4DEPB

Structure of the il-1b signaling complex
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
304
structure length
296
Chain Sequence
KEREEKIILVSSANEIDVRPCPLNPNEGTITWYKDPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Interleukin-1 beta
publication title Structure of the activating IL-1 receptor signaling complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 296
sequence length 304
chains with identical sequence E
ec nomenclature
pdb deposition date 2012-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13895 Ig_2 Immunoglobulin domain
B PF18452 Ig_6 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4depB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4depB03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4depB01
4EOWH 4WO4D 3MUHL 4JB9H 3HE7C 4RMVA 1X7QB 3LIZL 4DK3A 3H9SE 2F9BT 4LSTL 5GRYA 4QT5A 2VLLB 4DW2L 3MQIA 5D1ZA 5BZDB 3S98A 4M5YH 3G6DH 3GM8A 3QJHB 1P7KA 2EYRA 4APQB 2GJ6A 5BV7L 1I1FB 1Q94A 2MCG1 3OL2A 4G3YL 4YE4H 3DRTA 2QL1A 4GKZA 3OKKA 4R96B 2ZCLL 4W4OA 3BZ4B 1L7TL 1QBLL 3QUXB 4OQTA 3QUZD 4TTDC 2OJZH 4X0KB 1QLFA 4HT1H 3RHWK 2F54A 1N0XL 3VGEA 1SHMA 1G7IA 1MCKA 4G8GB 1DUZB 4PJDF 4RAVA 3BO8A 3HG1B 4X6CA 5I75B 3RY4A 2A77H 5E1AB 4Y4FD 3GJFH 4JO4L 5MP6H 4GAYA 2DQFB 1H3WM 2H8PA 2QHLA 3VE0A 2V2TB 2FX9H 5C07D 3CSYB 3HMWL 2VUOA 2HFFA 4HWUA 3S5LB 1QSEB 3TYGH 2P46B 3FN0H 2ESVB 3HC3L 3DRQB 5F9DC 2GEEA 3TYFA 3HE6B 3MRFA 3O8XA 2EXWC 4Z7UE 4ENEC 4LSUH 4DEPC 3UC0L 2VXSL 15C8L 4G80A 3UPCA 1IJ9A 2I9TA 4L4TE 1MAMH 4C56D 1GIGL 3S35L 4OCMC 3WIFB 5A43C 3C5ZA 3K7UA 3CFDB 1CE6B 1A7QL 2X4TB 4U1GB 3VXRB 3MUJA 2WINA 5HGDA 5FUZH 1JP5A 3EYUH 3ULVL 2Q86A 3SGEI 1EFXD 3SGDI 1DQLH 4ZXBC 5L8KB 2DICA 3MLSH 3RZWA 3KYNB 4KUZH 1H8SA 5IG7B 4UDUB 1NGYA 3RI5F 1AXTL 1CZ8L 1JGVH 5DUPH 5ITBH 5E70A 4OM1H 1N6QL 5F6HJ 3G04A 2J12B 3U7YL 5KSBE 3QYCA 1YECL 3SDDA 2YUWA 2HJLB 2VDKH 5L7XH 1PG7W 5L8LB 5CCKL 4WW2A 2PW1A 4S0TD 3O0RH 1OQOA 3GMPA 4UNUA 4KQ4H 5J11B 2IEPA 1FV1B 2FX7H 3MRNB 3PL6C 1KNOB 3VA2C 4QYOA 4Q9QL 2FIRT 3F58L 4XBPA 3GEWB 4N68A 4HHAB 2JCCE 1EH9A 3DLQR 4KK5D 1GGCH 3VJ6A 5J12C 3OAYH 2RBLA 2QQNH 3LZFL 4QOKD 5IMKA 5I1CH 3CVHL 3BDBA 4NN7C 4PJGE 4L8BA 3VXUD 2J8HA 4XRCA 3MRIB 5GRJH 2N7AA 4N8PA 3UZQA 5I1DB 4ZUUA 4YUEH 3TPKA 4JM4L 5GGRB 5L2KA 4NUJA 3D85A 1B2WH 1EEQA 1JWMB 4MJID 3RBGA 4CVUA 4IJ3C 1R3IH 3C09B 3BKML 3DIFB 1KTRL 3BE1L 1OLLA 3W0WE 2ZNWA 1B6UA 2JIXD 4LLVB 4UT6H 3HUJA 5HI4D 3WL9A 1TJIL 4PRPA 3BN9C 3HN3A 4OLVL 1D7FA 1LEKB 1IGIL 2UYLA 1NMAL 3L9RB 1H5BA 4F8TA 1D5IH 4JPVH 1OLZA 5CD5C 1D6VH 2YD8A 3LD8B 1MHHB 3NFPA 3WLWC 2MCPH 4YQXL 1W8OA 3K74B 4Z0XA 3EYVB 4HIHA 3IDJB 2P1YA 3O3DB 5CINH 4D3CH 3TNMA 5M94B 1HH9A 3G08B 3WDJA 2VQ1A 4NDMA 2PO6D 4P2RB 1RK0A 4U6HA 1W72H 1XGUA 3INUH 3KJ6H 5DXWA 1F4WL 2O5YL 4MJ5A 5ADOH 4AEHH 3QAZC 4L5FL 1MFEL 4F9PA 4ZSOB 3ZHKA 3DVFA 3DO7A 2DM2A 5D2LF 4FFYH 1HYSD 1IC7H 3DXAD 3ARGB 3PF2A 1BLNB 2Y5TA 2OJEA 1UZ8A 4LGPB 4POUB 1E6OL 3RTQA 4Q9CA 5CJXA 4GLRH 4ZPVB 5FCUL 3QZWG 1CLZH 1AY1L 4XCEA 5IIEB 5D7JB 1T3FB 3DTXA 3UTTD 2AXFA 3DROA 4FNLL 4PJCB 3O2WL 1H15A 1JE6A 4LSPH 3UP1A 2VDPH 5TE6L 2VKWA 4QY8B 3PWPB 1U8IB 5DMJB 4XP1H 1LILA 4OTXL 3QCVH 4Z0BL 4AJ0A 3OB0H 3BAEH 1QA9A 1RZJL 4A6YA 3EYFA 5DHYA 3T8XA 4NWUL 1UQSA 4OAWB 4XX1G 3NABL 4X6EA 5HHME 3B8SA 1UB5A 5MENB 3OWEA 5KVDL 5D2NC 3U0TB 3VWKA 1P2CB 3QDJA 1DSFH 4WW1B 4G6ML 4KZEH 2ENYA 5IB5A 3ILQC 4MJ6B 2AQ3A 3ZKND 3I6LD 5MERA 1KACB 5MEOB 5D7LD 4POZC 4XPTL 4HFWA 1NGXB 5JIKA 2FSEA 5SX5K 2BVPA 1D5BB 3H9HA 4M8VA 1LP9B 1FSKC 5H35B 4FTVE 2UVEA 1P7HL 3B2UD 3V5DA 3P9LA 3IDMB 2DL9A 3WXWL 4HIIA 4LMQI 1Q38A 2WWMD 5CUSH 4KK8C 1BQSA 1OB1B 4OCSH 3MRQA 4OQTL 3IVKA 1UM6H 3NA9L 1MJ7L 3QQ3B 4I3SL 1EA9C 4WI2A 4LASH 2VQUA 1BBJA 4ZD3H 4N0FB 2NLJA 2W1NA 3FQXB 1BOGA 1KLGB 2YA1A 1RFDH 2E9BA 3WD5H 3WIHA 1EJOH 1JPFA 1EHXA 3LHPL 2XN9A 4JAMB 3O3EA 1G7MA 3RWGA 5ESAA 2D03H 2HN7B 2P5EA 4JFED 5FO8B 3CFBB 1NLBH 2WWKO 4EKXA 3EO9H 3DPBA 5D8JH 4DKDC 2WQ8A 2VC2H 4XCYB 2BHYA 1MFCH 3FB7B 2X4UA 4HH9A 5I30H 3HAEB 3OAZK 1UENA 5DJ0A 4IBLT 3IFLL 2DS4A 1MCOH 1PEZA 5TQ2H 4YHPA 5JLZA 1JNHA 2HG5A 2R0WL 4LNRB 1R5VB 5GGRY 1NFKA 5CHNB 2NY6D 1HH6A 1CD9B 1MCCA 4RBPK 4KFZC 4DOHE 2P47B 2RB8A 3IETB 4LHUA 4ODTH 1OP5K 4E5XA 3I50L 5E9DD 3HNVH 4G6JL 4XBGB 4X99B 5DJ6A 4IHOA 2CDFA 3MV8A 4HWZA 3ARBA 2DLTA 3VWJD 3I85A 4BFBD 3U1SH 1JRHL 3HPJB 4PGCA 3ULUC 2EDOA 5DURB 2W0PA 5FYJD 4D9LH 5C0DA 4JFFB 2IWGA 4P46A 5KVEH 3QI9B 1T2QL 4YBQC 5H37G 3VXOA 2YD1A 3UJJL 1OW0C 5EOTB 32C2A 4NKMB 4AMKL 1TJHL 5FO9A 5C07E 3RU8L 1NCAL 4L4VA 3CIQA 4WGWB 3TFKD 1QNZL 2XZQL 1MIML 3VXQB 1U92B 5K9OB 1G7JA 2P7TA 2X4QA 3OB8A 4NP4H 2RCSL 1UH4A 2AK4E 5IESL 3BJ91 2Z8WC 5IMOA 1M71B 4C56E 4N9OB 1CGSL 2B8OT 5GRWA 1C16A 3BZEB 2I5YL 3H42H 2QTEA 4NQCD 2DJ4A 4DN3L 4P2QB 4RMWA 1HWGB 2V7HB 2QBWA 3ARPA 3FONB 5CZVL 5A3ID 3I9GL 4UV7L 1AP2A 3MRMB 1FJ1A 3SY0B 4YHLL 3V6OC 4NQUA 3D39A 3Q0HA 4MQ7B 1Z0MA 3U30C 1NFDB 1T1WB 1BFOB 1UH3A 1VESA 1MI5D 1IGFH 1HHHA 5FGBA 4EDWL 3CLFL 4KV5E 5DD5L 5L6YH 1ZHLA 1K5NA 3QIWD 1A2YA 3LRSA 1W0YT 4TSAH 3RIAK 1AKJA 1G7QB 4U1KB 5JDSB 1S9YB 4PRDA 5I0ZA 4LAQL 2G5BB 3QISA 