4DEPB

Structure of the il-1b signaling complex
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
304
structure length
296
Chain Sequence
b'KEREEKIILVSSANEIDVRPCPLNPNEGTITWYKDPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-1 beta
publication title Structure of the activating IL-1 receptor signaling complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 45
structure length 296
sequence length 304
chains with identical sequence E
ec nomenclature
pdb deposition date 2012-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13895 Ig_2 Immunoglobulin domain
B PF18452 Ig_6 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4depB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4depB03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4depB01
1Y0LA 2UUDK 3P2TA 4JFPA 1KB5B 3HNSH 5TE7L 1AP2A 4RFOH 3DVGB 4AG4H 1A6VH 1KLFA 2H3NB 4K3EH 5J1AA 3UJTL 2WWMC 3ZT7A 1AR2A 4X7TB 3MRNB 3HE6A 2BNQB 3MJ9L 4PJGA 5FYLE 1G0DA 3UC0L 3MV11 3PWPD 4HAFA 3B2VL 1NKOA 1CLOL 1K2DB 5L0QB 3CXHJ 3RWJA 4Y5VA 2NXZD 3LEYL 4IEFB 1ZGLA 5GGTL 3O3AA 4OF8A 4DFIA 1CXKA 2A6IB 4ONHB 5C07E 1UH2A 5J12C 4H88L 4MMZC 2ED8A 4FQJL 2P8MB 1QR1A 4Z7WE 3VFOA 1G7JA 4KDVA 4RGOH 3QQNA 3NFPB 2FNBA 4ZYKA 3SDXB 1JMXA 5HVFB 4RFNB 1H0DA 4UB0L 4DQOL 1KCUH 4KRMB 4O9HL 3WS6A 3CGTA 2EIDA 2EE2A 4P9HC 4UUJA 2P44B 3P11H 4L4JA 2ZP0T 1T2XA 2MFNA 3REVA 1DLHB 3WSQH 1P5UA 4OLYH 1IL1A 5FUCC 3CZJA 1U92B 1H3PH 1EIBA 1L7IH 4DGVL 4WFGD 5CHNB 5ID1A 3UYRL 3QCVL 1C7TA 2DM7A 3CXDL 3H42L 1HHKA 2W65B 2OBGA 3AS1A 1OAUH 4HDIB 4DGIH 1JZ3A 3QHTC 4DGYH 5T5NF 4GRWE 5HHVL 1YMHA 3K74B 3H0TA 4RGMC 5I19H 3D5OF 1T89A 2YD1A 3QFJD 1YPZA 4OLUL 1XIWA 4OLZH 5GS0D 1NLBL 1JNNH 3T3PE 3UBXA 4WI8A 1U8HA 1K8IB 1J1XL 4ZO6A 4PGJA 1DBAH 1TXKA 2F5AL 2XTJB 5F3BA 1QLEH 2NYYD 3QEQB 5J13B 5DVLA 5HYJA 2XKSA 3WUZA 5CJQL 5I74B 2VLRB 1P7QD 3LSOA 3I02B 3BVNB 4G6FB 3QULB 5J3HC 3DHMA 1QFUH 2V2XA 1AXTL 2PF6A 3T77B 4Z77B 2O61A 1CD9B 3IF1B 4PRAB 1I1FA 3IS1X 5DJ6B 2HJKA 3ZT5A 4R96B 2JJSC 4JFFB 5J0BA 1ULVA 3NACH 5JOPD 1M05B 3TBWB 4HIEB 3EBAA 3ZT6A 1FVEB 4NHUA 4W6XB 4S11A 1MLCA 5A2LH 5KSAA 1AI1L 4TPRL 5AG8A 3BD4A 3QFDB 3QDGD 1FIEA 4JLRA 4MA8H 2EH7H 4LCIL 1N2RA 3GMRB 1MCWW 4M1GH 3WFEL 5TH2A 1VERA 1GZQB 5B39A 1DVFB 4KJYB 3QXWA 4RAHA 2Y5TB 4FXGB 4OFPA 4TSAL 3QZWA 4MSWA 1V3MA 1KCVH 3PGDA 3WEXA 1Z3GL 4HIHB 4QT5A 3VXPB 3S36H 5D1XB 5T5FH 3NZHH 3DYMA 3NIFF 2P5WA 2VDPL 1C12A 4GSDH 1PW3A 5SWSD 5CEZH 5IBTH 2HH0H 1WJ3A 1HDMA 4HXBL 3CC5B 1DUYA 4X0KB 3O2DA 5HDLA 4ZOAA 3TVMC 1U6AL 2FX8L 3WKNA 1OD9A 4OFVA 3IDIA 4AM0A 1J0IA 5L7XH 4V1DE 5DJ8A 3RVVD 4AT6A 5JA9A 5T3XD 1MQ8A 5EPMA 1T83C 3QJHA 4XC1H 3MV9A 2AEPL 4RNRA 5FYLD 1RHHB 5EFIB 2FH8A 5HPMA 2IADA 4Y8DC 4F57H 5GRVL 3RTQC 2Z8WC 1YYLL 4OF7A 1NEZG 4ZQKA 1MVUA 5MERA 5ILTH 1CWVA 5IKCB 2AEQH 4U6VH 2VDQH 4JY6B 1LE5A 5KJRL 3MLYL 4JN2A 4GW5A 4GLRI 2OK0H 2YMXH 4YE4L 1F45A 4KHTH 4EN3D 3KPPA 1IC7L 2VXQH 3B8YA 3KYOA 2L0DA 5EU6A 3CX5J 2I26N 3T2NL 1IEHA 4Z7VF 5D1QC 3OKNB 5GISH 4FP8H 4Z7VA 3FFCD 3KHOA 1A0QH 1E28A 3AM8A 1TNMA 3MJ9A 1F3RB 1IC5L 3RWCA 4YFLI 2ZOLB 4DKEH 4U1GB 3RRQA 4XBGB 3LB6C 2UWEF 2YKLL 3QIBC 4XNQA 1Y0LB 2UWEA 4Q2ZA 4JFPB 4KKLC 5GQBA 4WO4B 5D9SB 2FWOA 4X6DE 5GGTA 1HHJA 4ZTPH 3EHBC 5EOQL 5EZOH 4OD3L 3QT2A 2AAVA 1F4YL 1JNLH 1N64L 5I15H 4MAUL 5J1AB 3ZKMD 4P59H 3D2UD 2ZWLT 3VWJD 4PJGB 5E6YA 1ERNA 1S7RA 2JCCE 3NCCB 3LN5A 2NZIA 1I9JH 3NPSC 3EYFA 3QEHA 4ZOEA 4W4OA 3RWJB 3Q5YA 1A1MA 1FAKT 4YQXH 4JM2D 5CUSH 1T7YA 3O3AB 1VENA 3OR6A 5I18L 1IVLA 5J1TC 4U49A 3ULVH 4ZAKC 5E6IC 3KYKL 3MRCB 3VWKA 2XRAL 3RHWF 3WIIL 4HV8B 1H0DB 2WIMA 3O2VH 3BPNB 4R0LA 2BNRB 1LO5A 3CFJA 3SGDI 5TE6H 4UUJB 3REVB 1IL1B 3MRIA 2YK1H 3DTXA 4LNVA 6FABH 3KJ6L 1C5DA 1FNSL 5C0FB 5ID1B 1H3GA 3TYFA 4QOKE 4ZO7A 5E2WH 5T1MB 5EO1A 4ERSL 1Y6KR 1T1ZA 3BP6B 1MQKL 4OZIF 1YMHB 3T2PA 5ANME 4OZIA 4M9OA 2I25N 2DQTH 3GSNL 2DLFH 3QDJA 3TZVB 4UTBL 2JJVA 1PAMA 3BEVA 3Q5OA 4K7PH 5D2LA 4F15B 1OWWA 4X5XA 3FRUA 3H7BA 1HE7A 4DOHE 4UBDD 3IDYC 4BFGA 1RIUL 4NQVB 1KB9K 3B4NA 2PXYD 2RQ8A 4CRPA 3LSOB 1TQBC 3FB5A 2GJZB 2AEWA 3D25A 1W0WB 1P84J 4DTGH 4TUKL 4U4BA 4JO3L 3A6BH 2PCPA 1T03H 1G6RA 2VDKH 3EYQD 2YN5A 4NBXB 1FCCA 1MRDL 3O9WD 5JW4Q 1K6QL 2HJKB 3RWHA 2ZCLL 4PB9L 2P4AB 1J0YA 2D7PA 3QQ9D 1MRCH 2Q87A 2MOVA 4FMKA 3BIAX 5AWNL 4H1LH 4UV4H 3MOAL 2CKNA 1UA6H 3ZSTA 3V0WL 3UPRA 5BVJA 4XXDA 1H3TA 1MLCB 4EUPH 5KSAB 4HWBA 1CZ8L 5KZCD 3O6LL 1KGCD 4QXTB 4NKQB 1IQDA 4KJQD 4JLRB 3BP5A 2Y7QA 2ADFL 1N2RB 5J8OA 4Q9QL 4K2UH 1G7QA 3B9KC 2DM4A 4N0RA 3ARGB 4L4TD 5TH2B 3UZVB 1X3DA 2DMBA 5EU7E 3V6FA 4KKAC 5IMKA 2OP4L 4PY8J 4PG2C 1LHZA 3GBML 4JDZA 1G7LA 4CKVX 4LLVA 4KPHH 3WEXB 3EOBA 3QPXL 4NDMA 3VRLF 1C12B 3JUYA 5I1IH 3P73A 1DUYB 1MSPA 1AJ7L 5ALBH 3RI5K 3IDIB 4AM0B 1DL7H 4L8BA 5B22A 5KS9E 2E9JA 4AT6B 4U1KA 1AGCA 2A6DA 2K7QA 5EPMB 5F44A 2YD8A 3MV9B 4ZUVA 1L9MA 1YA5A 3WNKA 5HPMB 5KVFL 2XICA 2EYTA 1FG2A 2WBJD 5F7NC 4ZQKB 4U2ZA 1MVUB 4X6CF 3FAWA 1QOKA 5MERB 5LXGL 2D7TH 4QNPF 5DEGA 1BAFH 5I1KL 1IAKB 2IFFH 4KUZH 2CK2A 4WGWB 3TNMB 1LE5B 5E00A 3VW3H 1EFXD 4GW5B 1QVOA 2DLHA 3KPPB 4M6AA 1CLZH 1RIVH 1X5XA 1EZVY 5IV2A 1U8NA 2P42B 