3QPKA

Probing oxygen channels in melanocarpus albomyces laccase
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
559
structure length
559
Chain Sequence
b'EPTCNTPSNRACWSDGFDINTDYEVSTPDTGVTQSYVFNLTEVDNWMGPDGVVKEKVMLINGNIMGPNIVANWGDTVEVTVINNLVTNGTSIHWHGIHQKDTNLHDGANGVTECPIPPKGGQRTYRWRARQYGTSWYHSHFSAQYGNGVVGTIQINGPASLPYDIDLGVFPITDYYYRAADDLVHFTQNNAPPFSDNVLINGTAVNPNTGEGQYANVTLTPGKRHRLRILNTSTENHFQVSLVNHTMTVIAADMVPVNAMTVDSLFLAVGQRYDVVIDASRAPDNYWFNVTFGGQAACGGSLNPHPAAIFHYAGAPGGLPTDEGTPPVDHQCLDTLDVRPVVPRSVPVNSFVKRPDNTLPVALDLTGTPLFVWKVNGSDINVDWGKPIIDYILTGNTSYPVSDNIVQVDAVDQWTYWLIENDPEGPFSLPHPMHLHGHDFLVLGRSPDVPAASQQRFVFDPAVDLARLNGDNPPRRDTTMLPAGGWLLLAFRTDNPGAWLFHCHIAWHVSGGLSVDFLERPADLRQRISQEDEDDFNRVCDEWRAYWPTNPYPKIDSGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Laccase-1
publication title Probing the Dioxygen Route in Melanocarpus albomyces Laccase with Pressurized Xenon Gas.
pubmed doi rcsb
source organism Melanocarpus albomyces
molecule tags Oxidoreductase
total genus 177
structure length 559
sequence length 559
chains with identical sequence B
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2011-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3qpkA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3qpkA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3qpkA03
1KBWA 3PCYA 3DTUB 4G7RB 5IY5B 3UADA 4AX3A 1JZHA 1AANA 3NT0A 2IH8A 3X1EA 1TKWA 2CJ3A 2IDTA 4KOBA 3CVDA 3QJVB 2XVBA 4G7QB 2YARA 1BXAA 1XB3A 3FYIB 3NJIA 4NB7A 2PCYA 1A3ZA 1ZDQA 5I26A 2DWTA 1NPNA 4F2EA 2YXWA 1ADWA 4N4YB 5AFAA 4HIPA 4F7KA 3V9EA 2BWIA 2I85A 4CSZA 1GS6X 7PCYA 4E9XA 1A4BA 2LLNA 3PAVA 3TBBA 1GY2A 5B1JA 1GYCA 1IUZA 3SBQA 3SBRA 2IDUA 1NIEA 4FAAB 1J5DA 1QLEB 2VM4A 5I5IA 2VW4A 3ZIYA 1AZCA 1WS8A 1J9TA 5B1AB 3BVDB 4DP1X 2R7EA 4W9ZA 1KCWA 2AANA 4RH4A 4GYBA 2PP8A 2AZUA 3WNIA 2YAPA 2IWFA 2BP8A 3MX0B 2YQBA 1AS7A 3ZBMA 2JFCA 3TA4D 2AZAA 1J9RA 4DPBX 1OE3A 1BQRA 3KW8A 1AG0A 1NIFA 2X87A 3OMAB 3EH3B 3T71A 3QPKA 3HEIB 1BXUA 2XLLA 5AZUA 4YVUA 4UAHA 4A2HA 3IBOA 2BP0B 3QJSB 1IBZA 2MTAA 4P5RA 1XMEB 3NJHA 3V9CA 1PAZA 2BW5A 3WIAA 1BXVA 1HAWA 1JVOA 3FU7A 1L9OA 1BYOA 1GY1A 5ANHA 2PPCA 1JZIA 1OCOB 2IDQA 2JXMA 3FU9A 2JKWA 2YAOA 2GHZA 3IN0A 3FQ1A 4YSCA 1L9TA 5I6MA 4E9RA 1W8EA 5D4IA 1JERA 3UAAA 1SF3A 1AOZA 1JOIA 4Q89A 2BO0A 5B1KA 1ILSA 2I7SA 3D12B 3EF4A 4DP8X 1CC3A 2E86A 4HCGA 3U25A 4GY4A 4BK5C 1UATA 2GI0A 2XV3A 3PPSA 2EIJB 3NJMA 1DYZA 1SHWA 1B3IA 1QNIA 2BWDA 2FJSA 2RACA 1NWOA 1A8ZA 2H47C 3FSWA 2PP7A 4KO9A 1WAEA 2FQGA 2H5UA 1JZJA 1NDTA 4GP5B 2P80D 3GXUB 3GYRA 3JTBA 2J57A 5B1JC 1PMYA 2BZCA 1NIAA 1GR7A 1WA0X 1L9PA 4DP2X 2PPFA 4DP6X 4A68A 1ZIAA 4TXVB 1JXGA 1PZAA 4EF3A 2IWEA 4NERA 2GC7C 2BHFA 4BDVA 3IN2A 1PF3A 1E5YA 1NIDA 1N70A 3FS9A 3T6ZA 4AKQA 4HAKA 1AR1B 1NINA 5A7EA 4NAJA 1GW0A 2GSMB 1IC0A 3NJFA 4AI7A 1V55B 4YSDA 4E9SA 4HHGA 5I6NA 1V10A 1OOWA 3PXLA 3CZUB 3S3BB 1KBVA 1OCRB 1AS8A 4CSPA 3FQYA 1L9QA 4G72B 3S8FB 2WSDA 2H3XC 4A66A 2XXGA 1E5ZA 1KYAA 1JXDA 2PLTA 3NJJA 4BDVB 2CALA 1FFTB 4Q8BA 4AKPA 1AAJA 3QJUB 3ERXA 4X4KA 1SFHA 3NSCA 2BZ7A 3T6XA 1JZEA 2DWSA 1XB8A 2GB2A 1PNCA 4KNUA 4N8UA 1ZPUA 4BWWA 5I5MA 5B7MA 2DV6A 4G71B 5E9NA 2W88A 3WI9A 2GC4C 3OD3A 4ZK8A 3BQVA 2Y1AA 3CG8A 3QJRB 3EH5B 2BP0A 1J9SA 1XB6A 3OMIB 3DKHA 1IKOP 5D4HA 2A3TA 1KDIA 2OJ1A 4JHUA 1AQ8A 2HLEB 3FPYA 4YSPA 1JZFA 4A2GA 1AIZA 4HCIA 3X1FA 4DPCX 4KOCA 4DP5X 2B3IA 3TASA 3RYMA 4BXSV 2HX7A 4UF7C 2QPDB 1ZDSA 1MG3C 3FQ2A 2OV0A 1NICA 1YLBB 1E67A 4YSUA 2J5WA 3ABLB 2QDVA 2VMJA 4F2FA 3AW5A 1AZNA 2PPEA 1I53A 4KNTA 1AS6A 3FT0A 5PAZA 2CUAA 1SJMA 1J9QA 2FQEA 2XX1A 2YXVA 2XV0A 2QPEB 4K9JA 2HXAA 6PCYA 2WO3B 2UXVA 2Q5BA 2UX6A 2EINB 3ABGA 2IDFA 3ABMB 1CUOA 1PNDA 1WA2X 1PLAA 2CBPA 4DPAX 1KCBA 2EIKB 3H56A 4QKTA 1AZUA 1NIBA 4HHWA 1GS8A 3FU8A 1MZYA 1RZPA 4ENZA 2B08A 3QQXA 3OMNB 4M4RB 4GXFA 1CYXA 1RKRA 1J5CA 3GDCA 2OCCB 4DP4X 5I6OA 1PLBA 1ETJA 3ABKB 2Y69B 1A4CA 4KO6A 1N68A 2XX0A 4M3HA 4L0PB 1ET8A 4WKXA 5D4JA 2HX8A 2VSKB 2XUWA 3G5WA 3ZX1A 3AG4B 2IWKA 1ZIBA 2DYSB 1ZV2A 2FT7A 1SHXA 4E9YA 4WTQA 5F7BA 4GP8B 3C75A 3NSDA 4DP7X 2X88A 4BWUA 2XYBA 3S8GB 2AVFA 2UXGA 4YSEA 3NSYA 3KW7A 3FPXA 1EHKB 4BXVA 3WKQA 3PLYA 2NRDA 4A2DA 1M56B 3NSFA 4YVNA 1M9WA 3NP4A 4YSOA 1NWPA 2FNWA 3IEAA 3H4FA 4E9WA 1MDAA 3X1GA 2HRGA 4DP0X 3EH4B 1SF5A 2YAFA 1M57B 2ZXWB 4YSTA 5B1BB 2CAKA 3N55A 3WKPA 3X2QB 3T6VA 4BWTA 4G7SB 1AZRA 2EIMB 4GP4B 4A2EA 1E30A 1KDJA 2HX9A 3SQRA 2QT6A 2TSAA 2UX7A 1JVLA 1E65A 3ASOB 1AACA 4YSQA 1TEFA 2YAEA 2J56A 3N2JA 1FWXA 4YSSA 2PP9A 2XV2A 1ASPA 2VSMB 3UACA 4JKNA 3UABA 1OE2A 2UXTA 1SDDB 2VW7A 1MZZA 3AG2B 1AG6A 1X9RA 3PAZA 7PAZA 2J55A 4AKOA 1ILUA 2XU9A 3S3DB 3ASNB 4JHVA 4KO7A 5I6KA 1HAUA 3AZUA 2FWLB 2Q9OA 2VM3A 3X1BA 1PY0A 3T6WA 2BW4A 1BYPA 5EHFA 2FQDA 1W6LA 3ZDWA 1DZ0A 3FYEB 3FSZA 1FA4A 2HRHA 2XXFA 1TEGA 1OV8A 1GS7A 3WG7B 1NZRA 2WO2B 1OCZB 1WA1X 3H4HA 3DIVA 4UANA 4E9VA 5TK4A 2EILB 2GIMA 3TBCA 1RCYA 4A2FA 1KV7A 5I6PA 2TSBA 2XWZA 2DY2A 1PZCA 5PCYA 1OE1A 3MBWB 3NJKA 1BQKA 4MFHA 6PAZA 1HFUA 3X1NA 1SFDA 4DP9X 4W1TA 5F7AA 8PAZA 1V54B 1ET7A 3NJGA 4KO5A 2IAAC 2FQFA 1CURA 3WNJA 5B3SB 1GSKA 1F56A 1JZGA 2P80A 2PPDA 3L45A 2YAHA 3QJTB 1A4AA 5TK2A 3CVCA 1OCCB 2ZWNA 3FSAA 2DYRB 1JXFA 1BAWA 2R7EB 2GBAA 1RZQA 3AY2A 4E9QA 1KGYE 5AKRA 3OM3B 4P5SA 2BP8B 4E9TA 3CDZA 1NTDA 2CCWA 2QDWA 9PCYA 3AG1B 1PCSA 3NJLA 1URIA 4QLWA 1ID2A 2N0MA 3QJQB 1EZLA 2IH9A 2ZOOA 4YSAA 1W6WA 2I7OA 1R1CA 4HZ1A 2FT6A 2AFNA 3OQRA 5FC9A 1CYWA 2YAMA 3UGEA 4G70B 4YSRA 1PZBA 4FA7B 3HB3B 3SBPA 3JT2A 1TU2A 3IE9A 3FU7B 1MG2C 3NP3A 2PPAA 1L9RA 3PAUA 1BEXA 3CDZB 2FTAA 2MRYA 3T9WA 1ASOA 1IBYA 2VW6A 4A67A 2IDSA 1SDDA 1OF0A 1ASQA 1L9SA 1PLCA 5I5JA 5B7EA 3EHBB 5B7FA 3FSVA 1AZBA 4YL4A 4HCFA 2ZONA 2PCFA 3CVBA 3S3CB 2UXFA 3AG3B 3TU6A 1WS7A 3NJNA 1SNRA 5I6LA 1VLXA 5LDUA 3NYKA 4AZUA 2W8CA 2FT8A 5I28A 1BQ5A 4HALA 3UAEA 2HZHA 1NPJA 2YAQA 4PAZA 1X9UA 1T5KA 1ET5A 4PCYA 2VN3A 1A65A 1QHQA 4KNSA
