5D4JA

Chloride-bound form of a copper nitrite reductase from alcaligenes faecals
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
335
structure length
335
Chain Sequence
AAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
publication title Redox-coupled proton transfer mechanism in nitrite reductase revealed by femtosecond crystallography
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
total genus 93
structure length 335
sequence length 335
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2015-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5d4jA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5d4jA02
2EINB 1TU2A 1KCWA 2PLTA 1AAJA 5AZUA 2AZAA 4G72B 1JZGA 1J9TA 2XUWA 3QJSB 1AZCA 3SBQA 2HRGA 4KOBA 3FU9A 1IBYA 5B1KA 1AS8A 2YQBA 2BWIA 2XLLA 5I26A 1QNIA 1GY2A 3QJTB 4HCFA 2ZXWB 2VM3A 2YAHA 2Q5BA 5AKRA 2CALA 2XV0A 4E9SA 1J5CA 4ZK8A 3X1FA 2VN3A 2OCCB 3UABA 3X1BA 1BQRA 1L9QA 4F2EA 3FQ2A 4M4RB 2QDWA 3MX0B 2FT8A 4BK5C 3UGEA 1L9TA 1SHWA 1CURA 2J56A 2DY2A 4WTQA 4DP0X 3T71A 1CYWA 2UXGA 4KNSA 1XB3A 3PCYA 3NP3A 5A7EA 2RACA 1SDDA 1KCBA 1ET7A 1TEGA 3GYRA 2VSMB 3PAZA 4Q89A 1NTDA 3ZX1A 2HLEB 4E9RA 2QDVA 1N68A 1PAZA 2BP8B 4BWWA 1E65A 1ASQA 2R7EB 1R1CA 1ZIBA 2YAOA 3NSYA 2Q9OA 3BVDB 3OD3A 2FQDA 2FT7A 1ET8A 3IN0A 1JERA 3QJVB 6PAZA 1OF0A 2UXTA 3NJFA 1PLCA 2FQGA 3CZUB 3JT2A 4HIPA 4G7RB 1E5YA 3L45A 2CAKA 1M9WA 1SFDA 2QPEB 2PP8A 3EHBB 2IWEA 1ZIAA 2EIMB 4KO9A 2VM4A 2X88A 1J9RA 1CUOA 1PNCA 5I6LA 2IDSA 1JZFA 1TKWA 3AG1B 2I7SA 4UAHA 3FPYA 5IY5B 4E9XA 3ZBMA 4EF3A 4KNUA 3H4HA 3AG2B 1BYPA 2PPAA 2J55A 3NJIA 4PCYA 4G71B 3NJNA 3T6VA 5I6KA 2JKWA 3PPSA 1M56B 3ZDWA 3WI9A 2BWDA 4GY4A 5B1JC 1OCRB 1AG0A 4DPAX 1DYZA 2XXGA 4BWTA 5FC9A 1NICA 4KOCA 1FFTB 3WNJA 4GXFA 4YSTA 3WIAA 1GSKA 5B7EA 2MTAA 1J5DA 2AZUA 3ASOB 1ZDSA 1UATA 2H3XC 2YAEA 1RZQA 3FSWA 5AFAA 3V9EA 1KGYE 3WG7B 3OM3B 4YL4A 3T6XA 2VW7A 2N0MA 1NDTA 1GS6X 4A67A 3FU7B 1WAEA 2XXFA 2LLNA 2WO3B 9PCYA 2DWTA 4E9YA 3PLYA 2BZ7A 3TA4D 2GC4C 4PAZA 1IC0A 4W1TA 1FWXA 1NZRA 1OE3A 3KW8A 5B7FA 5EHFA 3WKPA 2YAMA 1MZZA 2PPDA 2VSKB 2YAFA 2BZCA 1JXFA 3T9WA 2TSBA 3DIVA 2GIMA 3FSZA 2NRDA 5B7MA 2BW5A 3OMAB 1A4CA 1DZ0A 2FQFA 2VW6A 2XU9A 1X9UA 3AG3B 1E30A 2IH9A 2YARA 3JTBA 3RYMA 1AIZA 4UF7C 4UANA 1MG2C 3SQRA 3NSCA 1KV7A 1ASOA 2IWKA 4A2HA 3QJUB 4BDVB 1NIAA 1NWPA 1SHXA 2JFCA 4YSQA 1NIFA 3N2JA 4DP7X 2XV3A 1SF5A 2PPCA 4G70B 1ID2A 3H56A 3DTUB 4BWUA 1AZBA 4YVUA 5I28A 5D4HA 4N8UA 1IUZA 4A2FA 4AZUA 2JXMA 1OCZB 5ANHA 3HEIB 1L9RA 1PLAA 3FSAA 3PAVA 2DYSB 3NSFA 1SJMA 1JOIA 3S8GB 4HAKA 4DP8X 1RCYA 2B08A 1F56A 3UADA 4HCGA 2EIKB 1OCCB 2XYBA 4QKTA 4GP8B 1M57B 1JXGA 3BQVA 4A66A 2HRHA 3NJJA 3T6WA 1GS7A 1B3IA 1L9SA 2A3TA 2HX7A 4AKPA 5F7BA 2ZWNA 3EH4B 2P80A 1AZRA 1ZDQA 4GP4B 1SFHA 2B3IA 1OE1A 3QJQB 4JKNA 3D12B 5B1BB 4HZ1A 4HHWA 3FU8A 4NB7A 1FA4A 1ET5A 2CCWA 1TEFA 3UAAA 1V10A 2GC7C 5D4IA 1AQ8A 3U25A 2XV2A 4E9TA 1GYCA 1ETJA 4YSOA 3ABLB 2WO2B 4MFHA 4KO6A 2J5WA 2EILB 1KBVA 4KO7A 3NP4A 4YSPA 3NJGA 3FQYA 2YAPA 1W6WA 2IDQA 2XX0A 1GS8A 4E9VA 1PMYA 3ABKB 1WS8A 3H4FA 4N4YB 2W8CA 1J9SA 5TK4A 1BXAA 4GYBA 2Y69B 1VLXA 2IAAC 1WA1X 1NPJA 1AACA 3SBRA 2MRYA 2DWSA 4BXSV 3ABMB 1HFUA 1ILSA 1WS7A 4AX3A 2UX6A 1I53A 1NIEA 2DYRB 5D4JA 4JHVA 2BW4A 3TU6A 3UACA 5LDUA 2W88A 1W8EA 4YSCA 1L9OA 2OJ1A 3FYEB 1X9RA 2FTAA 3TBBA 2P80D 3DKHA 3KW7A 2IDFA 2R7EA 3ERXA 6PCYA 1EZLA 3TASA 2HX8A 2EIJB 1OCOB 1JZEA 2CJ3A 4HALA 2I7OA 3FS9A 1MDAA 4FA7B 1QLEB 3OQRA 5I6PA 2FNWA 5B1JA 4AKQA 3OMNB 3CDZA 1KDIA 1PF3A 4YSAA 4GP5B 1PZBA 3UAEA 1BAWA 2Y1AA 4F7KA 2FWLB 2YXVA 2CUAA 3IE9A 4A2GA 4AKOA 1SF3A 2TSAA 3MBWB 3S3DB 1SDDB 2FJSA 3WKQA 7PCYA 1PLBA 3IEAA 2YAQA 3S3BB 5E9NA 2H5UA 2HXAA 4L0PB 1AS6A 4DP2X 4P5RA 4A2EA 3EH5B 1CC3A 1HAUA 4HCIA 2PCYA 2BP0A 2BHFA 1JZHA 1T5KA 3ASNB 3AG4B 1IBZA 4F2FA 8PAZA 1A4AA 1URIA 2GSMB 3G5WA 2FQEA 3EH3B 4ENZA 1N70A 1BEXA 2X87A 1ZV2A 3EF4A 5PAZA 3GXUB 2FT6A 2GBAA 3AY2A 3CVCA 1JVOA 2BO0A 2E86A 2ZOOA 4HHGA 3QQXA 4DP9X 1NWOA 3N55A 4CSZA 3FU7A 4YSEA 4FAAB 3GDCA 1A4BA 1AOZA 3AZUA 3S3CB 2DV6A 4DPBX 4KNTA 2I85A 1ADWA 4AI7A 3FQ1A 3WNIA 2AANA 5I5IA 4DPCX 1WA0X 5I6MA 1A3ZA 1JZJA 1NIBA 3FPXA 5PCYA 1E67A 1MZYA 4YSRA 2PP9A 1JVLA 1PCSA 3NJLA 5B1AB 1AZNA 1NIDA 1PZAA 1PZCA 2OV0A 1AS7A 1CYXA 1AG6A 5I5MA 5I6NA 1W6LA 2PPFA 3PXLA 2ZONA 4DP5X 1AANA 1AZUA 1XB8A 2XWZA 1XMEB 2PPEA 1SNRA 1EHKB 1KYAA 3X1EA 4QLWA 2QPDB 3NSDA 1ZPUA 1GY1A 1AR1B 2GB2A 1A8ZA 1GW0A 2J57A 4W9ZA 3T6ZA 4BDVA 7PAZA 5I6OA 3NT0A 2IDUA 2HZHA 3NYKA 2QT6A 1NPNA 3QPKA 1PNDA 2UX7A 4RH4A 3CDZB 1BQKA 1BQ5A 2IWFA 3ZIYA 2H47C 4X4KA 3X2QB 4YSSA 1OV8A 1YLBB 4E9QA 1KBWA 4YSDA 3NJKA 1RZPA 4A2DA 4DP1X 1RKRA 2UXFA 1NINA 1V55B 1E5ZA 1MG3C 2YXWA 1A65A 3NJHA 2PCFA 1QHQA 3OMIB 3SBPA 3X1NA 4BXVA 4YVNA 2VMJA 2AVFA 2BP8A 4M3HA 3PAUA 4Q8BA 5TK2A 3NJMA 1PY0A 3C75A 2XX1A 2VW4A 3CVDA 5F7AA 2BP0B 3FT0A 2AFNA 1V54B 1JXDA 1L9PA 1BYOA 3IN2A 1IKOP 3QJRB 4DP4X 3ABGA 2GI0A 3S8FB 1BXUA 2UXVA 4TXVB 4YSUA 2HX9A 3V9CA 1WA2X 4NAJA 2CBPA 4NERA 4A68A 3IBOA 1GR7A 3AW5A 4CSPA 5B3SB 1OE2A 3FYIB 3CVBA 3TBCA 1XB6A 4G7SB 4K9JA 1ILUA 2XVBA 1KDJA 2IDTA 2PP7A 3HB3B 3FSVA 1ASPA 4P5SA 4E9WA 4G7QB 5I5JA 1JZIA 1J9QA 4DP6X 3X1GA 1BXVA 4JHUA 3CG8A 4KO5A 4WKXA 2IH8A 2GHZA 1OOWA 1HAWA 2WSDA
