3QPKA

Probing oxygen channels in melanocarpus albomyces laccase
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
559
structure length
559
Chain Sequence
EPTCNTPSNRACWSDGFDINTDYEVSTPDTGVTQSYVFNLTEVDNWMGPDGVVKEKVMLINGNIMGPNIVANWGDTVEVTVINNLVTNGTSIHWHGIHQKDTNLHDGANGVTECPIPPKGGQRTYRWRARQYGTSWYHSHFSAQYGNGVVGTIQINGPASLPYDIDLGVFPITDYYYRAADDLVHFTQNNAPPFSDNVLINGTAVNPNTGEGQYANVTLTPGKRHRLRILNTSTENHFQVSLVNHTMTVIAADMVPVNAMTVDSLFLAVGQRYDVVIDASRAPDNYWFNVTFGGQAACGGSLNPHPAAIFHYAGAPGGLPTDEGTPPVDHQCLDTLDVRPVVPRSVPVNSFVKRPDNTLPVALDLTGTPLFVWKVNGSDINVDWGKPIIDYILTGNTSYPVSDNIVQVDAVDQWTYWLIENDPEGPFSLPHPMHLHGHDFLVLGRSPDVPAASQQRFVFDPAVDLARLNGDNPPRRDTTMLPAGGWLLLAFRTDNPGAWLFHCHIAWHVSGGLSVDFLERPADLRQRISQEDEDDFNRVCDEWRAYWPTNPYPKIDSGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Laccase-1
publication title Probing the Dioxygen Route in Melanocarpus albomyces Laccase with Pressurized Xenon Gas.
pubmed doi rcsb
source organism Melanocarpus albomyces
total genus 177
structure length 559
sequence length 559
chains with identical sequence B
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2011-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3qpkA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3qpkA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3qpkA03
1X9UA 4KO6A 3CG8A 3WI9A 2PLTA 2ZOOA 5FC9A 3ABGA 3C75A 1BQ5A 2XV0A 3ZBMA 1JZFA 4WKXA 4CSPA 3X1BA 5LDUA 1AIZA 2PP9A 3OM3B 1JZIA 2IWKA 5TK4A 3T6VA 4W1TA 3ASNB 4P5SA 1NIDA 4GP8B 1SHWA 3IE9A 5B7EA 4DP2X 2YXVA 3NSCA 3EH4B 3SBRA 3H56A 5AZUA 3UADA 1AR1B 2FT6A 1L9RA 1N68A 3T6WA 2UXTA 2YARA 5PCYA 2A3TA 3CDZB 1XMEB 3EH3B 1ZIAA 3HEIB 1EHKB 1PZBA 2B08A 4DP6X 2I7SA 2IH8A 4A68A 1ILSA 4HALA 1AOZA 2VM3A 3NJFA 1UATA 3OD3A 1R1CA 4M4RB 3AG4B 5PAZA 1AG0A 1BAWA 2PPEA 2AANA 2FJSA 2JXMA 2YQBA 2YXWA 1PMYA 1DYZA 1E30A 2TSAA 2XUWA 1L9SA 2FT8A 1JZJA 2EIJB 1MG2C 3CVBA 1F56A 2ZXWB 1HAUA 3NJHA 1JZEA 1PLAA 4G7SB 4BWUA 2IWEA 3FSZA 4YSSA 2WO3B 2VMJA 1AZUA 4HIPA 1AG6A 5B3SB 2VN3A 3NJJA 7PCYA 5AKRA 3EHBB 1L9TA 5B1AB 1MDAA 3PPSA 1OOWA 1L9PA 3FYIB 4DP4X 1PF3A 2PPFA 1AS6A 3DIVA 4AKOA 3T71A 2I7OA 3PAUA 5F7AA 3QJVB 4E9RA 9PCYA 3NJMA 3TASA 2PP8A 5EHFA 4G7RB 3QPKA 2CALA 3WKPA 2J57A 4N8UA 2YAQA 4DPCX 2CAKA 2CUAA 2HX8A 2XX0A 4YSQA 1QNIA 1IKOP 3X1NA 1J5CA 1AZRA 2BO0A 2IWFA 1J9TA 1NIEA 1TKWA 2W88A 3AG1B 4KOCA 5B1KA 2BHFA 1NICA 2YAMA 1JXDA 2HRGA 5E9NA 1MZYA 2PCFA 2ZWNA 1NIFA 2IDQA 4GXFA 3AZUA 4W9ZA 2E86A 5I5MA 4F2FA 3WNJA 1JXGA 2UXVA 3WNIA 4DP0X 1ASQA 4YSUA 1SF5A 5I28A 2BW4A 1VLXA 3QJSB 1CURA 1A4AA 2FTAA 1NIAA 2AZAA 1AQ8A 1V54B 5D4HA 1XB3A 1J5DA 1PLBA 1W6WA 1WS7A 4X4KA 5I6MA 4YSOA 1MG3C 1NDTA 3AW5A 4GY4A 1M57B 4P5RA 2WO2B 3S3DB 1KYAA 2OCCB 4MFHA 4DP8X 2XV3A 4HZ1A 2IH9A 2HZHA 2VM4A 5I26A 3CZUB 1W6LA 1OF0A 3EF4A 5B1JC 1E67A 1DZ0A 2XX1A 3SQRA 4TXVB 4HCGA 2AFNA 2VW7A 2XXFA 1BXAA 2UXGA 2HX7A 2DYSB 2QPEB 4YSPA 4BK5C 1RKRA 2H47C 1GY1A 5I5JA 1PZCA 1OCZB 1A4BA 1OE3A 1YLBB 2UX7A 3UAEA 2IDSA 1SJMA 3FU7A 4BDVA 8PAZA 1AANA 1EZLA 2FQGA 3T6XA 2EIKB 3X2QB 2X88A 1BYPA 3ASOB 4RH4A 1HFUA 3FSVA 4N4YB 2GC7C 2W8CA 1T5KA 2CCWA 2ZONA 1JZHA 1JERA 1QHQA 4L0PB 2XU9A 4NAJA 4DPBX 3WG7B 1A4CA 3CVCA 1SFHA 3FSWA 3TU6A 4A2GA 3S3CB 1GR7A 3AY2A 1WA2X 3D12B 2YAPA 4FA7B 1V10A 2HRHA 4YVUA 3WIAA 3QJTB 4KNSA 4YSTA 3ZIYA 1SHXA 2LLNA 2YAFA 2BZ7A 1V55B 4NERA 1XB6A 1NPJA 2FWLB 1ETJA 3FU7B 4KO7A 3NJLA 2GB2A 4KO9A 1E5ZA 1A65A 1HAWA 3JT2A 2H5UA 3ZX1A 1JVOA 2B3IA 1AZCA 2IDUA 3HB3B 3PLYA 4YSDA 2FT7A 4A2DA 3OMIB 2JFCA 3IEAA 3S8GB 4JHVA 3BVDB 4YSEA 3TBCA 1XB8A 2PPAA 3PXLA 1OCCB 3FYEB 1IUZA 1WA1X 3FT0A 1ADWA 1QLEB 1WAEA 2P80D 2VW4A 1AS7A 1RZQA 2P80A 5IY5B 1RCYA 4BWWA 2EIMB 1NZRA 3NT0A 4KOBA 5B1BB 1NTDA 2HXAA 4AKPA 1JXFA 1NPNA 2RACA 3FPXA 1KCBA 1ZDSA 1KBVA 5F7BA 2I85A 4YVNA 4F2EA 1OCRB 3OMNB 6PAZA 3IN0A 4BXVA 1FFTB 1SNRA 2DYRB 1E65A 1RZPA 3FQYA 4E9XA 2IAAC 2X87A 4GYBA 1JZGA 3X1GA 4DP1X 3GYRA 1KCWA 4ZK8A 3NP3A 4HCIA 2QDVA 5ANHA 3NJIA 3U25A 2MRYA 1OCOB 3BQVA 1KDIA 2R7EA 2YAHA 3NSFA 5I6PA 4AI7A 1X9RA 3NP4A 2GSMB 1A8ZA 1L9QA 2Y1AA 3AG2B 1W8EA 4CSZA 2J55A 4QKTA 2BW5A 4KO5A 3SBPA 1JOIA 1GW0A 1SF3A 3ERXA 1J9SA 3UAAA 1M9WA 3IBOA 3FQ2A 1I53A 3NSYA 2QT6A 2TSBA 2BP0A 4KNUA 2NRDA 3H4FA 4Q8BA 3CDZA 2XVBA 1GS8A 4JKNA 1BYOA 3FSAA 4NB7A 3CVDA 5TK2A 3UGEA 3KW7A 1NWOA 1TU2A 2JKWA 4F7KA 4KNTA 2XWZA 3JTBA 3MBWB 3N2JA 2DY2A 1CYXA 4E9QA 1PAZA 2R7EB 2PPCA 4A2EA 5D4JA 2UX6A 2XLLA 4EF3A 1IBZA 2WSDA 3S3BB 2FQFA 1ZPUA 1JVLA 3ABKB 3DKHA 3NYKA 3QJUB 4YL4A 3UACA 2VSMB 1URIA 1MZZA 1ID2A 4JHUA 4DP5X 3S8FB 3FU9A 3N55A 4G71B 3ZDWA 1AZNA 4UANA 1E5YA 1PNCA 5I6OA 1ET5A 4BXSV 4YSAA 1GS7A 1BXVA 4G72B 1PZAA 2MTAA 1TEGA 1ZIBA 2BP0B 3DTUB 2AVFA 1J9QA 4HAKA 2QDWA 2BP8A 2EINB 3V9EA 1TEFA 2FNWA 2QPDB 4GP4B 1OV8A 2XV2A 4PAZA 1N70A 3EH5B 2YAOA 2Q5BA 1AAJA 2CBPA 2H3XC 2UXFA 3GDCA 3QJRB 3X1EA 3KW8A 2XYBA 3TA4D 3V9CA 4DP7X 2FQEA 4BDVB 3T6ZA 4GP5B 1FWXA 3NJKA 1NIBA 2XXGA 2OJ1A 3PAVA 2Q9OA 4E9YA 4A2FA 4A2HA 3UABA 2YAEA 2VW6A 2J5WA 1ZDQA 4ENZA 4DP9X 2IDFA 5I6KA 2GBAA 2AZUA 2GI0A 1ET8A 4K9JA 3QQXA 3RYMA 4QLWA 5D4IA 4UAHA 3SBQA 4AX3A 3ABMB 2HLEB 3G5WA 1OE1A 1CUOA 1ZV2A 2CJ3A 2PPDA 3NSDA 4UF7C 2BP8B 1ET7A 1BEXA 3WKQA 1IBYA 5B1JA 7PAZA 6PCYA 4AZUA 1AZBA 1ASOA 3FU8A 3T9WA 1GY2A 1AACA 4DPAX 4E9VA 2GC4C 2EILB 2Y69B 1PNDA 4A67A 4HCFA 4M3HA 3OMAB 3X1FA 4FAAB 3ABLB 4PCYA 2J56A 1GYCA 3TBBA 1ASPA 3IN2A 4E9TA 2GHZA 5I6NA 1NWPA 3L45A 1KV7A 5A7EA 1WS8A 3MX0B 3AG3B 3PCYA 2DV6A 3QJQB 1PCSA 2N0MA 1BQRA 1SDDA 3OQRA 4YSCA 1L9OA 5B7FA 1B3IA 2PP7A 2VSKB 4E9WA 2DWTA 2OV0A 2IDTA 2FQDA 4Q89A 1IC0A 1WA0X 4WTQA 4BWTA 1KDJA 3FQ1A 1FA4A 4HHWA 1CC3A 1OE2A 1PY0A 3FPYA 4E9SA 2GIMA 2HX9A 1A3ZA 1ILUA 1BQKA 1J9RA 5AFAA 5B7MA 1NINA 1PLCA 3FS9A 1M56B 2BWDA 3NJGA 3NJNA 1KBWA 1GS6X 1SFDA 4AKQA 4G70B 1CYWA 5I6LA 3H4HA 4YSRA 3PAZA 2BZCA 1BXUA 1SDDB 2BWIA 2DWSA 1GSKA 4HHGA 4A66A 5I5IA 1AS8A 4G7QB 2PCYA 3GXUB 1KGYE