chains in the Genus database with same CATH superfamily
1KBWA 2W07A 4XWOC 5J5EA 3CXDH 4AQZA 3CHRA 2WXQA 3S5YA 4JFEB 4JFVA 3WO4B 1VZGA 5ERWA 4LT7A 5DJ2A 1TLKA 3MUGB 1J18A 3FO0L 4NB7A 4LL4A 4I85A 1Z9LA 2NZIA 3DGCR 2OJZH 5C07B 2JSFA 1YN6A 1FSKC 2FECL 4HIPA 4KMQA 2EVFA 4B60A 2OCFD 3LNDA 1IT9H 3M1BB 2ZXAA 5JHMA 1GAFL 1Y6NR 1U8OA 3CXDL 5ACMA 1QG3A 5C3IA 4NZRL 2Z6FA 3KAAA 1WGVA 2CDGA 2AJZA 3VFMB 1IBGH 3QWOB 1CVRA 2HFFB 5JXED 3D4CA 4MNQA 4E0RB 2WVVB 1FAIH 4C4KT 3ZTNH 4WU7A 3ISRA 1EAQA 1KNOA 1YNLH 2OJZL 2EO1A 1AZCA 3QUHA 1HE7A 3ZT6A 5JXAH 1HILB 3SDDD 1DLFH 1W80A 4WI9A 4ECNA 2WLZA 4PJ8C 4P2QE 4JREB 1IBGL 2YAPA 3NIGB 2IWFA 1Z9SA 4QXTB 2UVEA 2AHIA 1X5YA 4TLTA 1FAIL 4PJBE 3U7AA 3ZTNL 4GW4A 3HBQA 3I9IA 2D9QB 2AZAA 3MVSA 2FX7H 4JRXA 3HG2A 2CDEA 4KUZH 4R26H 5JO5B 5CBAB 4M9PA 5JXAL 4RQQA 3PWPE 1DLFL 1CJYA 4I5BB 1IRAY 4PRDA 4RZKA 3AT8A 4JQIH 5HJGA 1SOSA 5KBDA 3QJSB 3VWKC 5I0WA 3U1QA 5FA4B 2WYTA 1HKFA 4Z78A 1V3KA 3WIAA 1R3IH 4QWWC 4NCC2 4RFNB 5E1AA 2LT9A 4UUJA 1L9OA 5C1MB 4KUZL 1QFWM 1WT5A 4AH2B 4HU2A 1T21A 4R26L 2MPVA 3H9SE 1MCLA 1QUNB 3OC5A 1S9VB 1TCMA 3MO1A 1AQKL 4JQIL 4TUKL 2KLSA 3U2SB 5IIEA 4IGBD 1CGYA 3B5GA 3VWJA 5K5YA 1PEZA 4Y5VA 3BYYA 4GLRI 1U8LB 4MDJA 5DFTA 2XWRA 5G5DA 4X6BA 2GBVA 3ZUCA 3FZUC 4M3JA 4H2CA 1ZHLA 4RESB 3NGBB 1MXGA 3ARGA 2ATAA 5KSAC 1I1AA 3PPSA 3B9AA 1D7CA 2YN3A 2JCCB 3SCMD 4BM7A 3FUKA 3S37H 5GS3A 3GNMH 4GSDH 5ENWA 3B4NA 1GC1C 4PD4J 3QGVA 2EABA 3DX7A 1JGDA 5GRWA 1F11B 3AB0B 5BJTA 3FUEA 1UA6H 2WN3A 1GR7A 3X12A 3ELAT 3QDMB 3GMLB 2Y2YA 1G7LB 3S37L 5E6SB 5GGUA 3GNML 2XRAL 4GSDL 1G9MC 4OQTA 2QBWA 3ESMA 1GJWA 1KTBA 3BSHA 2KYIA 3O4LD 4U1NA 1F0LA 1UA6L 2NY6C 4KKNA 3FC8A 1V55B 5J12C 2APWA 5KG9A 4H40A 3WIHA 1JV2A 1QI5A 3QEQA 1FNLA 1XSJA 2A77L 3AAZB 3PXLA 1JV5A 3GXFA 4NGHH 3RDTB 3WDIA 5I75B 5IJKA 2YPLD 3NCYP 3V10A 1K2DA 1O75A 4L29A 2W95A 3ZDXE 1D7BA 1U6AH 2WCSA 5CZKA 5D7IE 3T1FB 4MAYB 4RDBA 1N8OE 5L0QB 4JVUA 2FWOA 3LN4A 2BCKB 4KH9A 2Z7WA 1BM3L 3QI9B 5FKPB 5F88A 2YPVL 3EJQA 5FECA 1UFUA 1QLEH 3FRPG 3E38A 2ODIA 3OWRA 1M3IA 3TZVD 4OFIA 3NZSA 3LQMA 3AU1B 3GPEA 4PLKD 4BQ9A 3LDBC 4PYGA 5I18H 3SBWA 2V6HA 1U6AL 4WV1A 5D93C 5MI0C 2BRQA 1TQCB 2CCVA 3MRJA 3RLSA 5I6XB 3HR6A 4YHNA 3CG8A 4AK2A 1THAA 3K4AA 2H8PB 3B9KD 4DETA 4FEIA 1S7QA 1BVKB 2CO1A 5F2FA 3KYNB 3MRBB 2C8NA 1QLEL 1RZKC 3G5XA 3SE6A 5IHWA 1ZLDA 2R23A 4KFMA 1IZJA 4N2EA 2QSCH 2WJ5A 1AXSA 3US9A 1TVBA 3CFDA 5I18L 1DSYA 2CLZA 1H0DA 5LGKA 5LN8A 4QHMB 2CPCA 3GKWH 4HGWA 3RYMA 2VLKA 3FBKA 2VMDA 2I60H 1EGJA 1UB5A 4L4TE 3ME0A 4WUUB 5L88H 4R3SB 5ISZE 1TUPA 1IIKA 3TYFB 2CLVB 2V2XB 2AQQA 3KPSA 4TSBH 4FN0A 3SKJH 1T7VA 4XZUB 1KBBA 1YMHB 3C6SB 3CN2A 3OKMA 2ERJB 3WEMA 2X3BA 3PDDA 3GKWL 4N2LA 5JZ7C 4QAWA 1QA9B 4P3CL 3B6SA 4U1LB 4XN7A 3MRNA 2I60L 4FNPA 3NQIA 1I3GH 3V4PA 4KI5E 2EIZB 4WNJA 3SZKC 5L88L 3GMQA 2ESVD 1CUOA 1NCIA 4P4KC 4XP9H 4AITA 4TSBL 1Q9OA 3BIKA 1MJJA 1TMQA 4UOW1 2F54A 1H9DA 2DQDH 2JQAA 1I7TB 2LAAA 4M4RB 3T08A 3ULVH 1J5CA 3HIZA 2Q7YB 3PAYA 1DP0A 3ARFB 4R2GC 3FNKA 1NGYB 4KKBC 4YPGA 1I3GL 4W6WB 3FUFA 4P07A 3WL9A 5FO2A 3EGXA 3ARXA 5AVYB 4ZW5A 3U2IA 5C0DB 2VLLB 1PG7W 4XWOD 4OVUA 2DQDL 1LILA 1I7UB 3N44B 5IUCA 4ZFGH 5K69A 4PREB 4YHLH 2EUZA 1MY5A 1MW0A 3LRGA 1TTAA 5KANG 43C9A 2YZ1A 1K5NA 3FH8A 3ZZQA 2O93L 1X5AA 2G75A 4LLAA 2HTKC 3NIGE 4HJ1A 4LLYA 4MB5A 4OZHB 4Z18A 2NRDA 4B9FA 3JYCA 1XIWA 1R3LA 2CHNA 2PTVA 3D06A 4ZFGL 5KSVB 1T3FB 4EDWL 4YHLL 3CLFH 4JANA 4N0UE 4G80A 4OD2B 2YUWA 2V2TB 3UP1A 4Z23A 1U93A 1X7TA 4AENB 3I02B 4FI8A 5AQ0A 3RWIB 1D5BA 4L3CA 1DJSA 2BNQA 4B53A 3BSGA 1KDJA 3G3LA 4MD4A 2Y22A 3I9GH 1T89A 3DX6B 4BV1A 1J1XH 4WI3A 4LB8A 5AEAA 5EF3A 3D0LA 1KFGA 4N5UA 1QQDB 5IM7B 5ECJE 1BVNT 1UA7A 3UIZA 2OMWA 3PWLA 5FUZH 4IRJC 3CN1A 2X4SA 4AC4A 4AQOA 4M93B 4ZQKB 4N90E 2HJFB 1IARB 3DI2B 3I9GL 1SDDB 3WO3B 4POYA 3ARSA 1J1XL 5KOVC 3JTSB 4HJSA 3HAEH 1RIUH 3NCCB 2R69H 3OKKB 3VWKD 2E7DA 4M7LH 1JNNL 3QJOA 4XXCA 2JK5A 3IS0X 4QWWD 3P4OA 4PV9B 3U1PA 3X1BA 5KBMA 3L1EA 4N8PA 1IV8A 3HNSH 4N2GA 3K4ZA 4J3OH 5B39A 5FUZL 4IRSD 1IC4H 1P84J 1G94A 5ID0A 5GRJH 1ZXKA 5GS1A 1OY3B 4N26A 2VXSH 4Y16B 2XXFA 3AGWA 3BLPX 1SYVB 2WXHA 1VJSA 2O72A 1E0OB 2OI9C 1RIUL 1JMXA 2OSLA 2B20A 2R69L 3ARPA 3G6AA 4ZO8A 4ETQA 4LCUB 1NUGA 1GA2A 2O61B 4GAAA 3SJVD 3QG6B 5IOPA 3PP3H 2ZCHH 4WSJA 5TK4A 4R84A 4AY0A 1QVOA 2Y3AA 3HNSL 3QUZD 4AOFA 3TLRA 4BRVA 1LJMA 4PHZA 1IC4L 2OMXA 2VDPB 4TQPA 5GRJL 1MVUA 5KSAD 5IVXA 4YOKA 4NI6A 2VXSL 5BS0D 1FRGH 2BRRH 5FDWA 4AQAA 5GZNC 3WNKA 