chains in the Genus database with same CATH superfamily
4C8XA 2IOIA 2HJKB 4BFBD 3UJIH 2GJ6B 4Z7UE 2PYFB 4G2AA 4HIHB 4LIQL 2FGZA 4GRWH 3L4VA 2GITB 5K1NA 1IBYA 2WUCH 5BVJA 4LCUB 3FCGA 4N6RA 3T0VA 2VXVH 3TA3B 3WO4C 4N0YL 5C08B 5HHNA 1VFBB 4JJHA 1WZ1L 1Z9SA 2HKHL 3INOA 1NDMA 1ZY9A 2HVKA 3O2DH 3X1BA 5EZOL 2ENJA 4M93B 4FQ2H 2W0PA 5GS1A 2DZEA 3LCYA 1UD5A 2WMPA 2XVLA 2WWMC 4PU2A 5DVOA 3VRIB 4EEEA 2FR4A 4I5BA 4HUNB 3RNQA 5CCGE 3EGSB 2A9ML 2WPGA 5A43C 1P5UC 5SX4H 4PJ6A 1IKFH 4RGMB 4EO5A 3IJSB 4NSKB 2WK2A 3HNSH 4K8RL 1ET7A 4KPHH 1WZMA 1WWBX 1TEGA 3N44B 4ONGL 4OTXL 4X6FB 4Y1AB 1H6TA 4NPYA 4Z3TA 1LHZA 3EH1A 3OR6A 5JHLA 3CC5B 3P30H 2Z31C 3RB7A 3IGAA 1SXBA 1H3PL 5I1KH 1AKJB 1O6SA 3WNLA 1E5UI 5AZ2L 1EJ8A 1SQMA 1TTCA 4RISH 5TH2B 5E8PA 5JIKA 3MJ9H 3L1GA 2OZ4H 1ROWA 4GKZA 3EDFA 3P0YH 2OPCA 3I50H 4R9HA 2IWEA 2R83A 3KD4A 3Q9QA 4NENB 4XBEL 2DQHL 2WQWA 4DO6A 4GBXA 4HLJA 1V3MA 4FF9A 4FFWD 3UIYA 5T1JA 5IBUB 1DQJB 3OHMB 1ADQA 4ODBD 3VUAA 5IHZB 3N9GH 4UAHA 3QUXA 5EA0H 3TCXA 2IANA 4E9XA 2IGFH 3SCMC 1FZKB 3LNGA 4KNUA 3RB5A 4PY7B 1IGFH 4EXKA 4Z7NE 2M8XA 1DBBH 2IFFH 4XVJH 4ZUTB 1RXLA 5LG1A 4DO5A 1RZ7L 2E9JA 2CMRH 2X89A 2XVGA 3ILPB 3A4DA 3L1FA 3MLZL 2X4QA 2BNRE 5TGBB 4YDLB 5ICYB 3AT8A 5IG7B 3U1SL 1QABA 4QXWA 3S7GA 4KY1H 1A6VH 5FC9A 4PLJD 5JTWA 3I9PA 5DI8B 4M03A 5M95B 3KPMA 5I74C 3C8DA 3CVHH 3OXSA 1J11A 3VXQA 2CXGA 5DMIH 1CD1B 3QWRD 2QPUA 3L13A 4MJ2A 5T1KD 1RP8A 3G08A 3HKFA 2X4OB 4LDEB 2VERN 3VXRB 1MQKH 1G7HB 4PJEE 5JOEA 3QXAB 3E3QC 2MJWA 3VWKC 1ESOA 1AYRA 3CU7A 4YEEA 5DMJB 1RUAL 4PJ5B 1LDPL 4GKNA 2VZSA 5I71B 3OV6A 2YMOA 3IDNA 3CTTA 2JF1A 2LLNA 5DQJB 1PS3A 4BSJA 3PRZA 2BNQA 2Q3XA 5T1LB 4CC4C 2GAZB 4G3YL 3TA4D 1IGYB 2R2EA 1ZHLB 3L3KB 2WHVA 3FTZA 1OE3A 3PGCA 3ARYA 5L4IA 1I8AA 4DEWA 1L9MA 4JGJA 2OL3L 3B4NA 4AK1A 1OGTB 2RGSA 3HUJE 2VSKB 1FF5A 1FFNB 1NPUA 4APXB 1OAYL 2R69A 2UV3A 3GZKA 5ALCH 4YHLH 2GIMA 1AXIB 3QNZB 1DDHA 5JHDB 2GJRA 2ZP0T 1MIEL 3UTZB 2VDKH 2Q1EA 4LLDB 4LVHC 4KVNL 5IKCA 4HLZH 2H32A 3HE7C 3PDGA 4DGVL 4PP2B 3QUGA 1KGIA 4JPVH 4UF7C 3C8HA 1CT8A 2ZNWA 3C09B 2ZYSA 1NGQH 5BRZE 1B9ZA 4Z7WB 5GGSA 3QIUD 3WXWH 2X3AA 2APFA 1I7ZA 1PZ3A 3QORA 3HI6H 5K9KA 5L2JB 2YGNA 1PDKB 2DICA 1ITCA 4LCCC 4OZIF 1SEQL 4BWUA 3DTUB 4UQBA 4UYPA 4HEPA 3PGFL 4N8UA 1MHHB 5DVMA 4GSUA 1SOKA 3A4AA 1G4MA 4WFED 3VE0B 3FSOA 4NBYB 2PWFA 4Z1PA 2ZWLT 1E6OL 2HCZX 1D6EB 2F74A 3VTMA 1JGUL 4P9ML 4MA7H 1CS6A 2E3VA 5GRJH 3PWNB 5DFVC 3RHWK 5KVDE 3JWDC 4LGPB 1F56A 1UKSA 4D0DB 3P54A 3H55A 3QBTB 3LY6A 3QFJE 4HWBH 4TL4A 4CBZA 1MLCB 5HGBB 2A9NL 4MDIA 1JNLL 2ZE0A 1AH1A 3ZT6A 3ARBB 2COVD 1FCGA 2ALAA 1GZHA 4OZ4A 3QUHA 3OWEA 3MKGA 2WQAA 1R5WA 5DS8A 3ZY7A 2ZCLH 4U1JB 1UUNA 2B77A 3OMZA 3SOTA 2MMXA 5T5FH 3RAJH 3WSQL 2CCWA 2GJ6A 4CN1A 4LPCA 1AQ8A 1KYUA 4KZ0A 1N67A 3ISWA 3LB6C 1U0QA 3EIFA 4HIHA 2GITA 2OR9H 2OK0H 1WTLA 5FFLA 1VKXA 1RU9L 3LZPA 1CE6B 4LCUA 4RMUA 1RJYA 3S36X 1ZSHA 4X6BB 4QRTB 4WLCA 4AEIL 3UAJA 5SWZE 3TA3A 4WNSA 2ITDB 4AK2A 1HXKA 3MV7E 3VGGA 2DI9A 4NT6B 1VFBA 2YAPA 1U2CA 2XZAL 4AQZA 4BUQA 1PMYA 5B4MC 1YECH 1FG2B 4NN5B 2DWYA 1G9MC 4PRPE 1OPGL 4KROD 5FYLH 1WA1X 1NPJA 1J9CT 2FEJA 2BSDA 1PX3A 4OGXH 2ZT9C 3SQBA 3OKKB 1U91B 1EIBA 4DVRL 5C8JB 4DGYL 4OV5B 4MB3A 4Y4HA 1G0XA 3EGSA 3QH3B 4NJ9L 5H37A 4Q4EA 1JUFA 2ESVB 2RR3A 3DSNA 4JG0H 5DD0L 1NOLA 4ZD3H 4Y1AA 4N8CH 2VXQA 4PUBH 1SOSA 1ZGLB 1T80A 2AP2A 2EH7L 5EB9A 5HHVH 5HDBE 3EXLA 2W95A 5CSZA 1KYOJ 1TTFA 1U58A 1YEJH 4NC1C 4QDGA 1MHCB 3AU1B 3LNDA 4G6ML 5IV2B 2YUWA 1CIDA 2EECA 3T0EC 3VFVA 4A1RA 3QDGB 3T2NH 4BK8A 5EEWA 1AKJA 4HALA 4GQ9L 3L9RB 1MDAA 2CKBA 2PWDA 1CGTA 5FFOA 4YPGB 3TESA 4G6AD 3NTCL 3M86A 4BQ8A 1SVCP 3FFDB 1IFRA 3KNBB 3RWEB 3Q8CA 3OJDB 1NM4A 3BEVB 4TNWK 1FNGA 2OMWB 2OSLB 2VGLM 3IS0X 3IGFA 4PJ9B 2J73A 1X7QB 3DHMA 2P5PA 5IHZA 2VDQH 3HCVB 4MA1B 1KIPA 4LU5L 1EA9C 5E0QA 3RY6C 2V2TB 4X7SL 1FPTL 1FZKA 1U95A 3V5DB 4PY7A 1G1CA 3DARA 4I9WD 3GI8H 1MJ8L 2FX9L 1COBA 4ZUTA 4RGNC 3ILPA 1NCJA 3D52A 1NC2D 1UM6L 2D0FA 1HAUA 4N2EA 5IG7A 1ETZB 2BM3A 2CBMA 3P73B 5F8RC 3LNFA 3SE4C 1B6UA 4JKPH 1FZOA 4KDWA 1KPUB 4L29B 4F57L 4GG6F 3WU1A 3MRJA 4XPHL 4WCYL 4PSRA 4R8WL 2DWEA 2W9EH 3SPCA 1CD1A 1HQ4B 3QUKB 4H8PA 4IBQA 3FK3A 3VXRA 1FNAA 3O9WD 3QXAA 2N01B 2DQCH 1XSOA 4JREB 2E9WA 4KX9A 4XB7A 3C12A 1MH5B 1XT5A 2V3EA 4DQOL 2J7LA 3N06B 5F3BA 5AD0B 3MA7B 5DQJA 4DEPC 5CBEB 1ZV5A 3LIZA 4U7SA 2V33A 3A6BH 2FDBP 2GAZA 1OSPH 4JM2D 1JGDB 1IGYA 3WLWC 3L3KA 3FMGL 4EZMA 5IEKB 2IPUG 3FPXA 5KYYB 1E67A 4MVBD 4ODSH 1TTUA 4M48L 3NAAH 4NN7B 3AXIA 1QA9A 4QLRA 3W0WB 5K9QG 2VLJD 1H3WM 2Q3AA 5I76B 4APXA 4HW6A 1AS7A 5I5MA 2UZXB 4IRSC 4J1UB 5GZOA 4MGXA 4ELME 4MSWA 4YLBA 4TNWF 2WSPA 2JB5L 3HG1B 4JO5A 4Y8DC 3UTZA 3C5ZC 1BVOA 1NFDB 1XXDC 5K9OB 4LLDA 1KFAH 1SJHA 4PRDB 1UWFA 4PP2A 3B9KC 1IGTB 4ENEC 3LZOA 4X6DE 2DDQL 2HVBA 4OLZH 2V7NA 3ZDYB 1NC4D 2R0WH 4Z7WA 5BOZG 1WITA 5SWSB 3IDIA 1AFVL 4QXUH 4WW2F 5J13C 4AT6B 2C9VA 1OP3H 1GXEA 5L2JA 5T5NG 2X2JA 4H20L 1PDKA 4YBLC 1AO7A 1PNDA 1BPVA 1KTKE 1G0YR 3SE9H 1T03H 2VO8A 