5D4JA

Chloride-bound form of a copper nitrite reductase from alcaligenes faecals
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
335
structure length
335
Chain Sequence
AAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
publication title Redox-coupled proton transfer mechanism in nitrite reductase revealed by femtosecond crystallography
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
total genus 93
structure length 335
sequence length 335
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2015-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5d4jA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5d4jA02
3TU6A 4HCFA 3ZX1A 2CJ3A 3H4FA 1AACA 3IN0A 1CYXA 2PPEA 1JZGA 2Y69B 4F2EA 1ET7A 2X88A 4N4YB 1PLAA 4GY4A 2BO0A 3NP3A 4BXVA 5F7BA 3PAZA 4KO6A 1SF5A 1PMYA 1ASPA 2HLEB 2XXFA 4P5SA 3PAUA 2AFNA 2AZAA 4JKNA 2FT8A 2XUWA 3D12B 1TEFA 2IDFA 2IH9A 4DP1X 3S3BB 1BXVA 2B08A 2H47C 3NJLA 1EZLA 3UGEA 2TSAA 1AS6A 3FYIB 1J5CA 4ENZA 3MX0B 3UABA 2QT6A 2XXGA 3BQVA 1BQRA 4PCYA 1IUZA 4KNSA 3ABGA 1JZEA 1OV8A 5B7MA 2IH8A 6PCYA 1AOZA 1ADWA 1A4BA 1ID2A 1TKWA 1PAZA 3S3CB 2YAMA 4E9SA 1MDAA 2XYBA 5TK2A 4E9TA 4KO9A 5D4IA 4YSSA 1AZUA 2CCWA 3AG1B 1NIFA 3SBPA 5B7EA 2IDUA 1BYPA 2ZONA 2FQGA 1OCCB 4EF3A 1J9RA 1XMEB 1AZRA 5I6LA 3UADA 5B1JA 1NIDA 4E9QA 2YXWA 1X9RA 4G70B 4W9ZA 3FSVA 2R7EB 3PAVA 3AY2A 1QNIA 4TXVB 2YQBA 2H3XC 6PAZA 3NYKA 5LDUA 3JTBA 1ILUA 2PLTA 2N0MA 4DP4X 2VW7A 1W6WA 4DP7X 2PP7A 1BAWA 3NJFA 3PPSA 4YVNA 5F7AA 3WKPA 4G72B 5EHFA 1AS8A 1OCOB 2YAEA 4CSPA 2GHZA 2CBPA 4YSEA 3CG8A 3IE9A 3FU9A 1X9UA 2VW4A 3EH5B 4GXFA 4HHWA 4G7RB 2XU9A 5I6PA 3C75A 4KOBA 2VM3A 1AZBA 2DV6A 2XX1A 1GSKA 3FSWA 4JHVA 4PAZA 4A2FA 3FSAA 1AZCA 2XV2A 1M57B 2OCCB 1XB3A 3NJNA 2NRDA 2UX6A 2FT7A 2WSDA 2BP0A 2H5UA 4A68A 1N70A 5TK4A 2HXAA 4M3HA 1YLBB 5PCYA 1TU2A 2BP8A 1PLBA 1CURA 1E5YA 3FU8A 3QQXA 1ZDQA 4BWWA 5ANHA 1OE2A 3IN2A 2IAAC 4DP2X 2HRHA 3ZIYA 1BXAA 4DP5X 1NTDA 3X2QB 1KCBA 3NP4A 4RH4A 1PZCA 3EF4A 2ZXWB 1IC0A 2UXTA 3L45A 4A2DA 3PLYA 4DPAX 2GC7C 3AW5A 3EH3B 3T71A 1DYZA 1A3ZA 2PP9A 3KW7A 3AG2B 1SNRA 3EHBB 3SQRA 4HCGA 3FU7A 1BEXA 8PAZA 2XX0A 3TBCA 5I5IA 3WIAA 5I26A 3SBQA 2GIMA 3IEAA 1OF0A 3NSCA 2XV3A 5B1BB 1XB8A 1ASQA 1SFHA 4BDVA 1PY0A 4QLWA 1HFUA 4QKTA 1ZIAA 4E9WA 4HZ1A 1CYWA 2I7OA 5B7FA 3NSDA 1PCSA 1URIA 1BYOA 2XLLA 1BXUA 3FSZA 4YSUA 4KOCA 1EHKB 3KW8A 1KV7A 4K9JA 1JVOA 1PZBA 3NJMA 2VMJA 3ERXA 1KDIA 3X1NA 2J5WA 2YARA 1AG6A 5B1KA 1L9OA 4UAHA 4G7QB 3HEIB 2DWTA 1MZZA 5I5JA 3S8GB 5I6KA 3NJHA 3DKHA 2QDVA 2W8CA 4P5RA 2YAHA 3X1BA 2YAFA 3N55A 2IDTA 4F2FA 2HX8A 1BQKA 1PLCA 4A67A 1FWXA 1L9QA 2J56A 1L9TA 1MG3C 4HAKA 3TASA 1UATA 2MRYA 3TA4D 3UAAA 2JXMA 2FTAA 2IWKA 1SHXA 2MTAA 4WKXA 2OJ1A 4F7KA 5I6NA 1PNDA 1AS7A 1AG0A 5AFAA 1L9PA 2VW6A 1J9TA 3T6ZA 3NJJA 3ABMB 2BP0B 1JZJA 2X87A 3NSYA 3WG7B 4YVUA 1R1CA 2IWFA 2I85A 3QJVB 2EIMB 1JVLA 4A2HA 4JHUA 1RZPA 1JOIA 3CDZB 2BP8B 2DYSB 4E9RA 4YSDA 2HRGA 3QPKA 1J5DA 2IDQA 5IY5B 3FYEB 1OE3A 3BVDB 3S3DB 4E9YA 4BXSV 3ASNB 3WKQA 2PCFA 1V54B 3QJQB 1A4CA 1SDDB 3CVDA 2GC4C 2BWDA 2PPCA 1KBVA 4G71B 4GP4B 1FA4A 3FT0A 1E65A 3QJTB 3HB3B 2CALA 4HALA 1E5ZA 1NZRA 1ET8A 1J9QA 1KGYE 2QPDB 1VLXA 4W1TA 1WA1X 1I53A 1NPNA 1GS8A 3H56A 3FU7B 2FJSA 3DIVA 2I7SA 1ASOA 2EILB 1JZHA 2B3IA 1WA2X 1CUOA 2LLNA 1GYCA 1KBWA 4NAJA 2IDSA 2TSBA 3GXUB 1IKOP 2UXFA 2BZ7A 3JT2A 4BDVB 2YAOA 4YSTA 5E9NA 4FA7B 3ZDWA 3AG4B 2A3TA 3CDZA 1ZV2A 2EIKB 4KO7A 4UF7C 4YSRA 3DTUB 4M4RB 2HX7A 1KYAA 5I6MA 2XVBA 3X1EA 2CAKA 1TEGA 2UXVA 1WAEA 1GW0A 4KNUA 4NERA 1NDTA 5I5MA 4Q89A 1SDDA 5AZUA 3QJUB 4HHGA 1L9SA 2IWEA 1OE1A 3QJRB 3NJGA 3EH4B 2J55A 4Q8BA 3X1GA 3T6VA 1J9SA 2RACA 4AKOA 3QJSB 4KNTA 1RKRA 1JXGA 3FQYA 3WI9A 1NINA 2EIJB 1W6LA 1V55B 3OMIB 3IBOA 4BWTA 5A7EA 1ZPUA 2JKWA 4AX3A 1SFDA 1E67A 9PCYA 1A4AA 3FS9A 3GYRA 2HZHA 4DP9X 1AIZA 2FNWA 1L9RA 3OMAB 1RCYA 3N2JA 1WS7A 2BHFA 1M9WA 4FAAB 2VN3A 4A2EA 2DWSA 1SJMA 1ZIBA 3V9EA 2FQDA 3SBRA 5PAZA 1KDJA 1OCRB 5B3SB 1JZIA 2PPFA 1SHWA 3OD3A 1PF3A 2GSMB 1PNCA 2PCYA 1GR7A 1NWPA 2DYRB 2VM4A 3FPXA 1BQ5A 2FT6A 1QLEB 4YL4A 1AQ8A 1JXFA 1CC3A 1FFTB 2FQEA 1XB6A 2OV0A 3FQ2A 3NJKA 2PPDA 1GS6X 1NIBA 2ZWNA 1IBYA 7PCYA 2GI0A 4ZK8A 1E30A 4NB7A 3T6WA 4N8UA 1T5KA 3NSFA 2J57A 2QDWA 2JFCA 4DP0X 4A2GA 1ZDSA 2YAQA 1JXDA 3V9CA 3RYMA 3S8FB 1NIAA 4DP6X 3TBBA 1JZFA 3U25A 3WNIA 3OQRA 5B1JC 1F56A 4BWUA 1NIEA 2E86A 2CUAA 5FC9A 4BK5C 2Q5BA 3H4HA 1AANA 4DP8X 1HAWA 2GBAA 3T9WA 4YSAA 2AVFA 3T6XA 1WS8A 1GY2A 2Y1AA 3AG3B 3WNJA 5B1AB 4A66A 1A8ZA 1OOWA 4AI7A 2GB2A 3OM3B 1PZAA 1M56B 2VSKB 3OMNB 1HAUA 3AZUA 2P80D 4YSOA 1QHQA 3MBWB 1KCWA 4GYBA 1SF3A 1AZNA 3CVBA 2Q9OA 4E9XA 1ETJA 1RZQA 4GP5B 2W88A 1N68A 2AZUA 2QPEB 3G5WA 3GDCA 4GP8B 4DPBX 2VSMB 4AKPA 2UXGA 1NICA 5D4JA 2FWLB 2YAPA 3CZUB 2XWZA 1A65A 1NPJA 3ABKB 3ABLB 3NT0A 3ZBMA 1JERA 2WO2B 1AR1B 2AANA 1AAJA 2PP8A 2XV0A 3ASOB 1ILSA 1OCZB 4MFHA 1MZYA 3UAEA 1IBZA 4HIPA 2FQFA 3PXLA 4DPCX 1NWOA 1V10A 3X1FA 1B3IA 2P80A 4KO5A 1GY1A 4WTQA 1WA0X 5I28A 3FQ1A 5AKRA 3UACA 4L0PB 1ET5A 4YSQA 2PPAA 1W8EA 2R7EA 4X4KA 3CVCA 2HX9A 2BZCA 4YSPA 1MG2C 4AKQA 7PAZA 4HCIA 2BWIA 4AZUA 2ZOOA 4G7SB 4UANA 2EINB 3FPYA 4CSZA 1GS7A 2BW5A 2WO3B 2UX7A 3PCYA 2DY2A 5D4HA 4E9VA 4YSCA 5I6OA 3NJIA 2YXVA 2BW4A 1DZ0A
