2DD8L

Crystal structure of sars-cov spike receptor-binding domain complexed with neutralizing antibody
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
212
structure length
212
Chain Sequence
SYELTQPPSVSVAPGKTARITCGGNNIGSKSVHWYQQKPGQAPVLVVYDDSDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSSSDYVFGTGTKVTVLGQPKANPTVTLFPPSSEEFQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG Heavy Chain
publication title Structure of Severe Acute Respiratory Syndrome Coronavirus Receptor-binding Domain Complexed with Neutralizing Antibody
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/viral protein
total genus 47
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2006-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dd8L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dd8L01
5K93A 1DUYA 2AJXH 2CJUL 2EXYC 3NPZB 5I16A 3GI9L 4LPXA 3P73A 4Z77B 4G6FB 1HHHB 4G3YL 5JA8B 5JW5B 4FMFA 1JPST 5F7UA 4YHIB 5C0IB 4NQED 1IGYA 4ZFGL 3CC5A 4FXGA 3CDCA 1T4KA 3BZEB 1H8NA 3DX7B 1MRDL 4ZAKA 1QR4A 3F58H 4Q58C 1MIMH 1F2XK 3QP3A 1RIUH 4QOKE 2CDFB 4HSQA 4LQFL 3ULSB 3C8HA 2FNBA 4NZRH 3BRGC 4LFHD 4LMQE 1NCDL 2J8OA 2NX5A 2BSRA 4U1MB 3CPLB 1NBVL 4JANB 3VXRD 1J1XH 3QBTB 5FK9B 3CDYA 1T2QH 1K8DB 2EDXA 5E9DB 4ESKA 2HKHL 2EO1A 4N8VA 4JO3H 2OQJB 5L8KB 4G80A 3CH1A 3V4VH 3U4EB 2DQCL 1X6LA 2EDDA 2W65A 3U36A 2Z35B 2R1YA 4L1HA 1NUFA 1R3KA 2I27N 2MQCA 4L3CA 2OSLB 5ITBH 4Z7UE 2ZPKL 3EDFA 2WANA 2EYSB 3FFCD 1QR1B 2NXZB 5EORH 4LVEA 1YEIL 3BGMA 4PJ8B 4OLWL 2VDRL 1JWSB 2VR4A 5JLZA 1YYML 3ME0A 2F54E 4S1DD 4MD5B 3W0WA 4GAYB 2EZ0C 4PD4K 3VD9A 5EZIL 5HGDA 4HC1L 3WD5L 5KJRH 4GSDL 4R6UA 1CT8A 2H32A 4MD0A 2FJHA 1K4DA 4E41B 1NGXB 4NN6C 4MA3A 3V8CA 3BDYH 4RNRA 4OM1L 3RJDA 5I1HH 4JPWL 3PV7A 5I9QB 4F37F 2VC2L 1I7UB 5J89A 1HQRB 4IMLB 3HC3H 4RGMC 5MEPB 3C08L 3OR7B 3SE4C 2R15A 1KF9B 2X10A 3MUGB 5KS9A 3WNNA 1ZSDB 4KZDL 1F4YL 3O9WD 3RWEA 1NAKH 2CR3A 2F53B 4U7KA 3O4OC 4QLRA 3GM0A 5DVLA 1CS6A 1MHCB 4X4YB 4HAFA 2OI9B 1J7VR 4AM0B 3T8XB 2JJSA 2JJTA 3U0TA 5L88H 2MCG1 1SHMA 1D3CA 5DJ0A 5GRXG 1VKXB 1KJMB 4KK9D 4CVZB 3RWFB 4F7CB 4H88H 3R0NA 4UINL 2R0ZL 2CD0A 4N1CA 5JZ7C 3MLXH 5T5FL 5MEND 2VZTA 3VXNA 4L8BA 4ELKB 3P2TA 1NLDH 5TJWK 2GKIA 1F4XL 3L5HA 4UTBH 4XNYH 1KIRB 5ERWA 1P4LA 3TNNA 2BVOB 1KIPA 1UXSA 3TT3L 3O8XC 1AE6H 1MELA 5DK2B 3LPGA 4OZIB 1RZKL 4P2RD 4CN1A 1IGML 5JXED 3H6JA 3QCVL 4YHZH 5F7EH 3R1GL 1G7HA 3PDOB 4M93B 1YNLH 5ADOH 2FB4L 4M5YL 4RFNB 1IVLA 2UZIH 1R5WB 3QDMA 4LFHG 1LK2B 3ES6B 5C09A 4IRSB 4DN4L 5E6ZA 1I1CA 5J3HD 1B6DA 4PP2A 4KJWD 4NWTH 3L3KB 3C5JB 3OBAA 5CJXA 3WN5A 1INDL 3C6LC 1MRFL 2A6JB 4Y4FB 2NTFA 1LD9A 1AI1H 2IBBA 3P4NB 4D0DB 3KYMB 4X99B 5I1GH 4XCEB 5SWZB 3RNQB 5L2KD 2GIYA 4OM0L 1PG7W 2DM3A 5SWQA 1NCAH 2HKFH 5GZOD 2ZCKL 3KHQA 4NO0B 2BNUA 5JW3H 3BVNB 4DGIL 4EN3C 1NFIB 1E4WL 1MCIA 2DI9A 4LLVB 5FM8A 1G7QA 1G9MH 4IOIB 4I3SH 1KCVH 4OKVA 3MO1B 5D1ZA 1J8HD 3G5ZA 1I7TB 2OTPA 5T3XL 4AT6B 1UEYA 2P5WD 3I2CH 4OD2A 3T4AB 2GSIB 2YBRB 4P2OD 4XC1H 3TPUA 4JRXE 3H9HB 4H26B 1FBIL 4XWOC 4JCLA 2IFFL 3TBTA 2AJ3A 1R5VA 2AERT 4RWYH 1EHXA 1RHHA 2H9GA 3TT1H 3F7VA 3WJLA 3G04A 3BHBA 3LD8C 5EN2B 5LKNA 1XCTA 3QUYD 1I1AC 3KYAA 1OB1A 3L5WB 4AY0A 4YXLL 3KAAA 2I5YL 2FEEL 2I60L 2Z93A 4J3OC 1EJOH 3WO3B 4P9ML 3LKQA 1OW0A 3GIVB 4YFLI 2H32H 2HVKA 3VXMD 1AKJA 2JIXB 3MMEA 4K71B 5T3ZL 3C8KB 4GQ9L 2GJ6A 3R0MA 4OAWA 5A2JH 4HUXA 4QNPE 4GRLD 2OP4H 1EUUA 1KJ3L 1PYWB 3VRJB 2XPGB 7FABL 1TZHB 2VOTA 5EOCJ 4RAVB 3T0ED 1NCBH 5T1KA 3PWPB 2CJUH 4N9GA 2RB8A 4A6YL 5I6XB 3MBEC 3BH8B 1WWAX 3GI9H 1C7SA 5CGTA 5DD3L 4M7LT 1YY9D 4G3YH 2AQ2A 3UTPE 1T2XA 4O5LL 5KZCD 3QXUA 3SDAA 4APQC 4X6CA 3CFCL 2M2DA 2QADD 2LU4A 1XCQB 1AO7A 2P46B 4QRRA 1BLNB 3D39A 1FVCB 4NQEA 4QRUB 1EERB 4ZFGH 3WJJC 1BIIB 3MNZA 5D7IA 1U3HB 2P5ED 3MREB 1MRDH 3WKML 4C56B 2MMXA 2MPAL 5GGQL 4GKOA 1VEOA 4JFHE 4BH8B 3O81A 4ZNCD 1MPAL 4LQFH 3LS5L 4MXQD 5IGXL 32C2B 4M9OA 1ACYL 3FOMB 4H25A 1I85A 1NCDH 4XBPA 1OTTC 4CU7A 1ZGLA 1NBVH 1R6VA 4X8JA 5FA4A 3RVXC 2BNQE 2AXJA 2HKHH 5TPWL 1FNEA 3WS3A 5BVPH 5KAQF 3QDAA 1SJEB 5BQ7A 4G6KL 2CO7B 2DQCH 2A73B 4MQ7A 4X98A 3BO8A 4LF3A 5EU6A 4P5TC 3FQTB 4F8QA 2R2BB 5ISZA 2IWGA 4B50A 2JK5B 5C0BB 4X6CF 2ZPKH 1ND0B 3GZKA 4TSBL 1RJCA 3ROLB 1J05A 5EC1A 2IH3B 3DIFB 1YEIH 3ARQA 3TYGL 4S2SA 5IP4A 3FTGA 4OLWH 2VDRH 1YYMH 3HZVA 1FCCA 5CZXC 4ORZC 3DVNB 1E6JL 3LOWA 2C3XA 2BNRD 4X5WB 5LCVL 3KYNA 5DRNB 3MV9B 3MCG1 3C60C 5EZIH 3W9EA 4L29B 4LLQB 2O93L 4JN2A 1U8PA 4HC1H 3RWCA 3WD5H 4GSDH 5JIIA 4GBXB 2NY1D 2I26N 3N1FC 2GJZB 4U1NA 3RGHA 4F2MA 3B2VL 4H0GA 4OM1H 5E08L 1HHGA 2AEQL 4MNGE 3VRLE 5D5ME 3TH2T 1UB5A 5DSCB 4JPWH 3BQUB 5HHVL 2VC2H 2CKNA 4NQXB 5K9QI 4HKZB 3BGFC 4OLVL 4NRXA 1U8MB 3C08H 1DQJB 5JOFA 4MQSB 3WE6B 3ZE1F 4F7PA 4A6YA 2AQ1A 3ZYIA 4KZDH 1F4YH 3QUZB 4CMHB 4EBQL 5K59F 4G8GD 4XNZB 3A6BL 4YAQA 1XGTB 4D0CB 1T20B 4Y5YA 4KRPB 1DANT 3QI9D 3RZCB 2BHYA 4UINH 4I4WB 2R0ZH 1NBQA 2WWMD 4J12A 1A3LL 4JY6B 5T5FH 3CFEA 4KKAD 1NBZB 1F4XH 2JJUA 3L95A 4LDEB 3G5VA 3SQOL 3MFFB 4P4KA 1FP5A 3TT3H 3SO3B 5HXMA 3I02A 1RZKH 2ZSWA 2XTJD 5JOPE 1IGMH 1NH6A 3QCVH 4YFDB 3W81A 3R1GH 1JF1B 5JXEA 2DQFB 3S37X 1RU9L 