3QPKA

Probing oxygen channels in melanocarpus albomyces laccase
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
559
structure length
559
Chain Sequence
b'EPTCNTPSNRACWSDGFDINTDYEVSTPDTGVTQSYVFNLTEVDNWMGPDGVVKEKVMLINGNIMGPNIVANWGDTVEVTVINNLVTNGTSIHWHGIHQKDTNLHDGANGVTECPIPPKGGQRTYRWRARQYGTSWYHSHFSAQYGNGVVGTIQINGPASLPYDIDLGVFPITDYYYRAADDLVHFTQNNAPPFSDNVLINGTAVNPNTGEGQYANVTLTPGKRHRLRILNTSTENHFQVSLVNHTMTVIAADMVPVNAMTVDSLFLAVGQRYDVVIDASRAPDNYWFNVTFGGQAACGGSLNPHPAAIFHYAGAPGGLPTDEGTPPVDHQCLDTLDVRPVVPRSVPVNSFVKRPDNTLPVALDLTGTPLFVWKVNGSDINVDWGKPIIDYILTGNTSYPVSDNIVQVDAVDQWTYWLIENDPEGPFSLPHPMHLHGHDFLVLGRSPDVPAASQQRFVFDPAVDLARLNGDNPPRRDTTMLPAGGWLLLAFRTDNPGAWLFHCHIAWHVSGGLSVDFLERPADLRQRISQEDEDDFNRVCDEWRAYWPTNPYPKIDSGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Laccase-1
publication title Probing the Dioxygen Route in Melanocarpus albomyces Laccase with Pressurized Xenon Gas.
pubmed doi rcsb
source organism Melanocarpus albomyces
molecule tags Oxidoreductase
total genus 177
structure length 559
sequence length 559
chains with identical sequence B
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2011-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3qpkA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3qpkA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3qpkA03
2GIMA 2JFCA 3T9WA 1XB6A 1M56B 3V9EA 2GSMB 3DTUB 1CYWA 3EH4B 2XLLA 1DZ0A 1FWXA 1I53A 3ABMB 2ZWNA 1L9PA 1GW0A 1MZZA 1NIEA 2X88A 3KW8A 1OE2A 4Q8BA 4Q89A 2N0MA 1AACA 3N55A 2H5UA 1HAWA 3NJLA 4A68A 1AS6A 3EH3B 3FPYA 1OCCB 1PAZA 2TSAA 2OCCB 4KO9A 1KYAA 1OE1A 5LDUA 1GSKA 5AKRA 3NP4A 2VW6A 3NJHA 2HZHA 1ID2A 2FWLB 1N70A 4DP5X 1E65A 2PPFA 1AR1B 1URIA 2W88A 4CSZA 2XYBA 3D12B 1A4BA 2QPEB 4A66A 3GYRA 2VM3A 1KBWA 3WG7B 2IWFA 2IDQA 2EIKB 4CSPA 3T6XA 1BQRA 1A65A 3JT2A 3ZX1A 4DPBX 3GXUB 4A2EA 4DP0X 1MG3C 2A3TA 4YSEA 5I6MA 1YLBB 3L45A 3UADA 1SJMA 4YSTA 1J9QA 1JVLA 4G72B 1UATA 2XX0A 1BYPA 1NDTA 2PPCA 2BO0A 3NSCA 3QJRB 1EHKB 1E5YA 1BQ5A 2RACA 2DV6A 4YVUA 4YSDA 1J5DA 1HFUA 1R1CA 4A2DA 3X1NA 3PAVA 2PCYA 2UXVA 1PLAA 1J9SA 1IBZA 2EIMB 2GC7C 2VSMB 2XUWA 3NSFA 3IE9A 5B1JA 4DP7X 2XWZA 3H4FA 3NJKA 4E9WA 2XV2A 3ERXA 1CYXA 3H4HA 4HHGA 1HAUA 1OCRB 1OOWA 4F7KA 5I28A 4E9YA 1IBYA 1JZGA 3PAUA 3PCYA 3RYMA 3DIVA 2DWTA 4E9QA 3QJVB 1WA0X 1DYZA 1QNIA 1NIBA 5B1KA 1ZDQA 4AKOA 2FJSA 2R7EA 2YAFA 5A7EA 3WI9A 4E9SA 2FT8A 2AFNA 1KBVA 2MRYA 2XVBA 3FT0A 4BXSV 5F7BA 2YXWA 4A2FA 5I5JA 1PLBA 3NP3A 4YSCA 5B7EA 3U25A 4G7QB 3FS9A 3ZBMA 3EHBB 1JXFA 1SHWA 4BXVA 1AG6A 2IWKA 2YAPA 4KNSA 1AZRA 2CJ3A 4E9VA 3X1EA 4F2FA 1A4AA 1MZYA 7PCYA 4KO6A 8PAZA 2GHZA 2UX6A 5I26A 3FQYA 3HEIB 3FYEB 4G7SB 2WSDA 1GY2A 2XXGA 2J57A 3OM3B 4DP9X 1F56A 1GR7A 4E9TA 3QJQB 5IY5B 3CVBA 1TU2A 1BQKA 3SBPA 2MTAA 1ADWA 5D4HA 1JVOA 1XB8A 2VMJA 2B08A 2HX9A 2OJ1A 4QKTA 1B3IA 3S3BB 4YSRA 3FU7A 1PZAA 3T71A 6PAZA 3EF4A 2P80D 3NSDA 4KNTA 2XU9A 2B3IA 2YQBA 2PP7A 4UANA 1BXUA 2PPDA 1MG2C 3X1FA 1WA1X 2FQGA 4AI7A 3FQ2A 1PMYA 2HXAA 3OMIB 3UGEA 1L9TA 3TBBA 4DP8X 1N68A 4DPAX 2I7SA 3ASOB 3FYIB 2J55A 3X1GA 1AZNA 2CAKA 2IDSA 5I6PA 3UAAA 2QT6A 2Y1AA 1WA2X 1QHQA 1WS8A 3MBWB 1PCSA 1OF0A 1A4CA 3IN0A 2FTAA 3CG8A 3FSVA 4YSUA 3AG4B 2IDUA 4YSOA 2I85A 4HALA 3SBQA 3WKPA 4E9XA 1SHXA 4YSSA 7PAZA 2AZAA 1PLCA 2FT7A 2QPDB 4HCIA 1L9OA 3SQRA 3NJJA 4KOCA 1OE3A 2FT6A 2Q5BA 3PLYA 3T6VA 2BZCA 3AY2A 3TBCA 1SF5A 2NRDA 3AZUA 3FU9A 5TK2A 4M4RB 2AANA 3S8GB 2VM4A 3CVDA 1AQ8A 5PAZA 3N2JA 5I5MA 4P5RA 5I6LA 3PPSA 1JERA 1RZPA 1AZCA 1SF3A 3S3DB 4ENZA 2PLTA 2IH8A 1ET7A 4GP4B 1NICA 2GB2A 3AG3B 2XV3A 2QDWA 5D4JA 2BP8A 3C75A 2OV0A 4L0PB 1V55B 4N4YB 1AOZA 2J5WA 3H56A 1VLXA 4M3HA 1ILUA 4BWWA 4YSQA 1BAWA 4HCGA 1GS6X 3NSYA 1NIDA 3IN2A 3ABGA 3ASNB 4HAKA 4WTQA 1SDDB 4KO7A 3CDZA 2YARA 5E9NA 1NPJA 1KDJA 1JXDA 3FU7B 1RZQA 3BQVA 4W1TA 3S3CB 4DP2X 1NTDA 3V9CA 5I6OA 4NB7A 2YAHA 4P5SA 2FNWA 4GXFA 4BDVA 1EZLA 1ZDSA 2H47C 4KOBA 4A67A 3ZDWA 3BVDB 1TEGA 4A2GA 4FAAB 2EIJB 2PP9A 2I7OA 1W6LA 2GI0A 2WO2B 3NJFA 1PNDA 2E86A 4WKXA 5TK4A 2IWEA 2BW4A 1IUZA 1PZCA 2FQEA 4BWTA 1KCWA 3NJGA 1SNRA 2ZXWB 5PCYA 2P80A 3FSZA 1L9QA 1IKOP 3DKHA 4UF7C 2XX1A 1ASPA 2J56A 5AZUA 1KGYE 3IBOA 1AS8A 1ZV2A 3JTBA 4HZ1A 4MFHA 5B7MA 1TKWA 3GDCA 1JZFA 3SBRA 1KCBA 3AW5A 4G7RB 3X1BA 2TSBA 1M9WA 1M57B 2UXTA 3T6ZA 1NZRA 4DP1X 1IC0A 1OCZB 2BWIA 4F2EA 4AX3A 2YXVA 1J9TA 4W9ZA 1JZIA 5FC9A 4YL4A 5B1AB 2CCWA 5EHFA 2HX7A 3CZUB 3MX0B 1NPNA 1W6WA 2H3XC 3PXLA 1X9UA 1ILSA 2X87A 1FFTB 3HB3B 1BXAA 1BXVA 2VW7A 3ZIYA 1J5CA 1RCYA 2IH9A 2PPAA 3QQXA 4G70B 3WNIA 4AKQA 1OV8A 1PF3A 2CALA 2BP8B 1XB3A 3CVCA 1AANA 2WO3B 1NIFA 4GP5B 1PNCA 3UACA 3ABLB 1GY1A 3NYKA 5I5IA 4BWUA 2HRGA 3TA4D 3NJIA 4NAJA 2BZ7A 1V54B 1XMEB 2YAQA 4E9RA 1CC3A 4GYBA 1E5ZA 1KDIA 3CDZB 3IEAA 4AKPA 3UABA 3PAZA 5ANHA 3TU6A 2HX8A 2LLNA 1V10A 2DYSB 1A8ZA 2R7EB 4BDVB 3NJMA 2BP0A 1L9SA 2CBPA 3KW7A 1TEFA 4K9JA 1GYCA 2IDFA 5B3SB 3OD3A 2UXGA 1L9RA 3EH5B 1ET8A 4YSPA 2EINB 1BYOA 5I6NA 1QLEB 1T5KA 1AAJA 4X4KA 4N8UA 3X2QB 1ASQA 3QPKA 3WKQA 4NERA 2JKWA 1E30A 1NWPA 1GS8A 4UAHA 2QDVA 4JKNA 5D4IA 3G5WA 1AS7A 2BHFA 3AG1B 3FU8A 1AG0A 1AIZA 2XV0A 3QJUB 3NJNA 4QLWA 2HRHA 2VW4A 5B1BB 4A2HA 1ASOA 1NWOA 2Q9OA 1GS7A 1JZEA 1PZBA 1SFDA 2FQFA 2IDTA 4HIPA 2GC4C 1W8EA 2DYRB 1J9RA 1CURA 2DY2A 1ZIAA 3S8FB 3ABKB 2YAOA 3FSWA 1ZIBA 2UX7A 4G71B 5B1JC 1JXGA 2PP8A 1WAEA 4DP4X 2PCFA 2BWDA 1E67A 2HLEB 4YVNA 5AFAA 2FQDA 1ZPUA 4EF3A 1WS7A 1BEXA 4PAZA 1X9RA 4KNUA 4ZK8A 4KO5A 1ETJA 4YSAA 4TXVB 4JHUA 3OMAB 2XXFA 3OQRA 1NIAA 4HCFA 2VSKB 2YAEA 3TASA 2Y69B 3T6WA 2CUAA 4FA7B 4PCYA 1SFHA 1MDAA 2UXFA 1JZHA 2AVFA 1JZJA 1A3ZA 4DPCX 1FA4A 4DP6X 3QJSB 1RKRA 3NT0A 1CUOA 1JOIA 4RH4A 4BK5C 4GP8B 2EILB 2ZOOA 9PCYA 2DWSA 4JHVA 5I6KA 2GBAA 5B7FA 3WIAA 5F7AA 3FPXA 2AZUA 4GY4A 1OCOB 1NINA 3AG2B 2BP0B 3UAEA 4HHWA 1ET5A 1KV7A 3WNJA 2BW5A 1AZBA 2W8CA 3OMNB 2ZONA 6PCYA 1AZUA 3FQ1A 4AZUA 2JXMA 2VN3A 3FSAA 2PPEA 2YAMA 3QJTB 2IAAC 1SDDA 1PY0A