chains in the Genus database with same CATH superfamily
2G5RA 3P4NA 4B3EA 5DVOA 4E41D 5CNHA 3CGTA 3SZ6A 1RVFL 2Z4QA 3VG0L 2A1WL 3IXAB 1UXSB 1FUNA 4LLWB 1P84K 4RFEA 2XA3A 4JW3A 1KXQA 4HSAC 1QLRB 2X88A 5IOPA 4HS8L 3KPOB 4N4YB 2DMGA 4WW2C 4BXVA 2BDNH 2JKSA 1LMKA 3O0RL 1MJ7L 5K69A 2JF1A 2TRHA 3V4PA 3PQYE 5F1NB 1CICA 1DDHB 4WWPA 3V0WH 1QPXA 4R4FL 1X5KA 4QRSB 4N2OA 5KVMC 1PAMA 3EH1A 4N2GA 2ZCKH 3QFJE 4ZTPH 4YJZL 3VACA 1J11A 1CFVL 3A67H 3SY0B 5JXED 1JD9A 2CGRH 2H4EA 4PWHA 1BQRA 3L2NA 3CLFL 4FTVB 1WUZA 3NZUA 1YECL 2YWZA 3EJRA 1MLBA 4PJ6A 1A1NA 1KOAA 4TQEL 1EWHA 5KVEL 3N5AA 5E00A 2EDEA 2CJUL 2Y22A 3RNKA 5C0IA 5FR3A 1S7XA 4C56A 1BG1A 5DQ9A 3ULVH 3L6FA 1ZOXA 2OI9C 3DBXA 2R23B 2ZONA 4MD4A 1JGLH 2ESVB 4WGKA 4PJIA 3NCFB 1KCSL 4WQOA 2W94A 1S7WA 1NIDA 2E47A 3D39A 2B77A 5D71L 4BFGA 4D9RE 5AOZA 1IKFL 1B9ZA 3GTNA 3EBAA 3ZN6A 1UGNA 4B95C 4G70B 1NCWL 2ZOWA 4MAYA 5IB5A 5EULV 1EAQA 2GI7A 4JMNA 4WK0B 3VXQA 2X6UA 4KJYA 2A9NH 3H3KA 2XVGA 4XMKH 3NZ8B 5D5MB 3S96B 5HDQL 3EUDA 2BCKA 3BUIA 1OAYH 3NPZB 3D87B 5CN2A 4DP7X 5JZ7C 1CZ8H 4MJ4A 1OHZA 3CFJA 2EO9A 4PWGA 1VPOL 2FWSA 1BJ8A 2FCBA 2CKBA 3B8SA 3P0VH 4JN2B 5I16B 2CBPA 5EC1B 3CHSA 1R3LA 2GJ6A 3IAQA 1F3DJ 3P3TA 1JWMB 5KVFE 2VW4A 4HHWA 3Q1SH 3D69B 2PWHA 4AV4A 4JM2A 4OSUL 2DV6A 2G75A 2PUQT 1T1XB 2Y36L 4P3DA 1KTCA 4L5FE 4NQCA 5BRZD 3BJLA 2WLYA 3C5JA 1E27A 3N42B 4B27A 4P23A 3TBSA 1RJZA 1NMCC 2BP0A 3R8QA 1CGSL 1QTSA 1N70A 1RP9A 3B5TA 4QKXB 4M3HA 3VFMB 1I82A 1TQSA 2BXZA 1E6OL 4JQXC 3UZVB 3T3MB 1S78D 2IFFL 5PCYA 1U8IA 5AAMA 4LDEB 4LRNL 1VFAA 1PLBA 3NIFF 3QQXA 4IJ3B 4BWWA 4D0CB 1YEFH 4M5SA 3ZK0A 3WDIA 5ANHA 4FCHA 1EXGA 4BUQA 2HRHA 5GJTL 1A9BB 4TOYH 1KSRA 5HHNB 5I66B 4QRPE 2DYPD 3X2QB 4LOVA 1YY8B 4WW1B 2F8OA 1NEPA 1IGFL 5IB2B 3L45A 3DUSA 1MFMA 3F64A 4MZ3A 2BSCA 4Y4FA 4JVPA 4M1CC 4M8UA 2D7QA 1UOVA 3NFNB 1XEDA 4Z3IA 4HWEH 2VITB 4M5YL 3GI8L 3BFWA 1I1CA 4MD5B 3ZTNL 1U8MB 4K3JH 4ABUA 1NC2D 3BPOC 4CADA 3RP1A 3LMJH 4H5SB 4I48B 3RPIB 5E2WL 3BH9A 5H8DA 5C9JA 2XHNA 4QKTA 1ZIAA 4XI5C 3WUZA 1JN6B 4KXCA 3HKZA 4KQ3L 4XTRD 1RZ7L 1JGDB 1M2VB 1NGZA 2Z92B 2J5WA 4R90H 1OPGL 3LH9A 2Y6TE 4UAHA 3CH1A 5E94A 3OJVC 5EZLB 2P4AB 3IGLA 1I9RH 3Q8CA 4DK5A 2YAHA 3UIYA 3L1EA 3C8DA 1JYWA 3PGFH 4ZQTA 2Z6FA 1AHWB 1EHAA 1GMIA 3KPQB 1BVKA 1ZA3A 2G3MA 4PLKD 3E6HA 1TYRA 4FJZA 4E0RB 1J10A 3S98A 5D1ZI 5ICZB 3W5MA 4LCUA 1INQA 2HFGL 4FMVA 4CU7A 3IF1B 5DZJA 1PEZA 4ZUWA 3QZLA 4WK2B 5EO1A 1L9PA 4PJCA 2X0VA 2ZOLB 3I9GH 3L5IA 4EIGB 3MRNB 2E7DA 3NJJA 4AGMA 3C2AH 1MHPH 5EWIL 4IBWA 1M7UA 2H3KA 4GUOA 2AK4A 3LZNA 3WFZA 3IDIA 4GRWE 1ZSDA 2WC7A 1UFGA 3KPMA 1JPGB 5AAWC 1BZ7A 5D7IA 2EXWD 3BSZA 3X3GH 3TV3L 2IDQA 5JXEC 5IY5B 4KKBD 3UIZA 4L8CB 1IQDB 3I9PA 3O9WA 3ASNB 4S1SL 3EXJA 1SBBA 1ZHLA 5G4OA 2XOTA 4Z7AA 3QUMB 4JHAL 5DO2C 1THCA 4HKXB 4UQ2B 1DCLA 4Y9FA 5H2BA 3RAJL 3GZPA 3VFSB 1G0YR 4ALAL 3V8OA 4AQ8C 1GTNA 3QA3B 3OR7A 3ZE0E 3ARBA 4FXLA 1OAZL 5IR1A 4KRPB 3UJIH 5HGBB 1XGYH 1N5YL 1NPNA 1BQUA 2QQQA 3EJQA 1M6OA 1YMMB 2CNYA 5B39G 2VDKL 3ZTDC 4F58H 2FEDD 4NQQA 3BUYB 1OSZA 4NAJA 2IDSA 3GC3A 1YMMD 4V11A 1MLCA 1IKOP 1PGRB 4HIXH 3VWJB 2MQ3A 5A7BA 3SGDI 3ZDWA 3QZMA 4FQPA 3GGWB 2FWOA 4FQLH 2IBGA 4UB0L 1MFBH 2DF3A 1F3JA 4JG1L 4JY5L 4X9FA 3VWJD 5KBKA 2ED9A 3FOLB 1A5FL 3BX7C 3RWDA 2F54B 2MCPL 1SVZA 3V6OE 1J1OH 2XG4B 5DC0A 5IEKA 1IO4C 4QYOA 3FO1A 4YHNB 1HINL 4DN4L 3US1A 3C60A 2XNAB 5HD8D 1ADQA 2G9HB 1VENA 3O0LA 3QUZA 4NP4H 4ELKB 2W65A 3BP6A 5K39B 4OCWH 1DLFH 1IX2A 1UWEH 3EH4B 3LXBA 2UY6B 2OPCA 1KTKE 5HHOE 3P2TA 4AKOA 1U6AH 1R3HA 4RCAA 2BSDA 4AENB 3TFKD 3L81A 4V2CB 4PUBH 1QLEH 3UYPA 1CU4L 2IJ0C 3BP7B 5AOMA 3QNFA 1EGJH 3IFLH 4M1DH 2OXGA 4AX3A 4LE8A 5ESVB 3R7QA 3QQNA 9PCYA 5GRVK 1PFCA 4N2BA 2ATKB 1PZ2A 2VLLA 1N59B 2JQMA 1GZQB 2P24A 1KJ2H 2Y07L 4HT1L 4XVSL 3BWAB 1FVCB 1QKZH 1S78C 1AIZA 3AWEA 4MX7A 3TBVA 2L7JA 3MRIB 1HEZA 4Y2LA 4LLVB 2VL4A 3U9UB 2Q87A 1J8HD 4LBEB 1W0WA 3L3OB 3BAEH 3WFDH 3OKLB 4M8RA 2CD0A 3SBWC 2EUZA 4FGMA 4IJ3C 3QHFL 3HLAA 1KDJA 4RRPA 5C0DB 3QUKB 1WT5C 1FNFA 4X99B 1NKOA 2AEPH 4AL8H 3QC6X 3FB7B 4FNSA 1PNCA 4KX7A 1O5DT 1SVCP 1I7RB 1IU1A 2J88H 1G7LB 3RTQB 4RSVA 3VM7A 4X6CB 1OHQA 3M45A 4U1LA 2VQ1A 1OY3B 1UB5A 3IDNA 4GKSB 5BMFL 1Q9KA 1D7FA 2J73A 3DRTB 2X0WA 4K8RD 2GI0A 4LB8A 3DXAE 4F57L 2D4FA 4LGPB 1VFUA 1T5KA 1UG9A 1RHHA 2IAMB 4O2CA 4J3OF 4H0IA 3T09A 5GZNC 1OKEA 1EFXB 4K55A 2VLRE 4K8RL 1C5BL 5HHQA 1PEWA 3D18A 2Y6SC 2IAMD 3Q5TA 4OZHA 3BUBA 3PAYA 1IJNA 3TBBA 3HZVB 4WWKD 2YPLA 5DI8B 3VGHA 3OQRA 5CF3A 1L6ZA 4RRPG 4IIQA 4NZJA 2E86A 4QNPE 2R69L 4QHUB 1RUAH 2CUAA 1MFUA 3F7YB 3U1PA 2DW5A 1QFWI 4MA8H 2MEJB 4XX1E 5I19H 1S3KH 4R7XA 1CFQA 2AGJH 2NPLX 3BDYL 1T04B 3ESUF 2VQUA 1G1CA 3IB4A 4HIJA 4P57A 4ZT1A 5IB3A 5F8RC 1IBBA 4Z95L 4UQBA 5FGCE 3TIEA 1YMHB 3L3DB 3QCVL 1AHWC 1MCCA 2DQDH 4PLJC 2CO7B 1EV2E 2ZCZA 3DV6A 1QHQA 3VD1A 4ZO8A 5CEZD 1LO3L 1E8YA 3IDYB 2R2BA 2BNQE 4KDWA 4CVXA 4D8OA 5D9SB 1W0VB 2FIRT 1F5WA 3O41A 1SLVA 2ARJA 1IBGL 4PY7B 1KGXA 3ARDB 3PG2A 3IFNH 5E8PA 1MFEL 4IKKA 3UBFA 4DZ8A 