4QNPE

Crystal structure of the 2009 pandemic h1n1 influenza virus neuraminidase with a neutralizing antibody
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
224
structure length
224
Chain Sequence
QVKLQESGGGLVQPKGSLKLSCAASGFTFNTYAMNWVRQAPGKGLEWVARIRSKSNNYATFYADSVKDRFTISRDDSQSMLYLQMHNLKTDDTAMYYCVRPSIYYYASGYLDVWGAGTTVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/immune system
molecule keywords Neuraminidase
publication title Structural characterization of a protective epitope spanning A(H1N1)pdm09 influenza virus neuraminidase monomers.
pubmed doi rcsb
source organism Influenza a virus
total genus 46
structure length 224
sequence length 224
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qnpE02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qnpE01
5DURB 5BV7C 4CADA 1G0XA 1U3JA 4HBCL 5BV7B 3MYJB 4YIQB 2D03L 4NBZB 4PJGA 1FVDB 1BFVH 5GRZA 4P2OD 3A6CL 2E5EA 3BE1H 3KPRB 4LNRB 5F7KC 4ZSOE 4KRPD 3QIWB 2RR3A 3O3AA 3GK8H 1NDMB 4PJHF 1T5WB 1HILA 5D71H 4KUZL 1YMMD 4R4FH 2DF3A 4QRPA 4HEME 1Y6NR 1AGFB 2Z9TA 4L4VD 1HH9B 4E42A 3QCUH 5F6HJ 3TYGH 1P4LA 1F4AA 3MV7A 1NL0H 1HIMH 3U9PL 3BDYH 3PNWB 5JTWA 1XGYH 2WUCH 2DLEA 4AH2B 2YKLL 3IJSA 1UWEL 1YN7A 3BVNB 4YDIL 3MNVB 3FCTB 4JPWH 4M03A 2HFGL 4JFFA 4U1KA 4UNTA 3E6HB 2VAAB 1T04B 3VWKA 3TA3A 4HZLA 4H1LA 4U6HB 5CP7B 5IBUB 3HPJB 3MJ9L 1OW0A 4L8BB 4MJIA 3WIIH 4KV5E 3BN9D 2PKDA 4KGJA 4OI7A 3TVMC 3GMLA 1MOEA 3PQYA 3V7AE 5HHXL 3DO7A 1P7HL 1TCRA 3HI6H 4WFED 2IBZY 3O6LL 1OD9A 1B9ZA 1J1PL 1YMME 5ANMA 1WIUA 2VB5A 2PF6A 2QQNL 3TBWA 4B7IA 5F96H 3RWGB 4ZOCA 2ICES 3O2VL 4L4VE 2P5WA 3PWPA 4APQB 2RHEA 2OXGA 5I1GH 1RFDL 2OP4L 2X41A 1BX2A 4NQXB 2AJZB 4NYLA 1ZGLP 1J8HB 5DK2A 1HYSD 3FQXA 4NNPL 4D9RD 3B2UC 5ITBH 2GAZB 4OGAD 3QQ9C 2CMRH 2EEDA 2NY2D 4S1RL 4MQ7A 4RA0C 4F7EB 3IDNB 1K4DB 4OF5A 4WFEE 5C1MB 4OI8A 3V0WL 5I18L 3HG1D 2EDNA 3BGAA 3WO4B 5C2BH 3VDAA 2EC9U 5FKPB 4MQSB 2ARWA 2FGWH 3QG7L 4BUGA 4KRLB 1TZGL 4AMKH 4U6VH 2HMID 4XPFL 2E7CA 43C9A 4NO0B 4JY6B 3Q6GL 5HJ3A 1SBSH 3GRWA 4QRTA 1UACH 1E27A 3BN3B 2FX9H 4L1HA 1D9KD 3BQUB 1C12B 4HKBA 2AP2A 3QUXB 2DI9A 4DGYH 3VXUA 5HHOA 3WL9A 1VEOA 2ZOKB 3B5GA 3FQTA 2H2PD 4D9RE 3CUPB 1N64L 5E70A 3QO1A 4K23H 4XBEL 5BVPL 1U41A 5C0AB 4HQQL 1YYLL 2N1KA 4UTBH 1RHHB 3KJ4B 5AG8A 1JHLL 1MJ7H 1VESA 2GSIA 3HG1E 1JZ5A 4KY1H 2C3VA 1AQDB 3NMEA 1ZHNB 3U9UA 1CD1A 5KSAA 3DRQB 3OAZH 3TH4T 1JRHL 4MX7A 2GITA 4PJ5E 2AV7A 5I8KH 5CWSB 3A67H 1Y6MR 2L0DA 3Q2CA 3B5HA 3L95B 1TZHA 4I0PA 4U1HB 1U8IB 1LO0H 1CGSH 1T1WB 2V2WA 2NXZC 5ADPH 3TF7C 1A22B 1OAUH 2YMXL 4FMFA 4LSUL 5EG6C 5HHQB 3VFGL 5D7LB 2OR9H 5IB1B 2QSTA 3OKEB 4IJ3C 1PKQE 2C3WA 5I19H 3WMSA 4Z0BL 4DGIL 2DIBA 3NOIA 4WJ5A 3LS5H 3RIAK 4HLZG 4JQVC 4P5KA 2FECL 3T3PE 3T3ME 4WEMB 1CBVH 1S7UA 4EJ1C 4YHPB 3QDJB 1RUPL 4JPKH 1OAXH 1XF3A 5BW7A 1R5IB 1U2CA 3QQ3A 1EO8L 2VZVA 3CU7A 4OLEA 2LAAA 4RGOL 2AJXH 2NXYD 5L9DH 1A4KB 3NN8A 4Z7WB 1BBJB 1JGLL 1JWUA 3ECBA 3ZHLA 1T7ZA 2EDLA 5J8OA 2VDQH 1CE1H 3UO1L 4PJ7A 4NQVB 4OSUH 5EO9B 5L7XL 2XZQL 3ARDA 5ALCH 4GH7B 4X5LA 2IC2A 5DJDB 2APXA 3E3QE 1ZLWH 1OM3L 4ZNCD 4PGZA 1LD9A 5DD6A 1MCHA 5SWZA 1RJYB 4YDKL 1KIQA 1A4JB 2Q76A 3D0VB 3MRQA 5TDNB 3PL6B 4WTZG 1F6AB 2EIBA 2O61B 1NFIB 3VXSA 1NLDH 5J9PB 1RK0A 1U92B 5GZND 5B8CC 2J88L 1ITBB 1TENA 1FZOB 5MEOA 3FRUB 1RJLB 2JB6B 3QO0A 1IFHL 4BKLB 5CZKA 4XMLH 4KQ4H 3N1FC 3CVIL 1DDHB 1N2RA 4U0RB 1ZGLB 3FOMA 5HGBB 1BFSA 2F5BH 4RWYH 1WTLA 4PJXF 4Z76B 2Y5TA 1IGMH 8FABA 2XZZA 3QIUD 2F8XC 4EQ3A 1MHHB 4PRBB 5DFVC 1LGVA 2OM5A 4NKDB 4PJ8B 5ADOL 5C0IA 1X6NA 3IRZA 5FUCE 1FVEB 3T77A 5KSBB 1X3DA 1CU4H 3ILPA 1HZHH 1KEML 1HHGB 1F4YH 1KYOK 4ODSL 2FYYA 4ZOEA 4UNVA 4JQXA 1L7TL 1T0NA 3L5JA 1CLCA 2PTTA 5GS0D 4QTIL 4QHLB 4DZ8B 3BEVB 1HXYB 4CU7A 4Y16B 4NJAL 4RIRB 1XR9A 4NQSA 3SKJL 5LKNA 4DFHA 3O41A 4GKZA 3P9LB 5GGVY 1JZ3A 4DCQA 4CN6A 3CDYA 3D18A 2IPKB 3VGBA 5E08L 3KJ6L 4YC2C 1FYTB 4QHMA 4XCEB 1GAFL 4U1MB 5I1IH 3C6LA 5J1SC 1Q72L 3SKMA 4YBQD 3LHPH 5GGTH 4PRNB 4AIZB 3HRZB 5F7DA 4DGVH 3NA9L 3DI3B 4OD1H 4TN9A 3VGFA 5GISH 1ZANL 2FX8L 1CLZH 1DUYB 3IDIB 1KLGB 5FGCE 4HKZA 5DD3L 1YEFL 4IRSA 3LS4H 1A6ZA 4RMWA 4X7DC 3RP1A 5KS9E 1UWGL 2AJYH 4CVXB 1NC2D 5F89B 1QA9A 1QOKA 1A7OH 4HX1A 3RVVD 1G9NL 3JWDL 2VTFA 1LO4L 1FH5L 4PGCA 3TZVC 3MRDB 3QCTL 1MQ8A 1NQBA 3TZVB 2ICWJ 2WIIB 2Z35A 2UVEA 2NW3A 4D8PA 1RUAH 5IIEB 3BDBA 4JO2L 5C0EB 4KUCD 5L6YH 1S9WB 1UCBH 15C8H 4ZFFB 1LO3L 3MRKB 4MS8D 4IIQC 4X99A 1AP2B 3RGVC 2DI7A 2JELL 2IAMD 5INDA 1T3FB 3U4BH 3S3SA 1NGZA 3UTTB 4Y4FC 3ZE2F 2VISB 3P4OA 5DD5L 5JHLL 3G9VA 3O9WD 3BPCB 5F9WB 3J7HA 3OKLB 4DN3L 1UT9A 2EEBA 1U58A 3OHXA 3GMOA 2V5RA 4MMXC 5EH1A 2XY2A 5IBUG 1DBMH 4D9QD 8CGTA 2R0ZL 5DFTA 3QXDA 5D1XD 3OF6D 1KN4L 2CXGA 5C6PB 4K94C 5F7MC 5J6GA 1NAMB 2EEAA 4Y5VB 4A2MA 1NKRA 1A9BA 4HFUL 5EWIH 4R7NB 2HT4C 4JDZA 3C5ZB 5CEZL 4MNQB 2VN4A 5EBMB 3C5SA 4ZS6C 2M1KA 4NN6B 1WZKA 5IQ9A 3EGSA 3O2WH 4F57H 2NYYC 4E0RA 4QHNB 1EGJL 5IOPA 1XZ0B 3GRWH 1CDCA 1RIUL 2FZ3A 2KPNA 1GSMA 4K71C 3MCG1 1TCMA 4X6BA 3ZHDA 2OQJB 1PBYA 4G8EB 4P57B 4CJ0A 4K9EC 3DMMD 4TRPL 2OSLB 4D9QE 4U2YA 2IBZX 1JWSA 5DHXB 4Y4HC 4WHYH 2R2HA 1BWWA 4WY7H 3WNNA 5AZEL 