4DEPB

Structure of the il-1b signaling complex
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
304
structure length
296
Chain Sequence
KEREEKIILVSSANEIDVRPCPLNPNEGTITWYKDPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the activating IL-1 receptor signaling complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Interleukin-1 beta
total genus 45
structure length 296
sequence length 304
chains with identical sequence E
ec nomenclature
pdb deposition date 2012-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13895 Ig_2 Immunoglobulin domain
B PF18452 Ig_6 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4depB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4depB03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4depB01
3KJ6L 1KN4L 4HFUH 2KQMA 2YPLE 3SQOH 3VD7A 5I8KH 1OAXL 1HZHH 1CICD 4XWGL 1Q9LA 5EU5B 1T1YA 1Z9SA 4N8CL 3HI5H 2VN7A 3DO7B 3ARED 4MQXD 3L3HB 3E2HC 3DTXA 1NKOA 2F5AH 1M7IA 1JZ8A 4ELMA 2XKNA 3GEWB 5EU4A 3CXDL 1CS6A 4F15C 1HINL 3SDXF 2XNAB 4K2UH 5M94B 1UA6H 3MLUL 4U1SA 1VEOA 2UWEB 1KCSH 4GBXD 3C60A 1IL1A 4XX1G 2E6PA 2YA1A 2GJ6E 3ZKXB 2XKNB 4KJWC 3QQ9C 3GMMA 3G6JA 3M1BA 5KSVB 3FB7A 1H0DA 1SJEB 3PWLB 5HY9A 5BJTA 2MCG1 2A6KB 3PQYB 1ZTXL 3LRSB 2JCCF 3O9WB 3P30H 3S35X 1SYSB 1A7OH 3QG6A 1FAIL 1UB6A 3V5KB 2H9GB 1I9IL 4U6HA 2VNCA 3L95B 1QFWI 2G5BB 2IAMC 3QAZB 4Y2DC 1HDMB 1WAAF 2IANB 2BY3A 2QADB 2VXVL 2ZSWB 3HAEB 3A67H 4FHBD 3RX7A 2VISA 1RI8A 1G1CA 4NYLA 4QRUA 1INEL 2XKSA 3AM8C 3OTTA 3D69A 1UM6L 4CJ0A 3LAFA 5E99L 5GGUB 4FQIH 4KQ3L 4UDTA 3D87B 3SDXA 5K9QI 1A0QL 4HBCH 4XMPH 4M1CC 4IOFC 4WFGD 4OAWA 4XPBL 5C9JB 3STZA 3VG9C 3VW3L 3UTPE 2LU3A 3IU3B 1PYWA 3INUL 4DN3H 1UCBH 3QCTL 3G5XA 3EAKA 4Y1AB 3RWJB 3BPLC 3X14B 1QUNA 3LKNB 1EFXD 1UG9A 5C0GA 4X5LA 1LDPH 1MCKA 2A6DB 4RBPK 4L1HA 3LZFL 3O2WH 5IBLC 3W5NA 2APFA 4M7ZB 2AV7B 4PP1D 3BKYL 3MJ9A 2BNRE 5E9DE 4EKXA 4LHUA 4P5MA 4P23B 3DSFH 5F7DA 1DQJB 1OARL 2QSTA 2D9CA 3DROB 4D0BA 3OGCA 5C2BL 4KMTL 1N6QL 5GRJL 4P5TC 4RBPH 5HHMD 4P4KA 4FQXD 1N8ZA 3GHEL 4FQJL 4Z7UE 1UYWL 1UB6B 2X9YA 2IBBA 2IEPA 4J4PD 4ODVH 2AI0H 3FAXA 3U9PL 3MTRA 5E8DL 5AYUL 3FQXB 4Q6IC 1A8JH 3MOAH 4WDIA 3U36A 3RDTD 4QOKE 3L3IB 4JQIL 4OIIH 3VRJA 2A6JA 2FGZA 1JRHL 4QXUH 5CD5D 1U8IA 3MLWL 3FB5A 2VO5A 3QWRD 4AQOA 2X44D 2OI9C 4Z5RA 1FNEA 1PKOA 3OX8B 5T33L 1HYSD 4I9WD 3S35H 5DGQA 3HG1E 4TQEL 2IQAB 3F62A 1HXYA 4UINL 4X5WB 3EYOA 1CGWA 3HFML 3A6CL 4L3CB 3PP4L 5TE7H 4I5BB 3GIVA 3QUMA 5DURB 5E4IA 3MRIA 5HVHB 4NRXA 3WIFB 1KPRA 3PJSA 4HJJH 3VXSB 5TQ2L 3FZUC 5INDA 1LP9E 3R06A 4JO3L 2VIRA 5GS2H 3VWJC 4PJAB 4HKZB 2P5WA 3T0VA 4V1DD 4WGVB 2VLRD 4XPHL 5E2TH 4X4YA 4RWHA 2PO6B 4NKDA 1BVLA 3RGHA 5I18H 4HWBH 4LSUL 1KC5H 3IXAA 5JIHA 3BAEH 2VAAB 4PRHA 5FOBA 2R8SH 1YNKH 2FHBA 3B4NA 1QLEL 4FFVC 3MRFA 2OTWB 2VXSH 4ZTOL 1AO7B 4DGYL 4PRPD 4YHML 3NTCH 4HWBL 4D2NA 1KG0B 4YFLI 1I7ZA 4P2OC 2MOVA 3E8UH 3MV8A 2EO9A 3ES6B 2BHUA 2P8MA 2BVQA 2O5XH 3O3AA 2FZ3A 1UXWA 4OD3L 2HFGH 3WE6B 1EO8L 2ICWA 4QHMB 3KPSA 3ZE2F 2ADJA 4OI7A 5DD0H 3H0TA 4CN6A 4AQ1B 1T2JA 4H1LB 2Z35A 3NVQA 2Q7YB 3QPXL 5E4EC 2AJSL 3LKQB 4JE4B 5GHWH 3RUGA 1SJHB 2VR5A 5LAXB 5D7JC 5KVGL 4NQSB 4P3CH 2QR0A 3VXTA 1KIQB 3IFNL 4RAUB 1BQSA 2EE2A 4NNXA 4PJIE 5H35A 1S7XA 4GRWH 1S8DB 4BZYA 2EH7L 4DW2L 4PRDA 3RGVC 1AR2A 1J7VR 1VESA 4D9QE 4YPGA 3EYUH 5GZNC 2VUOA 1EX0A 4I8DA 1DEDA 3O4LB 1JGEB 1KJ2B 3GBMH 4JRYD 2VDRH 5JXEA 4P2OA 4I13B 2FO4B 1I7RA 1TVBA 4EI6A 5JHLH 1FP5A 3LB6D 5IVZA 2X70A 3BPCB 2W0PA 4OFVA 1S7WA 2EIDA 4YK4B 2DTML 5EOCJ 4OLVL 35C8L 3UYRL 1QSFB 1EEYA 1AD0B 4HCRA 4AEHL 3PP3H 3VGAB 4TUKH 2ZKHH 3G5ZB 2HT3D 2PUQT 4NFBA 4NOBA 5EBMA 4U1LB 3SDAB 2VZUA 5DUPL 1D5BA 3DXAB 4MB5A 4OQTA 2NY6B 1DVFB 2CO6B 3BH8B 2AJUL 3TPUA 4I3RL 4BSVB 3HS0B 3W81A 4OQTL 5C2UB 1X4XA 4M5ZH 4MD0B 5IK3A 1GIGL 2FX8H 3QEUA 4FABH 1KBGH 1HHIB 1FH5L 1T4KB 5F21B 5DQ9A 5HYEA 3NAAL 1II4E 4FP8H 1BMGA 3SY0A 2O61A 3N50A 1FPTH 5KTEH 3EDJA 4XP4L 3OG6B 2UVFA 5D1XD 5T5FL 2ZP0T 4KRPB 1LE5A 1AJ7H 4JG0L 3X12B 3WS3A 4Z7QF 5EWIH 2IF7A 1NUGA 3BYYA 4KC3B 1MCLA 2AV1B 5IVXB 4OLYH 4NZTH 1I7RB 2W1NA 4WFGE 4XGZB 3B43A 4N8CH 3F65A 4JZOB 2P1YA 4LRNL 2OZ4A 2I26N 5EN2B 2FECL 5DD3L 5DQJA 4P4RA 4U1MA 3RDTC 2LTQB 4MB4A 4NQDD 2LAGB 1OP5H 3GSQA 3FAWA 5D1QD 2ADFL 4M3KB 4H26B 4EBQL 4YHZL 5FM8A 4MAYA 4RGOH 3KYKH 4KPHH 2LVCA 2A9NL 5KVFL 5TE6L 3V7MA 1RZ7L 2JCCB 3OR6A 3L5WA 3DRTA 1TITA 1UXSB 2DLTA 3RDTA 1WWWX 3O6FD 4TULL 4YDVA 4F37K 3QRGL 4YC2C 4KI5D 4Y4HC 5EBWA 1P6AB 5I8KL 1BD2A 5KSBA 1HKLH 5FB8A 2BSSB 1IQDB 1J0KA 2OZ4H 1WFUA 1AI1L 5B39G 2WINA 5I1AA 5C0AD 3F7PC 1OOAA 3TIDA 4NKOB 1KLUB 4I77L 1QBLL 2ED7A 5FUOL 1KB9K 1FAKT 1KTDA 3BWUC 3T3PE 3TCLB 3ARBA 5DQDH 4QWWC 4F7PA 1XF5B 1I9RH 1S78C 1VADB 4ZO6A 3GSVB 5JW4N 4J1UB 4PJGE 4LSQL 4P48A 4OD1L 1WIUA 1JHKH 1LO3L 3V6OC 1JMXA 2JJTC 1AP2B 1IBGL 2QSVA 4U0QB 5CAYB 4AL8H 3CLEH 5F7EL 2GI7A 3O3EA 3CMGA 3I6GB 4NZRL 2RIKA 5I19H 2Y25A 2EH8L 4X4YB 5HYFA 3PHQB 1EAPB 2BRRH 3QWOB 5EC1A 2GFBB 5T1KB 5L8LB 1XF1A 4PJ8A 4N0YH 3QIBC 3WIFA 1IKNA 4OLZH 4F7EA 3FB6B 5L2JA 1EK3A 2EIEA 4MWFB 4NQXB 5DDHB 2DD8L 5KOMC 1I7TB 4OZGE 3OG4B 3ULUE 2IQAA 3BZ4B 