3BZFB 1XF5B 2HKFH 5A1AA 4PP1C 4F9LC 2VR5A 5HYIA 4G7VH 1E28B 4MJ6A 3WJJA 3RWCB 5C09A 1KPUA 4DWHA 4ZPTA 1MELA 4GW1A 3PUCA 2K7PA 3NH7L 4Q2ZB 3VXRA 5F7EH 1E4WL 2FWOB 3FO2A 4JHBA 4PJ7E 4PV8A 4L8SA 2YZ1A 1T7XA 2BFVL 3R06A 4QOKD 4JKKA 1R3KB 5HYQA 1U8LA 4GRLA 1U58A 5C0IA 3WN5C 5T3ZL 3MUHL 2ZG1A 2WNGA 1ZT7A 1WWAX 2NY5H 1S7RB 4LSQL 3W0WE 2MQ3A 3LN5B 5FA4A 5FKAA 3EYFB 3LQZB 3CFDA 1OF2A 1A1MB 3L3OB 2JB6A 2DKMA 4OM0L 4G80A 5DRNA 1I9RL 1WT5A 3OR6B 3JV6A 1AD0B 4KWUA 3PG2A 5F6HJ 4JB9H 5GRVK 5C3LD 3WDIA 4Q6IA 3BH9B 5IBUB 3HUJB 4YK4C 4J7RA 5I1LB 3VWKB 1XGUA 2X4RA 3KWWB 1E4KA 2GYSA 3HNSL 3AROA 2AJSL 3L3KB 2BJMH 1UH3A 4MQXC 4RFOL 4AG4L 5IEHA 1A6VL 1ETZB 2XPGA 4K3EL 3RWIB 4G42A 5B8CB 1LO5B 3CFJB 1ZHBA 2Q1EA 3VGAC 3BDYH 4FQQB 4JY5H 5JXAH 3SN6N 1JHTA 5HI3D 4ENEC 2IAMC 4AEIH 1A7OH 1XMWA 1C5DB 4IRJC 5E4IA 2YC1A 4FQHA 5GPRA 3TYFB 1YY8A 4M7KH 5LGJA 1MJ7H 5EIQA 3MRFA 4UOW0 5EO1B 2XOTA 1MF2H 1OTSD 3F58H 1B88A 2YD5A 3PQYE 4ORGB 4QY8B 4GBXC 5CIPB 3HZKA 2VXVH 5CZXD 1OAQH 2NXYD 3UTPE 3QDJB 5E4EC 1BIIA 3PJSB 4ELMB 3MRQA 4HJ0C 3BEVB 1JWMA 4RGOL 1DBBH 2XQYK 1BF8A 3Q2CA 5GS0H 3R0NA 4QWWC 5FF6A 3P0YH 1U2HA 3GSXA 2HTLC 4KKBD 1B90A 3MLXH 2COQA 3FB5B 4X7DC 3P11L 2DLTA 4P2RD 5HGDB 5C3TA 3WSQL 2E6JA 4OLYL 3MJ8A 1TMCB 4UI2A 2EEAA 2PCPB 3GHBH 3DYOA 3HG1B 1L7IL 3K81A 5JW4M 8CGTA 1WCBB 5INDB 4POZC 4S1DC 4KI5F 1GCFA 5ICXA 3HN3A 3RWHB 5BQ7A 4DGIL 4DGYL 2ZCKH 4PJ8C 3GBLA 4AEFA 3WD5H 1PY4A 5DEFA 5I19L 1KCRH 1NMCB 4KMLB 3MOQA 3ET9F 1CCZA 1KENH 4C4KT 4LARH 5DD3H 1P5VA 4OLZL 4OZGA 1JNNL 3P0VH 5AD0B 5FDWA 2D7MA 1E4XI 4XXDB 5DR5H 4QRPA 3SOBH 2ZUTA 3ZMRA 1DBAL 1ES0A 2VLME 4XTRC 1QLEL 2GFBA 3KJ4C 1IQDB 4ZFFA 2DQUH 3BP5B 4AIZB 4HT1H 1G7QB 4WUUE 3O4LA 5A16A 1FNHA 1HHGB 3ILQD 4JANA 3RWFB 3QRGH 5IMKB 4O5LH 1QFUL 2IQ9H 2F19H 3LKPA 4GKOA 2VLLB 4JDZB 1VFBA 3MGTA 2X42A 3RJQB 2HRPH 2AV1A 1JNHB 1T2JA 2AQ2A 4NDMB 4L29A 3V0AC 2EDTA 1KTDB 3B5HA 3P73B 4MCZB 3DMMB 4FQXD 3X11A 4DAGH 1IMHC 3C5SA 3NACL 2X44D 1UACH 3H9HA 3SBWA 1T3FA 1AHWA 4L8BB 5DJDB 1A9EA 3OHXA 3ARSA 4M7ZC 2A6DB 2P24B 1SJXA 4HPOH 5T3XH 4ZUVB 1ONQA 2ZG3A 2Z35A 1JJUA 5FYLH 4MA8L 2EH7L 3SCMC 3W0WD 1DR9A 2FO4A 1FG2B 4HIXH 4EOWH 4M1GL 5J12B 1PEZA 4OZHF 4M1CD 1X4XA 3B2UC 4FRWA 3U6RB 3ES6B 3T0EE 2D0HA 1KXTB 1NGYB 5EZJA 2VDLH 4Z0XA 4JFEB 3PABA 4P4KA 1M6OB 3JUZA 4MVBD 3S36L 5J11C 5T5FL 3NZHL 5IV2B 5IR1B 4YEEA 4R7NA 3LEVH 4GSDL 3M1BA 1RZJH 5CEZL 5IBTL 2HH0L 2FGZA 3HLAA 1JGUH 3ZKND 2ZNXA 2DIBA 3OF6A 4MJ6B 5L7XL 2PR4H 2GY5A 5C09B 1KPUB 4ZPTB 4DZBA 4GW1B 3WO4B 3FJTA 1RVFH 4XC1L 4JFDB 4XPBH 2GSGB 3VRJA 5H2BB 4YZFE 3O6FA 5DVKA 4PV8B 2A6JA 4L8SB 3SDCD 3R06B 4RGMB 5ILTL 3SDAC 1ADQH 3TA3C 2AEQL 4U6VL 2VDQL 5C0IB 4F9PC 5DSCB 5HHOB 2HTKC 5I66B 4HFWB 3W2DH 4GRWH 1WAAF 2OK0L 2YMXL 2F9BT 4KHTL 3UTPD 5F96L 5IM7A 4LHUB 5D7IA 2HYMA 2DN7A 5FYJE 5FA4B 5FKAB 1OWRM 2ZCHH 4MA3A 3CFDB 4G7YH 5GISL 4GW4A 4FP8L 4PJAF 4PJAA 4XB8A 1OB1A 4JKWA 1A0QL 1IAIM 4PD4K 5DRNB 3PWVA 5JIPA 2OR9H 1CFQA 2J4WH 2J8UF 3JV6B 2E7MA 2J8UA 5ESAB 1IGIH 1RZKH 4DKEL 2APWA 4MHHG 4R4ND 5D8JH 1T66C 4LOUC 3SDDD 1UZ6F 2X4RB 4N0YH 2RCSL 3D0LA 2Z8RA 5DWUH 1YEIH 1BOGA 3TO4A 3A67H 1N7MH 3GSNB 1U8OA 4XCEA 4G42B 5I15L 1JNLL 5KAQG 4QYOB 5FCUH 3GI9H 4P59L 1AO7D 3O81A 1BD2E 1OAKH 3K4AA 1JHTB 1V3KA 3L3HB 4WTZA 3G6JB 3TCXA 2OR7A 3U0PB 1I9JL 2BVTA 2YC1B 4FQHB 1F90H 4YQXL 3C60D 3MRFB 2EH8H 5CUSL 5FYKL 4ISVB 2CMRH 1S7WA 3GB7A 2MSPA 3UP1A 4WEMB 4BH7A 3QH3A 2AXJA 4WUUD 4GAGH 4OI9A 1BIIB 3QXAB 3ARRA 3ULVL 1JWMB 1WC7A 4NRZA 1EEZB 3I9GH 3RUGE 5GZNC 1SJHA 4XMLH 3O2VL 2ENYA 2XY1A 1YEJH 4Q7DA 5CJXA 1B0GA 1SVZA 2BC4B 5D5MB 5TE6L 1GC1H 3OGOE 1C08A 1O7VA 1LNUA 2XN9B 4ZNEE 3PHQB 2FCBA 3MJ8B 1H3UA 3V5DA 2Z91A 2YK1L 4KKCC 4CMHB 6FABL 3C5JA 4UINH 4C54A 5ACZA 5EU3A 3R4DA 5E2WL 2R0WH 2DL9A 5BQ7B 1IM9B 1U8IB 4KJWC 4Y16D 2NNAA 2NXZC 1ZKAA 1IGTA 1TJHH 1PG7X 3ARFD 1R3LA 2DQTL 4TN9A 2DLFL 2WP3O 3MCG1 1NBZA 1EJOH 3T0ED 3QUXD 1EH9A 2GUOA 4GT7A 5ACMA 2HA1A 3SE9H 5FDWB 4CNIB 2R1WA 2C3VA 4HMDA 3P40A 3VGHA 3OJ2C 4MNQE 2EICA 4ZFFB 5E5UB 1FNGA 2EDDA 5DJYA 3MV7B 2W9EL 4WV1C 5EORH 3O4LB 3BW9A 3MV8D 4XX1E 4JANB 4DTGL 1RZGB 3UEZA 3A6BL 1T03L 4GQ9L 2VDKL 1L4IA 5LQBL 3LKPB 1AKJB 5EUOA 1RQ5A 1BVZA 5F1NA 4WHTA 4P0DA 4JRWA 1AE6L 4L29B 4WY7H 1MAKA 4LHJB 4NFBA 1MRCL 4S1RH 2EEBA 3OXSA 5AYQA 4LMQE 3X11B 4GS7B 3S6CA 4UV4L 1FL5A 1OQXA 1BM3H 2QTEA 4NQSB 1T3FB 2AK4A 1UA6L 2L4OA 5D2NB 2Q86B 2O93L 4I2XB 2R8SL 3RVWD 2DBLH 1DQTA 2CXKA 2CIIB 3THMH 5FYJD 4K2UL 4RBPH 5I1CH 4KUCD 3E0GA 5HJ3B 4JDTH 3Q6GH 2ITCB 3VFVA 4I4WA 4ZAKB 1FDLH 5E6IB 3MTRA 1F58H 2NW3A 3ZDZE 4WFEE 2DTSA 3LZFH 1XGTA 1T5WA 1R3IH 4KPHL 4OGAD 1CQKA 3LS4H 2NQCA 4N0CC 1SBBA 3HLAB 2N7BA 5CJOL 4NQCA 1DDHA 5ALBL 3WIFA 1DL7L 3K8LA 1X5KA 5F8QC 1XR8B 3IAPA 3SE4C 3ZSSA 3TGXA 4Y1AE 3OB0H 3DI2B 4UU9B 1U8JA 5D72H 2VQ1A 4XNUH 4MA1B 2D7TL 5F21B 4ZXBD 1J8HA 3V95A 2FJGA 2IFFL 4KUZL 5HDQH 4FQIH 4LCCA 1F2QA 3VW3L 1UG9A 1WIOA 2I24N 5J9PA 1BQHG 5CP7A 5E8EA 3IDYB 5JXED 1JN6B 1CLZL 5D7IB 1RIVL 3ARBD 3G04A 1T7VA 4XBPA 1TQBB 2HKFL 1A2YA 4MA3B 2B7DT 1KLGA 4YXKH 4G7VL 2YPLA 3PWVB 1WBZB 3PL6D 3K1DA 4B7IA 1HCVA 4CVZA 1BLNA 4G5ZH 4M4PA 4JRXA 