4JZOB 4P5TA 3RHWK 1RK1B 3JUZA 4NGHH 2GYSA 3SGDI 5IGXL 5JOFB 3KLDA 3VA2C 4ONFL 1I9IH 2DQTH 5HVHC 5BZWA 3V6OA 2DB8A 3W2DH 1UEMA 1UA6L 1J0YA 4R6UA 2BJML 5DQ9B 4NQED 5FEBA 2VLRD 2W38A 1BFOB 3L6FA 1NBZB 1S78D 1MF2H 3Q3GB 1AXSB 5DD0L 4XX1E 3T1FA 3QNXA 2XQBH 5FCUL 3FO0L 5CZXD 2PCPB 4OV5A 1UZ6E 5FHAL 5L0QB 1F90L 3KLAA 1RI8A 2V7HA 5C0CA 4BA8A 3QQ4B 5SWSD 1G0DA 2NTSP 4C57C 5CD3B 4GLRH 3N85H 4UIMB 4R90H 3ZL4L 2PXYA 3DX7A 4Y7MA 1N59B 2O5ZL 4EDXA 3GMMA 1HHKB 1CXIA 2DQUL 4KROB 4OZGA 4J6RL 3ZDZE 4JFEB 1QSFB 1UG9A 4P46D 1Y0LA 2JCCA 5D5MB 2G60L 4NRYA 4FQ2L 4NQEE 4NC2B 1Q0YH 2VLRE 5IESH 2F53D 3QXAA 3TH2T 2ORBH 3ZTNL 1E4JA 3BI9X 4JREC 2DQJL 4R4ND 3HC0B 5C0RH 4JREB 2HA1A 1FSKB 4OTXH 2W65A 4ZFOL 4Y19A 4HAFA 5HHPA 2NY6C 2C1PA 1G6RH 2BVYA 4ZUUB 5SWSE 3D0LB 4XPHH 4OLXH 4XNZC 2AW2A 2CLRA 4POZD 3U30C 3SDAB 3OG6B 4KFZC 4XNZB 4KRNA 1BAFH 1MCDA 1RQ5A 2X1WL 3BPLC 5EUOA 4X0KA 3EOBA 5FOBA 3FT2B 3ARFC 4FFZL 3KPSA 4P3WA 5T1DL 5TDPB 3RIFF 5I75B 3WFZA 3D2UB 1YEIL 2FEDD 3KLHC 3MRJA 4ORZC 2BNQA 3G6JE 4GBXA 4RFOL 1SY6A 4Q6IA 4TTDC 1A47A 1J0JA 4IM8A 4PLKC 3BP4A 5GRJH 5KW9L 5ETUA 4M7ZC 2MFNA 2X4TB 4QKXB 1FHGA 1W8NA 4FQXB 1U93A 1V7NH 3TIDA 3X12A 4GW1B 43CAB 4MNGA 4W4OC 3HAEA 3SDCA 2R4RH 3GSNL 1KJ3H 5C0DA 1KN2H 3KGRA 2IBBA 3MTRA 1N3NA 2Y36L 1I7TB 3DRTA 3FTGA 1IKFL 1ONQB 4YX2L 3BWAB 5DA4A 1JGDA 2XNAB 4F80A 4HGWA 3P30L 1RZIA 5ERWA 2EIEA 1AGBA 3TVMD 4G6AD 4LIQE 2VLKB 1GJIA 1B2WL 2FHFA 4NNXB 1KJMB 2YA0A 4C4KT 1DTUA 3WLWD 3QSKB 4I5BB 4NP4L 2R9HD 1JK8A 2CIIB 2YC1B 3WKNA 3RU8H 3GBNH 3UYOD 4P4KC 1I7UA 4K8RD 1XGQB 1QHPA 1T89C 4L29A 2AAVA 3QR2A 1L0YA 3GSWA 3WHXB 3UJIH 4U4BA 2VABB 5AUMB 4GW4B 1B88A 3HZYB 4O00A 4RFEA 3ZKSD 2NY3D 2EE3A 2XWJA 1UQSB 1FFPA 4WWKD 5EO0B 4U31A 3LN5A 3IGAB 5FKAA 1CFSB 1OP9A 1U3HA 2I9LB 5EUKA 4AL8H 3J8F7 5FO8A 5DRXB 1FGNH 1I1AC 5MEQB 3OKNA 3QWOB 2QKIB 5I76A 5MENA 2OLDA 3C87A 3WFBL 1GOFA 3V0VA 4NKMA 1ZLWK 5FHBL 4BYHA 1D6VH 1S9VA 4CUCA 5LJYH 3L1OH 1P84K 4LKXB 3LKPA 5EC1A 5D96B 1S8DA 3D25B 2FBOJ 4P99A 5CEXB 3N0PB 5IVXA 2R2EB 1GRWA 2FBJL 5DFWH 5HI5C 2X1PA 1JMXA 4M6ML 3DX6A 3B2VH 1U8PA 3O4OC 4YFLF 3WD5L 3TEUA 1H15B 2E7MA 3O4OB 12E8L 1P9MA 3TJEL 1DLFL 4P23A 1UXSB 4EN3B 2FL5B 4K3DL 3A6CH 3CXHK 1KTDB 2ICWI 4X8JA 3VD3A 1E4WH 1XCQB 1IGJA 2AK4B 3O6FB 1D3CA 1A0QH 3PWLB 2APTA 4XCCL 3U2SB 1LNUA 4ODTL 2WIMA 4KUZH 2O5YH 4XMPL 3L3GB 3QULA 4YEFA 5IHZB 3HE7C 3HUJF 4WO4B 2QLVB 5IB5B 3HE7B 4N0CD 2VUOA 3D3VD 4N8CL 1FC2D 1OPGH 4F7CA 5E03A 2VLJD 3CSYB 2VKXA 3KS0J 1BF8A 1FDLL 3DIFA 2HFGH 3OB8A 3VCLB 3A6BL 2PTUA 1IAOB 4M6OL 4PV9B 4MAYA 5ISZA 3W39B 3TBYB 3QHZL 3MBXL 3LB6D 4Z77B 2AEQL 1M05A 1LP9A 1AKJB 1J0ZA 1LO5A 1ZLSL 1CGVA 1A7RL 3MJ9H 1YEEH 1X5GA 3MPCA 2KDGA 3G6AA 3BIBX 2BHYA 1D6EA 1QBML 1ETZB 4N8VA 5TE7L 5HHXH 4W4NA 3Q6FA 3O6LH 5JNYB 3QDME 4QXUL 1K9TA 3DETD 1NFDB 4WTWA 4H25A 4E41D 4WNQB 3CCHA 4DEPC 5E94A 1YEGL 5GSVA 3D3VE 5ACLA 1REIA 5BS0D 2VLJE 2F54B 4Y88A 3O0RL 2VXQL 3VJ6A 1RFDH 2OP4H 1FE8H 2BDNH 4AY0A 4WI2A 2V7NA 1ES0A 1CD9B 1G7MB 2H26B 4CU6A 4GG6A 1RUQL 4XNXL 3KPNA 1KPVB 4YHOL 4CNIB 4H26A 3WXVH 3T0DA 4ZYKA 4XRCB 2LE9A 4YNYA 3SCMC 3REWA 1MJUL 2Q8AH 3AY4A 3WYRA 3I6LD 3RFZC 1LO2L 3BX7C 5BRZB 1P69B 3FB8A 5TPWL 3V0WH 1ZT1A 4WV1B 1MIMH 2A6DB 5JMRA 1CICA 1JPST 1IGYB 4E41E 3QAZC 4LNVA 5FF6B 5HYSB 3QG7H 4MD0B 1QYGL 1TZGH 4XPFH 3TCLB 3GMNA 5K9JL 4I9WD 2IPTL 3EFDL 1W0VA 5E24E 1YDPA 5J6HA 4HIJA 3CZJA 5J57B 2VXUL 1R3KA 2WV3A 1P5VA 2DLGA 1DFBL 4L3AA 1GGTA 1UC6A 2B5IC 4M5YH 2KQMA 4ZQKB 2WLYA 1N64H 2B5IB 5HHNA 4HQQH 4X6CF 1FL3A 1KIPB 3I6LE 3NCMA 3PDOA 1F3DJ 2P7TB 4KKLC 3DBXB 5DFVD 1JJUA 1N0XL 5GPRA 5I17B 4N68A 1WBYB 1R3IL 4O4YH 3QUYB 3CFEB 4HWNA 4IEFB 4LAJH 5AG9A 3QUZA 1ZSDA 1IQDA 5EUOF 5JW4N 2BC4A 3N9GH 3VXPA 4ZSOA 4I9WE 2FDBP 4ZPTB 4GAFB 4PJCE 1MQKH 1XCTA 3RWFA 3HI1B 4DAGL 4HH9B 1NJ9B 2BRQA 1BMGA 3GHBL 3H9HB 3HZKA 3MA7B 1LEKB 4ZUTB 3R8QA 3UPCA 2YMXH 4LSUH 3JWOH 3VFGH 2HKHL 4OBRA 1OP5K 4JPVH 5JHDB 5KVMC 2BVUA 3KNBB 4A6YB 1KFAL 3WFEL 2VZ3A 4HUXB 2IH1A 5DGQA 5F3BB 3PGFL 4XVUC 2ADJB 2UZYB 4P2OA 3IKKA 1SY6H 2W9DL 4NQUA 1M7XA 2CDGB 1IAII 3D39B 2XKUA 3HPLB 3AB0C 3G5XA 4YO0A 1AR2A 5MERA 5E6IC 4PIRF 4FFVD 4UAOC 1EO8H 1XGRA 1N5YL 4ZXBA 1YMMA 3MROA 3MRFA 1NSNL 4RGOH 3S88H 4Z78B 3E1F1 4J3VA 4L4VA 2O5XL 5HY9B 2X4QB 1ADQL 2XG4A 3RUGF 3UO1H 3L3OA 1FG2A 3GMRA 4RISL 5T3ZL 3QDGD 1MFBL 2LAGB 2FJFA 3RWJA 3OJDA 1QNZH 4HUWA 4ORGB 3RGVD 2DLFL 2XY1A 5I9QB 3EFFB 5K9QG 4MNHB 2G2RB 3HB3C 4K3EL 1BZ9B 1D5ZB 2F74A 1EZVY 1NBQA 1UKQA 1LE9B 3QZWB 5M7QA 4MGXA 2J88H 3DGCR 3LRGA 4H8WC 4Y5XB 1I8IB 1WISA 5IF0A 3CVIH 1WCBA 2WW8A 3P0GB 5TF1L 2ZZUT 5FK9B 5IROC 5GGUA 4JGJA 3MRNA 3ARED 4FG6C 1EHNA 1QEWB 1F42A 1CGWA 5EU4A 5CBAB 5F6IB 3QDGE 4OBSA 2EYSB 2HT4D 1P6AB 4O51A 2UZIL 5DHYA 1JPFA 4LFHD 4YAQA 5ADOH 1UVQB 3RDTB 1OQOA 2V9RA 3VXRD 3O3DA 3WFHB 5HI3C 4LCYA 1T21A 1KEMH 1YNLL 2QSVA 4YE4L 2NYYD 4DVBA 3TLRA 3JVGA 4ZO8A 3DVNB 1AHWC 1FJ1B 1BEYL 1L7TH 3EO0A 4JRYB 2FWOB 2E9WA 2HVKB 4YHIB 2AEIT 1AHWB 4U6YA 1NUGA 4X6DB 1OCWL 3WS3A 3KWWA 4NJAH 3VH8A 3TFKC 5DEFB 1INEL 4Z7QE 1H3VA 4LPYA 4Y4HD 4FTVB 5GQBA 3CU1A 5IHBA 4PJ5A 3HLAA 5FO9A 2YD3A 2XWTA 4QO1A 4GKSA 4Q9QH 4RBPH 