3MRBB 4OCNC 4EI6B 3TYFB 3QYCA 1HH6A 2CKBH 2CR6A 4ZFFB 5T1MA 3SEPA 4NHUB 2C1PA 5FCSH 3GNMH 3TH3T 3UTTA 4PB9L 3U4BH 4YDLC 2HFEA 5HHMB 4MQXC 1G7IA 5FF6B 4NQXA 1MNUL 3OXRB 3C5SB 3QEQA 5EA0L 4OCXL 5KVDL 4K23H 1ZT7A 1DBML 1S7XB 3OAYK 4KV5F 2J8UE 2JF1A 2J6EA 3C9NA 2EKSB 4JREC 4KKBC 2PXYC 2FX7H 2HVKB 3QBTB 5GGVY 4JPKL 5I73B 2IPUG 3PL6A 2ICES 3WXWL 4CVWA 1TJGH 5JDSA 3TNNA 2DI8A 3BXNB 3JWDL 3HMXA 4O02L 3CMOL 1Z5LB 4Y2DA 4JHBA 4PJHE 1NGPL 5ANME 1NLBH 1QKZL 4LDEB 3FQWA 2J88L 2JJUA 4QGTA 4J3XA 4D9RD 2OYPA 4ZS6D 2MPAH 1C12A 3RPIA 5HHQA 2VAJA 4NWUL 1J1XH 5IROA 4F7PB 1IGJB 1RY7B 3BP4A 1DLFL 4D3CL 3IDNB 4KKAC 1QO3A 3CFKB 1NGXA 3ZDYE 2BJMH 3QEGL 4Z76A 2A6DA 4Z7WA 4E41B 4JANB 4YHNB 4PJFB 2VB5A 5IIEB 5I1CH 1YY9D 5DJ2A 2GSGA 4JDZA 5IW6B 1DZBA 4QOKD 1PYWB 1V7MH 4ELKB 1FO0B 1EGJH 3O8XD 2PYED 1WBYA 3O6MH 3PABA 4B7LA 4LLWB 4TOYH 2Q6WA 3B6SA 2J8UB 5FYLL 3W0WA 3ZDZF 4L4TB 4RMWA 1IGIL 2DN7A 5DMJB 1HSAA 5IMOB 3BZDA 3V6ZA 3RWFA 1Z5LA 3CC5B 1NFDE 4NKIH 4JFDD 4MZ3A 5HYSB 3MXWL 3VXQB 4AM0A 1KN4H 1JYVA 4NDMA 2CDEA 4M7ZC 3QUYA 1ZVHA 5D7IF 5F1IA 4CKVX 3DIFB 3Q1SH 1MCCA 4LCIL 1VSCA 3VFTB 1UM5L 4L8SC 5F88B 4YLQT 3NFSH 3QPQC 3C5SA 3QEQB 4TUJA 3TBYB 1ZS8B 1HN1A 2EC8A 1YMHB 3EOTL 1V5JA 3HG1B 5MEOB 2VE6A 4EI5A 1ZHBA 3D0VB 3AAZB 5IB1B 5TQ0H 4XNZC 4TVPL 1QNZH 2CUIA 4FQQB 1MJJB 5T1MB 4G6ML 4HWZA 3VD9A 4WWKD 4XAWH 2DL2A 3BZ4A 1NBYA 3MRBA 5C9KA 3E6HA 4NO0D 4F58H 3RVXC 1QRKA 4GT7A 2VDOH 4ZUTB 1KCVL 1M7IB 2YS4A 5IGXL 2G9HA 1AI1H 2HMID 1CK0L 3AMKA 2EYRB 4X6BB 2YA2A 3KPQA 3MNWB 2XN9B 3O45A 1T66C 4N5EC 5D7IB 1A6VH 5IF0B 1F4WL 1NSNL 5CHNB 1JZ2A 3QDMA 1FL6A 4JDVB 1W72A 5C0JA 3RKDD 5I1JL 5IM7A 4AT6B 1MHHB 1UZ8A 4FXKA 1G7LB 1G7QA 2NX5B 4WWKB 1OPGH 3ARFD 5AAMA 3MCKA 4NQDA 3UTZA 1I8MB 4OCMC 5T5FH 1DQQB 1K8DB 1NCBL 4KPHL 1JCKA 4YHZH 3V5DA 1NGZA 1GOHA 2PYFA 1U91B 4C56A 1JPGB 1KTDB 4LSVH 3TBTA 1E4KA 4YXHH 3TVMB 3UJTL 4PY7B 4NWUH 5HGDB 3X14A 4DJMA 3ECBB 1QLFB 2WINB 4IIQA 4O2CB 5JOFB 5EUOB 1RK0A 3QXTA 1TNMA 3WKNA 1VFAB 4X6EA 4B53A 4JPWH 2NY2B 4M62H 1TPXB 1CQYA 5FKPB 1WFNA 6FABL 4FFZL 4XP4H 5IVOA 4OI9A 2XFXB 3VD3A 3Q6FB 4JO4H 3U9UA 5TF0A 1RZJH 3ULSB 4X4XA 3HAEA 3LD8C 4ZAKB 5EO0B 4ESKA 1QFWM 1CFBA 1ZGLM 4HH8A 4N9GA 3IRZA 2CIKB 1OW0C 1V3MA 3C5JB 4XAKE 3BIKA 1A7NL 4YE4H 2YBRB 2BSED 2BCKB 1DVFC 3N1MC 3GKWL 3LOWA 3M1BB 1BZ7B 5CSZB 3VXUE 4MQSB 4EN3D 3OJDA 1CXEA 3JZ7A 5IV2B 2Y4SA 4G6AC 5C6PB 1NGWB 4ERSH 5H37H 4PJ5D 2WBWB 2YD7A 5DRZA 4MXVE 5F3HA 5EZJB 1R5IA 2R1XB 1KJ2H 4G3YH 4D9RE 5CILL 4DTGL 1NC2D 4HUXB 4XPGL 3GSXA 5CINH 3PHOB 5I8OL 4G6AD 3RNKA 2R4RH 4R4NC 2D31B 1BAFL 3BDBA 3OSKA 4Y4FC 5DD5L 5AWNH 5ALBH 2AVGA 1BQUA 3MODL 4ODTL 4KHXH 3DO7A 1EJ6A 1N0XH 1TPXC 2B8OT 2XN9E 4RMSA 3MGOB 4HIJA 1ZLSL 3W2DH 1FIEA 4RNRA 3U2SB 1AGBA 4QYOB 2XI9A 4WU5A 4GFTB 3WFEL 4QY8B 1EO8H 4NWTH 2CLRA 4MJ6B 5DJ6B 3LPFA 3HS0A 4K7FA 5E95B 3I9GH 3SKOB 2YPVL 2YUWA 2HKFH 3I85A 4OGXH 1WICA 1TZIA 5HPOA 3WFBL 4X5XB 4OZFA 2VSDA 4DGYH 1HH9A 3R06B 1YN7A 5FGBA 5LQBL 3ALPA 5CP7B 4YFLF 5MEQA 1RJYB 2E6JA 4IRZL 1AXTL 3T08A 4WUUD 4GH7B 4OLXL 2G5RA 1FSKB 2HFFB 3ET9F 4JVUA 1BHGA 4QXWA 2JJWA 2YMXL 1FCGA 2F53B 4HUXA 3AMLA 1VGEH 3O4LA 4M03A 4M7JL 2NW3B 4QRPE 3OBAA 4N8PA 2NY1B 4N8VG 2MFNA 5HDLA 5I1DB 5DQDL 3VRJB 1MLBB 1OHQA 3VD5A 1OF2A 1J88A 4RX4A 3QNZB 3V4VL 3LKRA 3P2TA 3VXOA 5B39B 4OZIB 1ZLVK 4DKDC 4Y1AD 3EUUA 4ZOCA 4JRYE 2ADFH 3QIWD 1MQKL 4UV4H 3QR2A 3H9YA 1MCSA 3QO0B 3UTQA 3LS5L 3CUPB 3TNMB 4CL7A 2GHWB 5J11C 4FQLH 3D85D 3D2UB 3HR5A 4ISVA 4XCEB 5IFAL 4D0BB 4W4NA 2RB8A 4XXDA 5E8OA 2ADGB 3HG1D 2EIZB 3VFRA 3CZFA 4JM4L 3DGGB 1T89C 5MEND 2QADD 4CUCA 2YPKA 1G9ML 4L4VE 2VERN 4MAYC 2OQJA 4RAVB 3VRLE 1B88A 4M43L 4R6UA 4LP4A 2XWTA 2HFFA 3G6AB 5CJXC 1CFTA 1Q94B 4XP6H 3MJ8B 3RP1A 1T83C 3TCXA 1P7HL 4JGUA 4KDTC 4X6CB 1MCOL 4KMTH 3LQMA 3B9KD 4R2GD 1C1EL 3QHZH 5A2JH 5IOPA 1JPFA 2VAAA 2ZUVA 4OF7A 4ZUVA 3BT2H 4OIIL 4G9FD 1I3VA 4LU5H 2N7BA 3MCKB 4NQDB 4JHZA 4WWKA 1IAIH 5EIIA 4C57C 1ITBB 2AXGB 4BFIA 4XNQA 4S10A 3NOIA 1UH2A 3C2SA 5E8DH 2GYSA 5GGTL 2OJZH 4XI5C 3MLTA 1RUPH 4HKZA 1UCBL 4GG6F 2YPLD 3O9WC 5I9QC 3U2SA 2Q7NA 3PJSB 4GSDH 4APQA 3TN0B 5GRJH 5DD5H 1MY5A 5C70A 5DT1H 1AD9A 4NN6B 1FL5A 3WNNA 2DQJH 3D25B 1W8NA 2H2SD 2VLRB 1AXSA 1MCJA 1IL1B 1WCBB 4YDKL 4OI8A 1BREA 2YPKB 4KWUA 5FUCC 4DKEL 4ZXBC 5SX5K 3JBG7 1PG7X 5E8OB 5I75B 1HHJA 5F1KC 4TUKL 1N4XH 3ZTJH 3S34H 1RJZB 2OL3L 3MV9B 3BRFA 3L3IA 3QUZA 1R5WA 5D1QB 5D4QA 4TUJB 2V2XA 3CAFA 4Y19A 5KVGH 3SE8H 4X80H 5CGYC 4P57A 5EOQH 1J1PL 1CDUA 2CKNA 2NXYD 3JXAA 2EEBA 2XTJE 1CL7I 1SBBA 1Q9OA 4J7RA 2PW2A 3JSSA 4UIMA 5SV4A 3FFDB 1CE1L 2EYSA 5T3XD 3VXOB 3FQNA 4M5YH 4ZAKA 1VDGA 4MXWH 5D1ZB 1FIGL 4ZPVB 5JHDA 5HGAA 4GUPA 1AE6L 1VEMA 4HC1H 1OP3H 1BOGB 1N3NA 4NQTA 5DUMH 2P5EE 4UZGA 3MLYL 3GO1H 1ZTXH 1W8OA 4K7PX 4R3SA 4J23A 5CIPB 3SQOL 3L1OH 2ITCB 4H1LG 5KAQF 3ULUH 3K8MA 1RJYA 3CDCA 4Q9BA 5IESH 5FO7A 4H88H 3IYLW 5GS3A 3P4MB 4P23C 4LSSL 3NIDE 1WEJL 5F1NB 5C0AA 3HMXL 5K9KA 1XGPA 2EDHA 2BNRD 5E9DD 4HPOH 1CFQA 5DVKA 4ODSL 3TO4C 4NFCA 5CJOL 1H15B 3MCLH 2VQ1A 3U1SL 4QHUA 3FQWB 5EULV 4AIZB 3MR9A 1KULA 1YMMB 1K9TA 2ZPKH 1MHCB 4KKLC 5CEZD 4NO3B 3KPMB 1QSFD 3QHTC 