3QPKA

Probing oxygen channels in melanocarpus albomyces laccase
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
559
structure length
559
Chain Sequence
EPTCNTPSNRACWSDGFDINTDYEVSTPDTGVTQSYVFNLTEVDNWMGPDGVVKEKVMLINGNIMGPNIVANWGDTVEVTVINNLVTNGTSIHWHGIHQKDTNLHDGANGVTECPIPPKGGQRTYRWRARQYGTSWYHSHFSAQYGNGVVGTIQINGPASLPYDIDLGVFPITDYYYRAADDLVHFTQNNAPPFSDNVLINGTAVNPNTGEGQYANVTLTPGKRHRLRILNTSTENHFQVSLVNHTMTVIAADMVPVNAMTVDSLFLAVGQRYDVVIDASRAPDNYWFNVTFGGQAACGGSLNPHPAAIFHYAGAPGGLPTDEGTPPVDHQCLDTLDVRPVVPRSVPVNSFVKRPDNTLPVALDLTGTPLFVWKVNGSDINVDWGKPIIDYILTGNTSYPVSDNIVQVDAVDQWTYWLIENDPEGPFSLPHPMHLHGHDFLVLGRSPDVPAASQQRFVFDPAVDLARLNGDNPPRRDTTMLPAGGWLLLAFRTDNPGAWLFHCHIAWHVSGGLSVDFLERPADLRQRISQEDEDDFNRVCDEWRAYWPTNPYPKIDSGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Laccase-1
publication title Probing the Dioxygen Route in Melanocarpus albomyces Laccase with Pressurized Xenon Gas.
pubmed doi rcsb
source organism Melanocarpus albomyces
molecule tags Oxidoreductase
total genus 177
structure length 559
sequence length 559
chains with identical sequence B
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2011-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3qpkA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3qpkA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3qpkA03
3AY2A 1SJMA 4DP8X 2IDUA 4M3HA 2FQEA 3PLYA 4GP8B 2DWTA 1L9SA 5B1BB 3S3BB 3CVDA 4WKXA 1PY0A 1F56A 1KGYE 1OCOB 1RZQA 3FYIB 3NP4A 2I85A 4HZ1A 1JXFA 1PF3A 1PCSA 3OMIB 1AS6A 3ABKB 4E9QA 1SFDA 3MBWB 3PPSA 2PPAA 3SBRA 4KNTA 4F2EA 1ADWA 4E9XA 1GS6X 1A4CA 2HLEB 3NJIA 1HAWA 2VW6A 2CALA 2ZXWB 2QPEB 1NPNA 5TK4A 3QQXA 4BDVA 3CVBA 4N4YB 4YSTA 2PLTA 2TSBA 3UGEA 4DP0X 4E9YA 1E5YA 4A67A 1OCCB 2IDTA 3ASNB 3QJUB 1NICA 3RYMA 2YAHA 2BHFA 3ZIYA 4AX3A 3WNJA 5I5MA 2UX7A 4BWTA 1JZHA 2XVBA 3U25A 1SNRA 2GC7C 5B7MA 3T6XA 4ZK8A 