chains in the Genus database with same CATH superfamily
4QHNA 5TGBB 2VZ3A 3BVNA 2GJ6E 5DU7A 2VZSA 5ITFB 3RY4A 3DX9B 3T4YA 5DD6A 1FVEA 2ZOOA 5FK9B 5LCVA 1HHIB 3ABGA 2LHAA 4MS8C 5B38A 6FABH 3LCYA 1QWUA 3HZVA 4KKPA 5K93A 4ZXBB 2H9GA 4WJKB 1E2ZA 1FZKA 4KKZA 3MNMA 2IWKA 1G4MA 1WISA 4FYQA 5CBAB 5I1JH 4ETQA 1KTDA 3MFGB 3TBTB 3IB4A 2TRHA 1SHWA 1DZBA 3NEXA 2NTFB 4F58L 4Z3IA 5EEZA 3WELA 4K3JL 3CFIC 1H6TA 3UTPD 4PRNA 1AI1H 1NCDH 1T66C 2DQGL 3ZDYB 5IB1B 1VEPA 3BPCA 1TVHB 1FG2B 4DP6X 5LGJA 3NCXA 3K71B 5F7LB 1ZEAH 5CINL 2WQWA 3NJFA 1D2PA 4M7KH 4OZ4A 4N0YL 4UDTA 4KJPC 1AG0A 3ARDC 2BSTA 3H9SA 3A5VA 5L2KE 4G9DB 1ZLUH 2YXWA 1FV1B 2P45B 4KDTC 4P59H 4Q4IA 4OCMC 4PJBF 4EXKA 2AABL 1NCCL 3FO0H 2Z35A 3WLWC 1I1RA 2VLJB 3Q5OA 5CCKH 3HS8A 4ODTL 3L2MA 3O2WL 35C8L 1D6EB 4DCQA 5GZND 3LEVH 1JHKH 2EVHA 5D4QA 1R24B 2KLTA 5JHBA 1CTNA 2QVFB 3EOYG 4MNQB 4F33A 3D0AA 2J8HA 3B6SA 4ZO6A 1GMEA 4MBRA 2X4NB 3GLEA 4POYA 5IVXF 1KCUL 2VQTA 4WUUB 1XTLA 3R8QA 4TKWA 1RLWA 5J5EA 5JDSB 5BRZE 2FYVA 2TRYA 4Y88A 1RUPH 4Y4HB 2AXFB 4P48A 2EDQA 4H25A 3L7FB 4U3SA 3WFDH 3JWDH 2H0PA 1QBLL 2Z0UA 1UB5A 4WWKD 3FRUB 3QJVB 3S5LA 2X6AA 1CQKA 2C3GA 1OGTB 3LHAA 1JGLH 1IM9D 2K6ZA 2QJDA 3NTCL 1T22A 3DSNA 3BKML 3MUGB 4JY4A 5EOQH 3X13B 1REIA 3REWA 4X50A 5FYJU 2G75B 5JQ6H 1GIGH 1BHGA 1J8RA 4K7PH 2F5AL 4L4JA 1MJ7H 1OY3B 1LDSA 4NKQB 3U9PL 4BZ2A 3QNXB 2XNAB 2WV3A 3EJUA 4QT5B 5LQBL 1I9JH 3AREA 1XR8B 2HFFB 2OMVB 2OZ4L 3QI9A 1A4KA 3B8YA 5IIEA 1G6RB 1ZVSA 1XGYL 1A6VL 3OJ2C 1CGXA 3WY1A 1CK0L 1BQLL 4C56A 4LPUA 2ENPA 4HPOL 3IMVA 5LVEA 4UQDA 2W65B 5DYFA 3L5IA 1Z9MA 3FFDA 3OF6A 3V5HA 3DETD 4MDIA 3SDDA 4CDHA 3RFRA 3FN0H 4QHLB 2J4WH 1LO0H 3K4ZA 1ZT7A 2ICWA 4GAJL 5JPMA 1KMGA 3S35X 3WFCH 3JTSB 4YHIA 4ZODA 3QRGH 4KK6D 1LMIA 4GY4A 2JTYA 3RX5A 4GUPA 4I18C 2E7DA 4Y16C 4DP8X 4K94H 4CGUB 4HZ1A 5IMMA 2WVSA 1DZ0A 3VXUA 3LMJH 3M6DA 3RB5A 2BNQB 4F37K 5I2IB 3WGVB 4KXAA 1HH9B 1X9LA 4TXVB 4DFHA 4OBSA 3VE0B 1JPEA 3ILQD 1AKJD 3J07A 3OLEA 2KZWA 1PIGA 43CAB 4F57L 5CEXA 1SEQL 4GQRA 1RMFL 2OMWA 2XJLA 3P77A 4YHKL 4O2FB 4PCSA 1PZ5B 1YY8A 5GIRA 1IC5L 1WV7T 1I3GL 5AW3B 1P9MC 1AANA 2WBJB 2EDFA 2WNWA 1F4YH 4AY0A 4KTGA 3T0ED 4YHLH 1NFDA 3HE6A 4LPVA 4OV6F 1KFGA 2EDHA 3MA7A 4HJ0C 3LKRA 4PJ6A 5IFJB 3VFGL 2CNYA 4PJ8B 4XB3A 2VCOA 5EFIB 1OK0A 5G2NA 3X14A 1H15B 4YAQB 4X9FA 1IIIA 4MWFB 1CJYA 2YXFA 4OB5H 4DGIL 4ZO9A 5JHLL 1FNSL 4APXB 5BUGA 1A6AA 5CP3A 2IALB 5AQ0A 3FFCB 2XV6B 1BZ9B 4GLRI 1G7HB 5DJCA 4U1MB 3QO0A 2BZ7A 2ZYHA 2IV8A 4QEGA 2J1KA 1TCRA 1I9IH 5C08B 3MTXA 4MJ6A 3KVQA 2CM5A 4S1QH 3FU7B 3W1ZA 4KO7A 2OMYB 2OP4L 5D1XB 4N8CL 4KROD 4NDMA 4WENB 4WRLA 1I3RA 2APXA 4KO9A 1HAWA 4XB7A 4FG4A 4XNQA 3B5TA 2E9IA 4M29A 4RGOH 5FCSH 1W91A 1X7QB 2F8VA 2V33A 1AZCA 4I3RL 3C87A 5H35B 3UPRA 1O6VA 1QFWM 4K7PX 4NJAL 2B77A 4HFUL 3VTTA 5B22A 3EGSB 3TJEL 2FATL 4LSPL 3DTXA 4F7PB 4AM0Q 1MH5B 2HFTA 1KN4H 3HG1E 2CBTA 4XCCH 1E6JH 4Z7VF 1Z5LB 4NO2A 4PJ9B 3FT0A 5F93C 3ZU8A 4ODBD 5FUCC 3PWJA 1U95A 5DUPH 2ITCA 2NNAB 2JI2A 3GXFA 2BS8A 2VR4A 2VISA 3T2NL 1SYVB 3M07A 4PLNC 5HPOA 1G7LA 3IDJA 5HI4C 3UERA 3NIDF 2AC0A 5C0DA 3ETSA 3LN5B 1ONQA 5DZOA 2XN9B 4PGBA 2XFXA 2MOQA 3QUMA 4MMXA 4PJGE 5C7XH 2K7QA 1B0RB 1MFCH 3UH8A 4FFYL 1U8KB 4OLXH 1HOEA 3VXSD 4M3KB 5DHVB 1VKXA 5F97E 5DJ0A 1J10A 4GSDH 5MEQB 1Q4NX 1JL8A 1NGPH 4BQBA 3GYRA 1T0MA 1ZLVK 4TNEA 3QYNA 4O02B 4FNSA 3N5AA 2NX5D 1OAYH 3SDXB 1E5CA 2C26A 3BLPX 1OP5K 1BWMA 3H53A 1KDIA 5CSZA 4UZUA 4OQTA 2ZOKA 1EFXB 1X9RA 4G2AA 2Z8RA 3L3GA 3E1F1 3HS9A 3OKLA 4PRIB 1EJ8A 3IMWA 3GNMH 4X8JB 2W9LA 4XCFH 1A02N 2YPVA 4HGWA 2X6MA 4S10A 2WLIA 4WKZB 3S48A 1BX2A 2NNRA 4ELMF 3AAZA 1RXLA 2YSSA 3V0IA 4ABVA 1OTUD 4CMHC 3BRDA 1A7NL 3I3DA 3MLTB 3HOGA 2V5TA 2ZUVA 2IFFL 4OGZA 3AB0C 1WIPA 4ORGB 3V0EA 3C6SA 1S7XA 1DVSA 4LXFA 5T1KA 3ATFA 4X9YA 3OKNA 4AE1A 1MJJB 3CDZA 1I7TB 4P4RA 1RP8A 3SJVA 2OYKA 4ZFFB 3FSAA 5GGSB 4OUOA 1NOLA 4P9HH 3ZMNA 5CSBA 3UGEA 5JUEH 3U1SH 3N40F 1KIUB 3S5ZA 2PO6A 1EUUA 2FJHB 2NY1B 4P2CG 4IRSB 3IJ8A 5EUOE 4YDZA 3B2UD 3CBKB 4BIKA 2F53B 5C2BL 2HLFD 2J1ZA 4R7XA 3ZMEA 3V0AC 4PJBB 2IQ9L 4Z5RB 4FKHA 2QPUA 3WNMA 2VSMB 4X9IA 3FU9A 3KPMB 3B3IB 1BZEA 4Z0BH 4JFFA 4NP4L 1DBMH 3QC6X 2BJML 1ZJBA 2BVOB 1MCKA 2GIYA 2PWGA 3CXFA 3WO3B 4BH8B 2QSVA 4Z95H 3CFUA 4HIHA 2ZAIA 5IQ9B 2Z8VC 1GHFL 5IVXB 1HZHH 4YIQB 3DROA 4FFZH 1VSCA 4BFJA 1TZHA 2VDRB 5HHMD 3JWOC 1TJGL 4FL4B 5AW8B 4FG0A 1BZOA 1W9XA 3ARTA 3CH8A 4UT6L 4BH7A 4WW2A 1NGZA 1NFIA 5GHWL 4UM9B 5F3BA 1KYDA 3PGCB 4R0LB 3NCWA 4RGNE 2MMXA 4IOFD 3OLDA 1T4WA 1F11A 