2R0WL 2RQ8A 4G5ZL 5DXWA 4M7JH 5CJ5A 4M7LT 4DKFL 1FDLH 4XNXH 1H5BA 3BXNA 3O41B 4YHMH 2ZUYA 4IRJA 4J3UA 5F9WB 3V4UH 3T2NL 4OM1H 4Y19B 1JNLH 1MQ8A 1ZHLA 1R6VA 5DVOA 5EBGA 3SKUD 5KSVA 3V6OA 2ENYA 1KSRA 2F58H 3L5XH 2WLYA 1S9WB 4M7KL 5DRNA 3S3JA 3PHOA 1QFWH 1GGTA 3OXRA 3QIUD 2FL5A 3T65B 3GBNL 1DANT 1N59A 5BV7B 5JW5A 4HHAB 3REWA 1GGBH 2R2BB 3SKMA 4L8DB 2VXTL 1G6RL 3EYQC 1ETZB 2LVEA 3DVGA 3ZKND 1ZHBB 3DMMB 5DO2D 1FFPB 2XZAL 1M05A 9CGTA 4ODVL 3DXAE 3SDDA 1EHLH 2EDJA 1QQDB 1GZPB 1T1YB 1E4JA 4BK5A 4IRZH 1DBKL 4L1DA 3U0PB 5J13C 1TCRB 4PJDE 1EAPA 5GGRY 1GHFL 5FYJD 5ABDE 3EOBA 3CDFA 5D5MB 1WTLA 5CJ8A 2JIXA 4PY8I 3ARUA 1CGXA 2XFXA 5GRYA 4S1QH 2Z93B 5B38B 5DMYA 2VABA 1H15A 2LU4A 1K85A 2I9TB 2XYCA 3MPCA 4JG1H 4MQ7A 5EO1A 4H8WL 1N6VA 1I8IA 4HMDA 5GS0H 2R9HD 1EV2E 1HK6A 5BQ7B 4WY7H 2DLFH 4LSPH 2D0FA 3K4DA 3P0GB 3BQUA 1MWAH 3LEXA 2AW2A 4Z7WF 2MNUA 5DWUH 1N6QH 2XKUA 4Z7WE 3C5ZD 4ONFL 1KJ3L 2R4RL 3MMEB 1CT8B 1IEAA 3O4OC 4KJPD 1AGCB 5GIRB 3RVUC 4DK3A 4ZOEA 4MVBC 5DJZB 2VR9A 1OTSC 2Y7QA 4X6FB 1XGYH 3VFVA 5HD8D 5CBAA 2H2PC 1RUKL 3IU4L 4GW5A 4K8RD 1KEGL 2EDXA 4FFYH 2IAND 3QDMB 2B2XL 1NCDL 3LKPA 5F7HA 3TO2A 3GM8A 2R23B 1F3JB 5C0DB 4JFHD 3BFOA 3CU1A 2HT3C 1NMAH 3HB3D 4MJ5A 3ZE1F 3KJ4C 4ZTPH 3MLXL 2W9LA 2FATL 3MRLB 1MLBA 4FQIL 4G8FA 2KBGA 4PLJD 4HXBL 1RJZA 3MV9A 4HS3A 2X4UB 1KFAL 1IGCH 3LB6C 1LP9A 5DVMA 1OPGL 4H1LH 4F8TA 1IM9A 3CXDH 5IVXF 5T3ZL 2ICWI 4FQQA 3U83A 2VLKA 5JMRA 4XGZA 2QQNH 3T0EA 1WFTA 3E6FB 1FZMB 4FZEL 3HI5L 4LCCC 1QSEA 4PJ9B 3RL1B 5CS7A 1FSKC 3G5VB 4JEGB 1AHWC 4XT1C 4FQHB 5C07B 1JF6A 4OV5B 2QHRL 4LCUA 4QRRB 4XCFH 3RGVD 5CP7A 2CDFB 5I15H 5D7KE 1ONQB 3STLB 3TLRA 4NO2B 2GJZA 1ZEAL 3LN4A 5I1KH 4PRPA 5HYJE 3BE1H 2FECI 4JFEA 5ICXB 2JJSA 4OLWH 4NZRH 4UILL 3ZE1E 2GW5A 1XH3A 4AL8L 2E27L 1P53A 1G0YR 4MD0A 1ZLUH 1P7QD 2OJEB 4GKSA 3QQNA 4MJ2A 3BD3A 3HI6H 3V6ZB 2NY5C 5I1JH 4NOFA 3KWWA 4ZFGL 4J6RH 5C7XL 1NFIB 5FGCE 3A6BH 4PGEB 4FG6C 1GGBL 5D6DA 2YK1L 1G84A 3PABB 3RU8L 3W39B 2X4PB 3ABZA 4U1JA 1OAXH 1H3PH 4OD2A 1UKSA 3BGFC 4XBEL 3G6AA 3P4OA 4KMQA 5GS1A 1CK0H 1FYTB 1QBLH 3FB8A 2F5BH 2NPLX 3SGKC 5IMKB 4NCC2 4OCLC 3TWCH 2XQBH 3H7BB 4P2OD 5IB2A 3V4UL 5IVZB 4JFFE 3BE1L 4IEFB 3VGDA 4NT6A 32C2B 2CJUH 3LPWA 4PRID 3EBAA 1GXEA 3ZMRA 1Y6KR 2R69L 1FLRH 1SEBA 2GIYA 3DUHA 1QFUL 4R90H 2HTKC 4W81A 3V6FA 5ESQA 3ZKMD 3I84A 1AGEA 3DHJA 3BUYA 2HJKA 5DZOA 1BX2A 2ATPB 2Z8RA 2YBRA 3T8XB 2A0LD 3O0RL 3HLAA 4PJIB 4R0LC 4R8WH 1JGLH 2NW2A 4DGIH 4TUOA 4DUVA 3G08A 5D7SH 3ZHLA 2HT2D 1KUMA 1Q0YL 2FGWL 2DYPD 2UV3A 4ZTPL 4PJDF 5I1KL 2YD1A 2VC2H 4OFPA 5FF6A 2X4TA 5I15L 3LQAH 4MXQD 5CJXA 1NJ9B 3PWPA 1EVTC 3MLRL 1CIDA 4YO0A 1REIA 5E2VH 1A1OB 2YKLL 3VFSA 4IIQB 3GKZA 3I02B 2D03L 4FFYL 4JZNB 4S2SA 1QR1B 1QACA 25C8H 3HAEG 3VCLA 5I66B 5MEPB 5MEQB 2O5ZH 1X4YA 1T0NB 1CYGA 4K94L 4I4WB 1FJ1A 2YUXA 5EOTA 4KHTH 4HKJB 4LNRB 2FSEA 5ACZA 1WZLA 5CZKA 2CKBA 1KJ3H 2GKIA 1DLFH 5SX4H 3KDMA 3V0AC 3ARSA 2HKHL 1Z9LA 2HT4C 3FQTA 5IKCA 3SE8L 3CSYA 4M5ZL 4J4PC 2F74A 1AY1H 4G8IA 5HI3D 1IGFL 3SKOA 2NTSP 4PRHB 4FQXC 5C0JB 2J88H 2XZQL 2GITA 4G9FB 4P5TD 1Q9KA 1ORSB 5JQ6L 2YR3A 4ODWA 4E42B 1N5YH 1NCDH 4QHNB 1O7SA 4NO0B 1L0QA 1S9YB 4QRPD 3FQTB 3WJLA 1RUKH 1QLRA 2X4RA 5L7XH 1KEML 4JREB 4M1DH 1WT5A 2V5TA 4WU7A 1YEHL 4GLRH 2GTWB 2NLJA 5B8CC 4QF1B 4EUPG 3I3EA 3RL2A 2D7NA 4BM7A 3K7UA 4LPYA 3HNSL 1RZGA 3G5VA 1QR1A 2VZSA 4E0RA 1GH7A 3WO4C 3PWVB 3QFJB 2WQRA 3OHXA 1K2DB 4XP1H 1IM9B 4YIQB 2VE6B 4EI5B 4PJEA 2X4TB 2A6JB 4IRSC 3UJIH 4HS3B 5IVXE 5HXMA 2BCKA 3VXPB 4MDJA 3BT2L 1S7TA 5D7LE 1CF8L 4S1SL 1KYOK 3OAUH 3KPOB 4RIRB 1JI2A 5CEZL 4K3HA 5CZXD 2DL9A 4KROC 4GG6B 1RURH 2XN9D 2QR0B 3IB4A 4LLQB 5GS2D 1BP3B 4UNVA 3QIUB 2Z91A 3VXQA 4AM0B 4YR6A 5HYSA 1G1YA 2WP3T 3FN3A 4LLDA 3MZTA 3EDDA 3CC5A 5E5UB 4AEFA 1PEZA 5F89B 5KG9B 5EN2A 4L4TA 1QRNE 5BZDB 1JWUB 1LD9B 5C8JB 5ITBL 5JQHC 4F33B 4HZLB 4XNUH 4ZFOA 4ELKA 5KANI 1IC5H 1SYVA 1JGVL 4LIQE 5BO1H 3H7BA 4Y1AE 1I9RL 3QUZD 1J05B 1BGXL 1CLOL 1X5HA 3HZYB 3NIFF 4CMMB 2P5EA 4PJEF 5B4MD 5D2NE 1IC4L 4HXAL 3W9EB 1I4FB 1R3KA 2G75B 4Q6IB 3MFFB 1QFPA 1YJDL 1HWHB 4QRRD 4Z7VF 1NMCC 3L5IA 2EE9A 2WNGA 4EIGB 3UC0L 1CICC 5EG6C 3PV7A 1YNLL 4PY8J 4QRTA 1W2KT 2NY2D 1NANI 5CHNA 1MRFL 1KXVC 4QRUB 4GRLA 3BRGC 4WW1A 2PO6A 3UZQA 4ENED 3O45B 3AS1A 5F72S 1MIEH 1CIUA 1XGRA 3MV7E 2LFGA 3N1FC 2MMXA 2BERA 2ZCLL 4LPWA 4GG6A 4KZEH 3G5ZA 3S37L 1FIGH 4JFZH 2H9GA 2W0KA 3GSRA 4U6HB 4PJHB 1VFBA 2RR3A 3LRSA 4I5BA 1JGUH 3X3FH 2O26U 3TO4A 3KVQA 5BS0D 2X1WL 4S1RL 4W6WB 3G6JB 1SEQH 4L3ED 2R2EB 5HGGS 4ODBD 1JTPA 2ZSVA 3K0WA 3KPNA 3ULUL 3CZJA 1U8QA 4LPTA 1YC7A 5LKNA 3UBXA 4GG8A 1Z3GL 5IP4A 4LSRH 4U1SB 4LAQH 2NXZC 2YSSA 2V9RA 4QKXB 4NZTL 1LEIB 3T65A 4HQQH 5FGRA 3CFJA 1NEZB 2N4IA 5ISZE 2GK2A 2XG4A 5D6CA 2HG5A 4JG0H 1NAMB 3OKMA 4BQ8A 1OGAD 4K8RL 4RAUA 4JQXC 1EGJA 5HDQH 4OZ4A 4JPVH 3LCYA 1E28B 3MLVH 35C8H 1FC1A 2DTMH 4MZ2A 3GSUB 1F3JA 4XTRC 1DFBH 4MHHI 3SCMC 1HQ4B 4POZC 3D6GA 2KDGA 1ED3A 1IQWL 2Z35B 3LKPB 4H1LA 2AAVA 5J3HC 5L88L 4XC3L 5K59E 1MHCA 3MLSH 3S3SA 1T3FA 2E9BA 5E8PA 4G8IB 1WBYB 2VQUA 4PJEE 3B2VL 5EZIL 3WE6A 1A3RL 5HHPA 4OFKA 4NUJB 4XP9L 4FXGB 2O5YH 4NNPL 