3SGKA 4APQC 5GSVA 4U1JA 5F7EL 4JE4B 3NCYP 4R7DB 5L2KA 3W5NA 2BP3A 2OLDA 4W81A 3TO4B 3E6HA 4RSVA 1U8OB 4I18A 4XCEB 4E41B 5AAWA 2FGWH 1C8PA 5IHUH 1YN6A 1QSFE 1IAOA 5E2UH 2AS5M 2HJLA 1S5HB 3D85A 4EEEA 2NY5L 1CICD 3IDMA 3EOYG 4PJFB 4UQ3B 2H2SD 4GXUN 3RPIA 1TTGA 5HHMB 5GGSB 2C7UA 1LO4H 4F37F 1Z0NA 3B9KB 3D9AH 1JPGB 3MXWH 4Y2DD 2CDEA 1A64A 5K59F 1XF1A 2EDRA 4XCFH 3BH8B 4M43H 3TN0D 3MNWB 3H3BC 2C3XA 1T2QH 4LPVA 4X9IA 4JB9L 4NWUH 4M6MH 1WC7B 4NRZB 5DJ0A 2KKQA 2YUXA 4U6YB 4XP4L 2BJML 4U3CA 1BVKA 2VYRE 3FO9B 5DC0A 3IXTB 4Q58C 3JSSA 1C08B 3BDYL 1CD0A 3V7AG 1MAJA 3L7EA 1LNUB 3QNYA 3V5DB 4JY5L 1GOGA 5JXAL 2EC8A 4JO4H 4AEIL 3VWJC 1A7OL 5ACZB 5EU3B 1HSBA 1N6VA 2ARJQ 1Z2KA 2HLFC 3NA9H 5H8DA 3PNWA 4M7KL 3FT4B 3MLTB 3PWUA 3VXME 1BEYH 2FLRT 5I8EA 1MF2L 5HVGB 3F58L 4RMRA 2R23A 5ITFA 2WK2A 5E9DE 2VXVL 1NGZA 4D3CH 3IRPX 3GJFH 1NC4A 2EDWA 4OQ1A 3OMZA 5IW3A 1DBBL 1ZHLB 1JI1A 3KS0J 3P4OB 2R1WB 5GS0L 4IJ3C 5TFSH 3P0YL 4H1LA 4ELKA 4K94C 1FNGB 5DJYB 5HI5D 3MLXL 4Z78A 4FZ8H 5C0AB 5JMOC 3BW9B 3HB3C 3GHBL 4EUPA 4MJ4A 4YIQA 5E8DH 3OAUH 4ZPVB 4HJGB 4WHTB 4GG6E 2DQFB 4RQQA 3FQTA 4IDLA 3TFKC 2ZCKL 2DQIH 4Y1AD 3OXSB 5SWQA 5D96C 3WD5L 3BPLC 1LEKB 4LDOB 1YEGH 3QRFM 1M7XA 1KCRL 1JGDA 3RY6A 1KENL 4LARL 4WW2F 2AK4B 5DD3L 4FABH 5T5NG 1YC8A 3P0VL 5ABDE 1HN1A 3CDGB 5DR5L 4F37K 4K23H 3MBEC 3SOBL 1Q9WA 3GI8H 1KG0A 1N26A 2DQUL 3R8BB 4OFYA 3UBXG 4OCSH 5CJ5A 4HT1L 4DN3H 5IHBA 1VB9A 1EBPA 4HJJH 2C4FT 3OKLA 4Y19E 2BY2A 2DS4A 4I4WB 3VFVB 5C0DB 5CKAA 3QRGL 4O5LL 4P5TC 4YK4B 2ZKHH 3D48R 2IQ9L 3FQUA 5C8JA 2F19L 1AGDA 5ID0A 2HRPL 1I7RA 2M1KA 4R97B 3O9WC 3RIFK 5B38A 1MCCA 3PWLA 2KQNA 5JLZB 3NTCH 4HS8H 3BGFB 4DAGL 4ZDHA 4NQCB 9CGTA 1QTYT 3WIFB 4IRSD 1UACL 5IEKB 3EW3B 4I13B 3KPQA 4IRJB 3E2HC 2D9CA 1QSFD 4LVOB 2ESVE 4HPOL 5T3XL 2X05A 3O4OC 5M95B 1ZEAH 2Z31D 1MI5E 4X4ZA 3LV3B 5FYLL 3PGCB 2G5BA 4G9FB 1OM3H 1FFNA 4HIXL 1U8JB 4EOWL 1P6FA 3QEGH 2FJGB 2WANA 4LCCB 2VDLL 1JYVA 5E2JA 5J9PB 1TITA 5CP7B 5E8EB 4URTB 5ADOH 1MCLA 4ACPA 5B39G 1IQWH 1F4HA 3QEUA 4XBPB 5EG6C 1YJDC 1R5WB 1A2YB 1RZJL 4X7FC 3QZWG 1JGUL 2EDEA 1OT1A 1KLGB 3RBGA 2YPLB 5DJ2A 5JDSA 2P43B 3L9RA 1EUTA 2PR4L 5HSFA 1ORQA 1H8OA 1RZ8A 1U95B 4YAQA 1BLNB 1KPRA 3C8HA 5KVDH 3PWPA 1DANT 3QQ4B 1RVFL 2VSCA 3QWOA 3D87B 4XPBL 5F88B 4JRXB 5GSVB 2X09A 3ZTJG 3T1FA 2SEBA 3K80A 2VE6A 4QXGL 1ADQL 4X7SH 2AJ3B 3VXMD 3WFDH 1RAMA 2FH6A 5IP4A 1UCBL 4U6HA 1NDGA 1EXUA 5E9DD 3SDYL 1FYTA 3W2DL 4XPAH 3IDMB 4OFDA 3WJLA 2CSPA 2NX5D 2QKIB 2QADD 3MRRB 5HHQB 1FG9C 5DO2D 4UOW1 3VH8A 3SGEH 3W9EB 1XCTB 4YNYA 2ZCHL 4YHYB 3RX8A 1EEYB 5I17A 4G7YL 4LIQE 4JJ5A 5HI4D 2IAND 1HINH 1ZMYA 4HIIB 2NY3B 2OR9L 2J4WL 3VI3F 2VN4A 1IGIL 1RZKL 1CR9H 4K8RD 4PRPE 5D8JL 1BPVA 2Z9TA 4PJDF 1CT8B 4PJDA 4NC0B 3LDBB 5C9KA 5DWUL 5HGGS 1U36A 3MYJB 2VXUH 3A67L 1N7ML 3KLAA 3TJHD 3BN9C 3HZMA 2IBGA 1XZ0B 4NKMA 5FCUL 3GI9L 4PJBF 3L7EB 2EKSA 3QFJA 3QNYB 2ICCA 1OAKL 5DD1H 3NZ8A 4XWGH 4Y4KA 2X1QA 5L2JA 3MRGA 3N50A 3ARVA 3HI5H 2NY6C 1QSEA 1HSBB 1TDQA 3PNWB 2W9DH 3PWUB 5DA0B 1P7QA 2EH8L 5I8EB 1IAMA 4JPIA 2R23B 5ITFB 2CMRL 4KFZC 3HE7D 3O3BA 4F7TA 4JAMA 5ISZB 5CGYC 4LSVL 1FZJA 2JELH 2EDKA 3ARDA 1E6OH 3WKMH 5BXFA 4XMLL 5GRWA 1G84A 2NY0C 3LRSB 5FAAA 3FN9A 2OSLA 4O02H 4H1LB 3FQNA 1OW0C 4FS0A 1BFVH 1YEJL 1X9QA 4JQIH 4Y4FD 3RKDD 3EO9H 4Z78B 1GC1L 1MFAH 2RFXA 3L95A 3MRHB 1FC1A 2J3SA 5LVEA 3KPLB 5EO0A 4YXHH 4EUPB 4X83A 4RAVA 4UINL 4YIQB 5HI3C 4X99A 3RGVD 1HSAA 1U9KA 5I1HH 2R0WL 5F1SA 4H25A 1PZ5A 5I9QC 4I5BA 4RQQB 4RAUA 1MI5D 3FKUS 3KPSB 3AY4A 4QHNA 5SWQB 3SO3C 2V7HB 1Z0MA 2EZ0D 4XPGH 3V79C 1JYNA 5LCVH 4J8RA 5IT2H 5CJBA 3C8KB 1EJOL 3RZCC 2C3GA 2NXYC 2Z0BA 1UM6H 3GDBA 4CU8A 5FKPA 1D9KC 5E0QA 4ZO9A 3TBVA 3ZKQD 2PO6A 1KG0B 1P53A 3EGSB 3L6FA 3BT2H 2X89A 5EORL 5FYJH 1K4DB 1MCPH 4NIKB 1WTGT 1I4FB 3F7RA 4U7KA 3DPBA 5HPOA 3RNQB 1S9KC 1HHIB 3S5LG 5ID0B 1I7RB 2D4FA 3VXQA 5B38B 3PWLB 2C1OA 5HD8D 1ZSDA 4WY7L 4ELMF 3QUZB 4S1RL 2BSSA 3M17A 1N0LA 5E8NB 2Y25A 1ZANH 1ZA3A 3BYTA 2X9WA 3KXFE 4ZDHB 1BM3L 3C08L 3IS0X 2D2OA 1A6TA 5C07A 3P0GB 3RY5A 5DC4B 4EN3A 3KPQB 3BD3A 4OIIL 4Z7WA 3FFDA 3JV4B 1PLGH 1MCRA 1QSZA 5EOCH 2DBLL 1FSKC 1T7WA 2AXFB 3B5GA 3THML 1JI2A 1FFNB 3PGFH 5I1CL 4D8PA 4JDTL 3Q6GL 1P9MC 1FDLL 5MHSD 1F58L 3JZ7A 4PLJD 3WL9A 4U6XA 4NQXA 5IFHH 3LZFL 1R3IL 4PRPD 3RVXD 1T7ZA 5I1AA 2DQGL 3S34H 1PFCA 1G7IA 3EFFB 3LS4L 5FGSA 3T0BA 3QIUC 1BQLH 3QXDB 1KXVC 2QQKH 3JWDH 2VH5H 1UXSA 1JGEA 3L5WA 1LP9E 2GHWB 1U3JA 1RZ8B 1H9VA 2CK0H 5CEXB 1KPRB 1OARH 2DICA 3MUJA 5BMFH 3PWPB 3K8KA 5HYJE 3I6LE 2NXZB 4JM2A 3BXNA 2SEBB 5FUZH 5D72L 4XP9H 4XNUL 1RMFH 2DQCH 2VE6B 2YA2A 3CPLA 3EDJA 4PG9A 3DV4A 1RHFA 4FQIL 3U4EB 4POYA 2I07A 4U6HB 2A73B 1NL0H 1NDGB 2YWYA 2A83A 2VLKE 3W9DA 1HI6B 1J0ZA 3UAJC 4YNYB 3ARUA 3K2UH 4JJ5B 4P23D 1JTPA 5DD6B 4YXKL 2DIJA 2XZAH 5IW1A 3WUWA 1I7UB 3ZKNC 4M02A 2B2XH 1ZVHA 2XQYG 3MGAA 2VAAA 3QUMH 4MDIA 3G5ZB 4D9LH 5IJVB 3Q3GB 3IRZA 2PYFA 3MA7A 3OKMA 1S78D 4CUCA 2R0LL 3KLAB 3CMGA 5I6XC 4LL9A 3HZMB 5CZKA 4HX1B 2FGWL 4NKMB 4DUWA 5IHUL 1YEEH 1ACZA 1OP5H 2EKSB 4LSTH 5E2UL 4G8GE 5JUEH 3EYSH 1RU9L 3FQXA 4AK1A 3DI3B 4F58H 2QQNH 1LO4L 1FNFA 3D9AL 2PXYA 3MXWL 