chains in the Genus database with same CATH superfamily
4JFPB 3QI9C 5G4OA 1OB0A 4PH8A 3QWQB 1PKQB 4PQXA 4Z7WA 2WVVA 1RJYB 1J12A 5I1GL 2V2WB 3FQNB 4FLRA 4HC1A 3KH4A 2ID5A 2NXZC 2ZTBA 4HIEA 3F62A 4OGXL 3UG4A 1I7ZA 5JO5B 1INDL 1YEWA 3LQAL 4XB7A 2DD8H 3U30B 4F3FA 5DD5L 4NQXB 1QSFE 2OX5B 5CHNA 5F2FA 2WUCL 2EACA 3WKML 4EUPG 2QHLA 5GSVA 3HKZA 1JNNL 3DI2B 5IK3A 5DRNB 4YFLF 4ERSL 1X7SA 1K8DA 1SHMA 4L1BA 1IAOA 1QZ1A 4PD4J 4LK4A 5JYLA 1JDDA 4JHWL 1HOCA 4GO9A 3VWKD 3ZTCC 2VW6A 5IBTL 1RHHA 1BPVA 3L7FB 3HC3L 3NTCL 3TX4A 3CSGA 1WDAA 3C5JA 1CYGA 3LKRB 3MOAL 1JUFB 2WQAA 4PS4H 2ZPKL 4X80H 2IQAB 4MASA 1S7VA 1HKFA 5I6XB 3ZYJA 2BCMA 3QZOA 3BJ91 3CZFA 3GHEH 2NNAB 4NRXB 4A2EA 1DR9A 1I31A 2FJHB 2H32A 2NZ1A 4MD0A 2Q87A 2AERT 3JUYA 4HC1L 3IJEA 4WEMB 3L45A 3PXJA 1LP9A 5F1NA 5TTRA 5DLLA 3EW3B 2O26U 2W94A 1FH2A 1FC2D 5C2UB 5BV7B 4AVIA 2ZCLH 1MCSA 2UVFA 4PRBB 2ARJA 4LCWD 1QSFB 2ZKHL 4JM0A 2R2EA 5JORA 4IIQB 1GTFA 1KTLB 4GBXA 4ZO6A 2JQMA 4JG0H 3JTTA 2CIKA 4KPHL 3RKDD 1MCLA 4GS7B 1JP5A 2BNUA 3UO8B 3BAKA 3R0NA 4B9YA 2JJTA 1A6VH 1ZT1A 1TETL 2YUXA 5JDSA 4ENEC 5EU3B 4F7KA 3L1FA 4OGYH 4Y9FA 1HILB 4ZS6D 1RLWA 4LKCA 5F9OH 1T1WB 2VR8A 4FHJA 1Z1WA 2UWEA 2RAMA 5C8JB 5J8OA 2P42B 4PJGE 1BBJA 1CFVH 3L5XH 3WKNA 5LNDA 5GS1B 3LN9A 2QGBA 3VH8B 3MRBB 3FTSA 3NP3A 3VD3A 2ICWB 1YEEL 2IGTA 1O7VA 1RSYA 1WAAA 5FYKE 1N64H 4OLXH 5C0JA 2H2PD 2VDMH 4QKXB 5FYLH 2BP5M 3HNTL 4NBYB 3HMWL 4HV8B 3EYVB 2R0KH 1MJ8H 4ONGH 3QEHA 3UZQB 5JHLH 4DEUA 1IGIH 1ZEAH 1QQDA 3H7LA 2WB1A 5IMLA 1U4FA 4LHUG 1N5YL 3SE8H 4MCYA 4ZRGA 1A3QA 4NDMB 3RWHB 5D1QA 1NOLA 3G5VA 2IC2A 1XH0A 5D4HA 4OJDH 3TC9A 4LASH 2B08A 3DX8B 3V0DA 4B0MM 3S3BB 2P24B 2WWOA 2AJXH 1TZ8A 1U8HB 3IXTB 5JHAA 1I4FB 4TQHA 4CADA 2UUDH 4KNTA 4GMSH 4OLWH 1GZPB 4QHNA 3L3KA 2ADFL 3VM7A 2DWXA 4MZ2A 4BCXA 3LSOB 4MDJB 4CU7A 2FYVA 4LSSL 1NFDF 2L4OA 5DVMA 3DGGB 4IBYA 4S2SA 2WC7A 3VJ6B 1U8NB 1GCYA 3BQUA 4LEXH 4WK4B 1QSFD 2ERJC 5E2TL 1E2VA 2AEPH 4P5KB 3SD5A 3MLYL 3OKNA 4Y9EA 4P0DA 2IDSA 2FIKA 2HG5B 3RDTC 3UAAA 1R3HA 2CPCA 1BSIA 4FG0A 1KTBA 4WU5B 1OF0A 5LKNA 3UPCA 2BCKB 1MI5D 2WZAA 3HS0B 4QIRA 3D0LB 4PB0L 3EJYD 1MCCA 4GXVH 5DD0L 2PCFB 3LYRA 4HALA 3QDHA 5CSBA 2VDLB 1AXTL 2AVGA 5IHUL 1ZHBB 1X5AA 4ODTL 5L7XH 1CK0L 2XOTA 2D03H 2QKSA 1LDPL 5IJCC 2Q8BL 3MRMB 3CFCL 3AY2A 1OM3H 3K74B 3JWDC 4BINA 5L4FA 4K0OA 1AGFA 3OR7B 3FQRA 3EDKA 2VR9A 3VB9A 5F7NC 5KSAB 4Y8DC 1DUYA 3QDGE 4LP8A 2X7LA 4G7VH 1Q1JL 4JCWA 1A14L 2EDYA 5F7WC 5AYUL 1U30A 3JWNE 3SPVB 3SPGA 5BOZG 1AQHA 3GSNA 1ET7A 2IH8A 3GSUB 3KBEA 5LCVH 3E8UL 5BW7A 3JYCA 2QDWA 4ODVL 2ZP8A 4EDXA 4H25A 1YJDH 2WMPB 4U3HA 3WTVA 1JK8A 1JWMB 2EH8H 3E1F1 5D7IA 3RA7H 2EAEA 1XZ0B 4LPWA 1AOZA 2WKGA 1J1XL 1DSYA 3Q8BA 1SM3L 2WXPA 3CCHA 4AY0A 4TKWA 4OCWH 1A3LH 1T20A 3LXAA 5E5LA 5GZOA 5GZND 3QYNA 4K23L 4F20A 1BAWA 4HCGA 2XFXB 4ZPTB 1EHAA 1LE9A 2R0WH 2VUYA 3DOSB 5BQDA 5M7QA 3R0MA 4BV1A 3CVHB 3OKMA 4APQB 3PIQA 3CDZA 1J5OH 1EDYA 3WD5H 3FCBA 5GGSB 1BVNP 3NEOA 4P46C 3WV0A 3BUDA 3KPNB 1Q72H 2GTQA 5AL0A 1L7IH 1HU8A 1W9XA 3DGCR 4NB7A 4JG1H 3P2DA 4DH2A 1BDYA 1K6QH 3QPXH 3FN0H 4GINA 3ZDWA 3RPIA 4QRQA 1TO4A 5DRZA 1PL3A 3HE6C 3PWLB 3QS3A 4HD9A 1W6LA 3QDGB 4E42A 1OD7A 3NJFA 4PUBL 4R5TA 1RJZA 3W11D 1EJ8A 5DDHA 1EBAA 3H7BA 5I15H 2IWEA 5FYKD 4DJMA 2HTLD 3C5ZB 1GW6A 4D0BB 3NJGA 3CXDL 3UZVA 4F8NA 1UJ3A 3WO4C 2OLDA 2J56A 3JSSA 5A16B 4Z3EA 4ES8A 1QA9B 4YHMH 4MNGA 3VFTA 3S97C 5HVHC 4HXAL 3MCKA 4JFWA 4QRUB 5I30H 4XVOA 2HVJB 3X1BA 4G7RB 4U1LA 3IDGB 3NK3A 5HGDB 3S9DB 3II3A 4NRYB 2UXTA 5DRXB 1USQA 5EOTA 3O6FB 3VU2A 2BWIA 1QLEH 4PWKA 4QRPE 5JIPA 2NY6C 3MR9B 2J20A 1PZDA 2NY3B 4P2RA 1E8ZA 3RY6C 5FUOH 3SGKA 1DQDH 3INUL 1UM5H 2BNRE 5F3BB 2V3FA 2QV4A 2HX7A 1T0MB 4XE0A 2QELA 2E7HA 1ZT4B 5KSAD 4G11A 5DJ2A 1X9UA 2YEZA 2X87A 4QWWC 3OJ2C 4N2NA 4LSDA 5C7XH 4PSRA 1I82A 3EFOA 4HUKB 1U92B 3IDYB 5GGSY 3SKMA 1HHHA 3DDFA 2MNJB 3ZIYA 3ULVL 4FG2A 2BVEA 2AXHA 5IV2B 1ROWA 3C2AL 1CBJA 2J71A 2E7LC 2CALA 2VJ8A 4ZTOL 5ADPL 5I1HL 3T2QA 4NJAL 1NIFA 4WHYG 4GUCA 1P84K 1PQZA 4FCHA 3B37A 3ZGIA 3VM5A 1C5BH 3V5HA 2ICWI 2DEWX 3KLHD 1HZHH 4X6BB 2BZ7A 3DHJA 4F8LA 1MWAH 5FX3A 4XAWL 5L4MA 3FB7B 4L37B 4RA3A 1AGDB 4Z7AA 5KSVB 2COVD 2V9TA 5M95B 4APQD 5C6PB 1J8HE 4GW4B 3ATFA 5EZJA 4L9LB 4A7VA 4JKWA 3Q9QA 5EOCL 4MJ5B 4XMKL 2F74B 5LGJA 3UZEC 1GOFA 2ZOWA 4WHDA 2BNRB 2YD6A 4UTAA 3D07A 4WO0A 2ADIB 4ODBD 1TEFA 4MXQD 4NM8L 3SKNA 3F7RA 1KT2A 1Q0XL 1WP6A 4UWQB 4UDUB 1Z9SA 4N2HA 1BVLB 1KTKE 3EHBD 3ESMA 2A2QT 4DCQB 1ONQA 1YPZE 3C5ZD 