4R7DA 3L5XH 5DJYB 1YC7A 3KJ6H 1T4KB 2BCKB 4HIXL 1W0WA 3T0ED 1GAFH 2XRAL 2B4CL 2NY0C 3VXRE 5DYOB 1TVHB 3FB7A 5GSRA 1BREA 1PKQA 1KYOJ 3KPOA 1HHJB 3DX9A 3K1DA 1HKFA 1H5BB 4NSKA 3Q5YA 2R29L 3SE9L 5D70L 5DD3H 3BP6A 3EYFB 2RAMA 1M7IB 3MLTB 1MLCB 1UWGH 2GT9A 3DV4A 3U36A 3JV6A 5JO5A 4WGVB 2AJUL 5IJKA 1G9NH 5D6CB 2BY0A 1MCQA 5EOCL 3V6FB 3IF1A 1LO4H 3S37L 1FH5H 2X1OA 3HS0B 3VFWA 3BXNB 4Z7UA 3QCTH 2LTQB 2NNAB 2BX5A 3KPQB 2PR4H 2Q1EA 3T0EE 4OFIA 4HIHB 3SDDB 4PJAB 3OPZL 2R1WA 3FQNB 4IRJB 4FP8H 4YK4C 4PTUB 1Z6JT 1LO3H 1V7ML 4OZIE 1WIOA 3GUTA 3OJ2C 1LK2A 5GGRA 4JLRB 5DVNA 3QJFA 1O0VA 3EZJB 1ED3A 2X7LB 5F7EL 4PP1C 2P24A 4PJIB 2R4SL 1MJJB 5DD5H 3DARA 5HI4C 5JHLH 2ZSVA 2ARJB 1A1MB 3IFPA 4LLQA 3I02B 4DN3H 5CMAA 1CGXA 2A6JA 5L2JA 2Z92A 2R0LH 4NT6A 4KMQA 3ARRA 3RX7A 1G7JA 1KN4H 2Y7QB 2CRYA 4X7SL 1LEIB 1UB6B 2WBJB 2XOTA 4Y0GA 2R1XA 3REVA 3CZFB 1GL4B 4CDHA 5CEZH 4IS6A 3UBXI 2P8PB 2DTML 3BUYB 4OJFL 4LU5L 1EHLH 4AEFA 4NC1C 2EO1A 5JIHA 1DL7H 4RRPA 2HRPH 2X4RA 2GJ6A 4M1CC 4X9BA 1U8HA 1PG7L 4NOFA 4JN1L 4ZS7L 1RIUH 3ABZA 3PWNA 4PLKD 4MHHG 2EXYC 3RKPA 3BP7B 2JJSC 1MELA 3LVEA 1CFNB 2CK2A 5I66A 5M94B 3RY6C 2ZNXA 3GSOA 3NACL 1P7KB 4FFWD 4NO2B 1MCCA 4K8RL 1VADB 3PP4H 1EBAA 1H3UA 3B9DA 1TETL 5AZEH 3DXAD 3F7VA 4MA3A 1MH5B 1ORSA 5IGXH 3KPLA 2ZJSH 2GKIA 4UOW0 1EJ6A 1YEJL 4XB8A 5HYSG 4KZEL 1X4ZA 4UI2A 4POYA 1NCTA 3FFCD 4I0CC 1JUFA 1UA6H 3VI3E 1EPFA 2B1AL 1T2JA 2YD6A 4OUUB 2ADFL 5E9DA 5I1DA 3DYPA 3MLZH 3JZ7A 1QD0A 4JFPA 5GS1C 5F7HA 1TTUA 4KJWD 3T4YB 5H8DA 1WBZA 5IB3A 4KK5C 1P7QD 4LQFL 5HD8C 2Z31B 4NQDB 4JAMB 2P47B 4KV5F 7FABH 3VA6A 4PGJA 4JG1L 3S34H 3CNKA 5KS9A 3FO0H 3DXAE 5IFAH 2G5BA 5B38A 5FHAH 3CXDL 4FQHB 4PP2B 2AGJL 5GS3A 3KXFB 2IQ9L 3N50A 3EKCA 1MCPL 3IDMB 4KTEL 3EDDA 2OZ4A 5SV3A 4R97C 5A1AA 3ZL4H 2O5ZH 5GJSL 3FFCE 5I1LB 5BJTB 1OT1A 2DQUH 4WENB 3VFSB 4C83B 2FIKA 3OXRB 5J3HC 2HAZA 1EHAA 4PJBE 1I1AD 5FM5M 2GTZA 1EH9A 1YPZF 2G60H 3SKUD 3ZT6A 4FQ2H 1T2QH 3WKMH 1HI6B 5ACZA 1NUNB 3ZTNH 5JORB 3QEHB 2HH0H 2BNRD 2VQUA 1D5XA 4GRWF 3BSZL 3VFTB 5C7XH 1CG9B 4WHTB 3MGOA 4DKEL 1T7VA 2LU3A 2ESVB 3FFDB 1L0XA 1CD0A 2YUWA 3U7AA 4P2QA 2D0HA 1NC2A 3HE6A 3VXOA 3TPKA 4R0LC 3NAAL 5T1KA 1I8KA 1BJ1H 5DC9B 2OJZL 1U8KA 5CCKL 1BLNA 3F7RA 4MCZB 5E8NA 2AJ3B 1OGAD 4C55A 2CDFB 3CX5J 1X5AA 1HHHB 3RPKA 1KNOA 4YHML 4FFZH 4UBDD 5IV2B 2YBRA 5EU7C 5T1DH 3HZVB 4PV8A 2ZSWB 5A3IC 1U36A 5H37G 4PGDA 2PNDA 1PLGL 2BNRE 3LY6A 4LLWA 4LHUB 3RBSA 1MSPA 2IAMA 3CSPA 1DQQA 1I4FB 3GSXB 1F4HA 1KF9B 5KW9H 1WLHA 4MHHI 4XPAL 4ZUSB 3H9SB 2Q87A 4WUUD 5IB4B 3B9KA 3O9WA 3S3PA 1JGVL 4ZO9A 1DR9A 3MODL 1SEQH 4ZUVA 3HNSH 1HHIA 1MRDH 2Y36H 5E4EC 3V6ZA 1IKFH 1MAML 3KR3L 3OF6A 1OGAE 4R3SB 5E4IA 4RQQB 3WN5A 3RTQA 4U3HA 4Q7DA 4IOSD 4R8WL 5DJZB 4X7TB 5LGHL 1T0MB 4XCYA 1KCVL 2A77H 2Q86A 4DZBA 3QG6B 4PRPB 5ESVA 3QZWG 1TPXC 1Q1JL 3W11C 5DDHA 2FLRT 1XGPA 1DBJL 1IILE 3BPOB 1C08B 4PRHB 1ZVHA 4LEOA 3U4EA 4CADB 2F15A 5I8EA 3MRPA 4DJMA 1OWWA 4NP4H 1UH2A 3U7WH 2L7JA 4PJGB 4WUUE 4K3JH 5ID1A 1A14L 4ERSL 4UTAL 2BMKA 4P9HL 4GXVH 1WITA 2XXCB 1G1YA 2H2SC 1OL0A 2J8UE 3T3PF 3UAJD 3IAGC 2VE6A 3DMMA 3T3MF 3H7BA 3BJLA 5ESAA 1CL7L 3O3AB 4AQOA 2ILLA 3CDCA 3CFJA 1HILB 3FMGH 1AIFA 1XR8A 1HYRC 4EI5D 2P46B 1ZA3A 4QRPB 2CRIA 4E42B 1BF2A 1RURH 1HSAA 1P4LB 3C60D 4F58L 4J1UA 2YD9A 2W07A 5FFLA 3IJSB 1S7RA 1YN7B 2F19H 2F5AL 2MPAH 2VXSL 3V4VL 4JFFB 4U1KB 3TGXA 1IGFL 1QBAA 3QUML 3VWKB 1PDKA 4UB0L 5GRWA 3CLFL 5F7YC 2E7BA 4HZLB 4H1LB 5FHBH 3SDYL 3TA3B 1OW0C 2CUIA 2FH6A 5GRUL 4WI8A 4I8DA 4MJIB 1VFAA 3GMLB 3PQYB 3DO7B 3CIQA 5FA4A 1MFDL 1TCRB 2VWEE 4JO1H 2FBJH 4IMKA 1X7QA 2BVQA 4HH8A 3RL1A 4LCCC 5F7NC 4MB4A 3T0XA 5H94A 5ANMB 5D6DA 3WD5H 3TBWB 1A6WH 3L3IA 4F9PC 4OM1L 1DLFH 2P5WB 3PWPB 3ALPA 2DAVA 1DLHA 4LEXL 4MDIA 1CR9H 1FQ9C 4K3DH 2W0FA 3QP3A 1BX2B 4RGNB 4XNMA 1P84J 1Q9LA 4U7SA 3QIBD 4FQ1L 4NYLB 3GJFA 4ODTH 1CZ8L 4UT9L 5DK2B 4P46A 3FQXB 5C0NC 3W9DA 4G5ZL 2AK1L 2P42B 1CDJA 1PVHA 3G6JA 3GEWB 1DN2A 4N8CH 4MQ7B 2I60L 5JQHC 3STBA 3THML 1R24A 5DK0A 3DROA 1FDLH 2CLZA 3K2UH 9CGTA 5ACMA 3A6BH 5D72L 3QHZH 3VW3H 3LSOA 3CXHJ 2R23A 3C09B 5HDBE 3FAXA 3OKYA 1ZLSH 3LDBC 43C9B 1A7RH 5HJ3B 4QRTB 2MCPH 4FHBD 1E27B 4N90D 5HVFB 5HSFA 1DQLL 4OV6F 5H2BA 2NY4C 1F45A 1QBMH 2X40A 5TE7H 3CFCL 3BEWA 4HF5L 4HKBB 2NY4B 4PRAA 2FO4A 4PJ9D 3VXUB 2H8PA 3T0WA 4LVNB 3WL9B 5HHOB 3RL2A 2HJFA 3FQTB 2EKSA 3B9EA 4Y1AD 3LH2L 1R5VA 1P53A 3QO1B 1YEGH 2EECA 1Q8MA 3ZDXE 4MB5A 2GSIB 3O0RH 3M8OH 2ICEA 1N4XH 2C3VB 4LSSH 2GY5A 3U9UB 3ROOA 2DL9A 1KCUL 1CD1B 4GS7B 5KSAB 3HI5H 5DMYA 1PYWA 3C2AL 1RUQH 4KH2A 3CVHL 4Z7VE 4YHOH 1A7QH 4MX7B 1U8QA 2HTLD 2D0FA 2GITB 4M6NH 1FO0A 2D2OA 4HWBL 4N90E 3VFUA 5I30L 4UT7L 2VKWA 2AV7B 1MJUH 1IGCL 1DN0A 1R3LA 5FAAA 3GZKA 4I0PB 1TZHB 4TSBL 5TPWH 1D5BA 2I24N 2V2WB 2PO6C 5CJXC 4Y1AE 4G6MH 3TVMA 4A2LA 4XWGL 5IKCA 4YDLB 4BK5A 1IM3A 1IC4L 4Y2DC 2BVTA 4Q6YA 3PDGA 5K9JH 4WJ5B 3SEPA 2BRRL 5CILL 2PW2A 4WHCA 5GS0H 3EFDH 1MLBA 4FNLL 2I5YH 4P5KB 4PLNC 2JJTC 2YA2A 1S7UB 1JNHA 1WAAF 2P4AB 1Q38A 4FG6D 1RZFH 1XF3B 3PWUA 4PJEA 2E9BA 1F4XH 1QFPA 3QQ3B 1BBDH 1X5IA 32C2A 2VYRE 2E9JA 3CC5A 4WWKA 1MFAL 3B9VA 3I2CH 3NN8B 1KCRL 1JWUB 3ECBB 