1U8JB 2CGZA 3DSNB 1JN6A 1WIUA 1ETZB 1B6UA 1MEXH 2WQVA 3F6JA 2OL3L 4UQ2B 1LHZA 2ZCHL 2FQFA 1BQHA 4Y19B 2EVHA 3Q48A 2G0KA 5E8NB 2ZUSA 2I32A 4OY9A 4APQA 2HVJB 3NCYS 5B3SB 1R19A 2R2HB 2WYHA 3KJ6H 1Q9KA 2B9AA 3BWUC 4FLOA 5J1TC 2ZTBA 1FRGL 2ZX7A 1BZOA 3BGAA 5TK2A 4GS7C 3FSAA 1OM3H 3MRRB 3SO3B 3CX5J 3DUSA 4E2OA 2FCBA 4S1RH 1MEXL 4CMMB 1EHXA 1BEYL 3L3GB 3II2A 4E9QA 2XWBA 3ZE2B 4IOFD 3VRIB 2PXYB 2BOCA 2Z4TA 1WFIA 3FT1A 3I74A 4YE4H 2BC4A 3TESA 2C3WA 2F6AA 5C0CB 1XGPA 2PO6C 4OFYD 2COQA 4KKQA 4P99A 3GBNH 4M8QB 3MFFA 2NY6D 4XRCA 4P2QA 4EZLA 4L4VD 4LMQE 4YPJA 1M53A 2G3ZA 1URIA 3MREA 1B4TA 1N8ZB 5ABZA 4S1RL 4KHTH 2A74B 3NK3A 2X4NA 4MNHB 4QRTB 5T3XD 4N22A 2FT6A 3MU3A 4YE4L 2CKBH 3ZKNC 2L4OA 1AIFA 1KXQE 2X4QB 5J1AA 1DJYA 4P2OC 4XBGB 4HFWB 4FQHB 4MASA 3PWPA 4CGTA 2UUDH 4ZAKA 1EHNA 1W72A 4HIIB 3FU5A 1NOFA 2AJUH 3KDMA 4Y5XA 5CJQH 5GSRA 3TCLB 3F5WB 4NC0B 3UL4A 4KHTL 3BP7A 3NVQA 2OW6A 2YEZA 4WWNA 2WZ5A 1ASOA 2FJHA 1INDH 2YQ2A 4GQRA 2CKBL 1RK7A 5B7EA 3EGDA 3RWHB 1QTPA 3I2CL 2I26N 3EUDA 4MS8C 2AJUL 5CJQL 1ZSDA 4UDTB 4N2OA 3AJ7A 4QRSA 3NJNA 1J8HB 2YSTA 3WJLA 3WFHA 4Q2ZA 1I85C 3DV4B 2BY0A 4XMUA 4H0LC 1E9QB 1KIRA 2WP3O 3O45A 5TDOB 1LK3H 1TNNA 4U6HB 1YMME 1A1MB 3A21A 3NIFB 5K9JH 4UV4H 1NDMA 2WBWB 2XTLA 4KV5F 4MA8H 3U9WA 3BAJA 1T0PB 1TO5A 3TO4B 1OGAE 5LXGH 3UBFA 2EICA 2IDCA 2Z8SA 4TUJA 1AANA 3NT0A 5M95B 1IGTB 3LYRA 2YD4A 4ZFFB 4NFDA 5FM5O 3QJVB 4XN9A 2ZPKL 4DGYH 2WWNA 3FQXA 4WUKH 1LK3L 43CAB 2PCYA 4ADJA 2DAVA 3Q3GA 3MJ6A 3NEEA 3I9AA 4OLEA 4UV4L 5EC2A 4BSWB 5T3ZD 5EULV 2ZT9C 3SYPA 5LXGL 3WE1A 4WHTA 1RQ5A 4P4KD 4FA8A 2RJMA 3S5LB 2V5MA 1GYCA 2CUMA 2OX5B 2Y7OA 1SMDA 3I85A 1TJMA 3LZRA 4JPKL 3NZHL 4WUKL 4DGYL 3QUMH 4YBLB 3Q2WA 3FT2B 2H2SC 2HG0A 4YWGH 4WW2A 4KKBD 1RHHB 2YSSA 1MCOL 3EHBC 3C8DA 1HXYB 3VXOB 2V3DA 3DX1A 1SQ2N 1K8IA 3VGAC 3IJHA 4JM0A 2FWSA 3F84A 4GSRA 5AVWB 2N56A 1HTYA 3APMA 3QUML 1OIOA 3WLBB 4LBEB 5D7IA 2JFCA 3RPIB 1QYGH 4NP9A 4XMKH 1U4EA 4LZKA 5DUJA 3EH3B 3T71A 1F41A 4W93A 4BIKA 1PKQE 2FIKB 3FT4B 4Y9FA 5F9JA 2V7NB 3BRDA 2HTKD 4ZPTB 1F2XK 4NOBA 5C08B 4JFFD 1F58H 2BP0B 5BPPA 2MTAA 4P3WA 5GGVH 4IRZH 2WLMA 3FHQA 5A43C 2GSGB 2IMNA 4WCYL 1JJUA 2BSBA 3MRDA 3DV6B 1OP5H 3PL6A 5T1LB 3UEQA 4XMKL 4KDTC 4XOAA 1TSHA 2NYZA 1UXWA 3PU7A 5JMOC 5KYYA 2A6KB 4Z7OF 4QXWA 1HWGB 5IKCA 5F9AC 3GHEH 3F7YA 3IXAA 3OR7B 1HXMA 4IRZL 5GGVL 2ADYA 1D9KB 1G1OA 5DURB 4LCIH 2XTJC 1HL8A 1NCBH 4P2RB 3VFRB 3AUWB 5C0FA 3KXFE 4NRXB 3CFKB 4PG9A 2K70A 5HYQA 5I1EH 4NC1E 1G43A 2FLRT 4O2FA 5JIIA 3GRGA 2Y6TE 2FEDC 2XZZA 4G43B 4L4TA 5F6IC 4IRJD 4PRNA 1Z9OA 3FCSA 3P0YH 1R3HB 5ISZA 3VXNA 4RFEB 3OSVA 4F5CA 1NJ9B 1B3IA 1E27B 3BD5A 3GHEL 5C2BH 4L3EE 1BX2B 3MBEB 2D3VA 3IB4A 2EDLA 3ZDYB 2F7IA 4LCIL 4U1GC 1NCBL 3RX9A 3PHQA 4D9LH 3WNNA 5D71H 2A4EA 4ZFOA 3VB8A 4M5SA 3GYRA 5A2FA 5I1EL 4G42B 5DVMA 1WHOA 1VEMA 4JFEA 3TWCH 3FUIA 2HPTA 4JQVA 4YGAB 4IHBA 3QUGA 3P0YL 4PRID 4EIBA 4YHIB 3MUGA 1TTGA 3BLBA 3NZUA 3SPVB 4Z7AA 5C2BL 3IKCB 3O6LH 5E4OA 4Y19E 1JNJA 2VIRB 4S0SD 4YDKH 3VFUB 3DA0A 4OF3A 4BFNA 3M1BA 4QTIL 1HSBB 3T6ZA 4AKQA 4LGSB 2DLTA 1NCCH 1SN5A 1UCTA 4PI2A 3VFMA 3QWOA 2HFFA 5DRWB 3RUGF 1KBGH 4NCDA 4NP4H 4YSDA 5ALBH 4HMCA 2WVVA 5CJOH 2Q86B 3O6LL 1SXAA 3GXMA 1JF6A 3AQDA 3J8F7 3G9VA 3LEYH 2EE3A 1V10A 1OOWA 3MACH 4YDKL 3CZUB 5C0CE 3S3BB 3S36L 4BK5A 1LO5B 3V4LA 3E7JA 1A1OB 4IBQA 1PDKA 1HILA 3ULUE 1FYTD 4KVPA 1BFOB 2WKGA 3MJ9H 4K5NA 4M5ZL 4PRHB 4OLYH 2D4FA 4B7LA 1NCCL 1IL1A 4Z7WF 5GISL 2AJ3B 3CSBA 4NP4L 1X5XA 2AERT 3ERXA 4QXTA 5CJOL 5ALBL 4F7EB 1SOKA 3RVUC 2OM5A 3ECVA 3MACL 5EO0B 2J72A 3BH9B 1PZ3A 3LEYL 4X6FB 1ZPUA 3A0OA 1YUHB 4ORGB 3QZLA 5CBAA 1PW3A 3WI9A 5JO5A 1KLUB 5D7KE 4I5BA 3MJ9L 3N43B 2WKLA 4NWUL 4OLYL 3QFJB 3CK0H 1OW0C 2PO6D 4KQ3L 5FA4A 1KCKA 1QWHA 4U1JB 3EO9H 1J5OH 4JE4B 3RIAK 1YEHH 3JV6B 3VD0A 4XNMB 4DZBB 3CZJA 1JDDA 2WOYA 3P9MA 3IMRA 4AH2A 1GL4B 3PWNB 4DPCX 1WO2A 3KGSA 1SVBA 1QUNA 1S9VA 1MLCB 5HHMB 1R24B 2B2XH 3W9DB 4WFEE 3U2SA 4PBXA 1N10A 5JIPA 3N9GH 3ZKND 1HOCB 3HG4A 1YY8B 4UT9A 4P2OD 3EO9L 1VEOA 1J5OL 1PGRB 1H5BC 2RR3A 4C47A 1U8LA 4YSUA 4JFSA 4FXKB 4TL4A 5E95B 1MJ8L 5CN2A 4DF9A 3NIFE 2GG1A 5BRZB 5JR1L 1DVFC 1CE1H 2BIOA 1S3KH 4HSCX 3FT0A 2B2XL 4BKTC 1IQDB 4W9IC 2JCCA 4QY8B 3DPBB 4FF9A 2ADGB 3O4OB 3O9WD 4H0HB 4U7MA 5F3HB 3QAQA 5FFLA 3BPLC 4MS8D 1PLAA 4FFYA 2CBPA 3DX4A 1F11A 3ECBA 4DPAX 4MCMA 1CE1L 4A7UA 1S3KL 4I3SH 3P4LA 2AAVA 3QQXA 3QDMA 4F57H 3RU8H 3ZU8A 3NJXA 5G4MA 1G7LA 5EMYA 3I50H 1B4RA 1RJCA 2PW2B 4OI9A 1BJ8A 1BQSA 1HWHB 3OB0K 3FTUA 3TVMC 4ZX4A 3WTYA 3KL5A 4H8VA 3LD8C 4PJAB 3C6EA 4NBZB 3EJZC 2DJMA 4UZUA 4KK9C 8FABB 4LDLB 4KXAA 2VSKB 5I2IB 4PB9H 3T0WA 5BOJA 1ZIBA 4F57L 4YHPB 3RU8L 2YRBA 2XG4B 5F7BA 3RVVC 3I50L 1I9EA 3VJ6B 1TQBC 1EQWA 3AAZA 3RDTA 1K5WA 3I84A 4N2FA 2JKTM 4JR9H 3WKQA 5FYJD 3T1FA 5C0GB 4MAYA 2ALWA 3II3A 1HIMH 4PB9L 2X6CA 1N7MH 2FL5B 2QSTA 2BCKA 2ED9A 3QI9A 3AVEA 5FKPA 5GQBA 3FW6A 2VZVA 3PQYB 2C1OB 3ATBA 1INQB 2FNBA 3FQ4A 1KXVC 1RAMA 2X1XR 5C08E 3AU1A 4X6EB 4I13B 4P46C 4NT6B 2IVFC 3EHBD 1XCWA 3ULVF 4S10A 4Z3EA 2AQ1A 2VN7A 3L4UA 2X42A 1HIML 3MZGB 2AEPH 1N7ML 1Z9MA 2H8PA 3UC2A 4PTUB 4BZ2A 2E8ZA 3KYNA 2GFBB 3MRBA 2J56A 1KB9J 1G6RB 4R7NB 5GRUH 2NY0C 4YSSA 2WXIA 5CBEA 5DS8B 5HVFB 3ATFA 