 1E28A 1UWXH 2D3JA 4U1MB 3RVWC 3V4PL 4ZMTA 3DARA 2A6DB 4OCXH 2VW6A 1F90H 4P3CL 4YLQT 1ECYA 4BFGA 5JW5A 4XCYB 3AWEA 3AG4B 4UAHA 3QE5A 4X98B 3ZZSA 2HCZX 3QJFB 3RGHA 1KGYE 1CXLA 1N5AB 3OKDA 2C9PA 5EZIH 4DVBB 4YFDB 1R3JB 2DLFH 4H13C 2JVUA 4U1GC 1KXHA 3ZDWA 1N5YH 1WUZA 4PRBB 3ARGB 1S9YA 3SIKA 2WBJC 1U8IA 1IKFH 3CBJB 5EOQL 3WFEH 5I6LA 1JGUH 4GMTH 4NENA 2ZX7A 3KPSD 3BQUD 4L3EA 2W0LA 2XTLA 4RRPA 2MCPH 2V33A 3RU8H 4KKNA 4OFIA 3T4AC 3DWTA 2J12B 3V0JA 4MD5B 3WE6A 1FL6A 4M43L 4N3TA 1BVLB 3SYQA 3QUYC 1S7UB 1SBSH 1G7LB 2E9IA 2OR8A 3EF7A 4AQ1C 1LE5B 1EJFA 4YHIB 4GG8B 5SX5H 1HHJB 5E7BA 1V3LA 3MXWL 1OE3A 1A4CA 3E1ZA 1JPTL 2B2XL 3O4OB 5D7KE 2BFVL 3DGGA 1UH3A 4MA3A 5I24A 4NQDD 5E6UB 1S8DB 1E6JH 1S9WB 3AC0A 1MAMH 1FVEA 3EAKA 4TQIA 3H2PA 4RIRB 2CZNA 4PVNA 5MEPB 3RFRA 3IDNA 3U1SH 1T0MB 3PHOA 4PD4J 4NUGL 5F6IB 4W9LC 2YARA 5E99H 4A2GA 1KJ3H 3QCVL 3DVFA 5CGYC 4KJWD 4WJ5B 3U4EB 1XIWD 1GRWA 1KFAH 1PSKH 4PP2A 4LLYA 5ENWA 1J1XH 4B9GA 4HIHA 4K8RC 4ORGB 3BP6B 4QRTA 3T4AA 4IGBB 1BVKB 4F2EA 4QHUB 3EGDB 1PNDA 3DBXA 3QUYA 2BIMA 4PVBA 2Z91B 3RILA 1X5MA 3VI4F 3BC9A 2QDWA 4NHUA 4XPGL 1KMGA 1J1OL 2BH0A 3O2DH 4ZFFA 3ZRFC 4I9XA 1CLCA 3F85A 1ET8A 5JHBA 3VDBA 4PV9B 3ZE1B 3PWNB 2FUQA 1QWNA 5JOFB 2WO2B 3HLKA 3MYJA 2WJ5A 3NCCB 2AXFB 5LCVL 3VVWA 1TKWB 2ZOKA 4ADJA 1EJ6A 1MCWW 4X5QA 3EYUH 5D1ZI 2VRQA 5E94A 5IBTH 2KYIA 2VH5L 5HHPB 1FFPB 2YSSB 1AGCB 1F56A 1A9EA 2XNAA 2BJML 4PSPA 3LRSB 1IM9D 4YWGH 2J6WA 4J28A 3FCBA 1H3XA 2A6IB 1F3JA 2NSMA 1RK0B 3FU5A 2EKJA 4YHPB 3L1GA 2CBOA 2HJLB 4ISVA 1ML0A 2YSTA 1MIML 3VW3H 1JGDB 2J43A 4U2ZA 4XXCC 1HIMH 2OLDA 2FLRT 3JWDC 4XN1A 4WRLA 5ERWB 1ZV2A 5DSCA 5IB2A 4PW3A 3TJEL 5E2WL 4A6YL 1G87A 2PPFA 3GS7A 4K3HA 1N8ZB 4B7LA 2WTRB 2Q0ZX 3AS0A 4U6TA 4ZMOA 1GXEA 2FIRT 3NJGA 4O2CB 1L5GB 1MAKA 2XSKA 3DOSB 3QDGE 1KN2H 3X1GA 4C59B 2W60A 1XF3A 1IEHA 3RTQA 4GAYB 1FL3B 1KULA 5KVEH 3JWDH 4PD4K 3HG1B 1JGLH 1XH3B 4DOHE 1CLOH 2NXYB 3QUZB 4NQCB 3TNNB 3MRBA 4XCFL 2V5YA 4YSOA 1L9PA 2V3DA 3MO1A 4XXCA 1MHPL 1FORL 1IAIL 2VDKB 4IU3B 2PN5A 4IBSA 4NYLA 3L6FB 1AYOA 3BD3A 5GGRB 5SWSA 2NR6C 3C6LB 3O41A 4D0CB 4HOWA 1XL6A 4NC0B 5JQHC 2ITDA 2ZT9C 3U82B 3TN0B 2WO4A 1KBVA 4HGWA 3FB5A 4DGVL 3IAPA 5CD3A 1YNTF 4OLYL 3SKNA 1YJDH 1U8MB 3L95A 3OB0K 1H6EA 2JJWA 2X38A 3KS0J 2EEXA 1DLHA 5D5MB 4V2BA 5EF3A 2A38A 1OAQL 4BA8A 3PAYA 3SDYH 1KEGH 4G59C 5D7LE 1OP9A 4PJHE 3NIGB 2Z31C 3D25B 3ETBF 4JEGB 2CDFA 3ZPDA 1HNYA 3LSOA 4R4BA 5FDYA 3FT1A 1LO2H 4DIXA 4NQSB 2FATH 3H54A 3MJ6A 1DLFH 4NQTA 2VDPB 4QXUH 5EHFA 2ZTBA 3BYYA 5LHDA 3U0PB 4OM0H 4N6QA 4LOUC 3U7YH 4U6HA 1ZMYA 2AV1A 1AR1B 4N9GA 4JRXD 3TEUA 4ZO7A 4ODXB 4PRAA 2Q6WA 1AOZA 4K5NA 3GRGA 3HBQA 2H26B 1K9TA 3TFKC 3QQDA 5F97E 3ZT6A 5AYUH 5FB8B 2PCPB 3ARDD 2IPUG 3RHWK 1ZTXL 1M3IA 4G8EA 2DN7A 4BKLB 4ZMWA 4PS4H 1F6AB 3H1ZA 2V3EA 2ATAA 