1YC8A 2FE0A 4H1LB 4IU2A 1A6UL 4OZGF 4PJDE 4PY8J 3TVMC 1HIMH 3MV7B 2WLNA 5I71B 3OC5A 4JY6B 3MX0A 3EYQD 2MCMA 3TN0B 2ARJA 1NC2A 4I1PA 3DOSA 2NY0D 3JQOB 4X99A 1A0QL 4HJJL 3OKOB 1J11A 2J88L 4HEPA 5C0BE 3GT6A 2BOCB 3OQ3B 1SHMA 4K7FB 5L88L 5GS2D 3ULUC 1U93B 1M7IB 3WFZA 4LLDB 2WOBA 4P2AA 1IBYA 1KTLA 5KVEH 1IB5A 1G7IA 1Z3GL 3DX4A 4EZKA 4G1MA 4DPAX 4N5EC 4UMGA 1BVLA 5INDB 4U6XA 4F3FB 4JRFA 1NC4B 3S3JA 4R7NB 1U92B 2XICA 3K6OA 2WZAA 3U6RB 2OW7A 1RU9L 2XTJB 4J3TA 3WTXA 4OCWL 4NUJB 2DQUH 4G9FE 3T3PB 5IJKC 4FEIA 4LEEA 3AG3B 3A6OA 2IXQB 1SDDA 1TQWA 5K59E 3ZR6A 3MV01 1BQHB 1B3IA 3NRFA 5TFSL 4YE4H 4H88L 3TA3A 2IH3A 2A7BA 1Y6MR 4U31A 3N50A 1ZSHA 1TEYA 1WA0X 1N19A 4C59B 5DT1L 4Z7OE 2WWKT 3D85A 4R7DB 4U6YA 4PRHD 1NAMB 3BJ91 1EO5A 3P2TA 4TF4A 1YUHB 3FPYA 4E9SA 2GIMA 4QCIA 3ECVA 4GS7B 2BNUA 5A6MA 3VWJD 2G2RB 4HUWB 5AL8A 3DHUA 4P4KA 4ESKA 5E8DH 4NBYB 5HTSA 3VJ6A 1CE1L 2X1XR 5J6SA 1OHQA 1IGFL 1M56B 3P3UA 1I8LA 5E7BA 3VFMB 5GS2H 1RP9A 2L7EA 5KVFE 1SFDA 2I32A 1Q9LB 2X2IA 4G70B 3ZVVA 2OSLA 1WTGT 1AZVA 5F7KC 3U2JA 2X4PB 3CFBB 4NUQA 1CLZL 4QRSB 3TC9A 1XXDC 4S11A 2WSPA 4HSQA 2B0SL 3O2DL 5AENA 4HWBA 1SOSA 43C9A 4A66A 2BSCA 1EEQA 3QR1A 4WIQA 1FPTL 4F8QA 4HWZA 4CW1B 4NC1E 5ICZA 3GB7B 1A1OB 5C9KA 1ZLWH 2RIKA 3O6FB 4PVNA 3U4AA 2Z93A 3MFFB 4NRZB 4ZS6D 1JZFA 2WIMA 5KSBA 2Q87A 3G5VB 4M6AA 3Q3GB 1NBVH 2E6JA 4TMPA 4TN9A 2VR6A 3T6VA 1P7BA 2DI9A 2Q76B 4C4KO 1AQDA 5GISL 2R56H 5K5YA 2EKJA 3TT3L 2JELL 1KIQA 2VL5A 5CD5D 3JV6A 1GGIH 3QIUD 1T21B 2CK0L 5C07A 4UOJA 2VH5L 3O3DB 2FYYA 5DEJA 5AAMA 2BXYA 4LLWB 2HLAA 3UBXA 2YUXA 3EW3B 4GRLC 4OZIE 3FCTB 2VTFA 1KJ3L 3I2CL 5J9PA 1ACYH 1QRKA 3RVVC 2NZ1A 1VFAB 5EWIL 4D0CB 3WV0A 1U3HB 4R97B 1JNJA 1T1WB 2K3HA 3OKEB 3NA9L 1MLBA 1CLYH 1MLCA 2AEQL 1IFRA 1FNHA 1UXWA 3WNLA 5I9QB 5LB1A 4KKRA 5I5RA 1SVBA 3GS7A 5I8CA 1XIWA 2D7TH 2X09A 3VG9B 3IMBA 2UY7A 2R15A 1DVFD 4LSRL 4BHUI 1KXVC 4IW4C 5IMLB 4F7CB 4YK4C 2DQFB 3NIDB 4XBPB 4I87A 1QSFB 4BSVA 1XCWA 5D9SA 3FQTA 1T83C 5I24A 1UUSA 5HYJE 5GRJH 1KY7A 5L2JB 1R0AH 3QCVL 4PJXE 1I9RH 1Q94B 4L8BB 3AWEA 4NZTH 3MLUL 4DNLA 3QWRA 1NANI 5D1QE 1HWGB 1J48A 1AR2A 2H8PA 4G82A 3L5HA 1DBBH 2Y24A 3PHQB 2IGTA 4JM0A 4F8LA 5EC2B 1G84A 1KULA 4PJXA 3AU1B 4I2XB 2ISDA 2FECI 3BEVA 3RA7H 1NSNH 4TLSA 4IRZA 2YEZB 2ATAA 4W70A 1J5CA 2FSEB 3KGUA 4Z3FA 3SDAC 3MLYH 3WHXB 1G9ML 1XF1A 2YUVA 1HT6A 2Z7WA 2WXGA 4EO5A 4WI5A 4L4TD 3T65B 5JIIA 1PGRB 2VIRB 4K4KA 2FZ3A 4OGYH 1D5BB 4OLVH 1K72A 5HHOE 2XWDA 3RNQA 3Q5TA 4FMVA 3GRWA 5F3HB 4HETA 5IK3A 2AJVH 3RB7A 3VXNA 4YGVB 3GXPA 1RIVL 1W0YT 3Q1SH 2ZKWA 4XP5L 5FHAL 1Y0LB 4GG6E 3M1CA 4QHKI 5IHLB 1F2QA 3ARDA 1LEKA 5E94B 4UDUB 4A7QA 3GLAA 4R6UA 3N1PC 3MOAH 4PV8B 1AP2B 2Y1ZA 4G6KL 1NH6A 5E2WH 2IOOA 4JB9L 5IOPB 1ZKAA 2P8LA 1QWNA 4LDOB 4U1SB 2FJFB 3IRCA 4DOHB 4GAGH 5BOPA 1IC4H 1TQUA 1BQSA 3HI1B 3BP7B 1XVSA 4HJ1A 5B21A 3IGKA 1RPUA 3NCBB 4P5KA 3U7AA 2HJLA 1I4FA 1X9QA 2NY6B 1S8DB 1V7NH 1YCSA 4UINH 3BX7C 5CCGE 5C9JA 1U41A 4YHML 5BUPA 2MKWA 3OGCA 3MJ9L 1AXIB 3DRTA 1FVDA 2A6IB 1WEJL 1DBKL 2YXMA 4XHJC 4ZSOB 4NQTA 4FTDA 5GXBB 2YPLD 1CT8B 5I1HH 2PXYB 1Y07A 2H47C 4PWKA 2EEBA 4X5XB 3JUYA 3RU8L 3QAZC 1KFAH 4JGUA 1PFCA 4FXKB 3IJSB 3MA9L 1XZ0B 4H7VA 3GSNH 4LT7A 3VCLA 4NRYB 2UZYB 3RP1A 3AT9A 3ULVF 3RTLA 4BZYA 5I1GL 4IRJB 3ASOB 1L0PA 3QFDA 1N12A 1TJMA 5M94B 3Q48A 3HAEG 5D71H 5C0IB 5T33L 2DBLL 5CZVH 1JZHA 5TJWK 4PRPD 3B9KC 3GMOA 4G7YH 3TIDB 4FP8L 1KIPA 4JFED 3BRGC 5HDQL 1HHHB 3DUSA 5EEYA 2EH7L 3BE1L 2JIXB 2ZUUA 3JXAA 2IPUG 4H2AA 3PQYB 1FL3B 3FO1A 4KX7A 3KCPA 3KYNA 4RFEA 1O7DC 2D9QB 5D5MF 1WTLA 4HZAA 4YUEH 3TO4B 3NA4A 4MAUL 5TF1L 3QK0A 4KK6C 4XVTL 1YYMH 4BM7A 4BQ6A 1JGUH 3K2MC 3KDMA 3CZSA 4WY7H 5C0CA 1HOCA 4JQIH 5IW1A 3B34A 4XC3H 2OL3H 2CDGB 4XOBA 4AK2A 2WANA 2QGCA 2NCEA 4EKXA 1EEYB 3MVSA 1D6VH 4PRBB 1HILB 2HJFB 4JVPA 5D2LB 5DRZB 3X12B 1KJ2H 3FBQA 3AT0A 4PFEA 3T0VA 1TFPA 3ILQC 4D3CH 3C2AH 1DQIA 1HSAB 4PIRF 4AMWA 2NCMA 3RWGB 4A2DA 3OMIB 5DEFA 3VSTA 3IJYB 2YPKA 2QELA 4H26A 4MA1C 1DUZA 5HJ3B 3ZDZF 2Q10A 4I18A 1XB8A 3QZPA 1YNLH 2ZCLL 4NQSB 4Y16A 1MQKL 3LN4A 2CRIA 4WFFD 1T89A 1YMMB 4ODSL 2OAAA 1RH8A 4O2CB 3M45A 4MQXD 4A7TA 4HQQL 3L4ZA 5DUBA 1G7MB 3HRZB 2PW1A 1LEGA 2K6YA 5I1AB 2HKHL 3OR6A 4LARH 5DHYB 4AKPA 1I8KA 3WBDA 3FPXA 4AV4A 5IESH 2N0KA 3JZYA 4Y2NA 3OHXA 3RDTB 3MPCA 5D7LE 1YN7B 3VXRA 5TQ2H 3QFGA 1JBJA 1FH2A 3HZMB 3PFUA 2ARJQ 2GJJA 3WXVH 3FQYA 1LK2A 2F9BT 3NEEA 2E47A 3I85A 1INQB 4GSRA 3I50L 4G43B 4WSJA 2IQAA 2C5DC 1YPZA 4K07A 4HCIA 1CZ8H 4HS6A 1V7MH 4UTBL 5JQHC 1XH3B 1RHHB 3S36L 3U25A 4LEXL 4K5NA 1JZ2A 2IPKA 4IOSA 1Q0YL 4NQXB 3GMNB 2C3VA 4XO5A 4KI5D 3U36A 4D8OA 2MOGA 4YZWA 1G5AA 3CTTA 1A8ZA 1NBZA 3PL6B 4PJIE 5GPRA 1NUGA 5CN3A 3VQ1C 3IGLA 1P4BH 3DXAA 4JR9H 3US0A 2FX9H 3C2SA 2EZ0D 1OAUL 4GRMA 4KKNA 3ROLB 4X6CA 4WWNA 4YDKL 1P5UC 2BSEA 3WNNA 2FB4L 4P2QB 4OM1H 1KJMB 5I8OL 5GS0C 4ZS7L 3PHSA 4OGXH 2Z34A 1Q1JL 3O3BB 1NCNA 2X70B 3ESOA 1ZCRA 3DX7A 5IFHH 2ZX8A 5AKVA 7FABL 2I60H 4KMTH 1FYTD 4NN5C 2Z8SA 5LN4A 3MBED 1UCBH 5ID0B 4FQ1H 1BYOA 4MJID 4OZFA 1LE5B 5ERWB 4P9HC 3CFCL 2X5PA 3QJOA 3HHRB 1B6UA 3VFOB 3QUML 3EF7A 3I9GL 2OTWA 5CD3A 3GBMH 4KNTA 3TJHD 3EGDB 4AC2A 2H1LM 4MRCA 1CYXA 4JDEB 2OR8A 4FLRA 1QR1A 5DGRA 4DVRL 5AVVB 4KNQA 