1ZLSL 1F4HA 1FNAA 4B53A 4P23A 2HT4C 6FABL 5CJQH 1TVDA 1SY6H 1GGBH 4K3DH 2FD6L 5E7FA 1NEZA 5ICZA 1YJDH 4P4KC 1A7NH 4U7KA 3N1FC 3W9EB 4M4PA 5C0AD 4DN4H 1R5IA 2CDEB 4XWGH 3GUTA 1JI2A 2X89D 3GHEH 4P57A 3B3IA 2CKBL 2A6IA 1MWAH 4QOKE 4C58B 2XWJB 3QB7C 2NTFB 5I17A 4IMKC 3VXUE 3GBML 3F7YB 5F3BA 1B90A 1J8HA 4UBDD 1BF8A 2EICA 4BK4A 4KRPC 1YYML 1YPZB 1CBVH 1QLRB 1A7RL 4H5SB 1V7NL 1FVCB 1MQKH 1ZA6A 5A2FA 4NC1E 3TO2A 3MRPB 3E8UH 3B5HA 3P11H 3N50A 3O2VH 4GAGL 2R2HB 2MFNA 5I18L 5C0FB 4PPTA 1PQZB 2GSIA 4QRRB 4Q9RL 3K2UH 3CMOH 3AS0A 1JF1B 1BIIA 2XG4A 2IALB 2YZ1A 4Y4KC 2ADFH 4H25B 3X3FL 3BIKB 1B0WA 3ARYA 5EZLA 4JQIH 1VB9A 1HOCB 2V5SA 1T22A 1V3JA 3EFDH 5K9KB 5DVOA 3TJEH 4A6YL 4GRWF 1I7UA 4Y4HA 5KS9B 3WUWB 4WUUA 1Z5LB 1I8LA 4U3HA 4EI5D 3P77B 1ND0A 5IHZB 4MXVF 1XCQB 2OL3H 1G1YA 5IJVB 5T5FH 4BA8A 2A9ML 3QO1B 4KMTL 3UBXA 5IMMB 5EFIB 12E8L 5KANI 2EYRB 4GKSB 5I71C 4Y5YA 1CLYL 4JZOA 2DQHH 3DXAE 3G6JA 4JHAH 4L29B 2E7HA 3MBED 1EX0A 1A6TA 1II4E 3AMLA 5DO2C 1RMFH 3OQ3B 4IDJH 3MBXH 1ZVSA 1IKNC 4JN2A 4NKDB 3FO1B 4X6CB 2NZ9C 5HYIA 3MJ9A 1RZGA 3TNNA 1RJYB 5FUOH 5BCAA 2HRLA 3UTTE 4JKLA 3TEUA 1N2RB 4AT6B 1K9TA 5BJTB 5DZOA 5JXEA 4PY7B 1QUNA 4IOIA 3BDYL 1BQLH 4HJ0C 4KPHL 5D1QC 1RULH 5EUKB 5E2UH 3GKWH 4CVWA 3PWVB 2DMCA 4ELMB 3CFKA 3SKNA 1OTTD 2YRLA 2D0GA 3K0WA 4NQDD 3NN8A 2X7LA 3WS6C 1VGKA 4LHUG 1XGTB 4YEEA 4NKIH 5C2BL 3T2NH 5B21A 3QR2A 1YJDC 3KR3L 1QFWH 1J8KA 3CXDH 1QR1A 1Q0XH 2CLVB 3BPNC 3M1BB 2P4AB 4M62L 4YDIL 4U31A 4R3SB 1GAFH 2ZUTA 4NZRH 4FQLL 3VI4F 3D69B 1D9KC 1WV7T 3EZJB 3O11A 4XHJD 4U4BA 3HE7B 2OTPA 4L4JA 2H2SD 2BZDA 4OCYH 2B2XL 3I6LE 3FT3A 4PRHB 5D7LE 2LV4A 1KOAA 1T0MA 4PJFA 4TNWF 3VCLB 1FNHA 3C9NA 3LKOA 2A74A 4EXPX 3QEGH 2J7LA 3QJFA 5CJBA 1S3KH 3KGRA 4MD0A 2A0LC 4B41A 4KKBC 1PG7H 1U8PA 2YPKB 4F7EB 3X17A 1SMAA 2DDQL 2SEBB 2NY1D 2ZUVA 1Q9OA 5CIPB 4R4FL 3BW9B 3HZMA 2MHAB 3TH4T 1PLGH 2GFBB 4JANA 4ACPA 4OCXL 3ZKSD 3TM6A 4AIZB 4KC3B 3BZFB 4YIQA 5IMLA 3KPQA 3PABA 2EC9T 1HDMB 4J12A 5IVOA 3RVWD 4JFEE 4H0HB 1OSZA 2ICWB 1MCNA 4JZNB 2VDML 4NFCA 2DI8A 4K7PH 3MLRH 3T4YA 1U8KA 3GDBA 5EZJB 2YBRA 2Y1VA 2LU3A 3SDYL 4J23A 5IBTH 2WMPA 3LS5L 2I24N 3OHXA 4G7YL 3QULB 1KIQB 3RBSA 4JRXD 4ZOBA 4ZFGH 1C12A 3HZYB 5EDXA 3T0AA 5FKAA 1QACA 3FB8A 4P0DA 2EYTA 1HNGA 4JPKH 1GC1L 3T0EA 1FFNB 1KCRL 3RUGB 5HYJB 2IADA 2DIBA 5EH1A 5T1KB 1EJ6A 4HW6A 3QBTB 5E9DE 4U1SB 3MOAL 3HZKB 2H26B 3T2PA 5BS0D 1ZHKA 4DZ8B 1IM3B 5DSCB 4AG4L 3W5NA 1NEZG 2OS7A 4RWHA 5C7XH 2CMRH 3O6KH 3WMSA 4FQ2L 4LSVH 3X3GH 3SCMB 5D71H 4ZXBB 4OV5A 1GGUA 3RNKB 3HLAA 2DKSA 4QTIH 3PGFH 1OGAA 4KXZI 2JELH 1UYWL 4L8SC 2M8XA 2OXHA 5FYJE 2HFEA 1KPRB 4L8CB 5IROC 3HNTL 1L0YA 4KQ3H 3TBYA 5K59E 4Z7VE 4PD4J 3UAJD 2HVJB 2V5YA 1UWEL 3NZ8A 1OPGH 3P4MB 2AQ1A 4ODHH 5IJKC 2UWEF 3D48R 1FVDB 1OAXL 5L2JA 3PL6B 4HWBA 1DBML 1PFCA 2NCMA 4I2XA 3RDTC 4RAHA 5KVGH 1D6EB 4FMFA 1M7DA 5DFTA 1AGDB 2EDQA 4ZUSB 4KHXH 3C6SB 3QCTH 4ONFL 5TF0A 5J12B 4DZBA 5TFSL 1KJ3L 2VISA 4Y1AD 1ODAA 1P6AB 5CSGA 3VW3H 4NN7B 1WTLA 3BP5A 1R3JA 2XY2A 1H15B 5ACMA 1A4JB 2Q20A 2YD7A 1YPZF 4K2UL 4U33A 3MUGA 1JFQL 1Z9SA 2DB8A 1FNSL 4FZ8H 4MNQB 4NQCE 4LARH 2F74A 2DWEA 1FFPA 1KIPA 1BBDH 4IJ3B 1J1PH 1FGVH 3V6BR 1A5FL 2Z0BA 1AGEB 1KJVA 2R0LL 1MI5E 2FO4B 1XF4A 2X9XA 1UM5H 2AGJH 1OTUD 1GHFL 4PB0L 3VMPA 4M8QB 1FL3B 3BQUD 4PJHE 1RK1B 3NCJH 4QHMB 1RJLB 5CP3H 1RIHL 4K3GA 1LD9B 2FB4L 4ETQB 4MS8C 1CU4H 3E1F1 4O51A 5KS9F 2VNCA 2VZ1A 3RWHB 4X7EC 4JPWH 1I3RB 1SJVA 4OCRH 1GH7A 3C2AL 5C0AE 5DJZA 2BVPB 4M7JL 2IBBA 4Y2DC 2M26A 5AZ2L 4HH8A 3D2UA 4WENB 1XMWA 4KUCD 3QAZB 2CKNA 2CLZA 1AFVL 5IJKA 3GSNH 3IS0X 2Y9RT 4GXUN 4AM0A 5C2UB 3OXRB 5BW7C 4FABL 3KDMA 3MRQB 1FORH 5C08D 4Z7UA 1XIWD 2GHWB 4JLRA 1O5DT 2NLJB 5KN5B 4L4TA 4PB9H 4PTTA 3P4NA 1P4BH 3MJ9L 5LBSH 4X6CF 4FXKB 4ZAKA 1A3QA 3QHFL 3MOBL 5I66A 2P43B 4LRNH 2QKIB 1EHAA 4WI6A 1R6VA 4Z5RB 5I19H 5JR1L 4RX4A 3GNMH 3NH7H 3IDXL 1F3JA 4ZDHA 1WF5A 3FCTA 3K80A 4ELMF 4HGKC 1T1XB 1NKRA 1YNLL 1NAKH 4IOSD 1LHZA 3EFFB 5EIIA 4N0YL 1UJ3A 3BD4A 4NUGL 5E08H 1UXSB 3VD4A 4HJJH 2XZAH 4F2MA 3MXVH 3TP4A 4JQVA 5ID0B 4ALAH 5T5NG 3AAZB 4XH2B 3ARFB 1XGQB 4S1DC 1TENA 4XPGL 1ZLUH 4N1HB 5D2NB 1LNUA 1EXUB 4EN3D 1IAIH 3FHAA 3GSQA 4FQCH 4HWZB 5IB2B 1P53A 2YN3A 5LQBH 3C8KA 4UIMB 2A6KA 1JJUA 3X14A 1G0YR 3BYYA 2AI0H 3DO3A 4X9GA 3O9WD 2AXGA 1T04A 4MA7H 3VXTB 4MWFB 1CFTA 2VDNH 4XC3L 2XPGA 1FSKB 5DF0A 3KPNB 4UQ2A 4U6YB 5FHBL 3V7MA 1NC4B 5EA0L 5FO9B 1MNUH 2R1YB 1FFQA 1WZKA 2AEIT 1Q1JH 3UJIH 5DI8A 5DJAA 3JVGA 2OLDA 4AH2B 3KPOB 5CLTA 3QUYD 4NQDE 4GMTL 2Q3AA 5J4MA 1T1YA 3MROB 5D5ME 4LLQA 3RVVC 2R1XA 3CDGB 5SWQB 2KBGA 1JGEB 1KCVL 4CVZA 1OHQA 1W72B 4FS0A 3SDCA 3UEZA 1EERB 1N3NA 3IFOB 4ZUTA 3PWUA 3WLBA 3AVEA 5IW6B 1M7IB 1J7VR 1F3RB 2IANB 2OTWB 1GCFA 4W6XB 5J3HC 3OKNB 5GGVH 4XP9H 3RUGF 3PGCB 5C0BA 3GSXB 1AGBA 5GS2D 1TJGL 4I1NB 5FXCH 4P9ML 2R56L 3WS3A 1FBIL 5TDOA 3M07A 3EO1A 2ZUQC 2EEDA 2DLHA 1V3LA 5CGYD 2EC9U 1FL5A 2VL5A 3GIVB 5IQ9B 5C0JB 3IDYC 2NY5C 4C83B 3KYKH 3MLWH 2BJMH 3Q6GH 3T1FA 3VXNB 1WBZB 4WCYL 2Y06L 2HTLC 2IH3A 4PS4H 1ZANH 1P4IL 3GUTB 2CUHA 1ZHBA 3TA3A 1K8IA 4OZHA 3VFWB 3VFSB 4IDLA 4RMRA 5B3NA 4G42B 5F1KC 2ITDB 4HWBL 