1RPQA 2FB4H 4M5YH 1TNNA 1T22B 4HJGB 1UYWL 1H15A 1ZEAL 4DN4H 3U7WL 1T0PB 3P3YA 2OYPA 1YEJL 3MV11 4YC2B 2VWEC 3MRHB 3VFUA 5IEKA 1INDH 4LGSB 1MRFH 5DTFA 2VXTL 1OTUC 5E5UB 3IDXL 3QZWG 3VWKD 1T1WA 5F21B 3U46B 3NFPB 3OGOE 3QUXC 1FIEA 3QDJD 5JOEA 4KQ3L 1BZQK 2X4QB 1SJHB 1X5ZA 1KTLA 5FO8A 3ZDYF 2ZCKH 4Y4KC 4G6JL 4DGIH 2X4RA 2YA2A 1E4WH 1H3GA 5A2LH 4Z8FL 2CIIB 2QSVA 2R8SL 2ICEA 4G8EB 1XF1A 5HHMB 5DZOA 2ZUVA 1KCKA 5GZNC 1JGDA 1RFDL 3WMSA 5T3XH 3K81A 1YDPB 2DL2A 5I73C 1L7IL 4W6XB 4ZXBB 1PZ5B 3DROB 5IQ9A 3TYFB 3UEZA 5K9KB 4JFFB 1EGJL 1FBIH 5D7JB 5E94A 4HUUA 2IFFH 5CGYC 4WEUD 4BYHA 3QJHB 5ITFB 4JAMA 5I8EB 5GS0D 5LGJB 4S1QL 4XVUD 4DK6A 2KKQA 4NNXB 1A14L 1X44A 2VN7A 4CL7A 4HKBB 1S7RA 3VCLA 1EBPA 4QRPD 5I2IB 1B4RA 1T7ZA 2YD1A 1BVLB 5DRWA 4YXLH 1BVKA 2I5YH 2I60H 1QYGL 4LIQL 5DD1L 4EI5B 3SE8L 4P9MH 1WLHA 2VLME 3RVVD 5T3ZH 3VXMA 3FL7A 1ZHKA 3TF7C 4GQ9H 3DTXA 1JUFB 3RBSA 5FDWA 1WCBA 2OTWB 3QFJB 4TNWK 1QEWA 5BW7C 1T2JA 4V1DD 1KJ3H 3ARRA 7FABH 2QSQA 1FL6B 3UYPA 5L2JA 2VLRE 5DS8B 2GFBB 3T0EA 1BBJB 2E9JA 4A6YH 3RAJL 5GGSB 5DD3H 3O4LE 2RCSL 4O5LH 4JPKL 5FOBB 3CFCH 5DMKB 1T89C 3ORJA 5IR1B 1WSST 4RWHA 5D2NB 2DTMH 3IDNB 5DD0L 3CFIC 4OCNC 5JDSA 3L6FB 5E24E 2JB6A 1U93B 3ULVL 3DMMC 4OI7A 4MHHG 4PGBA 3WKMH 5D70L 4OUOA 1BQHB 3HE7B 2MPAH 1T6WA 3AREC 5C0EA 3L7EB 1IAKB 1MPAH 3LS5H 5IGXH 3JVGC 3GM8A 4J2XA 4LNRB 1ACYH 5F1IB 5IBLC 1N5AA 1OP5K 3FB7A 4RGND 1UA6L 2GY7B 3G6JB 3CVHL 4X9BA 4QTHB 4Y5XB 5TPWH 1UWXH 3PXJA 4G6KH 3LMJL 3IGAB 2Q86B 3EZ8A 2W0FB 2IBGA 1EGJA 1DBKL 1Q9KA 1HI6B 3DX9B 5LVEA 2OXGA 5DWUL 3DLQR 4CADB 5HPMA 4TSBH 1Q9LA 4RGOL 3CVHB 1I7ZB 1P6FA 1JIBA 1Z2KA 2PETA 3TYGH 4M03A 4PY7B 4O58L 4O51B 3ECBA 2FDBP 4I77L 3LHPL 1E6JH 5HYIA 5LCVH 4Z18A 2WIMA 1I8KB 4G9DA 2H45A 3HC0A 4JFED 4XNQB 4M62L 5B21A 1G9MC 2UV3A 3IU4L 1T04B 2ICES 3BEWB 2NX5E 3BPOB 5F6HI 3B2VH 1IQDB 5E08H 2AEQH 15C8L 1KLGA 3FCTA 1AHWA 4MAYD 4JLRA 3RWDB 2R1WA 5HHVH 1A2YB 4UU9A 2D31B 5GS2H 1YQ2A 4OLVH 3FB6B 3N9GL 5BJTA 4NZTL 3CFDB 5C9KA 1U42A 5GJTL 3FHQA 5JPNB 3ETBF 5HVGB 1WAAA 4EBQH 4KUCF 5E7FA 3T77B 2W07A 1IC7L 1I8LA 3A6BH 4U1JA 1J11A 5HHPA 3OX8A 4WTZG 3T2QA 3O3DA 3W0WE 4GAJL 3HR5A 1FC2D 1A3LH 4KZEL 2FIRT 3IJHA 1ZWIB 5IHBA 3GEWB 2R2HB 5E70A 3KPSD 2FBJL 1YUHB 3HHRB 4PLNC 3SQOH 3M1BA 2VQUA 4GS7C 2A6KA 3IRPX 3VFRA 1FVDB 4ONOA 5E5MA 4YWGL 2XOTA 1GHFL 2IAND 2XFXB 3SBWA 1OD9A 4X6DA 4ZYKB 2X4SB 1E27A 2IH1A 4M8QA 1YN6A 4FFYL 1RU9H 3GMLB 2PXYD 2V2TA 3SGEH 3V7AE 1LEGA 1MAKA 4OLEA 5FM5O 2XZAL 1UYWH 3IVKA 4NRYA 3HCVA 4MLSA 1F4WL 2HT2D 1XAUA 1ZEAH 3U7WH 2JJSC 5BZWA 4P0DA 4KRMB 1ULVA 1YEJH 3KPLB 2EC9T 2RAMA 4P5MA 1T6VN 2VXTH 2XZQL 4OBRA 1W2KT 3IDXH 3ULVF 2Z31B 1OSZB 5EIVA 3HS0B 3QDJA 3EFDL 4KQ3H 4MDJB 3DURA 3UPAA 1OQXA 3KJ4C 5TFSL 3PQYB 3ARXA 1IARB 2YD8A 1Y0LB 4JDTH 4N0UB 2C3VB 4G6JH 1VA9A 4XZUB 4Z8FH 4X6DF 3VXPA 1XMWA 2R8SH 2ATPA 1WTLA 3S36X 4PJ8C 4WFHD 3VFTB 4GRWF 1GPOL 2GUOA 1RFDH 3LSOA 4R4FL 4FG6D 3IAQA 1KXTB 5DZNA 4JZNB 2X1QA 1L7IH 5C09E 43C9A 2YD3A 1CFQB 1S5HB 2AABL 4KKLC 2ARJQ 3MV8D 3WN5C 5GS1B 4LLDA 5JW4M 1QHPA 3LKNA 4ONHB 5JQHC 3SGKA 1GGTA 1N4XL 5DJDB 3VE0B 4S1QH 3IDJA 1JTTA 1N59A 5FUCE 3SKOA 4Z5RA 5I9QC 5FO9A 1N6VA 2X7LA 2GW5A 1A14H 3ARZA 2D7OA 3G08A 2ESVE 1DBAL 3KPOB 1V3KA 3B9KB 5HD8D 5IMLA 4ISVB 4QRPA 1X7QB 3ULUL 5ACZB 4ZD3L 5GGSY 2B20A 4M00A 4LVHC 4PFEA 3HN3A 4N5ED 1QYGH 4LIQH 4PJ9D 5DD1H 1JYWA 5CKGA 3SE8H 3EOBA 2DS4A 4JHWL 3O3EA 4LRIA 4YEEA 5TQ2L 3HB3D 2RHEA 1ITCA 1P7QD 2HJKB 2PUQT 2V9TA 3TO4B 3ARWA 5AUMA 2EKSA 4HS8L 3P9LB 3Q0HA 1MOEA 5CJ5A 3GJFK 3N1MC 4Z76B 2N7AA 3FT4A 3RWGB 1FVEA 2VABA 4V1DA 4ZUUB 3MRIB 1M71B 4UIMA 5E8EB 1XGQB 4RX4A 3RAJH 1FC1A 2H6PB 3U79A 3OWEA 1M05B 1F3RB 3VXSB 3ZE2F 4JPKH 1PQZB 2OTUA 4YGVA 4M6AA 3ZDZF 1GVIA 1OM3L 3EYOA 5MI0B 5DD0H 4JDZA 3ALPA 3MRJB 4W70A 3UX9B 4DCQB 2A9NL 5DHYA 3PWUA 2Z4QB 3ULVH 3VFNB 2VDKL 3TA3A 4JO1L 1OW0C 3FB5A 3BWAB 1SJVA 2CLRA 1RUKL 2VRAA 4I18B 4IRSC 4XPAL 1A6WL 3D18B 4JN1L 1RZKC 2NY6D 2YPLB 3QUKA 4X7TA 4XHJC 3S3PA 5E1AB 3FO2A 5B38B 1Z9SA 2X4OB 4QHUA 1KT2B 4JZJB 4PRHB 2GJ6E 4Y4FC 2FYYB 4FFVC 3CVHH 4KVCL 3UYOD 2ITCB 3BMWA 4KK6C 4NDMA 2M8XA 5D8JL 4GRWH 4FNLL 1FDLL 5I0DA 4J3TA 1F8TL 5C0CB 3IJYB 3D2UD 2ADIB 4R2GC 3G6AA 3Q1SL 1CGWA 1JMZA 2Y5TB 2Z0BA 4LPWA 5EO1A 2HG5B 3KPRB 1DBKH 3SDAC 4IOFC 5TH2A 5DWUH 4X6CE 1T7YA 1JI2A 3QWQB 4RGOH 1FV1A 1AO7E 4QRRE 3D39E 5FGRA 4NQEE 4CGTA 4O58H 5HYJB 5C07B 5CD3B 4HIXL 4NWUL 1F6AA 5EU5A 3LHPH 4OFPA 5IW6B 2ADJA 4U2YA 3I6KB 4FQIL 1AGDA 3F7YA 1Y18B 1CD9B 3B3IA 5IF0A 4X7DC 1NC2A 1C8PA 3WIFA 1WFUA 3QJFB 4L3ED 5EUOB 1UWEL 4LEOA 5DK0A 4M62H 1I85C 1B6UA 1J0KA 1N8ZB 4GQPH 3IU4H 3VXUE 3NCCB 5LG1A 5CBEA 1WWWX 3IKCA 4R90L 5EOTA 3I75B 15C8H 4KHTL 4MAYA 5HYQA 4MLIA 3DO7B 1T5WB 4BSJA 2W91A 2NPLX 4J3SA 2ZSVB 4HV8B 1P1ZA 3N9GH 4UT7L 4NZTH 2H3NB 5ALBL 5HHOA 1X9QA 2FZ3A 5EU6E 4M7JL 5GJTH 3ZE1E 5ISZE 1NKRA 2DQGL 4YDJB 1A4JB 2XRAL 4P46D 5K59E 3MRGA 1L4IA 2ZP0T 1IC7H 4YPGA 5CEZL 4RFOL 2Q6WB 5FO7A 1FFNA 2AJVL 1C12A 3ULUF 3OR6A 4DK3A 4OBSA 1I9IL 5F6IC 4GAJH 2IALB 1G7IA 4P3CL 4KZEH 3MA7B 3QWRD 3LH2H 5FM5M 5IWLC 3Q6GL 3VI4F 1RHFA 4HKJB 1KSRA 2FBJH 4PD4J 4NKMA 5DF0A 5T3ZE 1WT5A 4YWGH 