4LVHB 4I88A 3HZ3A 2JJSA 1S7WB 1GGUA 4JKKA 4X6DE 2X4TB 4J3BA 4Z3HA 3OLEA 4X7FC 5ID1B 4OLVH 2WKOA 3MUGB 4G1EB 1AGBB 1SMAA 1JV5B 1CLCA 4R3SB 1AG0A 3L9RB 4XMWA 3FL7A 3TEWA 4JM2A 1AD0A 1EAJA 2VW4A 1LK2B 3O6FD 3U46B 4GAYB 1UXSB 2APFA 3K91A 2X40A 3UL4A 3WMPA 3NRFA 4JR9L 4TUJA 1IFRA 2NY3D 4ABVA 2FQFA 2NX5E 2MKLC 5K1VA 3ZMNA 1J8HB 4N2AA 4KJYA 4XP4L 2AI0L 5D2NE 2KZ1B 4GKSA 3TT1L 1CE6B 2GIXA 4NCC2 4Y2DB 1ZIBA 4MD4B 2M2DA 3P0VL 4ODWA 5ICYB 4YK4B 2O5ZL 5F6IB 2WNKA 4UTAL 4ISVB 2X4OA 4DN3H 1S7QB 1TJMA 3V0WL 5I1JL 3VA2C 4KUCF 5IB2B 1ZPUA 3JV4A 1V8HA 1WS7A 3OZ9L 1EJOH 4H7VA 1H5BB 1WE5A 4QRSA 5C7ZA 4PJCE 2GJRA 1PW3A 3A4FA 4QYAA 5CP3H 4K2UL 4ZQKA 4V1DE 5EZOL 2G5BB 3OMAB 2ED8A 2A74C 2IANE 1YPZB 1E5UI 2RR3A 4YHOL 3MV8A 5IVXA 2A7BA 2HKAA 4ZFOL 1MAMH 4NUJB 4KJWC 4N85A 5C0AB 2WZPD 4X6DB 1UOVA 4R84A 4OFYA 2W65B 4GRLC 4AUYA 4OKDA 2VL5B 2HT2D 1FFOB 1QFHA 3MNWA 5DO2D 4FJYA 5EBWA 4BQ6A 3TVMA 3QUXC 5E00B 2Z6FA 3C6EA 4QRPD 4RH4A 4JX0A 4Q6IC 3MRFB 3NABH 3WIAA 5D71H 2NX5B 3HPLB 5AW9B 4MCNA 3LH2H 1K9TA 2BNRD 4J3TA 5D2NB 4XPGL 5D96B 3TTSA 3I6GA 1FIEA 1FYTA 4OIAA 1N0XH 3UTTA 5IW6B 3FSAA 4FNLH 4Y4HA 3PHAA 1E5CA 3SDDB 3UJIL 5FUCE 3QJTB 5LBSH 5I17B 2YGPA 2ZYIA 4N1CA 1UM4H 1C1EH 4ORGB 5HHVH 3V9EA 3A3YB 1AXSB 4PJCB 4XOBA 4AYFB 5EH1A 4V1DB 1OQXA 3GB7A 4ZUWB 2A5UA 3WIHA 2P8PA 2X88A 1UH3A 3KW8A 3QH3A 3QQ3A 4J1UB 5ACMA 1I7RA 1V3MA 2LGNA 5C0BE 5I8OL 5IB1B 2JELL 4I13B 4UNVA 5A6LA 3VH8G 1NMBL 3WJLC 4G8GA 4JL1A 1IVTA 4AIZA 3N3EA 1NDGB 1BF8A 4P2AA 1S5IL 1A4KB 3UG3A 1URLA 1J8HD 4J3OD 2X4SA 4YZFE 4HZAA 1UEMA 4KXBA 2APSA 3QIUB 4Y2DD 1MRDL 3IDJA 1U8KB 2EDFA 5GRVK 4B9IA 3MBXH 3O9WD 1JGDB 5DK0A 2CRYA 1BG1A 1WH0A 1XO8A 5EO9A 4TLSA 3FTGA 4WUKH 2BERA 3H3BC 3CWGA 3IRZA 2K3HA 3QO0B 4WHTB 3RI5K 4XOCA 3QEQE 2NYKA 5IOPA 2NTFB 1A9BA 1QBLH 4PG9A 4C4UA 4FDWA 3JZ7A 1CD0A 3JWDH 4MD5A 1AKPA 3QJHA 3CVIH 1MW1A 3FO1A 4W70A 1TOXA 1RJLA 1ZTXE 3UP1A 4Y5VB 1KB9K 1FNSH 1TKWB 4KI5F 5D7SH 5T1DL 3WIHL 4FP8L 4G9FA 1JVLA 2Y6SD 1MFAL 1WITA 4GW5A 3HE7C 2R1YA 4BH7B 2ADJA 5IUCA 3LH9A 5E6IB 1NCCL 5FYJH 2C1PA 4P4KC 5C0IB 4ZYKB 1ZLWK 2QR0A 5JIQA 2NX5D 2VKWA 4NIYE 5BRPA 4JZOA 3MJ8B 1UD3A 2J8UA 4HIHA 4L1SA 1KIUA 4RDBA 2GW5A 1CCZA 4JN1L 1P9MC 3H4FA 4HMEA 1AHWB 1DBJL 3RFZC 4IRJD 5I1AA 2VDPB 2CGRL 5IVZB 3SDDD 1W72A 2Y5TA 4F15B 1OTSC 3GK8H 1JPSH 3D39E 1AD9A 2H6OA 5MI0C 4WDIB 1DBAL 1FN4B 3AY4A 3TNNB 4M5YL 3T8VA 3WN6A 5AB2A 3QEQB 2C9PA 5MEPB 3HNSL 4V1DD 4XXCC 2YD0A 3U9PL 4MXWH 3KYAA 2IAND 2CDFA 5AWNL 2MRYA 3SIKA 4YXKH 4TNVF 3RLSA 1KZYA 1OOAA 4N2LA 3TO4D 4A2FA 1FNAA 4HSCX 4HWZB 1WBZB 3EKCA 4XH2A 2X4NB 4OZHE 1PLBA 2N56A 3ARWA 1DVSA 4MHHI 5JDJA 4Z0XB 1D6EB 1OGAE 2EC8A 1SGKA 1LL1A 1JF5A 1E6OH 2ED6A 3CBKB 4P06A 2UX6A 4TNEA 3U7YH 1DEEB 2WV3A 1MIEL 1FZJA 2VXVL 1A02N 2HKHH 2WSDA 3K5SA 5DU7A 4NCC1 2L3BA 3TJHD 1JHLH 5TDOB 4QY8A 4ZDHA 3GUFA 3VFWA 4B95C 5IY5B 5E1AB 2F7OA 4WWNA 4MSWA 2AJUL 3SBPA 3ZRFC 1OWWA 1RP9A 5FR3A 1JVOA 3V52H 4G6JL 4JRXD 5HJ3B 2C8NA 5FKAB 1W72L 3MLTA 4QKTA 5AW3B 3KVPA 3D39B 3T71A 5KS9E 4GQ9H 3WLWD 3GXNA 3NSDA 2QVTA 2XU9A 2B3IA 3MV7E 4EBQH 1JNJA 3MRDA 4O58H 1GYVA 3COOA 1AJ7L 4N22A 2GFBB 2WUBL 2X4QB 1MCIA 3RIFF 2DYPA 3NQIA 3TYGL 2WIMA 1H6UA 2HVKA 1MCPL 3DXAE 4K71B 1ZSDA 1BJ1J 3GJFB 3GRBA 1U95A 1U8QA 2BSTA 4HEMA 3OMIB 2LAGB 3UGEA 1MCOL 2GK0B 4DQAA 1F41A 5C0BD 1A47A 2FSEA 4CJ0A 3SJVA 4YIQB 5I5RA 3NIGE 1PZ2A 4OZHB 1XGPA 2FVNA 1MSPA 2HFGL 1FPTL 2ESVA 2WOBA 4L1HA 3ASOB 3VXNA 2WB7A 3B7UX 4ONFH 3JWNG 2M1KA 1OGAB 4BELD 2XKNB 1RZIB 3IWVA 1BIIB 3U4KA 3FMGL 4XTRC 3ARGB 2LU3A 4JN2B 2YD8A 3HNVH 2V17H 2ZOLB 1CD9B 3AG4B 3PV6B 4KX9A 3FTUA 4YSOA 3RL1B 4MA1C 3CXHK 1TZHB 2X0WA 4MLSA 3K0WA 3MRNB 3TH3T 1FIGH 5I18H 3LRLA 1NGYA 3L3DB 5DC2A 5C3LD 3D09A 1YEGH 1L9OA 1M7DB 2CDGB 5BZZA 5B39B 4NEHB 3CPLA 3QEQD 4XHJD 3V5KA 4FZ8L 4YL9A 5D6DC 1SF5A 2AV7B 1U3YA 2NRDA 5KG9B 3F7PC 1MAJA 3MV7B 1V7ML 1TYRA 1THAA 1WZMA 1DBBL 4YDMA 1W15A 1AQ8A 2VXUH 2MSPA 2FJGB 4WTXA 1MCWM 2O5YL 1QACA 3DXAB 4BCYA 2W9EH 1YECL 1JNLL 2JVUA 2EE2A 1U41A 1QSEE 3ROLA 4Y1AA 1BLNA 5ISZA 4OJYA 1EEQA 1N18A 3NIGB 2FO8A 4PW3A 1S78C 25C8L 1MEXL 2F18A 1G7MB 3NCMA 3PF2A 1ZANL 4YUEH 3U2IA 3Q8CA 2XRAL 4RRPA 3GIZH 1TVHA 3C60A 4LLQB 4K5MA 2QSQA 2V33A 4Y5YA 5KN5A 1PG7H 2W07A 5E9NA 2X4UA 4NO0B 3D39D 4IDJH 3BQVA 3VRIA 3W9EB 3S3CB 4JK0D 5I8KH 5H35A 1WD8A 4XBEH 5C0CA 5I6OA 1H8LA 3LX9A 4HLZG 5HYSB 3KL0A 5HGAB 2DQEH 4H2AA 1WEJL 1TJIH 3E2HB 3W57A 4LSUL 1A9EB 1TEGA 3L3GA 5JUEH 3BAYA 4WJG3 2PP9A 4HLEA 5KUKA 2DLFH 2P9RA 1P1VA 2OW6A 2WO2B 1DLFH 1TDQA 4WWOA 1QASA 2YMTA 4I0PA 1MWAB 1P7KA 1IV8A 4O51A 5J6HB 4NN6B 2B1OA 1KC5L 1QSEB 4JQVC 4DGIL 1OGAD 4R7DA 2DKMA 2VIRA 3HN5A 4N9OB 3BEVB 4H26B 5KVEL 1CD1B 4MTMA 3ARGD 4MFHA 3MYJA 5IFJA 1JRHI 3T2PA 4D8PA 3G3LA 4HJGA 4LCCB 5I23A 4J7RA 3BPCB 5TDNA 4ZPVB 3IYLW 4DP1X 1IC0A 4GKNA 2DQCL 3D85B 4ZOAA 5T33H 2GJJA 3WE6B 3D5OF 3VTAA 1QR1A 1YY8B 2PF6A 4NLAA 4E41E 3QXDB 2VABA 4HGKC 5H37G 3GZPA 4AG4H 3WBDA 5I8EB 5GS0C 2MOGA 4MBRA 2X70A 2FWOA 3MV7D 1IGCL 1MW2A 3TNMA 3G7TA 4RMUA 2XZAL 2YJLA 4ZMLA 3D69B 2F1EA 4HGMA 1HHIA 3DXAD 1BXVA 4G8AC 4R97B 4U1SA 4PS3A 5C07A 4AH2B 4U6XB 3FO9B 4OGAD 4XNXL 3GMRB 4DK3A 4NRZB 3SDCC 3DLQR 3WNKA 3ARUA 3UACA 1R47A 4EI5A 4S1RH 1G7HB 1NCNA 2BSCA 