2N0MA 1AANA 2ZONA 2FWLB 4YSEA 1FFTB 5B3SB 3FQYA 1L9QA 2DV6A 3NJHA 5ANHA 4CSZA 2A3TA 3EH3B 1JZFA 4KO7A 1NWOA 1KBWA 1JVOA 1CYWA 3BQVA 5I5JA 2P80A 3FSAA 1CC3A 3PAUA 4UF7C 2HX9A 3OM3B 2YAEA 1PNDA 1BYOA 3JT2A 1AIZA 3SBPA 3NSCA 2OJ1A 2EIKB 2VM3A 3WG7B 4Q89A 3QPKA 2BW5A 4E9VA 1MG2C 1IC0A 1DZ0A 5B7FA 2Q5BA 4MFHA 1NIFA 2UXVA 2AVFA 4YSOA 1W6LA 1OF0A 3UACA 2QDVA 4KO9A 1A4AA 1B3IA 3ZX1A 3BVDB 4BK5C 4BXVA 3TASA 4YSCA 2YAFA 2GBAA 3X1GA 3FU7A 4A66A 3ABGA 2GIMA 2HZHA 3N2JA 2EIMB 2YXWA 3AW5A 1AZNA 1ZIAA 1TU2A 9PCYA 3OMNB 5EHFA 4DPCX 2PPFA 5I6NA 1OE1A 4N8UA 1V54B 1X9RA 4L0PB 4E9RA 3L45A 5I6MA 3T9WA 1WA1X 1JERA 4DP5X 3HEIB 2EINB 1ZIBA 4KOBA 3WNIA 3FPXA 2XV0A 4YSQA 4A2HA 4BWUA 1W6WA 4CSPA 2DWSA 5F7AA 4DP1X 1KDIA 5D4JA 4E9TA 2GB2A 1QLEB 4G7QB 4GY4A 2YAMA 2Y1AA 4YVUA 2IWFA 1BXVA 2BP8A 1T5KA 4A2GA 3T6VA 3AG1B 5AKRA 1BAWA 4YSSA 3OQRA 2VW4A 2J56A 3CZUB 2GSMB 1IBZA 7PCYA 1ZDSA 2YARA 3EF4A 3T71A 2J5WA 5I6OA 3C75A 1XB6A 1PZCA 2BZCA 3UAAA 4G7SB 1ET5A 1YLBB 4HIPA 1KCBA 4PAZA 4KNSA 5PCYA 5I6LA 2XYBA 4QLWA 1SF5A 2FTAA 1KV7A 3NJFA 1BEXA 1PLBA 2XV3A 2PP9A 3UAEA 4GXFA 4GYBA 2FQFA 3X1FA 1JXGA 1L9OA 1XB3A 1NINA 4F2FA 1TEGA 2VN3A 2R7EA 1ET8A 1L9PA 3DIVA 2JXMA 3CVCA 4G71B 2CBPA 3PAZA 3CDZA 3QJTB 5B1JC 2XV2A 2HX8A 2BWDA 2PPCA 1R1CA 3IE9A 3NJJA 2VSKB 1X9UA 2WSDA 3NP3A 3WKQA 1PAZA 1TEFA 1PLAA 4E9WA 1AZRA 3SBQA 4F7KA 1E5ZA 1TKWA 1KDJA 5B1KA 2W88A 4KNUA 2CUAA 2WO2B 4A2DA 5AFAA 5B7EA 1WA0X 3CDZB 4UANA 1SHXA 1FWXA 1GW0A 3GDCA 2YAPA 1ET7A 1AAJA 1NDTA 3T6WA 1BQRA 1BQ5A 1N68A 3NYKA 2XX0A 1JZIA 1QNIA 2I7SA 2J55A 2H5UA 1GR7A 4G7RB 3IN0A 4GP4B 4YSPA 2XX1A 1J5CA 1J9TA 3OMAB 1GS7A 3SQRA 1WS7A 2MTAA 3H56A 3FS9A 3FPYA 3HB3B 2YXVA 2GC4C 1OOWA 1BXAA 1AOZA 3FSWA 4DP2X 4W9ZA 2FT8A 1NIDA 2PPEA 2QT6A 1IBYA 3QJRB 8PAZA 5TK2A 3AG2B 4HALA 2Y69B 3AG4B 1SDDB 1KBVA 3NJMA 4HCFA 1OE2A 1RCYA 1W8EA 3D12B 4RH4A 1NTDA 4HCGA 1KCWA 2IWEA 2VSMB 4A2FA 