2A9NL 2NY1C 3QRGH 4KUZL 5BRQA 1IAMA 4Q9RL 2PP7A 2GI7A 1WT5A 2WLIB 1NGXB 1QR1A 1KBWA 1H3WM 2E3VA 3DSFH 2WWKT 1AS8A 1HHHB 2ZUUA 2Z31A 3NZHH 1INEL 4L5FH 4A2HA 1TFPA 4CN6A 3IT8D 1OP4A 3KWWA 4JO4H 1FO0A 3WKMH 2F1AA 4DETA 3CDZB 4JO5A 4Y4HB 3QISA 5GSRB 5L2KE 2OL3L 2XN0A 3FQWB 4M7JL 2FEDC 4F3FA 4E9VA 1COBA 3V79C 3BP5A 4WW1A 1A1OB 3LS4L 2A74B 5CP7A 5HGDB 1R6VA 2JJTA 1HEHC 2YEZB 4NKDB 2AGJL 4P2QB 1SYVB 2BHZA 4Y2DB 5D2NC 4U49A 1FL5A 3VXRE 4KU1A 3V5KA 1VFBB 2IWGA 3D3VB 2JKJA 4HMCA 4PJ5E 4FULA 4IOFC 4U1JB 2BDNH 2A3TA 4KKQA 3VGGA 3O8XB 4RA0C 2IQAB 3VXSB 5DFVC 1TR7A 1JZ5A 1BV8A 4QOKD 1G7PA 5C07E 5HHMD 3OKYA 5A2FA 3C5ZD 3WENA 5HYSA 1MHCA 5C92A 5HY9A 1BXXA 2ODHA 3IKCB 3I3DA 1VDGA 3MRRA 4IRZH 3X1EA 3MLTA 2Y7OA 4UCFA 3US0A 3VMNA 4WI7A 2F68X 3DOHA 5GQBA 1WHOA 1GGIL 5AVZB 1DQLH 1E27B 3MRFA 3KPLB 1UACH 5J1SC 3LRGA 3UIYA 4DPRA 5KVFE 4N5EC 4ZO8A 3RYMA 3WFBH 2VERN 1EQWA 1HNGA 5D1QE 2WD0A 1F2QA 1NSNL 2H0PA 4RISL 4XCEA 1P6WA 2ENYA 2FH8A 3PYCA 5IUSA 4QWWD 3UTTA 4HQQL 3MV9B 4DKFH 1OP3K 3S35L 4RDBA 1S7XA 4JR9L 1G7QA 4OIAA 1JWUA 4UZSA 3RY4A 3ZL1A 3LIZA 1KIRB 4GOSA 5FDWB 1U2HA 2FUTA 4XB8A 3TBSB 3PJSB 2RMNA 3JUZA 3KNBB 3Q7JA 1OAYL 4IHOA 1YAZA 5F9WC 3EH3B 4AH2A 1JMZA 1MELA 1NCHA 4N2FA 1TJXA 5KJRH 4WW2B 3DMMB 3GSUB 3KYMB 5D1XE 1KPRA 3PDGA 1MRDH 3JVGA 1BYNA 4F7CA 4IOIB 4P5TB 1JCKA 2R8SL 2XIDA 1DEEA 4Z7QF 1EH9A 2P26A 3A0OA 3FB8A 5D93B 3CUPA 1QSEE 4DZ8A 4OJDH 4Y1AB 3QNZB 4DPCX 2RFXB 3GF8A 2XBDA 5L9DL 4KHTL 2PWGA 4F58H 5J5EA 4JHWH 4UV7H 5JPNB 1DVZA 2VAJA 1HH6A 3RX7A 3G5YB 2G3MA 1NC2A 2JKWA 5EIVA 2YFOA 5SWZB 4LF3B 3JV0A 5FYJH 1XGQB 3LN9A 4J7RA 1PQZB 5K9JH 4QXWA 3UG3A 4CMMA 3L8QA 5JO5B 4Z0BL 1IGML 3FQ2A 2MPAL 4RESB 5IKCA 4BWTA 3CFKB 2ZOLB 2V9UA 1O6SB 3R0MA 3KCPB 4CUCA 1UWXK 1QSFE 3MNWA 4B53A 4PGBB 5IV2B 4ODBD 5ELIA 4R9HA 3QEGL 1XAUA 4WO0A 2ZKMX 3IB4A 4N1HB 2OI9C 2K7PA 2YPVH 1J18A 4WI0B 3VYOA 1A5FL 2KDGA 3Q8CA 1IMHC 1DVQA 4Z23A 5I1IH 3ATBA 4XMXA 4LQFL 1DP0A 4OCYL 4HBQA 4C54A 2OZNA 3RGBA 1ETB1 5D7IE 1J8KA 1AP2B 2R56H 3BH9A 4GP8B 3IGUA 1IGFH 4DH2A 4M7LH 3RIAF 3V6OE 4LGSB 3VYNA 5DYOB 3X1BA 4MA7H 1WFIA 3MJ9H 5BZDA 3CAFA 1U93B 5I1JL 1EFQA 4ZXBC 1H15A 1MWAH 4GKNB 4NRXB 3K6FA 3SDAA 4EPSA 5CN1A 2AC0A 3CV5A 3BW9A 3CSTA 5BO1H 4NEHB 3ARZA 1HOCA 3BXNA 4OKVA 2P5WE 4ZX4A 1NCBH 1TQUA 5I1KL 1VRSA 4NC2B 2AJVH 5I8KL 4U7MA 3TT1H 1SZNA 1Z5LA 1OSEA 3I2CH 4G80A 2OYMA 1RURL 2H5UA 1GY2A 2GITB 2DEYX 2NY2C 3KPSB 3H2QA 1JGVL 3BQUB 3QNXB 3PP3K 4MDIB 5D4QA 1BIIB 3UERA 3VB8A 3EO9H 2YKKA 4UINL 4AIXA 2I9LA 5F1KC 3HE6B 3QXAB 4B5EA 1KGCD 3BUIA 1KIQA 2VE6B 3PGCA 2QELA 4NZDA 3RFZB 5LGHH 1I1FB 2IADB 3APNA 3AG1B 1C9SA 3BPCA 2F53D 1HYSC 3RJDA 2WM0A 4UQDA 1OGTB 4TSAL 5FUZH 4HZLA 4LCCB 3B3IB 5H37A 4F92B 4L23A 5JHDD 2Y6TE 3NA9H 1NQBA 4I13B 1PZDA 2FWOA 1E0OB 5EOQH 3MLWH 4PIBA 4RZKA 