1BX2A 2LV4A 3CGTA 43C9B 2BSDA 3GMOB 4IRZA 3WJMB 4M4PA 3IF1B 4HQQL 1OANA 1BW8A 1SJXA 1HQ4B 2O6DA 4KXDA 4Y4FA 1BVOA 3PWVA 3V6OA 4NO0D 5CEYB 3U83A 2X53A 1FNGA 1Y0LB 2IPKA 3QK0A 3R4DA 1V10A 4W9EC 2WO4A 2G2NA 1KIPB 1ORQB 3Q8AA 4BDVB 3F01A 4E41B 1RIHL 2WLKA 2V6HA 3TBWB 2G0LA 4PY8J 4XPHL 2AQ2A 1IILE 1XH3A 2WK2A 1KJVA 5AVTB 2BMKB 3P3UA 5TGBA 3B7YA 1A5FL 3WY1A 2BNQA 5A43C 2VN6A 4HIXL 4XX1E 1PEZA 4GG6F 1S5HB 4JO5A 4OFVA 4UQ9A 5ANMA 3VFVA 5E6YA 1LE5B 4PB9L 1TITA 1QSED 4HPOH 1C08B 1YN6B 2JIXA 4NI6A 1BZEA 2K6WA 3QPKA 2DL2A 3EH2A 4UILL 3RVXC 1A6ZB 1E30A 3P77B 4AQAA 4LPCA 4ZX5A 5JW4Q 3M45A 1WJ3A 3IXAB 2VC2L 5E2VL 3QFDA 2Y36H 4M6OL 2AJYL 3TCXA 5INDA 5KVFE 3KJ6L 1M7IA 3QG7H 3QJUB 1D9KB 2NCMA 4IRZL 2O1AA 3L2LA 4NQCA 2YGNA 2G60H 3PP3H 4G6ML 3RZCB 2HYMA 4JL2A 2VR5A 3HZVB 2YO3A 3OKDB 1BMWA 4OZFH 4R8WL 3A23A 4QLRA 4R0LB 2HLEB 3RVWD 1CTMA 3T3PF 4YBQD 1O7SA 4S1DD 4W68A 2F53E 5IFHH 4YHPA 5DQJA 2R1WB 4IK7A 1HYRC 2W0PA 2O6CA 1BZOA 2B5IC 5BXFB 4AEIL 4WTZA 4X7CC 4JB9H 4RBPH 1WBYA 1LO0L 3F58H 3GSWB 4MWFB 5CS7A 3GJFK 2WTRA 1I7UB 4FEIA 4ICWA 5DJYB 5HPMA 5ADOL 3STZB 1KNOA 2HKFH 4LLYB 2B9AA 4IEFA 3T65B 6CGTA 3E1ZA 3O2DA 4OV6F 4ODXB 3FRPA 4XVUD 1UB6B 2O61A 2OMBA 4F5CE 1T0PB 2KPNA 2Z9TA 3ZQWA 3VWJA 1XSJA 3NFSH 5LQBH 3U48A 5DZNA 3CK0L 4ICXA 1DE4B 2DMGA 3FONB 2D3VA 2WQRA 1N0LA 1ND0A 4TVPE 4UDTA 4RGNE 5IB5B 5CIPB 4CILA 1OCOB 3S34H 4E41D 2VAAA 4PV9A 1OAXL 3HRZA 3FRUB 3QQNA 4HU8A 5IOKA 1J86A 2I5YL 1E50A 4QNPE 3QJFB 1C16A 1M3JA 2YAMA 3VFOA 1QBBA 3CFKA 5K9KA 2KQNA 3C8DA 3A6CL 4CGUB 2EUWA 1RH8A 2F53B 2J6EA 1R5WB 3X14B 1U8OA 4FXKA 3FAWA 3S6CA 3L3IB 4I18A 1OK8A 2F8IA 1UM6H 1JTPA 1R5IA 3HG3A 1P4LB 1SDYA 4L1LA 1EZSA 3VRLE 4KK5C 4RGOH 1PG7X 4Q89A 4U6HA 3PHQA 4LSVL 2AEOA 3CMGA 4L29B 1IZJA 1KXQA 2HLFD 4L3EE 2X1OA 1HJCA 1D9KD 3FQ4A 3O2DL 4PLOB 4OJFL 1OAKL 3C6LA 1FZKB 4XCFH 1VGKB 4PRAA 2IXQA 2OMZB 1VCAA 1LO2L 1A7NH 1OCCB 2YIHA 3PUCA 4POZC 5AW4B 3US1A 2AHIA 4R7VA 3RZCD 35C8L 5F3HA 2CBQA 1HHGA 2XVKA 4L4VA 4RGNB 1CE1L 4YGVA 3QGVA 1XIWD 4AMKL 2DDQH 4HAGA 5JPMC 3NP4A 4NQSB 4PJHA 4QXTA 3WXVL 3GSXA 3I84A 1MLCB 4NHUB 4UV7L 4R4NC 1Q1PA 3CN3A 4PJXA 5CSZA 1YYMH 1FE8L 2H4EA 1T22A 1HSBA 1AGCB 1A4BA 1CGUA 4JKPH 4G1MB 1U3JA 3WOVA 2XZQL 2VM3A 3L3HA 2IWFA 3RJQB 2LABA 5E1QA 4XNUL 2C3VB 4NUQA 3WO4B 4DP0X 3SE3C 3ZL2A 1MFBL 1OSZB 4PVLA 1INQB 1BZ8A 1PZ3A 3ENEA 1EEUA 3S36H 2QGDA 5HVHB 2E27H 2W38A 2BIIA 4Q56A 2YBRA 3ARDC 4YHYB 4G72B 3A6BL 4JFOA 2SEBB 3PDDA 3HI5H 1E5YA 3LD8B 3KEHA 4P3DA 5DUPL 1DVYA 3QXAA 2NY6B 4L3EB 3ZE0F 3TPUB 3DIFB 1I1FA 5LLIC 5EU6A 3TFKC 4A2DA 3BH9B 3RWJA 2W9LA 5AQ0A 3FULA 2LR4A 4IW4C 5F7YC 1KG0B 3OAUH 5E51A 1F1GA 1Z3GL 3D06A 4LRNH 1A0QL 1FSKC 2HG0A 1U58B 1OP3H 3VQ2C 5F7UA 5I28A 2A0LD 1YA5A 4JREC 4FHKA 3LKPB 3QRGH 1IGFL 1RZ7L 3H53A 4U6YB 2F53D 3QJVB 4NT6B 1DDHB 5DHYA 5B39G 3APDA 1XF2A 2DIBA 2A9NH 5DZJA 2VR4A 2QLYA 2EDJA 5LWYH 4WI0A 3MUJA 2FEEI 3IJ9A 2XVBA 4XCCL 3QUYA 5F1SA 3KL3A 2WW8A 4S0SD 2P7TB 3TIDA 3MACL 3GNMH 3SYPA 3R1GL 3OB0K 4JCMA 3GSVA 3U25A 5C3IA 3PL6D 4ZI8A 3QIWA 3D48R 4O02B 5GRYA 5TE7L 2EUZA 3ZHNA 4TUKL 3SKUD 4M48H 3UXFA 5KBPA 3F6IA 1RUMH 1FRGL 2APBA 3MV9A 4KTEL 4TVPD 3TBYB 1KYFA 4FJZA 4RGND 3QNFA 4N0YH 3N5AA 4N0CC 4PFEA 1B4JH 3O2VH 3WN5C 5J56B 1WCBA 1GR7A 2PMZA 5C86A 2P44B 1E27A 5D1QC 4DVRH 2Z0UA 1FBIH 4EE2A 4D9LL 1UOLA 4HS3B 4WO4C 2B1AL 2AJ3A 2WINB 5CJQL 4QYOB 2WNXA 3KLKA 3MRHA 4WUUE 1ID5I 4RMSA 4D94A 5IM7B 1MLBA 4B60A 3MJWA 3IDXL 1HCFX 5D1ZC 3VDCA 2G3MA 3UTQA 4DQOH 5GS0H 3VVVA 5FCUL 1D2OA 2VN7A 3L08A 4QNPF 2R69A 4OF5A 2G2RA 4UYPA 3WNNA 5HYSG 1UA3A 2X4PB 3M17B 3K81A 3TBSA 3U7AA 3X1FA 5JW5B 3BRFA 2Y1YA 1UXWA 2MEJB 1YEHH 1M2OA 4JDVA 1V3LA 4BM7A 1O6SB 3FQ2A 2Z34A 3KPOB 2FSDA 4X7TA 1Y6KR 4OW6A 4M7LL 1KJMA 1UA7A 3D4YA 3AS3A 4HPYH 2P46B 1JGVH 4L3ED 3MUZ1 2L04A 4ZUVA 1CR9L 4FQJH 4G6KL 4G43B 1MOEA 3KPQA 2CKBA 4N0RA 5IG7B 2KT6A 2C3GA 1CDYA 5DR5H 1A4CA 3QG6B 2N1KA 2PABA 1PEWA 1RULL 3S5ZA 3N42F 1U8IB 3AU1B 1IEBA 2B2XH 3EJQA 4U1IA 4Z0BL 4WNJA 2DQJH 3B2DC 4X6CE 1T21A 1CI5A 1WT5A 3PGCB 3DI3B 3ME0B 4YSSA 5JLZB 2C3WA 3F64A 4ZFZA 4UQBA 1HQRA 3IKCB 4YDIH 2R4RH 3BP6A 3CC5B 3FZUD 4PJ8C 2NUTA 2A9BA 4WUUB 5DUBA 4JFFA 1MHPH 4JO3L 2A74B 4EZMA 12E8L 4NQDE 5I1KL 3AXLA 4F33B 1PLGH 3UJJL 1DVXA 4UOW1 1QLFA 3CFJB 1O6TA 3FFCA 4LCIL 3S8GB 1MPAH 2R69L 2I27N 3BUBA 4GRLB 1HXMB 3PNWA 1MW3A 3FUNA 4LCUB 4KRPC 5DJCB 1ODAA 3TBVB 3ARVA 4N3UA 3MVSA 2R2BB 4Z7UE 3KYMB 2ZXBA 3S3DB 1KN2H 4JFDE 3U4EA 4OGZA 1AP2B 3NK4A 3KJ4C 3K6SA 3D0VB 2NY0B 3F6JA 1XFPA 1NGZB 4FKEA 1MRCL 3H9SA 4KDWA 4H8WL 4N4YB 2ZE0A 4YDLC 5C0GB 3B9KC 3KGUA 3SOBH 1HXYB 4DKFL 4EAEA 2CKBL 1CGSH 3B7RL 5L88L 3VU1A 3RURA 4R2GB 2JXMB 5HY9A 1QLRB 2LU5A 3KPPA 2DMCA 3ABGA 4JO1H 1IM3A 3BJLA 4X6CB 4HBCH 2X6MA 2V9QA 4PBWD 1JXDA 3NZ8B 4UT7H 3AT0A 5CR1A 4NO2A 2GUOA 1DLHA 2PO6C 4LKXA 1NMAH 1GKEA 5CMAA 3V0FA 3GZKA 1Z3RA 2FHFA 5CEXA 3KMDA 4YDJA 1ZDSA 4NQDB 5DJ0B 4A67A 4K7PH 2KL6A 2AJZB 2PYEA 1SLXA 3C9NB 1UYWL 3ULVC 1TQBB 1X7QA 2YOCA 5J9PA 2GI0A 2EXWC 1T83A 4PGCB 4A6YB 5CEZE 1ULVA 1ZOXA 2ITCB 5D6CA 5T5NF 2Y06H 3REVB 5I1GH 4HS6A 5IESL 2VR3A 3HC0B 4Z7UB 1R3JB 4I2XE 4JFDB 3DK2A 2ZXWB 1ZS8A 2P80A 3P54A 4NUGH 43CAA 5IJVA 1IGJB 2WCPA 1K72A 4UBDD 1JFHA 1X4YA 4HK3J 