4WO4C 1MCWW 3SGJA 2XWBA 4YHIA 1TNNA 4U1JA 4XMLL 4HCRH 2CO7B 4X6FB 5I1JL 2CGRL 5F6IB 4IS6A 4QGTA 4P4RB 1DBJL 4JRXE 1BVLA 2APXA 4MAYA 5BRZB 5KSUA 4PJBB 4OZIE 2E5EA 3RY6C 3KPRD 4MD4B 1GPOH 3QH3A 2C9AA 1N26A 5EWIL 1JL8A 3BKJL 5HD8D 1LO0H 3OKDA 4U6XB 5BS0E 4H20L 5CEZD 1NL0L 3QUZC 1F45A 3ZDXF 3PJSB 1KB9J 2R29L 5K9QI 3ZT6A 1ZSDB 3LVEA 2MQ0A 5KJRH 1JUFA 3LKNA 5C0CB 3HI6L 4OQ1A 5DA0B 1G9NH 2AV7A 2DBLH 3SJVA 4HKXA 3U30B 2HTKD 1TZHB 2ITCB 4Y4FC 1F3DH 5FAAA 2EH8L 1CL7L 3VGHA 1QPXA 3ZTJG 3EKCA 2A6JB 2KQMA 3IKCB 4X6BA 2BMKA 3ARED 3JWOL 1BVKA 1ULVA 4GMSL 1XH3B 2OR8A 4UUJA 2JB5L 4CW1B 5DHVH 1INQA 3DJ9A 3BEWB 3BWAB 1ITBB 1U8HA 1XAUA 3O45A 4M1GL 4P4KB 4Z7NF 5GS1C 5MEQB 5HHPB 4TTGA 1CGWA 1ORQA 1K2DA 2AJZA 5JTWA 2F5AL 4Y1AE 3OKMB 4JQXC 2IF7A 4YLQT 3A67H 5ALBL 2OK0L 5F8QC 5F7FA 4XZUB 3E6FB 4HKBB 1OGTB 2MTPA 3D0VB 4CNIB 1CXLA 4KRPB 2X4RA 2NNAA 4PGEB 2R23A 3RGVB 4OZGB 1A6AB 2G9HA 3CUPA 5AYUH 3IJSA 2P48B 4XVUC 2BC4B 2I07B 1YMHA 1NCBL 2V2WB 3KLAB 4PRBB 2FHCA 4GRLA 4Y4KB 5DQ9A 2YEZB 1GGTA 2W9EH 3R1GL 4XXDA 1HHJA 2VDOH 5DJDB 3DGGA 3DVIA 4XWOD 2GY7B 3BGFC 4KK5C 4OGAD 3WFHA 1PBYA 2DQIL 1C08A 3MJ6A 4L3CB 3DV6B 3BD5A 3BT2H 1A6VH 2QADD 3LQZB 4TUJB 5FYLD 3HC0A 2B0SL 3WO4C 2Q1EA 3U4BH 4AL8H 1AQDA 1RZ8A 4OD1H 1PW3A 1OARL 1FG9C 2ZUXA 3C6LB 5E2VL 5SV3A 5I71B 1J9CT 4KHTH 1IC4H 2BVOA 4GS7C 3QRGH 2QQLL 1UWGL 5DEFB 5T33L 5C08E 2Q8AH 5HI4C 1KJ2A 2AK4A 4MB4A 2E6JA 2AJXL 2ZG3A 2Y25A 1FYTE 3CFEA 1RIVL 1GL4B 1FRGL 2MPAH 3U2SA 4YXHL 1PSKL 1U3JA 3DUUA 3O4LB 4N0UB 1G9NC 5IFAH 5DJ8B 1QRNB 3UYRH 4O2FA 5EB9A 4MDIA 1WAAE 3G6AA 2D31B 1YEHL 3IJYB 1OSZB 5EULV 5GS0L 5T3XL 1DR9A 4NJ9H 3T4YB 5E8EA 2IFFL 4OGXL 4OCWL 2XICA 4HC1A 4WI3A 3CDYA 3L5WB 3L7FB 5D1QB 3CZFB 3ZSSA 2FDBP 2JTDA 4JRYB 2YBRB 4R4BA 5IEKA 1INEH 2F53B 4WDIB 5KSAA 3ARUA 1PKQB 2PO6C 4R0LC 5AEAA 3GIZL 4F7PB 3LN5B 4Y16D 5F7LB 1YY9D 5JA9A 3HZVA 1VSCA 4LSQL 3U48A 4FQPA 2OTUA 1HSBB 5J9PB 3P73A 4KK9D 1NCWL 5E0QA 3OX8A 1VFBA 1YN6A 1HYSC 2UUDK 1HKLL 3BPNB 1HHKB 43C9A 3QNYB 4UTAH 4RNRA 1BZ7B 1S8DA 4YC2C 3WFDL 1IAKA 4I4WB 1D9KB 1DL7H 1R24B 3F65A 1MWAB 4JHWL 1NFIA 5HBBA 2HJKB 2O5XH 2FEEI 1XGRB 4KAQH 1OGAB 1J1OL 5D1XD 4MAUH 4XPFH 2VXVL 3IF1A 4UNTA 1B6DA 4H1LH 5B3JF 4GW4B 5GSVB 3VXUA 2APBA 4H88L 1RHHB 1MPAL 3V7AG 4BM7A 2CIKB 2NXYD 4J3VA 1CQKA 3FFCB 3LDBC 4K8RL 4ONGL 1XF3B 3P4OA 4NM4L 1IGYB 2VZSA 2IBZX 1RIUH 1JF5A 3ULUF 4PJAA 1KCSH 4L8DA 4E41D 4U1IB 3JTTB 5GHWL 1MFDL 1JZ5A 5IF0A 5D72L 1P7QD 1RURL 2DQTH 4YR6B 1BWMA 1KPVA 4PJXA 2PTUA 5E8NA 3OXSB 2X1WL 4V2CB 3GSOA 1FNGA 5JIHA 4M7LT 1SYVA 3OR6A 3QNXA 2VIRB 3BP5B 4S2SB 3DOSA 1UZ6E 1X5AA 3LOWA 4ODWA 1AI1H 2OL3B 3ZKNC 4IMLA 3H9SB 3VFMB 2CO6B 5DGQA 4S1QL 5HSFA 4PJBF 5DMKA 4UV4H 4LEOB 4Z78A 4HKJA 4DKEL 1U8NA 1WBXB 3B2UC 3L95A 3LRHA 5JO5A 1CFVH 1J1XH 2E8ZA 3EYOA 5ANME 3V2AR 2BP3A 3W9DA 3ECBB 5I1IL 1IGTB 2WWMC 3DXAA 3GGWA 4JO2L 1H3XA 2JK5B 1OVZA 1CE1L 4NBZB 3MGTA 4TQEL 3WXVL 2OZ4H 4J8RB 3B6SB 4UT7H 2BRRH 4QRUA 3MCLL 2ZP0T 4N5UA 3LSOB 4XVTH 1C5BH 4K7FB 3I3EA 4JREC 4KROD 4PJ7B 2N56A 5DVLA 5EU4A 2FJGB 4L8SB 2QSTA 3UTTA 2O61B 4FQIL 4TSCH 4UOJA 3R0NA 3VI3E 3MCKB 2P8LB 4RAUA 2EE6A 4F7MA 4W81A 1IQDA 5IKCA 2CLZB 4MSWA 5TE4H 4YFDB 4F9LA 2NY7L 2KL6A 4UZGA 4LCCC 1F4XH 3Q5TA 3MYJB 1CCZA 1A21A 4QRQB 3TBWB 3NCEB 2OR7A 3RDTB 5GGQH 2EKSA 4CMHB 1JHLH 2VABB 2NY6C 4NO5B 4PTTB 3AUVA 1PY4A 4PJEE 3KPRE 2IQ9L 2F8XC 4XCCL 2O5ZH 4P9HH 5KG9A 5BVJA 1Z9OA 3W5MA 2XZCL 4R97C 3NMEA 3EDKA 3TO4A 3VWJC 3QG6B 4M7KH 5CEZE 4OZGF 1NMBL 3CH1A 3UO1L 5ESQB 3X13A 1VFMA 2EYSA 1I1YA 4KJPD 5JNYB 4LLDB 4I0CC 5KSBB 1DQJB 3VG0H 3PGDB 3JV6B 5C09A 1XZ0A 1CXEA 1I3GH 1ONQB 35C8L 3MV9D 3QDMA 4TVPH 3TBTA 2Y7QB 4JR9H 3O3BB 5I1HL 5CJ8A 4I3RH 1GGIH 5FYJU 1CT8A 1JPGA 5LWYL 5IT2H 1LNUB 5JMOC 3TFKC 3IFNL 3M8OH 1KN2H 4HUWB 1JGUH 2JCCB 2R2EA 1AXIB 2FZ3A 1R5WA 2EDJA 5FO7B 3NCFB 1I4FA 4NO0B 25C8L 2W65A 4M61A 1C1EH 2LAGB 2UZYB 4PJGB 4Y2DB 3TZVD 2X4SB 5TGBA 4NYLA 3KXFD 3BVNA 4PP1D 5I8KL 2E7CA 2G75A 4O58H 1BFSA 5CJOL 4J3XA 1QHOA 1T6WA 2X4PB 3FMGH 4QRTB 1NCTA 4FFWD 5A3IC 5CP7A 4DFIA 2DD8H 3W0WB 1CGTA 2QEJA 4KVNL 4EQ2A 2BVQB 4Y19B 3CK0L 3GJEA 2CK2A 3BOVA 3VXSB 1U3HD 1SM3L 1F6AA 2VE6B 3RVXD 4DKFL 4XMPL 5IVXE 2GJZB 4DQOH 2J88L 4ZFFB 4KY1H 4NRXB 3QIWC 4FXGA 5L9DL 1QSFD 5E9DA 2G5RA 4XP5L 3VRLF 5FGCB 3A6CL 3ULSA 2C26A 1DCLA 4JDVA 5FIEA 1AD0B 4FQHB 4HC1L 4ELKB 1V5JA 4F7TA 5I1KL 4TOYH 3ROLA 2ZOLA 1EMTH 3VXMA 2XFXA 1HEZB 5I8CA 4H0GA 1EEZB 4Z7VA 4XNZC 5EBLA 1JNLL 3R8QA 4YXLL 1UB6B 5FYLE 3QIUA 3T65B 1UXWB 3ZHDA 3BX7C 2Z93B 1G84A 1D5MA 4UBDC 1S7VB 3MFGB 3ULVD 5GXBB 5I76B 2J8UE 1J5OH 2NW3B 2D9QB 3VGGA 4BQCA 4P9HC 2P5WD 5GRUL 4PJ8A 4LU5L 4AEIH 1RD6A 4OGYL 4MB5A 1MF2H 5AUMB 5F1OB 4FFZL 5HDLA 4YO0A 3HTLX 2Z91A 4KDTA 3WFEH 3VRIB 1SVZA 4L9DA 1AJ7L 3FAWA 4ONHA 4RFOH 3H0TA 1HINL 1I7TA 5A2KH 4IRSB 3JSSA 3U7WH 1TCRA 2JB6B 4M93C 3CFJA 1CD1A 1JYVA 3BISA 3QFJB 5TF1L 5HHVL 1U93B 4JFZL 2Q6WB 2UZXB 2JKXA 4WTWA 3KS0H 3UDWC 3CPLA 3JBG7 1ADQH 4B5EA 4XVJL 3VRJA 1ORSA 4I0PD 1AGCB 1MI5A 4EI5C 2Z9TA 3QPXH 3WNKA 4OI7A 5EU6D 4QXGH 3L3IA 1BVLB 5HDQH 3TVMA 4NRZB 2XQBH 5D93C 4E42B 5HHMB 4K3JH 3FOMB 1AQKH 4GSDL 4P5TD 