1G9NH 3W11D 1W72H 3TH2T 3H42H 4L3CA 1BMZA 1P0SE 1SEBB 5T3ZL 3T0EC 3TO4B 3WIAA 1VENA 1CE6A 4PRDA 3S97C 3ABZA 1G94A 3EYSH 2YAOA 5JNYA 1L6XA 3B2PA 1SXSA 2CO4A 4TVPE 3HHSA 4GKOA 3KYKH 4GSXA 3HPJA 4I2XB 2Z7WA 4LAQH 5T3ZD 2HPTA 2HLEB 4P3DA 1KLGB 2XA3A 2CKBA 1JPTH 1P4UA 1U6AL 3AAZA 4BV1A 4IKJA 4OLVH 1DQJA 2WXLA 3H85A 4M8RA 3ZY7A 4EQ2A 4O02L 3MV8A 3ECBB 4AIZB 3X11B 5HDBE 5KVMC 3L7EB 2F18A 4NN6C 1UB5B 3RWGB 1X4ZA 1VSCA 1FG9C 2R0KL 4LVNC 3AITA 3A6OA 4NUGH 4ZX6A 3OMAB 2PW1A 3A23A 3KLSA 2FX7L 3IU3A 3ZDXE 2VDNB 3RX5A 3IPFA 1L9RA 2ZUXA 4OKDA 4BQ9A 4M6NH 2R51A 2BY0A 1INQB 1AGBB 4YMPA 4K07A 4Y1TA 1PLCA 4X4KA 1RUPH 3BLBA 4OF6A 3BKYH 4J3OF 3O6ML 4M5ZH 1EXHA 4KMLB 2QV2A 3B9KB 2XFXB 1ZVHA 1KTRL 3MRKA 1J1OH 2DQCL 3STLA 1A14H 2BK8A 3V95A 5CNHA 3OGOE 1OAUH 3MLYL 4HJJL 4W1TA 1FNEB 1TCRA 4Z3TA 2ADJA 5LCVH 4F57L 1TJMA 2P8PA 1SJEA 4UI2A 2AQ2A 2XV2A 3MGTB 3DO7B 3RBSA 4CVUA 2W5PA 5FFGA 1G6RA 4ONHB 3D0VB 3FHAA 4ODWA 1ZWIA 2YXFA 3VFRA 3E8UL 3NTCL 4O51B 3DURB 2XG4A 1IRAY 2BJMH 3DX9B 3CBRA 5C0ND 4KVNL 3I84A 5T1MA 2B1OA 1YC7A 4RGMB 4HMDA 4NUPA 4G1MA 3BCFA 1HI6A 2BVQA 1AS7A 3HS0C 2WB1A 3IGAB 4UT7H 4EDXB 5L7XH 2QGBA 1M7IA 1QFHA 1X44A 4MJID 1DJHA 1WLHA 2X40A 3EJJX 2C3VB 4N6RB 4Z7UF 5DGRA 4Q6IC 4WWKC 1UJTA 5BJTB 2UXTA 1QZNA 4A6YH 4NQEE 3MV7A 1BQRA 3BZEB 3GEFA 2V2TB 1YMHB 5CR8A 5T1KA 1F4YH 3CPLB 4O9HL 1OPOA 5IW6A 5ICXB 1SJHB 4HX1A 2OXGB 2P3YA 5T3XE 4Y16A 2VITA 1F1AA 1XMWA 2C4FU 4JNXA 3VO0A 5GXBB 1X9UA 1NCNA 2CDEA 3SOBH 4CKQA 4L5FE 1I7ZA 4LCYB 2H2PC 1IC5L 3ML8A 2UX7A 3VSQA 2Q7YA 1FZOA 2VLRD 4Z7VF 4G8FB 4Z7OE 2OJ1A 1HT6A 2QMJA 4L1TA 5F8RC 2VYRE 3MCKB 4JM0A 3KWTA 5EOCL 2L7JA 4UUJB 3IMWA 3IGKA 1PDKA 3GRWA 3HS0A 5AZEL 2R2BB 5ICYA 2AABL 3V5DB 4I0KA 2V17L 1PL3A 3WL9B 3RI5F 1HEJC 4XNYL 2XZAL 3GUTB 1HTYA 4RMVA 1FORH 2D7TH 1IAIH 2YIHA 1ZVYA 3BUDA 3IF1B 4FQQB 4WWKA 3G04A 1NOLA 1IGTA 1Z1WA 3B5HA 1RUQL 2DTML 1UWGL 2GJ6E 4FLSA 4JO1L 2I5YL 4JG0H 4N0UB 5IB4A 2O72A 2I24N 3BVWA 5DRZA 1XEDA 3PXJA 3TLRA 3WNMA 4URKA 1JZHA 2Z65C 2Z0BA 3CZGA 2YAEA 3GMRA 4I8DA 4PLKD 1OAQH 3IDGB 3TBCA 3VFWB 2Z4QA 4HCIA 3B1TA 4Q97A 4DW2H 4F2MB 2VKXA 4LQ1A 4AT6A 3H56A 2W65A 4AQ8C 2BS8A 2HLFD 1CICC 4V1DA 2JQMA 4QGTA 3L17A 5DUML 4B9FA 1CLVA 2KUTA 1AHWC 1CCZA 4XI5C 3D39D 3F00A 4EXPX 2DMGA 1E2WA 5DZJA 4K3GA 4KI5C 1MCRA 3KGSA 2I07B 4G3YH 3SYAA 4HMEA 2E8YA 1A8JH 5TFSH 1AO7A 3S96B 1SXAA 4N2OA 4PJXB 1AGFB 1ORSA 2P9RA 5CIPB 2IH1A 3WNNA 4K94C 5FA4B 2PF6A 2H8PB 3II3A 4QYOA 5LG6A 4AW7A 4NN7C 1UGKA 3FPYA 4AEEA 4QTHB 1CR9H 1R3KB 3ZMEA 1JI1A 3U2SA 2A9NH 2UY6A 4ZFOL 3D4ZA 4FLHA 4P59H 3WGVB 1X6NA 2J5LB 35C8H 2OMTA 5DHVB 1QLEL 4BFJA 5I5JA 4GUQA 2GFBA 3REVB 2CLVA 1M9WA 1B2WL 2ZSVA 1G4RA 3UO1H 1OWRM 2AMGA 2G5BB 2VC2L 4N8CL 2ZAHA 4Y9EA 1CXKA 5FLUA 4A66A 1J9RA 3NJMA 5MEQA 4Q9QH 2ENPA 5TDOA 3QO1B 3QI9C 5E8DL 