4O4YH 3BEVB 3IJSA 3DURA 3NT0A 1MFDL 4NENA 1TTRA 4PB9L 4X4MA 1PKQB 1QLFA 5F1IA 4JK0D 1XBDA 3SOTA 4P4RB 4ALAC 3T8VA 5JUEL 2J20A 1IBZA 5AW9B 3UP6A 2XKSA 1OSPL 1D2PA 1MCKA 3DX6A 1WBYA 1JCKA 2ZE0A 4JGNA 3QIUD 2C3GA 2LVCA 3BO8B 1K6QH 2OR8A 1DQQA 1P4LA 4QRPA 1EXUA 3ZE1F 4TNEA 4PJAF 4WHDA 3RY4A 5KTEH 2BZCA 4LSPL 3RZWA 1NCGA 3T8XB 3SDCA 3VGEA 4KRPC 2Z8WC 3TO2B 4X7DC 3V6ZB 1TCMA 4PTTA 4L3CB 7PAZA 5FB8A 1S5IH 2DQTL 5ERWB 1TETH 2BIIA 3EJZC 4UANA 4JY4A 1UWGL 3DPBA 3HMXH 1N0XH 4AH2B 5MEPA 3KBPA 3L8QA 3O3UN 3UC0L 5FDWB 3V95A 3VWJC 4I9WE 2YXVA 1CYGA 3CVIH 1ZLWH 5HYJE 4FNLH 1FCCA 2IOIA 5T3ZE 1FG2B 1XF4B 2BP3A 2X2YA 2DQGH 4G9FA 3C8KA 1XIWD 3LKRA 2I60H 1GC1C 3MV8B 5KSBF 3BIKB 4RGNB 5F7BA 2O4EA 3DOHA 5BOZG 4PRHA 2V3DA 3MV8D 5B3NA 4RGND 2JJUA 3N41F 3K72B 3J7HA 4L37A 1WSST 3TFKC 5E6RB 3GO1L 1BM3H 1WFUA 4U3XA 3S3BB 4JKPL 4D0BA 2V37A 4AITA 4CA4A 4GSQA 1YN6A 3G5XB 4MJHA 1DN2A 3GMMA 5C0EB 3LEYL 1IZKA 3NRPA 4QOKE 4YR6B 1AGEA 1GPOH 4IBTA 4ZW7A 5CXPA 4Q9RH 5J3HC 1U42A 2X9ZA 3H3PL 4Q52A 2ALAA 4UV7L 3FU3A 3GSUA 2DM3A 1SEBA 3ABGA 1HZLA 3OJMB 1WHOA 3MLXL 4KZCA 2JJSA 4IOSD 4OI7A 3QHTC 3UTTA 2WTOA 2XTJE 3OGOE 3SOBL 2AKRB 1BQHB 2JB5H 3L3OC 4OQ1A 5FCUL 3SPIA 2LAGB 5B7EA 3LRLA 5LNDA 4AJVA 1U2YA 1MAJA 2DMBA 2BIOA 2C3HA 5IROD 4WSGA 5T3XH 4KUCD 4XN1A 2HKFH 1WAAF 1I7UA 4PS8A 2A6DA 3ARFB 1FNAA 2JCCE 3RTQC 3HCVB 4QJ3B 1WZ1L 2A4ZA 3PNWA 1KIQB 4ZFGH 3FSVA 2APBA 4K8RC 2AXGA 1A66A 1NMBH 5T1KD 4XNQB 4LSDA 2CA3A 1CFTB 2VXQA 4R7DA 2AQPA 3BWZA 4AGNA 1FGVL 1ILUA 2BFVL 4I7ZC 1I1AA 4JO3L 2IAMC 1BIIB 4NXSA 4H88H 3WKPA 4AC2A 4WKZB 5FK9A 1QR1B 2E75C 4IS6A 1YEJL 1WTLA 4KX8A 2C7UB 3L9YA 5D7SH 3WFCH 3TPKA 3Q0HA 5DEFA 3QEQD 2BNRD 2CHNA 5IFHH 1MCDA 1IAOA 4X83A 4G7RB 4LFHG 2VM3A 4DO4A 2O61B 1R3JA 1QYGH 4MJIE 4XHQA 3RGVB 1FVDA 2E7CA 3BW9B 2HTLC 4BH7A 4U6YA 2FT7A 2UWEA 1TNMA 6FABL 4HUUB 2CDGB 1TCRA 1TQTA 5BRQA 3ECUA 4F7TA 1AQKH 1I9JL 3F6IA 1A4JB 2ZUQB 2ZF8A 2X12A 4GBXB 2IANA 4KMQA 1K2DA 3AWGA 3BT0A 4I5BA 3QYCA 4ZYKB 2OMNA 4NFDA 4IOIB 2FL5A 3U0PB 1KN4L 4AXWB 1G4RA 3WIHA 3N0PB 4XT1C 2OR9L 4KKQA 3GSRB 5C6TH 2BVOB 3E6FB 2DIBA 3IDYC 2IAAC 4DP2X 1IMHC 4CN4A 1BZ8A 2AV7A 1T89A 1QNZH 2EE2A 1OP3K 3RPKA 1UJTA 3U2IA 4YDJA 3ARDC 4ZQKA 2QQNL 3AT8A 4ONOA 2KKQA 3IJ7A 5KVDH 4XP9H 1CFNB 1M05A 4ONHB 3MV7A 1DYZA 4BE6A 5IT2L 1A3ZA 1TFHA 4Y16D 3D25B 4GG6F 1TSHA 3FU7A 4GAGH 3MLRH 3FFCA 4BQBA 1ZLUH 4TUUA 1T22A 4XNDA 2GIMA 3QAQA 4FFZL 4UT9A 2FX9H 5JW5B 1NM4A 3OHMB 2XV3A 1L7TL 4I88A 4KHXL 5I1LA 4OGXL 3LNFA 2BSRA 3L4UA 5HJGA 1LE5A 1CLYH 1JL8A 5I1HH 5KYYB 2VH5L 5KWYC 1LO0L 1MHCA 3GLDA 5CLXA 5C0RH 5B7FA 3EFDL 4XCYA 4U1JA 3FQNB 4M4RA 5DGRA 4KZEH 3BH8B 4MSWB 1FIGH 2VRAA 2NYYD 2P28B 2YA2A 4EUPA 3T0XA 4NQDE 5IBTH 1O6TA 4DZBB 3GSQA 1YN7A 1LD9B 1FV1A 3RB7A 2H2SD 3S97C 3TURA 3KBFA 3FT2A 4HJIA 2A2QT 4U1IA 2Y1VA 2CR6A 5I6KA 1EO5A 2FIKB 1ORSA 1XF5A 1RIUL 2PCFB 2VLJA 2WLZA 3GS0A 3L4XA 4P5RA 4X9YA 1JZ3A 1K5WA 2XICA 4YXKL 1GOFA 3LRSB 5ALBH 2X70B 4PGCB 3DGGB 1LE9B 1IQWH 1LXMA 3NA4A 1MG3C 4Z7OF 3QXDB 4TQPA 2D9CA 5EU7C 1G43A 4ADGA 4ZMTA 1OD7A 3OXRA 2VR5A 1FO0B 35C8H 4IRZA 4DW2L 2BIHA 4S0HA 2VDNL 2A74A 1AG0A 4UTAL 4OLYH 1GW6A 4RBPK 4RGNC 5FW6A 3G6JA 4P4KB 3MA7A 2D7TH 4N2AA 1BMGA 2X87A 4KKRA 2R9HD 1IJ9A 5F89B 4EUPG 1J0KA 2IBZY 4NX0A 1FO0L 4N3TA 3AITA 1MIEL 3UOAB 4QHNA 2Q8BL 5BXFA 2YC1A 3UX9B 2DEWX 5SWZB 1BW8A 2DYSB 43CAB 3CZEA 4F92B 2HRGA 2BOLA 1J5DA 3O3EA 4N68A 4DGIL 4NRXA 3ROLB 5D70H 1D9KB 4R8WH 2W59A 1MI5E 3DGDA 1FCGA 1IFHL 3BYYA 5C2UB 4CL7A 4JFYB 3K0YA 3EYUL 5IEHA 1D9KD 1V3LA 2DQUH 1UA6H 5IQNA 5JORA 3X13B 4MNQB 2WLLA 5CILL 3S7GA 4AQ1B 4YXLH 5C0BB 5T33H 3MNWA 4Q6IB 2ZPKL 1J9QA 4HZAA 4M48H 5C0BD 2YLKA 4MKMA 4C4KT 3V7AE 2KYIA 2CRZA 3V6FB 3DIVA 5KS9A 3QJFB 1REIA 4JPIA 4MS6A 1RUPH 4NQXA 4RWYL 3GPEA 3O8XB 1WGVA 3QRGH 4G43B 3WNLA 4HJGA 2YUVA 2H41A 4O2FA 5IHLB 2P7TB 2YAOA 1CD0A 2AJUL 3ARFC 3D4ZA 2A4EA 3O8XD 4UNIA 2BVUA 1NGPH 3C9NB 4JFXA 4WEBL 5LXGH 1Z5LA 1SJVA 5GHWL 3FRPB 4NYLB 5C6PB 2NNXA 2OSLA 3NTCL 1R19A 4OKVA 1HXKA 4YC2B 2BOBA 1I85A 1GH7A 1FLRL 3DARA 4XPAH 5D6CB 3T6QC 4L4VB 3H9HB 3ZT7A 2ED7A 2YXFA 5JPNB 4IU2A 4X4YB 2EDXA 5IW6B 5ABDE 3OPZL 4AWJC 4L4VD 5DVNA 3UTSB 2ODHA 1UM4H 2IADB 2WBJB 3BWUC 2EIJB 4JKKA 4W9GC 4Y5XA 3VRJB 5DTFB 4ZMAT 3SSGA 4QXVA 1ZLVK 3RGVC 4PJXF 3OAUL 5LCVA 3UTSD 1UZGA 3WSQH 4MB5A 1CVRA 4BFRA 3H6JA 5FYJU 5HHVH 1AQMA 5DCCA 4NZTL 4PJGA 2JNZA 2OMUB 3X11A 1KB3A 3BOVA 3MBED 1R3KB 2R1YA 4OD3L 5DYFA 4EQ2A 1JMXA 1RU9H 4NZFA 2ZUQC 3Q3GA 4GBXC 3DRQB 2AMUA 3MRCA 2YD7A 2BHZA 4MJ5B 4F80A 1WBXB 3HHSA 1TJGL 5KYUB 1I1YA 3MRRB 1OAUL 2ADJA 3QO1B 4FZ8L 1HHIB 2IXQB 4XCEB 1KPUB 2J8UF 2XQBH 3OB8A 5HDRA 3BKYH 3B9KB 1FZKB 1AQ8A 2H32A 2KZ1B 5FAAA 2J25A 2VOTA 2VLKA 1TVHB 3GUTA 3BEWB 4TLUA 3T1FA 2B2XL 2PCPB 4QTIL 9CGTA 5FO9B 5JW3H 1B2WL 1IEAA 4AC4A 3QCUH 1L9NA 4D8PB 1T4KB 4CC4A 4K07A 1FNSL 4NB7A 1NFDE 1GGTA 3UDWA 3VW3H 3KWUA 1S7QB 4A2GA 2NSMA 3V9CA 3UC2A 1DDTA 2XVKA 4MYWB 1LP9E 3O4LE 4H26B 5CIPA 3RIAF 3O4OB 3L17A 3FDWA 4GMTH 1D7DA 2OP4L 4GIPD 3SDDA 2PYED 3H0TB 2NYYC 4PP1D 2VERA 3N1FC 3L3JA 3LKNA 2AERT 2KZKA 4I2XE 4J1UA 1DJGA 4JQIH 4KJPD 4AM0B 5CCKH 2YLHA 