1WUNT 4X4KA 2ZF9A 1MHHA 2K4AA 3IFNL 3H7LA 1U8NB 3X2QB 4YSDA 1HYSC 1OQXA 5DQ9B 2G3NA 3VE0A 2VXUH 2P5WE 1X5YA 2F54D 1OOAA 1LQSR 1XGYH 1D6EA 3HBPA 4HPOH 4NKMA 5T3XH 5DMGD 5DD5L 4Z7UB 1GHFH 3PWNA 4OJEH 1LWJA 2XV6B 2VH5H 4D0DA 1HOEA 4MMZB 4MAUH 5GGTH 2NY1C 3GXFA 2AJVL 1Z3GL 1AHKA 4MX7B 3VH8G 1DCLA 1MLCA 4WY7L 2ZF8A 5HGBA 5LXGH 2QVTA 2FWSA 4BZ2A 1CTNA 2Y36L 3QS3A 5JHLL 4PTTA 4HS3B 1E3ZA 4KFMA 2A74C 4K8RC 2J1YA 4G5ZL 4ES8A 2IF7A 4U1JA 2Z7YA 4QHPA 3QDJE 1E8WA 1YNTF 5H4ZA 3ZZ1A 2V6HA 3HG2A 4KHXH 4OJFL 4IDJH 4L18A 1NGYB 4LCWB 2WOBA 1KCRL 1IC5H 1NCOA 4J3WA 1A7QH 1YEHL 2F53A 3HE6B 5FYJE 5GSVB 2V9RA 5FUZL 2O6DA 5HD8C 2J8UE 2PABA 1FJ1B 2WVVB 4PJFE 4URKA 5FUCC 4Y4KC 4QRTA 4ZNEA 3FQ4A 2ITDA 3NFSH 1KJ3H 1Z7JA 3FO0L 3ILDA 3PS6A 4HKZB 1HEZB 2DQGH 3BH8B 2Y2TA 5GRVK 3CHRA 3F7YA 1J9QA 1CLVA 3NPSC 4NKIL 1ZTXH 1KENH 5C8JA 1U91A 3P4MB 1K6QH 5HY9B 1A1MA 1KY7A 2EINB 1FCCA 4Y16C 4MTMA 3BGMB 2ESVA 4F92B 3KLKA 5IVOA 5C0AD 4E5XB 1I3UA 1KBPA 1A1OB 1G7PB 4L1TA 2J44A 3GLZA 3QYMA 1E8YA 3NZUA 1N19A 4HS6B 4NAQA 5CEZD 3NJXA 3RTQB 1ZGLA 2ENYA 3FDWA 2YA2A 1I7UB 15C8H 2Y5TB 4FERA 4RAVA 5EZIL 5MEQB 3QJTB 2IALB 5IV2A 1IT9L 3TIEB 3VFTA 1LJMA 2CIIB 3QDGA 4U1SA 3PQYA 4WTXA 5AW9B 1M7IB 4Z7NB 1FQ9C 4DGUA 4YPGA 1E5AA 1KIUB 4M5SA 2BNRB 1RL1A 3RWEA 5ICUA 3KNBA 4FXGB 2J56A 5HJ3A 4W9GC 3UPRA 1BZ8A 2I25N 4F1SA 4M9PA 1UC6A 5EUKB 2KLSA 3VXME 1S7QB 4TYUA 4HFWB 4PJ9A 1OKEA 1X7QA 3S5LB 5JQ6H 1BFOB 3NCJL 2OXGB 2V2TA 1GL4B 2R69L 4B9JA 2FAUA 2WLIB 3V5DA 1P7KA 1PAZA 2BP8B 3BH9B 4GW4B 4PJEB 5GZND 1A3LH 5E4OA 1ASQA 4HF5L 2EEXA 4FEIA 2Q9OA 2W0LA 2FQDA 4WHYH 1TCRB 3QR2A 4HEMA 3MCKB 2B1HH 4NZTL 1E43A 4GW1A 3NH7L 5BMFH 4MCYA 3ABZA 3JT2A 2DJSA 3MN8A 4Y2OB 2GTWA 1DUZB 1KPRB 1JGEB 1IC7H 1KLFB 4HV8B 5IJDC 1VB9A 3MNVB 3MLYH 1DFBL 1GCFA 4FXKB 3QUKA 5DZPA 4X4YB 4S1QL 1NCHA 2DD8L 2YXMA 5HHMD 3WDIA 5IROD 4AY0A 1ZRUA 3HUJB 1EDQA 3TTYA 5IHHA 5D8JH 4XVUD 3P3SA 4OZFB 3DMMA 3SKUD 2NY4B 5IHWA 2H8PA 1X9LA 4BQ6A 4D94A 4AC4A 1Q1PA 1MKFA 2J55A 3ZRSA 1K3ZA 4G71B 4LK4A 5AD0A 3HMWL 3MV9E 5DUBB 4NGHH 2NYZA 2ZKMX 5AAMC 1WBYA 4QHUB 4HGMA 1CBVH 1JGDA 2X41A 5BZDB 5A40E 4LPWA 4PYGA 3NFPB 5BRZB 4MB5A 5DFAA 4C55A 3OAYH 5IEKA 1HX0A 4Z7OF 4ICWA 4B0MB 5FYJU 4BGLA 3CXHK 4KRPB 3DX6A 5AWNH 1U4FA 5I8KL 1UATA 1PFOA 4IYKA 5B38B 3O6ML 4OFVA 1KCSL 2BIMA 3QR1A 3HR5B 4HJ0C 4DTGH 5C6PB 1NFDA 3D08A 5K9OA 2GIXA 5IJKC 1KBKA 1NDTA 4PRDA 4TVPD 4PJGE 1GGCH 1IGIH 5LCVA 5GISL 1IE5A 3SYOA 3PWPA 5SWSA 5FWRA 3TBYA 3NQKA 2CHNA 5F0JB 2CGZA 1O7SA 4AT6A 3L7EB 3EDKA 3QFJB 1JXKA 3RX7A 3VFRB 5LN4A 4CDGC 4YFEA 3EXJA 1W0WB 3RILA 4BELD 2Z7UA 4HK0A 4NYLA 3QULB 3NOIA 3C6LA 2V5YA 3NRPA 4NUMA 4ZAKB 3AU0A 3ZHKA 5BV7H 1R17A 3KL0A 5DQ9A 2BZCA 2HTLC 2IEPA 2AI0L 4JFUA 2O6CA 2K70A 3L4WA 4KXAA 5AW4B 4FMFA 4KQ3L 2CK0L 1DJWA 4WRLA 3BAIA 3QCVH 4NOFA 4MMZA 3GIVB 2R1XA 3NFNB 1GOGA 1S7TA 4FHJA 4MX7A 2IG2H 1NCCH 5SWZB 4U4BA 3DYPA 5F7EH 3MV7B 4DFHA 1MCQA 3FUNA 4LKXB 2L8AA 3KEHA 2NYKA 4L1SA 3HFMH 2CO2A 5BRPA 1WE5A 4RMRA 3O6LH 4PRPB 1NMCC 4CILA 5BOPA 2ZX5A 1ID2A 5LWYH 1F1DA 4WI7A 5E5RB 3UJTH 3ARFB 2CKBL 1UXWB 5I28A 1NGYA 5D4HA 2XIBA 4LCWA 4J28A 1RURL 5IIEA 4QGYA 4L2YA 3HE6A 5ANHA 5GSVA 5JPNA 4JR9H 1VFAB 4R90H 3PAVA 5DVKA 1FJ1A 4Y2DB 1J0YA 3OSKA 1ZLDA 3B3BA 3DGDA 4HKZA 4TLUA 1SJEB 3TM6A 3RVVC 2F9BT 3LEXA 1HEZA 4XO5A 3BH8A 5HDBB 3VFUB 1NAML 1B3IA 3WEMA 3VYOA 4PJCE 1HS6A 1P6WA 3MROB 3EH4B 2HH0L 1D2OA 1BZ7B 1EERB 1XD0A 4LCIH 1NBYB 3QJQB 2B3IA 5TQ0L 2ZCHH 4XBPA 5HY9A 2IADB 3EF7A 3EOBA 3WTVA 2XN1A 4O9HH 3WGUB 3HS0B 5HDOA 2X28A 2ZXCA 1ACYL 3DPDA 3QHZL 1G7PA 1GZQB 3MFGB 4J4PC 1GYCA 3MLWH 3PWJB 4HS6A 4WK0B 2Q10A 3RTQA 3CN3A 3FQWB 4KDTA 3SDDD 2OMYB 5AOZA 3QPQC 1A47A 4ZMZA 2EILB 5D7KE 3PDDA 1I7UA 2Y5TA 3RPBA 5MEQA 3MGAA 4JFZH 2BHZA 1SBSL 4JM4H 1SLUA 4PBDA 3TIEA 4LT7A 2VRAA 3ABKB 4U1GB 1M7IA 1GKEA 1TQBB 2J8OA 4MA8L 3LVTA 4I3GA 4XPTL 1NFIB 3AXHA 4GYBA 2E8YA 4OI8A 1KIUA 4ZOEA 3P77B 1Z32X 2PO6D 5F1IB 4IRZA 4KWUA 4ZOCA 3S8FB 1DSYA 4XXCA 1HFUA 3S96B 3QC5X 1NLDH 4HWZB 3JV6A 3QPXL 1RZJL 5EUKA 2R0LH 4FI7A 6TAAA 1OGAE 4HFUH 3S35X 4P3DB 2OMZB 4CKQA 4JPIA 5E51A 3S5LA 5C0JB 2HPOA 2LU7A 3U6RB 2OXGA 1H15B 1W8EA 3MLVL 2P3YA 1YY9D 4GW4A 4LHUG 1U8KB 1Q0YL 3ERXA 3GI9H 3WKML 5D1QE 1SEQH 1XHHA 2H6OA 4PGJA 1TCRA 3MO1A 3QNYA 3PGFH 3RIKA 1NANI 1R75A 2P5EA 1HXMB 1UJ3C 1VGKA 3V6OE 4LRNL 5I1AA 1TTGA 5LQBH 4PJIA 2I5YL 1DUZA 4EAEA 1INEH 2VMDA 2Y6SD 5ITBL 2R4RH 4JDTH 2BRRH 1LO0L 3DX8B 2DTSA 4X4YA 5EIIA 1CBJA 4A2GA 3OC8A 3KYKH 1T22B 4MNQE 2DL2A 3GD1C 1FDLH 4YAQA 4QKXB 2GBTA 1DVQA 4PVNA 5F7UA 1G0DA 3NZHH 2X6AA 4ELMB 4O00A 3RY4A 1TMCB 2F5AL 2HXAA 1CGSL 2Z93B 3MV01 1OK8A 3N1PC 5EBWB 3VXSE 1DL7H 1F97A 1FP5A 4OM0H 1NCWH 4QO1B 3I6KA 5GS1C 3I3EA 4G1MB 5BZDA 2D3NA 5I17A 3TEZA 3NFPA 4KKRA 5BRZA 3SO3C 1BBDL 1SXNA 4A7SA 1D9KD 5C09E 2D7TL 4BZ2L 1JZDC 1QO3B 4H2CA 4XCEA 4XNQB 4FMKA 1HILB 1P84K 2PW2B 2EH8L 5C6TL 4KH9A 4PJBB 4XN9A 2X4SA 4F5CE 1UFGA 3HR5A 1LO2H 2FT6A 4DGIH 2ZOOA 2P5WB 4PRAB 4EBQL 5H35B 5D1ZB 3SY0B 2F0CA 3MNWB 5CEYA 2NT0A 3BKML 3QZPA 4NM8H 4KK5C 1F2XK 5F96L 1GJIA 2NY0C 3D09A 2HMIC 4CU8A 5F3HB 1K5NA 3D39A 1JFQL 3Q48A 1J88A 1X7TA 