1ZDQA 2HRGA 2UXFA 1J9QA 3QJSB 1SFHA 3TU6A 1RZPA 5E9NA 2BZ7A 4QKTA 2NRDA 1A4BA 1AZBA 1N70A 4A68A 1J9RA 3NJNA 1SF3A 1J5DA 1GSKA 2BP0B 1MDAA 3EHBB 6PCYA 3NJLA 1FA4A 4DP9X 2JKWA 2IDQA 2XXFA 4EF3A 1JOIA 3EH5B 5F7BA 3KW8A 4AI7A 1A8ZA 1AZUA 2YQBA 4KO5A 2IH9A 1AACA 4YSRA 1JVLA 4NERA 1AZCA 1AG0A 4JHUA 1ZPUA 4FA7B 1IUZA 2B3IA 3AZUA 2UXTA 5IY5B 1NIBA 3WKPA 2H47C 1CYXA 1BXUA 2PP7A 2Q9OA 4X4KA 4GP5B 1NPJA 2HX7A 2B08A 2UX6A 4P5SA 3TBCA 3FYEB 1GS8A 1AR1B 3JTBA 1NIAA 1AS8A 1ASPA 4BXSV 1JZJA 1PNCA 1BYPA 1AQ8A 1OCRB 2IWKA 1M9WA 3T6ZA 3G5WA 2FNWA 1E67A 2XWZA 1WA2X 2P80D 5PAZA 5I28A 3NSFA 3H4FA 5I6PA 4DP6X 2HXAA 1ETJA 4DP4X 4YSAA 3DTUB 3ERXA 6PAZA 3V9EA 3N55A 2VM4A 2IAAC 2PCFA 4AKOA 3S8GB 2FQDA 1V55B 4BDVB 1ZV2A 3FU8A 3EH4B 3ABLB 1SHWA 4DPAX 3NSDA 2PP8A 1M57B 1GY1A 2FQGA 1XMEB 2OCCB 2CAKA 1A3ZA 2BO0A 4HCIA 5D4HA 2IH8A 2PPDA 4PCYA 3UABA 4NAJA 4G72B 3X1EA 2J57A 5I26A 2MRYA 3OD3A 3CG8A 4AKPA 1VLXA 1PMYA 3S3CB 2W8CA 2IDFA 3S8FB 4JHVA 3V9CA 2VW7A 5I6KA 1JZEA 1AG6A 3IBOA 1WS8A 2ZOOA 4DPBX 2XUWA 2XLLA 1V10A 4Q8BA 1GYCA 1KYAA 3H4HA 2AZAA 1WAEA 4YL4A 1PZAA 3FQ2A 1E30A 1L9TA 2BWIA 3NT0A 2JFCA 3IN2A 2I7OA 5AZUA 1URIA 1OV8A 2DY2A 3FSVA 3FU7B 3ZBMA 4NB7A 5A7EA 2XXGA 1ID2A 4W1TA 4WTQA 1MG3C 3NJGA 2RACA 1RKRA 2DYSB 1PZBA 2E86A 3AG3B 3ASOB 4YVNA 3TBBA 1ILSA 1PLCA 3FT0A 3QJQB 5D4IA 2X87A 5FC9A 2PCYA 2XU9A 2WO3B 1IKOP 3ZDWA 2H3XC 2ZWNA 1UATA 2QPDB 1EHKB 3QJVB 1L9RA 2VMJA 3FQ1A 4UAHA 3ABMB 2DYRB 2FT7A 1M56B 1NIEA 4AZUA 4A2EA 4E9SA 1DYZA 2AANA 4ENZA 1HFUA 3DKHA 5I5IA 1NZRA 1CURA 3KW7A 1ASOA 2YAOA 2CJ3A 2BW4A 4KOCA 1XB8A 2IDSA 4P5RA 3X1NA 3FU9A 2CCWA 4JKNA 2OV0A 4KO6A 2AFNA 1GY2A 1J9SA 3NJKA 4AKQA 3UADA 2BP8B 2UXGA 2QDWA 3GYRA 1SDDA 4BWWA 1ILUA 3PCYA 3GXUB 4YSDA 4DP7X 3FSZA 1NWPA 4M4RB 2LLNA 3S3DB 1OCZB 3X2QB 3IEAA 3X1BA 4FAAB 2AZUA 5B1JA 3MX0B 4G70B 2EILB 4TXVB 2X88A 2BP0A 2FJSA 1EZLA 2FT6A 4HHGA 2TSAA 1OE3A 1JXDA 2GHZA 3TA4D 5B1AB 1I53A 1MZYA 3PXLA 3NSYA 4HAKA 4HHWA 1E65A 1A65A 2EIJB 2YAQA 3PAVA 1QHQA 4K9JA 4YSUA 2GI0A 1MZZA 1AS7A 2R7EB 3WI9A 1BQKA 1CUOA 5LDUA 3WIAA 2HRHA 7PAZA 1JZGA 1ASQA 1HAUA