2C5DC 1P7QB 4XCFL 4HKZB 4M43L 4JPIB 2UZXB 1FLTX 1TTFA 3O3BB 1T2QL 3BKYL 3UTTA 4F7TB 4NWUL 4IOIA 3T2QA 1FZJB 4V1DA 3HE6D 4M6ML 2F54E 3S96A 5FECA 5MENE 4O4YH 4XMPH 2FIRT 3SQOL 1DQML 4UZGA 4UT9H 4HLZG 4HLJA 3E6FB 2RFXB 4KJPC 1M1SA 4KH2A 5BO1L 3DBXA 4X4YA 3RDTD 5EO0B 2JKXA 4JO4L 4RAVB 2B1HH 4U7MA 5DFWH 4X99B 5IVOA 2ZSVA 3MRKA 4NFDA 4RGNE 4WI2A 5DQDH 5E7BA 3QDGB 3WFBH 1A6AB 3NA9L 2YD3A 4Z7VE 1S5IH 1UJ3C 5ESQA 4LP4A 1BEYL 4RAUB 4JZNA 1RJCA 1SJVA 4U1HA 5JPNB 4QHNB 2GJJA 4PJXF 3LKRA 2AABH 3EUUA 1KCLA 5E99H 4D3CL 1UFUA 4J8RB 4R2GC 4ZUSA 5MEQA 1A7RH 1NCNA 4KK5D 4JPWL 3TBVB 3TNNA 3BPOC 5TFSL 5SWSB 1DQLH 5IMOB 4X6DF 1D5ZB 2RHEA 4X6DA 3FO1B 1L6XA 1A22B 3O3DA 4HEME 2X70A 3G6JF 2LVEA 3CIQA 4J4PC 5IUSA 4APQB 1M4KA 3ELAT 1XIWD 1A3QA 3OAUL 3DVNA 2JCCF 2JCCA 4HG4K 3PV6B 3VXQB 4JGJA 2WBJA 4P2OA 4PGCA 4XI5C 1ZSDB 5HYJD 3I6LD 2BSSB 4X6FA 3BWUC 1ZA3B 4HUUA 1YEGL 5BZWA 4KKNA 1A6TB 1FE8H 5DK0A 1EFXA 4FABL 1C7SA 1JP5A 4YFEA 4Z7WB 3TVMA 4K23L 1AD9A 1MUJA 5F9WC 2VLKD 4WUKH 3C5ZC 4FFWC 1R6VA 1IEBA 1OPGH 3FFCB 3LCYA 2A0LD 4OCSL 4RMTA 4DN3L 3U4BH 4R9HA 1NAKH 4HJJL 4D8PB 4J3SA 1GAFH 1F42A 2BVQB 2ZKHL 1T1XB 4ONFH 4U6XB 4XXCC 4NQXB 3CSYA 4OFKA 4RFEA 1TVBB 4WWKD 4LQ1A 3V6OC 3AVEA 4JFOA 5HGAA 3MLPA 1IRAY 4QOKA 1YNKH 1RJLA 3NTCL 4HS8L 4PJ9C 4JRYE 2VUOA 2NY2C 1UXSB 2HG5B 1T22B 3D2UB 4GRWB 5F70A 5IFJB 1G7MA 5ANMA 2BDNH 3VWJB 5JR1H 2LQRA 2HFTA 3HPJA 3ME0A 1CDYA 3EYVA 2CR3A 4G8GD 1F3DH 1ZEAL 4ZMAT 4Z76A 4FTVE 4MJIE 1XGQB 2IEPA 1MCKA 2P5WD 1UM4H 3BXNB 1OM3L 1AXIB 5DJZA 4L3EE 3QEGL 4PG9B 4MZ3A 4OLVH 2I07B 3AGVA 5CINH 2A83B 4IJ3B 1UGNA 4P5KA 3KPMA 4ZS7H 1LO3H 1IQWL 2F54D 4OGAC 4G8EA 4M3JA 3I75B 4XNMB 1G0XA 5IW1B 2BVUA 1WIUA 1S7XA 5FXCH 2KL6A 4PJCB 1QSVA 5KVDL 1IGJA 4QRTA 2UZYB 2FATH 2PYFB 2YZ8A 4K8RH 2LAGB 3FQWA 3KLHC 1Q9KA 1MHEA 2GJ6E 3OKMB 5EU6D 1TZIA 4RGND 4XVTH 4KK9C 5SWZE 5E5MA 1QACA 4X7SL 3WFDL 2X5PA 1RUMH 4OTXH 5IFAH 5FCSH 3T04D 1P4LB 3MLVH 3RY4A 2JLLA 4DW2L 1I1AA 4XPAL 4IOFD 3QNXA 1J1PH 3NBNA 3MGOA 3VRLE 1NCAL 3CCHB 4KQ3H 4ODWA 4K7PX 5KSVA 4HK0B 4IHOA 5DHVH 5DURD 1DE4B 2EEDA 4MNHA 1CR9L 3PL6C 1X7QB 4N0UE 5C6PB 5FB8A 1TNNA 5DMKA 3GMNA 1P69B 5KS9A 3O9WB 2IPKA 1CTOA 2CJUH 2CDGA 3NVQA 2VXUL 5INCB 4N1HB 4N90E 4X6CE 3KVQA 1I7ZA 4ZFOB 4QNPE 4QKXB 3WLWD 1YEFH 1MJ8L 1JK8A 3DBXB 4PRDA 5DD1L 3C8DA 2ITDB 3ZTNH 5J57B 2AVGA 3OGCA 2H8PA 3HI5L 5GIRA 2ZSVB 5KZCB 4XPHH 5F7MC 3I50H 1FZKA 5CD3A 2W9DL 4WTZG 1U3YA 1NCBH 2GIYA 4EI5C 4L4TB 4JFYA 1B3JA 3LKRB 2X4OA 2DKUA 4FN0A 4XMKH 3U0WH 5BVPH 2HN7A 1QNZH 3GIZH 2JELL 1E6OL 3VXRE 4HUVA 1Y6MR 5DQ9A 4PRNB 5MEQB 4C55A 3BIBX 2X4TA 2X4PA 2PN5A 3S4SA 4O02L 4TVPD 4PJ7A 1BFVL 4JQIL 5E8PB 2D03L 4X8XA 1RJZA 4KY1H 2FHBA 3EO9L 1AXSA 1MFAL 4MLIA 4Y5XA 2IBBA 4JRYD 1PSKL 3GSQB 4HS6A 3QUKA 4YXHL 2J8HA 4ODUA 1FVCB 1JWUA 3RVUC 3FCTB 12E8H 1T21A 2HMID 1REIA 3BZ4A 3DVNB 2KPNA 4M7LT 3LEXB 2YD2A 1QYGH 3LKQA 1WISA 5I1HL 3W0WA 4LCUA 2WBJB 4PGCB 3SGEI 4QHKJ 3WCYA 3F62A 4FTVD 4MJID 5D6CA 4EBQH 1BWMA 4FQCH 4X6FB 3EDKA 5J6HA 5I16A 1YNTA 5BZWB 5CD5C 1OY3B 4U1IA 5LCVL 5IT2L 4L3ED 1FZOB 2N56A 3MFGB 1EFXB 3IVKB 3OKOA 1UM6L 4Z7UB 1FO0H 3F7VA 4OCRH 3QXUA 1MH5A 1MUJB 5HYSA 2H45A 1FFPB 5GS1B 2XT1B 3AFLA 3WNPA 5C0EA 5F6IB 2DLIA 3N9GH 4ZTOH 1F00I 3CFBB 4KTYA 2UUDH 5FYJL 1ZGLP 1MCPL 2PW1A 3NOIA 1S7VA 4L4VB 4LIQH 2QQLH 5IGXH 5ENWA 1CL7I 4RFEB 3JVGA 2GSIA 4JFOB 2JJTC 5HGAB 1KELL 3VCLA 1PEWA 1VESA 3H3KA 5EC2A 5JHDE 3SDCA 3P4LA 1NGPH 4QOKB 1RJLB 2GJ6D 3CFEA 1AC6A 1W72H 1ZANL 1D5IH 1S9VA 3QA3A 5E70A 2EIZA 5SWZD 4FQ2H 3PQYA 5ANMB 2N4IA 4KROD 3CU7A 3HPJB 3U9UB 4XP6H 4J3UA 3EYVB 3T3MF 1PLGL 3PWNB 4Z76B 1FORH 5EOCL 3G5XA 3QPQD 4DOHB 2LU3A 3IJHB 4ZUTB 3U7AA 3PGFL 4WFFE 5DJZB 1MCOH 4I0PD 3Q0HA 2Y23A 1FPTH 1S9WA 5IFHL 1T80A 3SDDA 4KI5E 4OB5H 3WN5A 4PPTA 3KPMB 3S34L 3IFLH 4AIOA 1M71A 3MRMA 3U48A 1BQLL 2QQKL 3JWDL 2VH5L 4M00A 4HMCA 4N5EC 3QHZH 4TNWK 1T20B 2H32H 3SHSA 1FP5A 3HC0A 4IRSC 2CK0L 3GIVA 1OARL 4X9BA 1F8TL 4LLMA 2P7TB 4D0CB 4QRTB 2R0KH 4JJHA 3FQWB 5DYOA 1CK0H 1Q9KB 5EA0H 1EX0A 2XKNA 3C60A 4P3DA 4XH2A 5FUZL 5TQ0H 4M8VA 1RMFL 3TEUA 1A6ZB 2DWEA 4LLWA 4NO3A 2NXYB 4PJIE 1NL0L 1TQCB 4YWGH 4PREB 4U2YA 1OGAE 5DMGC 3QNXB 4JGUA 1X5GA 32C2A 4WU7B 2VWEE 2HVKA 3T65B 3VXRD 1RZFH 1AR1D 1H15A 2VRAA 2IAMA 3K2UL 3QQ3A 2IBZY 3DX7B 3WS3A 1ODAA 2E7HA 2XZAL 4P2RB 3UX9B 3OR7A 4GRLD 1MCNA 2ARWA 2B2XL 4PJ5A 4MNHB 4D9LL 5DMKB 3GMNB 1Q94B 3QIWA 4MJ2A 5KS9B 3QWRD 3EO1A 4WJ5B 3HI1A 1YYMH 2I27N 1F6FB 4NYLA 4Y16A 4WI6A 3SJVE 4IIQC 3MROB 1I85A 4OZHE 2Q3AA 3ARFA 3LKSA 3GJFB 4KTDH 4ZO8A 1B6UA 2VZVA 5E2TH 1JK8B 5ITBH 4KRNA 3T0EA 1IGFH 3QUXA 4OV6F 4PRDB 2J2ZA 1WBYA 4L8DA 3KPOA 1F13A 4D0BA 5JUEL 3HMXH 2YWZA 2VAJA 3EYSL 3OGCB 5GIRB 3VFGH 1BF2A 4MDJB 4W4NA 4F58L 1FZKB 2QADC 2QQNL 5CD3B 3TPUB 3MR9A 3QO1A 1J88A 3SQBA 2APBA 2AGJL 4JM4H 2X4OB 2CPCA 5TF1H 1NCCL 4JQVC 3JTSA 2HN7B 3OAZK 4XCNA 3B3IA 4XHJD 3QNZA 5BJTA 4PJ8A 4HUVB 1UYWH 5FO9B 3QIUB 2V9RA 1KCKA 3WIHH 5HTSA 4O4YL 4XMPL 2FR4A 4PJ7B 2F74A 1J8KA 4FQXB 4JCLA 1RJZB 4OCMC 4UT9L 3TJHC 4B7LA 2VXTH 3CU1A 4CVUA 1MWAL 5GSRB 1N5AA 5KSUA 1WAAE 4HS6B 4C56E 3B5TA 3WE6A 4D9RE 3CUPB 5JZ7D 2B1HL 