5L4IA 1MVYA 5HP5A 3GBLA 5EU7E 4P2RE 4QHMA 4GBXB 2AEPL 4L0YA 4F7PA 2P5WB 4JFUA 1XH3B 4KX9A 5B3NA 3GC3A 5DSCB 1NFAA 3ALPA 1ILUA 5DR5L 2VUOA 4WUUA 2F9BT 4R3SA 5GRUL 2FUQA 4X7DC 3FULA 3TYFA 2V2XA 3AZUA 4AM0Q 3BYTA 4XZUA 4TNGA 1YMHA 2HMIC 3C6SA 5SWSB 3HR5B 2PWHA 1GH7A 1MW3A 1QA9A 1G4MA 2AV1B 1FHNA 1TEGA 4U1LA 5ALCH 3VUAA 1UG9A 1Q72H 1JIBA 2XTJD 2EIZA 5SWZE 3FCUB 5JQ6L 2EILB 2Y1ZA 1QRND 1RCYA 3UBXB 1A4JB 2QQQA 4XOBA 1I7TA 2FEDD 2OBGA 4JCMA 4M4RA 4J3UA 1X5LA 4AYGA 2IPKB 4MJID 3LOWA 2BERA 2B3RA 3ARFA 1F3JA 1NGYA 1Q72L 4W9CC 4Y2DB 1KY6A 4NHUB 1ET7A 4AM0B 1WFTA 3MBXH 4TNVF 3C5SB 4XR8C 5L4FA 2DBJA 4J6IA 2IAAC 5LBGA 5JYLA 5C0DA 3GI9H 2CHZA 1I7UA 1CLYH 1CPUA 1AKJB 4KQ0A 1YPZB 4GXVH 2R83A 3K7UA 4PRHE 1XFPA 5FYKD 5MERB 1AXTH 4J3OF 4NM4L 3MBXL 3WIFB 4DVRH 5ADPH 1YJDC 3HBPA 4CDGC 3GI9L 1RURH 1BAFH 2YD3A 4OZHA 2P5ED 3BEVA 2BSDA 2ID5A 3ECWA 2IQAB 4IKJA 3T4AB 2YJLA 4ZODA 1CLYL 3FUNA 2FX8H 4E9TA 1E42A 1T3FA 3MXVL 4OD2A 1G7PA 4GXVL 3ETBJ 4JFDB 4PJXB 3W3BA 4TF4A 4I89A 3QIBC 2WBJC 1XD0A 1P4BH 3QFJE 2RHEA 4AENA 4WENB 4LLVB 3I02A 4OQ1A 4RDQG 4DVRL 2YOCA 4JN1H 3RWIA 3ZYOA 1FZMB 3MTRA 5H37A 1BAFL 3S48A 1OK8A 3B1UA 5I8CB 1A9VA 2P5PA 4Y2NA 3DX6A 2E47A 3TC9A 2FX8L 2R59A 1OWWA 3AADB 4JO5A 4HBCH 3WY3A 2IGLA 1NCWH 3V0EA 1H9VA 1EERB 1QQDA 3QUKB 3IE9A 3DECA 4E5XB 5IM7A 4JBSA 3RVUD 1P4BL 2BFGA 2Z31B 3VSTA 4CA4A 4QKXB 1N64H 4ZQKA 2HJFA 1X5KA 2HCZX 4JRYD 1SDDA 1IGMH 1KACB 4MZRA 4H8WC 3S3SA 5BRQA 3JTSA 1NUNB 3OKKA 3AQZA 4HBCL 3SGJA 5BRZE 1NCWL 1QATA 5KVEE 2FGZA 4UT6H 4YZWA 4JFHD 5IMKB 1GTNA 4PV9A 3QUXB 2JQZA 2YLHA 1ZLUH 3RWEB 4V11A 2VQUA 2LU4A 2FJUB 3DX9B 4NLHA 3VFOB 2UY7B 3QIUB 4IDJL 1IGML 4Y16A 3BSZH 2CBQA 5CGTA 1WBYB 2OSWA 3TOPA 4LCUA 1EA9C 2LW3A 1O5DT 2O61A 3E9TA 3QG6A 4UT6L 3CBKB 5T8IA 4OGAD 4MMXB 3UXFA 2J12B 2M26A 1KJ2B 3P73B 5IOKA 3BAIA 1DVFD 1BFSA 2WZAA 3L17A 4PJAE 3OG4B 3BSZL 3L4XA 1DVSA 1U8JA 3DSNA 4N2BA 4A7SA 1GYVA 2YXWA 4JDVB 1ZLWH 4N4YB 1ETZA 2V5TA 1NC2D 3B8YA 4ZMVA 5HJDA 4UQ2A 2HJKB 1YNKL 3VX1A 1KPVA 4BKSC 5CILH 5A6MA 4Y19A 3WKMH 4RMWA 4XWGL 5E8NA 5MEND 5DJYB 2HVJA 2BS8A 2R2HA 3JWNG 1LO3H 1WT5C 4JQXA 4X42A 2TRHA 5DK2B 3MFGB 5LKNA 2YMOA 4H88L 2NDGA 3MRRA 3V52L 1JWUB 5IFHH 4FQXB 5D72L 2EDMA 2W9DH 3VWJC 4CMMA 5IP4A 4LPYA 3L3GA 4FA6A 4Y5VC 4R0LB 5CILL 3VRIA 3EJZD 3WKML 1M1SA 2PXYA 4KK9D 3PQYE 4Z0BH 4BFGA 5C0CA 3K8LA 3T8XB 3LZPA 4B3EA 5HHXH 4PJEF 2AEOA 2FSEA 4XOEA 2E46A 3ARGC 4M8QA 1I1AC 3RVVD 4DPBX 1D2OA 3L1OH 1CGVA 1BQRA 1N8ZA 4YAQB 2W9DL 1NIFA 1AQMA 1QWNA 2A74A 4MNHA 4QRTA 1S7TB 5INCB 2KPWA 4KRPC 2WXKA 1BXUA 4Y4KB 4DT2A 2FX9L 1ADQA 2E27L 3WD5H 3MYJB 4Z0BL 3ZSTA 1CDCA 3FFCE 5HHXL 2X4QA 3AM8A 4XBGA 4HFWA 4FQHA 1HHHB 5I0VA 3QC5X 4HIIA 2JWYA 1F86A 1OAXH 2VZTA 3AS0A 3TCLA 3F5WA 3L1OL 4GLRH 1A14H 4XBPB 4OF6A 4XI5C 4UTCA 2G4GA 3K6OA 4KJWD 3VFPB 2VDKB 1CDUA 3LAFA 3GXNA 3P0VH 4X6DF 4CSSA 3KYMB 1O6TA 3WD5L 2YAOA 2NZ1A 4NNPH 3RWHA 1EMTH 1OAXL 1HNGA 4XVOA 1TJIH 5DQ9B 4UDTA 2W9LA 3HE6B 2QLVB 5J7CC 1J8HA 1A14L 1HEZB 2NY0D 3D12B 3DV4A 4NN7C 4UZSA 4WFFD 5IJKC 2EDQA 4GY4A 4KVNH 5J6HB 4M29A 3ZZLA 3NJMA 3NZ8B 3TJHC 4ZJ9A 4DTGL 4MQ7B 4U6HA 1AYOA 1A1MA 1EPFA 1KF9B 1IBFA 2JI2A 4NNPL 2BY2A 1MQKH 2ITDB 4BQCA 1EMTL 1F1DA 2A9DA 4NUPA 2AXGB 5DRZB 3TO4A 3MLVH 4G6AD 3ML8A 4GP5B 1GOHA 1QSFD 5CP7B 5IQ9A 1PBYA 4UOZA 2FR4B 5EEZA 1IGTA 2E7LA 2M2DA 4JJ5B 4KVNL 1FNHA 1WC7B 2C9VA 2W91A 4PG2A 3S2CA 4KTDH 3RNQB 4PY8J 5ESQB 4RWHA 3SBWC 43CAA 2HMID 4WV1C 2CJUH 3FTZA 3R4DA 5I15H 2DWYA 2R0WH 3JSSA 3PUCA 4BSWA 3OBAA 1MQKL 4I88A 1QX1A 5DC9B 1OGTA 1LEGB 2DIBA 3FSOA 3DGDA 3T2PA 2H6PB 5DQJB 3MLVL 4XN8A 1ZK5A 2CGRH 4JCWA 1YPZE 3S5LA 4UQAA 1NINA 5GS0D 4AEEA 3LXAA 4NAJA 4RA3A 2OX5A 4KTDL 1UWFA 3HN5A 5AVSB 5E51A 2CJUL 2JB5L 4NZDA 3FT2A 5I15L 1DR9A 3WIIH 2G5RA 1JGIA 4GG6F 4XVJH 5GS2D 1RHHA 3H9YA 2M1KA 1BMZA 4PJIB 3A4FA 3GD1C 1HXYA 2Y3NA 4IU2B 2XXGA 4NQCB 2IQ9L 4JFDE 4PJXE 4EJ1C 1JXDA 2HUEA 3SGKA 3BWZA 4Q8BA 4X6CE 4LBEA 3WLBA 3ZMRA 5JHDE 4W9KC 3WIIL 1JZEA 3RPIA 2ISDA 3N42F 4N9OB 4XVJL 2A73B 4J4PD 3RX5A 2YWYA 3CIQA 3PWJB 3FFOA 4ZT1A 2FIKA 3CN4A 3FT4A 4ZPTA 5DJ0B 4C55A 4RAVB 5KTEH 2BP0A 3GF8A 2JKSA 2ZUXA 2GSGA 4R8WL 3DV6A 4ZD3H 4DWHA 1JZFA 5F9WB 5T1LA 2BCMA 3LRKA 3QIBD 2WBJD 5AW6B 1OB0A 2MHAB 4KOCA 2A6KA 1AGCA 1WWBX 2HH0H 3ZTJG 2DQIH 3QXVA 4OJYA 5E8EB 3QS3A 5EZJB 3VFSB 5KTEL 5IFJB 2GSIB 3OR7A 1GC1L 5F0LB 1AR1C 1D9KA 1M1XB 4HEPG 4ZO7A 4P2RA 5J56B 2ZP0T 4WF7A 4NRXA 3SODB 1MCWM 3CFKA 1S3RA 4NZTH 2ZYRA 4ZD3L 4MWFB 5FWQA 4LCVA 3OC8A 4KZDH 4K9EC 4OFDA 4JFWA 4G43A 1VDGA 3NCXA 3WYRA 5J13B 1SJMA 4RFEA 3SGDH 1G9ML 1NJ9A 1E27A 4PP2B 2NYYC 5ANMB 2NCEA 1BX2A 3MBEA 5FO9B 1XIWC 3P3UA 3AGVA 1I7RB 2EINB 4G6MH 3BFWA 2HT4C 5ITBH 2H6OA 4MNQD 3B2VH 3WHE0 2HVKB 2MMXA 4KZDL 4FXGB 2WYZA 5K9OB 2B08A 1MDTA 1CFBA 4YHIA 1CYXA 3P3SA 3IBEA 5LG6A 3SPVA 2W60B 3IKCA 3OAYK 2J5LB 1QFOA 2P4AB 2VIRA 3VFUA 1T89C 2FATL 3MV01 5ITBL 4N1HB 2XWEA 5DZVA 4O51B 5ILTL 3B2VL 2EQDA 1HSBA 1C5BH 1ET8A 3F00A 5D4JA 3SE4A 1DQDH 2WXNA 1I1CA 1AFVL 2FT7A 3CFEB 5DRWA 2MPAH 3H7LA 4E9YA 4F33B 4BFKA 2Q86A 1NBVH 3C75A 4D7PA 3BFQG 4LQFL 5HGHB 1YHPA 1A1OA 1OLZA 3L5IA 1BFOA 1NGZB 2F8IA 4PRHA 1C5BL 3K80A 5ES4B 3C8KA 4LDEB 4ZNEA 1DQDL 4ETYA 1CVSC 2CR3A 2AQRA 3L4ZA 