3PL6D 4UV4L 1XGPB 1GHFH 4NQUA 1H3TA 4AH2A 3UBXA 3P9MB 4RRPA 5C9JA 4FQPA 1WWBX 1JK8B 4NT6B 5LGKA 1PEZA 2DB8A 2IAMB 4FFYH 4NYLB 3GJFB 3TVMB 3EOYG 2PXYA 3ZMRA 4G42B 4WWKB 1FG9C 1VFBB 2XZAH 4X5LA 2IBZY 1F4WH 1VADA 2KDGA 3DI2B 3CFKB 3S8WA 1GGIL 1EV2E 1Z9MA 5C0FB 2YA0A 5F9WB 1CIUA 3QXDB 1F3DH 4Y5YC 4LAQL 3VD3A 2BSSA 2XZQH 1TTGA 3W5NA 4TVPD 1X5KA 3QIBA 1DBBL 4XB7A 2H8PB 1DTUA 1NL0L 2GT9A 3EFDH 1WQVT 2A6DB 3E6FB 3AMLA 4IEFB 3NVQA 1GGYA 1TCRA 5DVNA 5TFSH 4ZAKB 4P4KC 4M9PA 5DYOB 4HUVA 3ZDYE 5JQ6L 5IB2A 3DSNA 4Q7DA 3PIQB 3REWB 2G9HA 2Q7NA 5FB8A 5J6GA 5B3JF 1JNJA 4L3AA 2F5AL 3JBG7 4PRAA 1AY1L 4CW1A 1CFSB 1GPOH 1H5BB 3CK0L 4GLRH 3HZKA 4R4FH 1FFOA 3EYVB 4EQ2A 1DN0B 4BSVA 5HI5C 2J8HA 2AABH 4JB9L 3BIAX 2D7NA 4DVBB 1DVFB 2DMKA 5AEAA 3T0VA 3V5KA 1LP9A 2ATKA 4YHML 1N4XH 2BXYA 3O6FA 2QR0A 4PJBB 3RWJB 1S7VB 1DBAH 2ZCLL 3ULUH 4ZD3H 2YN3A 5CHNB 5DMGD 5ABDE 3EJYC 4MB4A 2ZWLT 3QUZC 2QQKL 4PJ9A 2A2QT 4G5ZL 2VLKD 4JHWH 3PWJB 5TQ2H 2P8LB 3EOTL 4NKOA 1I8IA 5C2UB 2VLJD 1ADQL 4HLZH 4XNZC 4LOUC 5CP3A 4AZ8A 1HK6A 4L1DA 4NQCD 4TOYL 5GQBA 3EHBC 3OJDB 4HS8H 5I1IL 4GW1A 1F3JB 5D6DA 1N7ML 3BKJL 3OAYH 3B5HA 3KLSA 5KBNC 4HFUL 5TE6L 2XT1B 1UH4A 2P24B 1XZ0B 2GK2A 1LP9F 4GUPA 4X6BB 4JFDB 3JWOL 1EFXA 1AXSA 1KXVC 3LN5A 2N7BA 4PJGA 1OM3H 4CU6A 4KI5F 5MERA 2A9NH 3MJ7B 1JNHA 1MWAB 4QXTA 2VDKH 2W9LA 4PTUB 4LCWD 4JO1H 4DAGL 1IKFL 1AR1C 4XPAH 1RUKH 3JUZA 2HFFA 1QLRB 1L0YA 3ZTJG 1MCSA 1A6WH 3QR2A 4JN1H 5GSVB 4WUUB 5MEOA 1NGQL 1XF5A 3P77A 3OB8A 4KVCH 4RMTA 1NMCB 5D8JH 4FNLH 1FDLH 1F8TH 3L3JB 4AIOA 1ORQA 3Q1SH 5ID0A 4Y1AA 5IM7B 4K3DL 1IILE 4LPVA 3IFPB 1N2RB 4DGYL 1D5MA 1X4XA 3CSYB 4PJGF 2ENSA 4KJQC 1PX4A 3U2SA 2AEWA 3Q6FA 4WHCA 4L4VB 4M4RA 3RDTD 1S78C 3AAZA 2O5YL 3EIFA 4HIXH 4NWUH 2Y9RT 2HN7B 2R9HD 4FQIH 2ED8A 4HIJA 1WFTA 1A21A 4ZXBC 3OKYA 4MNQB 1C16B 5TDOA 2HLAB 5JORB 1UWEH 3VXOB 1ETZB 2PNDA 3KPPA 4KKNA 3D3VA 4ZFFB 5GHWL 1UM4L 4R90H 2EDLA 4O2EA 1G7QB 4KHTH 5FV1L 4HWZA 2Y36L 1SVCP 5ICXA 5D1QB 1A6AA 1CTOA 2ARWA 4UT7H 5ALBH 4GAGL 2EXWC 4M7JH 3S6CA 2DQGH 5I75B 4PTTA 1HSAA 3PF2A 2XRAH 3OJMB 3MX0A 5DEFA 1UQSA 3L5XL 4P46A 5HY9A 4RFOH 5CEZH 3FRPG 3V95A 4ZUSB 1U8IB 2HT4C 3UTTB 2AJVH 3V79C 1T3FB 3MBXL 5IEHB 3QFJE 4BFIA 1I9IH 3ARFB 1JPTL 5INCB 1EXUB 1XCTB 4P3CH 2APWA 4HAGA 4LIQE 4PRNB 3Q6GH 3GJFH 1EMTL 5F9JA 2AXFA 3QRGL 4NO3B 1G84A 1KJ2L 1SQ2N 5J11B 4GKSA 4XBGA 4UV4H 4YHNB 3MMEB 5CP3H 1C5DB 2A0LD 1LEIA 1X5XA 1U8QA 1EEQA 3FQWA 1CGYA 4QHLB 4Z7QF 3F65A 3QIUD 1KTRL 4JRYA 1A1NA 4PV8A 2ICWI 4MMZC 3GSUA 1OTSD 4RA3A 3IFLL 3SO5A 1GGIH 1S9YB 1A9BA 3VMNA 3K1DA 4CNIA 3I6GA 4LAQH 5E8NB 5HVFB 2NY3C 3ULVC 1TNMA 2IF7A 3P4OB 3WEXB 1DBBH 3ULVE 5IFHL 2DM2A 5ESQA 1YMMD 3GGWB 1NL0H 5SWSB 2SEBB 5FCSH 3IETA 3CDFA 3V6BR 3BEVB 4HGWB 2FHFA 4LDOB 2H2PD 4NHUA 1BX2A 2C7UB 1KC5L 4PJXB 5JQ6H 3GMRB 1J0IA 4MA8L 3JXAA 1INEL 2FIKA 4XHQA 4X6DE 3LN4B 3ILPA 3HLAA 4PJCA 2F5AH 3KXFE 1AY1H 3K8LA 3VXRB 3CK0H 4JM2A 4GRWE 4ZSOA 4E5XA 3OXSA 5LAXB 3RA7L 1QSEA 3STLB 5E4IA 5F88B 1EVTC 4CN6A 4CRPA 4P57A 3PE9A 4JB9H 5DVKA 1ZT4A 1A64A 4X4XA 4HJJL 3ARGA 3DHJA 4R4BA 3BPOC 4YHMH 4MB5A 2AXGB 5JUEL 5CEYB 3FFCB 4PJDA 4NKQB 1RJZB 1RY7B 1CDHA 4U6VL 5DGRA 4LSVL 3QDJE 3QSKB 2VQ1A 3L3OA 2ZCLH 2DMBA 5DJ2B 3DXAD 1G6VK 4IHOB 4JY4A 3O0RL 2QQKH 3TH4T 1KJ2A 4G5ZH 4YDVB 3CFBB 5H2BB 4XAKD 3QDGA 3GMQB 4KTDL 2A6IA 4FQXD 2RFXB 3WNOA 2YD7A 1KN4L 3EOTH 2MHAA 3MV7D 4TUJB 1ADQH 4PJCF 3L3GA 4U1NB 1CXEA 4TOYH 5EC2B 4ZMAT 4JM2F 3QXWA 1UB5B 5I1IH 2ADFL 5T5NF 4R3SB 1D6VL 4AEIL 1UJ3B 2DLGA 1N7MH 2GI7A 5DJ8A 4KAQL 3BKJH 2YXMA 3WFBL 4HFUH 4GW5B 5TE6H 1LDPL 3SGKC 4GXVL 3JWOH 3O9WB 1DUZA 3MRDB 1HZHL 4PJDF 5D93B 2K1MA 3QCUL 3ZE2E 4S10A 3CZJA 3ZDZE 3SE3C 4YAQB 3U0PA 1HN1A 3C09C 2XWTA 4EVNA 4EEEA 4QRPE 1PG7L 2VDQL 5B4MD 4JVUA 4HGMA 1ZVHA 4DAGH 1IKFH 4LRIC 1GGCL 3H9SB 5MENB 3GSNL 1W72L 2XY2A 4XPGL 3WNLA 3QUML 4HW6A 3HPJB 4KK8C 3X13A 1NGQH 4UAOB 4MA1B 4WHYG 5GXBB 3AXLA 1JN6A 2Z31C 4PJIA 3X11B 2BHUA 4P2RB 3OGCB 3VXTA 1FNGA 3DGCR 1YMHA 2RGSA 2PW1A 2FGWL 3MZGB 1L0QA 3PWVA 3EKCA 4L8CA 3QUMB 3DRQA 4I2XB 3IYLW 1WITA 4JJHA 2FO4A 4K3DH 5GRZA 2I25N 3EGSA 4PRPD 4ZUVB 4DGYH 4HJ0D 1OLLA 4LGPB 2DKUA 2WINA 4WU7B 1P2CB 3AGVA 4OGYL 2LE9A 5D6CA 4ZS6C 5JMRA 1HNGA 4LCCA 3T0DA 2IPUK 2O5YH 3ZHLA 4Y19D 3NFSL 3ROOB 3TA3C 1T5XB 1HQ4B 2ZOLB 2QKIA 4KRLB 1SYSB 4NBYB 5L2KB 3WFHB 4MSWA 4PP1D 5AYUL 3LKSA 1FORL 5IFJA 1WC7B 1F3DJ 5GHWH 2J88L 1UM4H 5HDLA 3IDYC 5H35B 2LQRA 4PJIF 2Y36H 2B2XL 3EO1B 1WUNT 3NPSC 4NQDD 1HEZB 2X09A 3B8YA 3GSRA 1MFEL 2E7HA 2C3HA 2K7QA 1J8HB 4GAGH 3L7FA 1NGWA 1IGJB 3QQ9C 3QA3B 2P5WB 4WWID 2GY5A 4WFFE 1MFDL 4HMDA 4P2OB 2VZSA 3D0LA 3SKMB 1W0WA 3L5XH 3ARBD 1WFOA 1T21B 5EH1A 1U8KB 3D0VB 2KPNA 1Z9OA 4LPUA 5DFVC 3MBXH 4I0PA 1HOCB 1TJGL 5A16A 3ULUC 3LEXB 1YPZB 3DNKA 5K9OB 3ULUE 1JPTH 2QQQA 1YNTB 3H8NA 3D85B 5CLTA 4JE4B 3QUYB 4HDIB 4XVTL 1LE5A 1OF2A 3QIWA 1EMTH 3GSNA 3QRGH 3VI4E 1KJ2H 3V5HA 1W72A 2A74B 1BBDL 1A9EB 4PV9A 4UQ2A 5A40E 3AU1B 2WNGA 3QNZA 3VXSE 2GTWB 5EWIL 1KCRL 3E1F1 2VIRB 2X9YA 4JEGB 4TULL 1HHJA 1HXMA 3EOAB 4MZ2A 4Y2DD 1HINL 4GRLB 3MRPA 5HHOE 4WHDA 3QIUA 5CBAA 2EE9A 3DV6A 2QBWA 3REVB 5C0AD 1IC4L 3IFLH 1PY4A 3H9YA 