4OJEH 4CAGA 3PWPE 5BXFA 1MIEH 2EVFA 3L08A 4GSUA 3NYKA 4PJCA 1MZZA 5HJBA 4ZBJA 4ATWA 2WKOF 5ISZD 1CFNB 3GBNH 1BIIB 4NO0B 4PP1D 3ZDWA 5J3HC 3TEZA 3U0PB 4OQTL 5L9DL 2DWEA 4QRUA 5T3XE 2FWOB 4YSAA 5DD5H 2R8SH 5DZJA 2C7FA 4DEWA 1CDUA 1MIML 1TEGA 3ECQA 5F1KC 3D0VA 2B5IC 3MRJB 4LLQA 4N2FA 2BERA 3DI2B 1NLBH 4JY5H 3WDJA 4OFYD 3FTGB 2X10A 2OS7A 4TOYL 4P0DA 1X5GA 4MB1A 1L6PA 1F6AB 1TETH 3T1FA 2JCCF 4GW1A 3L3OB 2FO8A 4HUXB 1NBYA 4OCRH 1T1ZB 4G3YH 1B2WL 4NXSA 4A2LA 2OJ1A 2WB7A 3BZDA 1QKZH 3GMMB 5LAXA 4I1RA 1E27B 4XCNB 4JDZB 5J6HB 1VEMA 5ESAA 2R59A 3WIHH 2YFOA 5GGTA 3QQ9D 1WH0A 2AQPA 3FRPA 4E41D 2R1XB 2Y1VA 3ZYIA 2WMPA 2HLFC 4BE5A 4P9MH 5G4OA 4QY8A 1VCAA 2PKDA 2PPDA 4UF7C 4OZHE 3WY4A 7PAZA 2P8MA 3VI3F 4JKMA 3VGFA 5FA3B 1HL9A 3WFBH 1LWHA 2FVNA 2NDFA 5ADOH 1T4KA 3NH7H 4A67A 1CGSL 4S1RH 1KLGB 5CJXC 1VRSA 2OI9C 4XC1H 1BD2E 4J1UA 3WMSA 4UBDD 2XXMB 3MV8D 4EUPA 1MUJB 1PX3A 4P46A 2WXQA 1NEUA 4FYTA 3MRPA 5EU3B 1NL0H 1FL5A 3LB6D 3RWEB 3VFUA 4H20L 4UI2A 2OJZL 1QSZA 2CA3A 5AYUL 2CIKA 4A55A 3OQRA 1AXSB 5GGRA 4N8VA 4P06A 2UZXA 1L9OA 3GIVB 1N8ZA 4JN1H 4PRDA 3ROOA 1F90L 2QR0A 2WC7A 3ET9F 5F21B 1ZLSL 1QUPA 3GSRB 5CAYB 4ZUSB 1IBDA 4XXWC 3RUGF 2NY0C 3UC2A 3QDJB 3HVNA 3PPEA 5E1AB 3D2UD 3LXBA 4TUKH 4K9EL 1BPLB 1I7ZB 1NINA 5IBTL 1IE4A 1JIBA 2H6UA 3ZUNC 3FS9A 4GBXA 2V6HA 1XF2A 5E6IB 3SO5A 2K45A 3CQQA 1UADC 4PS8A 4XVSH 5DHVH 4BKLA 1WFMA 2FX8H 3VXPB 4Y5VC 3UCQA 3TVMA 5C0FA 2EDBA 1ETB1 3SKNB 1NEZG 1AE6L 2XPYA 3CN2A 2CBQA 3C6LC 3KLLA 1G1OA 3SDCD 5I5IA 1YEDB 5KSVB 2ADGB 4KVNH 1UKSA 3WI9A 4KUCF 3RVUD 2WLYA 3DPBA 3OPZH 4HMDA 1U8PB 4M5ZH 4Y9CA 4BEIA 3FU5A 5FW7A 4WTZA 3IDGA 4FGMA 1NQBA 3ZBMA 2JJSC 5D7JA 1VESA 5D5MB 5KJRL 2VQUA 3IDIA 2HKFH 4IMLA 4OKVA 1E4HA 1MWAA 1Z9LA 3L3KA 4XI5D 1RJYB 2Z92B 2FT6A 3LY6A 3T6WA 3DO7A 1TZIA 1XMEB 3LKNB 2WLJA 4E36A 4WEUD 4DF9A 3TS8A 2CGZA 1J7VR 2UVEA 3SPCA 3VWJC 4DKTA 1SJEB 1LXMA 4ZNCD 3EO9L 4HALA 5F8RC 3VA2C 4UOZA 3OZ9H 4Q0XH 4ZUUA 1EAJA 3Q2NA 3T4AA 4OFVA 3WUWG 3C8HA 5FYJL 5E4EB 5CGBA 5DK0A 3UTSE 1J8HD 3EO1B 5J11C 4Q6KA 3ZDZB 3Q5YA 1ZTMA 3LRLA 1JHTA 4P5TD 4HWBL 4GSXA 1OB0A 3S34H 2AQSA 4N26A 3QDGB 3WU1A 1IEBB 2VXTH 3C08H 2OMUA 4O58L 4ODXA 4B9FA 3QQ4B 1JZEA 4FI6A 4NM4L 4RSYA 3KWWB 3TNNB 5BZDB 1XBDA 4NZRL 3FSZA 4JHZA 5IHUH 4B53A 4YSSA 3QDMB 4JFXA 3D69B 5KYYA 5F9WC 3TP4A 4FNUA 1S9XA 2VDRH 1I75A 3ECUA 3F6IA 3K81A 4JRXB 2YD7A 1EBPA 3PJSA 3EHBB 5B1AB 1TYRA 2EKSB 3FB6B 3TH4T 4E5XA 4IK7A 5TE7H 2AQ1A 4E0RA 2WAQA 15C8L 4JFPB 2ZKMX 1KENH 2IVFC 3ARGB 2VXQH 9PCYA 1CLOL 4WVRA 2NUPB 4FQHB 1CQYA 1JGDA 1UXSB 1VGEH 3RL1B 3REVB 3GZPA 5HHNB 1AY1L 4WGVB 3B7UX 4DO6A 1UFGA 2X4UB 3L9RA 4L3EE 5D1ZA 3SKOB 2W5PA 1AD0A 1DVZA 4J23A 5GGVH 2N7BA 4XPTH 1TIUA 3VXQB 1UKTA 4V1DA 4YX2H 1NICA 5EOCJ 4AYBA 1UZ8A 5SWZE 4OCYL 2ZWNA 1QLEH 2ESVD 1INDL 2NLJB 4L2LA 2R0KH 2ZE0A 4NPYB 1VZHA 2AK4A 2X89D 4TTDC 5MP6H 3TH2T 5AW0B 4KI1A 2J73A 3V6OC 2ALWA 1DVFC 3HMWL 1GH7A 5E4AA 5SWSB 2DKSA 3MNWA 1D5RA 5HVGB 4H40A 4GRLA 2R29H 4P5MB 3V6FB 5LGHH 3BQUB 4NNYA 2HA1A 2V9QA 2WW8A 4EVNB 5SWZA 1Q0XL 4ZUVB 3O9WD 4Z7WF 1IAKA 3W56A 2Y7OA 1V54B 3WJMB 1F0LA 2ZWLT 1M7DA 1MREL 3CXHK 3F5WB 1IAOA 3P2BA 4AG4L 1T1XA 4BFGA 3HE7B 2N4IA 4WGKA 1DSYA 4FI7A 4G8EB 4Y2OA 1WZ1H 1NDTA 3P73A 1PLGL 1MCLA 5C0RH 2V2WB 4XXCC 3QWQB 4N2LA 2AJZA 4XTRC 5I16A 3VA6A 2BMKB 3BKJL 1J0JA 1KXVA 3WN5C 2HZHA 1NKOA 3IDXH 4IRZL 5D6DA 1N59A 3VTAA 1UWXK 4LLYB 3WIFA 1N4XH 1ED3A 4YDIL 5I23A 1QTYT 3S37H 4AYGA 1NJ9A 3PGDB 1T83A 3SQRA 5F0MB 5EDXA 3UMTA 1RK1B 1HKLH 3V0DA 4ECNA 5C0ND 4IGBD 1IC7H 3QXVA 5T1MB 1BBJA 4AV0A 1PZCA 2JCCB 2VDOL 1MCOL 5JZ7C 2Z31D 2CQVA 2OMBA 3Q2WA 1L5GB 5IB3A 4TTGA 1BEYL 1WD9A 3B4NA 5HJDA 3CN1A 3D25B 1R3KA 3V55A 2VMDA 2DJUA 3FZUC 2NXZD 1HCYA 1BYPA 5E6YA 5HGDB 2A74B 1DQTA 1UA6L 1UM4H 3FSVA 4NNPL 4DGYL 5IF0A 1GJWA 3K6DA 3MCLL 4LGPB 1KZQA 1CFQA 3B9AA 4FCHA 1P2CA 1MW0A 1IAII 4BUQA 2AXHA 3TU6A 5F1NB 4N0FA 3S3CB 5T1LB 3SDAA 4TV3A 5MEOA 1HQ4A 3LH2H 2C9PA 2VT0A 4ZTEA 1TZ8A 4HHAB 3D12B 1AKPA 4FNRA 4ZXBC 3A24A 3WOVA 3F7VB 1VENA 4I9WE 2DWXA 2HRHA 3EOTL 4FE9A 4I5BA 3K3QA 2YD4A 2PYEA 5ENWB 3ARBB 4GW5B 3VI3B 2HP4A 5IUCA 2EUWA 4YBLB 3N91A 2FWLB 2X9XA 3ILPB 4HUCA 3BWAA 3LNDA 2AXJA 4FTVB 4OLWH 3FL7A 2VKXA 3ZZQA 4ELKA 1OQOA 3AWGA 2ZIDA 5I76B 2BRQA 1BOGB 1JPFA 4K5MA 4XXDB 1K8IB 3ZHDA 3Q6FB 1JVOA 3H0TA 2F54E 3FAWA 4K3DL 3PV6A 1NM4A 5B3JF 5L4JA 4XT1C 2DEYX 3BSZH 2XC8A 3IEAA 4N2OA 3M86A 2FGWL 4WEBL 5HYQA 1F8TH 3NPSB 4DTGH 3G6AB 4G6FD 1U36A 1FNAA 1P4LB 2X7LB 3M7FB 2BX5A 1QG3A 2W95A 2OSYA 4FMFA 1CFVL 3MMEB 1IM9A 2UVFA 5ADPL 1J5OH 3EGXB 3ZTEA 2R39A 1K8DB 3BZFA 4W9IC 4FD0A 1MHCB 3RUGB 1U58B 1YAZA 4WHTB 1LWJA 9CGTA 5C8JB 3TYFB 1KNOB 2V5YA 5E8EA 3ZYZA 4KTDL 1KBVA 2QEJA 5DRWB 4B0MM 2I85A 3FQRB 3MRLA 4OJFL 5LLIC 1WZMA 5C0JA 3OMNB 5EO0A 4WW1A 3V5KB 1NCAH 2JKSA 5J6GB 3APNA 1L3NA 5EOTB 4Y4HC 2VB5A 1KOAA 5I8EB 3RPIA 2BZDA 1QUNB 2XPGA 4L0YA 1J05A 2XRAH 3OJDA 4NO5B 5IREA 3RAJL 3MOBH 3IPBA 5ANHA 1JDDA 2L7UA 5EZIH 3N3EA 2VLLA 3B9KA 1M1SA 4AI7A 4HUNB 1U6AH 2R4SL 2ZWZA 4RETB 1O7SA 3ZE2F 3GTVA 3MGTB 1H3UA 3DUHA 4N2GA 5E95B 1RUAL 2Y2WA 3BUDA 2J7LA 3T2PA 4Z7UE 3EBGA 4FZEH 4XO9A 5E9DB 1QA9A 1Q9WA 5A3ID 1SF3A 5HVHC 4XPHH 4R83A 1AR1D 3DRQA 3L1EA 3GSWB 4YLCA 3DMMB 