1JHLH 4FA8A 1MY7A 4K3JH 5DQDL 1MLBA 3LKQB 3WFBL 1QR4A 2XWJA 1W0VA 4LKCB 1LE9B 3DETC 1S5IL 3W0WB 2B39A 2AABL 3O8XD 2J8UE 3JWOC 2OTUB 3FOLA 4AENA 5I16B 1YNTB 1CFNA 5E99L 4U6TA 1ZA6A 3MACH 4KV5F 1DTUA 1EHLH 2YHGA 5DQJB 1NEZB 1A7RL 5ICZA 4I9WE 4G6AC 5AG9A 4K71B 1MNUH 4KI5D 1DQLL 1LDSA 3IDNB 4JHAH 4TRPH 3V5KA 5L0QC 1Q9OA 2FJHA 4HGMA 1MFDH 1ZLUH 4H1LG 1S7VB 3QI9D 4H8WC 1VEOA 2P48B 4W6WB 1BD2A 5ENWB 4ODTL 4Y89A 2GSIB 4LMQI 5BS0A 4LGPB 5DZNA 1WGOA 3LH2H 4TUOB 4YDIH 2D9QB 2FL5A 1U8PA 4ZXBA 3DROA 3X12A 4HS3B 1UWEH 1S9VB 3QA3B 4LRIA 3ZYZA 5I2IA 1OOAA 1DSFH 4LBEA 3WO3B 3PHSA 3O6KH 1FE8L 2W0KA 2EZ0C 4NZUL 5JXEA 3BO8A 1ZHNA 4P49A 5HHPA 3ARBA 3RUGF 3RUGA 1OGAD 3U83A 4FG6C 4WUKL 3G5XB 4KMQA 4KU1A 1H3XA 1OPGL 5FA3A 3BN3B 3U4BL 1NAKL 5GRXG 3DO7A 1GAFL 4O2CA 1IM3A 5BW7C 4OIBA 4ONFL 4ZNEA 4R3SB 2Q76B 2W9LA 3P30H 3SDDB 4DUXA 2B4CC 1FHGA 1ZVYA 1G9NC 3ZTJH 1MCWM 2CUIA 1U3HD 2GK2A 4LASH 3VD7A 5I30H 1M71B 3MRMB 2APTA 1XCQA 1YNKL 4BQ8A 2XTJC 3KGRA 5LBSH 1GGCH 4K7FB 5B38G 1AO7B 2HT2D 2J88L 5I74C 3SJVD 4H0HB 4ODXB 5IWLC 2BDNL 2Y6SD 3HC0B 5JR1L 3SKJH 5C0JA 4K3GA 5DYOB 3ZO0A 2D4DA 2XKNB 1GGYA 4Y2DA 1EDQA 3C60B 1G7HA 4XH2B 4MNQA 5C0GB 2VNCA 4LPYA 2A1WH 4UILH 3TN0A 1DN0A 4OKVA 3QUMA 4LLWB 3DIFA 4NO3B 1S9YA 4YHZH 4LPXA 4WUUB 1JZ4A 3OF6D 3BZDA 4E5XA 3EO0B 4LCYA 3NAAH 1JFQH 4GO6B 4PTTA 1LO3L 1FH5H 4G6JL 2VQUA 1BP3B 3U0TA 1H15B 1MHCA 5F1OB 2DJSA 1MCIA 4U0RB 3QQ3B 3BEWA 4OAWA 1I7TB 3WS3B 1N6UA 2RAMA 3B43A 4A2LA 1R3HA 4EDXA 2D0GA 4J3VA 3OR7B 5E1HB 4DJMA 4OCYH 2E9IA 3CVIH 4KK8D 4LNRA 1OAYH 1BJ1J 1DVFC 2FATL 1QHPA 4K8RL 4E9LA 5GZOC 4C56D 4D9RD 1RK0A 4QCIA 1TJGL 2DYPD 1SYVA 3NCMA 1IT9H 5L8KB 3HI1B 1J7VR 3BJLA 4NYLB 4XVTL 4Y16B 1D6VH 3N1QC 5D1XC 5A3ID 3ARFB 4MX7B 4MD0B 3LKSB 2HKHH 4OUUA 1RUML 3CXHK 2JB5H 3FB7A 3QDMA 4OTXL 5IFAL 4HGWB 5CGTA 3MLVL 5F9OL 3QUXB 1KJ3H 4AYFA 2DQEH 4L8DB 4D0BB 5F9WB 1SJEA 1SYSA 1J1PL 2BY3A 3I85A 2VZ1A 4V2CB 5DMYA 4LLYB 1OLLA 4KQ3L 5TDNB 4I9WD 5MEPB 2VISB 3QO1B 4L9LA 3BRGC 4NQEE 3VH8G 2X2YA 3MV8B 4P23C 3WXVH 2NY1D 3B9VA 2J6EH 3JTSB 1MFCH 2UYLB 4XCCH 4PGZA 4XCNB 3B3IB 1D3CA 4HKBA 5ESVA 2VLRE 4JZOA 5BJTB 1F5WA 5IB2A 1A7QH 2HRLA 2IALA 2CJUL 5C0NC 1JHKH 4Z9KB 5J06A 1P4IH 4Y1AA 1TCMA 1FC2D 2F74B 3H3PH 2R2EA 5EO9B 4TVPH 1YEFL 4LSUH 1MAMH 4GLRH 1N5AB 4IBLT 5IVNA 1MREH 3WE6B 1QFWH 4MHHI 4OF5A 1LEGB 3ARZA 3X14B 3ZTNL 4Q9BA 4RISH 2GTZB 4XPHL 1MLBB 3I50L 2XWJB 4HUXB 4HFUH 4PJEF 5IVZA 4PJEA 1NCBL 5IW6A 4XMKL 3U0WL 2YEZA 2R2HB 4LP5A 5CMAB 4Z5RB 5BVPL 1HWHB 1QNZL 3IFNH 4HMEA 1ZA6B 3GIZL 4WTXA 4PUBH 5KOMC 5EBGA 5GRUH 3HE6C 1BFSA 1OP5K 1NC2D 1UKSA 4HK3N 5AZ2H 1TENA 3K0WA 2Z8VC 1JF5A 1Q9OB 5F89B 4KY1L 2A74B 3BKJH 4Y5VC 5FM5O 2DM3A 1T04A 3GMLA 1BFOA 1A7BA 3L7FA 3NN8B 1QSFA 5C2BH 12E8L 3NCYS 2PTVA 1YEKH 2Z31A 1QYGL 4F7CB 2IQAA 5JDJA 3VG9B 1N4XH 4HWBH 5CCKH 1S7SB 4CN4A 4OZ4A 1U8PB 4ZXBB 4EBQL 3BPNC 4FQCL 2CLRA 3X12B 4BH8A 5TJWK 3WS6C 3OJDB 2EYSA 3VD5A 1I3VA 4JGMA 2BCKB 4LBEB 4BUHA 2VZTA 3S88H 1OAZH 4AY0A 1MHHA 4M5ZH 3P77A 1FO0L 2CLZB 3BO8B 1ZHNB 3V4UH 3KLDA 5HHPB 4OCRL 3ARBB 4UMGA 1HXYA 2IH3B 4P4RA 2WV3A 2WUBL 2NY4D 4KTEH 4ONOA 4TSCH 5F9JA 3RP1A 4LLDB 5L6YH 3SGDH 1MRFH 1QO3A 2DWDA 1BGXH 3SE4A 2CLVA 3KPNA 3N9GL 4ZTOL 1AQDA 5D7JD 3PL6B 5E5RB 3C6LD 3DO7B 2H2PD 4LIQL 1IM3B 4NRXB 4PY8I 2QQLL 3EIFA 5IGXL 1T89C 3AU1A 3KYMB 5C08E 1XIWC 2EDXA 1NGPL 3GO1H 5IB3B 1W72L 1GGIH 5GGSY 4MQSB 4B53A 4FQ2L 5E9DA 2HT4D 5IMLA 4Y0GA 3GSUB 1CICB 4ETQB 4G6KH 2EC9T 1LK2A 1WQVT 4XP6L 3R0MA 4NKOB 1FORL 1YQVH 4Q74A 2QSCH 4NQTA 4Y2DB 1G7HB 2YSSA 1BWWA 4RCAA 3MCLH 5F7HA 1RFDH 3VXNB 3TN0B 2BSTA 1MCOL 4OKVB 3CZFA 1S9YB 1V5JA 2ENSA 1OCWL 4NQED 4UV7H 4LCYB 1KIQA 3OXRA 3VD9A 2X41A 4OB5L 2FIKA 4FQ1H 4PTTB 3OG4B 2VLRD 4HD9A 3IFLL 3TT3H 3L5JA 3IETB 1CFSA 5KSAC 4GG6F 1UWXH 3U0TB 4N0FA 5IJKC 4GG6A 2V7NA 3VFSA 4HZLB 1P1ZA 4EDWL 2C4FU 2R4SH 3QHZL 4DCQA 3I3BA 1KIPA 4EDXB 1J8HD 2V6HA 3PP4H 3DX9A 3ARGC 1QRNE 1NAMH 3MNVA 5EUKA 1YNLH 4LNRB 1KJ2B 2PYEE 4HK3J 4PYGA 3KS0H 3D0VA 2R0KL 5D70H 3QUYD 3HZVA 1CK0L 5EA0L 1RK0B 2RGSA 5DHVA 1SYVB 1QLRB 2ZUVA 4PRHB 5TQ0L 2VN7A 4CJ0A 4PR5A 1AIFA 2BVOB 3HE7A 5DFTA 4X5WA 2YXFA 3FB7B 5L88H 4ZSOE 4Y19A 5JO5A 3ROOA 4WWID 4YWGL 2PTTB 4YDVA 3MLSH 1RZFL 4YO0B 5L2KD 3LS5L 5CAYB 4NC1E 4Y4FA 4HLZH 4L9LB 1MWAB 2BMKA 3S35H 3F6LA 3QG6A 1IZKA 1KTRL 5D1ZD 43CAA 3BQUD 1UB6B 5IB5A 1AGFA 2XFXA 2X9XA 4Q9RH 3WUWG 5DK2A 3RGVA 3RL2A 4WNQA 5T1LD 3BKMH 5IB2B 1NPUA 2IALB 2ESVA 3BRDA 2Q6WA 4TUJA 4Z8FH 3UDWC 1MI5A 4YX2H 4Y1AB 1I1CA 3TP4A 5IHZA 2HFEA 5TDPA 1KC5H 1JYXA 4JHWL 4S0TD 3MZGB 3FB6A 3OKDB 5E2TL 1FN4A 5BCAA 5ITBL 1EBAA 3AM8C 1IGFL 5KOVC 1XF2A 1DANU 1DN2A 4E42A 1KN2H 4GKSB 3HMXL 3NIDF 5EN2B 1IBGH 1CQYA 1VFAB 3V6BR 2MWCA 5FYKU 1FV1A 4PJHF 4TQEH 43C9A 1GZPA 3CVHH 4PJHA 4JM4L 4X98B 4EI6A 1N0XH 4XVJH 3ZKXB 3VXSA 3UPAA 4OBRA 1I8KB 4PRBA 5TF1L 5DHYB 2WW8A 1BBJA 1H5BA 4AH2A 5E56A 3GSRA 2ICWJ 1P84K 1UYWL 3CFKB 2GAZA 1U8MB 1TIUA 2KZWA 1XF3B 1OTUD 3DYPA 1CG9A 4OF0A 5C08D 7FABL 4NNXA 1HOCA 1ZS8A 4W4OC 5F71A 2VXTL 1DEDA 2YRZA 4IRSB 3U30B 4YHLH 1T04B 2WIIB 3GMLB 3SGJA 2YOCA 1CDUA 4P3CH 1BFOB 3PIQB 1NC4D 1QSFB 1JHLL 1JPTH 4ODVH 