3LY6A 3IFOB 2XN9D 5F1NB 1BD2A 4JZJC 1FAIL 3AB0C 1CWVA 5KZCB 3MGOA 1NFDA 1YA5A 3MRQB 5AZ2L 1TJIL 1BJ1J 4L8SB 5IFHH 2APBA 2VKXA 1W8OA 4QKXB 4FOMA 3D1MC 2P5EB 4LEXL 2O5ZL 3OAUL 3X14A 4U1HA 1KC5H 4DQOL 1WT5C 2VISB 1NEZG 3GUTA 2W9DL 4MA8H 1AQDB 3V5DA 2WM0A 2R1XA 1INEH 4JFOA 1A1MB 2R56L 2X4UA 2OJEA 1UADC 2O61B 3TJEL 1S7WB 1DEEB 5B3JE 4JFZH 2X05A 2F9BT 3TFKD 4U1IB 3D69B 4RISL 4IRZL 3P11L 2PW2B 3RA7H 4F7TA 2F8XC 2ENYA 3QZWB 1ONQA 2UUDK 2Z8VC 2Q76B 2P4AB 3INUL 1KV3A 1JGEA 3MRRB 1U58A 4LLMA 2DWDB 3VFSB 2PYEB 4OIAA 5EG6C 3QIBC 2BMKB 3D25A 1PW3A 1A4KA 1RJLB 5ETUA 4LKCB 5CIPB 4U6VH 4LSVH 2APVA 5D7KE 5FYLD 5D2LB 1V3LA 5F7DB 2BNRB 4C4KT 3O0RH 2OR9L 5TGBA 1JPFA 4KTDH 4PJ5D 4HIEA 4FQXA 1KN4H 3RUGA 1VACB 3MV7A 1NCTA 5J9PB 1BWWA 3KDMB 2NY1B 4IRJD 2NW3A 3N1PC 1U91B 1UCBL 4JLRB 2ADFH 4G8IA 1ZHLA 1D6VH 4AEIH 5IFAL 2CLZA 5IMKB 3PV6A 3JTSB 4KAQH 5I8CA 2BVUA 1UT9A 3WFBH 3O3AA 2IC2A 1LDPH 4F58L 1HYRC 4XXDB 4KDWA 4GXVH 3O6FC 1S7XB 1LP9E 2B7DT 5CEZE 1X5LA 2FR4A 4G8GB 1HZHH 2AK1L 2X89A 3UP1A 1QLEL 2CUMA 3QCUH 2G5BA 5FYKD 3O41B 1NAML 2VQTA 4KI5C 4HZAA 2UYLB 4OZFA 5IJVA 4KI5E 3OX8B 3MRMA 1PG7H 3QI9B 2VDQH 4GJTB 5E6ID 4KK5D 3RPIB 3DBXB 5F7LB 5DJAA 1GGCH 1LNUB 3DX8B 4ZODA 5DJXB 4AENB 1PY9A 2BC4A 3GSNH 3RUGF 5DVMA 4KGJA 1W72H 3QQ3B 1U6AL 4XPGH 1V7ML 3QUMH 5BZDB 3GSQB 4J6RL 2NY0D 4RQQB 3UJIL 2NLJB 2HJFB 5TDNB 1RZFL 1KB5B 2BY2A 3FO1B 3NAAL 5C6WH 3RL1B 4ZNEA 3DV4B 3BH9A 1ZGLP 4OZHA 1AGFA 2J7LA 4K3GA 5IB5A 5GGTL 2FGWH 1FGNL 1XGUB 4J4PC 1D9KA 1HHKA 4Y16D 4MGXA 3IXAA 1QACA 3LQZA 4UDUA 1WBZA 3RTQD 4I9WD 1B0WA 2RIKA 1BZ9B 1SYVB 3ZHDA 2WBWB 5C0JA 1JZ7A 2OCFD 4NUJB 4PJGE 3MSPA 2M26A 4OGYH 1LE9B 3VW3L 5DK3A 5JHDE 2KZ1B 4NFBA 1BGXL 2FD6L 2FL5B 3MYJA 3NFSH 3UAJC 3VWKB 1OP9A 2PKDA 1KEML 2XKUA 4KJYB 1UC6A 1ZHNA 3WS6A 5TQ0L 4JR9L 2JJVA 5AYUH 1FORH 1MVUA 3BIKA 2J88H 2C4FU 2IQAA 5ESAB 5AD0A 4IM8A 1Z9LA 3GMOB 4OZHF 2B2XH 3BESR 3FONA 2GAZA 5I1AB 4NQDA 1MFEH 1U8JB 5HHQA 4ZO7A 3TCLA 3QEUA 2NXYD 4XPHL 4Y1AE 1MFDH 3WUWA 1ZLVK 3JTTA 1LHZA 3UPCA 2BVTA 3L9RA 4BSWA 2JCCB 1WFNA 1B0GA 4QY8A 4JFQA 2EYRB 1NAMA 1SEBA 5BV7B 3GHEL 3VGEA 1TJGH 4HIIB 1WV7T 4CVXA 1IT9L 4XVTH 4XI5D 4D8PA 1FPTL 3PHOA 4ELMB 5CP7B 1K5NA 4RCAA 3D3VE 1JZ6A 1BBDH 3S5LA 1V05A 3QEGL 4JFDE 1MCLA 5BRZA 4FTVA 1IM9D 5EWIH 1KCRH 5J12B 1WICA 4TULH 1MUJB 4K7FA 4OGAC 4KJPC 4PRIB 5I66A 1VFAA 1HINH 1FN4A 4Z7QE 2Q3AA 4V1DB 2BCKB 3ISWA 3IU3A 3CZFB 3JWOC 1IC4H 3B9VA 4RAUA 3OKNB 1KYOK 3VA6A 5FKAB 2GITB 3KLAA 4XH2A 5DHVA 5ANMA 4TVSa 4WW1A 3BZFB 2W0LA 1FAIH 1ODAA 3FRUA 3CIQA 3VJ6A 3MJ9L 1MHHA 4EDXB 4LP4A 3C5SA 4TUOA 5FECA 1K3ZA 5AZ2H 1TJIH 3UTSB 4OZFH 2BVYA 4S0SD 2ICWB 4P4RA 4WO4B 3RX5A 4PGDB 43CAB 1HKLL 1ZHBB 2RQ8A 4LEXH 2O5ZH 3OAUH 2OX5A 2VZ3A 4WFEE 3EYSL 3CU7A 2P42B 5KSAA 4DQOH 3MNVB 1UWGL 3MYZA 5HI4C 5F89B 1VFMA 3HG1D 3K7UA 4NBXB 2R56H 2YPKB 3FO2B 2Y5EA 3MLRL 3TJEH 1RJYA 4RGNB 1C5CL 3G5YA 4RISH 2XACC 2VL5B 3P11H 4IRZH 3ALWA 5M7QA 3ZKMC 4JRYE 4FZEL 5J57B 5CIPH 3DVIA 2EXYD 2UY7A 4YPJA 1MY7A 4M61B 5EO1B 3OTTA 1S9VA 3V0VA 2HJLA 3INUH 2BVEA 5BS0B 4ODWA 4AL8L 5M95B 1K2DB 5D1QC 4NO2B 3HNSL 3GFUA 5EA0L 3OKLA 5ESVA 5EBLB 2EDFA 1YECL 1AGCA 4QOKD 4UOW0 1WBYB 2ZUTA 5I75C 3PGDB 4PS4L 1HH6B 3B3IB 1JPGB 2OR9H 4BA8A 4HMEA 4JFEB 4PJ5A 3PWLB 4KH2A 1PJ9A 3BDBA 4EUPA 3FQXA 4PJCE 1G0XA 2HRPL 2WLYA 4H1LA 4BFGA 5CLWA 4JM2C 4PGJA 5B8CB 3ZKNC 4W4NA 1UCBH 4ZSOE 2YUZA 1QSEE 5IFAH 5M94B 2R4RL 1IEAB 1DQLL 1BFSA 4ZTPL 3L3IA 1MI5B 2FSEA 3ARGC 2VZ1A 4F58H 4RDQF 3E3QC 4DGVL 4NZDA 2IPTL 1QA9B 1ZVSB 5F6HJ 3E3QE 2APXA 2AK1H 3B9AA 5FCUH 3MJ9A 1QLEH 5BOZG 1RZIA 4K55A 4PJDE 5I8KL 5TDPB 2LAAA 4XBEL 2F54D 1X5AA 1NAMH 1P7HL 1X5YA 3F62A 4K3EL 3SCMB 4MQXC 3ZDXF 2EZ0D 5IW1A 5I74C 3LDBB 4X0KB 5IROA 1QRNA 1WBXA 3BPCB 2C9AA 2OL3L 4PJHA 2IG2L 3QDGE 2AEPL 1XF2A 1OY3B 5F70A 1K6QL 1U6AH 1FFPB 3KPSB 1V7MH 2LAGB 4K7PX 2I9LA 3I6LE 3MRKA 1BZ7B 4J6RH 4TUKL 3UJIH 4E9LA 3B8SA 3TBWB 1RZFH 3NAAH 1CLCA 4WHTB 2IANB 4JG1L 1DFBL 4PREA 5CINL 5C9JB 1EEYA 3BXNA 3DVGB 1R24A 4U6XB 3SGDH 1LQSR 1QBAA 2QHLA 3W5MA 5SWSE 5GGTH 2VL4A 1FGNH 4FXKA 1NPUA 3TCXA 1YN7B 3CGTA 2VYRE 1JPSL 1TZGL 1I9RL 3AFLA 4LCYA 1F6LL 4QRQB 1VADB 1VSCA 4QCIB 5DHVH 3FO9A 2V5TA 1IAIM 3OJ2C 3HZYA 1I3RA 4K9EL 3VW3H 3VMOA 2R2EB 5K33A 1BGXH 2FD6H 5JZ7D 4KTYA 2EDKA 1KEMH 5DQJB 4PJHF 3BP7B 2LTQB 4YR6A 5TQ0H 5A3IC 4JR9H 4XRCA 4NNYA 1YZZA 3BRDA 3HMXA 3O8XD 1N6QL 1N3NA 4WENB 4JPIB 5JPMB 5FUZL 1ZAGA 3BSZL 4PJIE 1UZ8A 5IG7A 1PD6A 2YEZB 1OLZA 5I1LB 4TTGA 4OZ4A 3CDGA 5IVXA 2Y4SA 1PZUB 3RWHB 3GBML 4H0HB 4HKXA 1RIHL 2AKRB 5D9SA 4XPHH 3VFOA 4AQOA 1N64L 3U4AA 2GCYA 4JDVA 3WLWC 3C6LD 3MV8B 4LCCC 1E28B 3IDGA 3RIFF 3G6DL 1P7KA 2Q7YA 2BVQA 4U1KA 3GHEH 3EO9L 2AK4B 1KPRB 2E9WA 2ZUYA 4FABL 4YUEL 4X6FB 2D0FA 3ZT7A 1PKQA 3MRFA 4TQEL 3OAZH 1M6OA 2D9QB 1T1XA 2AJZA 2UZYB 4HG4K 1PKOA 1IT9H 1RZGB 1FPTH 3QH3B 2OL3A 4KXZI 4MWFB 1KEGL 4YBLB 2AI0L 3ZE0F 4EN3D 4LLWB 2NNAB 2VXSL 3BD3A 3QEGH 4MCZB 5J7CC 3WLBB 3H0TA 4EUPH 1P7QB 1IM9A 1R3IL 2GYSA 4H1LH 2Y6SC 1Z5LB 1F00I 5IVXF 4HUWA 4D9QE 2D7TL 5T1MB 4U6YB 5HDOA 1LEKB 3GK8L 1FHGA 1GRWA 5DJYB 4JRXD 3MRNB 3BRFA 2V2WA 4DTGL 4MNHB 1XR8A 4XWOD 1YEFL 3K4ZA 1AD9A 