chains in the Genus database with same CATH superfamily
3AY2A 4MGXA 5LG1A 1X6NA 3MCKA 4UT9H 2VZ1A 4ORGB 3CVDA 3JZYA 4F8QA 5E8EA 3QQ4A 5E5MA 2A1WH 2ZWLT 5K9OA 4FXGA 2DQ6A 1RJLA 1YEKL 2FZ3A 3BGFB 4G9FE 1Q9OB 3JWOL 3HI5H 3RZCB 3D1MC 1L9NA 3LQAL 1JGVL 3QI9C 4XNBA 1G84A 4YL9A 5SWSB 3CTTA 3O3BB 3KXFB 3O4LD 3EW3B 2X6MA 1UYWH 1YYML 5ID0A 2PPAA 3ZE0E 1A3LH 1RZFH 3DX8A 4KK6D 1T2QL 4L3CB 5BZDB 1GS6X 1X5IA 2AEIT 1ECZA 1ZHBB 5K9JL 4NXKA 4KI5D 4AL8C 3GMNB 2APXA 3FFDB 5F96H 2F54A 5A2FA 3LEXA 5ETUB 3WOVA 3NCEB 4Q58C 3X14B 1X5KA 1QKZL 1AKJA 2VDOB 5LAXB 1FC1A 3R7QA 4U3SB 5DJ8A 4N9GA 5DHVH 1FLRH 2UX7A 2X70A 4YDKH 2H2SC 2AJVH 2PO6A 5CSBA 1JWMB 4Z3JA 3SDXB 3P4NB 1NUDA 1HXKA 3B7RL 1EFXA 4YSEA 1FFTB 3P9MB 4XPAL 3CN1A 3AACA 2BNUB 3BMVA 3NJHA 5ICUA 4NQEE 4BZ1H 2A73B 1DZBA 2YQ2A 4OD3L 5J13B 5CSZB 1EJ8A 3MRQB 4QF1B 1SJEA 3MJ9A 1B4TA 3K6NA 4IBSA 4CRPA 4FQXA 3BQVA 5I5JA 3NA9L 1MXDA 2NX5E 2F5AH 1GJWA 2DQTL 3PGFH 3BHBA 5DVPA 1JS4A 1U3YA 4LU5L 2QKIC 1XF4B 1DDHB 2H8PB 3QPKA 4I2XA 4H20L 3F3HA 4PJCA 5T3ZL 1FC2D 1MG2C 3BWSA 5EIIB 2A0LD 4XPGH 5T3ZE 2UXVA 3OGCA 1TTRA 4M61B 1OF0A 1A4AA 2XQYK 4JG5A 1DUZB 1RAMA 1ORQA 5FKPB 3RWCB 3HLAA 4EKXA 2Q8BL 2BVQB 3CN0A 2ICWI 2XKNB 4I5BB 4IW4C 3FUNA 2DJUA 3VG0H 3KDPB 2M83A 1QLRA 3ZL1A 4CBZA 3H3BC 4PRHB 3AUVA 3IRPX 3N9GH 3KPRE 1LO3L 3IXAA 4KFZC 4XWGH 4FLHA 4X50A 5DK0A 1A9VA 4L18A 5IEKB 1IM9B 5IGXL 1MFDH 2YR3A 4JY6B 4PJ5E 1GGIH 1TU2A 1WK0A 1XGTB 4LL4A 2GIYA 3L4CA 2YS4A 3RFZB 1JHKL 5I6NA 1KXVC 1V05A 1INEH 5HVGB 2XVGA 2UWEF 4TUJB 2DD8H 5BVPL 4P2AA 4JDTL 4S2SB 1LWJA 3VH8B 4CU8A 4WJ5B 4PW4A 4R7DA 4KUCF 5CZKA 5LAPA 1J8HA 4JFTA 4AT6B 4GXUN 4E9RA 4URKA 3VD0A 1ZIBA 4ZAKD 2NUPA 2AKRA 2YD1A 3B2MA 