3GS4A 2AJ3A 4F7EA 1JFQH 4QHKJ 1XCTB 1NBVL 1MCKA 5GS1C 1E2VA 5C0NC 1ZT4B 5EO0A 3BH9A 2HRGA 3VSQA 4IBYA 4X6FA 2XPYA 2YXMA 4OGYH 5A2KH 5JMRA 1YUHA 4ORGA 1SJHB 3VWJD 4YS4A 1KLUA 4G7SB 2O5XH 4OB5H 4WU5A 4FE9A 5AYUL 5HGGS 1QLRB 3QFJA 3WTXA 1SJEB 4R83A 5I0YA 2JIXB 1JFQL 4OZIB 4U1JA 5DJXB 3ARGD 3JV6A 1DCLA 3ZDZB 1I1AD 4XNMA 4DZBA 2VSCA 3C09B 4OGYL 4ANUA 3PWNA 5LGHH 1CD0A 3BVXA 5F1SA 1VAHA 2P52A 1MLCA 2O5XL 1R24A 4PJ9B 3MXWH 3RTQC 3W9DA 4KRPD 5BVPL 5T3ZL 1VFBA 3HOGA 4I48B 1U3HB 1HOCA 2EDFA 4APQC 3QORB 1YY8A 2NY7L 4G5AA 1MI5D 1ZVSB 4K94C 4WIQA 3G9AB 4NRYB 3AROA 1HAUA 4FXKA 4YHMH 2FWLB 3B34A 3FO2B 1JFHA 4F37K 3ATEA 5LGHL 2K4WA 5BRZA 2WQRA 4BH7B 4HLZG 5EZIH 3ZT5A 4EBQH 2ZCLL 1D5MB 4XODA 1IQDA 3QVAA 3LHPH 4UQ3A 3IJ7A 4LHUD 4QY8A 4B9JA 4MKTA 2ADGA 5F3HA 1NZRA 1OCZB 3REVB 3TEWA 2GYSA 3ESNA 3TBCA 4YHML 2GW5A 4EQ3A 1KULA 4ES9A 5F1IB 3EYFB 3QEQD 5EZIL 4EBQL 3DIFB 2Y2WA 4Q0XL 4QIRA 2CA4A 3L5WB 1XF4A 3BD3A 3LHPL 3TFKC 5E8DL 1NA8A 3VM5A 2PW2A 1TFHA 3SPHA 1CFQB 3BAEH 3DOHA 5E9DB 2ZNWA 4Y1AB 3L3KB 4PJAA 5HDBB 3VXPB 3U6RB 4ZAKC 4PW9A 8FABA 4Y5XC 4AIEA 3B3IB 3WNJA 4NJAH 5I2IA 1N4XH 4D7BA 5IG7B 4KJQC 1TQTA 4JG9A 1KGIA 2P80A 5DHYB 3X14B 1Y6MR 1OTSC 1ZKAA 2WAQA 2XG4A 3BP4B 2R0KL 4KK5C 4RZCA 1C7TA 3VJ6A 1QBBA 3BAEL 1GGTA 4LSQH 3RBGA 1BP3B 2C9PA 2DIEA 2DYRB 2HT3C 2NY5C 4PMEA 3AY2A 2Y06H 3OHMB 4YX2L 2MEJB 2VO5A 2EVGA 1OP3H 1A4KB 1QSZA 1J8KA 1E2WA 2Y7QB 4NJAL 1ZCRA 3VXUB 4QJ3B 1N4XL 2FL5A 5IQNA 3QCVH 4FNUA 5DYFA 2VXVH 3WNPA 3PQYA 2C1OA 2I24N 4WI2A 4N2IA 4EZMA 5IR1B 4LSQL 1INQA 3AMKA 2H41A 4Q6YA 3GEWB 3BUIA 2VLKD 4X6EA 5E6UB 3WJMB 2Y06L 4NT6A 5C09E 4G59C 4R96B 5DRNB 1SXCA 2H45A 1UH2A 2R39A 2ZG2A 3B9VA 5CGYC 4O02A 1Q1JH 3KPSD 2VLJB 4W6YB 3KPNB 4PTUA 3QCVL 4FHKA 2VXVL 1A02N 3DRTB 1OANA 5ID1A 1G6RA 3QIWC 4R7NA 2NXZB 4KJPC 2P48B 3S36X 3L3HB 3ZT7A 3D2UA 2J8OA 5DS8A 4CJ1A 3DJ9A 4C59B 3P4NB 2X6AA 4GBXA 3IAPA 1NGXB 1Q1JL 4X7TB 4QUOA 2P5WA 2DI8A 1XH3A 1VFMA 3PWVB 3G5YB 5DSCA 1UYWH 2C3VA 2F54D 4YL4A 4HFUH 3EJYC 3BEWB 3D5OF 1C1EH 2Y6SD 1J48A 3D34A 5ANME 4BYHA 3NYKA 4WW2C 4M7KH 5K33A 3UGUA 2PR9A 3B2MA 3UAEA 5DS2A 5SWSA 1BWWA 3HR5A 1BLIA 3L8QA 2AV1A 5T5FH 4AYDC 4AEIH 4LCCC 1AR1D 2VN3A 1YEGL 2HLAB 3C9NB 4HDIB 1C1EL 1ZAGA 2K3HA 4WJ5B 5DTFB 4WEMB 1S9KC 3UBXA 3R8BB 4F58H 1A4JA 1WFMA 4M7KL 4ZOBA 4IIQB 4PJCB 1OM9A 1T1ZB 2BINA 5AB1A 3RGHA 2IPKA 4HOZA 4AEIL 1WDAA 2RTTA 2Y7SA 3VQMA 2NYYD 4Y2DA 5C0BE 4F7KA 4NHUA 1XIWD 5CKGA 4KAQH 2XETA 5D7HA 5EC1B 4AM0A 3C5SA 1CICB 2QADC 1U8HA 2HT4D 5HTSA 2VN5A 5B1JA 2VLRB 3PL6C 3C6LB 4F58L 5AAWC 4DP6X 1AKJA 4WFGE 5HI3C 5F7YC 2IDUA 4J23A 2OMTB 2WPGA 5EDSA 1YPZA 4R5XA 2BNQD 5E2VH 1SN2A 3DUUB 1Y1UA 4U33A 4KAQL 1FGVH 4BQ8A 4O4YL 1UKQA 4JL2A 3IFNH 3WIFA 1XTLA 2FRGP 3PUUA 2ITEA 4RISL 2VN4A 4CDHA 1NGWB 2O6FA 3QS2A 5D1ZB 3T4AA 1RUAL 4P9HH 1UEYA 5LBSH 5CCGE 2VMEA 3OKYA 4AEFA 3ARVA 3MX0B 5E5RB 4BZYA 4X9YA 4U7SA 1IZKA 4PJXA 4JFDA 3NOIA 3P4MB 4R4FH 4WEEA 2RAMA 5E2VL 2W5PA 4NPYB 4M56A 5DYOB 1WJ3A 3HE7C 1DN0B 1FGVL 4LLVA 4D9QD 4ZG1A 3IFNL 3MNZA 2D73A 4Q9BA 4PGJA 1FZMA 2NXYB 1WBZB 1U4FA 1LTXA 1ZT1B 2MOVA 5AZUA 3TEZA 4PRPB 2D7TL 3OJDA 1RD6A 5D7LE 2JF1A 1E90A 3WO4C 4A2MA 5KAQF 4JQVC 4KI5C 2DS4A 2NLJB 4DGVH 3QUKA 5DMKB 5EF1A 4E5XA 1FFOB 5JHAA 4Z7QE 1N2RB 2WGXA 4NJ9H 2Z31A 5M7QA 5B8CB 1OSZB 1RLBA 4NO2B 3ZHDA 2DMGA 4AV4A 3SQBB 1P6FA 2JKWA 3HG3A 1I8UA 1L9TA 3OXRB 2ZXCA 5FYJH 5CSBA 4DGVL 2ZUVA 1DJIA 1FBIH 1YDPB 1DQKA 1NLBH 5IMKA 1FVDB 3QUYB 4H4NA 3ECUA 3QUXA 2BHUA 4NJ9L 3RWEA 4KRLB 1XO8A 4BK5C 3CBRA 3W2DH 1SQMA 3DX9A 3VFOA 2UY7A 3QIUA 4CN1A 4WAFA 2H1PL 3IS1X 5KWYC 1G7HB 4BK8A 1CFNA 2AITA 4JREC 1WAEA 5FYJL 1ETB1 4APQD 1MCQA 1FBIL 3L54A 3GXUB 4GIOA 3OWEA 1TXKA 4GAFB 4YO0B 1ZE3H 1S6NA 3WAJA 2AQNA 3TNNA 4OUUB 4U6YB 5K39B 1KJ2A 3P73A 1F8TH 5E9DE 1TTBA 3W2DL 2VZ3A 4DP2X 5KANI 2IC2A 2UUDK 1CXIA 3HCVB 1EZVX 1PZAA 4EF3A 4RBPH 1KLGB 1EO5A 1UT2A 3UBGA 2BJMH 1E5YA 2HJKA 4OGQC 4RFNC 1RLWA 4KKCC 4LPTA 2J8HA 4P2QD 5K9KB 3ALWA 2F08A 4K7PY 1CIDA 1GW0A 2ZOUA 2ZP9A 2D2CC 4ICXA 5CN1A 5IB5B 5K59E 4U1KB 5DK2A 4L1DA 2H3NB 3QPXH 1WF5A 2MWCA 3F7VA 1MH5A 1JWUA 3JZ7A 2WXGA 3VXUE 3PFQA 2QFRA 2YD8A 2BJML 3PWPD 3ZGIA 4ZAKD 4R0LA 5GIRA 2H3XC 1O0VA 4KRMB 1S7UB 2DQJH 5ECGA 5EZOL 2ZQKA 4N6QA 2HFGL 4PHXA 3T8XA 1IM3B 4LEOB 4XN5A 3HS9A 4KJQD 1IC1A 3NGBC 3QJUB 1XH2A 1SFHA 3ASWA 3P02A 3QPXL 2XFXB 2GB2A 4N8UA 4BWWA 3GJFH 4YAQA 3QEHB 3V7AE 1CFTB 5ACZB 2VLJE 1ZS2A 5EU6B 1MRCH 1S7TA 5INCA 4J39A 5FLUA 4ZK8A 3BQVA 3MJ7B 2DQJL 2V9QA 2Y1AA 3TYGL 1SMAA 4MYPA 2IF7A 2LQRA 4MMYB 3BH4A 4QI3A 4OU3A 3AB0C 4TUUA 1HHHA 1HL9A 4N8VB 5D4HA 4LFHG 3L1FA 4HA1A 3QYCA 5MEOA 1KDIA 2OJ1A 4H1LG 4UM8B 5AVXB 4JS7A 3RWDB 4MD0B 4PJBF 3IMTA 3FO9B 2AEWA 4XBPA 1UOVA 4XX1G 1MRCL 1F90H 2H3KA 3DJZA 5ICXB 3L5JA 3VFPA 5H35B 3HPLB 4E41B 4EDXB 7CGTA 3KYMA 1TETH 3FAXA 5CGYD 1R46A 2EDNA 3DJRA 1C16B 4XP6L 5I8OH 5J89A 5DQ9A 4Z7NE 1BFVH 3HE6A 1HEZA 4M6OH 1CG9B 3NESA 4KJPD 2V33A 4LK4A 3KGTA 3RDTC 1F90L 1L6XA 5I75C 1IFRA 4LXFA 5J6HA 1TETL 2WNKA 3NZ8A 3V6FB 1H8NA 4HIJB 4J8RB 4MQ7A 2YXVA 3BVNA 4MAYC 3MRLB 4ADGA 3EH2A 2ITDA 3TNMB 5L0QC 5G4NA 5IHHA 5I8OL 5DRZA 4PJCE 1BFVL 3EJYD 3ABMB 3QI9C 4HOMA 3GXIA 1Z6JT 4M6OL 2FR4A 1URLA 2DJUA 3EGSB 4GW1B 1GS8A 3SEPA 