4BUHA 1A6ZA 2R23A 1IAOA 2DD8L 4ZPTB 3MJ9H 4I0PC 5TE4L 4WW2B 1KULA 3LKPA 3JV6A 1JWUA 1WIUA 1I1AD 5IB3A 4O2FA 2VH5L 2I07A 3NCFB 3C2AL 2CUIA 3QIWC 1HKLH 1NGZA 4R4NC 3F5WB 1DL7L 3T1WA 3EYSH 2E9IA 4LHUD 4XPTL 4M1CC 4I2XE 1UWGH 4RZCB 3UXFA 1MJJA 4Z0XA 1CDIA 4F3FB 3QCTL 1FZJB 2Y06L 2YA1A 2NY6B 5JIKA 1OAQL 5EUKA 1NEUA 1EAPA 5ACLA 2ZOKA 3MLRH 4KU1A 1C5CH 4X5XA 3QXAA 1CTNA 4FZEH 4MCYB 1AH1A 5E56A 1JHKL 3MBED 3OL2A 3IDUA 5DJZB 1ZA3B 2V7HA 3UTPD 1W0VA 3FFDA 3D2UB 1QFWI 1PFCA 2YC1B 3EDEA 4L8DB 1TZIB 1BD2E 4APQD 3SDCA 4AL8H 3MR9A 4EJ1C 3MXWL 1FNAA 2EIZA 3QFDA 5IHLB 3HNSH 5EA0H 1U92A 3U0WL 5GRVL 3L3DB 1YECH 4JFHD 2Z91B 1I7RA 4GW4A 5EFIB 2VDLL 1S7UA 2UWEB 1IAMA 4PS4H 1KCUL 5FM4A 3MLPA 2VXVL 4L3EB 1G7JA 2YRZA 1OTTD 2BNQD 4U6HA 3RVXD 5CEXB 3MTRA 2HRPH 2DF3A 3FQRA 5EBMA 2DLTA 4J7RA 1RK1A 4S1SL 5CJQL 2R4RH 4P5TD 3H9ZA 2X4PB 3N0PB 3T65B 1DQLH 1U9KA 2NZIA 4ZTPH 2FRGP 4YO0A 4QTIL 5IMOB 4PRDA 1OGTA 1KN2L 5FHAL 5LBSL 2EIBA 4DGVH 2IPTH 4OSUL 4ZFZB 5FGBA 4XWGL 5DEFB 5H8DA 1TQBB 4PJ7A 3MROB 5I8KH 4OF6A 4XBEH 4OV5B 1OD7A 4U1SB 2GQHA 5CZXD 5KW9L 4K3EH 4CMMA 2DYPA 1UXWB 1CGTA 1CU4H 3QNXA 4J1UB 4BFIB 2J12B 5DJ6B 3C60D 4KMTL 1ZLWH 2ZG1A 2OL3H 5SV4A 2FX9L 1MCFA 5I1DA 2IG2H 3B5GA 2AEPH 2IMMA 3GMNA 3NTCL 4Y8AA 1J86A 1U41A 1NJ9B 3RUGE 5LJYH 4JZOB 3O6ML 4TUKH 1GZQA 2MTPA 3OKEA 5D7SL 4GKSB 4IS6A 4ONGL 3G5XA 4K23L 4W6WB 1ZS8B 3NCYS 3PL6B 4U1GC 4JG1H 4LSTL 4PRBB 4P48A 1N0XL 5IT2L 5CINH 4L8SC 2OK0L 1RZ8B 2P8PB 1BFVL 4LHUG 4ZUWA 3SE4A 5JA9A 2CSPA 3V8OA 3MPCA 1AC0A 3UC0L 2V5MA 3GHBL 1TVBA 3VGHA 4JHAL 3GSOB 4PGCA 3C9NA 1JPSH 1TZGH 1I9RH 5KANG 4RIRB 2B8OT 4PJ7F 4EIGB 1FYHB 5H94B 1FZMA 4K9EH 3PNWB 5GGUB 2MCPL 2B4CL 3C6SA 2F74B 4HPYL 5DI8A 3IDMB 1UKTA 2WBKA 1AXTL 5I17A 2WLZA 5IK3B 3ZYOA 4LLYA 5A2IH 2V5RA 1JZ4A 5HHNA 2HLFC 2XICA 4YZFF 1CICA 2C4XA 1JZ8A 1MLCA 4GG6B 3ARSA 1BX2B 5D7LB 3ZKXC 3O8XA 1N6QH 1FJ1B 5JOPD 5HSFA 3BP5B 5F97E 3RBGA 2PYEE 5FUZH 3BSZH 4ZNEE 5SV3A 1BPVA 4OZHE 4AG4L 5DGQA 4JFYB 1D9KC 2UVFA 3RKPA 2LV4A 5ENWA 1GGUA 1DCLA 4JRWA 2VSCA 3GBMH 5E8OA 1RIHH 1CXHA 3IJSB 1JWMB 3WNMA 1JV5B 1M4KA 1N64H 1U95B 1TTFA 5DUBB 1BMGA 5H37H 4P3DB 2WV3A 5ADPL 5CILL 1OTUD 5AG8A 3G6DH 3TZVA 3DX6A 3QUXD 4P2QA 3EO9H 4K7PY 3GMPB 4FABH 2EDOA 4YUEH 5EU4A 1AIFA 3W39B 1S7TB 4HIHB 4HZLA 4TQEH 3QDHA 4Y4HB 1XF4A 2V2XA 2YD2A 4XP5L 4E42A 3R06B 5CSZA 3TIEA 4FQ1L 3GKWL 4Y4KD 5IKCA 1KEGH 2AI0H 2VXSH 3UTQA 1S8DA 3EYQC 3OKKB 1MCCA 5T1LA 1ZT1B 2VLKB 3SDDB 4PGEB 2VLJB 1HHIA 1M7XA 1R3IH 4MDIB 4R9HA 4Y89A 1S3KL 5GZND 3PP4L 4FS0A 4NQDE 2D7TH 4NQCB 3OKMA 3M17A 3GK8H 4MJ5B 2IADA 4LKXB 4UBDC 4DTGH 5A2FA 4P9HL 1YEFH 5CGYD 1I9JL 2K7PA 1BOGA 2DD8H 1SM3L 3WV0A 5TE4H 4MJ6A 4HFWB 1KIQA 1I1AA 2VH5H 4U3CA 3C2AH 5IV2A 4RMRA 1MCNA 9CGTA 1DL7H 2DMCA 3S34L 4LCWB 2VLMD 1VFOA 3EO0B 4XPTH 1G0YR 2PO6A 1DEDA 4OF0A 3TBSB 3O3BA 5BRZE 3QCTH 4FTVE 2Y06H 1XFPA 3WDHA 1OAQH 2NZ9C 4KDTA 3VGFA 4GMSL 2FJFB 2VLRD 1E0OB 1NMBL 4L9DA 2P48B 4PYHA 3BP4A 5ELIA 4NFDA 3W11C 1JHKH 3O4LD 2BSTA 1MQ8A 3PWVB 4YFEA 3QO1A 5B39A 5ANME 2YD4A 1KG0A 4OTXL 5HDQL 5C8JA 3OG4B 5JIHA 3MXWH 4WEBL 3UPRB 4TPRL 3VG9C 3WJJA 3DMMD 1WZMA 2QQNL 4AIZA 2DWEB 3U0WH 3RDTB 5EO9B 1OGAA 1CXKA 3EFFB 4NSKA 5CD5C 5KSAC 2VDLH 3B9DA 4UUJB 3ARED 1KCUH 1P5VA 2VXVH 3MRCA 5IBLD 4G6ML 3HI1B 4FZ8L 4F7EA 3KGRA 3FT3A 1EH9A 1INQA 5DMJB 1KJVB 5ICYA 2HTKC 3WO4C 1JYVA 1IKNA 4JFPB 1ZT7B 5CJQH 4S1SH 1FYTA 1S7SA 2XKNA 2DI8A 4U05A 1T66C 3P30L 4WDIA 3KPQB 4QTIH 1HDMA 1KN2H 1I1FB 5FHAH 5LBSH 2PYFA 1CF8L 4OSUH 3AC0A 2CLVA 3BI9X 3ARTA 4OUUB 2FX8L 4XWGH 2YHGA 4F33B 4N0YL 4WU5A 3RVUC 3ZL4L 3VFMB 3BMVA 5KW9H 3GMMB 1MLBA 4R8WL 1G6RL 4JKMA 1BFOB 4PRIE 1GGBL 2B39A 3Q3GB 4IJ3B 3ZDXE 4POZC 3HZMB 3ZKSD 2BVPA 3C60A 1CFNB 4KMTH 1P4BL 1EHLL 2FX9H 5ID1B 2NX5D 3NTCH 4NBZB 5I76B 3HUJB 1UJTA 3EYFA 3O6MH 5D7SH 4ZPVA 2G2RA 4LAJH 4ONGH 1KNOB 4K23H 3PGCA 5KSVA 5IT2H 4LSTH 1N0XH 1GC1L 3SKNB 2OK0H 2WIIB 2J8UA 4WO4C 3V6FA 4XT1C 1BFVH 4D2NA 3SDXA 1I1YA 4PY8I 4QO1A 2WZPD 3H2WA 3UC0H 4ZS7L 3GHBH 4JHAH 3QEQA 4QHMB 1R3HB 3S4SG 1U8HB 4O2CB 5IB4A 1URLA 2HFTA 1YEDA 3WFDL 4Z7VA 2Y7QA 4NKDA 4OFVA 4R0LA 5D1XA 2MCPH 2B4CH 2X4TB 4HPYH 2VZUA 5EBWA 1AXTH 4D0BB 2DQDL 5IROC 1KLFA 2ICWJ 1PX3A 4J8RB 5E8PA 3T2OA 1YMMB 5DDHB 1QRNE 4J23A 1BAFL 4PJHE 3LV3B 3QG7L 4ZDHB 1T0NA 2WW8A 3Q5OA 1MCRA 3KPNA 1WF5A 4X9HA 1F4HA 3SJVA 5EZJA 1CD0A 2J8UF 4R7NA 3VG0L 2ARJA 5ALCL 3SDXF 2QSTA 2ITDB 3H7BA 4AG4H 3VXQB 2O5XL 3HPLA 4PJFA 1FZOB 1QSVA 3OHXA 4R96B 2QLVB 5DD6B 3QQ4B 1D5BA 1JGLL 2K9UA 1ZV5A 3MFGB 4Z7VF 1D5ZA 1QQDA 1QPPA 5ADPH 2VLLB 5CILH 5HGAB 2FECL 5E9DD 2NW2A 1D5XB 2FO1A 3QUXA 5DRZB 1JCKA 4GKZB 5HYSA 1G6RA 3FZUC 2HT3C 4ZOCA 3QHTC 4XP5H 4YDIL 4FQ1H 1S9WA 3GKWH 4LSPL 4ORGB 3DXAB 4Y4KA 5DLML 1MI5E 5EU7C 1H0DA 3ZE0E 1HILA 5EU7E 3QWOA 4PJ8D 4H5SB 2FWOB 3MV7B 1E6OL 4M8VA 4ODUB 1S3KH 3HAEA 3BN9C 3PP4H 3SCMC 2NW3B 3DUHA 4PJFF 2DAVA 5IVXE 5C09D 2NCMA 5CAYB 4NIKB 4C54A 1TVDA 1S7QB 2JELL 4KKLD 1TPXB 4N8VG 4P9HH 4B41A 3VWJA 1TVHB 1I9JH 4E41D 1IFHL 3FQNB 2KL6A 4NQSA 4Z7NF 2DOCA 2ESVD 3MCKB 2W38A 1JRHL 5KTEL 5FKPA 5JO5B 5FYKU 1PKQE 1CFTB 2BOBA 4Y5VC 3F8UB 4HS6A 3D9AL 3KPMB 5C0GB 1GZPB 3MRMB 1EPFA 