4AOFA 2R1XA 4WWID 2ROYA 3QJZA 4CSPA 4PJAE 5JDSB 5EPMB 2VDLH 5D93B 1F4HA 1W0VA 3LHPL 5DMKB 1FFQA 5EWIH 4UT9A 5D4JA 4H8WL 1G7HB 3T4AB 1KXTA 3GJFK 3WXWL 1HHGA 4J3BA 5BXFA 5IHHA 4UM9B 4PY7A 2HFEA 5I73C 1TO4A 4AYMC 1RHHA 2E27L 2FHBA 5ESQA 1HHJB 2EJ1A 2UZXA 4YDZA 4HJJL 1NCJA 3NPSC 4LCCC 1S7SB 3PWPE 1G7MB 3OF6D 1T4KA 3KPMA 1RUKH 3CSPA 1F3RB 5CJXA 1KPUA 4P9ML 1DQKA 4ZW3A 4L9DA 1EMTH 4G5ZL 3FU5A 4J3SA 4F2MB 5CN3A 2GVYA 2OMVB 3H9SA 2Y9RT 3QCTL 5IESL 2PW1B 2VO5A 2XPYA 5DJAA 5J12C 3V4UL 1PYWB 1B90A 4GRLD 4L4VA 1TVDA 3VXOA 4WFED 1ZCRA 4YHYC 1H6FA 4PJHB 2XWTB 2CBQA 1BD2E 3LOWA 3WFEL 3U7WH 3VXNB 1A6TA 1YPZE 2F1BA 35C8L 4PJIE 2OR7A 1L3WA 2OZNA 3CVCA 4J27A 4KRLB 3BDYH 2QADC 2GITB 3NJJA 4JZJC 3N43B 1L0PA 1HU8A 4JPSA 1WH0A 4BZ1A 3SDDA 3ROLA 1I4FB 1G7PA 5IP4A 1HKLL 5ADOL 3IF1A 3N41F 3BD4A 4R7NA 3DMMB 4A63A 4PJ8A 2UY7B 2JJSC 1MREH 2UZPA 1A6UL 4MD4A 2ZXDA 4LF3B 4OAWB 4AENB 3K2KA 4OT1H 5DO8A 1OAXH 3CHXA 3B37A 4JAMA 1BF2A 4NBYB 4ZYKB 1WZKA 3WKMH 4XN2A 4F37K 3KLAA 1MY5A 2B16A 3ARFA 3ARGA 5F1IB 3PL6A 4M7ZB 1KCUH 1Q72H 2BFGA 2BPBA 4FZEH 2QHLA 4FI7A 5D7JC 3VFNA 1ZWIA 3C5ZA 3C09C 3DNKA 4XNUH 1HNFA 1TJGL 1CGXA 2Z64C 3I6GB 2KZBA 3LKSB 4MNQD 1JV2A 1P53A 2NNXA 3ZDZF 2FATH 3PXHA 3RWEB 3REVB 2DQFB 3B7UX 1KCVH 1LO4L 1A6WL 4HD9A 4KKAD 5J6SA 2ADJB 1SLVA 4NIYE 1P5UA 4U0RC 4KVNL 1G5AA 4Z78A 3F7YB 2V7HB 2ZX6A 3JBG7 1S7TA 5JNYA 5DVMA 5TFSH 3ZGHA 3MUUA 4W9FC 3JTTB 4L37A 1J9RA 2EKSA 1ITBB 3OKNB 3AQYA 1WAAA 4ZTEA 3ZYZA 1MNUL 3HTLX 2GSIA 4X8XA 2FAUA 2CR6A 2VT0A 3QUZB 3ZZLA 1A8ZA 3IJ9A 1KPVB 2HKHL 3HR5B 2VAJA 4KO5A 4QRPE 4X5XA 3ZE1B 1JVLA 4NERA 1CFTB 4PVNA 1G0YR 3RTLA 4FA7B 3WTWA 5L8KB 5EN2B 5G5DA 1T0NA 4K3DL 5MEQB 4Y5YB 4OGQC 2ORBL 3FH5A 1NIBA 4NUJB 1L4IA 5KW9H 3VD1A 1Z7JA 2Q9OA 2BOBA 2R2HB 3TA3A 2VQUA 3F6JA 2WMPB 1D7DA 1K85A 4TTDC 3KCWA 3JTBA 1U8KA 1JTPA 1OM9A 5DJCB 4U6HB 3LB6C 3L1OH 3SKOB 1EPFA 1FP5A 3MROB 2ENYA 1UM6L 