3K81A 1FVEA 3VFRA 5GXBB 1W0WA 2CUHA 3FTVA 1VACB 3H0TB 3HC4H 5CGTA 1A3ZA 4B0MM 3WKNA 4YDMA 4QXVA 3NZ8B 5GGVL 3UCQA 4BKSC 2LHAA 3QULA 4YSRA 2BS8A 1ZLEA 3QIUB 2PP9A 4K5NA 1PCSA 4ZAKA 4GBXC 2R0KH 5K93A 3WTYA 2NNAA 1PZCA 3TFKC 3MCLH 3O45A 4ZFZB 1QFWL 3HI1B 3QDJB 3NBNA 4HXAL 3II2A 3QUXC 3DPBB 5HI3D 4I0CC 2OMBA 4LEOB 5AVUB 2PXYD 1A6ZB 4RGOH 2J8UB 3GIVA 3LHPH 4YK4C 5CP3H 3REVA 5I75C 3NFNA 1QSVA 2GIYA 4PJFB 1CFNB 1EHKB 2FJGA 2WW8A 4Z3FA 5JOPE 2CGRH 2NSQA 2X7LB 2Y0SA 3ZK0A 2ZD0A 5GGRB 2J6EA 4LKXA 5I82A 2E6QA 3A67L 2WXPA 1F8TL 4GRLD 3BZ4B 3DJ9A 2W0FB 3GM8A 2ALWA 4I87A 4PRPA 2VLRD 3GRWA 4LU5H 1IEAB 2OJEB 1G6VK 2GUOB 4R96A 3WCYA 1HXYB 2AXGA 1A8JH 4D8OA 3NIDF 3S34H 3BPNC 3FTSA 4OLVL 4P49A 2ZAHA 4ISVA 2YXWA 4Y2DA 3ME0A 3QS2A 2WXFA 5F9JA 5ESVA 4QOKE 1SJEA 1AR1C 4G1EB 4ZS7L 3VFUA 3PIQB 5F7YC 2I24N 4GFTB 2VABA 3H9HA 1E9PB 2WJ7A 3DRTB 3ECBB 3HFFA 2E7HA 4KKCC 1BZ7A 5INDA 2H41A 1E4XI 2PMZA 3LV3B 5J89A 2IADA 2E76C 1ZPLA 4L3ED 1CICD 4F8TA 3CXDH 3KPOB 4HGWA 1MPAL 3AWEA 3FZUD 1GZQA 1KNOB 1QFUL 4Y8AA 3OF6D 1IILE 4OCXL 1N0XL 5K33A 2OJZH 2VDMB 2B0SH 4OGAD 5E00A 5KW9L 4C56E 3MRLB 1WZAA 3HAEG 2J20A 4FL4C 3SDAD 1QEWB 3R06B 4KXZI 1OB1B 3GSOA 4KJQC 3BSZH 3QORC 2YRZA 4N3UA 3WJJA 2O5NA 4FZEH 5KOVC 4F7MA 4FP8L 1QFHA 1QX1A 4WSJA 5DLLA 3V8CA 4Z3EA 2IGTA 3MUJA 4XPAH 4D8PA 2F1AA 5F1IA 3EBAA 4FABL 1FE8L 2V4LA 1JPEA 3N41B 2XA8L 4WKXA 3S96A 5C9KA 1UT2A 4JPWH 2GHZA 2KLRA 2QSQA 4HWZA 3SKJL 1N6QL 4HUWB 2AEPH 2PLTA 1AAJA 4DH2A 2VQ4A 5JA9A 3FBKA 4P3DA 3ASWA 4ZXBB 2YRPA 4PJDA 1MVUB 4JHZA 1CLOH 3I9GH 2DIBA 1RPQA 5ALBH 2LU5A 3FU9A 3V5KB 1I1CA 4ZUSA 1GGBH 1MFNA 4U3XA 2DL9A 1U8KA 4KTEH 5C70A 2ZTBA 4PWEA 1WLHA 2ED9A 2YAHA 3CSYB 2Q2EB 3V0HA 2CALA 4OLWH 4HIJB 1GZHC 1J5CA 1T66D 4LEEA 5FKPB 5AYUL 1HDMB 3MV9B 4Q56A 4MNGA 2Z8SA 2FT8A 4XNYL 4PW4A 5DJ8B 3U4BH 3PXJA 4RDQG 2DY2A 2V2WB 4X9YA 5KSUA 1XB3A 3DX8A 5D72H 4BFNA 1HCVA 1R3LA 4NQEE 2PW1B 1J86A 3D5OF 3KPRE 3BESR 5B8CB 1T22A 1YQVH 3WHXA 4P59H 3LS5H 3RJQB 1CO1A 2J2ZB 3UAJC 3TA3C 4BKLB 3PAZA 2NY3B 4L9LB 2HLEB 3ARDB 3AY4C 3U9WA 3G6JA 3JV5A 4FQIL 1M05B 1FVDB 1FAIL 2NXZB 3V0DA 4R3SB 4G1MA 4PJGB 3JTSA 3FBQA 2HSIA 2NXYB 3BUYB 1KJVB 3GXNA 3OXRB 1FC1A 2DYPB 4QXTA 4M6OL 4WI0B 5DRZA 5L6YL 3RFZA 1RVFH 2AMGA 1E4XL 4X7CC 4Y4HC 4RAUB 3EOTL 1ORSB 2L7EA 4MD5B 4Z7VE 4RGMC 1M9WA 1QO3A 1B4JH 4QJ3B 2DQTL 4XNQA 3ZSSA 3ULSA 1CL7I 1MCPL 1G1OA 2PW2A 1JP5A 4DW2L 4PJBA 2UUDH 1XCXA 4JX0A 4WI9A 2EDTA 3MRRB 5GRUH 2FIKA 4L3FA 1UVQA 1VF5C 1J87A 2P5WA 3G3LA 4PRAA 3SOBL 3RGVB 5D1ZA 3SY0A 4UB0L 4U31A 4NKIH 2FE0A 4PCYA 1RAMA 5IB3B 2X9YA 3BN3B 3CZEA 5KVEE 3PF2A 1MFCL 2CUIA 3H0TA 1DYZA 3HN3A 1VACA 3TYGH 5E08L 1DBMH 2X1XR 1JHLL 4YSTA 5E99H 3VAEA 1ZGLP 5FHAL 5B7EA 3QIUA 3PAYA 5DFWH 4J12A 4KRNA 3QDJA 4HZAA 5KVGL 3DX3A 3DPBA 5EWIH 4A63A 1OTTD 4LEOA 5FA3B 3W9EB 4NWUL 3Q06A 4FYTA 2VW7A 4U3CA 4WUUE 4WI3A 3TXAA 2J8UA 5HGDB 5F9OL 5GGSY 4QNPF 1CFNA 4OFDA 5FLVA 2WBKA 4X6CE 1FORL 1Y1DA 2WXQA 4F80A 1SHSA 1UCBL 3N1FC 1CI3M 1HKFA 5D1XE 2XZCL 4NRXB 3T8VA 3BZ4A 2BVOB 5A2AA 2W0FA 3CXFA 1R33A 4PJCB 4R0LB 5MEOB 1IEAA 1U21A 2OJEA 3CX5J 3ZYJA 4WTZG 2HRLA 2GUOA 4LBAA 1P4LB 1ICTA 1HXYA 2FO8A 3UIZA 5E2WH 2OSWA 2WXJA 3IJ7A 4IRZL 1JXFA 2AJXL 1KWGA 2HT2C 2TSBA 1XBDA 4GAAA 1QSZA 4JDVB 4HQQL 1KZYA 5MERB 3CSGA 1YRKA 5I71C 5EN2B 1JZ5A 3E7JA 4AUJA 4OU3A 3WIIL 1XGTB 4EZKA 3DC0A 3EO9L 4K5LA 3KBFA 5D2LF 4ZJ9A 3PIQA 4UANA 1AGBB 2NY2C 3SQRA 2GHWB 1AXTH 1PEZA 3DRTA 5DQDL 1LO4H 6FABH 4U7KA 1K8DA 1I9JL 2FL5B 5IW6A 1R24A 4BRJA 2YD4A 5MP6H 3LV3A 2K3TA 3MRDB 5JNYB 5TPWH 3F7QA 3H56A 4U33A 2YKLH 5F44A 2XIDA 4XZ4A 5GZOC 1KGCD 3B9VA 3QCUH 2R29H 4YVUA 2Y72A 3KPOA 2IPKB 1KNOA 3HEIB 1I1AD 3ZL1A 2LGNA 2DYSB 4PBWD 2AMUA 1JPGB 1OGAB 4AGQA 3C09C 2YN3A 1RCYA 2B08A 4GUCA 3GM0A 3MRLA 3ZHDA 1QBLL 1IO4C 1QEWA 4N2DA 5GS0H 1OCCB 4N2OA 4POZC 4U0RB 1M7DB 1JGVH 1MIMH 3T6WA 5KAQF 3DTDA 2ZWNA 3QUMB 3HN8A 5LGHL 3QYNA 2BIHA 5BO1L 1M2VB 4O2FA 5LXVA 3H3PL 2GSIA 4MD4B 4W9JC 4PPTA 1MNUL 3MUZ1 2K6YA 3UTTE 3JUZA 1RV6X 4PLKC 3ROLA 1T7VA 1CGYA 1E6JH 1D3CA 3N43F 3OKOA 3K0YA 3M7FB 1MVUA 5C86A 1NMAL 2Z34A 4NFBA 3V5KA 3G6DH 3ESMA 2VR3A 2WO2B 3GSQA 1X5IA 4KO6A 3UBXA 1OZUA 4TLKA 3TZVD 4MNQB 3RVUC 2J3SA 3FONA 4IKKA 3PREA 5H4YA 2DLFH 3D34A 1WQVT 5DK2B 2IDQA 4QRSB 3ILQD 5F9AC 4HIJA 5TE6H 2H2PC 5FKPA 3VXSB 1HDMA 5ABDE 1KY6A 2DLTA 5D7IF 3FUMA 1UEMA 4GT7A 1ZTMA 3LZLA 1NMBL 1NC2A 2NR6D 1NBCA 1XD1A 2WANA 2V2WA 4LVOB 1JDCA 4WU7A 3FJTA 3WDJA 4HKJB 5C09B 3SE8H 4GKLA 2PW1A 3BISA 2UWEF 4K55A 3VW3H 2FB4H 3GZQA 3I02A 5HI4C 1SUJA 2OP4L 3KJ4B 3AITA 2CRIA 4BKLA 4F93B 2O61A 4G7VL 1E40A 2AJYL 4F7EB 2F8OA 4LSPL 1XXFC 5I24A 4QRQA 3ZGIA 5HI5D 3DKHA 4QHKJ 4NN5C 1M05A 1YPZA 2VJ8A 4MMYB 1FVDA 3O9WA 1S7UB 4OF5A 2ZKHH 4R3SA 5IMLA 2EIJB 3KXFD 1QNZH 3TX4A 4PS8A 4XMXA 2DYPA 2AVGA 1YYLL 3O0RH 2I7OA 4WI0A 3TBTB 4JL2A 4ILDA 5FXCH 1LD9B 3MV11 3M1OA 1ORSA 1BAFH 1A3RL 2YPKB 1MCBA 3QI9B 5B1JA 2A4EA 3RIAK 2J6EL 3ZTNH 5IHUL 4UV4L 1A6WL 3FTUA 2CA3A 2JXMB 5C0EB 3N40F 3B37A 4XCFL 4RRPG 3AC0A 5HVHB 3MRRA 5F6HJ 1F6LL 2P44B 3HNVH 4V1DD 7PCYA 1HNFA 2VLJA 4LSQL 2BNUA 5L7XH 5EZPA 1KPVB 5E9NA 3APMA 4DESA 3RDTD 