1BJ1H 5K69A 3GBDA 2CHXA 4NP4H 1WBXB 3CFDB 3WKMH 1JI2A 5EUOB 4XPAL 4AYMC 2CR6A 4PLJC 3AABA 1M57B 3B34A 4ERSH 1ZGLM 4IKIA 4MJ6A 3UMNA 1IJNA 1U6AH 4R90L 3DPBB 2EIZB 1IMHC 1UURA 1MCFA 3S36X 4WUUD 5FC9A 3MLUH 3AROA 4JHWH 5EIQA 2ZT9C 5IBTH 1JMZA 4MMXA 1GCFA 2R2HB 5ITFA 3GMQA 3NTCH 3F7VB 2AJSL 3A21A 1LQSR 3GMLB 2Q7YA 4R7NA 4BZ2A 2RFXB 2DQTL 1IGTB 2ZPKH 3CQFA 1VPOH 5E94B 5AD0A 4JDZB 1TZGL 4FNSA 2YPLA 4OZ4A 1NBVL 2CBMA 2OMXB 4XX1G 1IM9A 2NZ9D 1WWCA 2Z35A 2NY0D 4P4KB 2BP8B 1XB3A 4I2XB 1O9WA 1JXKA 4PJ9B 4J28A 4FMVA 1JN6A 3IMSA 1DQJB 5DUJA 2WQXA 4IYKA 4F91B 1EO7A 4I1RA 4EJ1C 2H1PH 4R2GD 4PM1A 1T4WA 2X1QA 1F8TH 1AQKL 3X11A 3LY6A 1HJBC 1FFRA 1OO2A 3G04B 4A7GF 4RQQA 4J6RL 2NNFA 4FXLA 3VXTA 3RVTC 3QNXA 2KLTA 4KPHH 4HUCA 4H8PA 2VZ3A 4R4FH 4NFDA 3P4LA 2NSXA 1TETH 4X6CF 4NQDD 5TPWL 3TV8A 3WFBL 3NH7H 1I9EA 3K72A 4QRTB 4HOWA 4PYHA 4BZ2L 4OM0L 3FOMB 3FTZA 4MDRA 3C8KA 3V4PA 1KGWA 4XXWA 4BQCA 1HEZB 1T4KB 2JMRA 1N67A 5H4ZA 4PCKA 1YNTA 4QHKJ 3AVEA 1WZ1H 2O93L 3OX8A 4JFDD 1U8PA 3ECBA 4LIQH 8FABB 5GSRA 3BUQA 4YXHH 3VI3E 4TPRL 3FFOA 1CICB 1KCLA 2B59B 5HDWA 3KZ8A 3MGOB 3ABZA 3FT2B 2BS71 4UM8B 4L05A 1DQLH 5HGGS 1QTSA 5KWYC 4U1JB 1NBCA 3M1CA 4Y5XC 3BMWA 3G6JA 4CL7A 4LEBA 3NCBB 4I9XA 5BRZE 3HNTH 1JV2A 3MLZL 3HMWH 3WHXB 3H9HB 5AKTA 5K9QI 1ZVHA 3VNYA 2N7SA 2JJVA 4MMYA 1EEZA 5EOQL 4X9IA 3VGDA 1BJMA 5DXWA 4AXWA 4OM1L 3GSQA 5EUOF 4NOBA 5CINH 1N5YH 2BLFA 4HWUA 3POHA 4C54A 4OZGA 5TH2B 4AVHA 3ATAA 3QO1A 4DP4X 1E67A 1W8NA 1WF5A 5CKAA 1U9KA 1MRFL 4DFIA 1OY3B 2C9SA 4KHTL 4YHIB 5GJTL 5I1DA 1KCSL 4HS8L 4NKIH 5CEZD 5D7EA 4JRYA 3D6GA 2GI7A 1F58L 5T1MA 1H8SA 4P4KD 2OSWA 4QXWA 4X42A 4H40A 4IKKA 4PJ9D 4XRCB 4LSSH 3PGFL 3VI3B 4PCYA 4J23A 1GGTA 3VFPA 3CBJB 3X12A 1SEQH 5FO7A 1HEHC 4N6QA 3OR6A 1I75A 3MLYH 3M07A 3GXMA 3GGWB 5K59E 3HBPA 1SYVB 2E59A 3ISWA 5ERWB 4DP6X 4ZFFB 4OTXL 5BRZB 1VSCA 3P02A 3MRRB 4WWKA 3KG5A 3RL2B 4P2YA 2Z4QA 4X5WB 4PB0H 4YNYA 4QGTA 5DD0H 5EDXA 5F7AA 1PYWA 4GY4A 3QFJB 1SN5A 4FFYA 4MS6A 4XI5D 3VRJB 3C6SA 3LEYL 3TTYA 1TTBA 5IHUH 1A6PA 4ODTH 5BOJA 2EDWA 3V79C 3ARFB 1AZBA 3S4SA 4KKQA 1AZUA 5CZKA 2DMHA 3WJJA 5F97E 1PDKA 4PV1C 1LDPH 3PHSA 5DHEA 1C7TA 2Q8BH 2OI9B 2H8PA 3CFCH 2FO1A 1P4BL 3L7EB 1XB6A 3IS0X 2X44D 1RD6A 1LO5A 1FORL 3LQZA 1FNFA 4P2CG 3SZ6A 2OQJA 2P5EE 3HCVA 3I2CL 1CICD 4QAMB 2Z92A 5FO2A 5T1KA 1Q1JH 3WNPA 1WK0A 3RUGE 5F7EL 5MENA 3BP7A 2N0MA 2KQMA 3NCJL 1CXIA 4TSBL 3IVKB 1ZRUA 3E8UH 4AQ1C 4FERA 4ODVH 4G5AA 1T1ZA 1UKSA 1B0GB 2PUQT 3MGTA 2DMKA 2JWYA 4X5RA 4JPIA 1TZIB 4ONHB 4BE5A 1J1XH 1P4IL 3GIVB 5B4MC 1D5IH 4NPYB 2ORBL 1KTCA 5C08A 4K23H 4BSWB 1L5GB 1OALA 4JFXA 1ZSHA 2ADGA 4QPEA 2CPUA 4OCXH 1KFGA 1XCTB 3GRWA 3STLA 4FFYL 4DKDC 4KVPA 3HRPA 3BCFA 3V0GA 1OAQL 3KPMA 4LVOB 5DQDL 5AB1A 4P5MA 4W6YB 4QHPA 1C5DA 1J88A 3E8VA 1WIUA 3WNLA 3CLWA 1HL4A 4PWGA 1KIQB 2ALWA 3VQ1C 4CSZA 2XYBA 3SDAC 3EZJB 2VISA 3N0PB 2N0KA 3RWFA 1BD2B 1G7QA 3ZL4L 5E08L 2IG2H 4Y9CA 3GI8L 5BVPL 1YCSA 2P5EB 3TH2T 3D18A 5T5NG 2E56A 2X1XR 3ZE1F 4Z7NE 3UADA 5ID0A 2ODIA 1CT8A 3VVWA 3RUGB 3OXRA 3GHPA 2XX0A 3HG1D 4K3GA 5GHWL 3CXDH 4HXBH 1KXVA 3OAYK 1VFMA 5DLML 5F8QC 2X89A 3RWCB 5BRZD 2CO7B 3LRMA 1VZHA 1CLOH 3IMVA 2IVFC 4G80B 1R1CA 1HFUA 3LKQA 5K9QG 1CXHA 1Q0YL 4HOZA 4F7EB 1F97A 3TLRA 2V5RA 2A73A 5KVDL 2HFEA 3RTQC 3OJDB 4NKMA 5A6MA 4TN9A 1SJHA 3WFHA 1OP9A 2XNAA 1DSWA 3ARFD 5C6TH 1KLUA 2AABL 4W9LC 3GRWL 5C0FB 5AENA 3L5WB 1JPGA 1YMMA 3NZHL 1DO5A 4XPTH 3RGVC 5L2JA 3RYMA 2V3DA 5AAWA 3CIAA 4GW1A 4AOFA 4K3EL 1NCAL 3GTVA 2QHRL 5E9DA 4UTBL 2VITA 4HCRA 1H9VA 4MJ2A 4MDIB 4QTHB 1DSFL 5IW1A 1ZHLB 2VYRE 5E4EC 1JPEA 4URKA 3ULVH 1O5PA 3LXCA 4CVZB 1VZIA 3PUUA 4TLUA 1F45A 3C2AH 3U6XA 2QKIB 4XXDA 1CDGA 4AVKA 5ADPH 1R33A 4Y2NA 3CZLA 1AG6A 2IWKA 4PJ7F 4EN3B 1S4IA 2AQQA 4KKBD 3HAEA 4HDIA 3B9AA 2OYPA 5E56A 2Z7ZA 3D9AL 4FNRA 3O6KH 2Q20A 4WU7A 3U0TB 5J1AB 4G7YH 1DQML 3SZKC 2XY1A 3PWPE 2V37A 2ZX7A 3BESR 3VE0A 1RY7B 1EDQA 1KJ3H 1U3ZA 5LHDA 2IADB 5BJTB 5DJZB 1ADWA 4U4IA 1DJIA 1DVFC 1I7TA 1UENA 4K3DL 4YHKL 3VXOA 3KS0J 3APCA 5CCJA 3KLLA 3OKLA 3FU7A 3VDBA 1PZAA 2WQVA 4JLRA 5SWQA 3BEWA 4IGBC 4NM8H 2CHZA 2IWGA 3DVNB 2VDOB 3APNA 1Q9KB 5IROD 1UWXH 2P5ED 3ZKMD 3SEPA 4HCRL 3VQMA 5CP7A 3DYOA 3KGTA 2FQGA 4H1LB 5I1IH 5IVOA 1QWNA 1NH6A 4Z78B 3PHOB 4XR8C 1HH9A 4EMZA 3NACL 4P2OB 2HPOA 1LLAA 3ZDZE 4PU2A 1EWHA 3RUGF 3FAXA 4O5LL 4FNPA 1BZQK 5C0ND 1SJEA 3VCLA 5F7MC 4P49A 3U0PB 1SBSL 4I85A 2HJLB 1NGPH 4G8IB 2IDUA 3FHAA 4OFKA 2J1XA 3PWPB 4JR9H 5ESQA 5ESAB 5DFAA 3UDWC 3NZUA 4S1QH 4XP4H 1G7JB 4LGRB 4K5NA 2E9JA 3DVGB 4PWJA 3CMOH 5FV1L 4XWOC 4Z7WE 4WTWA 2ZUUA 4OF6A 4PP2B 3DO7A 2OPCA 3GMPB 2EUVA 3ETSA 4I77L 4YE4L 3T2NL 4PREB 4H8UA 2O5ZH 5IKCA 2BZCA 3AZUA 5TK2A 5I1JH 3V0WH 2D7QA 2PWFA 2VM4A 2VLKD 1N2RA 1CU4H 3ECQA 3K6OA 4KDTA 1A2YA 4LL9A 5TFSL 4GAAA 2GITA 4O4YH 2MCPH 5E2UH 5EN2B 3BIKB 4MAYB 3RIKA 2NUPB 1CI3M 3UC0L 2Z91B 2PR4L 4M8VA 3SE6A 3WGVB 2YSSB 4EN3D 3AC0A 1NLDL 1UVQB 3HUJF 4JY6B 5HHQB 1QO3A 1F1AA 1NM9A 1UD4A 3ZDZB 1UEYA 3HMXH 1EANA 5J5EA 4YN3A 4BZ1A 4M61B 2DJ4A 4FS0A 2WLNA 1C5CL 2QQLH 2CLRA 1B4TA 3GBNH 1XH2A 3EG9B 4P07A 4LAJH 1KB5A 2EVHA 1E4HA 2BRRL 1PJ9A 4NO5A 4YBLC 3SYAA 1W91A 4Y5YC 2LAAA 1BM7A 1IAKB 4ABWA 1OAYH 4LHJB 2BVYA 4NOFA 4GNKB 3RQ3A 4LP5A 