3ULVF 5JIMA 3VFPB 4LT7A 3ZE1F 1WFTA 2Z9TA 3CMGA 2D4FA 2QTVA 1LO5B 2MFNA 3SB3A 1IGYB 1U3YA 1MI5A 1GH7A 3QPXL 4K2UL 4UQCA 2XZQL 1OARH 4Q56A 3WNLA 4QHKI 5B39G 3C6EA 4J3OG 2DH2A 4LPXA 3DX1A 4JFZL 3A6BH 3CZLA 4UU9B 1N0XL 2BS71 4WKZA 5L6YH 1EAJA 3GXFA 2NRDA 4HOZA 3OJDA 2R2HB 4AKQA 2XXCB 4GW1B 3ZQWA 1T1ZA 1J0IA 1LK3L 5BRZD 3TIEA 5DD5L 4BA0A 3ESMA 3Q0HA 1HHIB 4OAWB 2CUHA 1OY3B 1XGRB 1YQVL 5TE7L 3VGFA 2NTFB 1ZT7B 3B5TA 1UQSA 1QHQA 4YDJB 4N1EA 2DI9A 1DVXA 1Q4NX 1CG9A 1TZOA 2JK5B 2F74A 5CD5C 4Z8FL 2IANE 3K81A 4OTXH 2EDOA 3FRPB 4K7FB 3QUKB 2XYCA 4BE6A 3ZU8A 2YEVB 5I5IA 4JPQA 1KB5A 3WHE1 4HIEB 4U1SB 4UWQB 3SDCB 4NNYB 2X4OA 4HQQH 2DJMA 3HRZB 1IILE 3QYCA 3VH8A 5FYKU 1IAOA 5ISZD 3Q3GA 3FCUB 5AG8A 3IFLL 2X9YA 1BG9A 2O5YL 2WINA 4G43A 1MHHB 3QEUB 1TTUA 4PJGA 5I16A 3I9GL 4RA3A 1OAYH 3DK0A 4MHHG 3VWKD 3VXQA 2BIQA 1NAKL 1EVTC 2H6PB 4N0YL 4S1RL 5E23A 3KGUA 2ARJQ 5GJTL 4FD0A 4AM0Q 1OWWA 1X7TA 4AV0A 4Y5XB 1MF2L 3PNWA 1ID5I 1CFSA 3FJTA 3JV4B 1SLXA 1WP6A 5GSVB 2ZX8A 3NZ8A 1WG3A 2VLJD 3CX5K 3LQAC 2ZSWB 1JPGA 2KHAA 4MXQD 3WXVL 5I71C 1U2CA 4YBLB 1ED3B 3FKUS 2JELL 4XB3A 5JHLA 3ZMRA 2YPLE 1WZ1H 4X2UA 5D5MF 1PU0A 4XRCA 5B4MD 3NIGF 1H6TA 3OR6A 1GIGL 5EZLA 2G75B 4P2YA 5EEZA 1WITA 3K46A 4QXTB 5F7FA 1Z9MA 2W07B 2WMPA 3BISA 2RACA 3PDOB 4M9PA 5J1AB 1P5UC 3RZCD 1DJZA 5DURD 3IFOB 1AJ7L 2FJFA 4DJMA 4R26L 4Z0BH 2DD8L 4TUJA 3T0BA 2IDFA 3AWFA 5CSZB 5C6TL 3BAJA 5EUKA 2MPAH 1R4XA 5ITBL 3TF7C 2F8XC 1QUPA 3FT0A 1FVCB 3M1CA 4JQIL 4YUEL 5JQ6L 2XWJA 3TNMA 2IPKB 4K5OA 4P23D 4PY8I 4PRHA 1EFXD 3T77B 2ZG1A 4K9EL 4B9IA 2J72A 4AXWA 4NQDE 2ADYA 3QEGH 5TDNA 5C86A 5F89A 4MB4A 5IOPB 5C0AE 2C9VA 4FXLA 3AS2A 5C08E 1XBDA 5CZRA 1JPSL 3X13A 4OZ4B 3S37X 5E6RB 4LQFH 3L3HA 4NO0D 5L4FA 3X3GH 3GBNL 4QF1A 1NCGA 4GS7C 5F7BA 3AS3A 2C3GA 2H0JA 3QFGA 4HCRH 1MZYA 3DVNA 3LKRA 1YY9D 2R0ZL 3EOYG 5I1JH 5GZNC 1HE7A 1ZLWH 1ZHNA 4G6AD 3UP1A 4AQEB 2CBMA 1P5UA 4HSAC 4FJYA 5DQDL 2ZUSA 1C5CL 4Z3IA 3QPQD 3FTZA 4MJ6B 4AYMC 3FSVA 5FXCH 3LRLA 3RWEB 3BDXA 4FQLL 4DGYL 3S3DB 3QUXD 2EECA 3FBQA 5I1KH 1DVFD 3EBGA 4F37K 3LPOA 4KC3B 4UDUB 1MCBA 5T1DL 1FIEA 4HIIA 1RURH 2BWIA 4QHMA 4QXGH 3GMLA 3RPKA 2VQTA 1A1MA 2XJLA 3DXAA 2UXGA 4UNVA 1VGEL 3BAEL 1LP9B 3K8KA 4HUXB 3VFTB 4YSTA 4C4KT 4UINH 2WXGA 4A7SA 3FTVA 4LL9A 3ARBB 3C8KA 3MCYA 3C5JB 3J7HA 1U3ZA 1EEZB 2XY1A 4YDKH 4O2FA 5EU4B 3U6XS 5FHBL 43C9B 4X6FA 3X12B 5DEFA 5GZNA 4TSAH 3P9WB 4C56E 1S78D 3EO0A 3QIBB 3U79A 4U3SA 2JI2A 1BM7A 4D3CH 4LU5H 4X4YA 1SFDA 5EO9A 1J5IA 3FSAA 5I6OA 4WFFD 1NJ9A 5I8CA 1NBQA 3FB7B 2NYZA 4P5MA 1SVCP 3T65A 3HLAA 3AU1A 5SX4H 2RALA 5D2LE 5J6HA 1RV6X 3D18B 3SPCA 1JXGA 2JB6A 3IDMB 4Y9CA 1ADQA 1YPZB 4LCVA 2XQYG 5D6CA 1BQHB 1RPKA 2P7TB 2LW3A 2DDQH 2FZ3A 1HQRA 5F1SA 4F8PA 5C70A 3P4OA 3IFPB 3NCBB 1VFAB 4NX0A 5JIDA 4S2SB 3EYVA 3OG4B 2NQ3A 5KG9B 