5IB3A 1P7BA 3FAWA 3L1OH 1N4XL 4N2BA 2AABH 2BSRB 3R4DA 3WTSA 1F11A 4P23D 2JKJA 4NM4H 1PG7H 1HU8A 3DOHA 3QUZB 4M8VA 4OF3A 3QB7C 2B4CC 3BRGC 1QLEH 2V5MA 3WOVA 1DVYA 1CWVA 3K46A 4PGDB 1T4KA 4UMGA 2XI9A 4ZFOA 1RZKH 4PJ9C 3O4LD 4MA1C 5CZVL 3EYQC 2ADGB 1MRDL 2ZP8A 3PHQB 2RB8A 5IVXF 2HG5B 4M43H 4WGKA 3W9EA 3KJ6H 5HHXH 1O5DT 1TQCB 5DJDA 5DC4B 2FX7H 2XBZA 2NY6D 4LVNB 1BVKB 2F54A 3K6FA 3GDCA 1B2YA 2HB0A 1YMMD 3D8MA 2VC2H 3FQRB 4IRJD 2X1QA 5EZLB 2DV6A 2QPSA 4I8DA 4QOKB 1M6UA 4IMKA 4JVUA 5D1ZI 3S2CA 4ZW5A 3EFDH 4RIRB 1MHEB 1R5VA 2BVOA 4FFYH 4XN4A 1QBBA 2YN5A 3N6YA 2A1WL 1NIBA 3NCFB 5FB8B 5MEOA 1P69B 4RFOL 4JFWA 2EDYA 4HD9A 5DD1L 8FABB 4RLDA 1P4LA 3QE5A 1BSIA 5ANME 4ZS6D 3LS4H 2LW3A 3BP4B 1PZAA 3DURB 2OV0A 3AUWB 3OR7B 4LGRB 3W57A 4JREC 3DMMC 3DVGB 4JDVA 2X0UA 2ZSWA 3KG5A 1L7TL 4X9FA 5EU3B 5MERA 5EC2B 3L4TA 3QDMD 5J6SA 2EIZB 1XGTA 3AGWA 5BZWB 1CU4L 2OYLA 5CSGA 1RUKL 2KZWA 5D7HA 3B56A 3IRZA 3THMH 1UXLA 5HDQH 1AGBA 3WNOA 2WLKA 2QPDB 3ULUE 2APWA 4C56B 5IFAL 3KPNB 3MOAH 3NN8A 2FL5A 5EBLB 1S46A 3K1DA 3T6ZA 1I9RH 4QRUB 4NN7C 1NPNA 3MRDA 3OKMA 2UUDK 5JIHA 1BQKA 2R15A 1JK8B 4ODTL 2HFEA 1C1EH 3EH2A 3ZVVA 1AIFB 3T6QC 1RUPH 4I13B 2IPKA 3EJZC 4FFZA 4NO2B 3L5XH 4JFFD 5DYOB 1SMOA 1OCWH 4UTBA 1JPGA 4K71C 4G83A 3A5VA 5GJTL 4B9YA 4BK4A 3C9NA 3X1NA 4TSBH 3MBXH 5GGVY 3BVVA 7CGTA 3K71A 2EIEA 2DIEA 1HI6B 4BINA 1EEQA 1JS4A 3GUFA 3QUMA 2XWJB 4N0UE 3S4SA 2BP0B 2MSPA 3HN5A 4K5OA 4NBXB 4C47A 1CJYA 1JXDA 2QEJA 3C6LC 1U6AH 2A4ZA 4I4WB 3IN2A 1GOFA 5K59F 1WHPA 4YFLF 3NCYS 4ZMQA 4ZX6A 4XWGH 3VVWA 5EOCH 2IO5A 5F96H 5I66B 4HC1H 4DZ8B 3CUPB 4YQXL 5J8OA 3Q44A 2D7QA 2KZBA 4MMZC 4NQEB 3JZYA 2BXYA 3ATBA 3KPRB 2EE3A 3MLRL 3CMOL 1YEEH 4MNQA 1CB4A 4A2LA 4OGYH 1C7TA 5D2NE 2EABA 4QRSA 1F4HA 1AHWB 1JXJA 2Q3ZA 1W72H 1BV8A 1N3NA 3WGVB 2W5PA 2R0ZH 5KVFE 2VZOA 4LASL 2R9HD 4AYBA 3GSNB 4XE5B 4YHYC 2DMGA 2O6FA 3CZSA 4P07A 5IWLA 1SJXA 1H0DA 1UD8A 4JFOA 2Q8BL 4LE8A 3HE6C 4ZX3A 4KI5E 3W38A 5JPNC 4HKJA 3GSXA 5C09A 5AZUA 3JTTB 1KCWA 5EEUA 3K4DA 4Z7VB 4OUUA 3FN0H 5DC0A 5FFGA 5B21A 2OKMA 3K2UL 1J9TA 3OB8A 5A3ID 2AF2A 3UL4A 2WXMA 2QV4A 4F7EA 4ZO7A 4AH2B 4AC2A 5GJSH 4F5CA 1YCSA 5IROA 3WFCH 3L9YA 2WGNB 4OCMC 3UBXI 1I1FA 3KLHC 3Q01A 3RWFA 5F71A 5KYWB 1P9MA 3CAFA 4EOWH 4O2EB 4OFIA 2DH2A 1UUSA 3IWUA 4TNEA 4WWPA 4S0SD 5F3FA 5GGUA 3TBTA 1LD9A 5C0BD 2EEDA 1BEYL 3QI9A 2YPKA 4ZUUB 2Y5EA 3L2LA 3ZE2F 2OW7A 1HINL 4WNQB 3BKYH 3MUY1 4FQHA 3VG9B 5C0EA 2EXYD 2J4WH 4Z8FH 3WIFB 4EIBA 4ZOBA 3A47A 4HGKC 4KKNA 1U8HB 3IJHA 5DEFA 5IM7B 3RTQC 4KDTC 7TAAA 1OAXL 4XMVA 1U33A 1EMTL 5LUMA 1BM3H 3BUIA 3CLEH 3DX7B 4KHTH 2EXWC 3D85B 1C5DA 3BLKA 2H26A 1OHQA 3V0VB 3CBJB 4MQ7B 5BXFB 4WUUB 2FT7A 4LPTA 1S9KC 1XF3B 4PG9B 3D2UD 3OKLB 4KZCA 3QUZA 3U2IA 4S1RL 4X6CB 3KBHE 5GSRB 5EEYA 4XXCC 1I1RA 2ATPA 2IV9A 2FQGA 4HIPA 4DVBA 4PGDA 4G7RB 1H3VA 5HYSG 1UM5H 2PP8A 2LVCA 3C60B 3ZKQD 2JKXA 2ZUYA 5E56A 1OTUD 3KH4A 5CM1A 3ET9F 1UWGL 4YIQB 4KKLD 2VMFA 1BIHA 5IY5B 2CDEA 3NGBB 3H4HA 5KSBE 1EFQA 5C7ZA 1IARB 3EYUL 3DHJA 3FQRA 3NJNA 1MCLA 2WLYA 4QOKA 3VFPB 3CFJB 1XCQB 4K23L 4EVNB 2IH3B 1OAKL 1MHEA 2G4GA 4M6NL 2OR8A 2YD3A 1UYWH 1AG0A 1L0PA 3UPCA 2QQNH 1EK3A 5GRZA 4LDOB 4N8VB 4YXKH 1KELH 1U8MB 5FB8A 3WNJA 2G2NA 3VACA 1FFPA 3OKNB 5TFSL 8FABA 4JG9A 4PRID 4QWWC 1T3FA 5JR1L 2VN7A 1U8CA 1B3JA 1NGWB 3QUYD 1EPFA 2V9TA 1NOFA 4K9EH 1QLRA 2C3GA 3BCDA 4Z7QF 5CP7B 1BWMA 4UT6A 1LMIA 5E8EB 4AENB 1RPUA 2RALA 2ZOLB 2EIZA 4LARH 5BZWA 4CVWA 1I31A 1C5CL 3X17A 2X6CA 4I48B 3DI2B 2ZG3A 2CLRB 4QTFA 1N8ZA 3K7UA 3KPNA 5D9SA 5EBLA 2R56L 4KRPC 5IQ7H 4LDCA 2GCYB 3MRMB 4NUGH 4OM1H 1JK8A 3DYMA 3PDOA 3QAQA 4P5MB 3VFGH 1AI1L 5FYKH 1AIFA 1F4XL 2P4AB 2QHRL 5AVXB 4ADIA 4LVEA 4ALAH 3MLPA 2MIZA 3UTTB 1DLHB 4WI4A 3N91A 1TJHL 2NY5H 2C9PA 4XVSH 2B1AH 3R18A 3FRPG 2PR4H 1KN4H 5HJDA 2WM0A 3SDCD 3BZFB 3ELAT 3KWWB 2EDOA 2YEZB 4KVCL 3INUL 1CFTB 3KGTA 4IU3A 5CIPB 5I9QB 2Z1PA 5CLYA 5FYLD 1EEYB 4BH7B 5KG9A 3MOBL 1HI6A 5D4QA 1MG2C 2FATL 3NSCA 3PHOB 2XWJA 5EBMB 1M9SA 4C4KT 5HGHA 4EIUA 1KEMH 5HVWA 1OSZB 5IK3B 3VRJA 1PYWB 2JFCA 4R6UA 4WFGD 4ZAKC 1YY8B 4P4KB 1UZ6F 4M5ZH 1MCOL 1IBGL 3WS3B 1R0AH 4W81A 5FK9B 3ZW3A 1AZBA 1EEUA 1TQUA 3SE3A 3OVUB 5G4OA 4Y5YB 4AZUA 2WZ5A 1BJ8A 2NNCA 1CGWA 5I66A 1BD2E 1MY5A 1TQWA 2DBJA 3CUPA 2EDMA 3HRZB 3IAQA 4NQEA 1JPFB 3KPRA 1JRHH 2X70B 4ODXB 5DEZA 1KCVL 1XAKA 4KKBD 4X5XB 2WB7A 3IFLH 2XZQH 5CUSH 3HC3H 4RMSA 5IHBA 5A16A 1AHWA 3P3RA 3GQFA 5F70A 2E9GA 3R7RA 4MJJA 3QSKB 3ULVH 4I3RH 3NJJA 4I1NB 2NQ3A 3JSSA 3ZYOA 4O58L 2J5LC 4PG2A 2FHCA 4JFXB 2Z7ZA 3WS6A 3S98A 2C7UA 1B0WA 12E8L 1DO6A 4ZUVB 4BK5A 5ADPL 3JTTA 5J9PA 3UGUA 4Y2DC 4L5FL 2K9FB 2GC7C 4X4XA 3RPIB 2CH8A 5ES4B 3NSXA 4ZX5A 1VFUA 4RSYA 4ZFOL 1QSFD 1OT1A 5DGQA 1UT9A 2ILLA 3EO0B 2J5WA 2ZPKH 3BP5B 4QTIH 1IIIA 5K39B 4DKFL 1D6VH 4L1DA 4Y89A 2HA1A 5C92A 3OKYA 2FH6A 1YEGH 3BKJH 3KS0J 4XODA 1BQLH 1E27B 3MLUL 4NZUH 1H19A 4WO0A 1SMAA 2AJSL 3QAZC 3P3YA 2H4EA 4ZPTB 4TTDC 4WNQA 4K3HA 4UOW1 1XH2A 4XP1H 1G9MH 1LVEA 1WS7A 5TF0A 2UX6A 5EU5B 1LGVA 3WIFA 3K0WA 4X5WB 1U8HA 4AUUA 3RVWD 1D9KA 2RBLA 4KBPA 2YA1A 3B7TA 2W88A 2N3JA 5E8DL 5FOJA 1F13A 2YJQA 1IGML 2ZX9A 