2APBA 5BMFL 5KVGE 1TO5A 3DLQR 3EYSH 1KACB 4NM8L 5I73B 1W72L 5IEKA 2KKQA 1EMTH 3FTVA 4WEMB 4WZ9A 4MZ2A 2WXRA 4W6WB 1UOWA 5FF6B 5T1DL 1FC2D 3T0EE 3E6FA 2VDLH 1G7PB 4ZQTA 5E6UB 4EBQH 5LKNA 5IVZA 3GKZA 5TDPA 1XGTB 2GUOA 4P2RD 4O9HL 1AKJA 5H94A 4LVNC 3L4VA 2O4EA 5KBLA 2DLFH 4DVBA 2EDXA 3ULAB 1UM6H 2Z8WC 2NYYD 3O3AB 3IFPB 4K23H 3U30C 4X8XA 1TF4A 3KL0A 4W9JC 3BWZA 2Q7YA 4PJ5B 1J1PL 3NFSL 3IRZA 4QAWA 2PW2A 1MHHB 1LYQA 4BCZA 3E7JA 3MZTA 5DQDL 1RURL 1P1VA 2FEDD 5A2JH 2BP3A 2F1BA 5TPWL 2I69A 5HHXH 4IKNA 4KI5C 3P3SA 1T7WA 3H9YA 3KBEA 3TGXA 5DO2D 5L4FA 3N0AA 2PCPA 3BKYH 4UILL 4N85A 1E42A 3L95B 2MOVA 3CDCA 3QCTH 3FB5B 1J9QA 4OCSH 3BCDA 2WZPD 2QV2A 4NC2B 1P4IL 3VWKD 5A2FA 4AGPA 4M5YL 2A1WH 1SLWA 4QTHA 4Q6YA 3NACL 2Q5BA 4P3DA 4QHUB 4U1KA 4YDMA 1LD9A 4GAFB 3LQAH 2X1WL 2Y7SA 5HHVH 3V0VB 5FGCB 4Z3JA 3T6ZA 2JJWA 1LK3L 1JTOA 2WBJC 3BH4A 3OLGA 5T3ZL 5D7IE 2XXGA 3MBEC 4GFTB 5JW5A 3O45B 4R4FL 5KS9E 3DOHA 1YZZA 3OXSB 1BFVH 5I1IH 2VDNL 4ENZA 5HYSB 3LX9A 2O93L 3PGFL 3LDBB 3MYJB 3IGUA 3SB3A 1WZAA 4QXGH 3ZKMC 3CH1B 4D0DB 1P7QD 3RYMA 2X1QA 3ECBB 4NO3A 5D4IA 2D03L 1E9PA 1V05A 4KKCD 5FA4B 4YS4A 2CO3A 1EVUA 4AM0B 2GSIB 3HN3A 3ZJAA 5K9KA 5TQ0H 1U8HA 5FIEA 5EZJB 5IP4A 4L9LB 4AZUA 1AZBA 1DN0A 2E7MA 3DK2A 3I75A 3UTOA 3GK8H 1H8OA 3ZE1E 3WEAA 3QNYA 5D1XC 2YUZA 3APMA 5AVSB 2J71A 3MN8A 1AO7B 2WD0A 4ZFZB 2Y5TB 4PW9A 4AUUA 2P46B 2P44B 3MAWA 2GUYA 3IJ7A 1NFDF 4LCYA 5IMOA 2LOEA 3KCWA 2XWEA 3VXSA 1KV7A 3KYKL 4U1JA 4P23D 1WQVT 3HNTH 5E7FA 1E4XH 2F8IA 3GTTA 5KN5A 4KKAD 3ALPA 2IDTA 2NX5A 3UTTD 1LEIA 2L0DA 3LIZL 2AERT 2AV1A 3ZW3A 3E8UL 3PJLA 2CR3A 3HZKB 1U8CA 3T8XB 5I1DA 3BN9D 5GGTL 1PY0A 2CKBB 2NY4D 3DNKA 2WTOA 2HVJB 1B4JH 4FFZA 4KRPD 5K9QG 4WWPA 1I85A 4XCEB 3GKWH 1IGTB 2VDPL 1HNYA 2C9VA 3WS6A 1UACL 3P54A 4L1BA 1IRAY 3GD1C 1BF8A 2FJGA 1TG8A 3CPLB 2ITDB 4O4YH 5C0EA 5BQDA 3IJHB 1NMCB 2QVKA 1Z0NA 4JFYA 1UASA 2PTTA 1BXUA 1C16A 4HHGA 4B7LA 4TUOA 4JFHD 1ROWA 2HMIC 3SIKA 2ZF8A 4LKCB 3MV9B 4FQLH 1VZGA 1LP9E 3K2UL 5FYLH 4HKXA 4Z3EA 3GMLA 1TZGH 2XN2A 4U4IA 1T0NB 1LE9A 2VDKL 4I0PB 1K3IA 4PTTA 3RZCB 4HS8L 4J3OF 1PG7H 1JGVH 4H8VA 4NENB 3B2PA 3PDOA 1CR9H 4P2OB 5AOZA 1QW8A 4AQEB 3D3VB 1ZHKA 1AHWC 3QFJB 3KXFD 2YXVA 2Y23A 3EYFA 1JK8B 4HDIB 4UQ3B 1LO5A 2AJSH 2I9LB 2KQMA 2EXYC 5CJXA 4HH8A 2EDKA 3KGSA 3LZPA 3IJEB 1TQSA 1T2QH 5J1SC 1EHKB 4LCWE 5IJCC 3JWOL 3NRPA 5E8PA 2BLFA 3BGFB 4L37A 4DESA 4F2MB 3VX1A 4KV5E 5EO1A 2ZPKH 3QZNA 3UJTL 3NN8A 4AQ8C 4RISL 2EVGA 2NY1C 3BVNB 3O2VH 4HV8A 4J8QA 5AB0A 6CGTA 1KB5H 5FECB 2WIIB 1DYZA 1Z9OA 3T4YB 4D9RD 4JVUA 3BAJA 1PX8A 5B38B 4ADJA 3HZVB 2XVLA 5HYFA 3M88A 1FZKB 3P4NA 3P9LB 1SEBA 2LQRA 4H4NA 3SDCC 5KYUA 3D52A 5FUZH 4ETQB 5TE4L 3UTPE 4N2EA 1KTDB 1RJCA 3OBAA 5EU6D 2W60A 3MLWL 4EN3D 4N1CA 4PS7A 3ZZ1A 5BS0E 3ULUL 4PRNB 5AW1B 2VXSL 4Z7QE 2NXYB 4FL4C 5LGJB 3CC5A 3E2HB 4H13C 1MWAL 4KQ4H 3FHQA 4Y5VA 3RVTD 2VLKE 1IL1A 4UDTB 4XI5C 4R0LC 5LHDA 1IFHL 3NCEB 2BSTB 1YEHL 3C6LA 3H9SB 4C58B 4JW3A 1ETA1 3IVKA 1QNZH 1NCTA 2Q7NA 3QEHA 5EPMA 4UYPA 1ZT1A 4MA7L 4W6YB 2Z35B 4G7RB 2VLRD 5I17B 3ZE2B 3L4XA 3MXWH 1ZTXH 4JKPL 1WK0A 4MCNA 4R4ND 2CAKA 4IDJH 4PRHE 5CEYA 4DCQB 1M3JA 3BSHA 5JHDE 2KC0A 1J5IA 1KY6A 2EADA 1FFQA 4DQAA 2ZCHH 5EUOF 2BHFA 3PABA 3MACL 3B6SB 2Q0ZX 5D2NE 4A63A 4ZFOA 4BSJA 1L7IL 1YN6A 4P5TC 5DD1H 1KTJA 3ZDXE 1FQ9C 1IQWL 2ED7A 4PRHA 3MQIA 2E86A 4MJ5A 4H25B 4U3SB 3JBG7 1NCJA 1Z9SB 3RWCA 3VWJA 1UB5B 1UZ6F 3L3DA 4M8QA 5D7KD 1MF2L 4G8GD 4JUSA 2E9BA 3S5LB 1RZFH 3MNDA 2IJ0C 1BG1A 4JFVA 2AQ2A 2DLHA 2APFA 4YC2B 2BIQA 4LESA 1PG7X 1T22B 3DSNB 4UIKH 3EJPA 4JY4B 1OALA 4QRPE 3SYPA 5LXGL 1WS7A 3REWB 4Q9RL 5I6MA 4OR1A 1MG3C 5FO9B 3AW5A 1A7RH 1M57B 4PBDA 4YHZH 5D6CA 1B9ZA 4PJDF 3SDYH 1IBGH 3ME0A 3AREB 4MFHA 5CLXA 3A4AA 4NGHL 2NY2D 2CDEA 2EABA 3V4UL 1AMYA 3QI9B 1A4KB 4QF1B 2JKRM 4B9JA 1ZVSB 5IIEB 3A6CL 3ZZLA 3TZVD 1JGEB 2F5BH 5F1SA 3NUKA 4AQAA 4C8XA 1HS6A 4GS7C 3VFTA 3ARFD 2ZP9A 1FC1A 1PQZB 4ONHA 3RKDD 4WK0B 3S35L 2VW7A 5I1JL 4C56B 1DEEA 2YBGA 2P47B 3KEHA 4BK5C 4XNYH 5C7ZA 1A7PH 3KPQB 1ZLUK 1Q9OA 1LHZA 5J0BA 3FFDB 4NQCA 1RFDL 3ZTJG 3V5HB 4ZMNA 4MDIB 1AI1L 3K8LA 4NQVA 5L7XH 1ZT7B 2ICWB 5JPMB 1INEH 2W80C 1R34A 2E56A 4HYTB 1CI5A 4YDVA 4YHIB 1F3RB 1VIWA 2GC7C 4LNRA 4ZAKD 2EXSA 4Y4KD 4Y5YC 4GUPB 4N28A 2EDTA 2FIRT 3O9WC 4Q2ZA 4M6ML 1P4UA 3NK3A 4AIEA 5IMMB 4O51A 1LDPH 3O6FC 3CFNA 3FO0L 2OTUA 3K7UA 3VXUB 5CCKL 3AXLA 1M4KA 4V33A 3MJ6A 1DO6A 1C1EH 3QJTB 3ZKQD 4B5EA 3KPRE 3Q44A 5K59F 3ZIYA 1A14H 1XH0A 3D4ZA 2I07A 5CEXB 4HC1L 5KTEL 1KEGL 5FWQA 1Z6JT 3V6OA 3WY3A 1DVFA 2OMWB 3P77B 3O4OB 1WFUA 4XP1H 4Z7OF 1ETJA 4ODVL 1JYVA 2AQRA 5GIRB 3FH7A 4BD4A 2FHFA 2KUTA 1T0PB 2F2HA 5DO8A 3O6KH 1I1FA 1WUNT 2DPKA 3HC4L 4X5WA 4A37A 5AVZB 1FL6A 1NFDB 1PPIA 3HE6B 3DHJA 1FNEA 1VDGA 4DAGH 3MA7B 3LKRB 4Y8DC 4RFNB 4YHPA 3R7QA 8CGTA 2Z31C 2EICA 4JHVA 1AFVL 4XXCA 1OAJA 3HHSA 3VG0L 3FCGA 4GI8A 1OWWA 4AYID 4BUHA 2HWZH 1XF3A 1JGLL 4R26H 1ZHNA 1XT5A 5KSBF 1U3NA 3D33A 3WN5A 1A6AB 5EOQL 1NANH 1WAEA 1CXIA 3L4UA 5GRWA 2WUCH 5DJCB 1GIGL 5JQ6L 4K7PL 5IKCB 4XE5B 4LSSL 5IBUB 2Q3AA 1TCRB 2J8UE 4MJ6B 4HLEA 3QZWA 1I9JL 1C5CH 1FHNA 5B8CC 1I3RB 1NCHA 4L4TA 5C3IA 1CXEA 4XNQB 2FO1A 1AGBA 1B4RA 4U0QB 3O81A 3GSNA 4PY7A 2M8XA 1Z9NA 