3EJSA 2HJKA 3TN0A 4Z7WB 4PI2A 2XQYA 5DS8B 2XSKA 2GEQA 3JVGA 4PRPA 2XT1B 4HK0A 1R3LA 1LP9E 2OULB 4HIEB 5IT2L 2UYLA 5I9QC 3BAIA 3UJIH 1I7ZB 1JZ4A 1E4XI 4F3FB 1PD1A 2CUMA 2GJ6B 3QUZA 1ZHNA 3CN4A 1YEFL 4HW6A 5CHNB 4MA3A 5FEBA 2YEVB 1DHKA 4P04A 4P2OD 5F6HI 2APTA 3MZTA 5DZVA 5GSVB 1PZCA 5IBLC 1QFWI 5IK3B 2J1WA 5PCYA 2RGSA 3BSZA 1L9QA 4FQXD 3WU1A 2MKWA 1IKOP 5I8OH 1IAOB 3MNVB 3P3TA 1IO4C 4N24A 4X5QA 2DQUL 1FH5L 2NY4B 1D7BA 1HOCB 5JPMB 1RHHB 2WP3O 1AGEA 3VXPA 3PWPD 1WZLA 3V0HA 1S5IH 3BKJH 2J88L 3C5JB 3T6ZA 4Y1TA 4LSTL 3ZR6A 3UAJA 2D7NA 4AUJA 5KVGL 1ZLEA 4GMTL 2UWEE 1MRDH 3MLSL 4ZMVA 3TT3L 1PX8A 3CZFB 1PAMA 5IF0A 4IIZA 4M43L 3U0WH 4MD0B 1G6VK 2H32B 4P9MH 2X6AA 3IJEB 5JIIA 2Q7NA 1LP9B 5F1NB 2ZWKA 3AITA 3OSKA 3AQYA 2E76C 1WAAE 5I1LA 1MWOA 3GBLA 5HI5C 5BUGA 3TH4T 4MAYD 4JDTL 2ARJB 5EN3A 5J89A 3LZLA 3S7GA 5DC0A 4KKZA 2VQUA 2C7UB 2R2EB 4OJEH 1ETA1 3VFNB 15C8L 3L1GA 2QQNH 4N9GA 2LLGA 2XC8A 3I02A 1MJUL 2KERA 4FTDA 5ACZA 2DLTA 3SGEH 3WSQH 3BSZL 3JTTB 2CIKB 1IGYA 5D1QE 3PPEA 1FFNA 3NIFE 1MFAH 2BNUB 3AM8A 4YC2C 2DTSA 5FCSH 4DETA 3NJIA 5IJDC 4IDLA 1MJ7L 1NCCH 3CNKA 3EBAA 3MQIA 3O4LA 4E9RA 5JDSB 3FTXA 5HHMD 1WTGT 4PGBA 4AKPA 4EPSA 3E6FA 2F8OA 4LKCB 4Z76B 2X1PA 5IJKA 2UWEB 4HUWA 4JN1H 4HETA 2EXSA 1H0DB 1DBJH 1X6NA 5FLUA 4BFIA 2ZYHA 1BBJB 1EMTL 4JGUA 4KK5D 3MBEA 3UYRH 3FJTA 4GRMA 1GYCA 3SN6N 1YNKL 3SE9H 2CA3A 2V7NA 1GOHA 4U3XA 3KYKH 1YEDA 4EXKA 5GS2H 4TSCL 5E5MA 3ARRA 4TOYH 2P48B 3HNSH 5C0JB 5FF6B 1CFNA 1WIOA 3LXUX 4RAVB 3U9PH 5AWNH 4OI8A 3CVHL 4N5UA 5ICUA 4AEHL 3K80A 1G0DA 2N1TE 2AK1H 4L2YA 3QEHB 3MYZA 4HT1H 5KYUA 2E4TA 3K4DA 3BP5A 1QQDB 2CK2A 2NY4D 2ZUSA 5IMLB 5D4IA 4IHBA 3WN5B 5I24A 4AGOA 3DO4A 4MCYB 1V3JA 5D1QB 1BEYH 3NIFB 2GYSA 5IMKA 3G5VB 2H0PA 4GRWH 1U2CA 1WFIA 4WO4B 5C0EB 2QADC 1OPGL 2OZNA 1GS7A 3MUHL 1WHOA 1MIEH 1EGJH 1CGXA 4RVBA 1GYUA 2EKSA 1W8EA 2PXYC 5D1ZB 4CADB 5ICXA 1AR2A 3I6KA 1CBVH 3OAWA 4OLYL 2B9BA 4HGWA 2VH5H 4QHNB 3IPBA 3L3KB 3MPCA 4G71B 4B96A 2DWEA 4Y16C 4AYBA 2NZIA 4WHCA 4A38A 1BEXA 3Q6FA 1X9RA 4XPBL 3BQUB 1YEIL 3F8UB 4LEOA 5T3XL 2DJUA 3N85L 4KO5A 2WUBH 5D7IE 3OKNB 3TYGH 4UUJA 5MHSE 1MCPH 4KKLD 1R3HB 4WI7A 2OMVA 2OSLA 5E4IA 2Y7OA 1NIAA 3AWGA 4GBXD 3CHXA 2NQDA 1MCOH 2V8LA 3QEGH 2YGVA 1F0LA 4H0IA 1KN4L 5HHNA 3EOAA 1CB4A 5HSFA 2HFGH 1Z9LA 4OVVA 4JFZL 1LK3L 4KTYA 2MPVA 4OCYL 4RISH 3MCLL 4TL4A 4RSVA 3QXWA 1CUOA 4N8PA 4PJ8B 2ENQA 4LSQH 4NGHL 1MH5B 4QHUA 2HP4A 5AW5B 5DGRA 3QORC 3L2NA 3WENA 4HUNB 4GUQA 1AGFB 4OF7A 3FQRB 2APWA 3S35L 1J05A 4B9GA 3QZLA 1DUYB 4Y4KC 4RDQF 4I3RL 6PCYA 5J06A 2X7LB 2ZXAA 2VR7A 3HN3A 3FU3A 1ZA6A 4KRPB 2R23B 4W9CC 3OPUA 3N1QC 3DDGA 2MOVA 4LF3A 3W39A 3KJ4B 3P2BA 4EDXB 4I18C 1IIKA 1DBBH 1JK8B 1JFQL 1FWXA 5D7IB 5HD8C 5J1SC 4M7KH 4MNGE 2O5YH 3V7MA 4YDLB 3B9KB 4JFTA 1YECH 5JXAL 1JNLH 3EFDL 4JO8A 3T09A 1AO7A 2ROYA 1LE9B 4ZW8A 1P6AB 5D1QD 4YLCA 5DK2A 3BKCH 4HJSA 4HWNA 1Z9MA 1HAWA 3OKMB 4P2RE 3PIQB 5EPMB 3MA9L 4PBXA 2OFQA 2LTQC 5KJ4A 3WEOA 3MHZA 4RETB 5FKPA 2GEEA 1ZANH 2PO6B 2XRAH 3GRGA 2RCSL 4D0CA 3CZEA 4KZ0A 4L8SC 2BSBA 3DETC 1CF1A 4MJ4A 2VJ0A 3IJSA 4QRQB 1CQKA 2JCCA 3NJHA 4WW2C 2HZHA 2OTPA 2FWLB 1EJFA 4N2OA 1T3FA 1RJZB 1URZA 4O2FA 4OI9A 3H7BB 3BQUD 2WY3B 3P1VA 2X2JA 3ZDYF 2RH0A 4DKAA 1ORSB 4LBEA 1WEJH 4LSUH 3WAJA 3UZVB 1UJ3B 4M62L 4LLMA 5B38A 3MX0A 2JI3A 5ALCL 2DLEA 3OAZH 4GO8A 1H9DA 1E8XA 1YEJL 2X3AA 4JKLA 4U1LB 3F3HA 4H1LG 1MUJA 5EOTB 1RZKC 1X6LA 2Y07L 2ZWSA 1EHXA 3C87A 5D8JL 3UP6A 3EUDA 4DGIH 4XO9A 4I0KA 1QUNA 1K3IA 2AQSA 1BCIA 2DIAA 2V8MA 4YVUA 1RVFL 3MJ6A 1KCUL 4P2RB 4YHNA 4YSDA 3RBSA 5HGHB 2NQ3A 2XA8L 2F19L 1R24A 5L2KA 2R51A 1J9SA 4NQTA 5B1JA 1ZVNA 3U9WA 1QW9A 5DJ2B 1G7LA 3NEXA 2YEZB 3N9GL 3ZTEA 3SQBA 2YRLA 1XEDA 3EFOB 3MROA 3N44F 5HYQA 2X10A 1HHHB 4KRPD 4WFFE 1OLLA 4LPXA 1FGVL 1EUTA 3WTUA 5IHZA 3DIVA 3BVVA 3M8OL 1NLBL 4YFDB 1IGCH 3BAEH 4NJ9L 1D7CA 1M05A 1QNIA 1F3JA 4YLBA 1E6JL 3G9AB 5EU5A 5B1KA 3AAZA 5MHSD 2R2CA 3KD4A 1PQZB 3MRGA 4BXSV 4WKZA 1N4XH 4CU8A 3V5HB 5E8DH 5GZOD 1B6UA 4XNBA 1EAOA 2ZSWA 3Q8FA 1HL9A 4KTDH 4YPJA 1FNEA 2KC0A 3RNKA 1I1AC 5KW9L 5CD5C 4XNXH 3DA0A 1BZDA 5HJDA 3G9VA 4J6IA 4BXVA 5DCCA 3H0TB 4YAQA 5EZJB 5IQ9A 4PRHA 4U4BA 3NJXA 2OMUB 1FDLL 2D0HA 3U1SL 1I3RA 5LGJB 1W0YT 2KBGA 3BWUC 3D1MC 2FNBA 2Y7QA 4G7SB 1R46A 1T1YA 2J57A 1OT1A 4M1GL 1KJ2A 4Q2ZA 4W4OA 1DO6A 5EU7E 4X9GA 3SKNB 4DP9X 3ZZLA 1WFJA 3MNMA 4PJFF 4PRDA 4ZUSA 1Z9SB 1UKQA 2AK4A 1AMYA 5DTFA 2OBGA 1B0IA 3T0VA 2GCYB 1ONQB 2O30A 3MV8E 1DJZA 4P3WA 4WY7L 4KV5F 5JR1L 3R7RA 1B4RA 3IE4A 3ULVF 3QQ4A 2FYYA 4UANA 5CJOL 2PPDA 4HA1A 2FEDD 1EAPA 2WXIA 5JXEA 3CU7A 4XPFL 1UH4A 2RD0A 1RU9H 1JS4A 4JM2B 4K15A 4QD2E 1AD0B 4TQIA 2XN1A 2VMDA 5FUZL 5E8NA 3V4UH 4F80A 5ECGA 4LOUC 4JM4L 4XNYL 1P2CA 4KJQC 2DQHH 3BN9C 1H3PL 4P2RD 4KJYB 4R96B 1KGCE 3Q1SL 1WUNT 1E4JA 2ISDA 4GKSB 3ZT6A 4M6OH 2Y1AA 1IAIH 1GAFL 1FYTE 2RMNA 3KJ6H 4NZUH 3WXWH 3L3OA 1F4XL 1X5FA 4ODWB 3DRTA 3FSVA 1J18A 3A4AA 2TRHA 4OZIA 4K7FB 1LD9A 2QSCL 1KJ2L 2BDNH 3JV4B 4HEPA 5I76A 4DN4L 3NMEA 3RX7A 1JRHL 4QRSB 3KNBA 3DOHA 4ZQKB 4JO4L 2ZCZA 2EE0A 1Y6MR 4XWGL 5T5FA 5JW3H 4HJIA 1OE3A 1CLVA 2JCWA 4MNHA 3MV8B 3TBCA 4Y9GA 2WLIA 3N0AA 1JK9B 2WXRA 5E95B 3FXIC 4AGNA 2YJQA 1YHPA 3RILA 3T0EA 5IW3A 3BISA 4YE0A 