2QADC 2EH7L 4YH6A 5HI3D 1HCFX 1TJGL 5TH2A 5KVFH 2AQ1A 4ODVL 2WWKT 5IMLA 4PJ7B 1K3IA 2ZUSA 3ARDB 4DAGH 1UYWL 4ODXA 1QRND 5HYJA 3CX2A 1PGRB 2C4FT 5FV2A 3TFKD 1LD9B 5DD6B 3GHBH 5SWZB 1EMTH 1F3RB 1KIQB 2Q76B 3RI5K 3MRQB 4ZTPL 5TF0A 4WDIA 5KG9A 2HKHH 4TVPD 3L5HA 3RNQA 3D9AL 5T33H 5J11C 3VXSB 5SV4A 1RK0B 4G43A 2IMMA 3QHTC 1WFOA 1QPXA 2XIDA 5J11B 1QBBA 1YQ2A 5J56B 5MEOB 3ESVF 3QPQC 1KFAH 3X3GL 2P8LA 3WFEH 3QO0B 5A2JH 5F44A 1N2RB 2XKNA 2WUBH 2CUMA 3FOMB 3ISWA 4NCDA 3S97C 2Y5TB 2OL3L 1ZEAL 5I71C 3QDMA 4ALAL 8FABB 1N5YH 1QRNE 1ZMYA 1C16A 1IAMA 4RX4D 5C0IB 4GMTH 3L7FA 5KOMC 3L95A 3T77B 2O5XH 3D3VA 4O2FA 2X09A 4Q9BA 1ADQH 3ILPB 2VLJA 4TVPE 1V8HA 4CN4A 1AH1A 2FYYB 5F3HA 1T0NB 2IH3A 2PTTB 1KSRA 1ZTXH 5T3ZH 3VGAC 1MFBH 3V5HA 4LHUG 1V3MA 4JB9H 1XR9B 4NQSB 5DURD 2Y06L 2DLFH 1UZ6F 3O41B 5DD1L 1GGIL 4GKZB 3IXTA 4DCQB 2E8YA 3MJ6A 1CDGA 3D18B 5CGYC 1VSCA 2XZAH 5HI4D 2ICWA 3KPMA 1J1XL 4QHMB 3F7YA 3KPRD 3C6LB 3QIWD 4NM8L 3SKMB 4U3CA 1C5CL 1NPUA 5F7DB 3ZDZF 4QRUA 1VGEL 4Z7WA 3SO3C 4MLSA 3MCKA 4IRSC 4JHWL 1JTOA 4HKZB 4UMGA 4IRSB 3ET9F 1A6ZB 1XF2A 5ITFA 1H9VA 1HXMA 3L7EA 4IRZL 1WCQA 1QA9B 1WVZA 4G9DA 2UZIH 5DUML 5DWUH 3HNTL 5JIPA 2B0SH 1NGPL 4HX1B 2UY6A 1QKZL 3WSQH 4PY7A 4PGCB 2H32A 4WI9A 4AG4L 1ZLVH 4S10A 4WW2F 4FFYL 1PX3A 3R8BB 1JZ8A 3KHOA 2NTFA 2Z35B 2NW3B 4D8PB 3PGDA 4ZG1A 2YK1L 3KPRE 2NCMA 3EJYC 3DOSA 3MUHL 4OUOA 4BFIA 5B8CA 4M8VA 1TJIL 3BW9A 3FHQA 4X99B 1A3RH 1TITA 2EYRB 3ARYA 5INDB 4X9GA 3D1MC 1NGZB 3QUKA 4APQD 1B0WA 4DOHB 3P4OB 5CBEA 5DMGD 1J88A 4HIXH 2JLLA 5DC0A 4OZFA 3FKUS 4N1EA 5JDJA 5IBLC 4H1LG 1U58B 3OHXB 3GMOB 4CKVX 4ZD3H 1BM3H 4HAGA 1C5BH 3CDGA 1J8HD 3ZE1F 1MUJA 3GJFH 2C3XA 4YPGA 4OQTA 3ESUF 1NGWA 2R29H 3NFPA 5DUPL 4GQ9L 2OX5A 3SE9H 3SY0A 5J6GB 5D70H 3WFCL 4YXKH 1ZXQA 2DJUA 4LSTL 5GZOC 2ZG3A 1K6QL 3P0YL 4G9FA 1A9BB 4NQCA 4OIAA 1ZWIA 1LDSA 4JDZB 3Q1SH 3I6KA 3C5SB 3ARTA 2C26A 2MQ3A 2ATKA 5IQ9B 3DLQR 3EGSB 3UTSD 4E0RB 3CH1A 5IOPB 2FZ3B 4KJQC 1DQDH 4X6BB 4O58L 3BQUD 5LGJA 2YXFA 3QUXD 4NKIL 1V7MH 1J8HE 5LG1A 1JWSB 5F7WC 5FYJU 4OZHF 4P5TC 2R2HB 3MRGA 2PN5A 5E99L 5FM5O 2GEEA 3NTCL 4P5TB 4LIQH 5C0AD 3S8WA 5F7EH 1MHCA 4ODUA 4UUJA 3KVQA 1JN6A 3OKOA 1VKXA 4N1HB 5BZWB 1NDGA 1TXKA 2A9NH 4OKVA 5LBSL 1X5YA 5IFHL 3NIGF 1IEBA 3UTSE 2JKXA 1ZS8A 4OLYL 4X7SH 5DVKA 3K4DA 5LCVH 2E6JA 3K1KC 2X05A 1F8TL 3T0VA 5EOQL 3TBVA 5FV1L 1A1OA 3L6FB 4XBGA 3GBMH 4EZMA 4YHKH 4QHUA 2NW2A 1EAJA 5E00A 4OJFH 3G5YA 3T1FB 2R56H 4LU5H 3QNXB 5JIIA 4O02L 1Q9WA 3RBGA 1SYVA 5D7LD 4OV5B 3QDGA 4CJ1A 4QEGA 4O9HL 5C0AE 5EZLA 5HDOA 4POUB 3KLAB 3FQWA 2V7HB 5C0CB 1T22A 4IIQA 3RGVA 2EH8L 3EYVA 3N1PC 4KXZH 1RJZA 2DM2A 1UB5A 1EVTC 1GPOL 1ZAGA 2PXYB 3DX7B 5SWQA 4EDXB 3GMMB 4Y4FA 5IHUL 4FMKA 3NACH 1AY1H 2E27L 4OZGB 4K8RH 1CT8A 2A2QT 1TETH 1Y0LB 2JCCB 4MXWH 3U4AA 4NRYB 4Y5YC 4MJ2A 4R2GC 1A6VL 3QXAB 4TVSa 2HVJA 1YEJH 3OX8A 4KZEH 1OAKL 2RQ8A 3BZ4A 2YN5A 1A21A 5EU7E 3BJ91 5D7LE 2W65B 4OLUL 5DJAA 4Z95L 5EFIA 4Y19B 3KPPA 5KAQF 1XMWA 3ARQA 5HHPB 2C1PB 1MWAA 2ADFH 2C9AA 1MCSA 3VXRA 1T1YA 2ADIA 3Q5TA 3AS0A 2JIXD 4Z7OE 1CDBA 3IS1X 1I3RA 1XIWC 2CLRB 4UT6L 3UJTL 4XNUH 2NLJA 4JDTL 4UINL 5EUOB 2J5LC 4X0KB 3EOBB 5FOBB 5T1MA 1FIEA 3KPSB 2H2SD 1BJMA 3CXDH 3HMWL 3CFDA 5DI8A 3MRJB 2BNQB 3MREA 4GBXB 4Q6IB 2YXMA 4Y4HA 1MCPH 1SMOA 4KTEH 3DJ9A 3P4MA 4NRXA 3VG9C 3ZYIA 1A6PA 1NGXA 3BP4B 5CZVL 3SOBL 3PWJA 5ETUB 2HLFC 5CP3H 4HHAA 5FXCH 1U93B 3SDCC 1GOHA 3TIDB 4X5XA 3X12B 3PE9A 4MNGB 4RFNC 2HJKA 3HAEB 5DGRA 3SDCB 1L9NA 4QY8A 5C0DB 5CD5C 1TJHL 4PJDE 5TE4L 1N3NB 3WNMA 4OZIA 3H3KA 3DRTB 3EYOA 3FTGB 5ESQA 1QQDA 5FYKD 2MSPA 1JGDB 3BSZH 4HGWB 1YQVL 4DKEH 2ZCLL 3S36L 2I27N 1RZIB 4Z18A 5ERWB 1OOAA 1UM4L 1ZKAA 1J8KA 1RIVL 3NAAH 4OLZL 5D7JC 2OJZH 3UDWC 5CCKH 1LILA 3LPGA 4HWZA 1MVUA 4AT6A 1JK8B 1KUMA 1RIHL 2CPCA 1I7UB 4HG4K 3V6BR 4P3DA 3UEZA 3WV0A 4L29B 4YPJA 1TQCB 3GSWB 6FABL 2UY7A 4KK8C 2EZ0C 4XP6H 5FYKE 2BVOA 4OIIH 4RFEB 4K2UL 4K3GA 3WIFA 2XWJB 1FFPB 35C8L 4XPAH 5KSBE 3CK0H 3LN5B 4P3CL 5I73C 4PUBL 4NJ9H 5EUKB 1U3HB 5FKAB 3WCYA 1JGVH 2GQHA 5I73B 5AZ2L 5FO8B 1SBBA 3MODH 1EERB 3MLUL 4UQ3A 3OKNB 5MENB 5I76B 1FORL 3UTQA 5F7UA 1AXTH 3V0VB 4NKMB 2EKJA 3KR3H 2X42A 3MUGA 4KK9D 5T5NF 3AC0A 1EXUA 1S9VB 5E5UB 4R8WH 3ZYOA 2AABL 3LKPB 3QWRD 5EC1B 4RGMC 5LGHH 4PJCF 2WAHA 1S8DB 1OAZH 3NIDF 2NY5L 2VN7A 1G7HA 1SM3L 4JY5L 5LXGL 5GJTL 5IVXB 4YHNA 4PJFA 4I0KA 4M62L 3G5ZA 4GLRI 2XV6B 4W68A 2M2DA 3ARFA 5CSGA 4QF1A 3DX6B 5EIIA 1U8PB 4OT1L 5HPMA 2DQGL 1T03L 2BNUA 4P23B 4IHOA 4WGWB 4HC1L 5LVEA 4ERSH 4UTAH 4OF7A 1FV1A 4LLUA 2XN9D 4X8JB 4TULL 3UTTD 1IGJB 2N7BA 4X98A 5DUBA 1FNSL 4W4OA 3WXWL 1LNUB 3D6GA 4C54A 4MDJA 3VD5A 3QULB 4KHXL 1KJ2A 4NBYB 3SE4A 4W70A 5KVDL 1K85A 1IAKA 4F58H 3BZDA 5EU6D 1G9NC 3JWDC 1NMCB 4F7CB 2I07B 1H3PL 2ZCKL 1SJHA 1CIDA 1S7TA 2VXSH 2DD8L 3DIFB 3FFCA 1IGFH 3QUMH 5ISZB 3NPSC 4HUNB 4MAYB 4BZ2L 4UB0H 1FAIH 1NEZA 4Y8DC 3CLFH 1VGKA 2KH2B 5TDOB 3UBXA 1M05B 1LP9B 4MNQD 3RKDC 4PJBA 3SDYH 1LO5B 3OMZA 4JZJC 2DKMA 2G5RA 2OI9B 4U1NA 4MQTB 2VDOH 3QEUA 2XN9E 3G6AB 4HPYL 4N5ED 4NPYA 1D6EB 3STZA 1RD6A 5C71A 4U1GC 1V05A 4N8VB 3RZCC 1P7QA 1MFDH 4X80H 1E6JL 1EVUA 2JF1A 3NVQA 3Q6FB 