3UJTL 1CFSB 2VZUA 2CIIA 4LIQE 3X12A 5JPMB 3QEUB 5EBGA 5DJXA 2YUXA 5L88H 4G6KL 1BAFL 1NC2D 5EU3A 2XQYG 2GUOA 1LEGA 3K2MC 1AIFB 4NIKB 3GSNB 4QO1A 3CC5B 2PYFA 1CXKA 4NGHL 3U36B 1HSAA 2X89A 2CDGA 4FTVB 3L3GA 4NCC2 3STLB 3NTCH 4HKXB 2VJXA 1NPUA 4XAWL 4OD3H 1KCKA 4KJYA 2G2RA 1YDPB 3PHQB 1U8MB 5GZOC 1MREH 5EOCH 1Y18A 2XQYK 4G8FB 1V7ML 4Z7WE 2ZUQB 1KG0B 3DX7B 1KTKE 2WP3T 1SJEB 4BUHA 3CCHA 3IDYB 1OTTC 4UUJB 1ES0B 2W0LA 4PJ7F 5H94B 3SBWC 5F7MC 4E41E 3OJDB 3RWEA 2RIKA 5D7IE 4HQQH 5C6WH 4WFED 4OF6A 3S88L 3EYQD 4K7PY 3GBNL 1CICA 4NRYB 2BVYA 3GHBL 1S9WA 5F1IA 1G7PB 4N5ED 3OKOA 3EOBA 4WO4B 5FM5O 5F7EH 4XHJC 2BSRB 5TDPB 4OSUL 1F6FB 2DWDB 5C0RH 5F88B 3P0YH 4NNPH 5B8CC 3GJFK 1QTYT 2A77L 4KKLD 2PKDA 3IJHA 4WNQA 2GY5A 2W60B 4DOHB 1CGVA 3NZHH 1KULA 1Y6MR 2FX9L 1EEYB 5J0BA 1F8TL 4M03A 1Y6NR 4X5LA 4O2EA 4HGWA 1FH5L 2VITA 1KUMA 4PREB 3MBEA 5DD1H 5HHOB 2NY1C 3UTSA 3AS3A 4V1DA 1KT2B 1KGCD 3QUZB 1T5XA 3B4NA 5E99L 2YC1A 1RZFH 3AC0A 2PXYD 3W39A 4YEFA 2HH0L 5HI5C 1BFTA 3C8DA 3V52L 1AGFA 3LKPA 2GI7A 5KSBF 1WZMA 4ZO7A 4XB8A 8CGTA 5E5MA 1AHWC 4X4XB 3RVWC 4Y4FB 1H3PH 2ADIA 3IXTA 3JTSA 5I8EA 4YZFE 4RFNC 1J0HA 4LPUA 2CRYA 5C07B 3MLSL 4UOW0 1G9ML 1MCPL 1EO8L 4KUZL 2KZ1B 2JCCF 4Q0XL 3VGBA 1JGVL 5ITBL 4OM0H 4OLZL 1YEKL 2BNQE 2DKUA 5GS1B 1CIUA 2VDKL 3JV0A 2DQJH 4PJGF 2YUVA 1UWXH 3DURB 4PRIA 4C56B 2CSPA 3O0RL 1RUMH 2GSGA 3V0WH 4L3ED 3WSQH 2FX7L 3TBVA 4HV8A 3FT2B 1NCCH 43CAB 1Y6KR 3HRZB 3SO5A 1U3ZA 2F54D 3V4UH 4GW5B 1E4KA 1I1AA 1EFXB 4ORGA 5IEHB 1JWUA 2F15A 4MZ2A 3HNSL 4LCUA 4LOUD 5B8CA 1WBYA 5FA3A 3BMVA 1N6VA 1T20B 2QQNL 5GGTA 2ENSA 3MZTA 4GG8A 2CK0L 1DLHB 3BGAA 3O3UN 4XVSL 2AJUH 3VXPA 5GRJL 1LK2B 4JY5L 4QWWD 4ZUWA 3UAJC 3VH8B 1CFBA 2VXUH 2Z35A 1E4XI 4CN1A 4CJ1A 1Y0LA 1TITA 1R3IL 1YN7B 3AS1A 3O8XD 3MV9E 5I16A 2BSSA 3HPLA 4G8IA 3PWNA 3WJJC 1LO2L 5KZCD 4IM8A 4HK3N 3KLHD 3ZYJA 1OF2B 3MODL 4ZFOB 1AE6H 1Z9LA 3BGFB 1U91A 3C5ZD 3V6ZA 1G7HA 1FL6B 1HCFX 1D6VL 2ADGA 2GIYA 4KRMB 5E2JA 4DGIL 1TLKA 5I9QC 1F4AA 1BGXL 1CVSC 1T66D 4HEPG 2AJYH 4QOKB 4Z76B 3WO4B 3WUZA 4R7DB 4JKPL 2DQEH 2M1KA 5E94B 3KXFE 3RNQA 5F1NA 2WNGA 5FHAH 4X6DB 1T0NB 1WCBA 4GS7B 1BIHA 4XI5D 1E4WL 1CF8H 5HHQA 3ILPA 4MJIB 1CXHA 4UTBH 4NPYA 5LCVH 1T21B 1JWSB 3KJ6L 3ZE0E 2JIXB 5HDBE 5DZNA 2C3GA 4JFPA 3SDDD 3B2VH 1U8OA 2R69H 1ZT4A 4M3KB 3U6RB 5F72S 1FQ9C 3ARDC 1OTUC 1IC7L 1QSFE 2JJVA 3BQUC 4NKOA 1LK3H 5CILL 5BS0A 5IV2B 4M02A 3MFFA 4JZJC 4HIJB 4JN1H 3QRFM 4Z95H 4O5LH 3LKRA 2Q8BL 5F7YC 3KPSA 1S5HB 5FYKH 1RUKH 4HDIA 3SQBA 2GTWA 2CUMA 4QHKI 4QXTA 2B5IC 5GS3A 3BP4B 4R9HA 2PO6B 4R0LB 5EUOA 5J89A 3D18B 2AJSH 2B7DT 4JY4A 2K1MA 4LSPL 2VDPL 5L2KD 4PGDB 3D85D 2AJ3A 3AS2A 1G6RA 1RU9L 4DGYL 1FZKB 4NJAH 5KANG 3U0WH 3MJ8B 4XP1L 2E7BA 3OB0K 4HG4K 3GGWB 3DX9B 5FM4A 3SEPA 4G9FD 1T1ZA 1VACA 4YC2B 5DTFB 1WT5A 1XIWC 3PIQB 5F3HA 3SE4A 5GS2H 4I9WD 4WU5B 1SMOA 1IM9A 2BDNH 5GRVK 3GSWA 3CXHJ 4P2CG 5I2IB 3GMQB 4LSSH 5GRVL 5IW3A 3IGAB 4CMMB 1T89C 4GXUM 4YDJA 1MCJA 2X4NB 1J0YA 5DK2A 2LQRA 3S3JA 4JG0L 3VFVA 2D2OA 5ISZA 5BO1L 2AJVL 1FLRL 4NSKB 3RX7A 4KK6D 1SJHB 1HXMB 2RJMA 4NQXA 2QQKH 3P30H 4LKCA 3ME0A 4LRIC 1BX2A 4X9BA 3ES6A 1D5ZB 1DDHA 1NLDL 3L1OH 4KTYA 2H3NA 2XKUA 5GSRB 3HI1A 3LDBB 1EGJA 5EO0A 4JM2A 1S7TB 3D25B 4HWEH 3EZ8A 1SEBB 5IB4B 3Q5OA 3CSBA 4HJGA 5JW4N 1LEIB 4F15C 5EU6E 4HUVA 1Z3GL 3G5XB 4NO2B 1FE8H 1RZ7L 1C5DB 1A9BA 1UM6L 2DBJA 3WE6A 5IGXH 2W91A 4ZD3L 3RTQD 4LCYA 1YNKL 4EN3C 2YD5A 4P3CH 1B0GB 3V4VL 2DM7A 1I9RH 2IQAB 2ARJQ 4Z6AT 4LQFH 5EG6C 5T1MA 4WI8A 5D7LB 5CEYB 1OSPH 2NY0D 4Q6YA 2D03L 3E6HB 4ZUVA 2DIAA 2JJSC 3TWCH 2B4CL 5GGVY 5SX4H 5D8JL 3DX8A 4URTB 2VC2L 4N0RA 2HFGL 5CEZH 2Y6SD 4MQXC 3VGAC 3D0LA 5I30L 3JUZA 2FX8L 1OD7A 3EDJA 3TIDA 4U6TA 4D0DB 5JPNA 3ZT7A 5TQ2L 4X98B 4S1SL 1ZWIB 2D7QA 3I75A 2FL5B 2HA1A 1FYTA 2P8PA 1NANI 3QUYC 1FN4A 3LMJH 2A9NL 1ZTXL 5DVNA 4JREB 3KPMA 3VWKD 1UCBL 3BDXA 2ARJA 1BJ8A 1DEEA 4RRPG 4JFEB 2CRIA 2W07A 2VLJD 4LLUA 3MXWH 4WJ5B 4C55A 5ITFA 3CNKA 3BD3A 1A4KB 5FB8A 2Z92A 3FOLB 3JZ7A 5IB1A 4BQ9A 5ICYA 4JG1H 2WBKA 3U1SL 3RVTD 4RFEA 4LCCB 2E9WA 5C8JA 1X5FA 3P2TA 4MX7B 4QCIA 1XF5A 2A6DA 4O4YH 4P5KA 3RL1A 1VFAA 2IH1A 4HS3B 5H2BA 1P4LA 4MMZC 4YGVB 1UVQB 4LVHC 1S7XB 5IWLC 2EDXA 4YPGA 5JHLH 4OLUL 5GGSA 5INDA 4LF3A 3F5WB 1ZAGA 3Q6FB 1BZ9B 2VOTA 3L3JB 3WBDA 5CGYC 3FZUD 4JDVB 2A83B 4M6NH 4R97B 5DUML 2MSPA 4H1LB 2XN9D 3VWJB 1YEGH 5GGTL 4J3WA 4DAGL 1KGCE 2P5ED 3WKML 3F7PC 1B0RB 4KV5F 2R4RL 3O9WA 3SDAD 1EVTC 4M9PA 4HUUA 3NIFE 4TUOB 3SPVA 4OKVB 4HUXB 1IQWH 4UU9B 5ILTL 3H42L 1DE4A 4Z7VB 3S34L 4XHQA 3WNNA 3FHQA 3OAUH 2XWTA 1A7OL 1H0DA 2ORBL 4X5XB 5D70L 1D5MB 3IAQA 1IT9L 2Z4QA 2KPNA 2HVKB 2NX5B 4M00A 5FYLH 3L6FA 2VXQL 4YHML 5L6YL 1V8HA 2VMFA 1T83A 3NOIA 4QXWA 4XXCC 1CQYA 3OJMB 3EJYD 1FYHB 3T0VA 4CADB 1JMZA 3V5HA 2ZNXA 3QNZA 4XX1E 1TZIB 4RZCB 2NY2D 2MQCA 3ARBD 5I6XC 4L3EE 4BZ2H 5HD8C 5EC2A 1GGBL 3QCUH 1GRWA 3ZL4H 4NQCB 4PLNC 3SDXA 3JV4A 4NZUH 3I6KA 5D9SB 2F54E 4MDJB 2NZIA 4P46D 4DN4L 2CLRA 5HGBA 5D6CB 4YXKH 1WJ3A 3FO2A 5DRZB 2DM4A 1KXQE 1NJ9B 2HTKC 3IFPB 1PZ5A 1NH6A 2R0ZL 5F9OH 3QIWB 4P2OD 4I18A 4PJHB 4L4VD 4AY0A 4C4KT 2ZOKB 5INCA 3AREC 4GAFB 4EUPH 