2GB2A 2NX5B 4WW2F 2Y5EA 4O02H 1PAZA 4AEIH 1G9EA 2BMKA 5IR1B 1CD8A 1NAMA 3OXSB 4JFYA 3RIKA 4Z7NE 1XH0A 2IG2L 3KPQB 1GPOH 3MROA 3N43B 1A1NA 5DFAA 3VAEA 2OSWA 4Z95L 3BSGA 1ETJA 2LLLA 3PQYD 1PIFA 3E6FB 3PS6A 3RNQA 3LTVA 1NGZA 3TVMB 3GEWB 2X44D 1DJIA 3GZQA 4Z7WE 2W80C 4B41A 4BFIA 5ALBH 2FX7H 1NGYB 3VXMB 1NPJA 3LXUX 2XKNA 1P9MA 1NCAL 3E1F1 1H5BB 2CGRL 1FZJB 5D7SH 1C7SA 1UC6A 2OMWB 1KYFA 4GT0A 5F0PB 1DJGA 2WLNA 3KBHE 2FJSA 2J1WA 3ZDYE 1MLCB 4K5LA 5KZCD 1GJUA 2DYPA 2ICWB 2APFA 4HFWA 2DQCH 4GH7B 4PJ9D 4UQ2A 3T2PA 4JHVA 2BP8B 4JDVA 2VAAA 4K0OA 2XQBL 4F57H 1RULL 2BERA 5IGXH 2JNZA 2A6KB 1WD9A 4KPHL 1JWSB 1N59A 1MY5A 2AXGA 2DEWX 2G2RB 3FQUA 5FYKL 4KX8A 3WOVA 4NZRH 4WVRA 1M05B 4MFHA 3PL6A 4JRXE 5E0QA 4ZI8A 3NTCH 5I75C 1OF0A 1MPAL 1DQVA 2AEPH 3TU6A 1IKOP 1D5BA 1DBBH 2VDPL 3PCYA 4HC1L 3K6DA 2UZXA 5DJ8A 4M61B 1OAXL 5HI5C 4TNVK 1W6WA 3H2WA 5FYKD 5C0DA 1KBGL 3FU7A 5LQBH 4LDCA 5GS1C 3FZUC 1JAEA 3FCSA 3LKOA 2G9HB 2E86A 4W9DC 5J13B 4GRWB 1BBJB 2OYLA 1OGAD 1LM8V 2BHFA 4M29A 3QYMA 3A6CL 5I73B 1G9MH 1QLFB 2YN5A 4LIQH 3MRJA 4K3DL 4PRIE 4P2OC 2Q2LA 2WXFA 4LBEB 1RI8A 5FFOA 4YVNA 3B1UA 4Z1PA 2DLIA 3BP4A 5IVZA 2FYYB 3C09B 3G6DL 5ESVB 1ZTXE 4TLUA 3FUNA 2GT9B 4WI6A 2DWXA 1PZCA 3QDGA 4I1NB 4APXB 7FABL 2MOGA 4H25A 4Y2OB 4YSSA 1XTMA 2B1HL 2L4OA 1II4E 1E42A 2X42A 2HTKC 3WDHA 3EJPA 4KGLA 4JGUA 4G42A 1TEFA 4N2KA 5TF1H 2OZ4L 3ZVVA 4EVNB 3O4LE 1RD6A 1Y0LA 5GJSL 2H2SD 1AQHA 3MRIA 1NL0H 3KLHD 3OGCB 5EPMB 1QACA 1Y07A 5EOCH 5E4EC 3BPLB 4PGCB 2WWKO 3H0TA 1HHGA 1L0QA 5AZEH 2AABH 2ZF8A 3GMPB 4PBWD 5IF0A 4FFVC 1LO4H 2CBQA 3F7VB 4J1UB 2XZAH 2F8IA 4QOKE 3P4MB 5JZ7C 1RY7B 1TZGL 5KN5B 5AQ0A 2QT6A 3U2JA 1UXWA 1BJMA 3K4DA 3EOBA 5B22A 3EDFA 3GSNA 2MTAA 1A4KA 2DTMH 4PJFB 2I5YH 5A6LA 1QA9B 1A02N 1UHVA 3WYRA 1E8ZA 3WIIL 4NB7A 5HD8D 2Y5QA 2Z7UA 3HB3B 5D7LA 4F33A 4QD2E 4PJHA 3FQYA 1T3FB 2N3JA 5D70L 4JQXA 4NAJA 3B7YA 3GDBA 4UAOC 5BZWA 4AJVA 1TPXB 2WVVA 4BSJA 1KPUA 2Q8BL 1SDAB 4OD1H 2QVMA 3SBWC 2VR6A 2HT2C 5F0MB 4EQ3A 5AFAA 5DUMH 2VLMD 3B43A 3AXLB 1R5IA 4L29B 3TBYB 3V55A 3MRPB 1GTNA 5EU3B 3CJJA 3FO2A 3TYGL 2WANA 4UYPA 5B8CC 4JRYE 3CLFL 3PWLB 1M6UA 5D1ZC 3T8XA 1NGWA 2YMXH 3F12B 5JYLA 2OBGA 5DZVA 2VM9A 1KIPB 4AZ8B 2GK2A 1OOWA 1P4LB 1I4FA 5DFWH 1UG9A 2WCGA 2VMJA 4OGAD 4KV5F 2VABA 3ESUF 3GZKA 3QS2A 2Q2EB 4M6AA 4XP5H 2VQUA 5F71A 1ZXQA 4DEUA 3UIZA 4UT6L 1E4KC 1XF5A 3D2UD 2NUPB 3EBIA 3Q1SH 3Q1EA 2NXZC 1JDDA 1B2WH 3GSWA 5DF0A 4J3OC 5BRZB 2C1OA 3AB0B 4N8CH 2XG5A 1M7DA 4DT2A 1E4WL 4N86A 3O3AB 4JFQB 2HT3C 4TXVB 5B1JC 2AK1H 4LCIH 1S5IH 2DL2A 4HT1H 5SV3A 5E8DH 4BINA 5D1QC 2E5EA 3VXRA 1S7VB 3TPUB 4TQEL 5GGUA 5EULV 2FBRA 4PJ5A 1A3QA 1H3UA 2NY5L 5IESL 5LUMA 5C2UB 3QPXH 4K2UH 4NN5B 3W37A 2XZQH 4MAZA 3P11H 4BFBD 3V0VB 5BCAA 3O9WA 3UPAA 4J3OH 4RFNB 1XSOA 5C07A 4PBDA 4KTDL 2P5ED 4C4BA 