2LAAA 4WJG3 4Z3GA 3WY2A 1R46A 4N87A 4HHAB 1RIVL 2P52A 4K7PH 1T21B 1CS6A 2Y1AA 3U36A 5C8JB 2R2EB 5JR1L 2X6CA 1SQ2N 5H35B 4Q2ZB 4ZUUB 3FTYA 1JF1B 1VDGA 1WWAX 3CXFA 5E6ID 4HWBA 1T20B 3V0WL 4MCNA 1HAUA 3ZYJA 4X8CA 3HZMA 3TH3T 2FWUA 1MCPH 3ZYZA 1NAMH 3APMA 4IQHA 3VWKA 4ABVA 2VRKA 3B3IA 3HUJF 3MDJA 2ZCKL 4P3CL 3SE3A 4BKSC 4ZTPL 4BH8B 1BJ1J 3LKOB 4PIRF 5C0GA 5KJRH 5JIMA 2CGRL 1PIFA 2CO2A 3O3AB 1T4WA 3C87A 2R9HC 3NEOA 2NY6B 4PRBA 4P4KC 2EEFA 2J1YA 1G6RB 1WBZA 1FZJB 3CZUB 3LB6D 1CDCA 4J2QA 2KLRA 5D1QD 4UM8A 1Z9PA 3ULVD 2NY6D 4M6AA 4RDBA 1AR1B 1CDIA 2Q3XA 4OGAD 3G04A 2L7EA 3IVKA 3OHXA 1AR1D 3JTSA 1XF3A 1SXBA 1D9KC 1U36A 2MKLC 4QF1A 4NT6B 3HFMH 5D72H 2BK8A 5L2KA 1NKRA 3TPUA 3PWNB 1QRNA 2D0GA 3JYCA 1JGUH 5D7KD 2Y72A 1G7QA 2OYPA 3R0MA 1U8KB 4A2MA 4XC1H 3CVCA 5HGAA 5FUZH 2AXHA 4AQ1C 4ZUTB 1KACB 4K94C 4JO4H 1NGXB 4Q6IC 8FABA 2DQEH 5DHYA 4ZMQA 3FF7A 2A9NL 2BVPA 3STLA 1T1ZB 4WI8A 4XMKL 1QFUH 1RK0B 4X8JB 3TJEL 1CLOH 1S7TB 1OAYL 4D7BA 5FM8A 1CZ8L 1T83A 4MMZA 3MLTA 5C0ND 5L0QB 3KM1A 4NCDA 4XODA 3O8XC 4NQEE 3VFUA 1BVLA 3T3PB 2XXMB 3W2DH 3Q06A 3E7JA 2H0PA 3TT1L 2OKMA 1O7DC 3Q1SL 4P9MH 3ZIMA 2ITFA 2PPEA 4Z0XA 5INCB 4X8GA 2IFGA 4IU3B 3BMWA 3LHPH 1ET7A 3D8MA 4MDRA 3DMMB 3E9UA 2YFNA 4YC2C 2QSCH 4MLIA 1KEML 4ZSOB 5F9OH 4Y8DC 5C0AD 2NT0A 5F7LB 1ACYH 3ZE1B 3RTLA 1CGWA 3M07A 2D2OA 5D2LF 4LCYA 5JPNC 4PJHE 3REVB 1F2XK 1QABA 3FO2A 3DVNB 4NO5A 1YRKA 1W16A 2H47C 4QXGH 2WBJC 1YEFL 3UGEA 4FG2A 4PV9A 4G6JL 5E8EA 2AEQH 4C4KO 4Y4HB 4BIKA 1GIGH 2CIKB 4OCNC 1U0QA 1EERB 3KDMA 1EZVY 2H6PA 3MRPB 4TOYL 5E0FA 4Y4HD 2CO4A 4YH6A 4ZPVA 5I6XB 3FT4A 3S48A 5A2CA 1K8DA 5I76A 3QEHB 4WAFA 2CQVA 5ITBH 1NMAH 4BK4A 2KQMA 3BLPX 2C3WA 2P5PA 2ZUYA 1RJLA 4IKIA 2AXJA 4GO8A 4RMBA 5F7HA 5HGDA 2A9DA 3QUHA 1AZUA 3AG1B 3QIWA 4WLCA 4X9GA 3PWPB 2IDUA 4HWEL 4PSRA 5IB4B 3ZO9A 2AQNA 1HQ4B 2NY1D 3EOTH 3PNRB 3F7QA 2PR9A 2NSXA 2P8PA 1EEUA 4K3JL 1KPRB 3KVQA 4ZFOB 3N41B 4L9LB 3LMJL 1S7RB 3C6LA 3B9KC 2FBOJ 4X4XA 2HKHH 2WIMA 2NW2A 1H9VA 2DQHH 4M7LH 5JIHA 1LEGA 1I7TB 3WNKA 3ZMNA 5JOFB 5J11B 2VDMH 3UPCA 3ARVA 3S37H 5DZPA 3QXUA 1OP5K 1BZDA 3JWNG 4KRMB 3NYKA 4LLYA 3U0WL 1XCQB 4DP4X 3HJEA 5I1IH 3TCXA 5C9KA 2PP7A 5A16B 4R90L 2IH3A 4QRRB 1PPIA 1SJHA 4ZO9A 5KG9A 1NEUA 5D6DA 2V8LA 1I8MA 1I9RL 2A9MH 3DVGB 1AGFA 3QQ9D 4PP1C 4MDJB 4ZW3A 3JTTB 4MZ2A 3O4OC 1NCAH 3O2WH 1G0XA 2P8MB 3AU1B 4LVEA 2GEEA 3VQ2C 5CZKA 3ET9F 4DK6A 3Q6GH 3H9SA 1G7JB 4OIIH 1JGIA 1ZHBA 4N0CD 4DCQB 2H5UA 5F3BB 3GRBA 3GJEB 1R24A 1I9IL 4HC1H 3I9GL 4U1HA 5C97A 1TNNA 3C2AL 1MHPL 4HOZA 2EIBA 1BD2E 1PKOA 1A7QH 3CFKB 4GQ9H 1JDCA 2CCLA 1JV2A 4ODVH 2IV9A 3KH4A 1QP1A 3C5SB 4ZDHA 4Q9QH 4G2AA 3X3GL 4NNYA 1JZ7A 1X5XA 1QEWB 4QTHA 2DIAA 2JQAA 2HT4D 2XXCB 3GEWB 4BBWA 2G5UA 3MC0A 4XOBA 1KCBA 3O45A 4PJ5B 3DHJA 4X5PA 4MB3A 2NY6C 1R9FA 4A2DA 5FA3B 4N22A 4JL1A 1C08A 3IS0X 4XP5L 2C3VA 3P0YH 4QDGA 1TVBB 1AR1C 2YBRA 3KPSB 1QHOA 1WG3A 1XGYL 1LL1A 2ROYA 4HUNB 5EZOH 1IM3B 4PGBA 3SKMA 4B6ZA 1EBPA 4WY7H 4NC0B 4F58L 4YUEH 5HDLA 1A9EB 4Z5RA 1TQUA 3GB7B 2X44D 4B9GA 1MNUH 3W9DA 1HFUA 2X4PB 4PJ7F 4Q7DA 3ZO0A 1FYTA 4HIXL 1EEYA 2MQ0A 3OMZA 3UG3A 1Z9SB 3C12A 2EXSA 4QPEA 5IVNA 4XXDB 1MFBL 2ZYHA 3F58H 1AR2A 3GSXB 2DQ6A 4B5ZA 2R39A 3SCMB 3VRLF 1MFVA 1UUNA 4AQEB 2WIIB 3O3DA 3PF2A 1ZGLA 3WGUB 3W11C 5C0NC 2WBXA 3N40P 4DVRH 2CBMA 1DL7H 1WFTA 2QDVA 3DKHA 1AH1A 4NP4L 5L0QC 1VRSA 1JYXA 4LCWE 4J3OG 4OCWL 3SDYH 1V05A 1DLFL 3FQRA 3AQZA 3LXUX 5GS1A 3CQPA 2BRRL 2FO4A 1CGYA 1T2XA 4JO2H 5I82A 4A67A 4GG6B 1LDSA 1JGEB 2GHWB 1MCLA 5I17A 4J4PD 5CD3A 1ZS8A 1XH0A 2Z4TA 3KNBA 4MMXB 4LDCA 4N24A 3BXNA 5JIPA 4PUBL 1EDHA 1SHXA 1EGJL 1P6AB 3IFLL 3N43B 3DMMC 4I2XA 5AD0A 2ZNWA 2UUDK 4BFFA 4G83A 2X7LB 3OG6B 4XPBL 3ABMB 2YZ8A 2WJ5A 3WMQA 1QKZL 1JZJA 3Q48A 4OI8A 3I02A 3S35H 1X5IA 3TIDA 5I0VA 4LARH 4XVTH 3T0VA 1A7BA 4KI1A 2PO6B 1IVTA 4YFEA 3MNZA 3DYMA 4QXUH 3T4AA 2IV8A 2Y7QB 2Y25A 4BK5A 2DTMH 3RKDC 3V4VH 2B1OA 4G6FB 4Q6KA 3BAEL 3WFDL 1HSAB 1DBMH 4QGYA 2B7DT 2G5BA 2GSIB 3FCTA 3EJUA 1JNHA 4M7ZB 4W93A 4DAGH 2WNKA 5DWUH 3S3DB 4G6FD 3DTXB 4Y4HC 2AEPL 4AL8L 4DWHA 3WE1A 1SDDB 4PJAA 2YUWA 4LLDB 5FM5M 2J88L 4NKOB 1J8RA 5I6XC 1KEGH 5DJZB 5J9PA 1NGYA 4JDVA 3DX7B 3QR1A 5EBMA 3CIAA 1UACH 4D9QE 1PY4A 4JQVC 2UZYB 2CALA 1ODUA 5DZLA 1A6PA 3CUPB 4GOSA 4Z7UF 2MQGA 1EAPB 4FTVE 1PY9A 1Z32X 5JXAH 3IFOA 2WLNA 2VAJA 4ZO6A 4A7GF 4G8IB 4UTBA 1WFOA 3N0AA 1JG9A 2ETWA 3DROB 3EYQD 1KB5B 1KBWA 1ZSHA 2IH1B 4LHUB 5ISZA 1I8IA 5BZWB 2YRLA 4N0UA 4L9LC 2AQ3A 2V3EA 4ONGH 5JNYB 3AG4B 4QGTA 3CZFB 5EEZA 2CDFB 4Q0XH 4GO9A 1WZKA 2ESVE 5KSBA 5J11C 3V79C 1ED3A 1HXMA 1KB5L 1KXVA 4Y5YB 4U05A 4E36A 2Y2WA 1RUAL 5I5MA 3CSBA 5DZVA 1NCBH 3VXSA 1OZUA 4HHGA 4BFNA 3ZGHA 1B6DA 1S3KL 3F7PC 3QQ9C 2AGJL 4H8VA 5L9DH 4G8FB 3ZDYF 4WCYL 5J1AB 3K6OA 4FNQA 3CFEB 5D5ME 5IVZB 2PABA 1YUHB 2HMIC 3F7KA 2WGXA 2O1AA 3UJTL 2DQDL 2EC8A 4PB0H 4W9KC 1JBJA 2V2XB 2WZAA 1HH6A 4JFHD 1S7UB 4BWTA 2WXIA 3H9ZA 1MCJA 4N0CC 4NKMA 4AYBA 4Z7WF 4JFFB 4H8UA 1JWUA 4KUCF 4L3EA 4NN6B 1TIUA 3MJGX 5AVQB 4UNTA 3ZQXA 3IFNL 4N2NA 2IPTH 3AS3A 5KVFH 3GNMH 1RCYA 2H3NA 2VZTA 3N2JA 3SE4C 1OW0C 3ULUF 1HH9B 3BIBX 4CVZB 1SM3H 4WUUA 