5E2WL 4U1GB 4P4KA 4WU5A 4G6FD 4F37F 5L8KB 1BVLA 1T89A 3ZKND 4H25B 2CKBL 3LQAL 3CCHB 5E94B 5GSVB 5EU6E 1J87A 4QXTA 2WNGA 3VJ6B 1KT2A 2V7NB 1B0RA 1CK0H 3LV3A 1ES0B 4LAQL 1T83C 1CZ8H 4MNQE 4GG6B 5D7IA 1I1AA 2VDNL 3KPNB 2IADA 5IW3A 4G5ZH 4H26B 1PEZA 4H0IA 4ZYKB 3TJHD 1Z9LA 4YNYB 3REWB 2I60H 4R9HA 5LWYL 4ONOA 1YEHL 4Z9KB 4ZPVA 2X10A 3FB8B 5ECJE 1ZT1B 5ALBL 1UJ3C 2UWEF 1CICB 2QHRL 2XT1B 6CGTA 1QACA 3QQNA 1UCTA 5IWLC 1WFUA 1G9ML 3PHSA 4S1QL 5DEGA 4PYGA 3GMNB 4AEIH 3FO9A 3QPQD 1W0VB 4PD4J 1YDPB 1OGAA 4QWWC 2P43B 5J6HB 3CFCH 4DKDC 4HF5H 2H1PL 1L6XA 4HIJB 3H42L 4UDUA 2GSGA 2VC2L 2EC9T 5BV7L 1HNFA 4HEPG 5HHNB 4FN0A 3IU4L 1FL3B 3GJFK 1YY9C 2CJUL 5IM7B 1QSFD 3PDOB 2IFFH 2GK2A 3W9EA 2W60A 4M6AA 1D5MA 5EDXA 4WUUA 1EEUA 2WQ8A 4NWUL 3QISA 3KHQA 4J8RA 3QUZB 1IQDB 3CVHH 2BC4B 3P73A 1IJ9A 2J8UA 3UZVB 3VXPB 4KTDL 2XG5A 4ZSOB 5DC4B 4HWBH 5I30H 4PPTA 3RWFB 1XCTB 4UT7H 4C4KO 4KVNH 1IGCH 3CFBA 4WEUD 4TSBH 3HMXL 1NANH 5B3JE 3HZKB 3FQUA 3WFDL 4XWGH 3I3DA 4S1SL 2WK2A 4G7VL 2HWZL 1YUHA 1CE6A 1KLUA 3BGFC 1IC4H 4JEGB 3FN0H 1QSFE 3D85A 5CILH 1DSFL 5D5ME 2NY1C 5DJ8A 2IH1B 4JVPA 1QO3A 4P2OB 3H3PH 4WCYH 5K9OA 4KRPC 1KELL 4H0GA 5IMMA 4CAGA 2FHBA 3G5XB 5DSCA 4FQXD 4YO0B 5MERB 2G9HA 5BZDA 1UZ8A 4LF3A 1XGRB 4ZXBB 1A6UL 1YMMB 3MROB 3MRFB 5D1ZC 3SE3A 3HTLX 4EBQL 4LVOB 4F7TA 1S5IL 4L4VB 1KCRH 5E95B 3LMJL 3QRFM 3MV9A 2EH7H 3SCMA 2UV3A 4XCFL 4Y89A 4YUEH 3TT1L 3QH3A 1TJGH 4P48A 2YN3A 2HJLA 3L3KA 4EIGB 5FYJL 3LKRA 3MJGX 4LLVA 3L3OB 1FG2B 3GMRB 3T65A 2R69L 5HVGB 1EEYA 3EJYD 1TIUA 2FJFB 1G1CA 3RWJB 3OJDB 3BN9C 3OV6A 4HUWB 4X4ME 5AYUH 5D1QC 3AMLA 3LN4A 4JHZA 2CIKA 1CVSC 1G7QA 2F74B 3HAEG 3MFFA 4G42B 2LABA 5J12C 1FNGA 1T7XA 3QJHA 2FJHA 3DGGA 3MFGB 5D7SL 4ZMAT 4J4PD 2Y72A 3X3GH 1RULL 4PYHA 1JHKH 5CIPH 5IF0B 1U91A 1MRFL 1II4E 1WCBB 1KIRA 5GGUB 3MRNB 3OZ9L 5HHVH 1J5OL 5FO7A 3QIBA 1MCEA 1ZEAH 4LVEA 4ALAH 3HHRB 5EU4B 4O51B 4OGAC 1A7NL 5DHYB 1JPFB 4LSQH 2NY2C 4XVTL 4YAQB 3NCEB 2VJXA 4HXBL 4KKCD 4XBPA 2BY1A 3O3DB 1UM5H 4I4WA 3VI3F 1X6LA 3BOVA 4MLIA 4LCYB 1T21B 2P44B 1NMBL 4G8GA 5DQDH 4DVBB 3T1WA 3JTSA 1S9XA 1LE5A 4HCRA 4DUVA 1UM6L 1NCAL 3IFNL 5D2LE 5IT2L 4KJQD 4E5XA 1MFCL 5CJOL 2HMIC 3LAFA 4U6YB 1XGTA 3WS3B 1CF8L 3KWWB 5I1EH 3VH8B 4Z7VA 1D9KC 2OJEA 1C8PA 2IAND 3EYQC 3K8KA 4HJ0D 5BOPA 4PJ5B 3BKYH 3HLAB 5FO9B 5DD1H 1GGIH 1C7TA 1IBGL 1SVZA 2XWTB 4UV7L 4GKSB 4MYWB 2H2PC 4R7DB 5K59E 1DJSA 3MRIA 1W0WB 1J1XH 4MCYA 1MNUL 2AK4D 5E6IA 3FB7B 5GSRB 1PKQB 1C5CH 3KPOB 2GFBA 3DO3A 2LU4A 1VGEH 5DT1H 3DX9B 5KN5A 2DMKA 3QFDA 1EA9C 3C08L 2HFFA 1FCGA 4WO4D 5HY9A 2A73A 4NSKB 1KJ2H 1NAKL 1CQYA 1KTKE 4C59B 3BP6B 1NH6A 4DK3A 1U95A 3WO3B 5FECA 2GT9B 3DV4B 3U36B 2YWYA 3JV6B 5JO5B 1QRKA 4BH8A 5DUMH 3HNTH 5HGAA 2DWEA 1EEQA 2EC8A 2IANE 3JSSA 3U1SL 5J13C 3IF1B 3VFWB 4KJYA 5J13B 4AG4H 3JV4A 2AEWA 4Z7UB 5LQBH 1WEJL 3C9NA 3VMNA 1BIIA 2B2XH 2AK4E 3DECA 4RMVA 2R1WB 1ZE3C 3GUTB 4JZNA 2WP3O 1TJIH 1F13A 2ZG1A 1Q9OA 1LK2B 2DQCL 4R26L 3E3QC 5GGRB 3QJFB 5CFHA 1BJ1J 1W72A 1ED3B 1F2QA 2ITDA 4HS3A 4PBVC 2P24B 1NBVL 2ZSVB 5IROA 2BERA 4QRSA 2DYPA 3IFPB 4LLQB 3WEXA 3L3HA 4RMQA 5CMAB 1OVZA 2YPVL 3IDYC 1LDPL 2A6JB 2NXYC 2Z92B 5L2JB 2IALA 4NT6B 3B5TA 1Y18A 3QNZA 4TNVK 3IDYB 1OF2A 1G7JB 3ZDYF 2A74A 4N8VG 1AI1H 4Z0XA 4ACPA 1K6QH 3P0YH 5K9KA 1XIWD 4BFEA 4LLMA 4HK0A 3OWEA 1QFOA 2R1XB 3REVB 4HULB 2AVGA 4IS6B 1F3DH 3ZKXC 1AHWA 1NFDE 2W0PA 1KEGL 2Z8WC 3SKOA 1QRNA 4WFHD 5FUCC 2X9XA 1QG3A 2X4RB 4TSAH 4BM7A 1BZQK 2GJ6B 4L8SC 4K7FA 1U8HB 3QI9D 3QEGH 1L7IL 3QWQB 3QXWA 3PWNB 4AEHH 4X6CE 2IQAA 4OF6A 5GZNC 4O58H 2EICA 5GHWL 2HLFD 5I66B 4HGKC 4NKIH 3GSOB 3B3IA 3I6GA 2ERJB 4IMLA 3DX8A 4OGZA 3IVKA 4WW1B 5E99H 3NTCH 1CDHA 5KSUA 5CD5D 4N9GA 1FNFA 2VO5A 5JQ6L 3SGKC 3F7VB 5F88A 3SJVD 1A1NA 4MA3B 4GRLC 7CGTA 1ORSB 1C1EH 3KPLB 1K3ZA 3H8NA 4YEEA 3LQZA 4NZUL 3QIUC 4PJHA 5LBSH 4JO4H 25C8H 1JUFB 4WFHE 5MP6L 5FM8A 4HV8A 4RX4A 5HXMA 3CH8A 4OLYH 5D7JD 5E9DB 2H9GA 4FXGA 4NFCA 5I1DB 2EDRA 4K07A 4MVBD 4JFPB 1FN4A 3EDKA 5D93B 2AI0H 3DVIA 3SGJC 1WBZB 1CFQA 1WSST 5IB3B 1OTSD 3GHEH 4D0CA 5GS0C 3QA3A 3QHFL 3EJZD 5GGQL 3WLBA 3GGWA 1R3JA 1KCSH 4O02H 5KS9B 4EUPA 1S7XA 2G5BB 5B38B 1MI5E 4MXQD 2YD8A 3SJVE 4LCWA 4EI6A 4NHCL 2EZ0D 5JHDD 2V9QA 4NHUA 5DHVH 4M3KB 4QLRA 1CGTA 4GOSA 5IHUH 4BQ8A 4GQPH 1NLBL 5CKGA 1FRGL 1BD2D 2FIKB 5JW5B 5F7FA 4PGEA 4F37K 3D39D 4CL7A 3O8XD 4XHQA 4MJ4A 1JV5A 3IB4A 4JFDD 5F8RC 1N26A 3RUGE 4XGZA 4G6KL 5ACZB 4GAGL 4PB9L 4KU1A 1D5XB 4U1IA 1IAIL 3MGOB 4XWOC 4LVHB 3VRJA 5KTEL 1A3QA 5C09D 1OAKH 4PLJC 4OFYD 4P2QB 4Z95H 1NC2B 3HE6B 3RVVC 3VXOB 3KYOA 5LAXA 5T1KB 1NAML 1I8KB 3QCVL 5JHDE 1OWRM 1U8KB 2D3VA 2Q6WA 1BLNB 1ZVSA 4I1NB 3P2TA 5E8PA 5E8NB 4JFZH 3TCXA 3KYAA 5HDBF 3MLVL 3DHMA 1BD2E 4JDTH 1JBJA 4UINH 1RZJL 1KNOB 3D39E 4OM0L 2YBRB 4N0YH 4JY4A 1W0YT 1P7KA 2JJSA 1ND0A 4PV8B 3HMWH 3RY6A 2A9ML 4J2XA 2DICA 4JFDE 4RAUA 4PGDB 2XQYK 1NCBL 4LLWB 5DJ2A 2IAMB 1DQQB 5C09E 3AAZA 2DQHH 4JVUA 3SOBH 5EZOL 4P49A 4XPTL 3U0WL 3B9KB 3O9WB 1B6UA 4S2SA 2C3HA 1IQWL 2L4OA 2VZOA 4KHTH 2V5SA 4ZUVB 5D1XC 5I2IA 1HHIB 1KBGL 3V6ZB 2VXTL 3WN5B 3RTQB 2E6PA 4Z7VF 3I84A 3T4YA 3RDTD 1EO5A 4QRRA 1MAKA 4OF8A 4XCYB 3ULUD 