2AJUH 2OK0H 4H0LC 5I0WA 2XQ0A 1OHZA 5I1EL 1FE8H 4X7SL 4JFDE 3DJZA 3NP3A 2IOIA 3DTXB 4OD2A 5DRXA 3QP3A 4PGJA 3FOLA 3VD2A 3NSFA 5JXEC 3FN0L 4MNHA 1PU0A 4NO2B 4OZIF 2J4WL 1E3FA 1IGIH 1DQVA 3DX9A 2DQEH 1I1AD 1U95B 3PWJB 1I8AA 2ITCB 1HHJA 3WFCL 1UA3A 4BBWA 2WQVA 3VM5A 2VISB 3QRGL 1GZHA 4ZXBA 3SBPA 4GXVH 3ZTDC 3PNWA 2XFGB 1JOIA 1FRGH 2B15A 3AU0A 5C0DB 2PN5A 1ONQB 4PGBB 4LVOB 2XFXB 3L4YA 3QUMB 4MMXB 4YHNA 2NTFA 3BD4A 2PCFB 4JQIA 4QJ5B 2OL3A 3RVXD 1U30A 4F24A 3LMJL 5LNGA 4ZPVA 4TRPH 2NRDA 3D7PA 5DJ0B 2V8LA 3NFPA 4IHOA 4KGLA 3TOPA 1J0IA 1ZT4A 1KJ2A 4RLDA 3KG5A 1T0MB 2WM0A 2YPLA 2LFEA 2QGDA 4PRPE 1AIFA 5A6IA 5C97A 2YD8A 1XMWA 5CSZB 4XVJH 1F4YL 3GJFH 2ZOKB 3W2DH 3ESUF 2XKUA 4LOEA 1ZSDB 3L3GB 3OKLB 1SN0A 4PJXF 2XETA 4FXLA 3FO2A 3TO2B 5IQOA 2D7MA 3F7RA 4HGWB 2W1NA 3S8FB 3S4SG 3B2DC 2DTMH 2WLIB 3LD8B 2ZP8A 1BX2B 1T03H 3AAZB 2VL4A 3BH8B 2IG2H 2YSSB 4Y9GA 4LEBA 3QORD 5JLZA 3QEQE 4JGMA 2LW3A 1SY6H 2NY6C 4JFEA 2GEEA 3GF8A 3QZBA 3MR9A 4IKJA 1QZ1A 4U1HA 4OH2A 3C6SB 2J72A 1S7XB 4OB5L 3S6CA 4ZUTA 1T7YA 3OKNB 1ESOA 3KPOA 4P4RB 3SJVB 2GJRA 3S3SA 1W0VA 5JDSA 1SPDA 3D9AH 4Y4HA 1I9IL 1AR1C 1TO4A 3OX8A 1KXTA 4PJHE 1KB9J 5AAWC 3BN3B 2MNWA 4S1QL 3SGKC 5J06A 4FXKC 2BP5M 2PO6B 3EYVA 2KZKA 2WLZA 4LVHC 4IRJC 4RGOL 1AD9A 4A2FA 1OGTA 3CVHH 5D7HA 3RVWD 3SD2A 3BDYH 3MNZA 3EBAA 5FFLA 3X13A 4G83A 4GG6F 1PSKH 2V2XA 5E6RB 2HTLD 5C70A 1G94A 4F1SA 1KN4L 1RK7A 4HIHB 4XCCL 1E6JL 4ACPA 3FN3A 1MFDH 2MWCA 3OR7A 2HFFA 1ZV2A 2EC9U 4L1HA 3TURA 3DROB 1RVFL 1TZHB 4MKMA 4XBEL 2Y06L 2K8MA 3CZEA 1A64A 1GMIA 3TPUA 4BH7B 2FHBA 1A22B 2YGVA 4WW2B 3VGEA 1NGZB 3KPLA 5F3BB 1WD8A 2F8XC 2D0HA 5IROC 5T8IA 4M3HA 5DLLA 4Y9FA 4JBSA 1MFCL 1F11B 3IFOA 1N26A 4IU2B 1KC5H 1HSBB 3SGJC 3T8MA 2EDJA 5JO5A 5BQ7A 1HC1A 1NWPA 1MVYA 2W0KA 5D72H 4EZMA 2A0LC 3MX0B 1NGPL 4ZW8A 1NC2B 5ANME 2ZXEB 4X99B 1OF2A 1C5BH 5HYSG 4QJ3B 2KERA 3L6FA 3N0PB 1CGTA 1YA5A 3BMVA 4B95C 3QEUA 4LAQH 5IJBC 4PLKD 2KPNA 1KTLB 1DQMH 1FYTE 2FGZA 3OJMB 1NCBH 1G7IB 4GRWB 3TFKD 3L54A 1JF5A 4G1MB 3QG6A 1HCZA 5EBLB 5L0QB 5GS0L 3VE0A 3O0RH 2WXPA 5AFAA 1BVLB 4MVBC 5C0BB 4U6XB 3RDTC 1HNGA 5KJ4A 3QUZD 4KKCC 3ZL2A 3DX8A 4M7ZB 5KVMC 1E9QA 1IBBA 4W9HC 3E3QE 4Q6IC 4MA8H 3TCTA 1AHMA 3K1DA 4IBYA 4NQDD 4P9HL 3MBEA 5KBMA 5JUEL 3WEBA 3NGBC 4X6DA 1SDDB 4MJIA 3STZA 3U1SL 4X9GA 1PX4A 5DTFA 3TA3B 2W0FB 2ZYSA 3BUIA 3F58H 4ODWA 3WIHA 1ADQH 3PL6C 4DEPB 1EVTC 5EFIA 3D85B 4WO4D 5EMYA 2BY0A 3PUCA 4U6YB 4YAQA 5AW4B 2DEXX 4RDBA 3DSFH 2C4FU 1U8QA 1JXKA 1KG0A 1KGUA 4QCIB 4WHYH 2BNUB 2IALA 4Z0BL 1E28A 3W11D 3V8OA 4P4KB 5ISZA 4M1DL 1BLIA 4FMKA 4Z95L 1NIDA 3VJ6B 4L5FH 5EN2A 2ZJSH 4L8SC 4TLKA 1HWWA 4MXQD 5D1XA 4JJOA 1HZHL 3SCMD 2WTPA 1RD6A 2LU7A 3ISRA 2YN5A 4GKZB 3D4CA 3II1A 3KVPA 2L4OA 4YXLH 1X7QA 4ZW3A 1KGXA 1YPZF 4Y8AA 43C9B 4KMLB 2HB0A 3D39D 5E5MA 2UUDH 4Z7AA 3CFJA 1BV8A 4JO8A 4V2CB 5IJVB 4HWZB 3AC0A 2MCAA 1UC6A 1HIML 5ICZB 2DJSA 5CN2A 5L8LB 5C6PB 1JZJA 4PWJA 1Z5LA 2Z93B 4K0OA 4X6CF 1H6FA 3A0OA 5EZOH 5KSBB 2NTSP 3TESA 2NNAA 1MG2C 3CWGA 3APFA 3MREA 3QARA 1DEDA 1EJ6A 1AQDB 3DIFA 6TAAA 4HJEA 2VL5B 1KIQB 3DX0A 4PJIF 3JV6B 4RGMB 1M1XA 1HVXA 4E41A 4KH9A 2C3HA 4DW2H 5C07B 2WO3B 1J1OH 4TSAH 3T6QC 2FYYB 4I9XA 3MV8E 2HLAB 5KVEL 3VD1A 4N0RA 5DHVA 1L0YA 4LU5H 5DJAB 4F9LC 1ZLDA 3SEPA 2CIIB 1OO2A 3L3OC 3AT8A 4EI0A 3MLRH 1PF3A 4OU3A 2Y2TA 3SGEI 4EQ3A 1MN4A 1MLBB 1MLCB 3ELAT 3WFEL 2APWA 4CVZA 2AGJH 1UXWB 3ASWA 2VERA 4O2EA 4Z7NE 1WFOA 3NJMA 2DQUL 1WCQA 1YEJL 2EDWA 4PJCF 5INCB 1USZA 4HX1A 4OZIB 3W57A 3WKPA 1XIWB 4RBPH 3MZGB 1S7SA 1ZS8A 2CUAA 3DOIA 2UY7B 4HU8A 5B38G 1YEEH 4F93B 1QNIA 1IKOP 1UOVA 4YE4L 5I30L 1KBGH 4RFOH 3MLTA 4ZOBA 5CJ5A 2O6PA 4BSVB 1DVQA 1MZYA 5D9SB 1AHWA 1MFEL 1GAFL 4ORGA 3R0NA 1KJVA 4GXFA 5T3ZE 4RRPM 3L7EA 4AQOA 3BUTA 4GEIA 4KK9D 4ZOCA 4ZFFA 2AP2A 4WFGD 4XP6H 4FA8A 4H44C 1QSEE 5E23A 4TSCH 5E8DL 1TMCB 2UYLA 3FT2A 3KPSE 4LEOA 3VD0A 4YSUA 3D2UA 4ZDHA 5AB1A 2FCBA 2H8PB 3WAKA 5TF0A 1MI5E 2P5WE 4AQ8A 1ZLWK 2R1YA 1RZ8B 1DJSA 2DM3A 4NS0A 1IZKA 4GKSA 3DX6A 4MJHA 1JNLL 4PJXB 4URKA 3HW7A 3KAAA 3BEVB 3RVTC 1X3DA 4X4KA 3CLEH 3GI9L 2BHUA 2VR7A 3H6AA 3KPMA 1MFBH 3B3IA 3CJJA 2J2ZA 1U4EA 3SDCA 1NCWH 1OAQH 4UQBA 1XF4A 5DMYA 4ZMWA 3R4RA 3HAEH 4G80A 4OFPA 4F7MA 2H3KA 3PNRB 2FZ3B 3L2NA 1J0HA 2DDQH 1JMZA 1S5IH 4WFHD 2VDOB 2EEFA 3DURA 3HNSH 5IVXA 3L3IA 1ETZA 1CD8A 5BZXA 3RNQB 2P5EE 5T5FH 4ZFOL 1DANU 2R56L 1E3ZA 1S7VB 3TWCL 4TPRH 1BA9A 2WUBH 2F68X 4HXAL 5FM8A 5I5JA 4OZHF 3G6DL 3PGCA 1EHXA 3ARDB 1LEKB 4EIUA 5CUSH 2MHAA 3VFNA 2VXQA 3U1QA 4JRYD 3ULVC 1BP3B 2JB5H 1WC7A 4FNLH 4NXKA 2P8LB 4I7ZC 3MUJA 1G43A 1JERA 4NBZB 2XU9A 4YQXL 2GJ6D 1BCIA 3H6JA 4P5KB 5EA0H 1CLYL 4FFWD 2HJLB 3WG7B 1I4FB 1I3UA 3RFZC 3OKOA 2XN1A 2F08A 1XCQA 5C9JB 2BOCA 1J8HA 2DQ6A 3QCUH 2B2XH 4K7FA 2YAPA 3PP3H 3OGCB 1U93A 4YVUA 1F42A 4P5TA 4LLDA 4Y1AA 2R0WL 3U0TA 3DRTB 1FVDB 4OM0H 4HG4J 4HIEA 4UQ2A 4GH7B 4ENEC 3LTVA 3DYPA 2WNGA 2FH8A 1KXQE 1JFQL 1PJWA 1E9OA 3WDIA 2R29A 1HJCA 3GXIA 3UP6A 2YEQA 3BO8A 3NJLA 3VCLB 1LJMA 4R7NA 1AGEB 5GRJL 4Y7OC 4N6QA 3CN4A 2H5UA 3U6RA 1R0AL 4NUJA 5AWNL 4NZUH 5J89A 1S9VB 5JR1H 4NZTL 3K1KC 1KIPB 2X3CA 1JHLH 5ESVA 2CO1A 4XO8A 5L2KD 3DUSB 1F1AA 4M1GH 4FQIH 2DTSA 2OCJA 4TQ8A 3VM7A 2GTZB 2DBJA 5EDSA 