1MQKL 4FQ1L 2L7UA 1ZGLM 3WHXB 4NHUA 3V0AC 1IFHH 3E8UL 3U46A 2AAVA 3P11L 3P0VL 2HWZH 4D8PB 3HR5A 3O6MH 1ZA3A 2AKRA 3S96B 4H8WH 4LIQH 1UKTA 5C0AB 4MJ4A 2ZSVB 1GZPA 3FQRA 3GMLB 1G6RL 3L3HA 2IG2H 1HSAB 2VLKD 5CSZA 3MR9A 3BIAX 4PP2A 4XNZB 3S4SA 3LKSB 3HS0A 2H2PD 2E6QA 3WN5C 2ZG2A 5E8OA 3ZDZE 3R06A 3EOAB 1DQQB 4DGVH 4LDLB 1MIEL 1R3HB 4MNGE 1YYLH 3D39D 1BJ1H 3LKQA 4NQEA 3WEXB 5C6TL 1CR9L 2VN7A 1Z0NA 2VZ3A 1E6JL 2IPKA 5F7DA 3RAJL 2A38A 4YDKL 5J1AA 3QO0A 2OL3L 4YHZH 4EIZC 4QRSA 1IILE 3J8F7 1U95A 4MXQD 2V2XA 2OR9L 3I6GB 3PV6A 1N59A 1FNEA 1IAMA 2W9DH 5SV4A 5FECA 1UFUA 2Q7YA 1ZGLA 3TGXA 4M93B 4QTHB 1EGJL 1MHPH 2FJFA 3C60A 1HILA 3L7EA 5DD6B 3GSUB 4JDZA 3BZDA 5FDWA 3MBXL 1GYAA 2E7LC 4OGAC 4PJ9A 4WWKA 1A3LL 1FIGH 2V6HA 4EI5B 2QADC 1EFQA 1X5HA 2WW8A 4BFIA 2DLFH 3QQNA 4N0CD 1BQLL 5L2KE 1ZHNA 4G9DB 5FV2A 4PV8A 1FVEA 1ZEAL 4YNYB 3THML 5LGJB 1ETZA 5HHXL 1WEJL 1ZT7A 3MRRB 2YMXH 5HYQA 1D5XB 5DRNB 1HKFA 3RIFF 4ZQKB 4ODXB 4G9FE 2FIKA 1S9VB 3G5VA 1FZJB 2BNUA 1TDQA 3T2NL 3QHZH 4I9WE 4PRNB 2BSTA 4P49A 1NGZA 5T1LD 3OKEA 2LFGA 5DT1L 3A6OA 5FF6B 1B88A 2WBJA 2DYPB 2XKSA 3WCYA 2P8MB 3SKMB 4NZRL 1KFAH 4GKNB 3B9KD 1A1OA 5DD3H 3M17A 4Y5XA 2PTTB 4PRAB 2RFXB 2X70B 4K23L 4WV1B 5DMIL 5FK9B 5M95B 2DQCL 2EDBA 4OCYL 5JZ7D 4WUUD 1Q9KB 3PNWB 5AWNL 5IVXA 3KHQA 4Y16C 4OZFH 1YY9C 4NQDB 1RUQH 4NT6B 1OAQL 2XTJD 2BY0A 5DVMA 5D5MB 3B9VA 4KK9C 4HG4J 3MLUH 1VKXB 4I3GA 1U8QA 5E8PA 1DVFA 1REIA 1WZ1H 4I5BA 5JDJA 1K4CA 1WUNT 5J8OA 2FHBA 1G1CA 1UC6A 1MRFH 3HCVA 4DTGH 3SE9H 2AV1A 1MCEA 4OUOA 4UIKL 5DUBA 4HPYH 4Z77B 1KLUB 5B8CB 5D1XC 3BMWA 1CFQA 4L9LC 5JUEL 4HZLA 5JXED 4OLXH 4PYHA 1T6VN 4AIXA 1NDMA 5DFVD 5E00B 5BOZG 3BH8A 2GCYA 3BGMA 4RGND 1H8OA 3KPLA 2F19L 4JFXA 1GOHA 5IBTL 4ODUA 4NCDA 1MCLA 2AK1H 5IVZB 1HI6B 2RQ8A 2R9HD 1K3IA 2NY1B 5F6HI 2DN7A 1R3KB 4UDTB 4F58H 4U1MA 3QUXD 3NGBC 5HPMB 4HUNB 4GRWH 5F44A 5K59F 5FKPB 4Z7VF 3KYMB 5AD0A 5E5UB 3WFCH 2W0KA 1T5WB 4XNQB 1S9XB 1NBVL 3EGSA 4Q2ZB 3T77A 1AHWB 4LSTH 3L3OB 1OAUL 5IBUG 2VLJE 4PG2A 4DW2H 1FC2D 5HTSA 4Z7QE 3O6KL 5L8JB 8FABA 4OIIH 1Q9WB 1JMXA 2IGFH 4RFNB 5EPMB 3WHE1 4M48L 5I8OL 4CGTA 5HJ3A 2JELL 5I1LB 5BV7H 5JQHC 4JRXB 3N85L 4OZIB 2VLRB 3F7VB 2GJJA 1JV5B 1EAPB 2WIIB 4G3YH 4H0IA 1CDHA 2ZCLH 1YMMA 1L7TH 1QBLH 1NAMA 4U1LA 5GPRA 1N0XH 1IEAA 4MCZA 1GOGA 3C5JA 1PGRB 1I8IB 1PDKA 4R7NA 3RZCD 4TRPL 4DVBB 4MVBC 4KMLB 3BSZL 3MRHB 2XN9E 3ZMRA 1JZ4A 3QFDB 4KHXL 1LO3H 2ID5A 4JFYA 4HX1A 2C3VA 2P5EE 3HMWH 3S4SG 3ELAT 2K9UA 3MA7A 4NNXB 4K3HA 3FQWB 4PJHF 2HT2D 3HC3H 1KB5B 4S0SD 1SYSA 4BKLB 4Z7WA 4PJDE 3QXAA 4LARL 2VXSH 15C8H 5DWUH 4XNUH 1OTSD 1E28A 1B4RA 5ID1A 2RHEA 1GIGH 1X5YA 3BP6B 2D3VA 1OP9A 4E41A 1KEML 4IIQC 3T0ED 3MRGB 1I75A 3MRLA 4MA8L 3MNVA 1SBBA 3MRJB 3ULVH 3V6FB 1M6OB 3IS1X 1DEDA 4GO6B 2VL4A 4Y1AB 3IB4A 2ZSWB 5I9QB 4XBEL 2QLVB 3D9AH 5EIVA 2EKJA 1NGPL 3DBXB 1AXTH 1CZ8H 4Z9KB 3VD3A 1CU4L 3EOTH 2H9GA 2X1PA 2PCPB 1JGDA 5TDNA 1YECH 5DHVA 3OSKA 1F6LL 1VEOA 1W0WA 5CCKH 1RI8A 3VGDA 2Z31B 5JHDB 3EO0A 2DQUH 4J7RA 4F37K 4KJPC 1OP3K 1HQRA 2XACC 4JFOA 3BRGC 4OD2A 3NFNA 4Q9QH 4HSQA 3F58H 4NM8H 3ARDB 3KS0J 3BQUB 2A2QT 3VMOA 4NBYB 4L4VE 1QKZL 4JZJB 2YSSA 5TPWH 1LE9B 3MOQA 3LZFH 1X3DA 1P4BL 2C7UA 3CVHH 4LNVA 1NSNL 1ACYL 5LBSL 3AM8C 2CR3A 4J2XA 1MFNA 1QQDA 1CDUA 2XA3A 4NC0B 1QZ1A 3TPUB 2FJHA 4NQVA 3PP3H 4JM4H 4LRNL 1HQ4A 3A6BL 2VR9A 4ZS6C 1YEEL 4QF1A 4ZG1A 5BV7C 4P2RD 3TZVC 3GNML 3NH7L 3BKMH 2VLKE 4PP1C 3BE1H 1NUNB 4JFDA 4OJFL 1S7RB 4X4YA 4U1NB 4OLVH 4PUBH 5B38B 3T04D 1IGIH 3DUSB 3L5XL 4L3AA 2EE2A 4FFWC 4N9GA 4PLJD 5HHNB 5C08B 3D39E 2BNQA 4G43A 4RDQF 1XIWB 5E08L 1Q72L 1U3HC 4HAFA 3CVIL 3RVXC 4YQXH 4OFIA 2NMSA 1CDYA 3UTQB 4HS8H 1L4IA 1ZLUK 1X6LA 3O6LL 3PDDA 5TH2A 2EIZB 2NPLX 1IAIL 4FQCL 1AC6A 3DVGA 1MHCA 5FB8B 4ZYKB 4EI6B 1TPXC 2C4FT 4M9OA 2YWZA 5IK3B 3QQ4A 2E7MA 3RWDA 2O5YH 1KCLA 4GRMB 5AG8A 4L5FH 1MFEH 4PLKD 5EO1B 4NOBA 4LQ1A 5F89A 3T4AB 5EOQL 4E0RB 3D2UD 5D5MF 2V5MA 2XYCA 3LQMA 4QHUB 4U0RB 4OUUB 4MLSA 1MJ8H 4J3SA 4F15B 3BRFA 1E6OH 5CEXA 1PAMA 4JGMA 3MV9A 4RIRA 2GAZA 1UACL 1KJMB 4PBWD 4YPGB 1HHGA 5FCUH 3ULVC 1A3RL 4X9IA 1CXIA 3GK8L 4IEFB 3RFZC 5E95B 1Q1JL 4PJ5D 4KI5D 4L4TD 4WGVB 2BY3A 5GGUB 4EN3B 4FNLH 4MA3A 4ZAKD 1O0VA 4BFGA 3O2WH 5I1AA 4H26B 1RUAL 1CL7I 3PWJB 1AD9A 4BH8B 1YEIL 5TE6H 5JOFB 4RGMC 4RX4D 1XGPB 4HUUB 2PYED 4AQ1B 1S7UA 2JE8A 2FR4B 1FZMA 3KXFA 1JHTA 4OTXH 4Z0BH 5GIRB 5I74C 3VGAB 4HF5L 1RZJH 5DZLA 4BZYA 7FABH 5DS8B 3VH8G 3FN3A 1N0LA 4NWUH 3NABH 4WUUE 4UQ3A 4CVXB 4TNVK 4XP9L 4NOFA 5A16A 1RZIB 1DBBH 3KG5A 3ZZ1A 5KVDH 2FEEL 4NNYB 3OKLA 4OZ4A 5J6HB 3QUYB 1QSFA 4P3DA 2PW2A 2XTJE 4G6MH 5IHUL 3RPIB 1YEDA 5CBAA 3VFRB 3PDGA 4P5TC 4D94A 4HMCA 3N1QC 1EO5A 1K6QL 1LDSA 4XPTH 1MVUB 5ERWA 1MAKA 3MNWB 1GZQB 5SX5H 4FQJH 3SE3C 4WU7B 1B9ZA 5T3ZL 2YXMA 3IKKA 3FB5B 2FBOJ 4OF7A 4HLZG 4OZIF 3VFPB 4YDVB 4YHNB 2OXGA 1ZXQA 4OQTH 3NA9H 3DV4A 2HYMA 3RWJA 4I3SH 1GOFA 1MLBA 3WHE0 1I7RB 5ANMB 1K3ZA 1JGLH 5DC4B 4LVHB 1HHIA 3UTZA 4OLWL 2A73A 2XXCB 5GS0D 4HCRL 3LB6D 4LVNC 4RGNE 4U1HB 5T3XD 4MA1B 1UM4L 2N1KA 5HVGB 1JTOA 2XI9A 4PTUB 5SWZA 2Z8SA 2FATH 4NWTL 3QEHA 4J3UA 1CLOL 2ED8A 2OSLA 3AMKA 4XPHL 5CBEA 