3CHRA 2PP9A 3JBG7 4TVSa 2VLKD 4HJ0C 1LK3H 1NOFA 4HS6A 4D0BA 5DD5H 3M8OL 5HVHB 3RJQB 5I8OL 4MKMA 4FQCL 1T21B 2OSLA 3MCLL 2L8AA 1U8JA 5GZOC 1OM3L 5HPMA 2OW7A 1Y1DA 4JM2D 3SKMB 1LO3L 3FBKA 5FWQA 1YQVH 2BY3A 5TE7H 1S7RB 2IFGA 3VWKB 2VR3A 3VGAB 1NUFA 1C12A 32C2B 4GLRH 3BGAA 4WY7H 1HXKA 1KYAA 1L9OA 2A7BA 4ODUB 3MX0A 3LNHA 1C08A 2UZYB 5D1QA 1EAOA 1DVUA 5AL8A 2QADC 1NGQL 5E4OA 4R90L 5FKPB 1WO2A 3HC2A 1GJIA 3CBKB 3H9HA 4ORZC 1K85A 1EEUA 3OMZA 2J1YA 3C60A 2UZIL 3GHEL 4LLQB 3G5VB 2A9CA 2RJMA 3A47A 3GS0A 3HMXL 2WSPA 1W8EA 3QWRD 3RL1B 3OHXC 4IBYA 2DBJA 3UGXA 5MI0B 3V6ZB 3I9GH 3KG5A 1EXUB 4TNWF 5D1XA 2NYYC 5GZOA 3C2AL 2J8HA 3FT3B 1MCPL 4K3EL 4NOBA 4RMSA 1IBDA 3MJ7A 4D94A 4YFEA 1ZLSL 1MF2H 2CBPA 2OXHA 5GGSA 4K73A 1QSEA 4YBHA 3ZQ9A 1EERB 1G43A 1KGCE 4QRRB 2BVPA 1GYUA 1F00I 1JG9A 2VIRB 1RZKC 2WOBA 4NPYB 1ETZA 2DOCA 4RWYL 3L5XL 1A7NL 3G5XB 1IIKA 4JG5A 4OCNC 5DUPL 1DVYA 5HJBA 4CNIB 5ACZB 4N0CD 5LDSA 2AEQL 2X4QA 2QQLL 5LXGL 1P69B 5I5MA 2Y22A 1VB9A 4HKXB 1IUZA 5KUMA 1RJLB 3RPBA 3FUFA 4CGUB 2DQMA 3C5SA 2PMZA 4TV3A 2F5BL 4MAUH 1D5XA 2RIKA 1X5ZA 1S4IA 3PHAA 4QHNA 2NY6C 1GIGH 4NO0B 4O4YL 6PCYA 2V2XB 3VSUA 1ZHLA 2ALWA 5IFAL 1RZKH 3X2QB 1JHTA 3P3SA 3O4OC 1T1WA 2Z0UA 5E03A 3X14A 2DD8H 2O61A 4F80A 1NBYB 1QSFA 3RUGE 2PXYD 5ITBH 3H6AA 4OLUL 3HMWL 4PJXF 1Q1PA 3WIFA 5BZXA 2XTSA 5H8DA 4AYDC 3ILPB 5T3ZE 1OZTG 1RIHL 4KJPC 4ZTOH 1CBVL 4X9HA 2YS4A 4UOW0 5IFHH 2FO8A 3ME0B 1SYSA 2HKFL 2XIIA 1DVFB 5F6IC 4E0RA 1I85A 4LNRB 1E90A 3GSRB 1A7BA 3KR3L 4FQ1L 5I18L 3LZPA 1QRNE 5D7IA 3RNKA 2HFFB 3MFFB 3KGTA 3V6OA 1S5HB 1DN0A 1QEWB 3GBNH 1OOAA 3WNJA 1T22B 2AQ3A 1AKPA 4BHUA 5PCYA 3ZN6A 4UV4L 2EDFA 4GSDH 1YUHB 5ALCL 5HI4C 1RJZA 2IV9A 1AE6H 2IDQA 3OKMB 5J12C 3V0FA 1SN5A 1YNKH 2J6EL 3VFSA 4KZDL 1DR9A 1A2YA 3HN5A 3PUUA 2P5WA 4ZW6A 2XACC 3VG0L 1E43A 2DKUA 3W9EB 2ZF9A 4HD5A 4N24A 4D9LL 1C5DA 2LAAA 3ASOB 3RVXD 5FYLD 3QHFL 4KZEL 2XN9A 2CCVA 3WD5L 2VXQL 3V5HB 1RHHA 5D71H 1K5NB 2WXNA 4RAUB 3K72A 3GSXA 1BEXA 4WFGD 3IN0A 4IJ3C 2DM2A 4ELMB 5MP6L 2Y3AA 3I50L 4YHKL 1D9KB 3UJIL 2YQ2A 3L3JB 4MYPA 1VGEH 3BAEH 1YEJL 1TTCA 1ZS8B 4J23A 5ESQB 3ZKXB 2FRGP 3F83A 1T5KA 3ULVH 3A21A 3QC6X 2VL5B 2QSCH 3MLUL 3LKQA 3CFQA 5IB5B 2Y7QB 2A83B 5E8PB 1YN7A 4NZJA 5JW3L 1T66C 5BV7L 4W9FC 2ADGB 1Q9LB 1TTGA 5FHBH 4U6YA 3WEAA 5ICZB 3Q6FB 1ZV5A 5J3HD 1UUSA 2JQAA 3OZ9L 1D5ZA 4IU2A 1JNNH 3D07A 3TL5A 4WSGA 3U9UA 4H2CA 2LU5A 2JIXD 3HNVH 1QFUL 1GKEA 1AD0B 4WCYL 4MJIE 3KM2A 1RSFA 3UC0H 1XCQB 4KFMA 1HEZB 1ZT4B 4TVUA 4KITB 4GO8A 5FK9A 1THCA 2AERT 3A67L 3SGJC 4GLRI 2YUZA 5HVGB 1BLNA 4PJIB 1KCRL 2XWDA 2R15A 5TPWL 2NXYC 3QUZC 1NIAA 3RDTA 4HCFA 2A0LD 4YIQA 3VRJB 5F3HB 1RJYB 3QZPA 5CN2A 4HV8B 2H1PH 4ZMZA 2NY3C 2YUXA 5T5FL 5DO2C 3QO0A 2Z3FA 5BMFL 2AK4B 4KKLC 4OJFL 4JFED 3SQOL 3V4VL 3C6LC 4E36A 4J6RL 2Z34A 