4D9RE 1JGVL 1FSKC 1FRGL 3S34H 4X6EB 1VPOL 2CIKA 1G7PA 3GIZL 5MEQB 3CFJA 2WWKO 1DE4B 4QHNA 2OR8A 3QEHB 5DC0A 5HVHB 3K8KA 3D6GA 2QQLL 3GB7A 2HFEA 4C59B 1XIWC 1F13A 4OD3L 2BJML 3CCHB 4GMSH 2NY7L 1Q94B 5DQ9B 5C08A 2GK0B 4EOWL 4DUWA 4BH7B 1ED3A 1NMBH 3GRWL 3OF6D 3GKZA 4LLUB 1M1SA 2LTQC 3GJEB 3V6ZA 4U1LB 4JKPL 1IBGL 4YIQA 4JFXA 2XWJB 1HH9A 4K9EC 4OTXH 1FG2B 1KYOJ 2GHWB 1T89A 4PRPB 4ZQKB 5HDQH 2E8YA 4WEBH 3HE6A 4JG0L 4TPRH 3L3HA 4PUBL 5DC9B 4M4PA 1HYSC 1NEZB 1XH3A 2QQNH 3RL2A 2W60A 3DMMA 3T2PA 2DQHL 3TIDA 4DOHB 5INDB 4Y19B 3F12A 1RUQL 4IRSD 3AS3A 1AKJD 1AP2A 1ZHNB 5FXCH 4MVBC 4XHJD 2GJ6D 3MLTA 4G6MH 1MFCH 4FZ8H 4Y4FD 3CLFL 1T7VA 2D9CA 1YC8A 1R3JB 4FFVD 1H8SA 3DUSB 4KK6D 5T1KD 4HS3A 2FJGA 2X4NB 1A7BA 4R2GD 1W8NA 2NY2C 1KUMA 3SDAD 1XEDA 1G7LA 3QG6A 3P30H 4IOFD 5DJCA 3S35X 3SDCC 3VFPB 1CF8H 1AO7D 4QRRD 3D39D 2IPKA 4XB8A 4F8TA 2FX8H 1YY8B 1OAYL 4P23A 3ARBB 4N0YH 5J1AA 3IS1X 3QULA 3ZL4H 2C4FT 4LP5A 4DZBA 2P7TB 4J3WA 4R8WH 1G6RH 2BY0A 3MNWA 1AD0A 1EEUA 1GGBH 4IOSD 4Z95L 4ZUTB 1TCMA 2V5SA 2ADGA 1MCOL 1P4BH 3SY0A 1EHLH 4HWUA 5KG9B 1A6TA 3VXUD 2DI7A 1XF3A 3TLRA 3ZLQC 1I3GL 3CUPA 3OJVC 3GSXA 1GIGL 3NCMA 4LARL 5BVPL 4I1NB 3VH8A 4PJEB 5T3XD 3VFVA 4HH9A 1DBJL 3B6SA 1WISA 3HAEH 1GC1H 5EU6D 1QLFB 3WIHL 3GRWA 5ISZD 4P99A 5I66B 1I4FB 3TBVB 4Y2DB 1M7IB 3T1FA 4ODTL 3SE9L 4ZS7H 1CDGA 3O45A 3TO2B 4OT1L 3NACL 2GTZA 2XWBA 3AM8C 5FGBC 5C0AB 4NRZA 4B7IA 4XAWL 2VR5A 3NN8A 5I71B 1Z0MA 1AXIB 5JXAL 4PJ7E 5F7MC 2NY6C 3WFDH 2XN9B 1CG9A 4OCRL 3OXRB 3VJ6B 5EZLB 1JI1A 4P59L 3V52L 1Q9WB 3JV4A 2GSGB 4MJIA 1K4CB 3F6LA 5FECB 5GRJL 5BXFA 4JY5L 4G9FA 4QGTA 2DQDH 5KANI 2PTTB 1KXQE 1U36A 1CE6A 2VB5A 5T3ZD 1BAFH 1TTUA 3IDIB 4HHAB 4Z77A 3QG7H 1HHHA 3LKOB 3DPBA 3I9GL 5JW5A 4YZFE 1JE6A 2WQ8A 2FATL 3EJZC 5AZEL 4YHIA 5C0IA 1T83A 3B2UC 4PJAB 3AS0A 1DQQB 2P8MB 3P4LA 3VG0H 5ALCH 3BZEA 5F3BB 3DX7A 3E2HC 5F7NC 5CKAA 4E0RB 3G5YB 2O5XH 3TH3T 1J10A 5EDXA 2CDFA 1A6UL 2Q20A 1RK0B 3ULSA 3MCLL 5KVGL 4L4TB 1JGLH 1YEHL 5KAQG 4U1MA 3CPLA 4JANA 2OJZL 5FK9A 2N1KA 1K8DA 5E9DA 1UEMA 2E3VA 3NZHL 3CAFA 2OQJA 4YK4C 4RFEB 3U4EA 5ESVB 2Z35A 3MUZ1 4P4KD 1CICC 4KXZH 4YDIH 1RSFA 4LSPH 1FE8L 5FYJL 2OSLA 5DLMH 4U33A 2EYSA 3VD5A 1QR1A 1OARL 4CDGC 4QT5B 4Z78B 1TQCB 1NBYB 4NC2B 4PJ8A 1UGNA 1F45A 1E6OH 1JWSA 1IGTA 5F9DC 1BEYL 4LVNC 4Q6IB 4IRJB 2CPCA 2PN5A 2J6EL 4MD5A 3D48R 3WIHA 4GAYA 4EXKA 2ORBL 5KSBB 3NA9L 3E0GA 1TETH 5HI5D 2JELH 2YS4A 2VITB 4BZ2L 5KVDL 1IFHH 4E41A 1NGXA 4M48L 4M43L 2APTA 3KJ6L 3PGFL 4NQVB 3TZVC 4KRNA 2XV6B 1JRHH 2ESVA 5KTEH 4P2QE 4POYA 1I7UA 3S96B 1HQRA 4IMLA 3JUYA 4N90E 3LIZL 5MEPA 4YBQC 4UQ3B 3OR7A 3D9AH 2E7LC 5IJKC 3MUGA 4HC1A 1OWRM 3EJYD 1CQKA 5GIRB 4PR5B 1ZSDA 1JGVH 1MCDA 1FRGH 1JTPA 4ETQB 1UKQA 1JGUL 1VPOH 4G6AC 2F53A 3QNYB 3GIZH 1U8LB 3K74B 3JWDL 1I75A 1MHCA 5E6IB 4X4YA 1B2WL 1WIPA 4AM0A 1KPUB 3T8XA 2QQLH 2YOCA 4LOUD 5GS2D 1L9NA 4YNYB 1VKXA 1KJMA 2NY0B 3EHBD 4GG8B 1NQBA 3T4YB 2HTLC 4CVZA 4OD3H 3RWFA 2BJMH 2EDHA 4F7CA 5EU3B 2NY7H 3UZVB 4EOWH 3IF1B 4PPTA 5CS7A 4OLZL 3GRWH 2HH0L 2D03L 4ELKA 4EXPX 3OF6A 1QUNA 1KIRA 2AGJL 5FGCB 1QFWH 1V5JA 2VSDA 4Y16B 4JKPH 1IBGH 2BVOA 1CDBA 4ZOEA 4P3WA 5DK2A 4GG6E 3RTQB 5D7LE 2B4CC 4Y8DC 4OZIA 2J5LC 3MRBB 4WNQB 4GRMB 4XCYB 4JG0H 4OZGB 4HGKC 4PUBH 5BOPA 3PDOA 3HNTL 4KROC 1R5WA 2DQHH 4FQ2L 4OF3A 1RUQH 4LQ1A 1AR1D 1LK2A 5JNYB 3ES6A 4IRSA 5D96B 1KBGH 2PO6C 4WIQA 4L9LB 1JHTB 4QRTB 4QYOB 5GSRB 2YPVL 3L3KA 3C5JA 4JKKA 5E2UL 4NC0B 4KDTC 3CLFH 2A6JA 4Y4FA 4F7MB 4R7DB 4IMKC 3P4NA 2E6JA 1FQ9C 1XR9B 4D0DA 2J6EA 3KYMA 4NN5C 4X99A 5IG7B 4XCEA 3RHWK 3V4UL 5SWZA 3RNQA 2H26B 4Y4HC 3P0YL 4CJ1A 3K2UL 4NO0A 3BVNA 2G75B 2NXYB 1NFIA 4OZIF 4LLVA 1MFBL 2DTML 5I15L 4KJQD 1F2QA 1LWRA 3SDDC 1MHPL 4IOIA 1Q0YL 1OAYH 3MO1A 1VDGA 4NPYB 1S78D 3HNVL 3HI5L 4DKEL 4MXVF 2GEEA 1I7TA 1S9XB 3ABZA 4AT6A 5CMAB 5BVJB 1OGAE 2KZWA 3T4AA 2GSIA 2YBRA 4Z95H 4ZXBD 2EO9A 1MCOH 2H1PL 1T1XB 4QRSB 1JFQL 4JFFD 1QKZL 3H9HA 3MRLB 4H26A 1B4JL 3VXUA 4YDLB 3LEYL 5E4EB 1OWWA 2BK8A 1I3GH 4GXUN 4S1RL 5E1HB 1RV6X 1GIGH 3BP6B 4I48B 1NCWL 4LARH 5E2VL 5HYEA 1DBJH 1IKNC 4NC1C 2CRYA 3BPNC 5ECJE 2E6PA 5EN2A 3ARDB 1S5IL 4NC1E 5C6TL 3L5WA 4UOJA 1FYTE 3OG6B 3KS0J 3TV3L 2QHRL 3WIHH 3UZQA 4P9HC 2EXWD 2AV1A 4ODTH 3SE9H 4IIQB 4WV1B 1T0MB 4OT1H 4HMCA 3DOSA 3NACH 4KUCD 1J8KA 5HJ3B 3JV5A 2JIXA 4XAWH 1G7MB 3C8KA 2FCBA 3MLYH 3PABB 4PIRF 2HT4D 5JXAH 2PCPB 1JJUA 1ZLUK 5IOPB 4OCRH 3PP3H 3DHMA 3QFJD 3RNKB 4P59H 1VGKB 3V52H 3VRJA 1PYWA 4JHZA 2XPGA 1V7NH 5GRJH 2Q8BL 4JY5H 1TZHA 4RAVA 1IAIL 3PWPA 5IWLA 1GYAA 3BH8A 3KYOB 4WUKL 4KC3B 2AV7B 4KDVA 5GRUL 2D7QA 3BPLB 3I9GH 1V3JA 2FATH 3P4MB 5AZEH 3BZDA 4F15B 1XCQA 3HG1B 4UDTA 5B3NA 1BLNA 1FVCA 4IDLA 4QRUA 1BIIA 2J8UE 1U3HA 3MREA 1SY6L 3SDXE 4C56A 3MQIA 4ALAL 1CQYA 2EYTB 3QEQE 4BH8A 1A6UH 3IAPA 32C2A 4CKVX 3MCLH 5KVGH 4XMLL 3FOMA 1YEHH 4R0LC 1MHEB 5C2BL 5D1XC 4PB0L 4Z7VE 2NY3D 3ULVD 2OJZH 3DYOA 3FMGL 3ELAT 3NZHH 1SJEA 5KVEL 4NO5B 2A73A 3BD4A 5DO2C 3EZJB 1WK0A 3FQTA 2R2BA 3IT8D 5DURD 4G8FB 4QOKB 1FE8H 1JF5A 1ROWA 5FYJH 1CDUA 2JK5A 5C0BA 2E5EA 1ND0A 1OARH 3KXFD 4BFBD 2IH3A 3DIFA 3SJVE 1UZ6F 1FL5B 1LO2L 4QF1B 4QWWC 2VDML 4PB9L 1LK3L 