5HVWA 3UH8A 1QASA 4JJ5A 3C5XA 3RNQA 1HNFA 3IRPX 2ORBH 5ESQA 1PPIA 4D9RE 1KPRB 1OP5K 5I6XC 1TQCC 2GKIA 5E1QA 4E42B 2VLRE 1LEGA 3ABKB 4WFHD 2H6PA 2VWEC 4BBWA 1QPXA 4IKLA 4KO6A 1GZQB 3APDA 1NGPH 2LU7A 4NAMA 2QVMA 1H19A 2IWKA 4AV5A 1OPOA 3I6GB 1JNHA 1R5VB 1SHXA 1FV1B 3JZYA 1KOAA 4GP8B 4HCRL 3HI5L 4H26A 1QO3B 4BWUA 5K9QG 1BZ7B 1I3RB 1U3JA 2VB5A 5DMGC 3CNKA 4ZXBB 3HI1B 3MCKB 5IBUG 1QRKA 3K72A 4PJIA 4EZKA 5L2KD 1PX4A 3VVVA 3ET9F 4IU2A 4Q4EA 4NQCA 3PL6D 4J1UB 4H8PA 3VCLB 2FNWA 3BX7C 3O2DL 5HI3D 5KJRL 2ERJC 4E9WA 2ETWA 1S46A 3X1GA 2A73A 2DQFB 4PRPE 1KPUB 2P42B 3PWJA 1X5JA 3DVNB 3X2QB 3MA9H 4Y89A 1W0YT 5C3TA 5DJ0A 2HG5B 5FYLE 4RAVA 2ARJB 4GKNB 1PJ9A 3ZQ9A 4EMZA 3LH2H 3Q01A 1OGPA 4J3WA 5E2JA 4ZFZB 1N3NB 4L4TD 4KWUA 5I23A 5ISZD 5A2CA 4YR6B 3ARFC 2VITB 3GRBA 3F6LA 5I76B 1CQKA 2MHAA 3MA9L 3NA9H 2VJ8A 3IJYA 1RK1B 4JDEB 4P23D 2BVEA 1DJGA 1PAMA 3DNKA 1J8SA 4KKAC 3TGXA 1T1XB 2VZOA 3VFSA 2Q8BH 5IFJA 1X9RA 3L4WA 4TUOA 1L4IA 4JFED 1M1XA 1RUQH 1WTLA 2J55A 1NM9A 2Y72A 4KI5D 2ICEB 4NFCA 5BV7H 1GVIA 3DX0A 5BOZG 4MWFA 4FQIH 2FBOJ 3WEOA 5L4MA 3V8OA 1HJCA 3NA9L 3U0TB 3E1F1 2BW4A 4QRQA 4I18B 5FX3A 2Q8BL 4LSUL 3JV5A 5ANMA 4Y4HB 2XTSA 4MD5B 1L0XA 1OPGH 1RUQL 5CFAA 1I7RA 4PJFE 3LY6A 4FQIL 5BZZA 2HVKA 3QXAB 4FXGA 3RIKA 3T04D 2BSCA 1MJ7H 5K9OA 3IAGC 1UT1A 1AYRA 1OE1A 5TJWK 2X3CA 4P5KB 1QTSA 2W60A 2OXGB 1OQXA 2VDOB 2XQYG 1FJ1B 3A6CH 5CLYA 5HVHB 1H3WM 2ZD0A 4K4KA 2LLLA 1JNLH 3FU0A 3UROR 4O51A 2APBA 4LLUB 1RZGB 1MRDH 2VC2H 2DBLH 1JUFB 3M46A 5D1ZI 1MJ7L 3LZOA 5IMMB 3CUPB 1XGZA 4EPSA 5T1DH 1JZGA 3CFEA 1L9MA 1ZD6A 4F33A 5F44A 3EKCA 3AUVA 4M93C 1HSAB 5KUMA 3UJIH 3HUJF 3QK0A 3CD4A 5HGHA 1JNLL 3FOLB 1AJ7H 3SGJC 5KVFH 1RZQA 1U58B 3L2MA 1MRDL 5EUOB 1NGZA 3UGXA 2FHCA 2DBLL 4OZFB 5EBMB 4GT0A 1GSMA 5T1DL 4ZZKA 3D51A 2BP8B 5GJSH 1E4XI 2QDWA 2J71A 3TF7C 1XCTA 3UEZA 5DZPA 3HC0B 1NKOA 1YEIH 1ZT4A 3CAFA 4Y16C 3RWFB 3UJIL 1IGYB 4XP5H 4XZ4A 1JZ5A 2VXQH 1AJ7L 1SJHA 5KVFL 1Z0MA 1CT8B 4YSAA 4AK1A 3NIGF 4UQBA 4HZ1A 2O5ZL 3NDZE 5BO0D 2CO2A 2CD0A 1CO1A 4PGCB 1SJEA 1T6WA 4LHQB 2C9SA 3T3ME 3K6NA 2JIXA 4OZIA 1ZWIB 2B1AL 3KLLA 3JT2A 5DJXA 5H2BB 4EN3B 1YEIL 4ANXA 4E41E 2UZYB 5GS0H 1IEAB 4JFZH 5CP3A 4FYSA 2G2NA 3GO1H 3GMMB 4UBDC 2OSXA 4XP5L 2NPLX 2P47B 2VXQL 5J6SA 1BEXA 5IJBC 1HYSD 4PJ9A 35C8H 1T4WA 3E8UH 1UXSB 3ZE0E 3ZL1A 2R2CA 2XXMB 4LIQH 5GS2H 4I48A 2ZYHA 3RDJA 1ASQA 1U3HA 2EIDA 5JW3H 3FUDA 3QORA 1RH8A 1ZVSA 4JQXC 3C60D 1P0SE 4PWKA 3QDMD 4NRYA 5GS0L 3GO1L 4RAUB 3FO2A 5ESAB 4N1CA 3FK3A 3LPOA 3LNGA 3SO3C 2GJPA 2N3JA 2W8CA 1QNZH 35C8L 3E8UL 2EEXA 1D5MA 4X8CA 3EBGA 3WUWB 2IXQB 3RX8A 1URZA 4LIQL 4QHKI 4Z3HA 3B7UX 2PXYC 3HRPA 5JW3L 4UQCA 4ZOAA 3VXSB 4LESA 2WTRB 3REVA 2JQMA 4B9IA 1AHWB 1A65A 3U9UB 4XO8A 5D7JB 4EKJA 2BS71 2X6VA 1JHTB 3VQLA 1YYMH 5F1IA 3EYFA 4N25A 3DIFA 3MDJA 3V0GA 2A74C 1XB3A 2AXHA 3L5WA 1R5IB 1HXKA 3GSRB 4JDTH 1A3ZA 1MN4A 1EFXB 1SOQA 2Y23A 3KLQA 1ZDQA 4TULH 2DWTA 5T5NG 4EAEA 1NPNA 2HJLB 1CFQA 4MAYD 4TS6A 4BRJA 1WP6A 1Q38A 1E9OB 4Y1AA 3L3KA 3VXPA 1T80A 1WUNT 2G5BB 3AREB 1SOXA 1LL1A 3QI9D 2XKNB 4A6YH 3MRFB 3B3IA 1KC5H 1YYML 1A6WH 3D08A 3HJ0A 3MCYA 5EBWB 3FB8B 3ATDA 1NC4B 3X14A 5DHYA 5C07E 4JDTL 1UM5H 4TULL 3WTVA 3U46B 3A6OA 2YWZA 2X5PA 4FFZH 5E2WL 4CN4A 3TH4T 3V8CA 4V1DB 4A6YL 1A4KA 3E8VA 1UJ3B 3BPCB 2PP8A 2Y7QA 3EYOB 3VXUA 2DLHA 4ELKB 3WNIA 5I30H 5IWLA 5DMYA 1T20B 4R7VA 1MCJA 2KMWA 3S3PA 3VD4A 5IR1A 2XQYK 4OLVH 3MRHA 2X53A 1AG0A 2R0ZH 3BW9B 4FFZL 1WZ1H 3WJMA 4R96A 4HJ0D 4DN3H 4YBQC 2XLLA 1F5WA 3WTSA 3TO4C 4H8WL 3KPLB 3K6IA 5EN2B 3APNA 4KZCA 4WUUD 2VH5L 3IYLW 1IBZA 2VLJA 5AKSA 3WY2A 3KPNA 2E7LC 2GIXA 4PG2C 5CMAB 4BHUA 2ICWB 4GKLA 3DRTA 4JLRB 4ZMNA 2EYTB 1GMIA 3DVGB 2EUWA 4OLVL 3TM6A 5L8LB 3L3HA 2R0ZL 2LOEA 1WZ1L 5ANHA 3BE1H 5IW6B 5F3FA 2E59A 1WFJA 2AXWA 4LL1A 2WQWA 3SDAB 4DN3L 3UTTB 1NGXA 1DN2A 1UOWA 5J8OA 3W38A 4X7TA 1PIFA 4CC0A 3PWVA 3G5YA 2JI3A 4KPHL 4J27A 5D55A 5E1IA 3BEWA 5G55A 4XVUC 1ODUA 9CGTA 4YBLC 2EECA 2JJSA 2KPNA 3HFFA 4B7IA 4KKRA 2QTVA 3ECQA 1BZEA 3ARFD 3BE1L 1B88A 4GXUM 3JBG7 3P9LB 3VGGA 1ZA3B 2XV3A 4RMBA 4IQHA 1FIGH 1SHWA 3KPRE 3Q6FB 1LWRA 1WEJL 1F4XH 4KY2A 3WS3B 3EFDH 2NT1A 3SGKC 4ELMF 1JK9B 2FWUA 2J6EA 3C9NA 2HLAA 4HDIA 3SOBH 4PFEA 5DTFA 5DK3A 1PD1A 3LPPA 4Z7WB 4JKLA 5JORA 2D8KA 2J43A 4IIQA 3H2WA 1T1ZA 1IQWH 4LKCB 4K23H 1KTKE 3WMSA 4LVHB 4A68A 2YGPA 1J0KA 1F4XL 4FD0A 3D85B 3TXAA 3EFDL 4W9EC 4ILDA 2E76C 5EC1A 4XPBL 3SOBL 1CICA 1NIDA 2FYVA 3FS9A 1KTLB 3RZCB 5E4IA 2NY1B 2WGNB 1YN7B 3DXAD 2VLRA 4HIHA 3C6LA 3UMTA 1OAQL 3GTVA 5HYSG 3WNOA 1IQWL 4K23L 2AQSA 2AC0A 2OMTA 2A9NH 3GXPA 4NQEB 5EUOE 2KKQA 1IAOB 3DUUA 1ZLUK 4OVVA 1S7VA 4O5LH 1D9KC 1VERA 5I0XA 1G7QB 5EU7C 4HAFA 4I9WE 2JKLA 1CMOA 4N0FB 4GRMB 1E5ZA 3ZIMA 1NGWA 5D1ZA 4P4RB 4D3CH 5KYUB 2X2HA 4QR7A 4WSKA 3MX0A 4I0KA 1MY7A 2A9NL 3WIHH 3P4MA 4B5EA 2IADB 2P44B 4P5MB 1OSPH 5DI8B 4NPYA 5DYOA 1M05A 3CPUA 2ZOLB 1DN0A 3A4DA 3MBEC 1ECZA 3MJWA 1NEZB 3F62A 1ZT1A 2ZX8A 4PRPA 3UERA 4D3CL 3CQQA 4LKXB 2X4OB 1NPUA 3U6XS 2K3TA 1IKOP 2ZCZA 4KUCF 2NW2B 1LMIA 3JV4B 2NLJA 5DMKA 3WIHL 4JHWL 1FFOA 5D1QB 1OSPL 3PDOB 3Q2CA 1N2RA 5C7ZA 2K8QA 1OSZA 4NO2A 3L3JB 4Z95L 3HVDA 3SQBA 3UMNA 3GSUB 2DM4A 2A6IB 3CHSA 5DC0A 4HKZB 1ZDSA 3SE4C 4DIXA 