5JORA 1JPST 1ZS8B 5IB3B 3WKNA 3SDCD 1LDPL 3EYQC 3OAZH 3L3DA 4JVUA 4NZJA 3HS0B 1TNMA 3AXLA 2R0WH 5HPOA 3RWCA 4N5EC 1YQVL 5HGAB 3OZ9L 1XCTA 4PJFE 5ACZA 4RBPH 1PJ9A 2CJUL 3I50H 1A64A 4I0PA 5C0BD 5DHXB 4KKLC 1X9QA 4G6JH 5EU6A 5EO9B 3QO0B 4EJ1C 4PJEB 3KPRB 1NCNA 2FWOB 2PR4L 5FA4B 3TC9A 1CWVA 3P9MB 1JRHH 1QEWB 4HPOL 4IRJA 2EIDA 3WNOA 2W9LA 4K8RD 1U58A 1KIUA 1T2QH 5FCSH 1NC2A 5FM8A 4D0CB 3QWRA 2XOTA 1NBYA 3UYPA 1KEGL 1RZJC 4UNVA 3LEXB 4LLYB 3TA3D 1IC5L 1FG2A 1TJHH 3DX6A 3VFTA 3RU8H 1AO7A 4I48B 1NCAH 2PNDA 3RA7H 2XZQH 1MIMH 5EORL 2VYRE 3O3AB 1AXSA 4FP8L 5DQDL 2RCSH 4BSJA 5EU5A 3S37X 3AREB 5H37H 3VD7A 5KOMC 4MAYD 4QHLA 3FQUA 2I9LA 3F6IA 3I3DA 4OCNC 1KTLB 4WI5A 1CGSH 2I5YH 3QEQA 2HJFA 4MNHA 3T0EE 4P48A 1NCDH 2B1AL 3OBAA 4DN3H 5D2LB 3K4DA 4PGBA 4HXAH 2Q76A 1OQXA 4KUCF 5E8DL 3FRUA 1A1MA 4UV7H 4W4OC 3GI8L 2ZJSL 4YHLH 3WN5B 4ZFZA 3SE8H 4UT9L 2VDOL 2V5TA 4EDWH 5DD5H 4AYFA 4R4ND 3SJVD 4LOUC 4KRLB 4RWYH 5JOPD 4LAQH 3BPCB 1ZLSH 3RIFK 3PDOA 6FABH 4OD1L 3U9UB 3VFUA 2MWCA 4QWWC 2FD6H 3TF7C 5FGRA 1WAAF 4CKVX 3FB6B 4KHTL 3OR7B 3QDGA 4GUPB 3D5OF 3O8XC 4I2XE 4I0KA 2Q8AL 3MTRA 4QHNB 5HY9B 3EBAA 3KLHC 1AC0A 2PXYA 5C0EB 1KIRB 1GXEA 4LCWA 3BP7B 3C5ZC 3GBMH 3MCG1 4LLWB 1JK8B 2QADB 4D9QD 2PTVA 1T66C 3FT4A 4P2RE 1T4KB 1V7NH 1NBZB 3G5ZB 3MSPA 3ISWA 3K3QA 5HYSB 1KTDB 3KYOB 2J8UB 4GAGH 3VFOA 4LGRB 4L1DA 1INEL 4XI5C 1FAIL 5ELIA 5KW9H 4MCYB 5DR5L 5CMAB 4X8JA 3MUZ1 3SDDC 3NIDE 5FFLA 1L7IL 5KTEL 5E6IA 2Z8VC 4WW2C 3X3FH 2QR0A 1LO5B 3RL2A 5KAQG 2E8YA 4L3EA 2F58L 4GRLD 2CPCA 4A6YH 1OAKL 5HI3D 3REWA 3EJJX 3MV7A 4OIAA 4KVCH 3H7BB 3RJQB 1DL7L 4X4ZA 3V5KB 4PJCE 1EK3A 5IP4A 2A9MH 5ADPH 4KAQL 4KMTH 4ZNEE 12E8H 4CJ0A 3ORJA 4Y5VB 4LAJH 4JGJA 4Y16B 1PYWA 3GMNA 4EUPB 1J11A 5HYFA 4ORZC 5JXAL 1J12A 4GQ9L 1NAMB 2EDLA 1QFOA 1UZ6F 4P99A 2AABL 4GW1B 2IMNA 1RIUL 2AK4D 2DI9A 1X5GA 1DANT 4PJ5E 4KI5E 1Q9LA 1H5BC 5MENE 3H8NA 2BOCB 3VFNA 4JPIA 3MREB 2DQTL 2YR3A 2ZKHH 5B39B 1VFUA 1RSFA 3FAXA 2VAAA 4HK0B 5D1XB 4X7TA 1P1ZB 4KPHH 4L9LB 2P42B 1FO0A 3AB0B 5AAMA 3WIHH 2FYYB 1S5IH 2PYEE 4KK6C 1QHPA 5CAYB 3C5SB 4ERSL 3PHOB 4MNGA 1LP9E 5ALCL 4OFYD 2FGWL 1MHEB 1RJZB 3STZA 3BKCH 2H41A 5KSAD 4AENA 3KR3H 4WHTA 3TBSA 4U49A 1EAJA 3K4AA 4UV4L 3LN4B 1K8DB 4PG9B 1J0ZA 5I1GL 3N9GH 5DLML 4F9PC 4M62H 4YDIH 5MEPA 3L3KB 3Q3GB 4M6MH 2VDRL 4FQLH 5D7IB 3NGBB 4LBEA 3SKOB 1DN0B 3VI3F 1VCAA 3U9PL 1P7QB 2Q3ZA 3FTGA 1BFVL 4M5ZH 3U4EB 2B2XH 2QV2A 1J05B 3S3PA 3QXVA 1A6UL 3IAGC 3MRBB 1TVHB 4FQQA 3RTQC 5CJXC 2P44B 3LAFA 3REVB 1U8JB 2BK8A 5JW4M 1TVBB 2R0KL 2NY0C 4EZMA 2BVUA 4EQ3A 5LGHL 3EDFA 4LLMB 2E6PA 4EVNB 4PJEF 3V0VB 3VI4E 4F33B 5JW4Q 2H6PA 1NGWA 2DDQH 2BNRA 3IDNA 5BXFB 3BUYA 5J6GA 2Y6SC 4R90L 4R4FH 5EN2A 5TE4L 1IL1A 3NIGE 3STBA 3Q48A 3I02B 4OCXH 2DOCA 2MNUA 1WFOA 5ICXB 5DRWB 4G9FA 1T7XA 5T3XE 3TJHD 2Y07L 2ZPKL 2A1WL 2GK0A 3OF6D 5CS7A 5FOBA 4JFQB 2VDMH 4PJIA 1QQDB 2VSDA 3SCMD 1CFNB 3K8KA 3VWKC 4O02L 5IOPA 3SDYH 5F8RC 1L6ZA 3LS5H 4N8CL 4G7YH 2ICWI 4OZFB 2Y5EA 4XTRC 4PFEA 2GT9B 3GB7A 1MJJA 4LLAA 2CRMA 3RVTC 2VDLL 5IR1A 1QRKA 3BEVB 1GC1H 3WFBL 4G6FD 2YOCA 2DQGL 1A14H 4P5MA 3BH9B 2W0FA 5C0BE 3RKDD 3MOAH 4IIQB 3RJDA 4AG4H 2CKBA 3SQOH 1LE5A 3C08L 4FQ2H 4R26L 3O4OC 5DJCA 4TVPL 1QO3A 3PWLB 1BJ1J 4JEGB 4JR9L 1GGIL 1N5AA 3J7HA 1VGEL 3HB3D 1N64L 1UYWH 4YHKH 1IEHA 1KN2L 4N1CA 5ETUB 1JN6B 1M05B 2EDHA 4QNPE 5DJ2A 5IVXF 2GITB 1UWEH 1C1EL 5F9JB 3RX8A 1BQHB 1E27A 4OZHE 5ESVB 4JKWA 2IPTL 3KWWA 2FECI 3ULUH 3HI5H 4BSWA 4JY6A 3ZT5A 1C7TA 3L5JA 1WK0A 3BN9D 3GI9L 3O6FA 1NFDE 3V7AE 4OFVA 3BKYH 1P84K 2HLAB 1I85A 3TT3L 3MRKB 2WUCL 2DI7A 4GRWB 2NY4D 5K9JL 3DVNA 4ONFH 4D2NA 1JHKL 1KJ3H 5CD3B 2XKNB 1D3CA 4DQOL 5F96L 4MA3B 1WC7B 4FQXB 1DN2A 3EJYC 5DDHB 1JCKA 1IGJB 4K2UH 1JFQH 4F8QA 1FNSH 2VLJA 3S37L 1S7QA 3VMNA 1A6WL 5JW3L 3IU3B 2NY2C 3ARBC 3TO4D 3TZVB 5EZIL 3QXDA 1WVZA 3FO9B 5BV7B 4YAQB 2J8UF 2ADJA 4M1DL 1E4XL 1A5FH 1YY8B 4WHDA 4WFGD 3MMEA 4RQQA 3HRPA 1VADA 1IEBA 2R0LH 4P46C 4XCNB 5IFHL 1YNTB 4N8VA 5TE7L 4PB0H 1GHFH 3SJVE 2OI9B 3GMOB 4NN6C 4JJ5B 3NCYP 4RISH 3F12B 1U3HB 5C09D 3GMRA 1YPZE 5JOPE 2C1PB 3D3VB 3QUKB 5IW1B 4WEMB 4OZ4B 3QDMD 4P2OC 1F90L 1X5XA 3BWUC 3FQTA 2EIEA 1OCWL 1WISA 1MUJB 2JLLA 4AEIL 4M7JH 1TPXB 3FQNA 2XRAL 1KYOK 1F11B 5AZ2H 4GXVL 1CG9A 4O00A 4BSVA 3NA4A 4NCC1 4J1UA 5EC1A 2R1WA 3WFEL 1G6VK 3MRDB 3SDAA 4EXKA 5DK0A 3GSVA 3QXWA 4RFOL 3QSKB 1GC1C 2YKLL 1XF2B 4FABH 4QRPA 3DMMA 1X4XA 5IFJB 5J13B 2AP2A 2HT3D 2H2PC 3E2HC 4KU1A 4PJDA 5KS9E 5HVHB 1MLBB 4D9QE 1INDH 5C9JB 1MLCA 1WIPA 3LS4H 3MJ9H 3MLTB 1W0VA 3TCLA 3RWFA 2NW2A 3MNZA 3MOBH 5EBWA 1X44A 4DCQB 1QVOA 3ARFD 5FGBC 1K4DA 5HGHA 1FZOB 2P5WB 3V4PL 4I77H 4QXGL 1FFOB 5C0GA 1PX3A 4AQOA 1FO0L 3MO1A 1MCSA 4F7CB 3IDXH 4EDXB 1AQKL 1QYGL 2OSLB 2V7NA 4P23C 4RGMB 1YNLH 2FBJL 4ZOAA 5EBMB 5LAXA 4Z7WF 4P59H 4YWGH 5I74B 3BRDA 4N0YH 4X5WA 4NUGH 2ATKB 4NZTL 1FCGA 5KVFL 4XP6L 3VXMD 4PV9B 1YUHB 3K81A 2CRZA 3FFDA 1WICA 5ACZB 2L4OA 5D7IF 1K85A 2D0HA 1EV2E 4XPGH 3QIUD 1OOAA 4NC2B 3QUMA 4P2OA 1DANU 3CVHB 4ELME 2QSCL 3LQAL 4N0CC 1MREL 2DLIA 4GBXA 3G5YB 4U2ZA 5BZWA 4P5TB 4MD5A 4HIEB 1KPUA 3TIEA 4PJ8D 4KMQA 4F3FA 2BX5A 1R3LB 4R8WH 