4PB0H 4K3JL 2Z31B 4Y4HD 4JZJA 3VWKC 1HKLH 1FL3A 1K8DA 1QBBA 2ED7A 3MNZA 4GFTB 3M07A 4OZ4B 3VFRA 3VI3E 4BH8B 2EYSB 2QL1A 1WZLA 2ZNWA 4A6YH 5LWYH 2HP4A 1KTLB 1G1YA 5IK3B 1MHHB 1EHLL 4PRPA 4TTDD 3NABH 2VC2H 1HXYB 5DRZB 1W72A 1MNUL 4TRPL 4JHAL 5F9JB 1QO3B 4PLKC 2BSRA 2CLVB 3KPNB 1KT2A 1MFDL 5DFVD 5DI8A 4PJBE 5ELIA 3NCJH 5EBLA 1VDGA 1HHHB 4KK6C 1VPOH 3HPLA 1QRND 3I6GA 3AU1B 1WICA 2G75A 4CL7A 3KDMA 3LH2L 1JL8A 2PYED 4N9GB 3QG7H 4YDIL 3T4AA 4ALAH 1INDH 2VITA 4U1LA 3VXMB 3ARWA 5DDHA 5H37G 1UWEL 3GSVA 5GGVH 1DSFL 3BP7A 3O6KL 2YD7A 5E9DB 4HPYH 3RWDA 3TM6A 2NX5B 3LRHA 2QADB 3VDBA 1JNJA 3JV5A 4DVRH 5LJYH 1INQB 5L8LB 2BNUB 1Y18A 3ALPA 4QF1A 4WDIA 2YSSB 2HLAA 4PP2A 4NWTH 2IANB 2WQRA 2BSTB 4OSUL 5D7SL 4DEPB 5K9OA 3CZFB 2EXYD 3IDJB 4OZFG 4TSBH 2XZQH 1E6JL 5KN5A 4RWYH 1NMCC 3P30L 3OXRB 2HT3C 4P3WA 4LASL 4AQ1B 5I30L 4PGEB 2VLJE 1KNOA 8FABA 4NKDB 4N0FB 2V7NB 5E08H 3HUJE 1IKFL 3VRIA 3VFSB 1P1ZB 3FZUC 1GGCL 5IB1A 1HYSD 1BZ9A 3DX9B 4CU6A 3VMPA 4MAYD 3EOTL 3ULUC 4Z7OF 1K4CA 1E4XH 2R1YA 3D0VB 3IDUA 1HQRA 4LEOB 3HZVB 3D6GA 5DHVB 4RZCA 2EXWC 5AAMA 3DURB 1A4JA 2A1WL 4UILL 2C26A 1C5BH 4PR5B 1AIFB 3HE7B 3TJEL 4X5WB 1CU4H 3MLRH 3B6SA 4M62H 3DMMC 5F7LB 4CU7A 3KLSA 4UT6H 3NAAL 3C9NA 4ODSL 3ROOB 3BFOA 4BSJA 2AXGB 5CSZA 2DDQH 5DJXB 3MREA 2YRPA 3ARED 1RD6A 4HH8A 1FH5L 4ELME 3IDXH 4XRCA 5JOEA 2EDBA 5IQ9A 4Y4FB 1TJIH 1WVZA 1YECH 1GJIA 3W11C 3H7LA 3FQRA 5A2KH 2BOCB 1QBAA 4S1SH 4OUOA 4OCYL 43CAB 3HMXA 2H9GA 3KXFA 3RDTA 2R0ZH 1NUGA 4K9EC 1FYTD 1AGFB 1OAYL 4EVNA 2XFXB 1J87A 5DK2B 3RGVB 5DRWB 1T4KA 3RL2B 4ZFZA 2E5EA 4LF3B 1NFDF 3ULSA 2Q6WB 4TUJB 1IT9L 3RU8L 4F7MB 1OLZA 3HG1E 4WTWA 3N85H 1MI5B 3BI9X 1DQJB 2AI0H 1FNAA 4KMTH 5C71A 4QHLA 5IHZB 2HKHL 2F8XC 2JB5L 2NLJB 3STLA 5I0ZA 1J0HA 1KJ3L 3IAQA 5AUMA 1M7IA 1OW0A 2DQEL 2N7AA 3WJJC 4E42B 3WIHA 4MCYA 3WO4C 1T0MA 3EAKA 3TBSA 2GTWA 1FV1B 4UDTA 3CLFH 43C9B 5SX5K 2FEDD 4WW1A 4HUWA 2Q8BH 1T6VN 1J10A 3HA0A 1G7PA 2AQ1A 4L8SC 5TDOB 3WXVL 4I3SH 2J6EL 1ND0A 4J12A 4NT6A 2OTWA 4XCCL 1H5BB 1LP9F 3PV7A 4GRLC 4JDVA 4XP1H 4AH2B 1JPFB 1LP9A 2FSEA 2P5EB 1F4AA 2F58H 4Y4KD 1Q1JH 2CUHA 4MNGE 1A6UL 4Z7QF 3ARTA 2A2QT 1A7QL 2HJFA 5CWSA 1QSED 3MUZ1 1QKZH 1UVQA 2ZUQC 1JHKL 3VDCA 2P8PA 4OCNC 1P4IL 1KJMB 1ZS8B 4FNLH 5HGBB 3WV0A 4TVPL 1Z9LA 1GHFH 4LSUL 1MAML 3LPWA 1FO0B 1WT5C 1QFWL 2WBKA 3T8XA 4I3GA 1KB5H 3ARDD 4YC2B 4Q6IC 4RISL 4NO0D 2VLKA 3LKNB 2ADJA 4LLUB 4JZJB 3GRWH 1FL3B 3G6AA 1E4KC 4D9QD 1K8DB 5B4MC 3MNZB 3VFRB 1SMAA 4DZ8A 3MBXH 3LQAH 2NZ9C 2XNAB 3IFNL 2FX7H 3DX8B 3BRFA 4WWKA 3HS0A 4PRPB 4Z95H 5GRUL 3SKMA 1G6RL 5EZLA 1JUFA 2ATKB 2J1KA 1U91A 1W72B 5AZ2L 1TVHB 1VADA 1OHQA 3MRJA 4JFEE 1FL6A 2VLJD 3BKJL 1BQHB 1KT2B 4NJ9H 5JIIA 3S4SG 4MQ7A 3RIAF 5I8OH 2WQ8A 3O41A 5C2BL 3HPLB 1YEKL 4G8GA 1ZVSA 5FUCE 5GRYA 1VSCA 3SKOB 2KZ1B 3KDMB 2BVPB 4CW1B 2O26U 5LGKA 5KSBF 2PO6D 3L3GA 4FFVD 1N4XL 4HWBL 3T4AB 2VITB 4YPGA 4U1LB 1C16A 4JFDE 5DDHB 3UTTE 2JK5A 2X89D 2IFGA 1RY7B 1MOEA 3S88L 1OAZL 3ULUL 4R4FH 1SM3H 1UEYA 4M5ZL 3VI4F 3ZDXE 3IGAA 3PDDA 3V4UL 1BVLB 1U93B 2F54A 4CMHC 1CE1H 3TESA 5HHOE 3MC0A 3T4YA 1NDMA 1DEEA 4KTEL 4OLXH 5I73C 4TSCL 3HAEA 5L6YL 3OSKA 1MRFL 2H32B 2ERJB 4JFZH 4P23B 3WHXA 1BGXL 2HLAB 5MENA 6CGTA 4PP2B 1OQOA 5HYSG 5DMIL 2DAVA 3J8F7 5C07D 1ITBB 5KVEL 4YDKH 2Q7YA 1QQDA 2NR6C 1T5XA 1ZT4B 3V8CA 1QFWI 4TULH 3RL1A 1KBGH 4M3KB 2I9TA 4G43A 2CRZA 4OD1H 1KNOB 1MCJA 3GO1L 4PJXE 2JIXA 3NCBB 1GGIL 3RX7A 4W70A 1BZ9B 1UZ8A 1K4CB 4K9EL 2QBWA 4G6KL 3FTGB 1S7UB 1HZHH 1ZLUK 4BSVA 1HQRB 1YQVL 5AZEH 2QSCL 3MUGA 4BJLA 5CSGA 3EDEA 1AP2B 3G6JE 1A4JB 3MCLL 4PRIE 5IBLD 3SEPA 4NZTH 2G9HA 4GS7C 3FT2A 4UV7L 3HE6B 5EB9A 3C9NB 4B50A 5JIHA 3SBWC 5HBBA 1AHWC 3LPGA 4P57A 5D2NC 3MREB 1KPVA 3TT3L 4OGYH 4HBQA 1YZZA 4Y5VB 4XRCB 4UOJA 1B4JH 3DGGA 3CAFA 1ZGLB 2R4SL 1JZ2A 3I6KA 3FQRB 2NTSP 3PP4L 1NAML 4HCRH 2UVEA 3RDTB 3DV6A 1QR1B 3VFOB 4J1UA 1G7JB 5D70L 4ZYKB 3U1SH 4ZFZB 1LO0H 2XN9E 1QPPA 1DJSA 3ULSB 4P4KC 2WWKO 5I8KH 3GNMH 2J6EA 1ACYH 1B0WA 3DHJA 1HCFX 3BIKA 3MRBA 5EBMA 4GKZA 1GL4B 1UKTA 5AUMB 2DBJA 4F80A 4XNZB 2K1MA 4MS8D 4MCYB 4FMFA 3TBSB 2QHRH 1Q9LA 3BKCH 2GTWB 2QR0A 1HHKB 2B5IB 4CVXA 3TV3H 4HUWB 3O6FC 4GMTH 1WZKA 4JRYA 1PYWA 3PXJA 3H0TB 4MA1C 3WLBA 1ND0B 4NT6B 2OTWB 4JDVB 3OX8A 1YPZB 2FSEB 3MV7E 1XIWB 2YA0A 4Q9RL 3UBXB 4M48H 4JVWA 1U8HB 4KK8C 4C58B 5C6WH 2YUVA 3NPZB 5CWSB 5F3BB 3OJVC 4Z8FL 4FTVA 4MJIA 4YX2L 5HYJB 1KC5L 3S5LA 1R5VA 4L3EA 3UTTD 1WTLA 2V2XB 4EXKA 3T8XB 1KN2L 1BX2A 2DQJH 4V1DD 2O61B 1IBGL 5TQ2H 1I1FB 2RR3A 2VLKB 1QBMH 3KAAA 3SE3A 2ADJB 3DUUA 5KVGH 4TQEL 1FCGA 1M7DA 5IF0A 3CVHL 5C9JA 4UAOB 2WLYA 3TO4C 1N0XL 4XVJL 4I2XE 5T1KA 1DBMH 4DZ8B 3UXFA 3K4ZA 2H41A 5DJCA 4NHUB 4WWKB 3HS0B 1QBLH 4L1DA 3IFOA 5J3HD 1U91B 3TBTA 4PBWD 2GJ6A 5CP3A 3V9FA 2LAAA 1TETH 1VGEH 3IXAA 3DJ9A 1VADB 3MRJB 1FL6B 2DB8A 2EDNA 1I8MA 5SWZA 3W39A 4YHLL 4IOSD 5B39B 4MQ7B 3C5ZA 4P3CL 2Q7NA 3O41B 3RHWK 3DSFH 2FB4L 1XH3A 3DGCR 4ODVL 3QZWB 4G8GB 1ZVSB 4MSWB 3JXAA 4PB0L 1ZLSH 3PGDB 3OPZH 3QCUH 4QT5B 5KG9A 1WFNA 1OTTC 2WSKA 1HKLL 2P5WB 5IVXF 4JY4A 3F7QA 1HDMB 4I0PA 1N59A 1VFOA 4F3FA 2JK5B 4M61A 5CJXC 4A6YL 5LWYL 4PRID 5DJ8B 1WWWX 