4ZMTA 3CFQA 3OKDA 4XBMA 1ZTXE 4ONHB 4AUUA 2KL6A 5F21B 3QUYA 4L8SB 3D7PA 5F1KC 1E3FA 5EIVA 1NUDA 4UBDD 2BVUA 4XNXH 1I53A 1J88A 2FQEA 3R0MA 1JK8B 3UAJA 4Y19D 1G7HA 2WO3B 3K8KA 3HC2A 5AWNH 4YO0A 4HK0B 4OUUA 4U6YA 1HN1A 1AZUA 1RZJH 4QKTA 5HJ3B 4XNXL 1P7KB 3D4YA 5K39A 3TL5A 4NENB 4C83B 4LBAA 2XN1A 5I1AB 2HTLC 3HCVA 3QJZA 4XGZB 4U7KA 4DP4X 2PXYD 1KSRA 1KLGA 3D4GA 4U1MA 2W80C 1ZHBB 5EU3B 4TNFA 1MFCH 5AWNL 1LGVA 4X4MA 1RZJL 2J1XA 4RIRB 5IB5A 2ZOTA 4DFIA 1GYAA 4OZ4B 2H3NA 4GO9A 4V1DE 1XCXA 2VQTA 3Q44A 5CSZB 1EDHA 4ZRGA 3O8XB 2Q6WB 3SDCB 4HXBL 3V4PL 1XF2B 3N3EA 3RI5F 4M1DH 1ML0A 2UVFA 3HS0B 4G6JH 5D7KD 4QGYA 3BZ4B 4IKKA 4Q9RH 1S7UA 4FXKC 3QCTL 3EADA 5TE6H 1IM3A 3KCWA 4OCWH 4P06A 1TZ8A 4UTBH 3EFFB 5F97E 4X5QA 4YE0A 2XFXA 4DP0X 3EH4B 3QBTB 3WTUA 4JKWA 3L6FB 3MLUH 2VRAA 4J8QA 3QEHA 3I75B 3O4OC 3EXJA 1CFTA 5ACZA 3BT0A 4M1DL 4MCNA 5EU6A 4NQDB 3ULUF 2F1BA 1OT4A 4WFED 6TAAA 4Q9RL 1R3JB 2YXFA 3BP6B 2X0WA 4MMYA 4HAGA 1J8HD 5E0FA 4DUVA 1AACA 4YSQA 4KXZI 1KYOK 4OCWL 4LLMB 4N8VA 5FO7A 5I73B 3B37A 4UM8A 3RWDA 3UTTE 3FO9A 3B1TA 2EDOA 4X9FA 2W0FB 3MLUL 1L6PA 3BFOA 4WO0A 1DQLH 5ICXA 3DHMA 2EDTA 3AXLB 3ZTCC 3HPLA 4D2NA 4E41A 4EDXA 4YBQD 1JGVH 1G6VK 3TO4D 3AU0A 4RMRA 5E0QA 3ZKMD 1ZGLM 4ODTH 2Z92B 4UILH 1C16A 3LXCA 2PCFB 1GTFA 4YQXH 4U4BA 3LIZA 1F4WH 2ICCA 3N06B 3HAEB 1CG9A 5KYXB 3IMBA 2R4SH 1DQLL 1SMOA 2WXLA 4OLXH 4X5LA 1JGVL 1FPTH 3FSZA 3FYEB 3V6FA 4J8RA 1QPKA 2SEBB 3RFRA 4ODTL 3MRLA 2QFPA 1DVYA 2PN5A 3TNMA 2WO2B 4M5YH 1EVUA 4Z7WE 3ZPDA 3IM1A 4P48A 4YQXL 1PCXA 1MAML 1JZ4A 1F4WL 2XKSA 3WUZA 4GMSH 4XVUD 4XPTL 2NSXA 4L18A 1HQ4B 2AJVL 2XN0A 3EGSA 4GW1A 2R4SL 4JX0A 5BVJB 2HFTA 4HUXB 5PCYA 4OLXL 4HF5L 3VG0L 1FPTL 4MFHA 1GCYA 2VDMH 1KPRA 4LSRH 1OHQA 3GDBA 4J28A 4AW4A 1BBJB 1O6SB 5LGJB 4M5YL 1WITA 1B6DA 4G8EB 1QZ1A 4LOUD 4GMSL 2JNZA 1GZQA 4NQEE 2XSKA 2XN9B 1KFAH 5IVZB 2ZKMX 5E23A 3UZQB 2FJGA 2WTOA 1R5VA 3I6GA 5BUGA 1FV1A 2VDML 4LSRL 4A7QA 3BAKA 2Y07H 4GBXC 4S0TD 4PV1C 2IANB 3O81A 1QO3A 4B95C 1BZ7A 1I3RA 1CD9B 1MIEH 4QHPA 5C07A 3HI1A 3MCKA 5CGBA 2CJTA 3TT1L 4APXB 4FG6C 3DMMB 1UOLA 4I0PB 1KFAL 5T1LD 4J1UA 2V2WB 4KRNA 4P9MH 4P5SA 3H0TB 3VCLA 3CDZA 4KROB 3OF6D 2R1YB 3T0BA 2Y07L 3MRMA 3X13B 2COVD 3K71B 5T1MB 2DQFA 4JG0H 3ETSA 1KPUA 5LAPA 1MIEL 1Z5LB 1MFAH 3DVNA 2BIHA 1D9KD 5DURD 1TJGH 4P2RD 4GKNA 1FFNB 5D1QE 4P9ML 2XBTA 4K94L 2XY2A 3VXME 4FA7B 5CZVL 1AC0A 1AHKA 1N3NA 2BM3A 2FEEI 1ECYA 1G7IB 4A1RA 1NGQH 4YR6A 3DARA 2VITA 3PAUA 4XNYH 4Y2DC 1U8KB 3MBED 5I76A 2JXMB 3IDYB 3B2PA 4X5RA 3VGEA 3ARRA 1TJGL 1RK1A 4JDEA 1MFBL 2I07A 1T1XA 2PCXA 1TJXA 2BSEA 2XVGA 5KVGH 5D6CA 3IFOB 3FUMA 4JJOA 1W72H 1EEUA 2ICEA 5EU4B 1NGQL 2WXOA 4I77H 3N0PB 1NBZB 1DUYB 2X0UA 3AS3A 4XE5B 2BPBA 2BVQB 2XWTB 4DH2A 3DK0A 1NBQA 4I18A 2RA1A 3H6JA 3BVTA 4HT1H 3CZFB 4MD5A 3T4AC 5KVGL 4PI0A 1W72L 2DL2A 1QHQA 3DOIA 4I77L 3SB3A 1LQSR 2VAAB 3QXAA 1HKLH 3QARA 4PJEB 4F93B 2ZUQB 4FG4A 5IBLC 1IE4A 3P3RA 1SEQH 4KVCL 1NEZG 4N0CD 3MNWB 4P5KA 5E2TH 3ULVE 1VPOH 3SDXF 5FHAH 2OXGA 1KYFA 2NY5L 1FJ1A 1FQ9C 4HT1L 4M7JL 4HIQA 1T2JA 4PRHD 1I3UA 4IKNA 5AYQA 5H8DA 1BIHA 2HN7A 4ZOEA 7PCYA 4LLUA 1RZGA 2F1AA 2YC1B 1AI1H 1A4BA 3UTPD 1HKLL 3F83A 1JUFA 2IFGA 2NSMA 4DSYA 2CG9X 4K3JL 5D5MF 5IMMA 1SEQL 3CUPA 2Z31C 1UZGA 3CGTA 3W0WB 1VCAA 5E2TL 1JPST 1VPOL 1W0WB 3QDAA 1JF1B 5FHAL 1R34A 4HUCA 1HSAA 1W16A 3CVHH 3QFJD 4UWQB 3FOLA 2R29H 2KERA 4X6DB 3EDFA 3QUMB 1U58A 4FCHA 1J5IA 1YYLL 2P24B 5EBMA 2X09A 3QUXC 4ODHH 5LVEA 1X44A 3R06B 5HHOA 2BP8A 3VYPA 1N0XH 2YQBA 3BJLA 1IIIA 2R8SL 4NQDE 3HC0A 2ED8A 3QIUC 5HHMD 5J0BA 3RWFA 4YXKH 2W92A 3CVHL 2EVIA 1SYSB 3KW8A 1IGYA 3ZTEA 3R7RA 2R29L 1CT8A 3HEIB 1A3LH 2ZWSA 4MZIA 5AG9A 5HY9B 4X5WB 1N9PA 2WQAA 4G6KH 2DLIA 1WCQA 4ODHL 4X8XA 4MMXC 4Z3GA 2VJXA 4OKVB 4PGCA 1F3RB 1XMEB 1X4YA 2JVUA 2KDGA 1N0XL 2BW5A 4G6FB 4RGOH 5BRZD 1XF3B 1ZWIA 5H2BA 1DVXA 3RJOA 2UZYA 1IEAA 3N43F 3GMMA 3UC0H 1CS6A 1OQOA 1DQJB 1BXXA 2PPCA 1IGIH 4JUTA 3PIQB 4CVUA 1A3LL 1A8JH 2K9FB 3L1GA 3DROB 4MJ5A 4G6KL 2BXYA 2P7TB 4JKMA 1NCAH 2A6JB 4JRFA 1J1OL 2DQCH 1XL6A 4RGOL 1UQSB 1SF3A 4HIEB 1JL8A 5JNYB 3CFUA 4Y8AA 1OP3K 4RAUA 3UC0L 3MNDA 5ESAA 4BE5A 3LZFH 3O6KH 1IGIL 2I9TB 4FQXC 5J1SC 1H6UA 3LZNA 1P9MA 4R0LC 2BWDA 2RACA 4GG6B 1QP1A 3JWOH 1WG3A 2DQCL 3VXSA 4BFEA 1FP5A 4GAGH 2WTRA 1AHWA 25C8H 3U9UA 1OVZA 2P80D 5D7JA 5AW7B 3TBYB 2J57A 3LN5B 1RMFL 4AL8H 4A7VA 1JHTA 3LZFL 1U92B 3CLEH 4LQ1A 1PMYA 3H8NA 5CLXA 3HHSB 1R5IA 2KT6A 3GSRA 1ZIAA 4QXGL 2D7PA 1EFXA 3N42B 4R7XA 4Y4KC 3JWOL 4Y7OC 5AVUB 2HJLA 4KGLA 4AGOA 4GAGL 1E9OA 2WXMA 25C8L 2A9ML 1QW9A 3AREA 2G5BA 1UCBH 1N70A 1C8QA 3IPEA 2XKNA 3K5SA 4AL8L 4FULA 2WLJA 3CLEL 2J8UF 3CH1B 3EF7A 3L9YA 2Z7ZA 3GJEA 2H9GB 5EBWA 1DQIA 3FB8A 3SOTA 5A7EA 3NJFA 1AE6H 1NC4A 3V2AR 3HFML 4JPSA 3M1OA 3Q06A 1M42A 3U46A 1LK2B 4TNWF 5JOPE 4HW6A 1KBVA 4AGLA 2WY3B 3ILQD 2BNUB 4V1DA 1XR8A 3S8FB 3S35L 1A25A 3HE6C 3EYOA 3NJJA 3HG5A 4BDVB 1I1FB 5DD6B 4TVUA 4ELKA 1RZ7H 5HYJB 2G60H 1AE6L 3D2UD 4W4OA 2E8YA 1T20A 4GI6A 3LV3B 3NPSB 3HLAB 1VACB 2OMUB 1JTTA 1RXLA 2BLFA 3BGFB 3LMJH 4GBXD 5KSBF 2CHDA 3J27A 5B7MA 2P5WD 4M6NH 3LQAC 1E6JH 1UKTA 2GUOB 2CBTA 1RJLB 2WYIA 5EN2A 4FG6D 3DYMA 3QDGB 5GGTH 2X1OA 3DKHA 5ESVB 1A7QH 4MSWA 4NNXB 5CMAA 