3A5VA 2Q1EA 2YGNA 3S34H 4DH2A 2R4RH 2GK0B 2X6CA 4Y1TA 4CKVX 3WD5L 4J3OD 1G9NL 3MHZA 1XCTA 3S6CA 4CVWA 2FLBT 4G6ML 5M7QA 2FX9H 1J86A 5DHXB 2C3VA 4IMKA 4DP6X 1NCTA 5CFAA 3PWUA 4G6AC 4YSAA 4MHHG 5GGQL 4RSYA 5JA8B 4WO4C 4K71B 1FIGH 1LXMA 1V55B 2O6PA 2QEJA 2K9FB 1G0XA 1CDHA 4PFEA 4TSCL 4ZS6D 4FI6A 4FKEA 2ZCLL 4U1GB 3KJ6H 3A6CL 1BF5A 4U7KA 3B7SA 3BN9C 1P1ZA 5KSAB 1J1OL 1MCDA 2WQSA 4B5EA 3O3DB 4M00A 3AU1A 4WW2B 5IHUL 3D3VA 3O6LH 4GSDH 1SXAA 2OYMA 5EU3A 4KUZH 2XBDA 5D4HA 2CSPA 2A7BA 2ATKB 1FBIL 4URTB 1IC7L 2Q76A 1CG9A 4RDQF 3QRGL 3F58H 4KI5C 1M2VA 1DBJL 2L7EA 4EN3B 1P6AB 1ZAGA 2J57A 2XN9B 4FQ1H 3U9PH 5EF2A 3TT3H 5EZOH 3DHMA 1L6ZA 4RBPH 2JK5A 5DU7A 4XPHH 5HI3D 1QSFE 4XVUC 1MCWW 4X8JA 1IAMA 5IK3B 5IQ7H 4KX9A 1C1EH 4LB8A 3IVKA 1LP9E 3IDXL 1RMFH 3MKGA 3KDMA 1T4WA 2H9GB 2BS71 3WLWC 3MMEA 3GHPA 3DVNA 1KWGA 3H4HA 3K6DA 2IOOA 3CAFA 4HXAL 4R4FL 2YKLH 5F7DA 4OZIE 3FQNB 4FXKB 4Q9QH 4KQ3L 2WLJA 4TLKA 1FH2A 3AQDA 5IUSA 5TPWL 3U2IA 2EIDA 5TE7H 3GSXA 4MXVF 2B4CC 1L7TH 5F3BB 2CHWA 1TQCC 4EUPA 5B21A 5AKSA 4JJHA 3R19A 5DVOA 3LPGA 4MRBA 4U6YB 3FB7A 2A0LC 3ULSA 3CK0H 4F80A 4HK3J 4J3VA 2VXQA 3VWKC 3NRPA 4HIQA 43CAA 5I1DA 4N6RA 5A6IA 5L7XH 2G5UA 2JTDA 4S10A 5JHMA 1DQLL 2DYRB 4DGYH 4UIMA 5DZAA 3IPEA 5B4MC 3HE6C 2OULB 2RMNA 3E6HA 3WUWG 1HFUA 5M95B 2IVFC 1SPDA 5ADPH 1RZJL 2GW5A 3GSUA 3QDMA 2O6CA 2G9KA 2AJUL 3A6BH 2LVCA 4GW4B 2JIXA 2P5PA 3O0RL 1KLUA 3WTTA 3MN8A 5DDHA 4PJDB 3DLQR 2AJXL 4DETA 1FL3A 2IPUG 4O9HL 5DJ2B 2R56H 3O3AA 4MWFB 2V9QA 3DO3A 1ZS8A 3FT2B 3GYRA 3KM1A 5DS1A 3AY4A 3REWB 5IHZA 4OI8A 4HEMA 2Z31C 2X10A 4DVRH 2OX5B 4XO9A 5FR3A 4G1EB 5FAAA 5IJVB 3K8MA 2QBWA 3WTXA 2FCBA 2YSTA 1UD2A 2DQGH 3TESA 4AQEB 3SCMB 4JO5A 4HT1L 3QC5X 5FCUL 3LEYH 1HQRA 5GRUH 2BNRA 1OANA 1R75A 3JXAA 3WJLC 5JW3H 5E2VH 4AYID 3RIFF 1E7VA 3F7QA 1EZLA 1XX9C 1J05B 3VMPA 3T65B 3FO0L 2GHZA 1OB0A 2NY1D 3QWQB 4OZHF 4L3EA 4YFDB 1R0AH 