4U2YA 4CNIB 4Z7OF 2VDQL 2ORBL 4EN3B 2EH7H 3JWDC 4HQQL 4WI2A 4YK4C 4LVOB 2V17L 4LVNB 4U1KA 5TDOA 5MEPA 4JPIA 1D5IH 1IGJA 5FFLA 3MGAA 5BXFB 1FORH 2OS7A 4Z8FH 3VWKD 1XFPA 4P5KB 3S3PA 1OAQL 1LD9A 1ZLWH 2AJSH 2BNRB 1BD2B 5E9DB 5KSBB 1EO7A 1NL0H 4UT9L 3GMLB 4EDWH 4PRAA 3UAJD 1ZV5A 1JI1A 4IJ3B 1S7SA 1ZA6A 4P2RD 3BEVB 5D1ZA 1J12A 1BVZA 3A67L 4O00A 1TZHB 5ALCH 4YHKH 1F2QA 3LRHA 1ZHKA 3TV3H 3V0VB 3RAJH 3NFNB 2O5XL 1DUZA 3FFDA 1QSZA 1HXMB 1F6AA 3UXFA 1YEJL 1GZQB 3EDFA 3T8XA 4Y5VC 4Y19D 3VXPA 5KJRL 1AH1A 5HGHA 1Z9OA 3EJYC 3GSQB 2X4QA 4RQQA 3SDAC 1HXYB 4PRIB 1Y18B 4LCCA 5E8NA 3QPXH 4S0SD 3KPRD 4YIQA 5MHSD 4PLKD 1K6QL 4PGCB 3ZTNH 1Y6NR 5IB4A 1HH6B 2UWEA 3GRWH 4ZFZA 4NZDA 5IROC 2M8XA 1MJ7H 2AK1L 4ONOA 4MNQD 2XNAA 4X6CF 5DHXB 1FL3B 3V79C 1Q72L 1U8MB 5D2LF 1A6WH 1IC1A 1NC4A 4WCYL 3D25A 5GSRA 3PF2A 3RTQD 4Q2ZA 1FBIL 1F4AA 4BJLA 1F4WH 4K55A 5SWZB 2D7PA 3H42H 2XTJC 3T4AB 1EIBA 1N26A 1H3TA 2BX5A 4RGMC 1OLZA 4ZDHA 5JHDE 3ARDA 3HFMH 4FTVA 3MRHA 3SGKA 3UC0H 2AJZA 4TN9A 4HW6A 1DE4B 2R8SL 1A1NB 3MV7B 3KPMA 2OJEA 3L3GA 2BMKB 5DMGC 4AK1A 4X8XA 5J6GA 1ZLWK 4NM8H 3QUYC 1NFDF 2FD6L 5MENA 1JZ6A 4R0LB 3G9AB 2Z4QB 4N68A 5LCVH 2YPLB 4ETQA 3THMH 5EOTB 2ZUUA 3P4MA 4ORGA 4HT1H 1Q1JL 2CDFA 3Q5TA 4X6CA 1OQXA 3WLWC 3KLSA 3RL1A 1MCIA 2Z31B 4JZNA 4S2SB 2J4WL 5EUOE 4J3WA 3PP4H 1F3RB 1MJUH 4OGYH 2AJYL 2BSSA 2OQJB 4RAVA 3T77A 1ADQL 2ED8A 1ORQA 1CCZA 4P2QE 5BMFL 2BHYA 3TA3A 5GGUA 1N3NB 1T0PB 5H8DA 5TH2B 4C83B 5GSVB 3BGFB 4CDGC 4OCYH 1CGUA 4YDLB 3BIAX 3L7EA 4M7LL 3DOSA 4EDXB 3MA9L 3QISA 5FYLH 1CD9B 3U7WH 2NYYC 4NQSA 5C0BE 1IEHA 3HNVH 3HNTH 3FTGB 3HR6A 3O6LH 3QIBB 3GBLA 4M6NL 3BESR 2DMBA 3G6DL 4F8QA 4RX4D 4LQFH 3RI5K 1X5ZA 2ZUQC 1QPPA 5M7QA 5C08E 2VLME 4LGPB 3SN6N 1C08B 5SWSE 3SKNB 1AGFA 3BSZH 3P11H 4P9HH 5D2NB 4ZO9A 3UBXG 1I3RB 1ZAGA 2HH0L 3RTQB 1DSFH 1QOKA 3RWDA 1AGCA 2VLKE 3NIFE 4D8PA 4J3OC 1NGPH 3T77B 4CU7A 4KROB 2CR3A 4X6DF 2IPKB 4HBQA 3P4OB 1XGQB 1I9IH 3CU7A 3RWEB 4JGMA 4GAGH 1CVSC 1G7JA 3O3DB 3P73B 5BRZD 3KXFA 1P4LA 3MACH 4P0DA 1HHIA 1U41A 2H32B 1HH9B 5JOPE 4QTIL 1YYMH 1TJHH 3MLZH 4R0LA 4WW2B 4MGXA 3IXAB 1XCQA 2VABB 4NZUL 1DVFA 5B3JE 3LKOB 1SHMA 3H9HB 3U7YL 3BN3B 3DETC 4PB9H 4UNTA 6FABH 3D85A 2P5WB 2BC4A 4M48L 1NFKA 2VH5L 2NTFA 1U8KA 4ZYKA 4OZIF 4N0UE 2YKLH 3K81A 5DTFA 5IQ7L 2DD8H 3LY6A 3ROOA 4WJ5A 1RZFL 2IG2L 3FL7A 3O2DA 3MBED 1BF8A 1P4BL 1OM3L 1JPTH 1XZ0A 3NCEB 4NO5A 5GSRB 4L4VD 3CX5K 3O8XB 2ZOKB 1CFNA 5LXGL 3BZFB 4LSVL 4WEUD 4P2RB 5JW5B 4K3EH 4ZFZB 3QCUH 2EIZA 3VFRB 2KKQA 1XR9A 2MQ0A 2WQ8A 1I85C 2NY3B 3PP3K 3ZE0E 4TPRL 3VXNB 4NJ9L 1R24B 1BZ7A 5CSZA 5EPMB 4NQEE 3UTQB 4PJHF 5F9WC 3WFZA 1YEKL 1PSKH 5GS0C 5HGHB 1KIQA 1G6VK 2AEPL 1F90L 2LAAA 1ZWIB 1A7BA 1SJHA 1DN2A 3BKJL 3OZ9L 4RFEB 5B39A 4OZIA 4HUNB 3NFSL 1D5ZA 1ZHNB 1ZGLB 4PJXA 3C60D 4KV5E 1YMMA 3KPSB 4HIEB 3CPLB 2FX9H 4FN0A 5AZEL 5C0BD 2C3VA 2MQ3A 4LDOB 2FO1A 4JM2D 2BK8A 2DQFB 2X4SB 5K9KB 4H5SA 1MCWW 3K74B 3P0VL 4MX7B 4G6KH 3U0TB 3ULUD 3SE3A 4G6MH 4D9QD 4OZHF 5HI5C 1UM4L 8FABA 5D8JH 2B0SH 1OGAB 5CBEA 5BQ7A 1JN6B 1EGJL 2OMBA 1I9JL 3BPOC 3V6OE 1R5VB 3VXRD 2UZYB 1J8HA 4H5SB 1CDHA 1I8IB 2GJ6B 3QWQB 3KPRA 4Q9RH 2EE6A 1DL7L 3I2CL 3IKKA 1D6EA 2WW8A 3TZVD 3ARFA 1CR9L 4MA7H 3LHPH 2Y72A 1F02I 1MHHA 1T2XA 3LPGA 4NKDB 3SO3B 3RGVB 5IM7B 5LXGH 1BFSA 1NMAL 3BGMA 1C5CH 1IVLA 3QJFB 1BZ9A 1S9VA 3GB7B 3O2VH 3TVMD 3EOBB 2BHZA 2P7TB 2EXYD 2Y07H 3FOLA 3MACL 5ADOL 3WKMH 4RGND 5DHVH 1NAML 1YPZA 4PJAF 2ZUTA 2VJXA 1A22B 3RJQB 3QA3B 5EBLA 4I3GA 3Q5YA 3BYTA 4K9EC 4RISL 2X6MA 4C59B 4FS0A 3L3KA 1JHTB 1U3HC 5ID1B 1FGVH 4L8DA 2A77H 4M00A 1R3HA 3RVTD 1MF2H 3KPSE 5GGQH 3BH9B 2D0HA 1JL8A 2H45A 5JOEA 5C0EB 4DGVH 2CD0A 5K9JH 4L9LB 3OV6A 4PTTB 1U36A 2WBKA 5EA0H 2H6PA 2FB4L 3LN9A 1JJUA 1YDPA 1P2CB 4CVUA 4RMTA 2GT9A 2EO1A 4QOKA 2UUDH 4RGNB 1YPZE 1BIIA 1UVQA 5KVEH 1J1OL 1E4XI 3C5JA 4PJIF 3ZYIA 1Y0LB 2BOBB 2OXHA 4R96A 1OAUL 4IDJL 4PG9A 3ZYZA 4TTDD 1YPZF 1TXKA 3NFNA 2Y5TA 5E6IB 4S1QL 2IPTL 3SKJH 3BWAB 3RGVA 1B6UA 2BRRL 4WFFD 4JKMA 1DQJA 2F54D 3PXJA 1GHFH 1IAOA 4QGYA 3ARFB 3MRKB 4M6OH 4DZ8B 5DFVD 4ZUVB 4MMZC 1J8HE 1T2QL 5I19L 5LJYH 5I1GH 1NGQH 4YC2B 5C0FB 2DLFL 4LSPL 2AV7A 1KXTB 2YEZA 3HNTL 3EYSL 3LDBB 4HUUA 1J18A 5FO9B 4WHYG 1MAMH 2HRPH 2VMFA 1MPAL 2UZIL 4TSAL 1MLCA 3L6FB 3ZDZE 5TDOB 4WV1B 3NCYP 1DP0A 1T1XB 2XWTB 5D8JL 4ZUWA 2P5EB 4M8QB 2A73B 1JPGA 3TBTB 2W60B 1T04B 3S5LB 5C0FA 3TJHD 1J87A 4MDIA 3QDGE 1DUYB 1OGTA 3RIAF 2IQ9L 2COQA 5TDPA 5EH1A 1MREL 1YMME 3RWCB 1B0RA 4HAGA 3TWCL 2HAZA 1MRCL 5E2UL 2EH8H 3IF1B 4IHOB 1DN0A 1YJDC 5J9PA 2P49B 3T2NH 3EYFA 5ESVA 4LSDA 3RX5A 4LLDB 3QNXA 3BO8A 4BQBA 4JO2H 5IF0A 1Y0LA 2BOBA 3QI9C 2CXGA 2HFGL 3IFPB 4XNXL 2C9AA 3BKJH 2FYYA 1F45A 4LLQA 2A1WH 2VLLB 3TFKC 2W65A 4G43B 1K3IA 5EPMA 3NCBB 3IT8D 1NANH 2OSLA 4M9PA 4TVSa 4N0FA 3G6JE 2PCPA 4QRSB 3U1SH 1A7QH 3CFBB 3GMPA 4BZ1L 4WUKL 3CFJB 3QO1A 4ODSH 1L4IA 5C0AE 3NTCL 3VDCA 2DQHH 5D72L 3ULVC 4NKMA 3MYJB 3MRDB 4Q0XL 3WNLA 4GW1B 1N0LA 3UTTB 2LV4A 4M4RA 1WCBA 3BZFA 4EBQH 5C08D 1MJJA 4PGDA 2DLEA 4XMKL 1UCTA 1BWMA 2OL3A 1BJ1J 2Z31A 3OKLB 2OMNA 4JKPL 3PIQA 1BD2E 5KSBE 1V8HA 4OQ1A 1GC1C 5DK0A 2VTFA 4HIHA 