4OCWH 2R8SH 1KB5B 3B8SA 4U1GC 4LLYB 3WJJC 1TQBC 4MQ7A 1UD2A 3U9PH 1R5IA 5BXFA 1RULH 4WUUA 4ZRGA 4Q9RH 1OTSC 4HD5A 1XF3A 1RSYA 1TJMA 2AEQL 1C12B 2J88L 3FRUB 4M6MH 4PG9A 4LPUA 3MRKA 5F9DC 1J0HA 4FQLL 4JO4H 4X6CA 3S48A 1MFEL 2A7BA 3LVEA 4U1MB 2YEQA 4MXVF 4YFDB 3TPKA 5AAPA 5L4JA 1OT4A 4ZQTA 2QFRA 4WK2B 4ZSOA 3RP1A 4QRAA 3GMMB 3VRLF 1DVXA 3LRSA 4MHHG 3C60A 3QIBB 4XPFH 2D9CA 3IGLA 3QEQD 3X14B 5ANMB 3K8LA 1KGXA 3O6FD 3A4FA 4FFZL 4BZYA 4XC1L 1PKQE 1KEGL 3VGHA 1YA5A 4UTBL 2YSTA 4OD1L 5C0CD 2R51A 5C0GB 5IFJB 3CZFB 3VFPA 4EVNA 3PL6B 1XCQA 2E8ZA 4DP2X 3ZDXF 3LOWA 5D1QD 3IFOB 1R3KB 2R1YA 4MJ6B 4WEEA 5E7BA 4YZWA 3ASNB 4FG2A 3OKNA 3IGUA 4NWTH 4PLJC 1QUNB 5T3XD 2KQMA 3G5VB 4S2SB 5K69A 5IBTH 2X87A 3BMVA 3V4VB 1A7PL 3NABL 4HJ1A 1I8MA 5E8EA 5PAZA 2NT1A 1FRGL 1RLBA 1NWOA 4I0KA 3IDYB 4FN0A 4A7VA 4PW3A 2MTPA 4YBHA 3AWFA 4I48A 4WEBH 4HX1B 4DK5A 4DPBX 2EYTB 1E4WH 2OMUB 4XT1C 5T1DL 3VQLA 3RFZC 4S1SH 3C5SB 2VRKA 5AL8A 3VNZA 3FO2B 4TQIA 5FV2A 5AW8B 5BJTB 5GS2H 2CDGA 4XR8C 5I73C 1CGXA 5PCYA 4N0UB 2GQHA 4P5MA 2G9HA 1KCUL 4K3JL 4NO0D 4BUHA 4TL5A 3MGTB 1MRCL 2BCMA 3U6XA 4G7YH 4QRBA 1IAIH 5DZOA 4V2BA 3UTTA 1DLHA 4E9LA 4OZIB 3GHBH 5G5DA 4Y1TA 1Z5LB 2JWYA 3GK8H 5D1ZC 5I0YA 1GYUA 4ZQKA 1CICA 1L9NA 2B59A 3BZFA 3VD5A 4QYOB 3QG6B 2YEZA 4QI3A 2VL5B 1CFTA 3P40A 5CIPA 3QISA 2PPEA 1A3RH 1DQKA 5T33L 2AHIA 5CJ8A 1I7TB 3X1EA 4Z77A 4BH7A 4LLVB 1EO8L 1X44A 2NX5E 4AL8H 5D2NB 3HPJB 1RHHA 5EBMA 4UYQA 1OSZA 1PYWA 1B9KA 2HZHA 3NYKA 3FKUS 3QIUC 2QT6A 1YY8A 2UX7A 2WD0A 3CDZB 3WS3A 4MJIE 1HH9B 5FK9A 3QRBA 4JY6B 2OI9B 2GABA 4K5MA 4Y5YA 4LP4A 1MFVA 1S9VA 3NJKA 2XOTA 4DJMA 3OX8B 4OZGE 1C8QA 2VNCA 2CHDA 1E5ZA 1JPFA 4AIXA 1EEZA 1W0VB 1CG9B 3BD4A 3HB3D 4ODXA 4KTDH 4AM0Q 5E5UB 5FWQA 2VDRB 4YX2H 1ZVYA 1WT5A 2E59A 4BIKA 3PAUA 5JOPD 1NM9A 1PY0A 2JI3A 4NJAL 4JDZA 5A2CA 2DM2A 3I75B 3FU5A 1S3KL 3MJ8B 4JFXA 1AZZC 2E27H 5FX3A 4UNTA 5EF3A 5IMKA 1HWGB 5C71A 5F9WB 4E36A 4ZUVA 3VD7A 2BJML 1ZT1B 4TVPL 4NZ8A 3D3VD 4J3OC 1BXUA 2JJVA 5KBPA 3RPIA 4GAGH 3WBDA 3ECQA 1BMWA 1IJ9A 1OAUH 4U4IA 1IC4L 1AJ7H 1K8IA 1T0PB 5K39A 5JZ7D 3WEAA 2VDPH 3CFCH 4DOHE 1NBVH 5JW5A 1OARL 3TONA 3VYNA 1RIUH 3T1FB 1BVLA 2H2SD 2DPKA 3O6KL 4HBCL 2BFVL 1L0XA 1BZDA 1CF8H 3H3KA 2DLGA 4MRCA 1BXVA 4KROC 3ZKSD 2NTSP 4HOXA 3KPSE 3VD0A 4H88H 4XP9L 1HAWA 3FCSA 5EU5A 5FLUA 4JY4B 4Q6KA 3IDMB 1VJSA 3JYCA 1TCMA 4WI8A 2XN2A 4L1BA 4J2QA 3GBEA 1V7ML 5CJQL 3E3QE 1USQA 4HP5A 4GW5B 4KOBA 4CU7A 5EOTB 5B3JE 1KB5A 2LAGB 4IKJA 5IZ7A 1ZHNB 4M1GH 4LAJH 1GZPA 3S36H 3FRUA 1C12A 2G5UA 2X6UA 3GO1L 4F2EA 4U1MA 2G5BA 1FIGL 3KE0A 3L1EA 4TS6A 2EEBA 2MCAA 5I1CH 1SHWA 1Y1UA 4G6AC 3V4UL 5I15H 4L9DA 3MXVH 4GG6B 3QIBA 4PWJA 3J27A 3SPIA 4RWYL 5CCJA 4PN6A 1RMFH 3X14A 2IQ9H 3AJ7A 1R3IH 3DVNB 1D5XA 4MQSB 4PJHF 2FBJL 5DLMH 1H6EA 3V0EA 1QKZH 2NUTA 5E2TH 5C0GA 3FT3B 3P9MB 1JZ4A 1BM7A 3PL6A 1E2WA 3B2VH 3L7FA 4KFZC 3IFOA 4D0CB 2MPAH 3IN0A 1R3KA 2BVYA 4PMEA 4MJ6A 5D5MF 2NY6B 2UVFA 5CMAB 3RDJA 3ECUA 1YMMB 2LU3A 4XMLH 5I23A 1RUQL 1QUNA 4JE0A 1AQKL 3I6LE 5B8CC 2QLYA 1TJXA 5KS9E 2PCXA 4DSYA 5J1SC 2P8LA 5C0FB 3SKNA 3V4VA 1UACH 4JFHE 4OKDA 3TLRA 4MQXD 3CHSA 5I6LA 3LSOA 1YJDC 4NZRH 2XTJD 3BLPX 3O9WC 2NXZC 4AGNA 4OLUH 4GIAA 1FYTD 1JBJA 3HHRB 5GGRY 4WAFA 2NXYC 4HX1A 3HKZA 4N68A 4Q9QH 4N2HA 3C5SA 3JWOC 2ZYRA 4JKKA 3FO2A 5I0XA 5B1JC 1OCRB 1KXHA 4DPAX 1E2ZA 3V52H 1EAPB 5FR3A 2HRPL 4WW2B 2VM9A 1JSYA 3UGXA 1CE1L 4DZBA 1RZIB 4PHXA 4LCVA 3MGTA 5F7DB 1C5BL 4MVBC 1FFOB 4OZIA 4OY9A 2VDLB 1IKNA 2YPVA 3FSWA 3IDUA 5GIRB 4EPSA 4Z5RB 1G7JB 3AS3A 3CFBB 4JFED 1S9YA 4HS8H 4JRXE 3KH3A 2FYYB 3VDCA 3QG6A 1BD2B 3S88H 5AB9A 1FFRA 1WFJA 5D71L 4AMWA 1I1AA 2LLLA 4XOCA 3ULVF 4N2FA 4Q0XH 1I7TA 4LLVA 4MS6A 3VA6A 5IJVB 5D2NA 2WO3B 1T5XB 3HPJA 3VYPA 4PJXF 4KMTH 2BZ7A 2N59A 2WVTA 3LRLA 2QMKA 5KJRL 1HL5A 3JBG7 4XWOD 1XGPB 2YC1B 4OCSH 3KCPB 1HH9A 1A9VA 4YDNA 2BERA 4JY6A 3MRGB 1SN0A 1DVFD 1DZBA 3ZGHA 3VCLA 4YLCA 4N2AA 2NTFB 1YNTB 1B4TA 1KJMB 1NEZB 2IOOA 3SDXA 5B7MA 3OMAB 3B8YA 1AY1H 1S7VB 3UBFA 5FHBH 4JO3H 2XU9A 3B5TA 5HHQB 4N86A 5ADOH 3QHFH 3UP6A 1OM9A 3OLGA 4IMKC 3BWSA 2QV2A 2V7HA 5I1JL 1DBKL 1MAMH 4TQEH 4K94L 3QNFA 4PB0H 1XH0A 4TUKL 1P4IH 4PW9A 4O2CB 1KIQB 3I75A 3MJ8A 4FULA 1SHXA 3NIFE 5I8CA 1XGZA 3H9SD 4R5TA 4DP7X 1T1ZB 1ZT1A 3P0GB 2H0FA 2I07B 3K1KC 2EUVA 4A2FA 2BSTB 2E56A 2WQUA 4L3AA 4W9FC 2O72A 3F62A 3G6AB 5JW4N 5IESL 1AE6L 1MFUA 2NR6A 3FQXB 2WP3T 2DI8A 5H94A 3CK0L 1DFXA 4HSCX 4HDIB 3VFWA 2NY7H 4BRVA 4HUKB 3ZTJG 3W82A 3HIZA 3R0NA 2JTYA 5KZCD 1GPOL 4WFHD 1FL6A 3SDYH 2ATKB 3P11H 2HX7A 4ZPVB 4UOZA 1JHKH 1KXQE 3UC0H 1HJCA 5JPMA 4J3VA 3CSTA 4RAHA 5F72S 3F12B 1T6VN 1CLZH 4PCKA 3O3BA 3G9AB 4P5KB 1M2OA 3CFQA 1XIWB 3C08L 3KXFA 4I89A 5EOQL 3UAFA 1EJOL 4E41E 4JY4A 4Z3GA 3CVHB 3IDMA 4JCLA 1TEFA 4KK9D 4XXDB 2DKSA 3RU8L 1S5IH 5DRWB 2F68X 3BE1L 4HHAB 2JI1A 4D3CH 1R34A 3US0A 5EOTA 1DUYA 5JOFB 3RGBA 1KBVA 1INQB 3CN4A 1ZHNA 1EH9A 4K7PH 1LDSA 1M1XA 1IX2A 1PKQB 4V1DA 4ANKA 2O93L 4OT1H 5A2IH 1MFDL 2AK4E 1IZJA 5TK4A 3RDTA 4IMLA 4XCCH 5CCKL 5LDSA 4BQCA 2IAAC 2PYED 4LOFA 1T4WA 4L3CB 4P23A 4TSCL 1KOAA 2Z4TA 4LSVH 4NBZB 5AVTB 1XSKA 4GG6A 5JUEL 