3FO1B 3GQFA 3KCPB 3UCRA 3KYNB 4RFEB 1F3DH 4EI5D 2MTPA 1WVZA 2P7TA 3T0DA 3ZYJA 4ZAKC 2COVD 5C0CB 1RZQA 1ZHLA 4KJQD 1HOCB 3G7TA 3LRKA 4PCTA 5IW1B 3MLYL 4KOBA 1GOHA 5E8NB 1ODUA 4H8HA 1Q90A 4IK6A 1PZ2A 2OLDA 5B39A 4BK8A 2Y36H 2WXOA 4OGYL 4YVNA 4BK5A 3VFVB 4HIXL 5DS8A 5BRZD 3QHZH 3WCYA 3TNMA 2ESVA 1FFTB 1SNRA 3B37A 3EHBC 3JYBA 4CVUA 3WY2A 2X89A 1I9EA 5E08H 4I88A 2AJVL 5TDOA 5IWLC 4XCYA 5AOJA 1KCWA 3ARWA 1KCKA 2YPKB 4H26B 1DUZB 1MW3A 4Y5YA 4I18B 5C0AE 4KITB 3ISWA 5FYKD 3O9WA 4Y16B 3LN4B 4CW1A 5HXMA 1C7TA 2E7BA 3MOAL 3GB7A 5EIVA 3TBVA 5E2WL 3KWVA 2I24N 3T1WA 1S7WA 4UT9H 3ULUE 1KGJA 2IANE 5DUBB 2WXIA 2PW1B 1LEGB 3OR6B 3UZEC 1TTAA 1I8KB 2VRAA 1NGQL 4UINL 4Z0XA 3LHPH 3OHXB 4HEMA 4TNGA 1D7BA 1RQ5A 1BGXH 4A7SA 1K2DA 3VXRB 4TSBH 4JKKA 2G3MA 1EEZB 4KNUA 5H37G 3O3DA 1A5FH 5C09E 3LEXA 3FCTA 3NOIA 3BQUC 5I1HL 2KYIA 5E1HB 2DQJH 2IQAB 1YPZB 5IUSA 4FOMA 4HS6B 4GI9A 2K1MA 3JV4B 4PR5A 1KFAL 3MBWB 4YXKH 2YRPA 2IPKB 4N0UA 3AGVA 3AXHA 3U36B 3GSNL 2C3VB 2YUWA 1OAXH 3BSZA 4A2EA 2Z31A 1KEMH 1NBZB 3DXAB 3HE7C 4L3FA 1MCQA 4YL4A 2DD8L 4GRMB 4Z7VA 4HULB 4LHUG 4X6CB 2ZYIA 5CZVL 4OLUL 4G7YL 4UANA 3UO1H 4EIGB 1S78D 1MVUA 3MGOA 1B3JA 4P3WA 3DGDA 4U6HA 5FYKH 3DX7B 1GTFA 1GC1H 1PZAA 4QYOA 3UJJL 1I1AC 1RUQL 3DTUB 3DBSA 5B8CA 2D31A 4HAKA 4PUBH 1PBYA 1DCLA 2VE6A 4N0CC 4YXHL 3MLVH 1DSFH 1OPOA 1YYML 4OZFB 1JGUL 3MROA 4J28A 1OGAD 4YGAB 3IAGC 2OR7A 3GMRA 4ES8A 2OTWB 4XC3L 5CD3B 5KEZA 2PR4L 2ED9A 2VERN 3CXDH 2VDNB 2Y1YA 2PYFA 2DICA 3QEGL 2QVMA 2P4AB 4Y19E 4D7BA 1QR1B 1SXCA 3O4LE 4KZDH 5BXFB 3VNYA 2GHWB 2A74C 4QO1B 4D94A 1OXYA 4PJCB 3TCLB 2IDFA 4ZYKA 3HUJE 4IJ3B 4NNXB 2DWEB 4QRUB 4EDWH 2ZUQB 2WLMA 3GXMA 3WHXA 4ELMA 1H3PH 1YNLL 4H8UA 5CBEA 1K4DA 1OP3H 3NSDA 3D0VB 1WWWX 4JCWA 4Y2DD 3TIEA 4U33A 1RSFA 5B1JA 4PJAE 4PYHA 1RZ7L 6PCYA 1COBA 1JS4A 4BFEA 2N7SA 1YECL 5D7SH 2EDRA 3C6EA 4LARL 3T1FB 1PTZA 5EOCL 4ZX3A 4NQED 1NBYB 2XQBH 4Q74A 4RZKA 4ATTA 4S0TD 3QA3B 3W0WE 4XZ4A 4N3UA 1QBMH 1KPVB 1ASPA 3VFWA 3U6XA 3V0WH 3WXVL 5LAXB 3WEOA 4PJAA 1FFRA 3M7OA 5CO1A 5DMIL 4N2HA 2ETWA 2W07A 4H8QA 5A7EA 4PV8A 1G7QA 1BWWA 3QJQB 5ESAB 2X9ZA 4B41A 2L7QA 1CZ8L 1V7ML 2FJFA 4GQ9H 4B3VA 2B14A 3NPSC 3HG1D 1G4RA 3MRGA 4XNZB 1YQ2A 5MI0B 1S9YA 3QXUA 3IPEA 3Q8FA 3RVWC 5JORA 4PI2A 2VITA 1P4BL 2XTSA 1O5PA 1CC3A 4HHWA 1TJHH 1TR7A 2BDNH 2N3JA 2QSTA 2P8MB 5DUML 1DDHA 2NOYA 4D0BA 1X5MA 2B1AL 2BVEA 4OM1L 1L4IA 3QNZA 5I1KL 2HTLC 5HDWA 3RGVD 1J9RA 1YY9D 4MBOA 4A38A 4ORZC 4HAFA 4P2RE 4FABH 4J1UB 1G6RL 4WJ5B 2I60L 3NFNA 4EUPB 4KMTL 2X2HA 4NPJA 4KTEH 4I77H 1FGNH 1KBWA 3BZ4B 4P46B 3MNVA 4XNXL 5AAWA 5IGXL 3MRPB 5F7EH 4NRYA 1FL5B 4OZGA 2UZYA 3VFUB 1FH5H 1EGJH 2QGEA 2DMHA 1OTTC 5GGRB 2VDKB 4N8VB 2UZXB 3GBML 4XZUA 3PDDA 1N8ZB 2RB8A 2E27L 2NZ9D 4XVUC 1J8KA 3MRDA 4PRDB 3ROOB 5HDBE 3D07A 4AGLA 2W92A 2JIXA 4W68A 1MIEL 2E74C 4R7LA 1FL3A 1ZA6B 1BQ5A 4L1TA 4WKXA 3JWNE 3GBNL 1RULL 1AGDA 3FHAA 3QWNA 4FCAA 3SYQA 4Z8FH 4GBXB 1XF2B 1L9RA 1LL1A 4BKLB 2HJKA 4PLKC 2UWEA 1O6SA 4PRBA 1E4JA 3TFKC 1NLBL 2EDYA 4JY5L 3TVMB 2D0GA 5C0FB 2J3SA 2A9DA 2X2YA 3MLXL 4TVSa 3VGAB 4DN4H 3SGJA 2ICWI 1UT2A 4PMFA 1AOZA 3VWKA 1TETL 3HPLA 2DIAA 4JO2H 2X4QB 3IJYA 2X6BA 3DPBB 1EA9C 4N90E 5A6LA 3CE1A 3PWLA 3IDGB 1MVFA 4JKLA 2EIJB 5T1JA 5HBBA 5BO1H 5BV7H 1IGCH 2XVGA 5D7JB 5SX4I 4GNKB 5E4IA 5KYNA 4IMLB 1JYWA 4OKVB 1CIUA 1P5VA 4M7JH 4AVKA 1H8SA 4OD1H 1MWAB 3L3KB 1P7QA 1YQVL 4JQVC 4R96A 4YFEA 5DHYA 1MCIA 3VD3A 1XL4A 3HNVH 2ZG2A 4P9ML 4WO4C 5L4IA 3RNKA 3UYPB 3DO7B 1A9BA 1J9CT 3RDTA 1IVTA 3FUEA 4Z7UF 5KBDA 1FORL 1TZIB 4HIPA 3M1BA 3U2IA 5JIMA 3MUY1 1LO2L 5ETUA 3B9VA 3W11C 3I9AA 4Q6IA 2VUYA 4ZUUB 4BFRA 3T4AB 1OOWA 1OAZH 2CSPA 3NH7L 1INQA 4S1RL 4DP4X 2O5XH 3L5WA 4RGND 4XC1L 4BFKA 5I6XC 1OZTG 5DK0B 2J12B 2NZIA 4LOVA 1CFSA 4FXGC 4FQXD 1NL0L 1JHTB 1PKQE 3CNKA 3GMNA 1CDJA 1F3DJ 3CX5J 3ZN6A 1TZOA 2A83B 4XNUH 3ILEA 5IVNA 1SJHA 2OMUB 4ODXB 5DFAA 4YLBA 1HINH 2NSXA 2BFVH 4KOCA 3AVEA 5BCAA 4P49A 5B1KA 5AW6B 4N8PA 2FNBA 3GUTA 3AITA 1ZANH 4JFXB 3VQLA 3AY4C 5KYYB 2X70A 3UTTA 3K8MA 4H0HB 5KVDE 1S9XB 1S7QA 4L8SA 5E4OA 4ZOEA 5L4MA 4JK0D 2O5YL 3PJSB 4W9ZA 5EUKA 4F2FA 1N0XH 1F41A 1MCEA 4TUKL 1KBBA 3UBXG 3L5JA 4E0RB 3L3HA 3DVNA 5I28A 4A04A 1J86A 4KY2A 3F01A 4XVSL 4G9FD 1KB5A 2FEJA 3FU0A 2IAMD 5KG9A 5D1ZB 3L9RB 4RMQA 1AD0B 3ZRSA 3VGGA 5HDRA 3V0HA 1VPOH 3CN0A 1BIIA 4UWQB 5F7HA 5D7IF 4V1DB 3U0PA 4KVNL 3C8KA 1E6OL 3BHBA 5KS9F 1UZ8B 2D0FA 3OPZL 4M5ZL 3AQDA 2IH9A 4XN8A 2BCKA 3TV8A 1E67A 3NIGE 2AK4B 5B4MC 2VJXA 1EHAA 3MRJA 3R18A 3G6JE 5DVLA 4FERA 4TNWK 3VXME 3F05A 3MNWB 3FTGA 5E56A 4GRLB 5DS1A 3CBJB 2HH0H 1BVNT 4NNYB 3O3EA 1NGXB 1F6AA 2AITA 5HYEA 5SWZB 4X7FC 2VWEC 8PAZA 4KXCA 2IDSA 1IAKB 3BP6A 3KXFA 4UV7H 1M7DB 4ES9A 1NMCC 2DJMA 4XPBL 5HD8C 1G1KA 1IAOB 2YKLH 4AT6A 4D9RE 5CGMA 1T1XB 4KK9C 3X2QB 1FN4B 1P69B 3ZE1F 1H3XA 4Q0XL 3P73B 3SOTA 4J6RL 2KLSA 2WKLA 2DL2A 2AJZB 3QVAA 5I16B 2F61A 2XY1A 4N9GA 1YYLH 2EDMA 3KJ6H 3CVCA 5EU6E 4BQ9A 1FZOA 4YK4B 3UYOD 4F7EB 4GQZA 4I0PC 3RZCC 3S34L 3WIFB 4QOKE 1N2RA 4ZFGH 5HVFB 1V10A 3O8XD 4AQZA 1NJ9B 3T0XA 2O6CA 2VXTL 3BIKA 3C08L 4NOFA 4P2OC 2A9MH 2CGRH 4JG0H 1SHXA 4XN2A 4R8WH 4G6JH 4HUUA 1OVZA 3CN3A 1BBJB 1LM8V 5IHUL 2WP3O 2MPVA 4EN3A 4M5SA 1DQJA 1KLGA 2X38A 