5MERB 3VFTA 3TBWA 1JK8B 1JGDA 4P9MH 1GC1L 4KK8C 4HMCA 2ICCA 4UAOC 3QUYB 1TZIB 4TRPH 1BZ9B 4YHOH 3AXLA 3GI8H 4WO4D 5F9JA 2ED9A 3CIQA 1IAII 1JVKA 3WBDA 2FJHA 3LN5A 3BPLB 4HS6A 5F96H 3T0AA 2XZCL 3M17A 2CLRB 1T80A 3L5HA 1YECH 1R0AH 4JFDB 1ZVSA 3CLFL 1HKFA 3GSNL 2PYEE 2LQRA 3NZHH 5GGTA 2OTUA 1V7NH 3MROA 4APQD 1LEKB 5IW6A 4JB9L 2WMPA 3TCLA 1J8KA 5KVMC 3B2UD 5JUEL 5DLMH 3MOAL 4LRIC 3OKKB 5E5MB 4NM4L 1KENH 1XF3A 2DDQH 1BECA 2Z8WC 4HV8B 3RPIB 1FE8H 1I3RA 3GM0A 3VGEA 4DK6A 4ZFOB 3WSQL 3LQZB 4JFFB 1T5WB 1FFOB 1INDL 5IB4B 5FB8B 3GJFK 1T6WA 4LF3A 1OAYL 3KLDA 5T3ZE 3WUWG 5IV2A 4HS8H 3VA6A 3AUVA 4LKXB 4UAOB 4XXCC 4XP5L 4WHTB 5I75C 1WWCA 1ZE3C 4HG4K 3TF7C 2X4QB 2KUTA 3K4ZA 1FVDA 3QO0A 3QI9A 2E7BA 1OARH 1RJCA 3VGBA 1MWAL 3GBML 4HF5L 5IG7B 1HNGA 2R1YB 3DRTB 1FYTD 1K5NB 5IHZA 2L7JA 3S34L 3QDJB 4L8BB 1XCTA 1CXIA 1MFCH 2EXYC 1YYLL 4P99A 4YGAB 4NCDA 2YC1B 4CU8A 3O11A 1IARB 4KQ4H 1G7PA 2JCCE 1JWSA 3DI3B 1A3RH 4F3FA 4LARL 5CEZE 1ND0B 4LAQL 2BNQD 1XR9B 3IFLL 1XGTB 2I5YL 2C1OB 1T20B 2R29H 3CH8A 1QRNB 4P2RE 3VE0A 4PGBA 2UWEF 2FWOA 4UU9B 1SEBB 2D9QB 3WD5L 5CKAA 3HUJE 4O2CA 2W9DL 5JOFA 2VDPH 2ILLA 1U3JA 3Q3GA 4MCZB 4O2FB 1AO7E 1KPVB 5DJDB 3QUKA 5F7FA 4LGSB 4URTB 3R8BB 2B4CH 3ULUC 1BWWA 4PRHE 1YN6A 5ILTL 4JQVA 3KYMB 3MBEA 4HGKC 3S37H 4JM2C 4YFEA 1I3GL 1VHPA 1G6RH 3FQRA 2CDGB 3JWOC 2XZZA 4FXGA 4PS4H 1AKJD 3FFCA 3ARZA 5IW1B 4AH2A 1I8MA 4LQ1A 3GBNH 3C6LC 5LVEA 3NZHL 4ZXBB 5EU6A 1QRND 5GRUL 3VWKB 4JM2B 2UY7A 4U3CA 1ED3B 3PDGA 3N06B 2OR8A 2KZWA 4F7TA 1O5DT 4WIQA 3L7FA 1NCWH 3M8OL 2QL1A 1IC4H 4P4KD 5ACZB 5EUOF 1GOFA 3ELAT 4WW2C 1FDLL 2QEJA 4PJ7E 5JNYB 2A9ML 3STLA 4LSTH 3H42L 3RY6C 3O3UN 3QEHB 4U1HB 1FL3A 4UUJB 4J3TA 3KS0H 3Q3GB 4I18C 5B21A 1HZHL 2P24B 1PBYA 4KKCD 1CDJA 3HZKB 2JTDA 4ZTOH 4OB5H 2HFTA 4XHJC 2ZUSA 2VDKH 2VXSL 3GI9H 5L2KD 3T1FB 1NCCL 2R2EA 3LIZH 3VFNB 1CLZH 4RQQB 5HHME 1ZVYA 3V52L 1KELL 4W70A 3V4VH 4C55A 4ZD3H 3AGVA 1AC0A 3HE6C 4U3HA 1JWSB 4OZFG 4Z7UB 4PRBA 1FG2B 3OJMB 3GMOA 1JPST 5GJSL 1HYRC 4Y8DC 1AGDA 4X99A 1NBZA 2DIJA 2Q86A 1D7FA 2DWDA 3MRQB 1XGRB 3V0VA 5BZWA 5C0DA 4CBPA 3T3ME 1OSPH 4D0CA 3K1KC 4WW1B 2QLVB 5L9DH 1JRHI 3WJLC 3P40A 4O58H 5C09D 1J86A 4M1GL 2Q8AL 3QQ3A 3JUYA 4XP1L 3VG0L 3SDCA 4QRTB 1ORQB 2C4FT 3MNVB 3OKOA 3ZO0A 3MOBH 4LCYA 1I8KB 3UTPD 1I8LA 2K7PA 4H8WC 5IT2L 5AWNL 5ITFA 1GVIA 5IMLB 3DMMD 5GRVK 1Z0NA 5IIEA 5F93C 1F8TH 1JUFA 5ETUB 1YEHH 1FYTA 1JRHH 3ILQC 4PD4K 4QXUL 5E6IC 3IDYC 4OF5A 4IMLA 5DYOA 4UMGA 4Y7MA 4DCQB 2C3GA 2YUVA 5CMAA 3HPJB 4LP5A 4V2CB 3LH2L 2V2TB 3M17B 3IDUA 2XRAL 2I9TA 4JRYB 1CDIA 1HE7A 4RCAA 4UBDD 1RIUL 3RWGB 3BRDA 2GSIA 4LBEA 4WV1C 5FGBC 4HJ0D 3BP5B 4WHDA 2EYRA 1R3LB 2VKWA 3JUZA 5J1AA 4JPVL 2B20A 4LIQL 1AR1D 5D6CB 5C3TA 1QSFA 3B9VA 4G6FD 5LGKA 1ZK9A 3GIVB 4JPWL 5DJDA 3LZFH 1N5YL 1EAJA 4LU5L 1A9EB 4YZFF 3DYPA 4IJ3C 4R97B 2UYLB 4U6XB 5E8EB 3RVWC 2QKIB 2VL4A 3DX6B 1WVZA 2X10A 3FT2B 5E7FA 4NBYB 2FIKA 2BSTA 2XWJB 1KACB 4JFQA 2NX5D 3L9RA 1JP5A 5D7IE 4GKNB 2MCPL 3TJEL 4KVNH 2VXUH 3CSGA 4GKOA 4PJHA 3WN5B 1RULL 5DJAA 1WBXB 4P3DB 4LNVA 3T0WA 4WDIB 2BY1A 2FLRT 4HKBB 5E00A 5BOZG 5D7LD 5DLML 3WIHL 3GJFA 4NDMB 1MOEA 3KYNB 4LOUC 2DBLH 2GSIB 1TZHA 2YA0A 1FAIH 5I17B 2LE9A 5AG9A 2Q7YA 4YBQC 5SWSD 1CD8A 3VFMB 2YXFA 5B8CA 1WTGT 3ULVE 1CQKA 1HSAB 5IMOA 1B0RB 3ZHDA 4LLWA 2F8OA 2Y7QB 4JFHE 1T1WA 2GY7B 2VDOL 5DJ2B 5DYOB 4PJCB 2BVQB 3O3AB 1FJ1B 5KS9A 2VZVA 4XBEH 3FRUA 4XWOC 4HGWA 1T1XA 1I9JH 5HVFB 3H9SA 5FIEA 5GZOD 5E08H 3BQUB 3T4YB 1DBAL 1RZKH 5I1AB 5BVPH 12E8L 3MFGB 4RGNE 3O2DH 1L7IL 1PSKL 1OT1A 2OTWA 2AEIT 4KAQH 3C8KB 4OF0A 4QRRE 3WJJA 4JCLA 5DJ0A 4ZFOL 4NJ9H 3SDAD 5M95B 2WWMD 5I6XB 1MUJB 3RZCB 3VH8G 1RUAL 1MIML 5FO8B 1LO4H 1NDMA 3NGBB 5FCUL 3HC4L 3D1MC 4I0PC 3ARGB 3G04A 3PGDA 5D5MA 2Y5TB 1HHGB 4OZ4B 2E6QA 5D93C 4F57L 1OVZA 1RURL 2EKSA 5FYKE 2VIRB 3GMOB 2J5LC 5AZ2L 5DJAB 4IMKA 3HZVB 4MAYB 2MKLC 4WUKH 3MV7D 1SYSA 3D3VA 4WUUE 4NRXB 1VB9A 1X5YA 5EZOL 4M9OA 5H94A 3WNMA 4OJFL 5BJTB 2QQNL 3DBXB 5HPMA 3SOBL 4U05A 5DQJB 4EXKA 5D93B 2C5DC 1W72L 2DI9A 2P48B 2UZIH 3UO1H 1ETZA 1IKFH 4QNPF 4U1NB 1GOGA 3WDHA 5C0CB 3EYSH 3D9AL 3S4SG 4KTDL 1FYHB 1A47A 2I60L 1E4XL 3AB0C 1S7QB 4GBXB 5GGRB 3E2HB 5DDHA 1L0YA 4JFXA 4ORZC 3S4SA 4N8VA 3MLXH 2VZ1A 3ILPA 1Z9MA 4KVCL 3X12A 5ALBL 5EU4B 3JTTA 3RL2B 2PTTB 5T3XH 1H8OA 3MXWH 1JWMB 2LU7A 2GCYA 3L3HA 2ZCHL 1UZ6F 1BJMA 1FNGB 5ERWB 4PV8A 3SY0B 4NN5B 3W5MA 3JTSA 4G3YL 1Q9LB 1JV5A 1NLBL 1B4JH 3DX9A 3OPZH 4TYUA 3NABH 1S7UA 4O9HH 4PGEA 3V8CA 3EYFB 2V9QA 1MH5A 3QJFA 4X9HA 4MJID 5JQ6H 1O0VA 3SCMD 3VMNA 5AAWA 3P4LA 4FQXB 5L0QC 1DSFL 3QJHA 4JKLA 1CD0A 2NNAA 3IKCB 5E1HB 4K23L 4JR9H 1YY8A 1EXUB 4DGVL 3ARBB 4HKJA 3UTSB 2DQTL 5GGQL 3UTTE 2ARWA 1F13A 2R0KL 5FO7B 4Z95L 4WRLA 1RZJL 1J9CT 4DEPB 5L0QB 5EFIA 5F1SA 1B3JA 1FO0H 4AJ0A 4FRWA 1TIUA 4XPAH 25C8L 4OZGA 1A14H 4DFHA 3SHSA 3UEZA 4XWOD 3WJJC 1IQDA 2V9TA 1OCWH 2FJGA 4W6YB 2X4SA 3OF6D 1OAKL 2VSCA 4HEME 1FCCA 1NJ9A 3MNZB 3IJHA 3ULVL 1HSBA 2EZ0D 2YD6A 2N56A 2VOTA 1TQBC 1EHAA 3O2VL 4DZBA 1UXSA 1HDMA 1VGKA 4OCSH 3GSNB 1IAMA 2FGWH 3KNBA 4LLUB 4KZDH 2IFFH 4NNXB 5H35B 1ADQH 3GSWB 3IAQA 5D7SL 3F7RA 2AGJH 2AEQL 3FN9A 