4JDZB 4PJFA 4QO1A 3REWB 3RIAK 4N28A 1AGBA 1QX1A 5EEUA 4QXTB 5LBSA 2NNAA 4L5FH 2NQDA 2CO3A 3W5NA 4L4TD 3P77A 2HT4C 1WFIA 1ETZB 3CVHH 1ETA1 4BFOA 4FQXB 1OK0A 1M7DA 4JRXE 4PJBF 3ZKQD 3U4BH 4Z77A 4U1KB 1N10A 1UXWA 4J27A 4OFIA 4FQXD 3VI3B 3T0ED 2BVQA 2VDRH 1NCUA 1OGTA 1UD8A 1CC3A 2IGFH 5JIQA 1XB6A 3F5WB 5KTEL 5KYWA 5KUKA 1B0GB 2RJMA 1AO7B 1X4YA 3ZKMC 1SOQA 3I75A 5DK0A 3KPNB 4Z7VE 1S5IL 3QEUB 1AO7D 1TQBB 1TETL 3L3KB 4YBQC 1AJ7H 2EABA 5AKTA 3L3HA 5EV7A 1L6PA 3Q9PA 3HMXL 1N0XL 3TESA 3B7UX 2WY3B 4Q9CA 1UCTA 2DMHA 1D5RA 1F4AA 1ES0A 3WNIA 1BJMA 4A38A 2E7LA 3Q1EA 4LL1A 1F56A 4KVCH 3MGOB 2YHGA 5I1JH 3QZPA 1LO5A 4LDLB 1S3RA 3SCMC 2DQGL 3WLBA 3WJJC 4BZ1A 3QARA 5ENWA 2I60L 1AANA 3T9WA 1RQ5A 5I1JL 1RZKC 4HXBH 3BVUA 1WS8A 5DJDA 1NUGA 3TBYA 4PRPB 2A6IA 1OOWA 3L9RA 4JS7A 5F7WC 1OB1B 3HA0A 4J4PC 1J87A 3TZVB 4PRPD 2VR3A 1ROCA 2MQCA 4HIIA 2XN9A 5J6GA 1C9SA 3WLWC 1KYOJ 4PJ8B 4C47A 4Z3FA 3M46A 1KCRH 2YA1A 4MMXC 1DFBH 1KXHA 4HJTA 4YDVA 2CR3A 3ZSSA 3ME0B 3CK0H 5IMOA 5DMIH 1UT9A 1GPOL 2Y3AA 4NKDB 5DU7A 1YEGH 3QI9B 4Q9RL 2SEBB 4TF4A 5TDPA 2D3NA 4AKPA 4GKNA 4G6AD 1KV3A 3O2VH 1X7TA 3TTYA 4KK8D 3R4DA 4MQ7B 3FO0H 1JUFA 1H8LA 1HU8A 2IWGA 3ABLB 3HHRB 4FOMA 4AL8C 1P69B 2PO6C 2W07A 2HYMA 1IEBA 1AAJA 2JB5L 4IK7A 2O5NA 4B9ZA 4QR7A 2X38A 4M7ZC 2PXYB 3HC4L 4QRQB 5B4MC 1K4CA 3T77A 3NZHH 3N40F 4UT6A 5HP5A 3HAEA 2PXYD 2NNFA 4JPWH 4PD4J 2R7EA 5T1LB 4GFXA 2BSEA 1PX3A 4GRWH 6CGTA 3GQFA 4LHQB 1NMBL 3HUJB 2GQHA 5T1LD 2VL5A 1SMDA 1DSWA 4MCZB 5K9KA 5DUMH 2C34A 2A6KB 2GTWA 4FNPA 1N5AB 4KQ4H 3FPYA 3CHRA 3WYRA 1T0NB 4GEJA 5F7DB 3SKOA 4H88L 3R06A 5DRXB 3EKCA 4EE2A 3NOIA 5D7SL 3G3LA 3WFCL 5I1EH 5DJ8A 3QB7C 2H8PB 4YSCA 1E8XA 3RIFK 5F7KC 2HH0H 5IFHL 1YMME 3ZX1A 3CHQA 1OGAA 2W0PA 2ZKXA 3RDTB 3F8UB 1FRGH 3JWDL 2K6YA 1QYGL 3FCSA 5EOTB 4BQ6A 4Y5YC 3RDTD 3HAEG 4CW1B 1AYOA 5CLTA 1UENA 1KLUA 2BY3A 4AZ8B 3GMQA 3ZDZE 4HW6A 3DIFA 5T1JA 3DDGA 1TZ8A 2F54E 1AQKL 4APQB 4AMKL 5DYOA 2OX5B 2G30A 2JQZA 5F7UA 4FTDA 3FQTB 4LSUH 2B08A 5GGTA 1N64H 3IETA 4U4BA 4ZFQA 2CIIA 1EZLA 1PFOA 3PYCA 4XPGH 3FB5A 5CCHE 5C6TL 1LO4H 1R75A 4HKZB 3MLYH 3VFPB 1J9CT 1EUUA 1QNZL 5FECB 4E41A 3ATBA 5J6HA 5FLUA 1KBGH 4NBYB 3MRQA 3FQXB 4NN6C 1B0WA 5DMKB 1JZEA 1J8SA 4XMXA 3KYOA 2ZYIA 5D1XD 1L3NA 4JPKH 1AOZA 4ZXBB 4X0KB 1ID2A 4NSKB 3IXAA 5KVDL 4QY8A 1UXSA 4XP9L 3S3CB 3TONA 4ZOBA 1XGPB 3WTSA 1MDAA 3ZDXF 3UJJL 2DLFH 2COVD 4GAGL 1N26A 3CQFA 3VD7A 4X8XA 4DFIA 4OFQA 5H37H 4HIEB 3ZT5A 1C5CH 2FX9L 3D3VB 4FQXC 3G6AA 5AOIA 5F1NA 4BFJA 4ODBD 2OK0H 1AZRA 1QRKA 4HUWA 1DDHA 4J3XA 4JFSA 1CLYL 1VZHA 2WB1A 3GJFB 3D3VD 2YXWA 1X9RA 3MR9B 2K7QA 1MWAH 4GAYB 3ZPDA 1MJUL 1FC2D 4KZEL 2YQBA 4N20A 3KWWB 1FIGL 1YNTF 4BKLB 2V4LA 1QZNA 1T66C 5ETUA 3RFRA 4X6CE 4ZOAA 3IGUA 4ANXA 3HPLA 1KIUB 4LSRH 1TQBC 3QO0A 2N4IA 3NRFA 4MKTA 3MO1A 4GI8A 4DKAA 1JJUA 1A22B 1Z9LA 2KT6A 4OBRA 5DURB 1V3JA 4ZW8A 3LNHA 4X5XB 4YHZL 3BT2H 4PJXA 5ALBL 2FX8H 3EJPA 3O6ML 1DVYA 2ZUXA 3FSWA 5DURD 2R23A 3QORA 5SX4I 4W68A 4PJ9B 2OCCB 3DHPA 4R7NB 3MRLB 35C8L 5BVPL 2VMDA 4PJ9D 3QNZB 5E1GA 5IMLA 1U8NB 4OLYL 1I4FA 4UOW1 2ATPB 1M9SA 2D7TL 2NX5B 4NO0B 5JW4N 3B3BA 5I0DA 3KS0H 3VB9A 5JYMA 2XIBA 4RNRB 3TZVC 5FS5A 4B9PA 4W4NA 3PXJA 1U8CB 4FQHB 2ENPA 2G9KA 5EO0A 2DI9A 3O2DH 2J8UA 1H0DB 3PP3H 4NM4H 4MDIB 5HGGS 4PJ8C 5E51A 4F7EA 4R8WL 5HPMB 4OT1H 3EYFB 3GXDA 4JN2A 3TO4B 5I16A 1L6XA 1XZ0A 4G6AC 5JQ6H 3QI9C 5FKAB 5J5EA 4R7VA 3TF7C 4J2XA 2DQUL 3Q8FA 3PHSA 5IOKA 3TEZA 3D69A 5BRZA 1L9MA 2Q1EA 2UXTA 2APWA 5DVKA 1FNLA 3VFWA 4YXLL 1T1XA 3T71A 5T33L 5ID0B 3MI6A 4IBYA 2XWEA 2ICEB 2YS4A 4UYQA 1MY7A 1N6VA 2FJFB 1CDHA 3V5KA 2WVTA 3PIQA 3ARPA 4IBUA 2OMTA 3SBQA 1QWNA 3KYNB 2X4QA 4UIMA 3VFMA 2PXYC 1CIDA 1RUPL 2F53B 2IPUK 5F0JB 3VFVB 1HZHH 1PZSA 1A9VA 1GOHA 1NBVH 3QRGL 5C0FA 1U3HB 2XA8H 3LH8A 3RJOA 2X89A 5AG8A 2MPAH 1LEKA 1MREH 1IIIA 2WMPB 2VDQB 2WWKT 4WENB 4D0CA 1L5GA 1WE5A 1NGPL 1IZJA 5IMMA 1BWMA 5LXGL 1KTLB 4ECNA 2DYPA 3T65A 1UKQA 3RY6A 2ZX8A 3S5LG 3A3YB 3M8OH 5HHNA 5I66A 4BQ9A 1MJJB 1WIOA 2JKNA 5T8IA 1AP2A 3KWVA 4WDIA 5DC2A 2V6HA 5CO1A 2I07A 3JWDC 2VDQL 5DR5H 4FABH 1JHTA 4XPAL 5I1AB 4JFDB 1EHXA 3ULVF 2YXMA 4G1MA 3U46B 2Z0BA 3LIZA 3UTOA 5F88B 3IAPA 3QDME 3C5XA 1NC2A 1L9TA 2J56A 2ZUWA 3JUYA 4HAKA 4L8BA 2VITA 1UATA 5J56B 1UM4L 2MRYA 3A0OA 1KCUL 3IU4H 3RDTC 4MA3A 4MD5A 1YDPA 3HZYA 5E70A 5IG7B 4ADIA 2G4EA 4U3CA 3GMNA 4A7QA 5ECGA 4I48A 5HHVL 4BZ2H 4PJ7B 4L29B 5EU7E 2GW5A 1CBJA 4N90E 4AT6A 1TZHA 2E6PA 3SPVB 1O7SA 3B5GA 1RU9L 4APQC 1T5XB 2EIMB 4IGBB 4RWHA 1JGDA 5T3ZH 5AUMB 1M2VA 2MWCA 4IW4C 2Z92A 1KXTA 3QWRD 4M03A 2CK2A 3QPKA 2ATAA 5KSVA 5GS0H 5FF6A 1CL7I 1T2QH 1V5JA 5EC2B 1A1OA 1VJSA 3NFSH 4G5AA 4K3GA 4X7TB 4K5NA 2FSEB 1W72B 4NPYB 3F65A 2WUCL 2XQBL 5EDSA 2F2HA 4P46B 4QRUA 2PPCA 5JMRA 3BKYL 1OXYA 1BM7A 5EBGA 4BFBD 3KPQA 3UTZB 3NIGB 3SIKA 1EPFA 3QWOA 4B7IA 3DV4B 1A21A 4JANB 3SYOA 4AQZA 4XVJH 2GK0A 2VDOH 5LGHH 4ZXBC 4AVIA 1XEUA 3QZWG 3GDBA 5DC4B 2EUXA 3QCUL 1W72L 1WA1X 5EEWA 2XQ0A 4JM0A 3H56A 4ZFZA 1ZJBA 2FJSA 4PMFA 5EO9A 3VW3L 3FT1A 2CHDA 4GKOA 5IMKB 2FE0A 2NUTB 3GXUB 4XNAA 5CR1A 5L8JB 4ZPTB 4BDVB 3OLIA 1RPUA 3VXPA 4GMTL 4X6BB 2OTPA 