4YDJB 4KH2A 1II4E 3WTUA 5L88L 5HPMB 2Z65C 1VZIA 2WYZA 3BWAA 4G6KH 1YDPB 3RL1A 3SD5A 5KWYC 2DYRB 4GSXA 3DVNA 1BZ9B 4WTWA 4PHZA 5AVQB 3FT9A 5IBLD 3STLB 4ONFH 5E2UL 1JK9B 2G60L 4U1NB 2FUQA 5G55A 1QZ1A 1I8IB 4AJ0A 5EZJB 4YSCA 4QIRA 1CD0A 3BFOA 2ITCA 1Z2KA 2K7QA 4P2RE 2YGPA 2AQNA 4UBDC 1T0MA 2XQYA 4JPKH 5IWLC 2WXHA 2FSDA 3EGXB 4HXBH 4LIQE 1T21B 5CMAA 4IRJA 3E80A 1YMMA 1X5AA 1BOYA 2QGEA 4D9RD 1QTSA 5KJ4A 4PFEA 4AKQA 2Y7MA 3L2NA 4JO1H 3P0VL 3N85L 3KJ4C 1NEUA 4HISA 5C0FA 4PVLA 3JVFC 4ZW7A 1Y0LA 4NQVB 3IXAA 1MREL 5IROC 2G3XA 2JSFA 3F7VB 1QWUA 2YAQA 3N1GC 2N7SA 4AQEB 3OPZH 4F7CB 1P9MC 1JG9A 3X12A 3L95B 3WO4B 1JZ2A 4OLXL 4TUOB 2CPCA 1UGNA 3R1GH 3O3EB 1KT2A 1MJ7H 3QI9C 1U92B 2NX5B 1EAPA 2X09A 3L5IA 4WW2A 3Q05A 4HCRH 2EAEA 2A6DB 2N4IA 1KLUA 2WIIB 1QSEE 1RZIA 3F5WA 3IXTA 4HIXL 4Y19E 4UT7H 4EDXA 1F90H 4YZFE 4BUGA 5F7DA 3WFZA 1FFOA 1FG9C 4JN1L 2HN7B 4MJIB 4ENZA 1QZNA 4Y0GA 4Z5RA 3BIAX 3CFBA 2Q76B 4LHUD 1ED3A 5FUCE 2XRAL 4HUXB 4GI8A 1NEPA 4KQ4H 4FYSA 3LMJL 4OZGB 1BD2A 3ZUNC 1KXTB 3NMEA 4HHGA 5TD4A 2CRMA 2LE9A 1NBZB 4JZOB 5F2FA 4KNQA 3MRHB 5A6LA 2X5PA 2FEDD 4OZHE 5A2KH 3QUZC 2ZX8A 4A6YB 5IJVA 1RIVH 5KYUB 1XR8A 4RNRB 2Z31B 1WYJA 4OLEA 4CJ0A 3O3AB 1PTZA 3O2DA 35C8H 3VB9A 1EHXA 4NRYA 2YC1A 1KC5L 3FTGB 2Q20A 3KCPA 3NIGE 4HT1L 3UPAA 3GNMH 3EFOB 3FU3A 3HI5H 4J39A 3S37X 3CLFH 4ELKB 2RH0A 5E2VH 2VAAB 4TRPL 1YNTA 1KJMA 4M7LL 4JDEB 5EEXA 3GEWB 1EHAA 1NEZA 4OJYA 1DE4A 3DSFH 2EDQA 2YK1L 4LVNC 1S7VA 3QEUB 3KZ8A 2Y5QA 4JY5L 5GHWL 3WY4A 4U1KA 1AANA 1K4DA 2XWZA 4S0HA 5EUOF 3SCMB 1Q9KB 5KUKA 1B0GB 1EX0A 3AQDA 2YFNA 4DOHB 1KB5L 3HJEA 4O2CA 2ICES 3GLDA 3Q6FB 4IBSA 1LE9B 1ZEAH 4KZEL 3KYOB 1OALA 2I26N 2SEBA 3KYAA 2MCPL 1GGIH 3PE9A 4FNLH 1T1ZA 3LKNB 1INDH 1Q94B 4JCMA 3MJ9A 5L2KD 4IU2B 5I74B 2OZ4A 4C4BA 3C2AL 1YLBB 2BSTA 3NJVA 1KBWA 3UJJL 4OGZA 1AC6A 4PM1A 1NFAA 3KPSB 1A9EB 3MA9H 3QZWA 2AQQA 1RKRA 1VDGA 3OZLA 2V5TA 1AKPA 3FQXA 3DECA 2EEFA 4HDIA 1TJIH 4OD2B 2VDQB 4TKWA 1FZMB 5CEZH 1BBJB 3QEGL 1UTDA 2FBRA 2XVKA 2EDBA 3HS8A 3QRGL 2Y3NA 1QRND 2ATKA 2F61A 1LP9F 2K7PA 1FN4A 1G84A 1CI5A 1UH3A 4P5KA 1F4YL 2XA3A 1XIWA 1QW8A 2EDNA 4TUJB 3GBML 5I18L 3VI3F 4LSUH 1HEJC 3CVHA 3UO8B 2BMKA 1TJGL 3N0AA 2HJFB 3WN6A 2UXVA 1IQWH 4JFDE 3PNRB 1T20B 4GAYA 5E4AA 5JOFA 5DTFB 1INQA 3V4VL 3MRCB 4XAKE 1YN6B 2XVBA 1TVDA 4JRYE 4LVHB 5I1DB 2IDTA 1JGLL 3HE7B 1PGRB 5EEZA 4O5LL 5BOJA 4E9WA 4X42A 3UTOA 1GIGH 4BE6A 4L3CA 2D4FA 1KTBA 4G9FE 3SE3C 2IH8A 1WAAF 4LCCB 4YDJA 1T2JA 4EDWH 1AP2A 1NL0L 2Y7QB 5GGQH 5HPMA 5I8OL 3DHPA 2X40A 2M83A 2V17L 1DVTA 1MW2A 3DVFA 5DUMH 3RWHB 1BZ9A 4LMQE 3UG3A 2OMVB 5KS9B 1EZUA 3STLA 2H0PA 1JK9A 1TDQA 1KBGH 5E6ID 5IQOA 5KJ7E 4P4RB 5LAXB 1AHWC 3FB5A 2J1ZA 2BDNL 3QFDB 4MCMA 2V0AA 4QRRE 2EQDA 2XLLA 3Q1SH 3PNWB 1CLYH 1GY2A 3CZNA 5KSAB 1YY9C 2PN5A 4MDJB 5CINL 5IF0A 4F8OA 2X3CA 3V0WL 4JGNA 2BFGA 4PG2C 1MN4A 3EGXA 3WS6C 5JO5A 1BQRA 3FUJA 3CC1A 5ESAA 3WMQA 2ZKWA 1LO5A 1FNSL 1PJWA 5HPOA 4BK5C 1TFHA 3FQUB 4QRPE 4F20A 3MREA 4MS8D 5HYSB 1QRKA 3ZMRA 1CXFA 3IM1A 2OFQA 2B5IB 3BSHA 3WNPA 4GG8B 1NLBH 1SXCA 3BDYH 2UWEE 4M7JH 4HK3J 2Y6SC 1HCFX 3BP7B 3QZMA 2RACA 5DFTA 4UNIA 4NQVA 3KBPA 4HJGA 4ZMWA 1G7IB 3B6SB 3MVSA 3S35H 1F6AA 4MZ3A 4AQEA 4IBZA 1N68A 4JRXB 2Q6WA 1PQZA 3EADA 3L95A 1F3JB 3D0LB 3NSYA 3LNEA 2VXTH 4TUOA 1NGZB 1CDBA 4HWBA 5ETUA 1ET8A 3O3EA 4AOFA 2XQ0A 4HJIA 6PAZA 4X4MA 2NX5A 4XC3H 3VX0A 3VG9C 2A6DA 25C8L 3L45A 2DIAA 1UWXH 2GPZA 2JTDA 1D9KC 3VB8A 1X5ZA 3EHBB 4JZNA 1N5AA 4XP6L 4XP4H 2VN6A 2Y2YA 2EVFA 2H1PH 3GSRA 4K94C 4XTRC 4G8EB 3BPLB 3AG1B 1R46A 1NBZA 1RLWA 3TS8A 3GSVA 3WHE1 4ODVH 2XWDA 3T3MF 5KYUA 3SDCA 4HIEA 4FQXD 5J3HD 4H2AA 3WI9A 4XN2A 4BBWA 4GY4A 3O3AA 2OTUB 3TT1L 5BS0E 3FTGA 2BSBA 4PRNA 5DRNB 3EFOA 4R4NC 1DJHA 3HW7A 1MLBB 3C60C 5EU6E 4QUOA 4UM9B 4IOIB 4ELKA 3AB0B 2GUYA 2XY2A 2VISA 5K9JH 1JAEA 3WFHA 2VAAA 3V0IA 4PS4H 4JDEA 1JF5A 4L4JA 4L37B 5I30H 4LAQL 5HVFB 5IVXE 4EJ1C 1KGYE 1MCEA 3NIDB 5GS0D 4GKSB 4JRWA 2BHUA 2N0MA 1KYOK 5TE7L 3OLDA 2FHFA 4LOUD 3F7KA 4NQQA 1B2WH 4TOYH 2WCGA 1B0GA 1OVZA 4FZ8L 3IJYB 1HIMH 1JV2B 3S2AA 2DWTA 2G30A 2AJUL 2CR6A 7FABL 3AM8A 3Q6FA 3SPGA 4E9YA 3BP6B 1LE9A 4E0RA 4L05A 4WJKB 1IC0A 1VGEL 5FGSA 1ZSDA 1E9QB 1KGWA 2CLVA 3MRFB 5HDWA 2AAAA 1Q94A 4F27A 2VLKD 4IU2A 1D5MB 3E9UA 1HSBB 3KYMB 4WI5A 3BSGA 3QXUA 1XGQA 2VDOL 1JPTH 3UZQB 2EYRB 2APTA 1FVCB 1IFHH 3KPSA 1IGJB 2YAFA 1YEKL 3DK0A 4PRHD 5I0ZA 2HLAB 1Y6MR 2A0LD 3WY3A 4E41B 1T6BX 2BOBB 4LL4A 1UH4A 4U1LB 1RQ5A 1XQ4A 2CM6A 2BW5A 2CJUH 4OD2A 5SX4I 1PZUB 1OANA 1YEIH 3K4ZA 3SJVE 2AV1B 4AMKH 2YQ3A 3EFFA 2VR4A 1AIZA 3NUKA 1R47A 5GPRA 2P48B 2DQIH 2QSVA 4GO9A 4DN3L 1DJYA 1TZGH 2WKOF 4DEPB 4PMFA 4ATTA 1U8OA 4HAFA 3LIZH 1BQUA 3QO1A 2XC8A 1XR9A 3RZWA 3EDDA 3V7AG 3GXMA 4NQDE 2AK4B 3ARWA 4IHBA 2QR0B 4GQPH 4AMXA 2O26U 3I9AA 4GMSH 4PCSA 1T83A 3UP1A 1SYSA 1PSKH 2VZVA 4X8XA 4F37K 3X3GH 1CICC 3CLWA 4Y9FA 4Q6IB 4G42B 3FZUC 4UQ3A 5I9QC 4BFIB 5DTFA 1A6UL 1KIRA 2O5XH 2V3FA 2WTPA 4HAKA 2GK0B 4RWHA 4OCRL 2ZJSH 2DKMA 2OMTB 3C5ZB 4FG6D 4LSSH 4AYFA 4N22A 4DP8X 5I1DA 4OGAC 5AOIA 3QRLA 3BIKA 4A66A 1GS7A 5F8QC 4P4KC 3VWJD 4Y4FD 3D6GA 4JM2F 4P2RB 3IKCB 