3PV6B 3GJEA 1E4XH 1CN4A 4U6VL 4YJZL 1IBGH 1BX2B 1EBPA 1QPXA 3MUGA 3C6LB 5FM5O 4QOKB 3H3PH 1LK2B 2AABH 2C7UB 4KRPD 3NABL 1X5LA 2E9JA 1I7UA 5KZCB 4CVXA 1MHEA 4JDTL 3OHXB 3QFJA 5C0RH 3BP6B 4L9LA 5JR1L 3UMTA 4YWGH 4OCRL 1KJMB 3MRRB 4JJHA 5JMOC 1X5AA 5B4MC 3VXUA 4ZNEA 4YNYB 4DOHE 2OK0L 4TSCH 4M1GH 2IADB 3TN0A 5DTFB 2X4RB 4PUBL 3D3VD 2CUHA 1SMOA 4HPYH 2KZ1B 4OUOA 3IAPA 4LSQH 4QHNA 4BZ2L 1K8IA 2W0FA 4J6RL 1M6OA 3P4NB 1EEZB 4PJBF 1RZKL 5LCVL 3DXAD 1N2RA 1VPOH 3BH8A 1YMMD 1X44A 5EIIB 2XTLA 1ACYL 2ZG2A 3IFOB 4UBDC 5IW1A 4NM8L 4U1LA 3SDAA 4KROD 3CX2A 2J8UF 3VWJB 2FX9L 1MCPH 2AJ3A 2VLRE 4QT5A 4XBPB 4YAQB 1EHXA 1MY7A 1B0GB 5I1LB 1MCNA 2CLVA 1RUAH 3TYGH 1NCUA 5DZLA 3UTSE 3P73A 1ZEAH 3F5WA 5IEHA 1CFTB 1Q94A 4O2FA 1SMAA 3UJJL 1W0VA 2D3VA 4KY1L 5FYJL 1YEIL 1BF2A 2R1WA 4OFDA 2Z0BA 1T7YA 1HHKA 3O4LD 2NY0B 1YEKH 4X4ME 3ULUF 2IPUK 4MA3A 2EDFA 4X9GA 3PWPB 2Z8SA 4LPUA 2FRGP 2C3VB 1EEUA 3MRMB 5F3HB 1A1MB 4MXWL 2DQCL 4U0RC 1T22A 1D9KB 4UQ3A 4MMXC 1P4IH 3MV9E 1XIWA 2EDNA 4RGOL 4F3FB 3QDME 4IS6A 3HE7D 4JY4B 2J12B 3KXFD 4KVNL 2MJWA 1NL0L 2FDBP 2DWEA 2ARJQ 4HLZG 5IESL 1CVRA 4ZS7H 3LMJH 5GRUH 4HJ0C 1RUML 3P9WB 2V7HB 2DBJA 2FBJH 5LAXA 2CIKA 2R23A 1LMKA 3QDHA 3DSNA 5I76B 3CDYA 1XIWC 5GGSY 5GJTH 4CRPA 2DBLL 5JW3H 4X7SH 4DZBB 5C0CD 4WW2F 5CBAB 3QZWA 2X4OA 2I9LB 5HHXL 3VFWA 2SEBA 4WHCA 4ZNEE 1TJGL 4I0CC 4XBGB 2VKXA 3RA7L 2FX7L 5IB2B 3K8LA 1BD2D 2P8MB 1AQKL 1OWWA 3D48R 1S9KC 1CE1H 3VGAC 4OZGB 3WCYA 3ZKQD 1W0VB 3S5LG 3L6FA 1CG9A 3F5WB 4YHPB 4GQPH 3H8NA 2AJXL 4WEBL 1U3HB 4JHAH 4ORGB 3RVVC 1ZA3B 1FGNH 2X09A 3C8DA 4I3SL 1OTUD 2JK5B 1NGYB 3KWWB 4NP4H 4U1GB 5IW3A 4JCMA 3MRKA 5IWLC 3LN5B 5CEYB 3MRPA 1UZ8B 4KTYA 1KXQE 4IBLT 1ZLUK 3BZEB 2BMKA 2OXGA 1KGCE 1U8OA 5IB3B 1D5XB 4NHCH 2ZSWA 4WW2A 3VD4A 4U1GC 4PRIE 4UIMB 7FABH 1DFBL 3JWOH 4ZOAA 2YD2A 4XP6L 4P57B 4UDUB 3QUMB 1BIIB 4LLYB 3WSQH 1R5WB 2C26A 3DMMA 2HTKD 4ZUTA 1JYWA 3VXUB 3P9LB 2XZAH 3T04D 4PREB 2XXMB 5L9DL 3DWTA 3OXSA 3S4SB 3MUY1 1A02N 2LABA 5ACMA 3NA9H 3GSXB 3SJVA 1IM9D 5KSBF 3FB5B 1TCMA 1BFOB 5C09A 1UFUA 1Z3GH 5KSAC 3ZSSA 1TETL 3K80A 4HDIA 4UT6L 4ZO7A 4JY6A 4ZNCD 5ICZB 5LGHL 3MRLA 5HPMB 2OSLB 2W0LA 4RRPG 4LLYA 4XCYA 1UWXH 5H94B 4JFOA 3VJ6A 1WJ3A 2HP4A 5CP3A 3CDGA 2Y6SC 4CDHA 1HXMA 4LL9A 4RDQG 4KH2A 4Y16B 2P7TA 3FOLB 4CMHC 4GRWF 4OGAD 4PJBE 3H3KA 1VGKB 1FZOB 1X3DA 5SX4I 5F7MC 1NDMB 3BZEA 2EDKA 1D5MB 1TFHA 4CADB 5MI0B 4PJGF 3BEVA 3QHFH 4LASL 1S7SB 5FYKU 1QYGH 2DI7A 3IJHB 4NFDA 2GJ6A 1NGYA 1MFAH 2CIIA 3GMLA 3F12B 1TTGA 3KYKL 4I2XA 4P5KA 1NUNB 4ZUWB 1IILE 1QHOA 4OIAA 3HRZA 2GSGB 1I1AC 4QHKI 5FYLE 1A2YA 5CLWA 1B2WH 4Q6YA 4X98A 5EU7E 4HUMB 4E41A 4Z7WB 4OB5L 2V7NB 2P8PB 4G9DA 4L3AA 3ISWA 4OAWB 5KJRH 1DANU 3MJ6A 3MLWH 5F70A 4GAYB 3OAUL 2ESVA 2GTZB 3B3IA 4LLMB 1CF8H 4GW4B 5F7LB 1HILA 1GGYA 3UJIL 5I16A 4HIEA 4HC1L 3OF6A 5ITBH 3NA9L 3N9GH 3EO1A 5ALCL 3M8OH 5D5ME 3VFMA 3TBSB 4PJGA 5HJ3A 4RFEA 1XF2B 2CMRL 2WZPD 3NCYS 1MRCH 4TSBH 1A3LL 4KHXL 5T33H 1GZPA 1NMBH 2HWZL 7FABL 4I0KA 1G0DA 5EOQL 2Y9RT 5TF1H 1WZ1L 2R29L 3VFGL 2NY0D 3NZ8A 2O93L 4XPGH 2OL3H 3RAJL 4KXZH 3ZKXC 2YXMA 5ILTH 2YWZA 2VLMD 5T1LA 5HYJB 3SE9H 3NPSC 1MVUB 5MEOA 4U7KA 4HF5H 2D7QA 1IGTB 3GHEH 4FQJH 1I7TA 1N0XL 3ULVD 4XCCL 2V5RA 1ODAA 5EU5A 3SDDD 2OBGA 1N7ML 3O41A 4EOWH 5I1EH 5K33A 1QZ1A 3RUGE 1H3VA 1YNTA 3SQBA 3RJDA 3OKNB 3PGFH 1S9VB 3GB7A 5IFJA 1ZANL 4KFZC 4XNQB 4HSQA 4HUWB 3VI3F 5MENE 4NQED 4WO4C 3QI9D 1OCWL 1MEXL 5E24E 5JUEH 3EJZC 1IFHL 4HULB 3AS3A 2ATKB 3BIBX 2MWCA 4Y5YA 5A3ID 3B2VH 1A6ZB 2BXZA 1IC7L 2HJLB 3D0LA 4YEFA 4AY0A 1ZA3A 1FVCA 1BFTA 2MSPA 3IFNH 4UTAL 2FBJL 4PBXA 4I48B 4BSWA 5L88H 2IADA 4YHPA 1FG9C 5KS9F 1PX4A 1CXLA 1N5AB 4JLRA 4HS8L 4BQCA 2G75A 2NY5L 3W9EA 1OP5K 2BVOA 2YRPA 4WUUB 3FRUB 1JGUL 4OLEA 4XVUD 3VU2A 1QO3B 3IDNA 2AK4D 2YUZA 3HC0B 1UA6L 3PGCB 5DEFA 2C3HA 2K7QA 1BEYL 4PG2C 4ELME 3RTQA 1LWRA 5KANG 1G9NH 2VL5A 4M62L 3H9SE 5DRZB 4KZEL 3QIUC 3IDGB 3ARPA 2CO7B 4POYA 3FHAA 5IBTL 5EC2A 1UQSA 3GMRA 5HHOD 1PEWA 3D2UA 4CW1A 3SGDH 5JTWA 5A3IC 1D5ZB 3UTTD 1A6VL 3QXAB 4YDVB 3UJJH 1V7NL 3EFDL 4Y5VA 2EXWD 4KK9D 4Z78B 4EI5C 2F54B 4ZPTA 4XMKH 2EXWC 3GJFB 4KK9C 4JFOB 4HH9B 1XF4B 4ZUSA 4Q9QH 2XQBL 3DVFA 1MCPL 4K9EH 3F7QA 1OLLA 1TQBB 1P4IL 3RWIA 1KIPA 3CFDA 4TRPL 5J1TC 1S7RB 2MTPA 2XWJA 1EFXB 1UJ3A 4Z0BL 5F9OH 1JGVH 4TVPH 2ID5A 3LS4H 4X7EC 1D9KD 5GQBA 3EHBD 3P9LA 2AV1A 3TO4B 3BDYL 1YEDB 1BVKA 4X7TB 4KRNA 4K7PH 1P5UA 3TVMA 3QCVL 1YN7B 2NY0C 2GFBA 2JJTA 3D39E 1A6PA 3MUHL 3JVGA 4FXLA 2AKRA 3ULVF 3IKCA 2NNAB 4AMKH 3EJZD 4K07A 5CZVL 2Y36H 1T4KA 3QUXD 3GIZH 5HYSG 3FO1B 5DFTA 5BO1L 4AT6A 3G5YA 3S88H 1U6AL 4FZ8L 4G9FA 3REVB 2A1WL 3IXTA 5DGRA 3SCMB 2Q20A 3TBVB 5DSCA 1K8IB 1NCTA 3ZYOA 2NCMA 2XN9A 1ZT4A 3TZVA 1JNNH 2E27H 5DHYA 4D0DB 3MJ8A 1ZSDB 1ZLSH 2IFGA 1C16B 2W07A 4Q97A 1JUFB 5ETUA 3PG2A 3B9AA 3R8QA 1VERA 1OSZB 3RWDB 1KJMA 3MRRA 1JPTL 5I8OH 1T5XA 3C6SB 1SYVB 5ITFB 1R5IB 2R1XA 4N90D 4DTGH 2P43B 4G7VH 1OP9A 1JWUA 4LCYB 2X4OB 3TP4A 1FFNB 5C6TL 4WENB 3HR5B 4ISVB 5D71L 3MV8D 4YPJA 1ES0B 4GXVL 4PRNA 3WIHH 1B90A 3CUPA 1LK2A 1CDCA 1ZS8A 4PRDB 2H26A 2IANE 1NLDL 3WXVH 3QNYA 2DQTH 1EBAA 2IFFL 2X9WA 