1U21A 4KXBA 1ZXQA 4TS6A 1EJ8A 2DLHA 4YSRA 4BQCA 1ZTXE 3EH2A 1E7UA 1DP0A 5CCKL 4HPOH 4JQIL 5AW2B 3WY1A 4Q89A 5AZUA 4UQ2A 5D2LA 4OVUA 3VFSA 4K7PL 3U6XS 1PCXA 1Y18B 5EU5B 2EYTB 1RSYA 2J55A 1M7XA 4Z7UB 4KNTA 3QXWA 4Z18A 2P48B 3TLRA 5BS0B 1MCPL 1CG9B 2MCMA 3DSNA 3UBXA 4Y9GA 4XMTA 2WINA 1INDH 1HHHB 2DLTA 1EANA 4PJ9C 4PY8J 4XWGH 4N26A 3WHE1 1PIGA 4K7FA 1F8TH 1XR8B 4JG0H 1UOWA 5KJRL 4GQZA 5DJYA 3VWJA 4XNBA 3RX5A 2GJZB 3CMOH 4Z7QB 3LXCA 1CR9H 3K91A 3OMAB 2FUQA 4HD9A 4PHXA 4I18B 4WO0A 4MBRA 3DX4A 3FOLA 3HE6B 4QXWA 4RX4D 5A2KH 2V3FA 5FO8B 4JO1H 5IUSA 5B8CB 3HE6D 3EJSA 4YHNA 5F7YC 4PLNC 1SHWA 2G9HA 2DLGA 3HFML 3TO4C 3ZDYB 5D72L 2XJKA 4Y2OA 2UY6A 2Q86B 4AEEA 3CE1A 2LT9A 2X4SA 2HLFD 5DHVB 2BC4B 3LZQA 3UBXG 3U4KA 4NZUH 5E8NB 1WRFA 1JWSA 3LS4H 2FQEA 3ZZQA 5FUZL 5EUKB 4Y4KB 5HVFB 4JO4L 2ICEC 3RI5F 4YDKH 2DQEL 4Z7WB 2AEWA 1P9MC 3NSFA 3KYKH 1CDUA 2JFCA 3SDXA 1N59A 1QFUL 2YAQA 1CLOL 3BWAA 1FVCA 3FXIC 3LZRA 4G8GD 1J8HA 4YHLH 5G4MA 3WEXB 4HEMA 4W9HC 3AB0B 1HI6B 3MRIA 4FCAA 5MENB 4A1RA 4LLVA 3DETC 3HC3L 3IMSA 5BNXD 5DS1A 1U3HC 4EKJA 3KE0A 5JQIB 5MEND 3OKLA 3W2DL 4P5TA 3ZZLA 4F9LC 4P9ML 1K4DB 1NOFA 4O02H 4XB8A 2DL9A 3ILQD 4M61B 1U41A 2QMJA 2E9BA 4IYKA 1S2EA 3FB7A 2DKUA 4L1BA 3LHPL 3I3BA 2VUYA 3BQUB 2WBWB 1H3XA 3QH3B 4GQQA 4H40A 1I7RA 4XBGA 3TVMB 3NIFE 4HUCA 1OAXH 2WOYA 2IQ9H 5DS8B 2QSCL 3BQUD 3TVMD 1ND0A 4OFDA 2ZAGA 1ACYL 3JUZA 4XBPA 1AHKA 2F7IA 3FOMB 4LASH 4AEHH 3L4VA 3FHEA 4Y2DB 4QXGL 5AVSB 3GHEH 4WFHD 4B9YA 2CU9A 4FXTA 2Q7NA 2E9WA 4WWKA 2AEQL 4LESA 2R69A 5IP4A 1PYWA 3HZVA 2N01B 5DI8A 4JDTH 1N8ZB 3P3YA 5ITBL 1NMAL 1ZAGA 2DMCA 4ZFFA 4XNUH 1OANA 4IGBC 4C4UA 2G3XA 4NCC2 5HJ3B 1EHLH 2GCYB 3AMLA 4WF7A 2WXKA 3PXLA 1BFOA 4XCFH 5K1NA 1T04A 3EOTL 5BZXA 4G82A 4LIQL 4XMVA 5SWZE 5LWYH 3CSFA 3MUGB 4P46C 4Z8FL 1Q4NX 4WFED 3RZCB 4YSQA 1W8EA 1XT5A 3LN4B 2HKHL 4FYTA 4NQSA 1OT2A 2DQHL 4M7LL 4OZFA 3QXAB 2VDML 2WGNB 3UEQA 3S37L 5H4ZA 4FNRA 1U95B 4WNQA 3G5ZA 5L2JB 3S2AA 4ZX5A 4Z3TA 5I1IL 4MNQE 5DEGA 2LE9A 5C0BE 2GITB 2P1YA 4PD4K 1GS7A 1JP5A 5EU6D 4MQXD 3S4SB 3BEVA 2A9ML 2ENSA 5AW7B 1M2OA 4GIAA 3VXME 5HHMD 2CXKA 1F00I 1NCAL 1PKQA 3O2WL 4M7KH 1ZT1B 4HG4K 4P4RA 3EGDB 4UT7H 1KZYA 5AZEL 3EO1B 1GOGA 2OTUA 3QIUA 1Q9WA 4UINH 4BZYA 2Z1KA 3BVTA 3ZT6A 1IM9D 5IV2A 5CAYB 3NP3A 1O7DE 2YD6A 1SF5A 4OIIL 1ESOA 1A6ZB 2HRPH 4GAJH 4OZFG 3DUHA 1MUJB 4P5SA 5CLYA 1DTUA 4HC1L 4JKNA 5T5FH 3D12B 3P4OB 3T2LA 2OMVB 2OZ4A 3Q8AA 2XN1A 4Y2NA 3TO2A 1CXEA 2LGNA 2PR4H 1C5DA 2EE6A 3DDFA 4X7SH 5TF1H 1HZKA 1A7QL 4L3CA 5E9DB 3VXUB 2YQGA 5DJCA 4E68A 3RY5A 4GQ9L 4ODVL 1KBBA 3CFMA 5LGKA 4L4VE 4OGZA 5E9DD 3HC0A 3UABA 1CIUA 3RWHB 3Q6FB 3S5YA 5A43C 1BYNA 1GHFH 1GGBL 2R2HB 3TCTA 3BQVA 5FKPA 3IGKA 4WI7A 5G2NA 2VXTH 2WO4A 2IPUG 4FKHA 5FDWA 4LLAA 2AITA 3TT3H 3FT3B 4A7VA 2GVYA 3FTZA 1XIWA 2KMWA 3ZTCC 2EO1A 1ADWA 3TNMA 3DO7B 2AQRA 1A3LH 4I18C 1KLGA 4LCCB 4UBDC 4E9TA 4I85A 4KO9A 3HE6C 3HRZA 3MV8A 4GUPB 5LBVA 4JFOB 5FDYA 4N2HA 3B7YA 4BUGA 2QVFB 3AAZB 5EZOL 4BUHA 4AW4A 5B8CC 1HILB 2R4SH 4HUVA 4WY7L 1JV5A 4JBSA 4YUEL 4PVBA 1J9RA 1DBJH 3IDXH 5GIRA 1MNUL 1S5HA 2AQ2A 3LPWA 4ATWA 3DX1A 2CLRB 3U4AA 1EEZB 4PW3A 4WU5B 4GW4A 3OG4B 4K3DH 1B0RB 3OKEA 4JPQA 3DO4A 4P2RD 2PTVA 3PWJB 3DI3B 2FJHA 4DGVH 4OVVA 4NC2B 3SKNA 2XWCA 4Y4KC 4YR6A 3SDXF 3VQ1C 1W6WA 3LQZB 5CWSA 1LK2B 1NCCL 4IOSA 1OWRM 4KV5E 1AS8A 2HVKB 4FKEA 2DQCH 5CLWA 3GBEA 4LZKA 1DL7L 1DN0B 3AB0C 4HLZH 1XH3B 1U3NA 2K8MA 3IE9A 4JHZA 1JK8A 3PUCA 2GUYA 3SDYL 3ULUC 3EH5B 5F9AC 5KEZA 1GAFH 2AKRA 1B4TA 4JO2L 3ZL2A 3ILQC 2OL3B 3QR2A 4CNIA 1U92A 3JBG7 2WHVA 2X4NA 4HSCX 5CJXC 1YPZB 3MJ6A 5CP7B 5IROA 4FQ1H 5GZOD 4N8VA 2ZWYA 4F33A 1U8LB 5E6SB 3IRCA 1E7VA 1W91A 2EYRA 2H2PC 2WSDA 2NMSA 3BQUC 4HS6A 3TVMC 3US9A 4UILH 1CT8A 5T1KA 4OB5L 4M4PA 4UU9B 3HCVA 4A68A 3K1KC 2OL3L 3OXSB 4UNVA 4X5WB 2R1XA 3IGFA 3KPPB 3JV0A 3S35L 1D6EB 1JZDC 4LARL 4XNQA 4XVTL 2OS7A 2WZ5A 4HGWB 5DZ9A 3UL4A 3RVVD 1YNTB 1JNNH 4O2EB 4QXUL 2PN5A 1CWVA 1MH5B 2DTML 4JFZH 3IJYB 2P49B 3QEQA 1OE2A 1UGKA 2BNRA 2YWYA 4KDVA 3PQYD 5DWUL 3ZIYA 1BXAA 2C7UA 2WUBH 1I8LC 3RPBA 5FX3A 4FXGA 1XF2A 2A6JA 1XBRA 1KEGL 1DUYB 2FECI 3EOYG 4ODXB 4N8VG 1UACL 1CJYA 3QFJD 4AVHA 1Y0LA 1A2YA 1A1MB 3AG2B 5HYSB 1VGKA 1CTOA 4HK3N 2GUOB 4OZ4B 2IIJA 2CDGA 5B38A 3SJVB 1PLGH 3ZHDA 4EAEA 4F2ME 3HMWH 3WAJA 1QSEA 1SFHA 3V8CA 3CX2A 5C7ZA 3NFPA 4DIXA 5I1KH 2GJRA 4ONGL 4MNGA 3JQOB 1URIA 3RZCC 4AXWA 2B1HH 1N3NA 3OLGA 5C7XH 3MROB 5C6WH 3GSRA 3K6FA 3LSOB 4Q0XL 1EHKB 3EIFA 4KU1A 5ESAB 3L7EA 2EDFA 3NCXA 1QI3A 3WFHA 5B1KA 5DDHB 2YR3A 3B6SA 4MQXC 5BO0D 1NCBL 4AIEA 4PV1C 3IDJA 4IBQA 2W0KA 1OM9A 1U8QB 4Y16A 5L9DL 4TNWF 3WS3A 3ECBA 1RULL 4FXKA 4CU6A 3MRDA 1FH5H 1ZMYA 3OJDA 5I8OH 3EJCA 4F5CE 2P9RA 4CMMB 5B38G 4YHIA 2M1KA 4PB0L 3GMRB 3BESR 4XP6H 3WTUA 2B1AL 5JW5A 3BVNA 2F1BA 1AS7A 5F7FA 4H1LA 3E80A 4JLRB 3T3PE 3RVXC 3UMTA 2WLKA 3S0PA 2Q10A 3RWEB 2ZUVA 3HNVH 4G8AC 4TVPE 2K0RA 3FQNA 5B3JF 2IPTL 1EQWA 4FERA 1GVIA 2WNWA 3GNML 2HSIA 1WCQA 1E4KC 3BSGA 2EEAA 1SM3L 4A2HA 3QDJB 4YSDA 2DM7A 5MEQA 5J06A 4L5FL 4Y1SA 3B83A 2FLRT 3ZE1E 3IDUA 1IKNC 3KL3A 1PDKA 1TT6A 3LNDA 3QDJD 2ZG2A 4JMXA 4PJEB 