5GS1A 1EIBA 2Q86B 4I77L 5EN2A 4DZBB 5JXED 3DSFH 1UM4H 5FGBC 1A6TA 3RZCD 5ESVB 3LKQA 5E2UL 2B39A 4OLZH 4EXKA 5DDHB 1XGPB 4JRYD 4DW2L 1EV2E 3MXVL 2HLAA 3BYTA 4LEOB 3U4EB 1GC1H 3BD5A 5I8EB 3MRPB 3UTSA 4M93C 1WWBX 4P59L 3RA7L 5E8EA 5ID1B 4ONHB 4FTVD 5C3TA 3OBAA 4HK3J 3DMMC 2BMKB 1DBAL 2QJDA 3BKJL 5TJWK 2VE6B 3DMMB 3H7BB 4CVUA 6FABH 5ESAB 4WWID 3CFJB 2VH5L 4M7KH 2YD5A 1AJ7L 5L2KD 1XR8B 1X5KA 1EFXD 4HMCA 3ORJA 4NOBA 4LSRL 3ULUE 4PRDA 1ZA3B 35C8H 4PUBH 2LV4A 3S35X 3UJJL 1HSBA 1HSAB 1YECL 4J1UB 5AZ2H 3ULVD 2AJVH 2PYED 1VPOH 1S7RB 4JRYE 3MLUH 1DQML 2EDWA 1Q9KA 1FORH 1ACYL 3BMWA 4WUKL 4R0LA 4X6DE 3VH8G 4Q97A 2W0KA 4HG4J 4RSVA 1ORQA 1IT9L 2AABH 4FTVE 2HG5A 3EJJX 4HW6A 2NY5H 1VFAB 4JY5H 1JPSH 1SVCP 1B0GA 5LXGH 4QWWD 3NFNA 3MV8D 3CGTA 5FA4B 3UP1A 5DRZA 4CBPA 4LP5A 1X7QB 2BVQB 3RL1B 3MOBH 5L2KE 1J1OL 5H94B 5I74B 4GAJL 3SDDD 5IB2A 2DQGH 4IRJD 2QQKL 1T03H 3P9WB 3L3IB 4WW2C 2X6MA 4RNRA 1DLHB 4MDIB 2J8OA 3RVXC 2XA8L 4M9PA 2PYEE 2W0FB 4CMMA 5C86A 3B6SA 2X4UA 4XNMB 4KPHH 4P46C 1Q9LB 3LEYL 2GCYA 3GJFB 4P46B 3ES6A 1HQ4A 4HPOL 5EZIH 2FR4A 3D48R 3RWEA 3W9DB 2WMPA 3G6JB 1PEWA 3ARVA 4R4NC 3MV8E 3WE6A 2BK8A 4HUMB 4PJXA 4OB5H 5F9JA 1SQ2N 1NGYA 1R24B 3MLRH 5DK0B 4RMTA 3DROB 2CLZB 2CGRL 4JHAH 3GB7A 2WBJD 4PJAE 5D8JL 3LSOB 1KJVA 2R23B 2FB4H 4XTRC 2IGFL 4RMSA 4POZC 4PJDA 2JIXA 4HD9A 5E5MA 3G04B 4HPYH 4X9FA 2NY1D 5H2BB 3OL2A 3O6KL 1F00I 3BEWB 3C6SA 4FQPA 1CFTA 4PRAB 5E2WH 2FO4B 1IC5H 5E56A 5ILTH 2H8PB 1A8JH 2FEDC 4LLAA 5GGTA 3RL2B 2HJFB 3ZLQC 1QFWL 3ZYZA 2EKSB 2NX5A 3MA9L 5HYFA 2CKBH 1R5VB 4KK6D 1KXQE 4ODHL 4TVPH 4YBHA 5IR1A 5MHSE 5T1LD 5D1ZD 4ZTOL 2VSDA 5KBNC 2ICEB 3ZTJG 1U3YA 1VERA 3MBEC 5E2TL 3ROOB 5EPMA 4KQ3L 2FH8A 1PYWB 1AO7D 1U8QB 5L8LB 4HIIA 1FO0B 4RRPG 3VFUB 1QSZA 3VFRA 4XP1H 4G8IA 1DN0B 3O4LA 2AXFA 3QPXL 1R3LB 1YEHH 1VB9A 1D5BB 4KMTH 4G6AC 3E8UL 3VE0A 5ALBH 3VXMA 1OSPL 5D1QD 2QHRH 1S3KH 2VERN 3TVMB 5IW6A 5IKCB 1XGUA 2RB8A 1EUTA 2XFXA 3UPRA 4NRZA 4GG8B 2MQ0A 3TIEA 2Z31D 4NQDD 1IM3B 4PRIA 3ARGC 3WLWC 4LCCA 1G9MH 4S1QH 3WBDA 1KB9K 2PW2B 2R9HC 4F9PA 4EUPH 1AD9A 1MLBB 3KXFD 2H1PH 4K8RC 1E4XH 3H42H 4EQ2A 1R0AL 3MNZA 1QFUL 5I1JL 2P49B 2VC2H 1YPZE 5EORL 1AO7E 1BVZA 2QSCH 1JNHB 4KVCL 2YSSA 4HS8L 3V4UL 4ELME 1RUMH 2NY3C 4ONGL 3PWUB 1OLLA 4PJEB 4GRWE 2CJUH 4WWKC 4YHYC 1FNHA 32C2B 2J6EA 3CC5B 2RCSL 4WWKB 5IQ7L 4EOWL 1KENH 3GI9L 3RJDA 2DKUA 2VR9A 3LKNA 1N7ML 5I1HL 5TH2B 4NQDE 3C8DA 5IMLB 1DBBH 1KGCD 5B38G 2QQLL 2ESVD 2FATH 4PGBA 4KDTC 3X14A 3KXFE 4ODXB 3LN9A 2DQEL 3QWRA 5HYJB 1RMFL 4M7JL 3HMXH 4QCIA 4LRNL 3EYQD 5C6TL 5JZ7D 1B4JL 4S1SH 1CXHA 4WDIB 5I8OL 5KG9B 1BQLL 5F9OL 3RNQB 1B3JA 3CPLA 3NH7L 4UOW1 1JP5A 4G43B 1DSFH 4DK6A 2F8VA 5BO1L 2P8LB 1WIPA 4OGYH 1AXIB 3RRQA 4NIKB 4EVNA 4OKDA 1KELH 4LHUD 2VOTA 2XKNB 2XN9A 3GMPA 1KGCE 1CN4A 4PS4L 2ESVE 3NCYS 2Q8BL 2VR4A 3QDMB 4NO3A 5I1KL 1FPTL 3ZZ1A 2MKLC 4N0CC 1C16B 4WRLA 4EBQH 1S5IH 3NFSL 3ULSA 4BELD 4TUKL 1FZKA 5A2LH 3LMJH 3L7FB 5IEHA 5CGTA 3D3VB 3FOLA 4O2FB 4XCFH 1G6VK 4YXLH 5EU6A 2VLJB 2FO1A 2OCFD 2NXZB 2PO6A 2O93L 3LB6C 5CJXA 5F3HB 4XC3L 3OB0K 2IH3B 5DRNA 3K74B 4JDVA 1OSZA 4IJ3B 1OB1A 4Y2DA 5JW4R 3O2DA 3V5HB 1OLZA 5GIRA 5CHNA 1GGBH 3CDFA 3IYLW 1D5IH 1RZ8A 3DETC 3QXVA 3IXTB 2N56A 1XEDA 5DEZA 2COQA 2JJTA 3P0VH 1U42A 2ICWB 3KPMB 1T5XA 3F5WA 3F7YB 1P5UA 3NGBC 2CSPA 4QRUB 3MCKB 1MRFH 5GRYA 3RQ3A 3AU1A 2C1OA 4DVRL 4PY8I 1G6RA 5ITFB 1XF2B 3MV7D 4XVSH 1HXMB 3L7EB 4G9DB 3EYUL 4X5WA 1A7PL 4XVTH 3BKML 2EE6A 4JFFD 4JRXD 3VG0L 2DQIH 4G7YL 2ICCA 4HXBH 3CD4A 3VWKD 4PY7B 2H32B 1WZLA 4PJGE 4XC1H 3WUWA 2ZKHL 1GGUA 1GOGA 1UM6H 2NTFB 2J1KA 4Z7OF 4MJID 3IFNH 4NWTL 3PGDB 4TOYL 4XX1G 2IF7A 3NCJL 5BMFL 4D3CH 4FQCL 5FM4A 4BFIB 5CLTA 5B8CB 3ARSA 3MLPA 4XB7A 3BW9B 2AQ3A 4WI7A 4OIBA 2RJMA 2VZUA 5ENWA 4G8FA 4ZOAA 1IBGH 1XF5A 3S9DB 3QUKB 3MV7E 3CMGA 1C7SA 3WIHL 3IDJA 4XP4L 3O3UN 4A6YL 3E6FA 4GRLD 2HYMA 5CBEB 1VEMA 1U6AH 2NY7L 1IGIL 2VR5A 4OZFB 4JFFE 4JRXE 1CFBA 4RGND 4L9DA 3KAAA 3N1GC 4KAQL 5EOTA 1CIUA 1T1ZA 1UGNA 3CDGB 3P11H 2ZPKL 2Z91A 1MUJB 3DURA 4YPGB 2BP3A 3C08H 1OP3K 1NGWB 4PJDF 3NFPB 1N5AA 3SY0B 4MJIE 5C0BD 5DR5L 3VU2A 3B83A 3O81A 4G9FB 4NZDA 4NQCB 1Z3GL 2XTJD 5D9SA 1ZWIB 3BIKA 3I6KB 4KI1A 5BOZG 2YEZA 4RMRA 2ATKB 1KB5A 1NMAL 2D0GA 3HNVL 2DDQL 4MSWA 3ZKMD 1WEJH 3CH1B 2ZOLB 5EO1A 2ED7A 1K2DA 1C5DA 1EX0A 3NZ8A 1QSED 5LGJB 1EDQA 3NIFE 4JVWA 3H9YA 4P5MA 1FG9C 4YC2B 2YD7A 4R26H 3MRGB 4V1DD 4LARL 5C0BE 3ZE0F 5IMKA 3GMQA 1X4XA 3NABL 1MHCB 2P8MA 4ODUB 4ZNEE 1ZHKA 2XTJE 4UUJB 3OR7A 3C8KA 1HH6A 1NBVH 4X4MA 2YA1A 1WC7A 2DRUA 1JN6B 3OKOB 1VKXB 2AEPL 5EB9A 3GO1H 4FFVC 5I1AA 4XWOD 5KSBF 3BO8A 1NDGB 4JO3L 4OKVB 4PLJD 4U6TA 2YPVH 4ZFGL 1NCCL 1LDPH 1MIEH 3MLYL 2YUVA 4PBWD 3F12A 1DBKH 1IEBB 1I3GL 1ZS8B 5GGSA 4LPVA 5CJQL 3DV6A 5F6HI 5BCAA 3K81A 1QSEE 3TBVB 5FYKH 1A1OB 2MWCA 4XBGB 2ZUYA 4QHUB 1WJ3A 2NW2B 1U8LA 5E00B 3ULUL 3HFML 1KEGH 3G5YB 2YHGA 3GIZL 4G3YL 1Q9WB 4V1DE 3ZSSA 1SYVB 3QDGB 5EZLB 1ZLUH 2EYRA 5GRVK 3FQWB 5EU5A 3RVUC 1T22B 1WAAE 2NZ9D 4IIQB 3RGVB 4F15C 3EYVB 2H41A 4U2ZA 1I1FA 5M95B 1RJZB 4JKPL 1UB5B 4GMSL 4YBLC 5SWQB 4UDTA 5GHWH 1K5NA 4Y4FB 3UXFA 5C0JA 4YBLB 4OCWH 5D2LA 1T7YA 1CT8B 