3VACA 4Z95H 5FV1L 4POZC 2KLSA 1OCWH 4PMEA 3IGFA 1OCZB 1IC1A 1KTDA 1KJ2L 2NZ1A 4YR6A 4JO2H 4XC1L 1HK6A 4FEIA 1OLZA 2WIIA 1XB6A 3QUMB 4DQOH 1BBDL 2CXGA 2FO4A 3BSZL 1NCAH 2IAMD 2CGRH 5I5RA 5AUMB 2K1MA 5I8EA 3E6HB 4YDVA 4OM1H 4Q58C 2VDKH 1QO3A 3W57A 2V3FA 3QEQE 3TJHC 4HIXL 1OO2A 5E95B 3RKPA 3E2HC 1U92A 3PGFL 2DM4A 3BJLA 1JHLH 1UZ6E 4BM7A 5C9JB 4OQTA 1EBPA 3QXWA 4J39A 1IT9L 4ZOEA 4XBEL 3CVCA 1MW3A 3TV3L 4G5ZH 2XQBH 5IMMA 1S9KC 1OM9A 4X80H 1RULH 2BNQD 4TMPA 3AGVA 4KPHH 2YC1B 4UIKL 4MMZA 3HNSL 4N9OB 3D39E 4MA1C 4PWKA 3S3PA 1X5YA 5F9OH 5GGQH 2DPKA 4PCYA 5E2TH 1QVOA 2I25N 3KJ6H 1J5HA 3QGVA 2AJ3A 2VDPH 4LDOB 1KIUA 1XGUA 5K59F 4LVOB 2WXRA 4G7VL 4YPGA 1OAXH 1S46A 1KBGH 2C9XA 1MCQA 5GGTL 4JZJA 1TYJA 2JI3A 1AQ8A 3ZKND 5BVPH 2QPDB 3UXFA 5K9KA 1MVUA 1UD4A 3A6CH 4P9ML 5EORH 3MYZA 1MFEH 4NQEA 4K3DH 1HXYA 4CVZA 4L3ED 5IMOA 5IVXF 1GAFL 1QTPA 2H41A 4MD4A 5E9NA 5B3JF 2A74C 2VOTA 1D7CA 3G6DH 5IHZA 3QZMA 1PZUB 4MVBC 4R7NA 1DANT 3O3BA 1BD2D 4Y2DC 4C57C 5FO7A 4S0TD 3BZDA 3JTTA 3FO1A 3VXPA 3RRQA 4AUUA 5C0IA 2HG5B 1MREL 4YSPA 3V7AG 1Q9WA 3T0AA 4ZW7A 2R69H 3QXTA 3Q9PA 4NDMA 4PMFA 5CEXB 1FLRL 3O11B 2E9GA 1E5UI 3GSOB 3O8XC 2K45A 1LP9F 3MODH 5GJSH 2FGZA 2HFGL 3FQTB 3GB7B 3U36A 3QQ4A 1BXVA 1A6TB 2NW2B 1IFHL 4PHZA 2AANA 1WUNT 1XVSA 3MNZB 3QFDA 4P46C 1CF1A 2C7UB 2AQQA 5GS2H 1TZGH 2GJ6A 1I9JH 3CDYA 3LZOA 4AGQA 3SEPA 1MW1A 1NMCC 1F86A 3K2UH 3RB5A 4Y4FB 1E67A 3W39B 3BQVA 3MVSA 3S88L 1S7WA 3PWJB 4XNUH 3BDBA 3HUJB 3O3EB 1L7TL 4XWOC 5EZJB 4K23H 2ZXEB 2IMNA 2WKLA 1EZSA 3L45A 3GSVB 2JJUA 4NM8H 4PGEB 1KUMA 5C0FB 4IRZA 4R7XA 2LR4A 3E3QE 4R8WL 4CMHB 4CU8A 1YPZF 1D5RA 2EIEA 5DVLA 5D7JB 1HX0A 3L9RB 4IRJB 3K6NA 3MOAL 2Q8BH 1ZV9A 3D2UB 1TZHB 4IKLA 4YXHL 5K5YA 2DWSA 4TLTA 1EBAA 4E9XA 1UURA 3VMPA 2ZKHH 4ZSOE 4E9SA 3FRPG 3BMVA 5ISZE 5ESAB 2K4AA 3TYGH 2VISB 4WW2C 4XNAA 1R46A 3DMMC 3VU1A 1KNOB 2ICEA 4HWBL 3BH8A 4RZCA 3CLFH 3N43F 1HXMA 4P5TC 4BFRA 1FZKA 4OUUA 4HF5L 2A9AA 2EXYC 4GEIA 4YNYB 4WTWA 4NXSA 1JIBA 4PV8B 2SEBA 2XBTA 2R2CA 1NWOA 3WJMA 2HRLA 1X5JA 3GSQB 1TYEB 1T2XA 3RWHB 4ATTA 5DRWA 1PLAA 5KJ4A 5JQIB 3HTLX 1ZTMA 3KPTA 4MZ2A 4LFHD 3RJOA 4Q8BA 5F70A 1LEKA 2E46A 1GVIA 3CXDL 3UBXI 5FGCE 3WNIA 1KELL 1EJOL 4XHJD 4U6XA 5I66A 4PJBB 2BSTB 3TCLB 3WMPA 3SODB 2XTJC 1S7QA 4IBTA 4R6UA 2XY2A 2IBZX 5INCA 3ZKMC 2VXSH 1KV7A 3VRIA 3HI1A 4W6WB 5C0BD 4DEWA 3FULA 3T2NL 4Y88A 3RTQD 2NY5H 4XB7A 3D1MC 3SPHA 5CKAA 5E2UH 4HWZB 2TSAA 3IMRA 4H26B 1ACYL 5E2JA 4FZ8L 4M1GL 2F61A 5FGSA 2CUAA 5A2BA 4KTDH 4RFEB 2HLAB 3BFWA 1D6EA 2EEBA 4RH4A 4ZMPA 4JDTH 5DR5H 3RY6A 1N2RB 5SWSD 5I8OH 4FQCH 3EO1B 4GRWF 1I8KA 2DRUA 4A7TA 1LO3H 5B1BB 2O6CA 3L4YA 4FADA 3OMIB 3ZO0A 3GXUB 1M42A 3OPUA 3PRZA 3GTVA 1P7KA 1Z66A 2EAEA 2IANA 1WWAX 2QEJA 3F7RA 1VZIA 3TA3D 1FH5L 1JJUA 3QUHA 3GBDA 3IBEA 4XR8C 3QT2A 3RY6C 