3C5ZD 3CVHL 1AY1H 2PCFA 3WKQA 4BELD 1J0YA 4DTGH 2AI0H 4TL5A 1KULA 1OALA 1UOLA 3U4BL 1M53A 3X14B 5JLZB 4UTAA 4G71B 3D34A 3E1ZA 1WZMA 3LPOA 3P40A 4AE1A 4F1ZA 2VDRL 1JI1A 3LKQB 2IGFL 2J72A 3EOAA 3FMGH 1VLXA 3BP5A 4H1LG 4LCCC 1FO0A 1XD1A 3CPLB 3HG1B 4V1DB 2I24N 2J3SA 3GBNL 2F7RA 2HN7B 3ABZA 1TJXA 1W15A 3DPDA 4X6DF 2E3VA 1IAIM 4FEIA 5ACZB 3C08H 2C4FT 2VB5A 1AJ7L 2HVJB 5E8OB 4OJFH 3VTMA 3TBTA 2TSBA 1OT1A 3H55A 3JT2A 4PV8A 3PWPE 1TO4A 2A73A 4OM1H 1JHKH 2EZ0C 4HCRH 4KVCL 3WL9B 1X5AA 2F5AH 1D9KA 3AXLB 2XVBA 4ELMB 2ZX5A 2P44B 3EOBB 1QFHA 4ZNEE 3MCYA 3LZPA 2F19H 3N1PC 4WJ5A 1NDGB 1MPAH 1YG9A 2C1OB 3QJUB 3WMSA 3ZYOA 3PJNA 4HXBL 3WKNA 1DQJB 1RLBA 4WHYH 4ODUA 4KI5D 3B2XA 4QEGA 1KGUA 5L8LB 5GZOC 1CK0L 4QRRE 5ELIA 4UV4H 3RA7H 1PZ5B 3U7AA 3MRMA 2JJTC 3FULA 3L9EA 3V6FA 5CMAB 3W82A 1EX0A 3MRKB 2DPKA 2JKWA 1KCRL 3HG0A 1DFBL 4JPSA 1BV8A 3O8XA 4FG6C 3CK0L 3FS9A 4MGXA 4MASA 7CGTA 5I15H 1AGDB 2I26N 1YEGL 5A2FA 3K4ZA 1RFDH 4L1LA 2JKIS 4N9GB 3HS0B 3JV4B 3LVTA 5CHNB 2KPNA 4R3SB 3O2VL 1MAMH 3RVVC 1LEIA 5MP6L 1MJ8H 3FO0L 4FAAB 4NYLA 4D2NA 4IRJB 1CDGA 5FFLA 1WAAE 2VN3A 4NJ9H 1RZGA 4X6FB 3ZKND 3CD4A 2EYSB 1IGTA 2GAZB 5K59F 3S9DB 1ACZA 3AXHA 4PRDB 1N18A 4LK4A 1JZIA 1UEYA 2X4RB 4GRWB 3EZ8A 4TQ8A 1U91A 2G2RB 2DYRB 4WSKA 3VRIA 3NZHL 1KY6A 2XFXB 5JPNA 1BOGB 4X4YA 4L1HA 3KWXA 4JPWL 3RIKA 3UBGA 1I3RA 5AYUH 1CXHA 4GG8B 2YEQA 3OC8A 3UTSA 1C16B 2IADA 1EMTL 5HY9A 4OZGF 1NUDA 3A47A 5C08E 2ZWNA 3KPLB 2J12B 1T5WA 4MJJA 1GA2A 5CS7A 4PJ5E 1GGIH 3FRUB 1QUPA 4LMQE 2QDWA 3MLSH 4OLZH 2HJFA 3MBEA 3OX8B 2Q6WA 3G5YA 2VIRA 4JZNA 1OAQL 2BLFA 5L7XH 2WCPA 2OMUA 4OCMC 1A7OL 4KQ4L 4OGQC 3CFBB 1FSKB 1R3KA 3FN0H 1SJEB 3KPSE 4TPRH 4DP6X 4QRTB 3NDZE 1F4XH 3DRQA 5E1AB 3ZJAA 5I1EL 3QNYB 2EH7L 4XAWH 3U25A 4DETA 1UCBH 1DUZA 1XGTB 2HH0L 2ITDB 1IAIL 5DXWA 2XBZA 3I2CH 1KT2B 4WGVB 3L1GA 3MMEB 1FRGL 3NJVA 3IXTB 2MCG1 1XTLA 5EA0H 1A8JH 2Q5BA 3H4HA 3P30H 5FYKE 4WWNA 4HV8A 1FZKA 2EDQA 4APXA 3IMWA 2K7PA 4MYPA 4XWOC 4URKA 3T6XA 3QUXD 3D4YA 4A66A 1E6JH 2CR0A 3IRPX 5KSAD 3CFIC 3QJHB 2XRAH 4P49A 1LDPL 4XN7A 1GJIA 5FO9A 1M56B 4CAGA 4D8PA 2P80D 1T4KA 4LSUL 3QEGH 1DO6A 3MBWB 4AMWA 4XPGL 2Q9OA 4N2KA 3DO3A 1CDJA 3NCCB 3VFTA 2PTTB 1GTFA 1LO4L 4CSTA 3MLYL 2PYEA 2IPKA 5HHOD 4GG6E 2CRYA 1XWVA 1WJ3A 1OSEA 3G5WA 3GDCA 1N12A 1OAKH 4GINA 2X4OB 1IAKA 1KBGL 5BZDA 2B4CC 3SGDH 3H42H 2JJWA 2R0LH 2XWZA 5EIQA 1JDDA 1HL8A 1E2WA 3BRFA 1QO3B 2DTSA 2Z91B 1FJ1B 1D5BB 2A1WH 2AANA 4LF3B 3FCUB 5DJAA 1ZANL 4KVPA 3U48A 3Q2WA 4HJSA 1NBYA 2VO8A 4JHWH 1P7QD 1F97A 2DLFL 2JCWA 2OMXB 3GEFA 5IBUG 1WQVT 3UAJC 5DJXA 5E6IA 3BI9X 5INDA 4DF9A 1B3IA 2Y0SA 3M88A 3O0RH 5C8JA 1C5CL 3RWFA 2EDYA 3RWIB 5H35A 1UA3A 3L4WA 2AW2A 1T20A 4R4FH 4X4KA 3V7MA 4YEFA 1M1XA 3DSFH 4JB9H 2WVSA 5E1HB 5EN3A 5C07B 2A4CA 4LKCB 3BAYA 3TEXA 4URTB 5LN4A 5JHMA 1DQLH 2EINB 4AGPA 4IBZA 3CLFH 5CN1A 2G2PA 2GT9B 1XO8A 1G4MA 4LCIH 1SN5A 4LSRL 5D1QA 3SGKA 4Z7OE 3R7RA 2X3BA 3D0VB 4IKLA 5IHUH 5J12B 2V7NB 1HYRC 4TQEH 3IDMB 3POHA 2GBTA 3U7WH 3SO3B 1IVLA 1V7MH 4FS0A 3UPRB 3JSSA 3V4UH 2F61A 3DECA 2VLRD 3B7TA 3DHMA 3U82B 2MHAB 2WQWA 3KLSA 1T80A 3LN5B 2QHRH 1NEZB 3A6CH 1Z0MA 1ASPA 2W0FB 2XXFA 4K3HA 3DJTA 3KLLA 4KI5C 2AZAA 1UVQB 2Q7YA 2Y2TA 1TEFA 3UCRA 2WYZA 1NGXA 4CVUA 3TJHD 5IVXB 3K0WA 4PN6A 3AGWA 4WHCA 5HDQH 4X8JA 3O2DL 5M94B 3PL6D 1X5YA 1S8DB 5F71A 4ZAKB 4XXWC 2XXGA 4AQAB 5J8OA 2WQUA 4PEEA 1QASA 2BNUA 4KNSA 4PCYA 3SYPA 1TYJA 5JQ6L 5F3FA 1FDLH 2BNQB 4ZAKD 1U4FA 4GRLB 3MV9A 5D7JB 2BH0A 3HS0C 3D05A 2GFBB 3B7RL 2BNQD 2MOQA 4JFFE 4O5LH 3NIDF 3ZKNC 2WPGA 4OLWH 4N5ED 4IRJC 5D4IA 4YSSA 3K80A 5GGSA 5C0AA 2X4UA 2I9TB 1ZT4A 1QFWH 3MCKB 4Y9CA 5DQDH 3UCQA 3V0JA 3X12B 4AV0A 1CXKA 2FQGA 1E4XI 2PWEA 4ZSOA 2VAAB 3RVTD 1F4YH 3FKUS 4P8QA 1KJ3H 1HZHL 3FUFA 1J0ZA 1NBVL 1BIHA 2XA8L 1DFXA 3I9IA 3DVNA 4PBWD 2MPAL 3KCPB 1OSYA 5IJVB 1HHKB 2YD4A 1JDAA 1MREL 3JT0A 1TU2B 3WS6A 1T1WA 2WCGA 2VERN 5TDOA 2NCMA 4Y4HA 1S7SB 3IMTA 3VI3E 1MELA 3MRPA 5AOLA 3M8OL 3FUDA 3WE6A 1DSFH 5JHDB 3O6FD 2LV4A 3L1FA 1FSKC 1RIHH 1DVXA 1CI3M 5DR5L 4LLUB 2Y5TB 4K7PX 1O7VA 1ZLWK 2A38A 4FHBD 3LY6A 1LM8V 5A6MA 3RE0A 3RHWK 1PQZA 4YPGB 4YHPB 1ZT7B 3I6KA 4JHVA 4U1NB 4PBVC 3CC5A 2EDNA 2B59A 1M71A 3IU4L 5KBMA 1HQ4A 2OULB 3RWGB 1NJ9B 5IFJA 4Z78B 3AS1A 4L9LA 4BZ2L 5HYJD 4B53A 1JK9B 1AMYA 4U1MB 4JPVH 3UMNA 4DEUA 5T3ZD 3V6OC 1I7TA 4KQ3H 2OBGA 1OK8A 2WP3T 1JNLH 4A7UA 4B9FA 3A6OA 3ARED 3GSWA 1CURA 5EIIG 5GS0D 4K71B 4UNUA 5BQ7A 4WU7A 3L7FA 1G9EA 5JO5B 4QHMB 5A16A 3ZR6A 3ZUNC 1JXJA 2VDOB 2TAAA 2K4WA 1T2QL 5GS0L 5AKVA 3F6JA 4YBLB 3NFSL 3DVGA 4AYMC 2WXJA 3NQKA 3VD3A 2QR0B 4MDJA 3JTTA 1FORH 4QOKB 2ZXWB 3E0GA 5F0PB 5K1VA 5HYQA 4GI6A 4XVJL 2VDOL 5LGHL 4QOKD 2WZ6A 4L9DA 2NXYB 1NCTA 3EHBB 8PAZA 3ZOAA 2XX0A 3KEHA 1Z5YD 2P43B 3CSYA 2CBQA 5F3BA 2NXYD 5EN2B 3GJEA 2XTJB 1ZHKB 4UZUA 2NZIA 1BZEA 2GTQA 3UZEA 4JG5A 2XTJD 5IGXH 4BRJA 1CYWA 2YD9A 5IM7B 3CFKA 1B4RA 4XPFH 4OZIB 3WNPA 4AYID 3C5SA 5FHBL 1P4IH 5DHMC 1R5VA 3TV3H 4BSJA 4K9JA 7FABH 4F8QA 1QEWA 4HPOL 5IVOA 3X1NA 1P7HL 4Y19B 4TN9A 1WGOA 4A6YH 4ZMNA 4NUPA 4ZTEA 2O6FA 3HUJE 1ZA6A 4GEIA 3BHBB 4UOQA 5FA3A 5J12C 4PTUA 1HXYB 1U93B 