3ILQC 3S4SA 2V17H 4LPCA 4NN5C 3TBTA 3TYFA 5JQ6H 5FOJA 3QDAA 3GK8L 4NUJA 4L9LC 1L4IA 3AREC 1RZGA 4R4FL 2J6EH 2HVJB 1IL1B 4OD2A 3OX8B 4NZUH 3QCUL 3ARUA 3TYGL 5T3ZD 3BZ4B 4QGYA 3BDYL 4QOKD 2W1NA 5DJAB 5EFIB 3HUJA 3MJ9A 5MP6H 3ULVL 3KPPB 3PABA 3C2SA 4JPWL 5J4MA 1W8OA 1MWAB 3VXRB 1T1YB 2ADIB 3ARDD 4YDVA 3RPIA 1I3RB 2EIDA 4L3CA 2NLJB 3I85A 4H20H 3R0MA 2BSTA 5GGQH 5T1MB 3OAUH 4YLQT 1A64A 4C58B 4LDLB 4K71B 3HI6L 1ZHBA 3WNKA 3CFDB 5DI8B 1XH3A 3MREB 5SX4I 5GXBB 3VXSD 4U3XA 4TQEL 2IANA 4Y4HB 5CINL 2A0LC 4NRXB 3P4MB 5MI0C 1NGXB 4MWFA 1R3HA 3PWJB 1KXTB 5T3ZE 4HHAB 4QOKE 1NLBH 3T0EC 4S0SD 3E2HC 4X5XB 3MUJA 3G08A 2HJKB 1MPAL 1JGEA 5GS2D 4PJ7E 4QY8B 5HVHB 5HYQA 4OCXH 3FT3A 4IDJL 4OZIB 3ZYJA 3EYOB 2YRPA 5ESQB 3VDBA 2Y9RT 1QQDB 4G6JL 4G6KH 4GAGH 4PB9H 2FD6L 4S0TD 4XH2A 4HMDA 5ITBL 3HCVA 2X1XR 2CMRL 2C7UA 5KAQG 2AV1A 5C08A 1NCUA 3VXSE 1QLEH 3QCVH 4Z8FH 3NCBB 4HWZB 2FGWL 1MVUB 3WNOA 1HWGB 3KYKL 3O2DH 3MLVH 4AT6B 1UACL 1RZJH 4KGLA 3RVXD 3RWIA 2FX9L 4OM0H 5EA0H 4NNYA 1GHFL 4P3DB 4QHKJ 3PF2A 4PREA 3L5IA 4DGYL 2M8XA 4MD4A 4N0UE 2XA3A 3CX5K 4KI5F 3MRHA 1WZ1H 2BVOB 3I50L 3WIFB 4P9ML 4NUGL 4K23L 1I1RA 4Y5YA 5EZOH 4JR9H 1IARB 4OLVH 4UOJA 3NCFB 3U0WH 4KRMB 1MJ7L 4K7PH 1RV6X 1I9JL 3G5VA 1Z0NA 2R0KL 3AUVA 4X6CA 4LBEA 2P5EA 4UQ3B 3MSPA 1WFNA 3UTQB 3MUGB 2NR6D 2NY6B 1N6UA 4HJJH 1EXUB 4XTRD 4QXWA 2RBLA 2VIRA 1XIWA 1G7HB 4I77H 5I8KL 3U30B 4LMQE 4YHNB 4PJFB 3BPLB 4XVJH 3G5ZB 4KXZI 5FUZL 2V5MA 5B3JF 1OAUL 3ARFB 4DW2H 3BKCL 4QF1B 3MXVH 4X83A 5EIIB 1RZ7L 4OGXH 5HPMB 2F53E 3SPVA 2BNUB 4IHOB 1MY5A 1PQZA 3RA7H 3QI9A 1P4BL 3FONA 1GCFA 5D5MF 1FV1B 2D4FA 3MCLL 1JPGA 4LLUB 1Z9SA 4M7ZB 4FFWC 3OAZK 4XPBL 5JUEL 3ZE1E 2YR3A 4KZDL 4X98B 3MBED 5DUBB 5C0GA 4WU7A 4YWGH 1CBVL 3SDXE 3SE4C 4MDJB 1TLKA 4L4TD 1KJ2B 3B8SA 4JPKL 4JQIH 3T2PA 1MI5A 1TDQA 2ATPA 1IAKB 3SJVA 3UJJH 4I18C 3V4PH 5KZCD 2J2ZA 1YECH 2ZUQC 3RJQB 2AJXL 2EDTA 5L9DL 1CLYL 1GZQA 5JXAH 1X5ZA 1YNTA 2ZUQB 1SJHB 1DQMH 1S7TB 1ACYH 3FFCB 2FGZA 1NEZB 1VGKB 3UBXB 4TPRH 3BHBA 4PJBB 5CS7A 5D7JA 3ARGD 3UDWA 4KJWC 5ALCL 1CXEA 4U1NB 3QEUB 1MCNA 4NPYB 1RZKH 3STZB 3RUGA 2V2TA 1KB5H 1P7QB 4OZHE 4PLOB 4DOHE 3L3JA 4UV4L 4OZFG 4P4KB 3MMEA 2OTWA 4WU5B 1BVLB 4L4TE 4GAJH 1JF1A 2QQKH 3QFJD 1H3TA 2ED9A 2BFVH 4WFGD 2YS4A 4QXTB 1I7ZA 1XF1A 2QTEA 5FGRA 4X4YA 4XMLL 3NIGE 1KT2B 1ODAA 1UKSA 1B0RB 3LV3B 1BD2A 2XYCA 3B8YA 2F5BL 5D7IB 3O8XA 1I1AB 2CD0A 3FQRA 2IADB 4MA7L 4J12A 4XMKH 1X5JA 2MQCA 4JFDA 2AJSL 1UWXH 4ZPVB 5C09A 5DO2D 5CGMA 3CLEH 4L1DA 1NCNA 3QFJE 1HN1A 5B4MC 1F4YL 5FUOH 1P4IH 4ETQA 3T8XA 2J3SA 1G9EA 2IGFH 5IVOA 1M7DA 5D2LF 4WFGE 5DEGB 4HBCH 5E7BA 2D03H 5D4QA 3TPUA 3FO9B 4U6XA 1OGAB 3Q48A 5IW1A 4UBDC 2KQNA 5C0CD 4UDUB 4D0DA 5KVGL 2C3GA 2GSGB 3UMTA 5FDWA 1QFWH 4HMEA 3MA9H 4NFBA 2PXYD 3V6OE 1FFOA 1YY8A 4HKJA 5K59F 4U33A 2DBJA 2DQFA 5B3NA 3U9PH 3W9EB 2W60B 1D5MB 3MQIA 1YEDA 4DGVL 4WUUB 2YKLH 3FRPA 2I07A 1UWEH 4YDIH 4ZUWA 1TNNA 4J8RB 3RVTD 1H0DA 3KG5A 4MJ6A 3P73B 2MOVA 2QBWA 3O3BA 2J8UB 5TDOA 3PWVA 4C56D 2K7PA 3QPXH 1X5XA 2OMNA 2W9EL 3CFBB 5C0CE 4JZJA 5C92A 3FHAA 5F9AC 3FQUB 5HGHA 5TQ0L 1SJEA 3RZCA 1H8NA 1J1PH 1YUHB 2XQYG 1CE6B 3PXJA 4M43L 1KLUB 4OZGE 1PZ5A 2QQNH 3O2VH 5IK3A 3KPSD 3BD4A 4NKOA 5ID0A 3D85B 2JCCE 1KC5L 5L6YL 3LD8C 15C8L 5DJ8B 4D0BA 4DEPB 4ETYA 4GBXD 1QO3B 1F5WA 3GI8L 3UAJC 1QFUH 4UIKL 5I1JH 5K9OB 3HC4L 2ZUWA 5EORH 5IMMB 1QUNA 2VWEC 4ZO6A 3U4BL 1VFBA 4KVCH 3V4UH 3MGAA 5DSCB 2FEEI 4C56E 4ONGH 4KKBD 2G9HB 4LFHG 4EI5C 4NNPH 5BZDB 1UZ8B 1T83A 4NKQB 3SE3C 2X89A 2R2CA 4LF3B 5L2KA 1EFXA 1I9EA 3K4AA 1GYAA 4ZAKC 5A40E 1WV7T 2RCSH 3C60C 5IQ7H 1BECA 4S1RH 1FL5A 4F7TB 4M3JA 3GI9H 2D7QA 4MB3A 3MV9B 3SCMB 1J12A 4LLYA 5F1SA 5I18H 3QBTB 3QH3B 1N7MH 2HJLB 1KB9J 4XXDA 2GHWB 2PYEA 3L3KB 3LKRB 1UJ3A 3T2QA 3KPSE 2QQLH 4LLVB 4M1GL 5DJ6A 5EWIL 3T65B 3QAZB 5IWLA 1EGJA 5BS0E 2ZUTA 1EEYB 3Q6GH 2DQEH 2KBGA 1NFDF 5FCSH 1RMFH 3RIAF 1BJ8A 3UPAA 4LRNH 4P2CG 5C6TH 2BVPA 3O2WL 3LN4B 4F57L 3MV8A 2CIKB 1G7QB 1BQLH 3ARBC 3MFFB 5F9OH 1NKOA 3GRWL 3NH7H 1FNGB 2D7PA 3MNWA 4P2YA 2BXYA 4XBEH 5BVPH 3QJHB 2FJHB 3DGGB 3ARWA 4ELKA 1YYLH 5BO1H 5IM7A 4AYFA 1BFTA 1JHLH 2DM4A 1NEUA 3WHE1 2CRMA 1VEPA 1U91B 1MRCL 4WY7L 2DM3A 5I15L 3QIBC 1KIRB 4PS4H 4I3RL 1U3HD 1ITCA 5FO7B 3QIBB 2Q8BH 2IEPA 4M7LT 5I1KH 1JRHH 4LHJB 4BJLA 1I9IL 2DQTL 1NUFA 3NIDE 3PJSA 4ODBD 5MEND 5KVEL 3NFSH 4AIXA 4TUKH 2HFEA 4XBPB 4I4WB 4NN7C 1HK6A 1KCLA 4G8GB 2VLLA 4JG0L 5DMJB 4I48A 3EZ8A 3JTSB 1S9XB 1LE5B 3H9ZA 1GC1C 3AXLA 1RVFL 4XC3H 3L5WA 4E5XB 1OTTD 4Z0BH 4DGIH 1MF2L 1XGTB 3EYSL 5KANG 4Z7VB 1X5LA 1CLOL 2E8ZA 2XQBL 1Z9OA 2OJEB 3BWUC 4NQTA 5JA9A 4K7PY 3U82B 5F1OB 3HC3L 4PJ9C 3H2WA 3VI4F 4P23D 3OXSA 3LQMA 2EDDA 1OTUD 4N0FA 3BYYA 1RUPH 2OS7A 2X70A 3U46A 3MRIB 5D7KD 1Q94A 3AB0B 4MCYB 3X3FL 1N6QL 5E6IB 4HJGA 1SYSA 4UAOB 2GFBB 5T1LA 1S7QA 5KN5B 4LGSB 3QFDB 5D1ZA 1JGLH 1NC4D 2B1HL 2HFFB 2A73B 3MZGB 3U79A 4ZFOA 2DIJA 1Q0YL 3HR5A 5IESL 4W81A 4L8CA 3EOAA 1U95B 5IVXE 1FIGL 2ORBL 5FECB 5L7XH 2HTLC 1NANI 1YPZA 2XZQH 1AO7A 1U8JA 2CO7B 4AENA 4BH8B 2NY5C 5HGAB 2DWEB 4Y4KC 4ELMA 3VG0H 4FZ8L 4G7YH 4OTXL 1I1YA 4R4BA 5ISZD 1OM3H 4MAYD 3TO2A 5C07D 3QEQD 1A2YA 