3ARVA 3IETA 1OGPA 1OSZA 2C9UA 2FBRA 3AACA 1MPAL 4J7RA 4N2IA 5IB3B 2FLRT 3O41A 1R3KB 1HEZA 3AROA 2RTTA 4YHOH 1KIRA 2VDRL 4J12A 3BGFC 3SE6A 1UJ3B 4HOXA 2A2QT 1O75A 1FDLL 4M6NH 5IF0B 3VYOA 1CFQB 2MCPL 2V17H 1NKRA 1P2CB 1KENL 5KVFH 2XBZA 1O5DT 4B96A 2LGNA 4N0FB 1WGVA 5MEOB 2B1HL 4Y0GA 2B8OT 1E5UI 2AAAA 2BY3A 3A4EA 3DDGA 3IU4L 1JGIA 2N7AA 5IMKA 3WE6A 5DD3H 1E4WH 3BI9X 4I5BB 2VLRA 5H2BB 5E6SB 4ONFH 2WXNA 5GGVL 1F1DA 4XPTL 2EIMB 4FFWC 2FWSA 1F4WH 1QSVA 3BWAB 4J27A 4WI6A 3TPKA 2RACA 1TJXA 5ESQA 1HXMA 2F18A 3QJZA 4I0CC 4W93A 5D7KE 1QLEL 1N6QL 1WYJA 5CILL 1L7TH 5AD0A 3FUIA 2R0KL 5HYJD 4CNIA 6PAZA 3E2HC 4UCFA 3X3FL 5F6IB 3H0TB 4KC3B 1ZXKA 2KDGA 3T0AA 5IHBA 4LOFA 1N5YL 2R29L 3D50A 5LGHL 3OMZA 1HYSD 5D1QD 4ELDA 2QDVA 2NMSA 2IH1A 5CJ8A 4ZD3L 3DHPA 5HYQB 1B88A 1EHNA 1EDQA 4G8GA 4WWKB 2D3JA 2EC9T 3RFZA 4UNVA 4PGDB 4B9YA 4UTAH 1IM9B 5IBLD 5LBSH 3RKPA 1QW9A 4AE0A 2EH8H 5C0RL 2EXWD 2R4RH 2HG0A 5D5MA 3WEXB 3CSGA 4QRRD 1OEZW 4ZJ9A 3ERXA 4H8WC 3UZVA 2CHWA 2YOCA 5E8EB 1M9WA 4M62H 4IBTA 3MRLB 4KJWD 1X7TA 5C0JB 5EO0B 4J39A 4WW1B 3QAZB 5HHOD 5DJYA 1XXFC 3RPIB 3HVDA 2XQYG 3TZVA 3BAIA 3UDWC 1QRNE 2XPGB 2BSSA 1J05B 3ARFA 3E38A 4MCZA 4NJ9L 1SXAA 4ZQKA 4PS4L 1IGML 4Z7QF 2VLLB 1WIUA 3B9KB 2DY2A 2D9CA 3VI4E 4GUOA 5KAQF 1CGYA 2Z91A 4EF3A 3JVFC 3MBXH 1IBZA 3ENEA 1A6WL 1Z66A 1CTMA 2C7UA 4PJ7A 3ML9A 2DIJA 4K8RD 4FLOA 1JVLA 1UM4L 3J27A 3I9IA 4YWGH 3UG3A 4CKVX 5I1LA 2XG5A 4XPAH 3VU1A 2YMXH 3QDGA 3EFDH 1QA9B 1Q9WB 2WHVA 1SUHA 2DJ4A 4Z18A 1AC0A 4ZAKA 4Y4KA 3ECWA 3DRQB 3OC8A 1DJWA 4M03A 3LH2L 1BM3H 2A9BA 2LVEA 3LVEA 3SQOL 1GC1C 3NCMA 1J12A 2YD5A 3IS1X 5IEKB 5FFGA 2YC1A 5FO8A 3IMUA 1JVKA 3E6FB 1WP6A 5IVZB 4U1NB 5TDPB 4LPXA 2FK9A 2GUOB 2F58H 2H3XC 3FB6A 3X1EA 5DCCA 1AKJB 2O1AA 5H94B 4FLHA 3ZDXF 4OLWL 3KNBA 3CPUA 2YBRA 4DVBB 1D3CA 1FCCA 1GKOA 5IWLA 2FAUA 3LVTA 2DMKA 4X4MA 1UOLA 3RI5K 4QDGA 4IU3A 4MA1B 2Z1PA 5JPMC 2YZ8A 1A66A 1YEFH 2C4FT 2Q7YB 1K6QH 3MRNA 3T0EB 2PW2B 2E3VA 4ALAH 3QPXH 1JD7A 1BMWA 1DFBH 1M7UA 3SKOA 4JUTA 3TXAA 3BSZL 4UV4H 4PQXA 5CM1A 1I8IB 2QHRL 4QLWA 1OSPH 4DTGL 2PCPB 5DUJA 3UZEA 2AQQA 2H45A 5G4MA 3KLHD 4K8RH 4QRFA 3CMOL 3WKQA 2JH2A 1QLFB 4JANA 2AHIA 5HI5D 3UBXI 4QTHB 4P3DB 4XWOC 5FGSA 4YL9A 5SWSA 2R0ZL 5GGQH 2RD0A 4B97A 2YHGA 4QRQA 5JPNA 3SPJA 2YGPA 3X1FA 3BQUA 4BFOA 4XN7A 1R4XA 4X80L 4EVNA 3GSXA 3VFSA 4UOW0 2KS0A 2O6DA 3P11H 1SMOA 4KROB 4X98A 5ELIA 1NCAL 3HE6C 4M43H 5CXPA 3GJFA 3MGAA 2YWYA 4FDWA 1LNUB 1ZXQA 2ADJA 2XRAL 2R51A 1WO2A 4RFNC 2F0CA 2QPFA 2EYTA 4HPYL 2V2WA 2O72A 2VSKB 5GQBA 5EZIL 2WKOA 3WNOA 5DJ6A 1E9PB 2CJUL 2CGYA 3MJGX 1A3QA 4G42A 2K7PA 4XMKH 1DQQA 1SY6A 1U6AL 4RMWA 1KDJA 4WEEA 3B9DA 5K9KB 3JTTB 3MXVH 4NN5B 3CK0H 1I1AA 3U4BL 2R0LH 4Z6AT 4FZEL 4W9DC 1JRHH 2ZOTA 2QPSA 2ZOUA 4TQHA 1SQ2N 2JQZA 3D4YA 4BZ1H 4XPHL 3QNYB 2JB6A 4UT7H 1DJGA 2A77L 1CGUA 1PLCA 4LCIL 5D7LD 4GO8A 2C8NA 2X42A 4F92B 1OPGH 1USQA 3MRHA 3ARUA 4LCYB 5IMOB 5J56B 2LU4A 5I6LA 1ECZA 3CHRA 3VXSB 4OI7A 4U1JB 3NZ8A 3C5ZD 3C5XA 1SLVA 4EBQL 3LS4H 3CVHA 4FNQA 4B9PA 3P0YL 3OHMB 1LO3H 2QADD 5FKPA 1CTOA 1FJ1A 1I3VA 1LVEA 1PJ9A 5DJXA 5KN5B 2JSFA 1X9UA 2NX5B 4I3GA 1LEIB 4K23L 3H2PA 4JPKH 2AJ3A 2AV1B 3FRPG 1OLZA 5KSUA 4OJYA 5I1DB 4J3OC 3ILDA 2B5IB 3CCHA 3F64A 4MQSB 3OM3B 2VXVL 3DA0A 5ENWA 4ZNEA 3F62A 3OWEA 4LVOC 4NPKA 4W1TA 3VI3A 4MMXC 1W8OA 4JPVH 5DQJA 1Y1UA 2ZX5A 5B7EA 1KLUA 4KXZI 2D4FA 3ILPA 4I3SH 4QAMB 4KRNA 4RRPA 4F58H 1UT9A 4K3JH 3QCTL 2FJGB 4OCSL 5C0EB 4OIBA 1E8ZA 2DQGH 4PVMA 2HYMA 2A1WL 2J8UF 2JJUA 4JFYB 2PTTB 3HB3D 2Z1KA 1ULVA 4J8RA 1C16B 1QQDA 2KDYA 1F02I 5CINH 4TUOB 1PY9A 3IMTA 5HHVL 5KANG 1X5KA 3AG4B 2GKIA 4N0YH 2PPEA 2I9TA 3RLSA 4HKXB 2DH3A 3GMLB 4JDVA 4WHDA 5CR8A 3PWPD 1E30A 4PWGA 3G6AA 5GJSH 3HC3H 4AVJA 3AABA 1LE9B 4HS3A 2FT8A 4XMLL 2X7LA 4PTTB 5I1IL 1NCCH 5BV7C 3LD8C 5TH2A 2H2PD 5A2IH 3PDOB 5C3LD 2ALAA 1DANT 3EGXA 35C8H 2CRZA 1BFOA 1HAUA 1BG9A 1ZHKB 2MPAL 3P9WB 3NBNA 5F70A 1MHCA 2C1PB 3RUGA 3TWYA 3EYFB 4WHTA 3SKJH 4Y4FD 3F7YA 1VFBA 3CFEB 4XPGL 2O26U 2DN7A 4FG6D 1TYJA 4D2NA 3FQRA 4AUYA 3QC5X 4KJYA 4JFOA 4CADA 5FV1L 5E8PB 3V5KA 4L37B 4BFFA 5B3SB 1Z2KA 5I8EA 1R46A 1WHOA 4NKOA 2HG5A 2HTKC 5HHMB 3L9YA 3NN8B 5HHQA 2CO2A 4HV8B 1QBLH 2ARWA 4TUJA 3KYOA 2EIZA 3G5XA 4M9PA 3QYMA 3SE3C 4AGOA 4B5ZA 1ADQA 4L5FE 2CALA 3NTCH 2ZSVA 3BT2L 2B20A 3APCA 3HNTL 1P6FA 3P4NB 1RZJH 1SEBB 1E4XL 4KK5D 5KYUB 2CD0A 1U8IA 2BO0A 3IDNA 5E03A 1J9TA 2W60B 1WAAE 3AGWA 3VNZA 2F5AH 1PDKB 2NY0B 3UC0L 4M48H 3FTXA 3ALWA 4XMXA 1R6VA 4X6FA 1NDMA 2JF1A 2QMJA 2XA8L 2OZ4H 2AXGA 1YDPA 1YNTF 1XGYH 1CD9B 3ZDYE 3CC5B 4CA4A 3NABL 4QYAA 5DVNA 1B4JL 5FF6A 3WTSA 1WAAA 1CK0H 3QH3A 1BQLH 1C8PA 4HPOH 1BD2D 1XGUB 3IVKB 4JM4H 1N3NA 3QEHB 3QUZA 4GIPD 2QQLH 3QUYD 1ZT1B 3DX3A 4O4YL 3RIKA 3O3AA 2M1KA 3GIZH 5LWYH 5D70L 5SX5H 1V27A 3HLKA 3IRPX 4YLQT 2VLJE 4NQDA 4GAJH 1BAGA 1W6WA 4PJHF 4YEFA 4WF7A 1YYCA 3D0LA 3DTDA 1MHHA 3IFLH 4RGNC 3WTTA 3PABB 4AWJC 2WXLA 4F5CE 5FYLL 4AYSA 4ZFOB 4MNQE 1WWCA 1YN6B 2YA1A 1MCWM 4JQVA 3R06A 1UT1A 5DVMA 4WUUE 3RL2A 4WO4A 4BA8A 1PG7L 3VW3L 1JGVL 4PRHB 1FNLA 1BQUA 5KSAD 5L0QC 4MJ5B 1CR9L 4J3XA 5T5NG 1KB9K 3RWCB 1I8MA 4KFZC 1A8JH 4HAGA 3VWJB 3KL5A 3L3DB 4M8QB 2QPEB 4YSPA 3QZOA 5FHBH 4DKFL 1SEQH 2AJSL 2IBZY