2EE9A 4JO3L 1N5YL 1G7LA 4ODVL 5T1DL 4XC3H 2HMID 3MGOA 4UINL 5LG1A 5C0ND 2ZUSA 4DUVA 1S78D 3NCBB 4BH7B 3BXNB 4LDOB 5BVPH 3IDIA 5DQJB 2C1OB 2NYYD 5CJ5A 2VLKA 4ISVB 5EA0H 5LXGL 1CGUA 4LEXL 5DJYB 3B9KC 2FH6A 3O41A 4HIXL 4DK6A 1BD2A 3OGCA 4O2CB 4Y4HC 2YPVL 3S97C 2CR6A 1NCUA 4GMTH 3HKFA 5JZ7C 3P0YL 1S7WA 3LEVL 4ZNCD 1DBKL 4LVNB 3H7LA 4NNPL 1I8LC 1DLFL 2BOBA 3LRGA 3GSRB 3FQUB 3TVMD 3QDHA 3IXAB 4XGZA 2XTJC 1RHFA 3W81A 4KTEL 4Y5YC 1H3TA 2UWEB 3QWOA 5DYOA 2RGSA 4JFHD 5E24E 1XF1A 4BZ1L 4YZFF 3V79C 4YFLI 5DD1L 2E27L 2EDFA 4GG6E 1N8ZA 5F93C 5K93A 5HVFB 4YBQD 3X11A 3TN0D 2ICEB 3MJ7B 1HYRC 2P45B 4HS6B 5I0DA 4ZOEA 5KSVA 1TJGH 2JJWA 2X4OB 5M7QA 2R56H 1A1NA 1FBIH 3MLZL 2ATPB 3KNBB 5D4QA 4LKXB 3CFCL 3OKYA 5JXEC 1CIDA 3GMMB 4Z18A 5DRXB 3EDEA 5A2LH 1HE7A 4GLRI 4OI8A 1ZK9A 4RGNC 4OT1L 2IFGA 2XTLA 3RUGE 4WCYH 1NDGA 2Y06H 5JW5A 3N06B 1ZT1A 1P4IH 1EZVY 1JPSL 2P24A 2R9HC 4PJAE 1ED3B 3IDGB 2R2BA 3W2DL 2VDQL 3QA3A 5T1LA 3QZWB 1A6ZA 4HWBH 4PJXE 4U05A 4EIGB 2ZUUA 3PHSA 1CICD 3T2QA 1IAOA 3B9KA 4XMLH 5I75C 5I1JH 4UI2A 3DETD 5C3TA 1T7VA 1JF6A 1IC1A 3PP4L 1DBJH 3RWIA 3QIBA 4QT5B 5BQ7A 1CD0A 4GAJL 4N8VG 4XPBH 1U36A 1DBAH 2H32A 5JOEA 3AU1A 4KZDL 3MYZA 4RA0C 1HXYA 2J2ZA 4NQSA 5D1ZB 4JRWA 1WWAX 1NKOA 1I8MA 2AXJA 2AJUL 3H9ZA 3BKJH 1P7KB 2GJ6B 1Q94B 1QFUL 1H8NA 1S7SA 4H20H 5A1AA 2LU4A 1NL0H 2VXUL 3SKJL 2R29H 1NQBA 3DRTB 4GKZB 3OKKB 1MCDA 3UTSD 3HI6H 4V1DD 2OQJA 1F4YL 3RZCC 1QLFB 2F54B 1EHLL 4HUMB 2IAMA 1G7IB 3ZE0F 1AE6L 4RAVB 3BO8B 2EH8H 3GM0A 1X7QA 1MELA 4MNQE 4MYWB 4KRPD 4J4PA 2VLLA 3ROOA 2AJYL 3JWOH 4GAYB 2H1PL 2H8PB 4JHBA 4YHOL 3RGVD 2HT2C 3VE0B 4GMSH 2JB5H 2ZUYA 1ZLWK 3T0WA 5BZDA 2HFFB 4WHYG 4LMQE 4M1GH 3QJHA 2YA0A 4APQA 2YRPA 1I1FA 2G60L 1OTSC 3TYFB 3MRFB 3O8XB 3NBNA 3MLVL 3BN3B 5JIPA 2F5AH 4G80B 3T0EC 4R96A 4Y4KD 2I9TB 3BZ4A 3QUXA 4PRID 3ZYOA 4X0KA 3ZTJH 5ALBH 2OK0H 3C5ZB 3NFSL 4G8GA 1DUZA 1EUTA 3HG1A 5HGDB 2WINB 1ZKAA 4Y88A 1I1AD 5E1AA 2Q86B 4O5LL 3ULVF 1QSZA 2DQFA 5FYKL 1RUKL 4WFGE 3HC4L 5CKGA 4OB5L 1NGYB 3CSYA 3C6LD 3DHMA 4J6RL 1JZ3A 3S5LA 1QSEA 4WHTB 1NCBH 3G04B 2ESVA 2AJSL 5C71A 3DRQA 1EVUA 3SDDB 3HE6A 4K71C 5C09E 2EEAA 4WW2B 2PW1B 4BYHA 3GMPB 2OX5A 1B4JL 1FNLA 4DFHA 3QDME 3FTGB 2VO5A 4QYOB 4UAOC 3WIFA 4EBQL 4JDTL 3RZCA 4XBPB 1CE6A 2DQIH 2X4TA 3EDDA 3GRWA 3O4LD 3LPGA 3VXRA 3VJ6B 2B0SH 2HFTA 4LSSL 4XMKL 4WEBL 3RI5K 2F5BL 3U7AA 3QUML 5E2VH 5IMKB 3KYNA 4UDUA 4JRYD 1J88A 1QLEH 2YK1L 4L8BB 4HLJA 4XRCB 2QQLH 5CGMA 2ZCHL 4ZUUB 1UWGH 5L2KB 4NUJB 3D85B 2VB5A 3JXAA 2HJLA 3QG7L 5F71A 2AJXH 3WIIL 4QLRA 4M6OL 1KENH 4PLJC 3HUJB 4HWEL 1FRGH 3WL9B 4DEPB 4PRPB 1Z6JT 5J7CC 1FV1A 5F9AC 3MRNA 3K1KC 4YXHH 1KNOA 2UYLB 1H5BB 1QPPA 4OF5A 4HHAA 1YEHH 5D6DA 5FOBB 4QKXB 1AR1C 3NFPB 5GS0H 5T3XH 4OGXH 4OCWH 1DQDL 4LCIH 4OFPA 4Z0XB 1SBSL 4HIHB 5AZEL 3KPSD 4P3CL 3GIZH 3JWOC 5GZND 4Y7MA 3TNMB 3MRIA 1HH9B 4XC1L 5I1DA 4HK3J 4LQFL 4LSQH 2VQ1B 4NDMB 1JZ6A 4PLKC 1DFBH 1RK0B 5GGRA 4U6HB 2KKQA 4R2GC 1XGUB 1NEUA 1NCWH 3TWCL 3VXME 1JWMA 3FFCD 4MJ5B 1HKLH 2YS4A 3DIFA 1RJCA 3EJZC 4LLVA 5E4IA 3DO7B 4CDHA 1LEKA 1IKFL 3L9RA 2Y5TB 2OJEB 2XXMB 1UZ8B 1QO3B 4QHKJ 4Y2OA 2LE9A 1MHHA 5I15L 4MQTB 4KI5C 3RTQB 2UZIH 1DP0A 1OL0A 1IM9D 3EYVA 2VXVH 2V17L 4ZAKC 5LVEA 3IDJA 3MJGX 4XCEB 3O3DA 4TSBL 1MPAH 2E9IA 3DTXB 2NY0B 2AXFB 3DROB 5ISZD 3G08A 1I9JL 1IGML 1X6NA 4P2RA 4K8RH 1ZMYA 4ONGH 5HDOA 3ALPA 2IANE 4NM4H 3HMXA 1N4XL 4NHCL 1P9MC 3EIFA 4XCFL 4MJ2A 4BQ8A 1QG3A 4ZSOA 4JM2D 1F58H 4U2YA 1MFDH 3I84A 1UJ3C 3ARGA 1BLNA 3KAAA 1QA9B 4G5ZL 5EU7E 4O4YL 4A6YB 3S36H 3DVNB 3EYFB 5DHYB 2N7BA 2EZ0D 3MLPA 3NIFF 3T8XB 4JQVC 2E3VA 2VERN 1UQSB 4B0MM 3ZE2E 4X6EB 4ZPVA 3O81A 5E03A 2X40A 4ZO6A 5JHLL 1UB5B 4MHHG 3VWKB 5IIEA 5D7JA 4PY8J 3ZDYE 1T3FA 3QDJB 4JFHE 4S1QH 4M6NL 4PJCA 1U42A 5IB5B 1MEXL 5MERB 4KKAD 4AIOA 4DKEH 4HFWB 5DD0L 4ZNEA 3LH2H 2FSEB 3H9HB 4QY8A 3PWPA 1OM3L 1U8IA 5I1IH 4JO2H 3O2DA 1IQWL 4RGOL 3V5DB 3P9LB 1CE1H 4HIIB 4TQEH 3WXVH 2ERJC 4QXUL 3GO1L 3IVKB 3MCLH 1TQCC 3O4OB 4OAWA 5F9WC 5GS0C 4B7LA 3LB6C 1BBJB 4PJ5A 3JVGC 1FYTD 4N90E 1BOGB 5MENA 1R0AL 1VHPA 3U0TA 4FQIH 3R0MA 1P2CA 1JPFB 2AEQL 2EE3A 2XN9B 3B8YA 3SN6N 3O3EB 4WW1A 2I60L 4MJ6A 1G7MB 3RWGB 1IGCH 5ESAB 3ZHLA 2P5EB 5MEOA 3EOYG 3CMGA 3RQ3A 2NY5H 1NGXA 2PYEA 4S1RH 4R6UA 1D5BA 3SDCC 1LP9A 2X4UB 4HH9B 1P9MA 4WUKL 5H35A 1F02I 3V6OE 1F2QA 1NBQA 5DJ0B 3RRQA 3IDMA 2WUBH 3BUTA 1QFWI 4YHPB 3S5LG 1OAYL 5JLZB 1JNHB 1OB1A 2HG5B 4YXKL 3B83A 2VUYA 3RWFB 1JYNA 3QQ3A 5EBWB 4XCCH 1HH6B 3SOBL 4N0FA 4LHUB 3FQXA 2K7QA 1KLGA 2XZCH 4E5XB 1KN4L 4JAMA 1J0JA 5DJ6B 4ODSL 4Q6IC 5GJSL 4IHOB 2CDFB 1AH1A 3MV8B 3ZDZF 2HN7A 2OMNA 5FO8A 5B39G 3CFBA 2NY2B 1IARB 3ARBB 3UO1H 1UCTA 3UTSE 4K8RC 4V1DE 1QBML 4FZEL 2EH7L 4PGCB 2KQNA 4XCYA 2HRPL 3FB7A 5ECJE 5C0DB 4H8WL 3HAEA 3NCCB 4P46B 1EEUA 3TA3C 3VXOB 35C8H 2IG2L 4WW2F 4NN6B 4Y19D 32C2B 5I1HH 3SGEH 3SGDH 3SGJC 3VXSD 5LWYH 1JZ2A 1R5VA 5CHNA 4OZGE 3GRWL 3IETA 3OTTA 1YYLL 1NUFA 4L4VB 25C8H 3B9EA 4MZ3A 3U83A 2Y36L 4GJTB 4XBGA 4MAYC 4X99A 3ZKQD 3F7RA 5LKNA 3UTPD 1G7JB 2P7TB 2X4QB 4YHZL 4RMSA 5I8KH 5IMOB 4PRIE 1VA9A 3HPJA 3T0XA 5CJOH 2BVTA 1C16B 4JFFA 1KJ2H 4MXWL 3DYOA 3QI9A 