4G8GE 2EYRA 3B9EA 4M5SA 4U7MA 5I5MA 4C4KT 4AEIH 1TF4A 1ZS2A 1K2DA 3MNWB 5EBWB 1SF3A 2EQDA 4ENZA 2YQGA 1X5YA 3OXSA 1A7OH 3VFRA 5D4JA 1ERNA 3QDJA 4RZKA 1MJJA 1JZ2A 3Q48A 4EZKA 2GUYA 1H3UA 2OL3H 1L3WA 2F7QA 4X0KA 3I6GB 1FYTB 1SY6A 4BWWA 1H15A 4U3CA 4IOFD 4A04A 4Y89A 2YPVA 3TP4A 1YC7A 5MP6L 4Y4HB 1MFEL 1UA6L 3Q5OA 1HSAB 3ASNB 1PFCA 2EADA 4XO5A 4WFFD 4YZWA 3V5DA 4DKEL 4K9EL 2AQTA 3WTWA 1OAXH 2PW1A 4JVWA 1F11A 3BFOA 3QIBA 4A2MA 3VYOA 3GB7B 4W9HC 1G9NL 1F90L 2NQCA 2P8PB 7CGTA 1T5XB 1QFOA 5D1XC 3QH3B 3QQ3B 4G9FE 4KOBA 3QZWA 3A6CH 1S9WA 2VZ1A 4K3JH 3M7FB 4P99A 1XBDA 3QUKA 2DQDL 5GRJL 2C9VA 4ZJ9A 2ZX5A 2ZYRA 1GYWA 3VB8A 4JM2D 1UB5A 3KS0H 4G8GB 3MJ9A 4AIXA 3PABA 4AIZB 4IBQA 4TNWK 3VNZA 4N3TA 3AJ7A 1XV8A 1MIML 5ES4B 5FA3B 4IOIA 2X4SB 4ZT1A 1A4JA 3DTXA 2J8UE 1FGNL 1NAMA 3Q5TA 3IFLL 3KL5A 4LSVH 4XCYA 4YXLL 4HKZA 3RRQA 2OR9L 3I6LD 2R0ZH 5AZUA 3JTBA 3GDCA 4XOAA 2D8KA 2KMWA 3SBRA 1LO2H 2YPVL 3DSFH 1S9XA 5EO9B 4F2EA 4ZS7L 3GKWH 4EIGB 3WELA 4HP5A 5HI4D 4HJ0D 3L4TA 5IOPB 1CE1H 4JJOA 4OVUA 1ZHKA 1A9BB 4Z7QF 4PG9B 4MD5B 3BN3B 3ILDA 3PNRB 3F5WA 1QAWA 4JZNA 3WS6A 2WXLA 3IK2A 3UPRA 3MV8D 2X9ZA 1MREH 3FO1B 4FNTA 1RJLB 1NPNA 2BS9A 3NFPB 2YD1A 3OZLA 4AM0Q 1XD1A 4N2FA 4X6FA 4OFYD 3IAQA 1F6FB 1FE8H 4G9FB 3R8QA 1G6RA 1FFTB 3NCXA 2XZQH 1UD5A 1X44A 1VFBB 3GI9L 4GW5B 4KH9A 3TVMD 2EEDA 4CW1A 1SMOA 1U3NA 4GRWB 3EJJX 3B1UA 4BCZA 1X5LA 3MJ9L 2ADJB 4AL8C 4F7MB 4F9LC 3R06A 5KOVC 4ZMPA 4M8UA 2C1PB 3D2TA 3GLAA 2FBRA 3I9GH 1KGCD 4JZOB 1FFQA 2J8UB 1JYVA 4KMTL 5DMGC 1KIUB 1NAML 5DUPH 3FOLA 1HINL 1QNZL 1FYTD 3REWA 4F58L 1HS6A 1RAMA 5I5IA 1WVZA 1KLGA 1P84J 3UTTD 1WGOA 4LCYA 4P23A 4Y4HD 5I1AB 1HYSC 5J6GA 1W72B 2Y5TB 3WDIA 1S6NA 3ZOAA 4I1NB 1YZZA 1AD9B 1I1YA 1IC7L 1OF2A 4P59L 2D7TH 3RGVB 3T2OA 1CL7H 1I9IL 3V7AE 4GIAA 4DAGL 2HX8A 3NIDE 1S7UB 1F02I 1Z3GH 3JV0A 1A0QH 4U0QB 2CDFB 1D2PA 3FU5A 4XN1A 4LDCA 4FLQA 1MFDL 4XH2B 1RZ7H 3SJVE 3SO3B 4YR6A 1L9RA 3MRJA 5EWIL 1RZGA 1VKXA 1G6RL 4G8GD 3BPOC 4MX7B 2CJSA 2EINB 2K8QA 3H2PA 5CCHE 3WIFA 2ILLA 3NCCB 3HS9A 4NXKA 1KCVH 1ASQA 4XO4A 2OYLA 2WWNA 3AS2A 1FZJB 1T04A 1SJVA 1YN7A 2QDVA 4QY8B 2WBKA 4MS8C 4ZDHB 1FL5A 1RZKH 4KVCL 2ICWJ 1BVKA 3ML8A 4MSWB 1FF5A 4KKAD 1YQVH 4TUKH 2XJKA 2IAMC 4M00A 1MKFA 2XWTA 1PPIA 3BXNA 2QMKA 1ZGLB 4XP9L 4DGYH 3CZSA 1R75A 4RMRA 1NFIA 3LQMA 2GC4C 1TQVA 4H20H 1JPFA 4ZMAT 1JNHA 3QA3A 4IGBB 2A4CA 3MRDB 2HUHA 1WC7A 3NIDB 3SGJA 1HCYA 2DYPB 3SPHA 2B1AH 5E8EA 1L7TH 1U95B 1U8QB 2BSTB 3FO0L 1E5BA 1TQCC 5DZOA 2FQDA 4Y1AE 2FSEB 4UTCA 3ROOA 3SJVB 5ISZE 3CIQA 4ESKA 1XGPB 4TNGA 3LEXA 3B6SA 1A1NA 4MB4A 3VXNB 5KVEE 4YSAA 4IRSC 1WIPA 5KSBF 5D7LA 2B77A 3F12B 1RK7A 4HCFA 1YRKA 5IEKA 3HOGA 3WY4A 3O3BB 2MQ3A 4F24A 2ZAHA 3AACA 4M7LH 4GRWF 4ZXBC 4Q7DA 4OFDA 2O4EA 4CVXA 4NC1C 4DPCX 1NFAA 3QCVH 5H2BB 4GFXA 3CJJA 2IPTL 3DX7A 4G6KH 1CFTA 3JV6B 5J6SA 5LJYH 3QJSB 2BSSA 4WWKC 4U7SA 5C0CE 1IRAY 2E0PA 4N8VA 2ZOOA 1RMFH 5I6KA 1I8MA 1RULH 3CPLB 3O2WL 1BAFL 2JLPA 4Z0BH 3W5MA 2WAQA 2E47A 5L9DL 2OZ4H 4X7SH 1RHFA 3EOTL 4ZX4A 2WXNA 5E2WL 2V0AA 2YD4A 3WIIL 1SBBA 1TVDA 3M46A 3TBTA 1FO0A 1D5ZA 4NZTH 4XNZB 1I8UA 2FD6L 2X6VA 3SYCA 3IDIA 4JO3H 3V4VA 1X5KA 3ROLB 3T5WA 3BYYA 3T9WA 1BLNB 5ISZB 2NYYD 5D93B 1D5XA 2VMFA 3UJJH 4ODHL 4LCIH 4LOFA 3B56A 3G6AA 1I9RL 2GVYA 2JQZA 5DFWH 5HDRA 4ADIA 2B1HL 3HG5A 4JANA 5HYEA 5AYTA 4N2MA 3VWKC 1IT9H 1E9OA 1TVHB 3DHUA 3VX1A 4DOHE 1EVTC 6FABL 3O3AA 3VD0A 3N55A 4YBLB 5D7JA 1Q4NX 4Y5YB 2E8YA 2QGCA 4A68A 1NANI 5KN5B 4NQEA 1AS6A 1G5GA 1NCDL 2W07B 4ELKA 1PGRB 2X4UB 5KANI 3VRIB 4I48B 5H35B 5F9WC 2DLIA 5C0CB 5F44A 1DJXA 5AVUB 1F4HA 5GJSL 1CZ8H 2ZWLT 2DYPD 1NUDA 3HZYB 3L3GB 3UPAA 3DX9A 2YA2A 2A9ML 2O6EA 4IKJA 5D5MF 1ZA3A 3QNYA 2OJZL 2Z0BA 4EUPH 3VXUA 3VTTA 4C56D 5C07E 1BOYA 2Z31A 4KHXL 3SJVD 3T04D 1P7KB 4MYWB 4RFOL 5E8PA 1XEUA 2ESVD 3V4VL 3V8OA 4UZUA 1ZTMA 3CZKA 3ILPA 3H3PH 1IEAA 4R7DB 4ZMOA 1BQRA 3JT2A 5IQLA 2VIRB 4BKLA 1OKEA 3LN4A 4P2QA 3MYJB 5IFJB 3BRGC 3RKDC 4D8PB 1KB9J 2HT4D 4HJGB 5TDNB 2PPCA 1NDTA 1OW0C 3CFUA 3QJRB 4AK2A 1ZJBA 4GKNB 5ILTL 4FYRA 4RMTA 3V6OE 1NCJA 5AAMC 1NBYB 4ZS6C 4DO4A 1QR1B 2CM6A 3P4OB 3UC2A 1F4WL 2VABB 3M88A 1SUJA 1J1PL 1TQWA 2ITEA 3FCUB 2X70B 2FWOB 3KPRA 3QHZL 3MAWA 4URTB 2X9XA 4M6ML 3BIAX 2BNQE 4R90H 1UWYA 3U30C 5TD4A 5EEVA 1HHIB 2HH0L 2HMIC 2IGFL 1BYNA 1AHMA 1CMOA 5ANME 5KAQF 4KITB 3I9PA 5EORH 4J3XA 1YMHB 1IBFA 5D70L 4U1SB 4Y1AD 5C07B 5ISZD 2DWTA 2H2PC 3MKGA 4AE1A 4JPKH 1WZAA 5I8CA 5KVFL 1MCQA 2LOEA 1EXUB 1NIBA 4TUUA 5FM8A 2R7EA 4CC1A 2VC2B 5A7EA 3IMWA 2APVA 4Q9QL 2AFNA 1KBGL 3NFNA 3SE4C 4EI5B 3GXIA 4PPTA 3BUPA 1BQHA 1NBVH 3C60D 2DBLL 4NSKA 3FN9A 3OKKA 4NQCE 4ZO8A 4ZSOA 1E90A 3QULB 1P7QB 4UAOB 2JJWA 4Y4FB 4NKOA 4Q9BA 1RLBA 3PWVB 4XVJL 2YAPA 2C1OA 3L5JA 5I6XC 2CJ3A 1PIFA 4F2FA 5D2LF 3P3YA 3EDDA 1MZYA 1VEPA 3LVEA 5C0CD 5I26A 3HPJA 3ZPDA 4ZMYA 2YUWA 1AQKH 4X5XA 4LHUA 4LT7A 3SDXA 1F56A 1XH3B 1RP8A 1O9VA 3NA9H 1DP0A 1PIGA 4J6RH 2R59A 1QVOA 4M7JL 2JNZA 4OQTH 4RWYL 3QAQA 4XP1L 2VO5A 4I0PD 2ZXQA 4U1NA 3MNZA 5ANMB 2EJ1A 3VFVB 2BVOB 2NR6A 2MCG1 5TPWH 1OLZA 4IIQC 3WFBH 2K6ZA 4AQAB 3EBIA 4OM0H 2XWRA 3T1FA 1KLFA 3EJYC 5FV2A 3QFDB 3KWWA 4GS7C 2H6PA 3T77A 5FHBL 3CSYA 5D9SA 3TYFA 2FEJA 5INDB 3JT0A 5E7FA 3W38A 1M7IB 