3K8MA 4N0UA 3QJHB 2MNUA 3NABL 4RNRB 2VC2L 2F54B 3BOVA 4KZEH 2GY7B 1NDMB 1DEEB 2IADB 3RA7L 4NZDA 4P2OD 4MXQC 2DMKA 1IGMH 3WHXB 1AY1H 1BHGA 4X6CA 4HWEH 1FVDA 1GVIA 3NCJL 5JORA 1KYOJ 3STZA 3WFHA 4JN2B 1VPOL 5J4MA 5F97E 2AKRA 4IMKA 1X5JA 5IG7A 5LAXA 3TVMD 3KYOB 2W0FA 3RL1B 5EU6B 1KULA 2I9TB 1P2CA 1SQ2N 3QG7L 4RGNB 1J11A 4Z7VB 5I1JH 3MRPA 2ADGA 1QLFA 1Z9OA 3GM0A 1DFBL 3LQAC 1AC0A 5GGVL 3EOAA 5TGBA 4HPYL 1EAPA 1UZ8B 3RTQD 1UADC 1WEJH 2QSVA 5LG1A 3LRGA 4E41E 4XNQB 2UWEB 1DLFH 3T09A 4DVRL 3KPRE 3S9DB 2D7NA 1HHJB 4M9PA 4ZS6C 4WI7A 4GJTB 2E6PA 4HWUA 4PJFE 4NWTL 1NAMA 5DURB 2IG2H 4XHQA 4BELD 4N8VA 5HHME 4XWOC 2G9HB 2R56H 1IGYA 4H20H 3RAJH 4TSBL 2XZQL 1TZGH 3FT2B 5GGRA 4RWYL 5D1QD 1RSFA 3QWRA 4QHMA 4P57B 1KPVB 4RMUA 1CFTA 1T0NA 3QEHB 4C57C 5JMRA 1CVRA 3DGGB 3LB6D 3QIBD 2F5BH 2ARJA 3QP3A 3ROLA 4BSWA 3I6KB 2V17H 4KKLD 1A4KA 4XCYA 1RUAH 3EHBD 1E4XL 5JQHC 4F2MA 3I2CH 2B8OT 1CXIA 4RRPA 5DUPH 4MB5A 4PY7A 2P8LA 2R39A 2ZPKH 4R0LB 4R97C 3O11A 3L3IA 1C5BL 1EHAA 1W2KT 1CU4L 1ZXQA 2OMBA 3MLRL 4M62L 3BGFC 3BIKB 4Z0BH 3X3FH 2Y1VA 3MRIB 4GKZB 3VGFA 3DTXB 4AZ8A 4ONGH 2DDQL 4LVOC 4XX1G 2VQTA 4POUB 3IDXL 4CVXB 1IGCH 1P7HL 1ORSA 1T1ZB 1TJIL 5E6ID 5JHDA 1YECL 1CLYH 2DI7A 3MLZH 4JRYB 1PYWB 5IB4A 4OZIB 5DUMH 4S1SL 3BD5A 5B3NA 2R0ZL 2BHUA 3OX8B 3AMLA 5TE7H 2KH2B 5D2LB 1J5OH 4LCCC 1I1AD 2XXCB 4AMKH 4ZUUA 4UIKH 3T3ME 4X5XB 5C0AE 3FRUB 3H7BB 3CVHA 1U8QA 1KCUL 1FAIH 4CMMA 1UT9A 3OAYK 3N85L 2AI0L 2WLZA 4LSDA 3O8XA 4KMTL 2BERA 2VXSH 3D25B 3VGEA 3S5LB 3UC0H 1U0QA 4GQPH 4I3RH 1R5VB 4L3EB 2R9HC 1CLOH 1UWXK 2VZUA 4LCWE 4ZOBA 1H3PL 4JN1H 1G6RB 1RI8A 5TE4H 5DS8A 5HYFA 3SGKC 4E0RA 1OAUL 3CLFL 3N1PC 2Q8BL 1EO8H 2H26A 3LN9A 4I3SL 4JPVH 3QI9A 1A6PA 1ZK9A 1Q72H 3ULVC 3U46A 3VFTA 5C0CA 5DJCB 2F58L 3UPRB 1Q1JL 5BVJB 1QKZL 1HK6A 2GJ6B 2Y7QB 4A6YA 4YHIA 4YHYC 2E8YA 2VABA 1I8MB 1GHFL 3D3VE 2Z92A 3W39B 3V6FB 3KYNA 2EDJA 1LEIA 2NY3C 4KROB 4PJIF 4PJIA 2DI8A 4N1EA 2YPKA 1G7LB 1OGAA 1VHPA 4LLVB 5KG9B 1EV2E 3LAFA 3EOBB 3GRWL 1F11A 1KEMH 2CRYA 2ATPA 3KPRD 3LDBC 3TBYA 4JY4B 2XIDA 3ORJA 5B21A 4I0PB 3KHQA 4PJ5E 4RDQG 3MBXL 1EAJA 3LQAL 4FXLA 3LD8B 5D7LE 4O51A 1CBVH 1J1XH 4G9FE 2XKUA 2FX7L 4U1KB 5DEZA 1AGCB 2OJZH 1DQDH 3B9KD 2QSQA 4Z95L 2VSDA 5CGMA 2X1PA 3AB0B 2R2BA 1U3HA 4MXVE 4RA3A 4KKAD 4LKXA 5FOBA 3F12A 2OZ4A 2FRGP 4D2NA 2B20A 2EYTB 2L7JA 3K3QA 3HR6A 3V52H 5EBWA 3SJVA 4KGJA 2OQJA 1FVDB 4NJ9L 4OZHA 5DEGB 4L8CA 1BECA 4BKLA 5E00B 5I8OL 3WFHB 4N8PA 2CRIA 5HY9A 1QVOB 1L9NA 5IG7B 1NJ9A 1KCVL 4QLRA 5LAXB 1GGUA 2WBWB 2W0FB 3SPVA 3ESUF 5D6DA 1U8NB 1P2CB 5EC1A 1MCQA 2XA8H 3LY6A 4ZNCD 1PBYA 3BZEA 1WUNT 1CDCA 4KQ4H 5FYKE 1EAPB 4R4FL 5FGBC 3GZKA 1SM3L 3F7YA 4LCIH 3LIZH 3ULVE 1CE1L 1VACA 3H9SE 3VXRB 4OLXL 4LSPH 3FO2B 4MJ5A 4F57L 2FBJH 4JFZL 5I1GH 1LO2H 1NAMB 5HYQB 3EJJX 4R90H 1U8LB 4GRLB 1N6QH 1U58B 4TSAH 4N8VB 1IGYB 4YBQC 3V6ZA 3PQYD 4WU5A 3UTSE 1ZT7B 5GGRB 1JTOA 1AFVH 1WAAA 4YDKL 4LSSH 4C56A 1VGKA 2VXQL 3K2MC 4P46A 2J5LB 2ZUQB 4QHMB 4TULL 5FM5M 2DYPA 1KBGL 1T0NB 4QTHA 4OD1L 1TCRA 1OF2B 2JB6B 4IMLA 2ARJB 4G80B 3ROLB 4BSWB 1AGEA 3IU4H 3FOMA 4KV5E 3ZDYF 1A4KB 4XCYB 4DK3A 4Q6IB 1MCEA 3CH1A 5BRZE 4S0SD 4F2MB 1N3NA 4LCWD 4GH7B 1HZHL 1XGUB 1CXHA 1DP0A 4J3TA 3VMNA 5E6ZA 4ZTPL 1F3JA 3OB8A 1JZ8A 5IEHB 5EZOL 2XPGB 3O11B 1T1WA 3L3IB 3MJGX 2V2TA 1ZHBB 3QUZC 1Q0XH 4NZTL 5E7FA 3X13A 1QEWA 1FFQA 1OP3K 3NA4A 4XZUA 4IIQA 1HKFA 5BS0E 3T2NH 2OL3H 3DNKA 3JTTA 5FGCB 4LLQA 1SY6H 1YY8B 5ISZE 4OGYL 5LGJB 1U2CA 1HH6A 2VLMD 1B4JL 4L5FH 2W07A 5IB4B 2DIAA 3OV6A 3HZKB 4HCRL 3C09B 3MRQB 3D3VD 3L1OH 4MQXD 1TZHA 3T2OA 2G60H 4BZYA 3U1SL 5EOQH 4Q97A 1LO0L 2NY7H 3O0RH 3CVHB 1U8QB 4P9HH 5JIKA 5EWIH 5FF6B 5I8KL 3UYOD 3BGMA 3IKCA 3GSXB 4ENED 3GNML 2GT9A 2IAMD 1ACYL 4HXAH 3O8XB 4I77H 3Q5TA 5GHWH 4PJ5D 3FN0H 2VIRA 4BM7A 2NY5C 2DTMH 5D7LD 3KPSE 2FBOJ 3GJEA 1ZGLM 5I73B 3QIWD 1NC2A 5ICXB 4GBXD 4PGDA 1MPAH 2GK0A 2QHRL 3BKCL 2WWKT 4E0RB 4HJ0D 3W81A 3TV3L 1IC1A 5F9DC 1QD0A 4GMTL 2IGFH 2EIEA 5DEFB 1VCAA 1KB5A 3AC0A 4K7PL 1KUMA 4MA7H 4LHQB 3U46B 1QZ1A 4OZGB 3GRWA 1UQSA 4M48L 3DVGA 4QRPB 4NN6B 1ES0B 3WJLC 1I8LA 2GFBB 5C0BE 2XQBH 1A14H 1JE6A 3DUSA 4A6YB 4FZEH 4POZD 4S1DD 5A16B 3KJ6H 2Z92B 3KYNB 1K2DA 1F02I 1QFOA 3DARA 4YHKH 3Q48A 2DQJL 4PJ8D 4ERSH 5TQ2L 1VFBB 3MGTB 5CBEA 3QDAA 2AV1B 1OGAB 1QBML 1VA9A 4UNVA 1O5DT 2A6IA 5KVGL 1F11B 1XT5A 3E3QC 3H9SD 4HAGA 1CE6A 2ATPB 3MCKA 4FFYH 2P8MA 5D7JA 3NFPA 1DBML 3C5SB 2C9AA 1LGVA 3C6LA 3SDXF 4XTRD 3H9HB 1AHWB 1A9EB 3OHXB 2E7LA 1WBXA 2VZOA 1QBLL 5GS0C 3UTSD 1U3HB 1ONQB 1NGWA 5ACLA 2Z35B 5FOBB 2APVA 1DLHA 2FO4B 5H37H 2NYYC 1TETL 1U92A 5K9JH 3QDME 3AS2A 2I60H 5EBWB 3SJVB 2OQJB 4L8CB 4OGXH 5EZJB 2V5TA 3MLUH 4O58H 3DSFL 2ZCLH 2RB8A 4Z0XB 3PABB 4P4KB 4FFZH 1ZLSL 1IAII 3OPZL 3QCUL 4PLOB 3ARDC 2Y5EA 5BRZD 3SPVB 4R7NB 3M1BB 1G1CA 5I1IL 3ZE0E 1A9BA 4OZFH 3BZEB 4NQEA 3BUTA 2BZDA 4QRQA 3SCMD 1JZ5A 4KZDH 4DZBB 1BJ1H 2A38A 3EZJB 1BD2D 3VRJB 2VLRA 3B2UD 4TOYH 1VACB 5BS0D 4KZEL 3FAXA 3O6FB 3QULA 2A6JB 5FYJU 4JHZA 2W38A 1IGML 2GEEA 1AY1L 4HWEL 2VDMH 4DKAA 1BAFL 3T77A 4PRAA 5DJ6A 5HDBF 5EIVA 1BIHA 1GH7A 2GW5A 4R96A 3WNOA 5C92A 4C56B 1VGKB 2LU7A 