4KVNH 4I13B 1MHPL 3E2HB 3CK0H 1L9NA 4F80A 3SGKA 1SM3H 5EOTA 1DUYA 4DKFH 3HUJF 4NKMA 1AP2B 2J88H 1FJ1B 2YPLD 4TPRL 4R4NC 2ILLA 3D39B 3I2CH 4XP5H 1HHHB 4Z8FL 4HXBL 3ZTNL 1ZHLB 2OBGA 4RA3A 1K5NB 3A6CH 3MLXL 1A2YB 3LRSB 3VXQA 1U92A 4HC1H 2DLFL 1AKJB 5K9OA 4PRDB 4K9EL 1A6PA 4Q6IA 3RIAF 1EUUA 4BQBA 4P23B 2LU7A 1I3VA 3QDAA 1M71A 1TTFA 1NEZB 5ICZB 5MHSD 3BZEA 3UXFA 4IRSD 1BM3L 3O4LE 4N0UE 4OZFG 1R5IB 4P2QA 1JNLH 4YXLH 1MCRA 2V7HA 3QFJD 3FONA 4P57B 3B3IB 4F57L 2A6IB 3SY0A 2IJ0C 4MQ7A 5I17B 1NFDA 4JRYE 1T1WA 1BFOA 5TQ0L 5F3BB 1PKQE 1J8HB 5GRUH 4LU5H 4NQED 3NAAL 2HKFL 1G7QA 4U1KA 5JDSA 1S9YA 3RVVD 2LABA 2D7NA 1OWRM 3GZKA 1ZA6B 2G5BA 1AJ7H 3TO2B 2GQHA 1CK0L 1RUQL 5DMYA 2GSIB 4AK1A 2B1HL 1CS6A 4OLYL 1BIIB 3W9EA 3HMXL 3PXHA 4WY7L 2Y4SA 2CDEA 4O9HL 4JFZH 4GRLC 1WZ1L 3C60D 5HI3C 5J3HD 4XVJH 5EZLB 1T22B 3KPSE 2LVEA 1MRFL 2XWJA 2NTFA 3EYSL 1I7UB 4Y4HB 2XNAA 3F7YA 4PJ9D 4WWKD 2DM3A 4WUUB 3WDIA 4HPYL 5EUOE 5TJWK 3UJTH 1YPZA 4GSDH 1QLRA 1J0IA 4H5SA 1ND0B 1WWBX 3F8UB 4A2LA 3FFCE 1FVCA 1FDLL 2K3TA 3MRPA 3UBXB 2XTJB 3MACH 3B5GA 2R2HA 5DA4A 1BAFH 4Y5YB 4JZOB 1OWWA 3ARTA 5C0FA 2D7TL 1PQZA 3G6JB 4W6YB 4QRRA 2BXYA 4BELD 2AK1L 1KCUH 1JF1A 4NGHH 1MRCL 3T3ME 2IALA 2OQJB 1A6TB 4X80H 4H25A 3CH8A 3O2DL 3BIKA 1ZVSB 1FCCA 4HMDA 4JN2B 1HOCA 4XAWH 3KVQA 5HXMA 5K9KA 1U2CA 4YFEA 2WBJD 3W11D 4YPJA 1RZGB 3TNNB 3WFCL 5KS9A 3WUWA 2VH5H 4UILL 5ISZE 1H9VA 1V7MH 1Z5LA 3ROOB 4TULH 1JPTH 4OIIL 3KLSA 4IOIB 2IGFL 3P77A 5IHZA 1XCQA 3HFMH 5IJVA 4RGNB 3QO1A 5KSAC 5IMMA 5EFIA 3RGHA 4GKSA 3CFKB 3SKNB 1RVFL 2QHRL 3NN8B 2X7LB 3S88H 1VGKB 2B39A 2EDNA 3ESVF 1MQ8A 4L29A 1KC5H 5HHOD 2MKWA 3GBNH 1QR1B 3GHBH 1DVFD 1P5VA 5CFHA 4HWNA 4LPYA 2VTFA 4OSUH 1CDCA 2XY1A 4NKDA 3FO1A 1DQML 1BPVA 2E9JA 2HAZA 3ET9F 3O11B 4PJ7E 1RJYA 3NPZB 1N2RA 4X9FA 3LY6A 4AT6A 3DSFL 3HAEG 5BJTA 3FT3B 1LO3L 1T0MB 4PJFB 4PY7A 4OF0A 1F8TH 5EUKA 3C9NB 3LKOB 2A74B 1TETL 3KLDA 3QJFB 1FH5H 3PWVA 3RX5A 4MD0B 4ELMA 1IAII 1CDIA 3DSNA 1ZLVH 3MC0A 1U8PB 1XGTA 4C57C 1JNNL 4NC1C 4XNUL 5DWUL 2NY3D 5E99H 1JI1A 2HH0H 3JWNC 4XP4L 1B3JA 2CLVA 3M1BA 1Q9OB 1LO4L 2APWA 3HZMB 3V52H 1CTOA 1L0QA 2W92A 3RZCB 4JANB 2N4IA 4R3SA 3TJHC 3D69A 5BMFL 3BPOC 4YIQB 2HP4A 4TVSa 5IMLB 3KPQB 3PABB 2WBWB 4TNWK 1C8PA 3HE7A 3SCMC 4POYA 3WNLA 4G7VL 1G9MH 1MCPH 4PRHA 1EO8H 3ARWA 1TCMA 3D9AL 5IM7A 3VCLA 4Q0XH 3EOTL 1U8KB 4OFYA 4OLZH 4X7SH 1YEKH 4RMTA 3OHXB 2R4SL 1Q0YH 2YPKA 4XVUD 5T3ZD 4F7EA 1C12B 2DQUL 2SEBA 5FKAB 1BZQK 3FB8B 2EYTB 3RKDC 3T0EB 1YMMD 5CIPA 3BW9A 2MHAA 2IADB 2GFBA 4NM8L 1KSRA 4AIZA 3BZFA 4GG6A 3H3PH 1ZHKB 2DQDL 4XNXL 3HNSH 1HDMA 3HB3C 1U6AL 5TPWL 4S10A 3P40A 1MJUL 4OV5B 2ICWA 2CK0H 4JZNA 3HLAB 4JKKA 1G0XA 4XVSH 3PP3K 3HR6A 1KBGL 4JY5H 3VGFA 4ZTPL 2HFEB 5EZJA 4LHJB 3ALWA 3B9DA 2OYPA 3QULA 1KIQA 3TBYB 3NZ8B 4G6AD 3HZYA 4K71B 1LO2H 4Y19E 5FYJH 4Y8DC 2O93L 4F9LC 3H6JA 1QFPA 2OMBA 3VXSE 4PUBL 1FFNA 3RUGA 3MODH 5HYJA 3ZE1F 5L2JB 4GKOA 4UAOB 2NY4C 4I2XB 5T1KA 4U1SA 5A40E 3HZKA 2H26A 5DSCA 5FGCE 4DZ8A 1IM3A 4DGIH 3B43A 1M7DB 1BGXH 3OF6A 3UTPE 1RZKL 4HS8L 4JKPH 4DZBB 3SCMA 2VISB 4ZXBA 3RNKA 3ARRA 4KDVA 4HD9A 1TZGH 1R3JB 3TO4C 1E4WH 1KPRA 4L8CA 2DAVA 3MUGB 4IRZL 3SDXE 2F74B 2DWEB 2HVJA 3TT1L 3NCMA 1FFPB 1KIPB 3P4MA 1FVDA 4LSRL 2YPLE 2J6EA 4WIQA 3QPQD 3PL6A 1KJVB 5CILH 1N7ML 2X1XR 1MJ8L 1XF4B 1FPTH 1D6EA 3S8WA 2Q8BH 2FCBA 1AGDA 4ZUSA 4KGJA 3C6SA 5IBLD 4UB0L 1G9MC 4O51B 1T80A 3LN9A 1OT2A 2JJTC 5MHSE 1QP1A 1A4JA 1BHGA 1QR4A 4MNQA 2NXZD 5DJZB 4R2GB 2DMKA 1RU9H 4DGYH 3WUWG 4KJQD 3QFJE 4NO3A 3D2UB 4JFDD 5IHBA 4LFHD 5D7SL 2VXTL 2HT3C 2R2CA 4LGSB 3G6JF 4K94L 3MRCA 1AGEA 4AM0B 1TMCB 7FABL 3KDMB 2FO4A 4Z7UB 2BNQD 4NQEE 4HBQA 1XT5A 4M8QA 1FL3A 4JLRB 1RK1A 4QHMA 4PJ5B 1RJLA 3ARFC 4L4TB 1A7PL 3P4NB 1DBBL 1WIOA 1LD9A 4JG0H 3W82A 3Q5YA 1HZHH 4ETQA 4ZAKB 5BO1H 2AJVH 1A0QL 1FLRH 3GJFA 5SWSD 5AAWA 7CGTA 1H3GA 5I66B 2L7JA 3K46A 3RWHA 3TV3L 1MFBL 1I3RA 1WFTA 3IT8D 3CSGA 1NLDH 2ARWA 2WWKT 4WHCA 2PYEB 1F3JB 1WSST 2J4WL 4ZDHB 3IRPX 3FCTB 4FQJL 4M7ZC 1Z3GH 5EIIB 3OXRA 1RZ7H 1UJ3B 5C70A 1YQ2A 2V9TA 4F2MB 1LQSR 2X10A 4HZAA 1UEMA 3QIUC 1I9IL 1H3VA 1YNKH 1JGLL 5KN5A 1YEJL 3V4VH 4FXKA 4ZTOL 4YX2L 3TESA 4PJ8C 3GSQB 2COQA 2QKIA 3UZEA 3CFIC 2B4CH 4Z5RA 1VPOH 3C8KB 2JJTA 4PJFF 2AEPL 1IBGL 2A6KB 2HMIC 2FATL 5EZOL 4KDTC 3X14B 5C0NC 2HFGH 3E3QE 1S78C 5C86A 2AXGB 1T04B 2EDRA 2FX8H 1CFTB 2FGZA 2XPGB 4PD4K 1T1XA 2NYYC 4UQ2B 3EFFA 4S1SH 1YEFL 2W38A 1BJMA 5T5NF 1UXSA 4I8DA 2ERJB 5GISH 3ZO0A 2R8SH 4GT7A 2D7MA 5HGGS 1TQCB 3VFGH 1XGYL 4NKQB 5ID0A 1HN1A 2A9NH 4M7LH 5F9WB 1ZTXH 3AAZA 5EU7C 5DI8B 3PQYD 1KF9B 5DJAB 4XH2A 2YXFA 3ARFA 1XGQA 1UCBH 5D2NA 1EXUA 3BYTA 3TVMC 1T1YB 5IB2A 4LLQB 4WFFD 5FUCE 5HHOE 4UIMA 2R1XB 3OJVC 4K55A 1OAZL 3MLYL 4CVZB 2XA8L 3VXTA 3SDCB 4MWFA 2BHZA 1N3NB 1P6FA 1ZE3C 3KPNA 5H8DA 5JMRA 4GQPH 2BFVH 4ZUTB 3TN0C 3PWUB 3WLBB 4Q97A 1DUYB 4U6YA 3BESR 1NC4A 3DGCR 2R1YA 4MB3A 4OLUH 5C0BB 1AGBB 2NX5D 1BMGA 3WS3B 4AH2A 5F6IC 4KJWD 5TDOB 3RA7L 3KPOA 5DUMH 3EO1B 5GGTH 3MROA 4Q6IB 4DAGH 2AS5M 1FL5B 2VL5B 3WKMH 5CZKA 1VDGA 2R4RH 3CDGA 4WWID 5SWZD 5SWQA 1JGEA 1W72A 2FHFA 4X7CC 5ILTH 3T1FB 5HVWA 3P3YA 3S34H 2DF3A