3UBFA 3FU0A 4X6EA 4AL8H 4NQCB 2JB6B 2EP6A 4GT0A 1N68A 3DX1A 4APXA 3D3VB 1OT2A 4MMZA 3FYIB 1AZNA 2CAKA 2PXYB 5KANG 1J11A 1WA2X 2BJML 4NNPL 5CF3A 1MNNA 4U1GB 1P1ZA 3CG8A 1IBHA 3LZPA 4Y16B 3MLZH 4JHAH 5GS1C 3RNQA 4M1CD 3O81A 5EBMA 2EDOA 4G6AD 4ES9A 4OM1H 3CXHJ 4YHPB 5DQJB 1ZPLA 4NZJA 4IBTA 4IMKA 4ZOCA 1AZVA 5C07D 4FLSA 3TFBA 1WBYB 4OV5A 3E9TA 5T3ZL 5HPMB 3WMSA 3S2AA 1R6VA 2AANA 1R4XA 4EI5D 4EKXA 1MRFH 3FH7A 4KHTH 5GZNC 2A77L 3CVDA 1KXQE 4MNQA 4CGTA 1FVCA 2VDNH 3B2VH 2O61B 3T4AA 4P5RA 1F58H 4TQEL 1QPXA 5DZAA 3VWJB 3DGDA 3Q43A 5FO8A 3UTSA 1G87A 2EDQA 4Y4FD 1F4AA 3RPKA 3PGFH 2OXGA 1N0LB 2G9KA 4UDTB 4L4VE 5CGYD 3GZOA 3IETB 4HWBL 1XCWA 3MO1B 4YQXL 4OFPA 5HDBE 4KK6D 4PV9B 5AVWB 4PJHE 2FX7L 4QJ4B 5E1GA 3ZL1A 4FN0A 4OTXH 3KLDA 4PJXE 3VFOB 3BWZA 3CFKB 4A63A 2BNQD 3MRCA 1GPOL 4HAKA 4WTQA 3W11C 1CJYA 4H4NA 5K9KB 4J5VA 2WLLA 3K4ZA 1H6EA 2CO3A 3LDBB 3LEYH 3L1OH 3V6ZA 1U8OB 4FXKB 4MQXD 3BFWA 1NTDA 4W1TA 4XP6H 4I18B 5DJDA 2JIXD 4PJEF 4ELMF 4P5SA 1R5IB 4PJDA 3MREA 5I1EL 3OG6B 1VGEH 1L0PA 4ZTPL 4HFWA 4MKTA 3HS0C 1WGVA 4XVTH 1WWAX 1CDHA 2TRYA 4U6HB 1JTTA 2Y25A 3PHQB 4NPJA 3BLPX 4Y0GA 1A8JH 2VLJA 3ZGHA 3QUZC 1LNUA 1M9SA 1E4KC 2UZYA 1ZLSL 2FL5A 3I2CH 5DRWA 4HKJB 4NQCD 1YY9D 2VSCA 3OWEA 2FHCA 3CLFL 5EU6E 4PRAB 2IXQB 2LTQB 4HJEA 3T8MA 4LQFH 3LNEA 5F3HB 3DKHA 4TSBH 4L4VB 4ANWA 4Z8FH 4K8RD 4XGZA 5KSAC 1R0AH 4PS8A 5HDBB 2FECI 4PJHB 4KUZH 1M1SA 4QXTB 5JW4R 4WW2B 3FCSA 1P4IH 3ZHLA 1NZRA 3BI9X 1U2YA 2VDQL 4R83A 3LPPA 4GSQA 4PJXB 5AOJA 4NWUL 4WQOA 1AR1D 1ZLDA 5DJXA 1T22B 4M9OA 4HIJA 4R7XA 4ETQA 5BVJA 4GAJL 3A4DA 2EYSA 3V7AG 3M7OA 5DQDH 4BIKA 2FAUA 4NM4H 4NHCH 4GUOA 1BQLL 4QXGH 5CWSA 4TLTA 4F7CA 1U3HA 1EDHA 4JFEB 1G1OA 2YBRB 1HWWA 3BZFA 4D9QE 4JFOB 3ARBA 4QJ3B 1RZFL 2JQAA 3R19A 4P3DB 5LXVA 3VWJD 5E08H 1TR7A 3WEMA 3KYOA 3QXAB 4LGPB 4APQC 4DZBA 4G70B 1LO3L 4AKQA 2V9RA 3OHXA 4FI6A 3MV9E 4N68A 1I1FB 3OKOA 4JZJA 2AEIT 3G5YA 4PMFA 3FC8A 3RWJB 5GHWH 3BUYA 5FGRA 5IWLC 3MRKA 2VXSL 3ABLB 3MA7A 3EYUL 4MXQC 1IBGH 3AM8C 3NYKA 1T5WA 2YMXL 3L4CA 1XCQA 3QNZA 2EDDA 4PJAB 1MCWW 4NN7B 2GIYA 3QUHA 3B3BA 2P3YA 3EHBC 4U05A 2UZPA 5SWZA 5KVDH 2J43A 5LAXB 3JWNC 4H8VA 3DVIA 4X4ZA 5DHYB 3TO2A 1JGEB 1F1DA 3T3ME 3FQXA 5DUML 4WI0B 1XGTA 3LZNA 5KAQG 1T80A 5J12C 3NZHH 3QUYB 3FB8A 5DHMC 4M8RA 3LHPH 5B3SB 3TIDB 5ITBL 2O6FA 3F2LA 1QTYT 1VAHA 4K3EH 3N40P 3O6FC 5ECJE 5GRXG 2QHRH 3TL5A 3JTSA 4UTBH 1VACB 3AREA 3CBRA 5FHAL 3C6LD 2CHWA 5HHPB 2NY3C 3QIWB 2CIIA 3TONA 4WFEE 1TJXA 1BP3B 1PKQA 2EDRA 5AB9A 1GJUA 4N8UA 4ZFQA 3MV9B 2V2WA 2BFVL 3FQNA 1ITBB 4L4VD 4NERA 1KACB 1P5UA 1GS8A 3BVXA 5JO5A 1WCBB 2Y7NA 4RRPG 4ONOA 1HL5A 4FNQA 2OX5A 1HKLL 2AJ3B 1NWOA 3MRHB 5EEWA 3HG2A 3D51A 1MLBB 3K2IA 2CMRL 1DQMH 3ASWA 4HIPA 5HDBF 1S7RB 1X5MA 4MB5A 1J9RA 3UTQB 4WW2F 2APXA 3FFCE 2EEAA 3T3MB 3CDCA 2G2RB 3TBSB 2DOCA 1MQ8A 1UXWB 4K3DH 4JDVB 2G9HA 4OH2A 1HHJA 1NL0L 4N25A 2HT2C 1PJWA 4X7TB 1KJMB 2Y5QA 4OCRL 1NCBL 4E9LA 2CNYA 5E23A 4HWEL 2OYKA 4ZUVB 2CHDA 3H9SE 2G4EA 5EU6D 1NFDA 2WYIA 5FK9A 1A21A 2CKBB 4Z3IA 2I9TA 1IEHA 4N5EC 2ZOKA 2NNAA 5CGBA 4PJ6A 3A47A 4HG4K 1OZTG 4M4RA 4X83A 3Q7JA 1H6FA 1IEBB 5I0XA 4U1IB 4J39A 4G2AA 1INEL 1SQ2N 1T21B 5DYFA 4O5LH 1HQRB 1W2KT 3EYSH 4PRBA 3BP6B 4TVSa 1E3XA 2NUTB 4WIQA 4GP8B 2EILB 4LVHC 5DUBB 3KYNB 4RBPK 3UO1H 1SBSH 3IPFA 2GBAA 4LARH 3K8MA 5CEZL 3AXLB 4PJAF 3IFOA 3UIYA 1QLFB 2NY5C 3FFCB 1F4YL 3QUYD 3FCTA 2KYIA 3I50H 3ZR5A 4P05A 1EVUA 2YN5A 2BOLA 3H6AA 3F84A 4HD5A 3Q6GL 4YE4H 3T2NH 4C59B 4D9QD 5KTEH 1LTXA 5EU3A 2HB0A 4NKDA 3U4EB 4ANVA 4PGEB 1CTNA 1YAZA 3K8LA 1HILA 3QIWD 3TF4A 4J3OC 2WYHA 2XLLA 3NESA 2OTWA 3H9SB 4GSDL 1SOQA 3MV9D 4KQ4H 4XO8A 1DJSA 5TFSH 4Y2DC 2A83B 4XNDA 3KM1A 1JGLL 4OIBA 2PWDA 4YK4C 1QEXA 3UC0H 3O9WC 5HY9B 3WFDL 4N6RA 3MRBA 3KPPB 1NLDH 1IM3B 3CAFA 1EHLL 3KVDD 4CMMA 3US0A 3BWUF 1H5BC 4TQPA 1MHCA 3F6LA 3OLIA 2P45B 3QCUH 5FDWA 3A24A 1L9NA 2GUOB 2GTWB 4AW7A 1PAZA 1ACYL 4LKXB 5H94A 4NWTL 4OSUL 3U2SA 4S0TD 3EYVA 5CEXB 3AT9A 4YDJB 2BRRH 1JD7A 4JUSA 4FFWD 3AGVA 1WUZA 3UBXG 3HC4L 3RWIA 3RWHA 2Z8WC 5J9PB 1X7QB 3K71A 2YPLE 2Y6SC 3B83A 2QFPA 1T03L 4Q9RH 1FAIL 5D6CB 1JZ5A 3DX8A 4HS6B 2CJUH 1I9JL 4IQHA 2P24A 5IT2H 2IOOA 4KJQD 1XGRA 1ZS8B 3BN9D 3IXTA 4WF7A 3DC0A 43CAB 1Z0MA 4WFED 4Z5RB 4H88L 5IJVB 5GGTA 2QQKL 4LVNB 3UERA 4DNLA 5D2NC 4WV1C 4ZUTA 4PIBA 3SKJL 1KWGA 1TYEB 2CUIA 5GGUA 2A9CA 4MDJA 4IRJC 3CZJA 4N2EA 4DF9A 2CG9X 3AQXA 1U8NA 4G8FA 2B16A 1FH5H 3Q1EA 4QXVA 4JFFD 2HG5A 2ZNXA 4MMXB 1T6WA 3RWDA 5ITFB 4Y2OA 3GMQB 2NW2A 3SBWC 4J3WA 2J88H 2VRAA 2YXMA 3N40F 3FFCD 2Q7YB 3SCMA 3D0LA 3TO4C 3LIZA 5ALBL 5TE4H 4P57A 4FNUA 1EEYA 1JHTA 4DGUA 1O9ZA 4U6VH 3BKYL 5FYKH 1KEGH 4FXGA 1OOWA 2CM5A 2YPLB 5DZLA 3T4YA 4OZ4B 1F42A 1YYLL 3PWUA 4M43H 4RFEB 5D55A 1IM9B 2VWEE 4Y19A 3MRMA 4WTZG 4M9PA 3H9SD 2FJSA 1JN6B 3GTTA 1OXYA 3OR7A 3TPKA 3TJHC 2XZCL 3G6JE 5GGTL 2VDLH 1GZHA 1RK1A 2M8XA 2AJVH 1S9YA 3CQPA 3X11B 1IM3D 1CXKA 2D7PA 3ZYIA 5FUCC 3GSUA 2AV1A 3VXTB 2CJTA 5AKSA 4E9VA 3WLWC 5JOFA 3QNXB 4OZGE 2OK0L 2CGYA 1ZV9A 2CDEA 1OAUH 2D3JA 1L6XA 1XZ0A 2A6JA 3ZRSA 4GAFB 1NOFA 1GY2A 5A1AA 4W4OC 3K72B 3FH8A 4HUXA 2PYED 1BFVH 3KEDA 1S8DA 3C8KB 4FQCH 1OB1B 3V4PB 5IB3B 5A6IA 4JRYE 3QISA 4JPWH 1YNTB 3OX8B 2DQGL 1EMTH 1U8PB