2FJGA 1JI2A 4KJYB 2DM7A 4YDKH 3JV4B 1IM9D 2ZKHH 3DI2B 3RVUD 3IT8D 3C9NB 4OLXL 5D1QA 4JJ5A 4NWTH 2MTPA 4G42A 1H3GA 2K9UA 3DVGA 4RA3A 5D7KE 1BIIB 3NCJH 1BAFL 5BMFH 4S11A 3DWTA 1U8NA 4JZNB 1Q9OB 1IFHH 3ILQD 3OGCA 5KJRL 4M9OA 1JNJA 3MRCA 1W72B 2ITDB 1J18A 4HS3B 3GSNA 1A6AA 5DMKA 5ICZA 4BQ9A 4Q2ZA 4QRSB 2DYPB 4UU9A 3TN0C 3WEXB 2N4IA 1NEZG 3L3HB 1T66D 5ISZE 3UBXG 1JE6A 4R96A 4KAQH 3QEQE 5C07E 2IALB 4F2MA 1Y18B 3IS0X 1IEAA 3TO4D 2R4RL 3QNZB 1KJ3L 1OF2B 3MACL 1KN2L 4HWUA 2UWEE 4JFHD 3FN3A 3TBSA 3U83A 2A74B 3KYNA 2VZ1A 4Z0XB 5DJXA 1VACA 3HG1A 4KWUA 5FB8A 3FN9A 5K9KB 4ODSH 2DMBA 4LLMB 4JFXA 4HK0B 1TTFA 1D7FA 5H37H 3VFNA 4QTIH 1CICD 3X17A 2JB5L 3X13A 1V3KA 3SKOB 1QRNB 3SKJH 1NMAH 1D9KA 4IDLA 4K7FB 2A0LD 4GUPA 4CMHC 1RU9L 5E08H 1WGOA 2IQAB 5DJCA 3W0WD 2HP4A 3RU8L 3GBNL 1YN6A 3RIFK 3B3IB 4LL9A 5KANI 3EOYG 3I6GB 4IMLB 5CUSL 2CDEA 1Q72H 3DX8B 1AGEA 3IVKB 4JFHE 1E28A 2CR6A 2NY0B 3NA9H 5KSUB 5BQ7A 4N9GB 5GGSY 4ESKA 5DQJA 3UJIL 1VA9A 4EKXA 1ZANH 2FX8H 2Z8VC 4TUOA 5D2NC 5F88B 3GJEA 3T2OA 2WWMC 3NABH 1A1NB 3IJHA 2QL1A 1YEFH 4XAKD 3OR6A 3ULUF 3LQZB 5TGBA 5DJ0A 1LWRA 4PJHB 1NCCH 1BWMA 3LZFL 3R4DA 3JWDH 5C0FA 2BHZA 3VDCA 3UROR 2SEBA 4HV8B 4QNPF 1AGCA 4FQIL 5CJQH 2H9GB 3V5KA 4FXGB 4X6DF 3AMKA 5IVNA 3W0WE 4WFFD 1FN4B 1G9MC 3MOQA 4B7LA 1CFQB 4JO2H 5JPNA 1HWHB 3ULUH 4D0CB 3QA3B 3WLBB 4IOFD 2BOCA 1R3JB 3GGWB 3GIZH 2DN7A 2P48B 3ZO0A 4EUPB 1S7XB 4JHBA 4YK4B 3FT4A 2IG2L 4LCWB 1FNLA 2JELH 4EI6B 1G84A 3B2VL 4NHUB 4XAKE 2VDPL 1AQKL 1FZMA 2UVFA 4JKPH 3K7UA 3RHWF 4GMSH 4OD3L 3MV01 1WT5C 4Y8AA 3ULVF 2DL2A 2J8HA 3QIWC 4PGEB 4TYUA 1X9QA 3PUCA 1E4WL 2DBLL 2R0ZH 2MNUA 1JV5B 4YZFF 1A0QL 5F97E 3OKMA 5F71A 4RAHA 3HN3A 4WFFE 4ZXBD 2O5YL 4XGZB 1UWXK 3T04D 4U1IB 3EO1A 4HFUH 2APFA 4WI6A 3VRJB 4NZJA 1OPGL 5JR1L 1KLFA 3KYOB 3ULVH 5LAXB 1J10A 3L3DA 3EOTL 4JRXA 3D69A 2Q6WB 4PJAF 1ZVSB 4OF3A 2WZPD 5E8PB 1MCFA 4V2CB 1EGJH 3LPFA 1TTGA 1YEKL 4L8SA 1YEEL 3MZTA 2A83A 3IFLL 4FRWA 1CXKA 4TRPH 4JY4B 4PJIF 3S5LA 1ND0B 4GKOA 4WW1A 3KPTA 4TQEH 4RAUB 5CINH 1MCKA 4APQC 2QEJA 5DJ2B 1F3JA 1E4KC 2J4WL 4FQJL 3AAZB 3SGKA 5DMGC 4HUKB 5HDQL 2CK0L 4BZ1L 1YZZA 4GRLA 4ONFH 4S2SB 1FE8L 2BDNL 5DVMA 1MPAH 1AE6L 1URLA 2VZTA 3QIUA 1K8IA 5I2IB 4IDJH 4TTGA 1BVKA 1G0YR 3O6ML 4M61A 1L9MA 2Q7NA 2BJMH 3IDGA 3M17A 4G6JH 4JFQA 5HYEA 4X7CC 2FD6H 3WDHA 3WXVL 5C0BA 4QRRB 5B39A 3BZEA 5F1NA 5GS1B 2JTDA 5DD0H 5EN2B 2R0WL 2Q8AL 4ZNEA 3WO4C 3SGJA 1A6TB 1F4WL 3LKQB 3TC9A 2XKSA 1WWAX 5FCUH 5E1AA 1MIML 2VQ1A 1I75A 3O11A 1F90H 4OFPA 2HLAB 3UTSB 3KYKH 1DZBA 4TSCL 5E8EB 2R1YA 3OAYH 1VCAA 4M02A 3BQUC 3ZMRA 3QUXC 4R97B 4PJ5D 1GHFH 1QSEA 1IC7L 5JW5A 1F02I 2YPLD 4J6RH 1PY9A 4UQ2A 5KOVC 4BH7A 1NCDL 2XPGA 4U7MA 4M5YL 1DQTA 3I50H 3PGCA 4V1DA 1U8MA 4P9MH 4ELMF 4NUGH 4PRDB 3RGHA 3KJ4C 4H5SA 1JTTA 5F72S 2DQJH 1B90A 1HSBB 3KDMA 1WAAA 4DQOL 3BFOA 4FOMA 1I9JH 1QSVA 2R0KH 5ICYA 4P4RA 4O4YL 4UILL 1WBXA 5CEYA 1Q9KB 3OKDA 4R0LB 3W81A 5B4MD 5E7FA 2Q7YA 3N9GL 1ORQB 1MQKL 2HG5B 3HZMA 4GRWH 1B0GB 2YPLE 5CLWA 3NFNB 3BIAX 5JOPD 5DRZB 1KTLA 5FUZH 4LRIC 2EXWD 3BKCH 1YEIH 4OFDA 2ZUXA 3JWOL 1RZ7H 4RFOH 2ENSA 5IB2B 4OLWL 4JPVL 1RHFA 2A1WL 4RNRB 1P4BH 3V8OA 4F9LC 3MCLH 4K7PX 3PV6A 3NZHL 4XPBH 5JUEH 4CMMB 4YXHL 1R5WA 3B6SB 1SY6L 2X4UB 4KZDH 3GSNH 5FIEA 3ZDYE 2GCYB 1UXWA 4GJTB 1M71A 3ES6B 2VDML 5DVOA 1HQ4B 3DTXA 2FR4B 1ADQA 1BQHA 2EYTA 3RWEB 5D1XA 4YX2H 5E4EB 4JM2D 1EO7A 3EHBC 4Z7UE 5BVJA 2BZDA 3S88L 4G80A 3WE6B 3P30H 3DUSA 4PJXB 3VWJD 4JFYA 1YA5A 1CLYH 2HTKD 3OKKA 3SGEH 5F9JB 4JKWA 1NGYB 5JOPE 5JW3L 2PYFA 3RX8A 4P2RD 4HFWA 4F3FA 4QOKA 3KLSA 3GB7B 1B2WH 5FGBA 5J06A 1KJVB 1TPXB 4MAUL 4PJDB 2JIXB 4JGUA 5E5MB 4ONHA 5C9JA 3C6SB 1CFTB 1BZ7A 1QNZL 2GK0A 2GJ6D 4UV4H 3PL6C 4RDQG 1EAPA 3R0NA 2NX5B 1EZVX 1CTNA 1QLRA 4XXCC 3BDXA 3P9MA 1I8MA 5IR1B 2NQCA 3FZUC 1T6WA 4I2XE 4ZAKD 1FNEA 4P2RE 2BY2A 3K8LA 4U0RC 2PW1A 3ROLA 3RWHA 4AEEA 4M00A 5EPMB 3SBWC 3GSVA 2EDFA 3WFBH 2ITCA 4MA7H 4HIIB 4N0UA 4PJ8C 3VFRB 4G8IB 2AXFB 3O4LB 2AJSH 2GJ6E 4NQEA 1M6OA 1KPRA 2HT2D 5CAYB 2VLRA 5E9DD 3VE0B 3VXMB 1J86A 5FGSA 3MYZA 5IW6B 4PJGF 1XGUB 2XFXB 3P4NA 3UPRB 4M6MH 4NRZB 2H3NA 3TIEB 3T08A 3ARBD 4PRIB 4LCCB 3LKOA 1FL6A 12E8H 4Y16C 1FLTX 3TJEH 5SWSA 4WW2A 3UZQA 1AD9B 1JPTL 3CFKA 2BSSA 1V3JA 4ZDHA 5KVGH 3MNZB 4XCCH 4Q9QL 2YSSB 4PD4K 4GT7A 3F62A 4XMPH 2Z93A 3NA4A 3L5XL 5IMOA 2YUXA 5A2KH 2XI9A 5E9DE 2F53A 1QFHA 4M1DL 2FSEA 2FRGP 1H3XA 3LKNB 2B8OT 4M6OH 4NZTL 4EUPG 3MBXH 2AEQH 4KK9C 4PGBB 4BQ6A 5EU3A 4P2QD 3X14B 3BAEL 3HE6D 2HT3D 3SDXA 3M45A 4HDIA 4B41A 5T1KD 3G04A 1DVFD 1WTGT 2GJZA 3BGMA 3LDBB 2W9EH 4QCIB 1J0IA 3T2NL 4RBPK 2GW5A 1NGQL 3BH9A 3MRLA 1G7IA 5TQ0H 4H1LH 4QXUH 4LP4A 2AXGA 3RAJL 4M43H 2PR4L 4BQBA 3CPLB 2ADGA 1U0QA 1INQA 5A2FA 5CKAA 1KC5H 4I3GA 4FP8L 1J05A 2X4SA 3NIFF 1FNAA 4KJPD 2VXQH 3MRBA 3GI8H 4DKAA 4UIKH 4EVNB 1Z0MA 2XN9B 3HC4H 3GMPB 1P6FA 4N0RA 4CVZA 1T20A 2MJWA 4OZHA 3MBEA 4GXUN 4XNXH 4P2QE 5F9WC 3B9KD 4NO3B 4FQLL 5C8JA 4S1DD 4NFDA 4L4TA 5J1AA 5LGKA 3VFOA 4OCYL 3NBNA 2RFXA 4Y4KD 3HA0A 3QDHA 3ULSB 1FZKB 1LO2H 2R0LL 4QYOA 5IEHB 2OR7A 1DUZA 2E9IA 3FOLB 5EU6B 2UUDH 4Y5VC 3RTQD 1RAMA 4XNQA 1FFNA 4N1CA 1VENA 1UJTA