3ALXA 1TU2A 3AT8A 4K9JA 4ZS7L 3TM6A 4ZMVA 6CGTA 5K69A 2XV0A 4MNQB 1H8NA 4WTZG 3CFDB 1T4KB 1U8LB 1NC4A 2UZIH 5F7LB 2R29H 5T1LB 3MJ9A 5AVYB 1V7NL 2QQNL 2NNFA 3BQUC 4Q2ZB 1MWAA 3HMXH 3QQ3B 4HS3A 4ANUA 3LV3A 3X3FL 1QKZH 4WQOA 3L54A 1D2OA 2DQTL 1YEHL 2Y7LA 5EIIB 4AEHL 1GKOA 2EIMB 2YD3A 2DQHL 3K0YA 3I6GB 4AV4A 1CK0L 3UZQB 2DWEA 3SGDI 3MFGB 3RFZC 3IDIB 5FAAA 2PNDA 3N50A 1MCPH 1LO0L 4WUUB 3K6SB 1K8IA 2DWTA 3UMNA 5AW7B 3IMBA 2WYHA 4U1KB 5FUOL 1FAIH 1XDTT 4OZGE 5B1KA 3QQ9C 4JFFD 1KG0B 4NOFA 1C5BH 3II1A 4LEBA 1P53A 4MBOA 4IBZA 3P69A 4RWYH 2DLTA 2R1XB 3MKKA 4NZUL 2GW5A 1EDQA 2CO6B 3GPSA 1USZA 4PJFF 5DUPH 3BIKA 2YPLA 2F7IA 4TOYL 3RWFA 3UTQA 3V4PA 3ZTJG 4EVNA 3LX9A 4LVEA 4FQ2L 4MAYD 3EADA 2Q9OA 3KYOA 3CFJB 2F5BH 3LEYH 2N7SA 2ED6A 3DUSB 3KBPA 2CSPA 3IGLA 2FD6L 3GXDA 4NO3A 1AHKA 2ARJA 2QKIA 3KPRE 4AMXA 2ZPKH 4FGMA 1CDUA 4AM0A 4C4KO 1LE9A 1RHFA 4TQPA 4LLVA 4TRPL 1UXSB 3VQMA 4X0KB 5E6ID 3P3RA 3QZWB 2OMYB 2X4PA 1KPVA 3AWGA 4U6VH 2OP4H 4AGOA 1PCXA 1MFCL 5JPMC 3ASNB 3QZBA 1LWRA 3HMWH 5GS3A 2IIJA 2VZ1A 5G4MA 4NQDA 2JB5H 4PREB 3IDJA 4RQQA 1KGIA 5C0AA 3PV7A 4R2GD 1BQHG 2HKFH 1A6ZA 5C08A 4PWEA 5CMAB 4NQVB 5F9DC 3T3PB 5EC1B 3UP6A 3CZJA 3PE9A 3KR3H 4FQ1H 5I18H 2PCFA 1CDGA 1RJCA 4QO1A 1E9QB 3CHOA 1A3ZA 2ZAGA 3DHUA 1PEWA 1WFUA 2HRHA 3RWJB 3LNEA 4ODVL 1MH5A 1XIWA 1G5AA 4FS0A 1YEEL 3PQYE 1IC0A 1DJXA 1UM5L 1WBXB 3VNYA 5IB3B 3ML9A 1N9PA 2TRYA 3MRLA 1XF2B 1IGJB 1ES0B 4V2CB 3ROOA 2FEEI 4FL4C 1TENA 4KZDH 2W1NA 5L2KB 4M6OH 1J9CT 3QZOA 4YL4A 1JF1A 2N1KA 4EO5A 5I6NA 4D9LH 1RUML 3OKEA 2BHUA 4M62L 4JANB 5J6GA 4OZHB 1CXFA 3QHFH 4S0HA 1YSOA 2VDNH 3HG1E 4G8GD 2B9BA 2GAZA 2K6YA 1TQWA 2HVKB 2JIXB 3S5LB 3L4VA 3WD5H 3ZZQA 3VXUD 2GEQA 3WFDH 1Q1JL 1WF5A 3B9DA 5MP6H 2Z7YA 3O0RH 4YHKH 3I50H 3UJIH 3NAAH 4EZLA 2DQJL 2OM5A 4R5XA 5B21A 4DERA 3VWJD 5H94B 2AQPA 1BFSA 5HI3D 3MNDA 1IM9A 1FPTL 1I7TA 2VSMB 1WJ3A 1XSJA 2P43B 3H9ZA 3MLUH 2PWDA 5LCVA 3MBXH 5HJ3A 1UH4A 4XN9A 5H35A 4HKZA 4QRQB 5JW3H 3P73A 3G5ZB 4N8UA 3LIUA 4P2RE 1R5WA 1Z3GL 2VLLB 1SLUA 1RUKL 2QJDA 4IEFA 5FYKE 1UZGA 1KXTB 1DUZB 1CL7L 1UXLA 4KXBA 5FR3A 2Y06H 4FXKC 4A7GF 5IMLB 1AIFA 4F7MB 2MMXA 3NCWA 1CTMA 1QFUH 3UJTL 2CCWA 3D4CA 4OY9A 1FC1A 1NC2D 1KSRA 4P4RB 2EDXA 1KLFB 4YL9A 3BVNB 3GGWB 3MRMB 3HC3H 1WGOA 1I53A 3OXRB 4H1LA 1RL1A 5CHNA 1OB1B 1Q0XH 3A67H 3U6RA 3O2VL 4FQJL 1IC7L 1NIDA 3DECA 4OH2A 1KCRH 1AOHA 1VAHA 1CB4A 2IAMB 4WI5A 1MHEA 1NCWL 3RIFK 2FGWL 5TPWH 4JE0A 4A6YA 4B5ZA 2ZKWA 5FKAA 2WC7A 1XQ4A 4BZ1L 1F41A 1U58A 2UVFA 3L4TA 3L3OA 1WK0A 1A0QH 2YK1H 4JKLA 5AVVB 4OFPA 1U8PA 1BF5A 2AS5M 1D5IL 3L3GA 3SQOH 4KXAA 4UM9A 4MZ3A 4HYTB 4TUOB 4FXKA 4J6RH 1JOIA 4Z7WA 1J86A 5SWQA 4EOWL 4Q74A 2F6AA 1ORQB 1OIOA 2EACA 1XD1A 3ARDC 1EZLA 4XC1H 2A77L 2X28A 5HHNA 3RGVA 5FECA 3ALPA 3WCYA 3P77A 1BBDH 1Y7VA 4F8OA 2ZCLH 5EOTA