4U6HB 3E1F1 5E9DE 4PEEA 4YBLB 1YEFH 4Y5YC 1QPKA 4QF1B 5K59E 3D12B 1G7MA 4FS0A 1NUFA 4ODHL 4NQCD 2A6JB 1FA4A 2WNGA 2O4EA 3WJLA 3RWHA 1CDYA 3UAAA 4QJ5B 1GC1L 2OMVA 2XV2A 2UZIL 1ORQA 4W70A 1WT5C 3UJIL 2J12B 1WV7T 3LN4A 1YMHB 3NP4A 4KO7A 4YSPA 3GJEB 2YUVA 5C0IB 4EN3D 5KSAA 1X7SA 4MDJA 4F8QA 4H8UA 4EXPX 2WUCL 5ESQB 4W68A 4X6EB 5T3ZH 4TMPA 2VXVL 1T66C 4DUWA 1EJFA 3FQUA 4RZKA 1E4KA 2KL6A 4UTCA 2DWSA 1HHHB 2C9QA 3O2DL 4U1IB 3BWZA 3QZBA 2H45A 1QR1B 4FQ2L 1QSEB 2PETA 5I1JH 4Y19B 4JB9H 1WP6A 3MCYA 2EEAA 1EFXB 4PP1D 3UACA 2CDFB 4FNRA 1G7IA 4F37F 2O30A 3B6SA 2JLPA 2ADJA 2YD6A 5IREA 1CVSC 5IMMA 1FO0H 1IKFL 4JRXA 1XSIA 4XAWH 4Y4KB 4UV7H 5AAWA 3VMOA 2X4PA 3HNSL 2CSPA 1F3JA 4HMEA 5GGTA 4KPHL 3REWA 1NGZA 3OHXB 1H3UA 3CGTA 1I4FA 3P30L 5AKSA 4LSDA 3QCTH 1UEYA 3ZE2E 4WI6A 4PLOB 5C2UB 1MCWM 4G8GE 5I1KL 4F7KA 2YWYA 4W4OA 2C7FA 3W81A 1U36A 3U0WH 3CIAA 4RISL 4XN5A 3DOIA 3DUUA 3MJ9L 4G8EA 2OZ4L 4NO0A 3S3DB 1I1YA 1AGEB 4B96A 5LN8A 3P0YL 3I50L 2OYPA 3BZEB 3ZT5A 2DQFB 2V8MA 3H7BB 3WLBB 4JFQB 3BZDA 1MCNA 3C08H 5FDWA 3NK3A 3N9GL 1F1GA 2PR9A 1E8ZA 5EA0L 2IGFL 2OTUA 5BQ7B 3RU8H 1IGFL 2YMXH 4L2LA 1DBBL 2IFFL 4XVJL 5DRNA 4AM0B 3PJSB 5DJAA 3QIBC 2CMRL 1A14H 2ZKXA 5D7LD 4UM9A 1IBZA 2FO4B 5EEVA 1SHMA 2B4CH 4N2CA 4KY1L 5TE4H 1A6VL 2WC7A 2WSKA 3G5WA 3GPEA 5IEHB 1A4KA 4WFFD 3OB0K 3CVHL 4PWHA 2OQJA 4CN6A 2YPLD 1EANA 1JVOA 4P3WA 4AQAB 2XFGB 3O8XD 3PL6C 4U6YB 5DMIL 3JWNC 1N12A 3TJHD 1I3GH 1YSOA 5AB2A 3CH1A 1ZLUH 1MQKL 3IJYA 1TZAA 2VERA 1RK0A 3MRQB 3B3IB 1EO5A 2DIJA 3MNDA 3U9UA 4IKIA 2OL3B 4L48A 3BP6A 4JFYB 1ZHBA 4KKAC 1EGJH 4P46D 4D2NA 1E9QA 1OPOA 4K73A 1KXQA 1FL5A 5I1LB 4XNXH 4F24A 4IEFB 1VSCA 1D5MA 4FCAA 2FCBA 5B1AB 3K91A 3UZQA 2EYRA 1FVCA 1IGJA 1NGPH 3AXLA 4E5XG 2AK1H 3MRPB 4NHCH 2BOBA 4E41A 5I6NA 1W6LA 3ARGD 4LESA 4U1LA 5GRVL 2JIXD 5HGGS 4IGBD 4Z7QE 5CD5D 2K1MA 3PP4H 3D3VA 3M45A 4JFDB 1JN6A 4NCC1 5ALCL 2UVEA 5HGAB 1JPSL 2HFTA 4YHLL 4JUSA 5DHVB 2CO3A 4GS7C 3RWDB 4L4VD 5CKAA 3SPVA 1TIUA 1LK2B 4H13C 4NCDA 5IGXH 5LVEA 1TPXB 1THCA 1CFQB 2VDKL 3ESPA 4NDMB 4RX4D 4PREA 5HHPB 4JRYB 1EV2E 1GY1A 2AKRB 2J57A 3QA3B 7PAZA 4PBVC 4F9PA 2Z4QA 4P5TD 4JPVL 2AK4A 2GJ6E 4ELDA 2QR0A 1NGQL 2X4NB 3ZE0E 3RZCD 3WXWL 5EG6C 1IKNC 5K1JA 2C1PB 5EIQA 1QD0A 3HI6L 3PV7A 4G9FB 2WWNA 3CXHJ 2AJ3B 3MUGA 4A2DA 1BPLB 5LO7A 2XNAB 1V3LA 3O11A 4G42A 2R4SH 3OAWA 4JO2H 1J8HD 4Q6IA 4WV1A 3S5LG 1JE6A 3BX7C 3OKEA 4PY8I 3N43B 3SGEH 1R9FA 1I1AC 3DBXB 1ZANH 2G2PA 2GK2A 1QHQA 2GK0A 1CXHA 4U1HB 3OMIB 4MNHB 3RI5K 4R84A 4JNXA 5D2NC 1DN0B 4P2QE 1ECZA 3B34A 4MA7L 4H1LH 5GRJL 4BH8B 1NJ9A 4NHUB 3C75A 2XX1A 1TG8A 3VH8A 3RRQA 4P2RA 3Q8EA 1BQHB 1UZ6E 4HWBL 2WWMD 4QF1A 2B20A 4UIMB 4ZFGH 1ZLVH 5CD3A 5J6GB 4Y1AE 2H6PB 1CR9H 3H6AA 1GMEA 4QRPB 2QQQA 5EIIG 4TXVB 1KZQA 1UB5A 1GKOA 2ZCLL 3T0BA 2EO9A 2UWEB 5T5FL 4AV4A 2OZNA 2ZOTA 4OZFG 3RAJL 4A2MA 3TF7C 1F3RB 2B15A 2A6KA 1HNGA 3GEFA 3LN9A 5AVVB 1NGXB 5DWUL 3V0AC 3TN0D 1W80A 2OR9L 3P3TA 1XF2B 2OK0L 2BCKA 2BWQA 5ESQA 4X6EA 3P1VA 1CIUA 4NXKA 4ZW3A 2V2XB 3ILQC 5F9WC 2NDGA 4LF3B 3EBIA 3B2DC 3VQMA 2GW5A 4JHWH 1LILA 1HHHA 3LKRB 1YECL 4OKVB 4U1IA 4W9DC 4WUKH 1NMCB 1QR1A 2EC9T 4GQRA 5FYLL 1RY7B 2AZAA 2NR6C 3DJTA 3F04A 4C59B 4OGXL 3DXAD 1PJ9A 4J8RA 3TCLA 3N44F 2YD2A 5DURD 4F91B 2APSA 4BZ1H 1X5KA 3FFCD 3KGRA 3U6XS 4JG0L 4EE2A 3CE1A 1JHTA 4ZD3L 3BVNB 4N8CL 2Q5BA 4PUBL 5AKRA 1FGVH 3OHXA 1OGSA 3RI5F 5JPMC 1MCWW 3VXPB 5HHVL 3EDEA 4ESKA 1CVRA 2FRGP 1YEJL 1FYTA 3T4AB 3FT1A 3FC8A 3I84A 2K6ZA 3UYRH 1BMGA 1KCKA 1L9TA 4ZMAT 4KK6D 1MCHA 5DR5H 3QARA 4KRLB 3T2NL 5FDYA 5DHYB 3VXRE 5BS0B 3K80A 3BHBA 1WCQA 3QEGH 4HH8A 5EFIB 1TYEB 1ZA3B 5EU6B 3SYCA 1KN2H 3CZGA 2FD6H 4HKBB 1GYVA 1AGEA 4MMXA 4XNBA 3FL7A 4XMZA 4GOSA 4HKXB 4X9GA 2DQFA 2JJWA 2BIQA 3VWKD 5IVXB 5LJYH 2IQAB 3FO1B 4N90E 3WLBA 4JFQA 3D48R 3GSWA 1JV5B 4JFEA 1QR4A 3RDTC 2VDQL 2BVUA 4HIQA 1Q0XH 5FW8A 3HLAB 5FYKD 1O6VA 5BQ7A 4PVBA 3GI8L 4XHJC 3AFLA 4AM0A 1ANUA 3NCCB 3PJSA 1OWWA 4PV1C 4OF7A 2FYVA 3LZQA 1PPIA 1OM3H 2FO4A 2PTUA 2DTMH 1VADB 1DSFH 4XNMB 4GFXA 1CXLA 5IEHA 2N0KA 4JKPL 1HSAB 1LL1A 1KTDB 1YN7A 3R8QA 4J6IA 4PV9A 4X50A 1K85A 4ZT1A 3V2AR 2W9EL 1BDYA 5TF1H 4AQAA 2I7SA 4CDHA 4RMQA 4EF3A 3PGDB 4LKCA 4PV8B 2PPAA 3PG2A 2BVQB 4BCZA 3MQIA 2D03H 5E1HB 1AO7E 1KTLB 3SJVB 2NY6C 2DQCL 3D0VA 3MRQA 3B3IA 2GT9B 4IRJC 2BWDA 2QBWA 5D2LA 1PZ2A 4JFYA 1ZHKA 4IOFD 4AZ8B 4JLRB 5I1LA 3O2VH 2AERT 1UJ3B 2JV6A 2B39A 1CL7H 4OAWB 5TDPB 1JZ6A 3A6BL 1OSPL 4NQDB 5CGBA 4TSAH 3BQUD 5J4MA 1I3VA 4X5QA 3IAGC 4X2UA 1QPPA 1PLGH 5E4IA 4ODSL 5HYJD 3B2UD 3NAAL 5BVJB 3T65A 4N6RB 1AXSB 5HGAA 4OZFH 4ABQA 5A2FA 1FNSH 3RWDA 4CU6A 1HWHB 1Z9SB 1JDAA 2HVKB 4WW2C 3QA3A 3I74A 1KFAL 5DK3A 5GS1B 3OKDB 2WMPB 2HP4A 3U7YH 5L9DH 1T2QH 4OLZL 5GQBA 2R0WL 2X4NA 3GBNH 2FR4B 2F53E 4I0PD 4QXUL 4TNFA 1IM3B 3UZVB 1J1XH 2YZ8A 5HJGA 5E9DB 4G9FA 2CRYA 2YAMA 4FRWA 3W2DH 2AJ3A 2J72A 1DQVA 1EHNA 5LGYA 5DHMC 2XNAA 2Z9TA 3FSZA 2H0JA 3SE9L 1T03L 1DZ0A 3BVXA 4U1HA 5ID1A 1WF5A 5HYFA 3AG3B 4MNHA 1ZVSA 2VXUL 3OR6B 4UUJB 3EJSA 5H8DA 5DT1H 2KHAA 4ANUA 1DN0A 1XGYL 4HPOL 5T3XL 2OAAA 4XBGA 3IGAB 1GHFL 4BH8A 4W9LC 3CSPA 2VH5L 1Q8MA 1F5WA 5GGTL <