5IM7B 3QUYA 3ESVF 1FRGH 2DYPB 4EIZC 1WSST 4PJEE 2AJVH 1M05A 2PO6C 4WFGE 4HIEA 2VL4A 4GW4B 1JBJA 4PJAB 3RWGA 1OB1B 5I1JL 4NZJA 1CGVA 4IMLB 1CFQB 1AGEB 3CMOH 3FOMB 2J8UB 1F6AA 4OLWH 3WNLA 4GAJH 3RVVC 1WEJL 1GRWA 3GMRA 3SDAD 1DLFL 3TA3D 2X1XR 3D0LB 3KPSD 3IT8D 2HTKD 1BOGB 1GZQA 3WNNA 4XVUD 4JG1H 4KJYA 4HCRA 5GJTH 2V2TB 2NY1B 5D1ZA 2Y5TA 4FXGA 2P1YA 1CDGA 1JVKA 1QEWB 2R56L 3BQUA 4H20L 2Y06H 4HIHA 3RAJL 5ADPH 1TZGL 5D1XA 4XZUB 1RULH 4CBPA 2NCMA 1HILA 4PFEA 2V5RA 5T1LA 3HCVA 3JTTB 2XXMB 2FDBP 4EN3C 3TH2T 1MCSA 4LLQB 2L7UA 1JGVH 1RZJC 1NGQH 4Z7NF 5EZIH 1CDHA 2E8ZA 4MNQD 1T66D 5C0BD 2F5BL 1S7WB 3GB7B 4W68A 4BH7B 2F53E 2V17L 3QH3B 4U0QB 3HNVH 1RUAL 5EFIA 1IKNC 3LVEA 1TZHB 3I2CL 1SJHB 2PUQT 5DUPL 2ZPKL 2GI7A 2EDOA 4JY6A 2D0FA 2ZUXA 1T0PB 2GT9B 3GUTA 1B0GB 4RX4A 3QISA 3QDGE 5DGRA 4Z0BL 3ZKMC 3X3FL 5SV4A 4HQQH 2EC9U 3PP3H 2VIRB 2Z91B 4U1NA 4H0IA 3C5JB 4ONGL 3GJEB 3OKYA 1NC2B 4KXZI 4JQXA 2GK0B 5C08A 1A5FH 1MJ7L 3OL2A 2ZOLA 1IGCL 4YFDB 2NNAB 5GZND 4JM2C 1IGTB 1CLYL 3MLZL 1R3LB 3LHPH 1CGTA 1OAQL 2DOCA 1J86A 1RZKC 3QDMD 5SWSE 1EUUA 5K33A 1NBZB 4WO4A 2AJSH 5D9SA 1XR9A 2ED9A 5EOCJ 1J5OL 2GUOB 4YLQT 4AMKL 4NZRH 4UIKL 1UQSB 1LDPH 4WFED 4Y4HA 2C3VB 1WIPA 4KAQH 1DQQA 5T3XE 1FAIL 2Z93A 5FDYA 3H6JA 2VKXA 4KKCD 1H3WM 1PGRB 4PJGF 2FHFA 4OT1H 3DUSB 3ZE2F 4NNPH 4WI5A 2VXSL 1W0YT 4I3RL 5DVOA 4JN1L 4KJWD 3FN3A 1RPQA 5TE4L 1TPXB 5EUOB 4IRZH 5CBEB 5F1NB 1QFWM 4MS8C 2NY4B 4M4RA 3MLWH 2JJWA 1J1OH 5GGQH 3IJSA 1CE6B 3MCKB 4B41A 1EO8L 3UMTA 3C87A 2YS4A 2EE9A 1DCLA 5D7JB 2LTQB 4UNTA 3MRCA 1BMGA 1FL5B 3C6LB 4JPVL 4J2XA 4J23A 4BA8A 1Q72L 2YRLA 4HV8A 2YUWA 3CSBA 3BUYA 1Z6JT 1QRNA 4WW2A 3FFCE 1WBXB 1JRHI 4M93B 2PYEA 1JCKA 2BNRA 1EEUA 1NGWB 5E1AA 5A2JH 3LMJH 4UBDC 4X6EA 4C4KO 1GC1C 2PXYC 2R29H 4S1QH 3IDGA 2RIKA 5C0FA 2QEJA 3ZKSD 4X8JA 3H9ZA 3V2AR 3RWEA 3QWQB 2NW3B 3H2WA 4ZSOA 5T1MA 1EHNA 3PHOA 1XGTB 1T5WB 3EYQC 2UY6A 3BP6A 5L9DH 1KEML 3TZVA 1NCDH 1YPZF 5F7UA 4QHKI 4X9GA 3QQ9C 4Q6YA 1A9BB 1DDHB 1K3IA 4NUGH 1PD6A 5EULV 4NQEB 1NFIA 1CBVL 4QRQB 2ICEA 2E9BA 3MYZA 4NQVA 5F8RC 2W92A 1CIDA 2OJZL 1DQDL 4LU5H 2GJZA 1W0WA 1WV7T 4BFEA 1I9IH 4KJQC 2VQ1B 3V52L 1J8HB 1KEGH 4MAYA 3ZYOA 4RA0C 3NIDE 4N0CD 2F53D 3HTLX 3DWTA 4JKMA 4Y5YA 3AXLA 3QUYB 4WGVB 2WZPD 1A1NA 3G04B 3I84A 1MFBH 4PJHE 2DKSA 3LEVL 4PJCE 4WHYH 5B3JF 3VXSE 2XA8L 3CJJA 4X4ME 3N1MC 3RWGB 1CS6A 5EU5A 1V8HA 3MOBH 4KQ4L 1PDKA 2OX5A 1BREA 5IJKA 1F6AB 4NM4H 4CVZB 4QXTA 3LQMA 3K7UA 3AREA 4OI7A 3LIZL 5M7QA 4U1JB 3ARGA 4KVNH 5L2KB 4LSPL 3LOWA 3OAZH 1BQSA 5E95B 4JEGB 2FBJL 3E6HB 4QRUA 4RMVA 5I1GL 3K46A 4C59B 1LO2L 4GXVH 2WBJC 4P2OC 4I18B 4R90L 4NQDE 5I76A 1N6QL 5D1ZB 1YN6B 4PBVC 4YBHA 3HAEG 3BQUB 1IAOB 1HIMH 2HJLB 1B2WH 2EE3A 3CSPA 3W5MA 3D85B 1AFVL 4LSSL 1HILB 5T1LB 3S35X 3HCVB 3RPIB 1NUDA 2C7UB 2X4QA 5KANI 2CDEB 5GS1C 2A6KA 4OCLC 4APQD 5F6IC 4FQLH 3IU4L 2ZUSA 5DJ0B 4NN5B 2XTLA 3DVFA 4KC3B 4N0YL 3AS3A 5T1DH 35C8H 1WWCA 4TYUA 3VXUE 1YEIL 1IAKA 2CDFA 1BVKB 2UV3A 3TNMA 1WK0A 2X10A 4P5MA 3VGGA 3GUTB 4MQTB 2Y36H 4S10A 1Q0XL 1KGCE 1NCUA 5F96H 5GRZA 4PJBA 3UDWA 1D7FA 1CL7H 4U1NB 2NPLX 3BZFA 1XF5A 2OL3L 4L4TE 1J05A 1IE5A 4YGVA 1SY6L 3E1F1 4Y88A 3CD4A 4FOMA 1F90L 3UROR 5C08B 5I75B 2VTFA 1OD7A 2Y72A 4KDTA 4L5FL 3VGBA 1SMOA 4WI4A 1NGZB 1EEQA 4GAGL 2RCSH 3L1OL 1NC4B 4Y19D 5F1IA 1XR9B 2G60L 3I9GL 4NO0A 1TTUA 1R3KA 4Y4HB 2NY7L 3O0RL 3FHQA 4P9HL 5EWIL 1P7KA 3AS0A 1DQQB 1UB5A 4ELKB 1ZE3C 2Z93B 5FHBH 5H35A 4HXAL 4I77L 2QLVB 3QAZB 5GHWL 2DJUA 2HLFD 5JW4N 1L7TH 5I8CA 3FN0L 2DTML 4KRLB 4OQTH 3LQZA 3L3OA 4GXUM 1JPSH 3UYPA 5FYKH 1CTNA 1MPAL 2D31A 4P9MH 1URLA 2ESVD 3G9AB 1A21A 1AD0A 3FQTB 3HHRB 4I48A 3IJSB 2VLJA 4Z7UE 3ZE1F 3BH9A 3HUJF 2W91A 3HUJA 1TJHL 4N8CH 1OTSC 2IGFL 5I1LA 4Z7OE 1JGDB 3KWWA 5FEBA 1F3DJ 3L3KA 5CZXC 4MA7L 3BUYB 1QRNB 3F8UB 4WW2B 5DA4A 3SE9L 3U82B 1CLCA 5EU7C 1TQCC 4M7JH 1ETZA 3RWIA 2PYEB 1I1AC 5B8CA 4Z6AT 1Q9WB 5C7XH 5HHNA 3HB3D 2FECL 1BZQK 4L4VE 2XQBL 5H94A 5E1AB 4FQQA 2CH8A 1A14L 3HC3H 4X6EB 4KKBC 3DRQA 4DUVA 4FZEL 3RI5F 3IDGB 3OKLB 3VXSD 2C1PA 2WP3T 4X8JB 1IFHH 1Y6NR 3RWEB 2W60A 4YHKL 3FQUB 3TFKD 5C8JB 4ZSOB 1AGDB 3PHOB 3U7YH 3GSWA 4ORGA 4QY8A 5CIPA 3HFMH 1S7QA 4FFYL 3PJSA 4ELMA 5D2LF 4DN4H 3EJYD 4D94A 3MBED 3I3EA 1NFIB 2EDHA 4NQDD 5KVMC 2ICEB 4YFLF 2OR8A 1PQZA 2ZG2A 3HC4H 3GMOA 1NFDE 4UTAH 3MJ6A 2W9EH 2EDLA 4LEXH 4P5TD 5HGDA 2G5BB 5K9JL 2I60L 3HG1A 1CGWA 4GQ9H 5LQBH 1WCBA 5INDA 4JFQA 4MAYB 4QGYA 2UZIH 4OGXL 3ILQC 3CSGA 3RQ3A 3MLUL 4O58L 4H5SA 2ORBH 1AE6H 1F4WH 4Y5YB 3AXLB 4FFZL 4PS4H 3L5HA 1A1NB 2AJXH 4BQBA 4F33A 3QEUB 4NCC2 2BRRH 5CKGA 3VXUD 4P2QE 3DOSA 7CGTA 5DJ2B 5AD0A 4OBSA 3CDCA 5EU5B 4FQXC 3L9RB 5JDSB 5KW9H 4BK5A 2R8SH 1ORQB 4YAQB 4Y5XC 4KZDL 4Z7QE 1HXMA 3QWOB 3AREB 4AIZA 4TOYL 4MNGA 3ULUF 2BRQA 4XT1C 3TH3T 2VJXA 1GOFA 1HHGA 2A77H 1Z5LA 3RWFA 1OGTA 1ITCA 3T1FB 2FECI 4QRUB 2VDML 5CJ8A 5I76B 2VLLA 3DECA 5HDQL 4M1CC 1JNHA 1EXUB 1FYTB 5MEOA 2LE9A 3HR5A 1BZ7A 4P2RE 1FRGL 1KTDA 4MCZA 3DMMA 3VH8B 5CJOH 4GAFB 4L3CA 4MVBC 2AJVL 3WFZA 2X4QB 1NGXA 5I17B 3FHAA 4K71C 1X5LA 5DJDA 2A6KB 2BVEA 2P24A 4Y2OA 2BXZA 2OL3A 5F93C 3CMOL 4OLWL 4YHOH 3GGWA 4GAJL 1SY6A