2CKBB 1AFVL 1BEYH 5GS3A 5CWSB 1IGFL 2J6EH 3DVNA 3GI8L 4X5WA 4PJFE 2CDGB 5DRNA 2ORBH 3MV9A 3NA9H 4L29A 4LLQA 2OZ4L 4NQTA 4DN3L 1QSFB 4BZ2H 4P5KB 2X70B 5KVDH 2VWEE 4Z7UB 4GBXA 2CGRL 2NY5L 2GJZA 3U82B 4M48H 4M43H 1NDMB 3KJ6H 4Z7NE 3PGFH 2DQTL 2C26A 5DSCA 3BQUA 4NQXA 2ZG2A 1WGOA 3WHE0 1HXYB 2ERJB 4HKZA 35C8L 2F54B 3LIZH 3EDDA 1U8MA 2KBGA 1DQJA 3WE6A 4JDTL 5KOMC 5IHZB 2BY3A 3V0AC 3BWUC 3QUZA 1JGUH 3NABL 3JWDH 3TESA 1T1ZA 1B2WH 1OTSC 3U6RB 4FQLL 4H0IA 2EECA 1GC1C 1XGTA 4D0CA 1T20A 5EPMB 1A47A 3RZCA 3BYTA 1SY6A 5IVZB 4I4WA 4I8DA 2EDTA 2XNAB 3U9UA 4JY6A 4OLZH 2R39A 2HH0H 4RGMB 2D03H 3ZTNL 2EIEA 2BRRL 2FHBA 3VWJC 1NBZA 4NN7C 5EULV 3RKDC 2KUTA 4UT9L 3MFFA 2AGJH 1K8IB 2A77L 2R0LL 4O9HL 3O4OB 2YMXL 1F11B 1LO5B 1E4JA 3MUJA 3LRSB 3WL9B 2DBLL 1JF1A 3RGVC 3HNTH 2DQFA 2YKLL 5AAMA 4HCRL 2XTLA 3F7QA 1T22A 4FQ2H 4HJGA 2XG4A 2QL1A 3NZ8B 4JM4L 2YPVH 5IVOA 1JTOA 1FNLA 1L6ZA 3MRHA 5E2UH 1AGEB 4KK8D 3S37L 3O8XB 2ZNXA 5DEGB 1IC1A 5L0QC 2Y72A 3U46A 3NFPA 2DDQL 1MH5B 5C08E 4V2BA 3VFWB 3V4UH 2F5BL 4RX4D 3IXTB 2DQJL 2X4QA 1SJHA 5J6HB 4G43B 3P0YH 1KIUA 3RI5K 3PQYD 4JO2L 2L7JA 1AR2A 3T3MF 2OZ4A 3K2UH 1X3DA 2LVEA 1RZ7L 1J87A 2CIIA 1MFBH 4LCUB 3RVWC 3DYPA 5I15H 3HE6C 4G8EA 1MHPH 4ZS6D 1Q0YH 4OFYD 4Q2ZB 4DFHA 3C6LB 3HNVH 3HI5H 4DKEH 3TA3D 1UVQB 1II4E 3WBDA 1YDPA 4NOBA 5EU4B 3AS2A 4ZXBA 1PZ5A 2X1XR 2H1PH 3DROA 1OT1A 3TYFA 3H42L 1P84K 1JFQH 2V2XB 1ZLSL 1QKZH 5K9KA 4JFFA 4JJ5B 5JMOC 1P69B 5D7JA 1B4JH 3LEYH 3ZT6A 3QJHA 5ITFA 5I8EA 4EN3B 5LGJA 4S1RH 3TN0B 3ARYA 1NCWH 5E2VH 4WJ5B 3RY5A 2P44B 4NNXA 4HKBA 2L0DA 3GSWB 1NANI 1S5IH 5C6TH 4FMKA 3R8QA 5I2IA 1Q9OB 3JZ7A 2ZZUT 1BVLA 3TV3H 2QHRH 4WFFD 1VGEL 1KFAL 1QO3B 2F8OA 3QQ9D 4XTRC 4I5BB 3GSVB 3Q2CA 3OKDB 4EI5A 1IL1B 4JRXB 1U3JA 2VAAB 4X8XA 5ICZB 3OKOB 3UTZB 4N1EA 5IB1B 1W0YT 3GO1L 4P23C 3TP4A 1JUFA 2EDWA 2XIDA 5EO0B 3G9AB 2OLDA 4U4BA 1BOGB 5DFVD 2EC8A 2OTWA 3QFJA 3ULUD 2O26U 3DRTA 5E6YA 4DZ8B 4HCRA 1FL6A 3LD8B 2Q8BH 1MJ8L 1NC2D 2WUCL 4R97C 4LVOC 5DS8A 2GFBA 1BBJA 1IAIH 3W9DB 4ODSL 4WUKH 5IMMB 5GGSA 3FOLB 2IGFL 5GRUH 3VXSD 2VE6B 4LHUB 5FOBA 5DMKA 1U8NB 3DGGB 5IR1A 5D2NA 3IDNA 5FF6B 1IM3B 5HHOD 1U93A 4N0FB 5HPOA 1SY6H 3WNPA 1BQHA 3HE7A 4ALAH 1HSBB 5A43C 2DICA 2B0SL 3L7EA 1IAKA 3MBEB 4X9GA 2YPLD 3FN3A 4LNRA 4KVNL 5F1IA 4HX1B 4XMLH 2EDRA 5DHXB 5C2BH 3NBNA 4PB0H 3G6JA 4APQB 5I30L 3FMGH 5GPRA 4MJIE 4QTHA 1L0XA 4OB5L 4Y5XA 3PWNB 1F90L 3CJJA 3LH2L 4G9FE 5KVEH 3IGAA 2Q86A 2W0FA 5DFTA 5GGRB 3KPRD 5B22A 5HDBF 1HNFA 1HI6A 3DX9A 4CADA 3DVFA 4XNMB 1T83C 2BOCB 1LGVA 1JYXA 3CVHA 1I7ZA 4Y2OA 3KXFA 3RVTC 1LO2H 1SEQL 3JWNC 2VDMH 4PB9H 4X7EC 2BNQB 4YE4L 1LK3H 3RIAK 1AFVH 4O51A 2X42A 2Y1VA 1IGFH 1EO8L 3GI8H 1Y6KR 2DN7A 1I8KA 3NCYP 2OZ4H 4HWNA 4XNQA 4DN3H 5KSUB 4P5TB 5LWYL 1RD6A 2BERA 3V9FA 1E4KA 2CGRH 1T04A 3TJHC 2NY5H 5KN5A 1XGRB 3G6JF 3BEWA 3QIBD 1IQDA 1B0RB 4RMUA 2DQTH 1UM6L 1TMCB 1F42A 1JZ5A 5E9DE 3RWDA 5D7KD 1A2YA 2D31A 3AY4A 4OF8A 1BQUA 1FL3B 35C8H 3FB6A 2QJDA 5JIPA 4P2YA 3QXVA 3CFDA 4MAUL 1C1EL 1B3JA 1Q38A 2IMNA 5JPNA 3WHXB 2NXZC 4BQBA 3NABH 3T77A 2BXZA 3PHQB 4FQLH 1NUNB 1FZKB 4MNGB 5D5MB 4L5FL 4HLZG 5EB9A 3BGFB 1FGVL 3ZTNH 1ZWIA 2BRRH 2R2HA 1CL7I 4DVRL 2FEEI 1BP3B 1YUHA 5CEZD 5HGBA 4EI6B 4UT9H 4BELD 3O6FD 4E41E 2A77H 1GSMA 2R0LH 4N1HB 4O9HH 2Q87A 2YMXH 1FVDA 2FGZA 1NGPL 2XFXA 1N0LA 1IEBB 3KG5A 4ZYKA 1PLGL 2XZCL 4ZOAA 1CR9L 2X4SA 3FB8B 3GBLA 3HRZB 4KI5D 4DUVA 2DBLH 3SE3A 1I8MB 2C1OB 1H3VA 2YKLH 3GMLA 4HCRH 3X12B 3SHSA 3PJSB 2OI9C 2F53E 4YBHA 4MZ3A 4JM4H 3KPLA 3LRHA 2GJJA 4QXGL 2A83B 1JZ2A 1T03L 3RWIB 3K46A 4L4TE 1VCAA 3S37H 1MJ7L 4Q74A 2DDQH 2Z31A 2B1AL 1OSZA 3HS0A 2F5BH 4MDJA 1NGYB 2DQJH 5C0DB 1MCEA 3OV6A 4J4PD 3MGTB 3UBXG 4JO2H 3N50A 3PQYA 4EQ3A 3MC0A 4RRPG 1EEZB 1EFXD 1Y0LA 5L8JB 4N0UA 2C3VA 2XZZA 3LAFA 4XZUA 4Z7WB 1NCCL 1T1YB 4JQVC 1RZ7H 4OIIL 4OZIE 1ORSB 4OCMC 5JHDD 4M93C 4OFYA 4WFGE 3VFTA 4OCWL 5BCAA 4RFNC 3J7HA 4TNWF 2F19L 2Z92B 2I9TB 5CCKL 4MXVE 1MCJA 3QUXB 4BZ1L 1IZJA 4JZNA 3BIBX 1CFQA 4YDKL 1S5HA 5FYJE 3H42H 1ZLSH 3S36L 3ARUA 5GS1A 1FIGL 1FO0B 4ZFOB 4PG2A 4ONHA 5EIIB 5AWNH 4NKIL 5DJDA 3VE0A 1DDHB 3VRIB 4F37K 2FLBT 3TBYB 1GXEA 3KPOA 5SWZE 4AIXA 3B9KA 2AJYL 4ISVA 3TNMA 2CDEB 3SPVB 4Y1AD 5ACZA 2WBJB 1VGEH 1KFAH 3O2VL 4ODXB 2ZUQB 5I73B 1A1OB 4OQTL 5IIEB 1CZ8L 1ZA6B 4HPOL 1WEJL 4MD4B 2HJKA 3GO1H 3FT2B 4XCNB 3TO4A 2ICCA 3P9LA 1OT2A 4Z76A 3RWGA 5LXGL 4M7KL 4ZUUA 1MJ8H 2WUCH 1M71A 2Z8RA 3JWDC 5E8EA 3LKRB 3QT2A 4XX1E 2V7NB 3D3VD 1XGQA 3QO0B 4ODSH 2H6PA 1HCVA 1X5IA 4JFDD 1M05A 4GKNB 2IGFH 4X9FA 1NDGB 3VXSA 1PQZA 5E00B 3RU8L 5T3XE 1KPVB 2PTUA 3MRJA 2MOVA 4OGAD 1F4AA 4DCQA 4KJPD 1R3LB 3NFNB 3S4SB 1FH5L 1AGBB 2QSCL 2Z4QA 5GGRY 1C08B 3O11B 3VFNA 2Z8WC 2VLRB 3C5ZB 1J18A 3BKML 3BWAA 4I18A 3VDCA 4K71C 2B0SH 3D18A 3KNBB 4NCC2 3O4LB 1DLHB 2YPLA 3EDKA 2FHCA 4KVNH 5E1AA 1CGSL 5B38A 2X4OA 3U83A 1KT2A 4JZJA 4PRHA 3MOBL 2MKWA 2YXFA 2FYYA 3BT2L 5I30H 1RUML 2HVJB 2ITCA 4CUCA 4OB5H 4NGHL 1F90H 2JF1A 5E7BA 2HA1A 5GGVY 2HWZL 5I6XC 5F7KC 4YFLF 5FA3B 5F7YC 3IJYA 3PWPE 2ADIA 4N0CC 4UIKL 4WFED 5DRXB 1D6EB 3TIDB 2Y5TA 4BUGA 4XPFL 2HG5A 3KPRA 3UROR 4PLOB 4LBEA 5HI4D 2X5PA 4BKLB 3AREB 4FQQB 