1BP3B 2ITEA 3NEXA 5HPOA 5CZVH 1G9NH 4XO8A 1FWXA 1IILE 3LIUA 3QDGE 1L9QA 5EOCJ 3SO3C 3QUMH 5DFVD 3T2OA 5JTWA 1X3DA 2XWJA 2WZ0A 3BAJA 1GZHC 4XWGL 3WUWA 1TZAA 4NZ8A 1F8TL 4MA1B 3OAYH 3OGCB 4TUJB 4DQAA 2F7QA 3T6ZA 4M8QB 1O6SB 2WN3A 2B16A 1FZMB 3CMOL 1Z9SA 1G9MH 3VI4F 3QJVB 5SWSB 2DQFB 2MCAA 3MKKA 4C59B 4UB0H 1MCQA 2E27H 2OXHA 2ZKMX 3WJJA 4Y1AB 4GKZA 1DBKH 3APNA 1QQDA 2Z35B 5GSRA 3AM8C 3FYEB 4JO1L 5JIKA 5F70A 5I0XA 2CA4A 1HINH 5IWLA 4ZAKC 4WZ9A 1PVHA 2F1EA 1EGJA 3QPXH 1K3ZA 5EBLA 2GC4C 4J4PA 1PTZA 1KBVA 3M86A 4OTXL 2EE0A 3GBLA 1BX2A 1GC1H 2P26A 2WLJA 1KJ2A 1UB6B 3MFFA 4GRLC 4OF8A 5D7JC 4NZUL 2ICWB 3LS4L 5EF0A 2R15A 5J1TC 3WUWG 1T7XA 5F6IB 3I3EA 5D8JH 1ZLUK 1G9HA 5EZJB 1D7CA 4YDKL 1NOAA 3S37X 1FQ9C 3KYKL 3MLVH 2QQLH 3RVTC 3IPEA 3EDFA 3PWLA 4L8SB 3I3DA 1BFTA 1GYCA 1Q38A 3VD9A 2AV1B 2C1PA 3KXFB 2P5WB 1UZ8B 2E59A 2ZOKA 4PJCF 3G08B 1R5WB 2HG0A 1JVKA 4NQTA 2EIKB 3KXFD 4UF7C 2P5WD 3WHE0 3D3VE 1AD0B 2ZCHH 4N9OB 1T6BX 4O02L 2E4TA 3DTXA 3OSVA 2XZZA 3HFFA 3VYPA 5A1AA 1SDDA 1NBZB 1P53A 1IC5H 1OAXL 2EH8H 4FNUA 1PBYA 2IQ9L 1WC7A 5LNGA 4RMTA 2WN2A 2UZYA 4HBCH 2XI9A 5IQ7H 1RKRA 4NQDD 3CFCL 2F15A 4JJ5A 2W91A 3GBDA 3MTXA 4LASL 4F3FA 4G8IA 1TJIH 1TZOA 2VR7A 3L3GB 3OMIB 4Z0BL 2NOYA 1P84J 2JXMB 4M9OA 2O5YH 4I3GA 4DP9X 1ITCA 2WNGA 4ZI8A 3J27A 5DJ0B 5D7LB 3VA6A 5JNYA 4OCRL 1G7IB 3CZFA 5FEBA 1I1FA 4Z3EA 3AREC 5GS0C 1D5XB 4HFWA 4DPRA 3NK3A 4XNUL 4Y5YA 4A2EA 4K71C 3V9EA 1SMAA 4XXCC 2YD1A 2NY2B 2NX5E 5KJ4A 2HP4A 1NCNA 4MCYB 4XPHH 4ZS7H 3BAIA 4DVBB 3B56A 4YBLC 1NOLA 4YL4A 5IVZA 5HDOA 2V7HB 4ZZKA 1UM6L 1YUHA 2Q20A 3CCHB 4Z95H 1MI5B 5LWYL 1KELH 2Z7YA 3QCVH 5C0CB 2V2XA 3VXOA 1WISA 2G2NA 1MI5D 4U2YA 4JNXA 1IBYA 2PKDA 2ED6A 1VZGA 1ZHNA 4OLUH 3QIBD 1MVUB 2NXYC 1E30A 1VFBA 2HTKC 3EHBC 4G1EB 2WSPA 4PRNB 1VSCA 4OUUB 1HWHB 2XTJC 3MBXH 3VH8B 4YLCA 1IC4H 2HJLA 3VDCA 4KDTA 5CUSH 3S8FB 2QFPA 1MFEH 2XSKA 1HH9A 3D6GA 5JHLH 1F1AA 3M1BB 4L4TA 2EADA 2AJYH 4QXTA 5FUOH 3MTRA 4J8RA 2EXYC 4M7KL 2YFOA 1OTUC 3OKKA 2W81C 2DBLH 5DD0H 4BWUA 5ITFA 2F53E 1RK1A 4I0PB 1ETZA 5AVXB 1RXLA 4QCIB 4FQXA 5JUEH 3T0EA 4FFYL 4UINL 4N2EA 5TDNB 2F8VA 1G7MA 2I9LB 1Z3GH 2WYHA 4FQQA 4I0PD 4U1KA 1D3CA 3LPGA 4PG9A 4YFLI 3BC9A 3NABL 4GAJL 2VR6A 1BREA 4AI7A 3CXHJ 5T5FL 5D93B 4OZGB 3HMXA 1AO7A 4I9XA 1P7BA 4LSPH 1M7IA 3S35X 2PR4L 2VXVH 4X7SL 5TF1L 4GFTB 4HIHB 1H8SA 1FL6A 3MX0A 3QEUA 5DO8A 1EO7A 4NO2B 3KD4A 3VD2A 4JFDE 5L6YH 1CGVA 1GHFL 3V0VA 3VYOA 4W9FC 4MA1C 2FD6H 4PRIE 4O51B 3ZU8A 2VXTL 1UT1A 2HFFA 3TT3L 3PV7A 1WZAA 5MEOA 2WTRB 2Z31B 3MGOA 4I4WA 5JW4M 3KH3A 5CJQL 5DJ2A 4F7PB 1OF2A 2WO2B 3U83A 1A3LL 1KYFA 1OLZA 4PJ7E 5DFTA 2Z31D 2PP8A 4AUUA 3U30B 1RZIB 2OQJB 1GYAA 3MREB 5EUOB 4EEEA 2XV6B 3X1FA 1EEQA 5HDBF 5KOVC 3TEWA 4PRPA 3Q13A 1FYHB 1OB1A 1DJSA 4XNMB 1DBJL 3IDXL 5AKRA 5CJBA 3C09B 4NHUB 4AUYA 1ODAA 4UDUA 5TGBA 4B0MM 4F91B 1DVFB 4QMEA 3BZ4B 2N59A 3SE9H 3GSNB 4K3DL 4YSPA 2QBWA 2XYCA 4HK3J 4IM8A 3CFUA 2V5SA 1DVFD 3FNKA 2OYKA 4DGVL 5F6IC 3AACA 5EFIB 4AZUA 4NKDA 4G7SB 4B96A 1F11B 1YUKB 3UPAA 3NIGE 4RA3A 5HVGB 3MRBB 2SEBA 3EG9B 3H3PH 4B41A 4DGWC 3WKMH 4L8SC 5CFHA 4ILDA 5I1DA 2DQCL 2LLGA 1FIEA 1I7ZA 1NFDB 2HUEA 4PGDA 3LN9A 5J89A 1UD6A 3OZKA 3DX9A 6PAZA 2DQMA 4OCSL 3FH8A 1P1VA 5DD3L 1GAFL 4YGVA 2CJ3A 3EBHA 1EBAA 4NDMA 4NXKA 3O4LD 1OGPA 4FQ1L 5EB9A 3AS2A 2CCVA 5I1GH 4GY4A 3AY4C 4KO6A 3QYNA 3DK0A 5ALCH 4AGLA 3EBIA 3QZNA 5F0LB 4UILL 5EU3B 2X0UA 4POZD 5T1LA 4R2GB 1NH6A 2FAUA 5GGRB 4EXPX 5LO7A 3PWVA 3QE5A 3UG5A 1SRDA 4R2GD 2J1WA 3KLAA 7TAAA 4KKZA 1WIPA 1ZTXH 1JNNL 2Y7MA 2F58H 4JFZL 1N5AA 4I77L 1BLNA 3GKWL 3CXDH 1J5CA 1K5NA 2PW2A 2XKUA 2BMKB 2HLAB 2ZX6A 1C1EH 4Z7UE 2D31B 4GI9A 4EZKA 3UYOD 2D3VA 1F90H 1NUFA 2WUBL 5BS0E 4LLQA 1OV8A 4FYQA 3MUJA 4WO4B 1OTSD 2ITCA 3RDTA 2YMOA 1CGTA 3AC0A 3NMEA 4X6DA 4ZW5A 3UGXA 4TYUA 2NUPA 3A21A 1TG8A 3RQ3A 1W80A 2AXFB 4UM9D 4Z7QE 3VDAA 2NY2C 3S6CA 3RGBA 3MCG1 1BZ9B 1GL4B 2O5ZH 1KLFB 2ICWI 3EYSL 3MRFB 2J44A 1AQDB 2XWTB 2RR3A 3IBEA 5I1KL 3WJLC 1CXFA 1TYEB 4H8WL 1KN4H 5C7XL 2N7AA 2B1HL 4FZEH 4H8HA 3SPHA 3WO3B 2BVEA 2CMRL 3WD5H 1FL3A 4EI5B 1K72A 3BFQG 4PJDB 3ZDYE 1XHHA 4F7CB 3PDOB 4RAVB 4N86A 4P2QA 3HJ0A 5D1XA 1IAMA 1U2CA 3BD5A 3G9VA 3PPSA 4FDWA 1KWKA 3FQXA 5DMKA 3ZQ9A 2NYZA 5FCSH 1MRCH 1J88A 4U31A 4Z7WE 1A6TB 3OJ2C 5JHAA 1G7PB 4BD4A 1FH5L 1WUNT 5I8OL 1DJHA 1P7KA 3P4NB 2R83A 3M7FB 4NQEB 1F6FB 4XP6L 1KYDA 5K93A 1Q0EA 1TTUA 1XB3A 3N44B 2NY4D 4I0PC 3ULUE 1S9XB 5E2UH 1U8JA 1GYUA 4NQED 1L7TH 2ZP0T 4FFTA 2PMZA 4HA1A 3MU3A 5IOPB 3U0TA 1MF2L 3ZE2B 1TUPA 2ZX7A 4YDZA 1B88A 3ROOA 3HNVL 2WXNA 1MOEA 2L7QA 3V4PB 3GLZA 3LHAA 4HKJA 2VZVA 1CICB 4PJBE 5D93C 4H2AA 2EKJA 3LRGA 3STZA 2BS8A 1E5YA 3VTAA 3OKYA 4QI3A 2YBGA 1IB5A 4NNPL 1UEMA 2X5PA 2DH3A 5M7QA 2ADFH 1RJCA 3FL7A 1Y1UA 1AY1L 4HZLA 4MB1A 2BFGA 4WFHE 1RIUH 3M17A 2AI0L 4DTGL 1P6FA 1EJOH 3SYCA 4BM7A 3KBHE 5EZIH 2XZCL 4YIQB 2Y9RT 1A1NB 1XX9C 2Z31C 3R0NA 4PJ9A 3FMGL 2OSWA 4R7NA 2XKNB 3RNKB 4E5XA 1BEXA 2FSDA 1S7XB 1JXKA 4UDTA 3E3QC 3WXWH 4C56B 5IHBA 5DQ9B 4LXFA 2WKOA 1U8NA 5TH2B 3L6FB 3DBXB 1E43A 2YJLA 3U30C 2X10A 4LIQE 5BCAA 3C08L 4KKCD 4TLTA 3WN5B 1F3DH 2UWEF 4OJFL 3LRKA <