4YBHA 1DBBH 1MFDL 4JR9L 5EO0A 1HHGA 5FYJU 5LBSH 3H2WA 3SKJL 4JM2F 1BFVL 5BV7L 3HC3H 4NRYB 1TDQA 2DQDH 5IBUG 2X05A 1LHZA 5FO8A 2YWYA 4K94H 4PJ9C 5I1DA 1FVDB 4YQXH 3ULVH 1QKZH 5FV1L 4D9LH 3GNML 1DQDL 4EIZC 2VXVH 4K7PY 1RD6A 3FN0L 4OF6A 2ADJB 1K2DA 1A14L 4JZOA 4CVZA 1CE6B 4NJAL 1FO0L 1U92A 1C5DA 3WXWH 1NAMH 2XZQH 1M7DB 5JXAL 3S96A 3HC0A 2BVTA 4Y16C 1OGAE 1CGSL 4ONFH 1F4YH 4BUGA 2BVOB 4WUUA 2CSPA 1C16A 1BOYA 3NACL 4NQCD 3MBEC 2DIAA 2YPLA 2CRZA 3PWPD 3VWJA 5J7CC 2DAVA 1DQQA 1FGVL 3EGSA 5HHPB 3IETB 4UV7H 1U42A 5CIPH 3SDCC 1G7LA 1G7QB 3U7WL 1QSFE 1A6ZA 4LVHC 3L3GB 4JM2A 1QBBA 1CTOA 4Q7DA 4Y19E 4KGJA 3TPUB 4QY8A 3TA3C 2FJHB 1BVLB 2Y6SD 3CVHL 3GSUA 4RNRB 1XH3B 2P42B 4P2QD 4JQVC 3P0VH 1FLRL 1YQ2A 4WI4A 2J5LB 5ICXA 2WIIB 3C9NB 1OTUC 1UWGH 2CJUL 4ACPA 2HG5B 4KVCH 3WN5A 1RPQA 3S36H 2DQEH 1KN2L 1QHPA 3CSBA 4NSKA 1C7SA 4DGIL 1BVKB 2NY6D 5B22A 4HFWB 3DARA 3D9AH 2OZ4L 5T3ZD 4JFPB 1NBYB 2RCSL 4JO1H 2W38A 1TNNA 2AXJA 1TQCC 4Y4FB 3OMZA 3KJ4B 3BDXA 4RFOL 4MA1B 2ZPKL 1XGTA 1EFXA 1UJ3B 4X6CE 5CGMA 1JFQH 4JFED 4HWNA 1S5HB 5CJOH 1RUQH 4PJ5B 3F7YA 5AZ2H 4N0FB 2AQ1A 4LFHD 4TUOB 3RUGF 5D7JA 1CFSA 4L8CB 1U95B 1XIWD 1WZKA 4EVNB 1KCRH 2VLLA 2R2CA 3PE9A 3Q1SL 5E1AB 5IHZB 5JO5A 2CDEB 1RZIA 1EA9C 4K7PL 3U9UB 1HCFX 1AHWB 4Y5VB 4XVSL 4J2XA 2EIBA 3TO2B 1A21A 1ZA6B 2QHRH 3BOVA 4NKIL 3DGCR 5EZLB 1F90H 2B1AL 1LGVA 3SE3C 1ITCA 3EOAA 4HK0A 3O2DL 4NKQB 5IQ9B 3PDOB 4I0PB 5CMAB 5C7XH 4X6FA 2FH8A 4LDLB 2BNQA 1PGRB 5K9OA 2OX5A 1INQA 3SJVD 3ZHKA 4A2MA 5D7KD 2FZ3B 1J0JA 2P47B 2AK1H 3AU1A 4P46A 1KFAH 4PV9A 3BJLA 4JANA 1RULH 4Z76B 1WEJH 3VXUD 4UOW0 1RHHA 4NRZB 4I2XE 5IJVB 3MSPA 5F3BA 3LKNA 2IMNA 2UWEE 4H88L 1PAMA 5T1KD 4ETYA 1IEBB 4XPTH 3ZKSD 1CZ8L 1J1PH 1H8SA 2IAMB 3KLAA 1UWXK 1CGSH 4HK3N 1LK3H 2F53E 5IQ9A 1C5BL 2PR4H 4JKKA 2HJLA 1YEJH 3VXSE 1U8JB 2RGSA 2QQKL 1ZLVH 5A43C 4PS4L 5B8CB 3L3JA 1N4XL 4LHQB 3QUXB 3FO1A 1JE6A 1YQVL 2Z93A 1OAZL 1HQ4A 1AHWA 5HHVH 2D7MA 4WI6A 1PKQE 3PWNA 5DMGD 4BQ9A 5E6IA 3X11A 1G9MC 2B1HL 3JWNC 3FHQA 3PGFL 2BVUA 1MAJA 1AFVL 1OY3B 1RVFH 4HIHB 3HE7C 4L5FL 1JWMA 1U0QA 2DQJL 3OGOE 1PFCA 3QXDB 4JFFD 1U8HA 2NY5H 3P0YH 1NEZA 1FYTE 5ICYB 1S5HA 3DRQA 2FR4A 3DNKA 1JPSH 3KPLB 2GUOB 3HI1B 3QIWB 5JDJA 4P3WA 3OX8A 3DVGB 3QXVA 4I3RH 3SJVE 1DJSA 2WBJD 2MHAB 4UB0L 4Y4FA 3C60B 3FT4B 4ZO8A 3HZKA 3N85L 2R4SH 2I24N 5C0EA 2WWKO 2QHLA 3WLWD 1OTTC 1HIML 3HHRB 2B39A 2Q1EA 3N1QC 1FNAA 3CFBA 1KLFA 5F6IB 3AY4A 3TT1H 4MNHB 5TDNB 4OLVH 4YXLL 4R7NB 3MLSL 5AG8A 2O61B 1P1ZA 3KAAA 4R4BA 2X4NA 3QUYD 4XCCH 1SBSH 3RX8A 4G8GA 2J8OA 1LO2H 1SY6H 3DUSB 3KYOA 3W9DB 3RWGA 4H25A 2IWGA 3EJJX 3L3JB 3G6DH 3CH1B 1RUPL 1D5XA 4Y88A 4HKXB 5D1ZD 1F6LL 2CRMA 1FHGA 1KF9B 4DW2H 4TVPE 3GSVA 4H8WH 4P23A 5D2NC 43C9A 4RFNB 5DRWB 5F1NA 5C0AB 1AXIB 4ZODA 4E41E 2D0GA 2DTSA 1MVFA 5SWZE 1QFWL 3F6IA 1CG9B 1F4XL 3MRNA 4PJCA 2F58L 3L5XL 1A6UL 4PJFE 4F9LC 1CXHA 3HUJF 1F58H 3PDOA 4I0PA 5BCAA 1QBML 2Q8AH 1QVOA 2XICA 3S98A 2JB5H 2UUDK 2ATKA 4IOIA 2KQNA 1E27B 2X89D 1QYGL 1ND0A 3WYRA 3AREA 4OCWL 1UACL 2RBLA 3TT3L 2IH1B 1G7PB 5L2KE 2IANA 3QDGB 2OTPA 3HRPA 3B8YA 1LDSA 2VWEE 2Q86B 2A83A 2D7TH 5D7JB 1RZ7H 2FD6H 3JVGC 2JB5L 1NCWL 3WUZA 4W68A 2XA3A 3HMXH 1S7VB 1S3KL 3PQYA 3RUGB 3KLHC 1GSMA 5DD6B 1F58L 1P84K 1MFEL 1JTOA 1VENA 1IGTA 3GHBL 1A6UH 4PRNB 4FNLL 4IS6B 5AD0B 1MHPH 4ZFFA 3K2UH 1D9KA 3O8XC 4UQ3B 3PNWB 1NQBA 1YY9C 4P2RA 1T5XB 3C6SA 3TT3H 3C2AH 4LHUD 4N0CD 3I6LD 1A6TB 2BVEA 1Q9WB 2XIDA 4CAGA 3FB6A 1YEGH 3QG7H 2HLFC 1CDYA 3QEHA 4OV6F 1HHKB 5EWIL 2XWBB 4KKAD 5GS1B 5AYUH 1FN4A 2VLJB 5T1LD 1BEYH 4OD2B 3KLHD 2M26A 3VFUB 4LBEB 1GPOL 2VDLL 3PL6C 2BP3A 4OLUH 2BC4B 4XVJL 4YAQA 3VXRB 5J3HD 2RFXA 1KB5B 4IMKC 4Z8FL 3BPOB 2XPGA 3G5YB 1OB1A 2F8XC 1C8PA 2DYPB 4C4KT 4I0PD 2E7HA 4XTRD 3FKUS 1FFQA 4S1SH 4HWEH 4IRSA 3H9SD 2V17H 3LEYH 4JQIH 2WUCL 4HUKB 4FFWD 3KDMB 3MJGX 5E94B 3SGDI 2BZDA 1G0XA 4YHKL 2R15A 1P9MA 4DKEH 4IOSD 4LRIA 3KG5A 5E5RB 5INDB 2HLFD 1CDBA 1TVHB 4IM8A 3IJSB 3IDXH 4ELMF 4NKOA 5I66A 4U4BA 2QJDA 1KIRA 4YDIL 43CAB 5HVWA 1K4CB 3TEUA 1XAUA 3QP3A 3OQ3B 4XVTL 1CE6A 4KKNA 3F12A 3B5HA 3QUZC 4U33A 3VE0B 4NGHH 5I8CB 1CGTA 4XCNA 4NCC1 5AEAA 3FONA 3DSFL 3MYJA 5HGAB 3BKCH 2OJZL 5FDWB 3MXVH 4ZPVA 5JHDB 1HIMH 4F80A 2EDEA 1I7UB 4PJAE 2VDQH 3RWIB 1YEEL 4G6FB 2EC9U 2JCCA 5IBUB 4V2BA 5ADPL 4G42B 1WC7A 2CLZB 3CDGB 3NCMA 4Q9CA 1C5BH 1KYOJ 4LK4A 1LK3L 5ECJE 1WAAA 4AIOA 4XCYB 4H0HB 3QI9B 3RBGA 3GSWA 5D1QA 2EDTA 3ROLA 3QEQD 5FHAH 3FO9B 3NPZB 5HYQA 5K9JL 2HJFB 1X5KA 2ZCKL 4KQ3H 4IRJD 4U1MB 4UOW1 4GSDL 4CW1B 4XPFH 4JZJA 3BD4A 4OT1L 3QQ4B 2DLIA 1OTTD 5F7DB 4JAMA 5HDQL 1SJVA 4FFZH 4NQEA 4KMLB 5DK2A 5CEXB 5KSAB 5SV3A 4XCNB 2NW3A 3WUWA 4MA8L 4OD3H 3FT3B 1J10A 4Z7VB 3OXSB 3UDWC 3GGWB 4KXZI 1K4CA 3P30L 2XOTA 2B1AH 1F11A 3M07A 4C4KO 4PP2A 5IEHB 3N0PB 3ZL4H 4HUUB 5E7BA 3W39A 2OTUB 2NTFB 5J11B 1FVCB 4I9WE 1AR1C 2Z4QA 2G60H 4ETQB 1H5BC 1A7RH 3O6KH 2XTJB 1J0IA 4OFIA 2DQCH 4LSUH 1MFAL 3AXLB 3OWEA 3ZE2E 3VXSD 5ACLA 3FFCB 5EU6E 1KB5A 4LASH 2CXKA 2B0SL 5CP3H 1UM4H 1IRAY 5ESAA 4L8SA 1TCRA 1KCUH 1IM3A 4BZ2H 1AGBB 4QYOA 1AD0A 1ONQA 1VGEL 3TM6A 4R90L 1JV5B 4DQOH 1DEEB 4P46D 3DVNA 3FMGH 