4ACPA 4Z7WF 1QVOB 2XQYG 3BOVA 2YZ8A 1U3HC 1SEQH 1UZ6E 2JTDA 4YE4H 3PHSA 5HYJA 4JRYD 5C07A 5L9DL 1M7DB 5CD3A 4ZTOL 1HIML 4YHKL 3ZKMD 5IW6A 1EO8H 5HI3C 3I6KA 4C56E 1DUYB 4NM8L 1GAFL 1Y18A 5I16B 3QJFA 1ES0A 5LWYH 3P73B 2ZCHL 4YDLC 1N8ZA 5A2KH 1CI5A 3NIFF 3I75A 2E27L 1UM6H 5D1QD 1IGYB 3DO7A 3CC5B 4FXGB 1OP5H 1T5WA 2Y07L 3ARDC 1T4KB 2ZSVA 4HV8A 2H3NA 3RIAF 2Y23A 4AK1A 3C2SA 4O4YL 4PLKC 5L8LB 4MAUH 1C1EH 1FLTX 4IIQC 4WV1C 3WSQL 4YDJA 5C0BE 4W6YB 1A4JA 1A6TB 3LPFA 2Q6WA 2NX5B 2BSRB 2YZ1A 4A2LA 5I1EL 3T0XA 4JM2D 4OFDA 3NCEB 3ZKND 1QSED 4N8VB 4L5FH 2RBLA 4G80B 3CH1B 2YUXA 5EIQA 2IALA 2JKXA 2W65B 3L1OL 3U36B 3BGAA 2R1YB 3M45A 1FGVH 3MV9E 2D0HA 5EUOF 3MA7A 1REIA 4HWBL 8FABA 1R3KB 4DVRH 4HKJA 4GBXC 3ARGD 1BFTA 4L3CB 3STZA 5LGHL 1NGPH 3BQUC 1XGPA 3CX5K 1I1RA 5FHBL 3BGMB 1PLGH 2XZCH 1CR9H 2DIBA 3P9MA 5JLZB 1JK8A 4NT6A 4MQXD 2IAMA 3W0WB 4NYLA 3UO1L 4PY8J 3GJFA 3TVMA 4CMHC 4L4JA 4WWKA 3QDGD 1VFBA 4Y0GA 5HGDB 1P9MC 4OF5A 3CFKA 1CE6B 4NJ9L 1CT8B 2H32B 3I6LD 2FJHB 4MD0B 1K4DB 5C0FA 4QXGH 1J0JA 1AJ7L 4MA3B 3QXDA 4RNRB 1T03H 4GS7B 4HEPG 2FEDC 4GMTL 4KRPC 1MJ7H 3ILQC 5K9JL 2ZKHL 3RZCC 3SGJA 1BJ1H 1RI8A 2B1AH 2H8PA 2MKLC 5SWSD 1MWAL 5KS9B 4K8RL 2A6DA 3E6FA 1YEKL 2X6MA 4J4PA 3K80A 5DYOA 3RWEB 1RQ5A 3B83A 3T3ME 5C0RL 3SO3C 2BFVL 3PIQA 5HVWA 1NCCH 3REWA 3U0TB 2NY4B 4OIIH 1FO0H 5JHDA 5DJ0B 1QFPA 3UDWC 4MMXC 4OCWH 1CFSA 4LPTA 1H5BA 2F19H 2VZVA 5CCKH 5C71A 1BF8A 4BZ1H 3VXNB 3EYVA 4L8BB 4BQ6A 1DN0A 4HBQA 4YDKH 4YC2C 5A3ID 2HAZA 3KJ4B 3PXHA 5ERWB 3S36H 1P4LB 4DVBA 1DVFA 3RX8A 3ZHKA 1FIGH 3TNNB 1QSFE 1KIPB 1UXSB 4MHHI 2DLIA 3BUTA 4NKIH 4PJBA 3E6HA 3RWJA 1S7VA 1G7HB 2C3WA 2ERJC 5F8QC 1IGTB 2AJYH 3QDMB 3Q5TA 5CHNA 3O2VH 4HWBA 5C09B 2OS7A 1TITA 2R0KL 2NY5C 4OQTH 5GJSL 4PP2B 1MQKL 1CZ8H 3LVEA 3MZTA 3PWJA 2P8LA 2R0WL 4HPOH 3WLWD 3WN5B 1WEJH 5T5NG 5HHME 2NTFB 1LD9B 3OJDA 3QPXL 4UT6L 4Y7MA 1IRAY 2BP3A 3ZSTA 2ESVB 1F3JA 5LXGH 4M7KH 4B7LA 4LASL 1DQDL 5SWQB 3AVEA 5JW4N 1KGCE 5D7JC 5L7XL 4JFFE 2BNUB 4LVHB 2P24A 3ZO0A 1XZ0A 1ADQA 4X6BA 4JFDA 4PJBF 2B5IB 3VMPA 3DUUA 3I85A 1YJDL 3GDBA 4OKVB 4D9QD 3RU8H 1MREL 2Y6SD 3MACL 5D1ZB 3G5ZB 2WP3O 4WCYL 3MJ7A 5E2WL 1MWAA 1FH5H 2QSCH 4OD2B 4FFWC 4PTUA 4EI5C 3N1GC 3TPUB 1Z3GL 3H9SD 1EDQA 3BKMH 4B53A 4YHPA 1QLRA 3TBTB 2F15A 2AJ3B 4WI4A 4XP6L 3GBNL 1R5VB 1CGSH 5GSVA 1MCPL 1FNSL 3MOBH 1RHHB 4MYWB 2H9GB 4WUUA 4I0PD 2Q8AH 3F7VB 1BQSA 3BT2H 3G04B 3BHBB 3EJJX 1RUMH 1DJSA 4NGHH 1NMAL 1OB1B 5IBUG 3MV01 5KS9F 2HWZH 3QIWD 1NUGA 4R4ND 4XNXH 3L3JA 4UIKH 2Z93B 4ENEC 5J56B 3LQMA 4F57L 1P5UA 4XPFH 2YSSA 2WK2A 2B1HL 3LKQB 4EZMA 4M1CD 3IFPA 2HVKB 5HDBE 5IM7A 1AKJB 1N2RA 1DBML 3O6LL 3CSYA 5D2NC 2GJ6B 5TF0A 1UWXK 4N9OB 4OAWB 5D2NE 4HUXB 4L4VA 3NGBB 2EIDA 5HBBA 4TSCL 5L9DH 4F9PA 4ZTOH 1HIMH 3HE7C 4YHKH 1MY5A 2HN7A 5T1KB 4N9GB 4NM8H 1GAFH 3HRPA 3CSPA 4MNQA 4UNTA 1C16A 5JORA 2HLAA 4R2GB 3VXOA 1ETZA 5F1SA 1BD2D 5FFLA 2J2ZA 1GOFA 4OFIA 2ZCHH 4QXWA 4ZFFA 3SDAB 4X6CB 4LPYA 3TN0C 5JW4Q 2EDQA 3G6JE 2E27H 4Y5XC 1AO7B 4QRRB 3D39B 4NQEB 1WZKA 5D1QA 4N5UA 3MNZB 2Y07H 5C0NC 5D7IB 4K07A 3RRQA 3SOBL 4O4YH 4GLRI 3P40A 5I0ZA 2DJUA 2X1WL 4JPVL 3BJLA 3WSQH 2DJ4A 4H25B 4XBPB 3VXUB 1ZGLB 5CGMA 4ZUSA 1U8IA 5I1EH 4JFZL 4X8JB 5FA4B 3UTTA 1C7TA 4J3VA 2XXMB 1A3RL 1T3FA 4GT7A 1FNEB 3WS3B 2LU3A 5JR1L 5IEHA 5BQ7B 3ARFA 5INCA 3D85D 4MQ7B 1EXUA 4X98B 3L1OH 3BO8B 4LF3B 5EU6B 1O7SA 4PRNA 4HWBH 1CL7L 1VESA 5ISZB 1E4KC 4NO3A 2AV1B 1TXKA 1J0ZA 3TC9A 4LGRB 5LGHH 1J05B 5EC1B 4GOSA 4YHNA 3AY4C 1UB6A 5FHBH 1C5DA 4S2SB 3FTGB 2DBJA 4N68A 1CVRA 3RX7A 3HZVB 4QHLA 3O2WL 3H3KA 4WI5A 4WTWA 3UO1H 3KYNB 5F6IB 3W9EB 2VR9A 3DO3A 3JSSA 1U8PB 3BN3B 4JN2B 3RWCB 1NFKA 4NJ9H 1S9YA 3HR6A 3MJ8A 4F2MB 4IBLT 3KWWA 1AJ7H 2Q3ZA 1HHGB 1KCLA 5E8NA 4GMTH 4TRPL 5K9JH 2ZKHH 3P4OA 3WEXA 4UDTB 4NRXB 3GGWA 4Z7OF 1MWAH 4R26L 5SWSA 2SEBA 4K8RH 5JOFB 2R69L 1YEKH 4F7PB 4A6YB 1NC4D 3BEVA 4HGWA 4TTDC 2C7UA 4PJXA 5C0RH 2X89D 3GMRA 2UZXB 2BFVH 4Q6YA 4C55A 1BOYA 1RIVL 2EDBA 3MOQA 1O5DT 3FKUS 3LN4A 2IEPA 3MJGX 4Y5YB 5J13B 5J0BA 5EZOL 3UBXI 3VXRA 5LAXA 3STLA 2R4SL 5F88A 3CFEB 3VGBA 3L95B 3PDDA 2HLFD 3G5VB 1LO3L 2V6HA 4P4KB 3WUZA 4O00A 2UVEA 3I84A 4WVRA 2PYED 1ZTXL 2ED9A 3I02B 4MJ4A 2ZSWB 2AXGA 1EJ6A 5CEYA 3FFCA 1I3UA 1RJZA 5D7IF 5DA4A 1NANH 1D9KD 5DJ2A 3PQYE 1VEPA 4PJXF 5DEZA 1H15B 4IHOA 2NQCA 2R0KH 4N0UE 5GJSH 4YDVA 3PUCA 3CFBA 5H2BA 1MQKH 3GMQA 2E7BA 2RFXA 2R0WH 4TUJA 3VFUB 5IEKB 5DTFB 1CD8A 1T1WB 5EC2A 3QPXH 4UT6H 3NA4A 4OCYL 5HYFA 4KFZC 4R3SA 3Q5YA 1UJ3A 4LASH 1DQDH 1KTLB 5FO8B 5GS1C 2X9WA 4GW5A 4PG2C 3U30B 5L7XH 2WUBL 1OPGL 3EYQD 2VXUL 2X4RB 3O9WA 1OCWL 3QQNA 4JREB 2LABA 3MRDA 1P84J 1T1ZB 4OF7A 2ICEB 1YJDH 1MREH 3MACH 3I3EA 2YD9A 3B9KC 7CGTA 1JGDB 1UACL 4WCYH 5E2WH 5F9OL 3U9UB 4UBDD 1IMHC 1Z3GH 1EIBA 5IQ9B 3FQUA 4EIZC 3H9SA 5MENA 4M6OL 2NYYC 4LU5L 4HUUB 5E94B 4XP6H 3TO4C 3GBNH 4JAMB 3HPJA 1MCPH 1FNSH 2CUHA 3X11A 4JGMA 2AAVA 4P2RA 1S7RB 3VCLB 1NMAH 3OGCA 1KLUA 5DRWB 1BVKB 3U48A 6CGTA 3QUMA 4F57H 1UH2A 4I2XA 4OZFG 1ZMYA 2B1HH 5BRZD 4KMLB 4FTVD 4ZUVA 3VXMB 1DBMH 3O6LH 1ZHKB 4Z7WE 5MI0C 1QBLL 2WSKA 3DTXB 4WU7A 1P2CA 2FH6A 2NZ9D 5FDWB 1WCBB 1QEWB 4TSCH 3ROOA 4J3UA