3MRPA 2ICWA 3B7RL 1MWAH 4JLRA 4W81A 1AQ8A 1CQYA 2EYTA 4JQIA 2RB8A 2Y0SA 5SWSD 5I1GH 3LMJL 3ZK0A 3B83A 3I3EA 2BSRB 4FRWA 5IW6A 2FO4B 1TIUA 1E6JL 3SDAA 4OM0H 7TAAA 5JQHC 4N85A 3H3BC 2Q87A 4IKIA 4WJKB 2L04A 3UTTA 1XXFC 4FZEH 1VFOA 3V0DA 3ZL4L 5CD5C 5B22A 4FI7A 1JE6A 4R97B 4FQCH 3VI3E 2HT2D 4QXVA 3FF7A 1HHGB 1RL1A 1MWAL 4M5TA 3NQKA 5I1GL 2NNFA 1WIPA 4I9XA 2QDVA 1X9QA 4G9FB 1IGFL 5T1JA 2Z9TA 4Y2DD 3RUGA 3KVPA 4X5PA 3P9LA 3TO2B 4A37A 1ZA3A 4FZEL 1KT2B 4U1HB 2QV2A 3U7YH 4DW2L 3Q6FA 4RX4A 2NNCA 3CLWA 4IDLA 4PJEE 3WS3A 2EZ0C 2Q10A 2G9HB 1RHFA 3ABGA 1JK9A 2EEDA 3QXDB 1AKJD 4WTZA 2NUPB 5AG8A 4O2EB 1PNDA 3G6JF 2DM7A 5EN3A 3FF8A 2J6WA 3J07A 1RZFH 1TT6A 4Z7WA 1AZVA 1AGEB 4ENZA 5IT2L 3GUTB 5E6IB 4A38A 4LKCA 1UM6H 3U7YL 3BZFB 4F2MB 4DNLA 3CU1A 3GDCA 3FHAA 3MLSL 2QQNH 3PGDB 5HPMB 3I6LD 3ZMEA 4TSAH 1KJVB 2WLKA 1JD7A 5A16B 3D8MA 1KTLA 1YN7A 2X4UB 1ZXQA 4JFDD 3KL3A 5F9WC 1RZFL 3BGMA 5IBLD 4F8OA 1UM6L 2N4IA 2K6WA 3WSQH 2KUTA 4NQEA 4GQQA 1IAOA 5D6DA 2QQNL 3F05A 4H2AA 4PJ5B 2EACA 3K1KC 5IQLA 1J0ZA 1ZGLB 4XPHL 1G7QA 1HZLA 1AD0B 3L9EA 4N0FA 4GRMA 5GGVY 3KPPB 4A2DA 4P4RA 5KYUA 1E8XA 4R4BB 5TFSH 1JG9A 4QCIB 1KJ3L 1E43A 2Z31D 3WSQL 5J13C 4NAQA 2WCGA 4JFPA 4HS8H 3UTQB 2IADA 5DHVH 4P5MA 1IE5A 5DI8A 2YMTA 1ZLEA 3AMLA 4XCNA 1FL3A 4HGMA 2ZXWB 4S1QH 1AQDB 4BWTA 1NEZA 4A7GF 1F4YL 5IVNA 5L4JA 3QXUA 2UX7A 4FXGC 4LKXA 5TFSL 1LEKB 3L81A 3ZTDC 2NW2A 4OJFH 3JV4A 3IE4A 3BI9X 4X6CF 5D1QA 3QIUD 1FWXA 2J5LC 3R7QA 1AGBB 4S1QL 2VQ1B 4V2BA 1ORSB 3HZVB 3L3JA 4JKNA 2NX5D 3QFDB 3KNBB 2Z0UA 5HI5D 3GSUA 2C7UB 2FGWH 1KWKA 1OP9A 3L5HA 4UCFA 2A6IA 4HKZA 2UZIH 4MB4A 7PAZA 1B3JA 1SVZA 4OJFL 3VFGH 1IFHH 2ARWA 4GSXA 1LNUB 4ONHA 3JV0A 4FCAA 2WTPA 4L8SA 4EUPG 2MCMA 4GG6E 2PKDA 2IBZX 3FTVA 3SDDB 3DX8A 2APFA 1D5IL 4N9GB 3CSGA 3QCUL 1IC5L 2EH7H 2FGWL 1FA4A 1JK8A 1IFGA 4UINL 1JS4A 3RIFK 4E68A 3IKKA 2UZIL 4ICWA 4YXHL 1KGWA 1YNTF 3VFGL 1SXBA 1IFHL 1I82A 2B14A 1YQVH 3SKOB 3EFOB 4HK0A 4D0BB 1ZS8B 2TSBA 3Q0HA 4DK5A 3QG7H 2XWZA 1P7KA 4X83A 4NENA 1MCFA 1XR9A 3P2DA 4FQPA 4UZGA 4D0DA 1MREL 5DVKA 5I1AA 4HC1H 4ZUVB 4XGZA 5F7AA 2XIDA 1JGUH 1DJHA 1L3NA 1ZHBA 2ODHA 4QT5A 1NKRA 1YQVL 1B9ZA 2BH0A 5K1NA 3L9RB 3C09C 5DD3H 4RIRA 1BCIA 2Y1YA 4KK6C 5CZXC 1ACXA 3MR9A 3D52A 4IGBB 4ANVA 4PJ9C 1ZV5A 4OZ4A 5TF1L 5KUKA 5CSZA 4WWKD 3O8XA 4GI8A 2Q6WA 3SDCA 3H9HB 4ZUUB 1U3HC 4I7ZC 5F7EH 4CBPA 2W0PA 3QORC 4PU2A 1XF2A 3RVTC 2CQVA 3FJTA 3NRPA 2W0KA 3HS0A 3LNHA 1T1YB 3BZ4A 1RFDH 1N5AB 4FNLL 1U0QA 3L3OB 5DD3L 2P1YA 2CO7A 3EYQC 5DT1H 1AOHA 2EC9U 5LB1A 4DO5A 2C7FA 5JYMA 1IC7H 3APCA 5DUMH 1JPTH 3EFFA 5IW1B 5JDJA 1S78C 5SX5H 1N19A 3L6FA 3QDGE 3I75A 3CSFA 4UT7H 3CDGB 4NQDA 1R1CA 5IEHB 1RFDL 1R3JA 3UGEA 3BP6A 3HE6D 5DT1L 3V9FA 2D7OA 4LLMA 2I5YH 5ETUB 1V8HA 2IBZY 4LOEA 4AQEB 5DUML 1JPTL 1T2QH 4AVJA 3F6IA 4Y88A 5JW5B 1ACCA 3WBDA 3MV8E 4LRIC 2W0FA 2DKSA 4JG1H 4F15B 4C4UA 1E5BA 3FQRB 4UT7L 4B9KC 4HH8A 3AXLA 5MHSD 3CV5A 2EDWA 3O2WH 4L23A 4PLOB 1U9KA 3VM7A 4WK0B 1WAPA 3QEGL 1OF0A 4G9FE 2APXA 2BWQA 2I5YL 1JRHL 1NSNH 5JLZB 2PCFA 3MODH 2YEQA 4JY6B 1EFQA 5LLIC 2UXFA 3QO0B 3UPCA 3ZY7A 2YPLB 4JG1L 3HAEA 4FJZA 2R69A 5DD1H 4ABWA 4XP1H 5I1IH 2NOYA 1FO0A 2X40A 3O2WL 5AOIA 4HG4K 2SEBA 3FRUB 4XMTA 1NSNL 3MUZ1 4HEMA 3MODL 4N28A 4NUJB 2QVTA 3WFBH 5IWLC 5KS9F 3TZVB 5IEKB 2JELH 2UWEF 1HQ4A 4F2ME 1JZHA 3FQNB 4H5SA 2GK2A 4UAOB 5BVJA 4XP1L 4HUXA 2F8OA 2FE0A 2FD6L 5I1IL 2YARA 3VVWA 5CKAA 3RBSA 4ZMZA 1BBJA 1O6SA 5LGJA 4NQCD 4LEXH 5AFAA 4UTAH 1TZAA 3GSNH 3O6FB 2EZ0D 4OF8A 4G8EA 1FN4B 2JELL 4GQZA 4PGEB 1FG2A 4NX0A 1GY2A 3WTTA 2NXZC 2XN9A 3WN5B 5IVZA 4PEEA 4PJ5E 4FGMA 3UZQA 1J1PH 3IDXL 5I1KL 2LFEA 4PMFA 4DK6A 4DPRA 2FSDA 2IANA 4FQJH 4MAUH 3GSNL 2ZE0A 2X7LB 4PVLA 3D0AA 1KCWA 2WINB 5TQ2H 3WFDL 4APXA 1JCVA 3C5ZB 5TGBB 2DI9A 3B2UD 3DMMA 1LWJA 2EXTA 2JJSC 3QDHA 1YEEH 1LO4H 5JA9A 2V2WA 3MRQB 3H0TA 4GEJA 1J1PL 1KN4H 3ESVF 3F65A 2R1YA 4QOKB 3ZUNC 3X13A 3BMVA 3K71A 5AYTA 1JP5A 1CL7H 5T1MA 1AD9B 2ESVB 2F53A 1LO2H 5IHBA 1WFNA 1K9TA 2G30A 5LO7A 1YEEL 1FFNA 1BIIB 1LO4L 2OP4H 2JJTA 1TZOA 3TCTA 1PAZA 4EOWH 1KN4L 4IIQC 4JM2F 1HAWA 1G7IA 3CFTA 1OTUC 1CL7L 3EJJX 1Q0XH 4K8RC 4LCYB 2BS9A 2C3GA 4DCQB 1QR4A 1I8LC 1U8KA 4OZGE 2JXMA 1E7VA 1LO2L 1KZQA 2BXZA 3L48A 3O3BB 4QMEA 1CICC 4P5TD 5CINH 2BZDA 5JHLA 1F6LL 1ZPLA 5LHDA 3H9ZA 2OP4L 2KI6A 3C6LC 3CQPA 3IFOA 1JERA 4JB9H 1JOIA 4Y8DC 5EU4A 3TBSB 4NQQA 3WELA 1NBZA 1VADA 1Q0XL 1DUYA 3G5ZB 3S5ZA 1CC3A 5IFAH 2XWTA 2BVQA 5BW7C 5F7LB 1GOFA 3UJJH 4A04A 2GI0A 3L4VA 2V7HB 3BUYB 2FJSA 2H47C 5EEXA 4KO9A 3CZFA 3OKLB 5D1ZC 1E3XA 2FQGA 4ANKA 4L4JA 4JB9L 1U36A 2QVKA 3DDGA 1KXHA 1NDTA 5CM1A 2VAAA 4LPVA 2O5YH 5IFAL 4M9OA 4PJEA 1SJXA 2LV4A 2BZCA 3BO8B 4R90L 3UJJL 4Z77B 2FDBP 2YGNA 3MNWA 3QZWB 4HGKC 2J88H 1VRSA 4LCWB 4OJEH 2NXYC 3H1ZA 5IB4A 4BA8A 5AOJA 4JN2B 4HMEA 1Z9PA 2LHAA 2F19H 2YIHA 2X0VA 1JD9A 3GMOA 3BVUA 4HWNA 3G5VB 2DYPB 2YC1A 1UZ8B 3GSQB 1QFUL 1EJ6A 2ZXQA 1OKEA 3ETBF 5B8CC 2KBGA 2F7OA 2OCJA 4PJBB 3V5DB 3W0WA 2J88L 5LDSA 1W0WA 1JF1A 4EUPA 3GIZH 3RVXC 5I6NA 3OL2A 2F19L 5CWSB 5FFOA 2CRYA 4X6DA 4CSPA 3GXTA 4EKXA 2F7RA 1QTYT 1Q9WB 3FQUB 3IT8D 1D5ZB 3K6SB 4FLQA 4IRSB 3ARZA 3QUYC 3R06A 2BMKB 3QE5A 1AVAA 3OQ3B 1RPQA 4ZTEA 3POHA 4PS7A 4KK6D 1AXIB 4LASL