2YMXH 1CBVH 3SDDB 2B7DT 1ZT1B 3UZEA 2RCSH 2BY2A 3FB7B 5HY9B 3QUML 1AXTH 3T0EB 4WTWA 3NH7L 4NNYA 1KTLA 5CKGA 5E2UH 3RVWD 5HHOE 2DQEL 1YJDH 1JMZA 4IDLA 1LNUA 1QA9A 4L4TD 3U7AA 1G7HA 3ZSTA 2C1OA 4UT6H 5LGHH 1RUQL 5F8QC 5JR1H 4KU1A 1VPOL 4OSUH 4CVXB 1CLYH 4FMKA 5JPNB 1SQ2N 5D1XC 5ENWB 5IMMB 1X6NA 2ICWJ 4B5EA 2YC1A 1A7PH 3PHSA 3HI6L 5I1HH 3C6LA 4X0KB 1HEZB 1RZ8B 2R0LL 3U30C 2J6EL 4TSCL 4S1DD 2WAHA 3WS6A 1C7TA 4NN5C 3TBSA 4K3EL 2AGJL 4EDXA 2GJ6D 4PLNC 4LCWA 3CFCL 4MSWA 4WO4B 3ULSA 4GW5B 3Q6FA 5EU6D 2E8YA 2VWEC 5FYKL 4LF3B 1UENA 2Y1VA 3DROA 1GGCH 3VFVB 2HT4D 1MUJA 1D6VH 2KH2B 4L3EB 4QEGA 4LHUB 1CFQB 3GRWA 3KPRB 3QDAA 2AQ3A 4IDJH 4DN4H 3ARQA 4XHJD 4NJAH 5IB5B 4YXKH 2R1WB 1QSEE 4BH8A 2Y06L 5C0GB 5BRZE 3JWDH 1ZKAA 2R4SL 1N5AA 1EMTL 4JPIB 4P2QA 4XPAL 5C0IA 1NC2A 5FECA 1FZJA 3IU3A 3MROB 3GKWH 3D39B 2R0KH 3F7VB 5FA3B 1FV1B 1YY8B 3MODH 4ODTH 1FQ9C 4CNIA 2PTVA 4M6OL 1RK1A 1F4YL 1TJHL 2Y5EA 1T3FB 4KHTL 3T0BA 5J1SC 3RA7H 5F6IC 1XR8A 4N0UA 3TA3D 1W72B 2B1HH 2JIXB 5E6ZA 4LLVA 4MJ6A 4RWYH 3B83A 4H25B 5FGCB 1W0YT 1SVCP 4Z7NF 3LRGA 4R96B 2E8ZA 3TBWB 4O02H 1OAZH 3IU4H 4O9HL 2WANA 1E28A 1DQDH 1UVQB 4X0KA 3ARWA 1FNGA 3WNKA 4ZQKB 3ZKMC 4L3CA 4OLZL 4DEPC 4Z95H 1NAMA 3OKMB 4GQ9H 2FB4H 4FQPA 2EDDA 1MVUA 3MOQA 2DLGA 1RUMH 4GKNA 2HKHH 3VI4F 4Y16D 4JFXB 1EVUA 3REWB 1Z6JT 2YSSB 3E6HB 4MA7L 1PY9A 4PR5A 1VKXB 1G6RA 1G7HB 4LQFL 3I2CH 3WXVL 2FL5B 4M6NH 1NGWA 1DQML 3HE7B 4U1IB 3OR7B 4UQ2B 2J6EH 1A9EA 1UH4A 3CCHA 2P5WD 1JHKL 1LO3H 2EDQA 4KTEH 4PRIA 3IAGC 3DTXB 1FL5B 3MCG1 3RIAK 1X5IA 1B4JL 3OPZL 5DJCB 3CVIL 4XAKD 3MBXH 4APQB 4HGMA 4PLJC 3GJEB 5KZCD 1MRDL 2VITA 4N9GB 3QNXB 3HB3C 3JV6A 3E0GA 1RZJC 1ZHKB 4O5LH 5B3JF 4PLOB 5I16B 3QUXA 5BVJA 3CLEL 1D6EB 2NY7H 3F58L 2GTZA 1AIFA 4XRCB 4GAYA 4LEXL 3SO5A 3RFZC 3W0WB 3KPRE 5MHSE 3FZUD 3HPJA 2H2PD 3VGFA 4OD1H 4BH7B 1GGIL 4P5TB 2EDRA 1OTSD 3WFCL 5TQ0L 1E4WH 4MVBD 5DI8B 3G5XB 4ALAH 5E2JA 1HYSC 4I2XB 1MFBL 4LEXH 2A9NH 1U3YA 4NQCA 3QXWA 4X9BA 2CIIB 5JW4R 2XQYK 2JIXD 4QXTB 4DZ8A 5CD5C 4PJ9D 1LO4L 2ADGA 3RZCD 3C09B 4HKXA 5DMIH 4K94C 5JORA 5C0BB 3EFDH 3CH1A 5HTSA 4PJXE 4OM0H 1LO0L 3CK0H 4G5ZH 1S7UB 1T83A 3D3VE 3IDJA 3WFCH 3FFCD 2IH3A 3PL6B 3WHXB 1GGIH 3QULB 5SWQA 4MD4A 3BVNA 2V5MA 4G42A 5DJXA 1H0DB 1SJEA 3PWLA 3ALXA 2B4CC 4JY4A 5JPNA 5HD8C 4OKDA 3VH8B 4OT1H 1FPTL 2EICA 3QEGH 2QV2A 4XPFL 4DFIA 1A64A 2D4FA 1BFOA 4OF3A 5FDWA 4GBXA 2BOCA 2ZCKH 3P9MA 5DO2C 3UBXB 3FT2A 4KJPC 3SJVB 2QQQA 4FABL 5DS8A 3EHBC 5C92A 3C5ZC 2GK0B 1D9KC 3O8XA 4KRLB 5IBLD 1P4BH 3AAZA 2ZSVB 4LVNC 5IB1A 2AK4E 5TFSL 2APWA 2YD4A 1KIRB 43CAA 1WZMA 3QA3A 5EBLB 4NC2B 1IGIH 5DUML 1U58A 5IEKA 5ICYA 4F7EB 3CMOH 3CXHK 5CJQH 3HZVA 4KRMB 1UC6A 4YHLH 3MXVL 4FTVD 4G8EA 1G9EA 5BV7C 2HH0H 5EU3B 5ISZB 4U6YA 2H41A 4RZCA 3O3EB 4NQDE 1RZKC 2ADIA 4D3CH 2GY5A 1PDKA 1DDHB 1XGUB 3DUUB 4CN4A 3ARYA 4R26L 2MPAL 4WFHE 4OTXH 1DQTA 2H32A 2F19L 5L2KB 3LD8B 4G6JL 4LAJH 1KB9J 1U3HA 5KAQG 4F2MB 3T0XA 3RWEA 1HHHA 4PJ7B 5EOCH 3A0OA 2VLJA 8FABB 3PWUA 3N1GC 5F8RC 4KJWD 4NRZA 2ENSA 1S9XB 4P23D 5EZIH 1U9KA 3ETBF 1Q38A 3HUJA 4LHJB 3VCLB 1KPVA 4PBWD 1LEGA 3DV4A 3VFGH 1CL7L 3WUWB 2DQIH 2Z92B 2EYTA 5D2NA 5KVDH 3BP6A 1TZGL 2SEBB 4CVZB 4XNMB 2I9LA 3WHE0 2D7OA 4PGBB 4G8GD 5KG9A 4PJXB 5F89A 5EORL 2CRYA 1NFDB 1Y18A 3MO1A 3MREA 4XXCA 3TNMA 3TFKD 1OWRM 3K4AA 3SE9L 5DD6A 1SM3L 3FQUB 1IGYA 3RDTB 3EYUL 3K3QA 3MUGB 3QIUA 5I1HL 4EI5D 4OGZA 1F6AB 4OZIE 3CXHJ 4EVNA 4PG2A 4X7FC 5D9SA 4TTDC 2YD9A 4WFHD 1OF2B 1LVEA 1K5NA 3FRPG 1MCEA 3ESUF 4N0YL 1AC6A 1FRGL 2NY4C 4UI2A 3ZT7A 4M8VA 3WL9B 1EZVY 1UEYA 5CJBA 5FYKH 4ZD3L 3V52H 1SY6A 3RQ3A 1NFDA 5JW4M 4LKXA 1J0YA 3BHBA 5D7LA 3TJHC 3RY5A 1VFAA 4WNQA 4XVUC 4XNMA 1RJLA 2RHEA 1FFOA 4JFYA 2P24A 4O58L 4HC1A 4ZOBA 1Q1JH 1RQ5A 1YEGL 3QG7L 2VXTH 4XPHH 1L7IH 4J8RB 1U3HD 3ORJA 2VZTA 4X6DE 1UACH 5SWZD 5F9OL 4BFEA 4TNVK 3PHQA 3KS0J 4J3VA 4HPOL 3BJ91 5K59F 4I77H 3FCTA 1URLA 4N0RA 4M6ML 3P4NA 1M6OB 5ANMA 1FL6B 1CLCA 2VDKL 3GI9L 1WQVT 2OR9H 3I50H 3TESA 4FQCH 4HUVA 1VEPA 4L29B 5F7WC 1UB5B 5DD1H 3DJ9A 3SDDC 5D7IA 4WU5B 3DX9B 3RZCC 1TETH 5IKCB 5CGYD 3O3DA 1BGXH 2C4XA 4G8EB 1KCUL 4ZAKD 4YNYA 2VUYA 1R3JA 2R56L 1I3GH 1Q72H 2PTTA 1TLKA 3MCLL 1T0NA 4YDJA 5E6YA 4QRPA 3UTOA 1Q9WA 3ZYJA 4CMHB 4JRXE 1MJ7L 5KVFH 1M7DA 1TJIL 2JKXA 1PQZB 5DA0B 5HI5D 3RVTC 4RMVA 4O51B 4Z77B 4HWZB 1AGFB 1SY6L 2FWOB 4UU9A 4P59H 1MHEB 2AEWA 1KNOB 4H0GA 3QIWA 4MCYB 3VXME 1GIGH 2FX8L 2BY0A 5DD3H 3WL9A 1WV7T 3DRQB 2FR4B 1M7XA 5BS0E 1S7VA 4LEOB 2EDOA 2VDNL 3IJYA 1HQRB 1U3ZA 4NBXB 4CN1A 1P84J 3U0WL 1DUZB 4HH9A 3KNBB 2N7AA 5I71B 3V4PH 3WDIA 3QNYB 1LDPL 3IFPA 2DIBA 3K2MC 1I1YA 2F54E 3AREB 4M5YL 5HDBE 1UYWH 3J7HA 5EORH 5JZ7C 5ESQB 3MREB 2VDPL 3RZCA 5I1EL 3V6FB 4MCYA 4FP8L 3JWOL 4XP5H 2WK2A 5DT1L 1BIHA 1OAQH 1HOCA 4WHYH 5DJ0B 4XVTH 5KSAD 4Z7VE 4YDIH 5IVXA 2I5YH 2IAMA 3KLAB 2VL5B 5CINL 3MLVL 4M93C 3CGTA 1LILA 2AJUH 4YGVA 3EOYG 2Q87A 3JV4A 4QRPB 4K8RH 4J3SA 4NQVB 4YHNA 1I4FA 2D4DA 3G6JF 4KQ4L 5DUPH 4M8QA 2XG5A 4WFED 5HHVL 4XP9H 4KK6D 1U93A 1YEFL 2YEZB 4WEBH 5AUMB 4KUZL 5E8PB 3AVEA 1UB5A 3C60C 4XC3H 1PVHA 4N1CA 1ZVSB 3D0LB 1AIFB 1GRWA 1JPSL 2CK0H 4K71B 4OGAC 5JHLL