3PJNA 4U0QB 5I74C 1NL0L 3UOAB 3EOTH 2ZXBA 4MA1C 1KGXA 2JE8A 5DTFA 1R3KA 4NZJA 3HG1A 3UBHA 1C12A 4XOEA 4AXWA 5BQ7A 4NZTL 4MASA 1FGVH 3D52A 3ECQA 3UIZA 3W11D 3WIAA 4HGWB 4DIXA 4FFWC 4OCYH 4UIKH 3QJHA 3QFJA 2L7JA 1BFSA 3PLYA 4W9HC 1TZOA 2C3WA 2OMUA 2P49B 1X9QA 3GSWB 4ODWB 4H0LC 1DQDH 1T1WB 3T0ED 5IZ7A 3VD4A 4C4KO 5HHMB 1AO7B 1HYSC 3BT2L 3MRMA 1ZHNB 4ZODA 4HK0A 3IMTA 3UZVB 4QHLB 5T8IA 2B0SH 1IBDA 1AFVH 4HZ1A 4Q2ZB 2WO4A 4P2OD 1JXFA 1OPGH 3O2VL 3RJOA 4LSPL 2VC2H 4WEMB 1FO0H 1KIQB 4F7TB 1YYLL 3VQ1C 1H3PL 2HWZH 1QMUA 3FTGA 1AQHA 3POHA 2NY5C 2YLHA 2K6ZA 5LNEA 3PPSA 1QSVA 4KNTA 1ADWA 3HUJA 3RNQA 5KSBB 3R8BB 1HINL 1TPXC 2VLJB 3GJEA 5IROA 1VA9A 5ACZA 2R15A 3FO1A 3VAEA 4K4KA 1V5JA 2NY4D 3V4PH 2CDFA 3KPNA 5DA0B 1Z5LB 1ROCA 4MJ6A 4TNVK 2YAHA 4HPOL 2N4IA 2NY3D 2P44B 3ZDXF 5EA0H 3WNMA 2WYTA 4FLSA 1F4WL 4RAUA 5KVGE 1A1NB 2ED7A 3PPEA 3KWVA 4GKLA 2ZCHL 2NZ9C 1DSYA 1PLGL 1F3DH 2FWLB 5LXGL 1W16A 3INOA 1U8QB 5DO2C 2DQEL 3KPOB 3JYCA 1R34A 1SN2A 3FQYA 3T0BA 5DWUL 3PP4H 1TNMA 2Y6SD 2NTSP 4GUQA 4Y16A 2BNQB 1R24B 4YPJA 3WENA 1MW1A 5CZRA 2FIKA 3HE7C 4PJDF 4LPUA 4XHJC 3DBXA 3DROA 1V3LA 2HPOA 1JVOA 4L8SB 4WFGD 1MCKA 4KKAC 4N1HB 3PAUA 1KC5H 4UQ9A 1DVTA 3OKLA 2J4WH 4YDIL 1X5HA 5GGUA 2V2XB 3U0WL 2VDPL 1T0OA 3Q6GH 4XMLL 1JL8A 1MLCA 1UB5B 5J1AB 3QDGD 1S9WA 5IW1A 4NJAH 5I1CH 1ACYL 1W6LA 3AS3A 4ABVA 4ZMNA 1KEGL 3H53A 4KV5E 4OIIH 1NDGA 3LXCA 4BH8B 4AIEA 3P3SA 5JA9A 5KSVA 1SDYA 3EBGA 5LDSA 3ABGA 4GBXD 3STZB 3BSZL 4PWGA 3U6XS 5KG9A 5L6YL 2DWDB 1H15A 4WWNA 1B3JA 5EU4A 1NFAA 1PZ5A 1WBYA 5EUKB 2QSCL 4PREA 3VI4A 3QDJE 1OP5H 1T83C 4PI0A 5TDOA 2V5YA 5GSRB 3S9DB 1XIWA 2P5EB 3MRIB 5DLML 1X9RA 4JFEA 1V3MA 3HZKB 3U1SL 3AREC 4HLEA 2MCMA 4PLNC 3BGMB 3HEIB 2DEWX 3IJHB 3RKDD 2JNZA 4GAJL 1FZKB 1MCSA 4YSQA 3NCMA 1INDH 1LYQA 4D7PA 1LILA 4NIKB 3ROOB 2DYPA 1FYTB 4Y89A 3HRPA 5JHAA 2BCKB 1JWUB 4BFFA 3LXBA 1ODAA 5CBAB 4J3OC 1UZ6F 4BFRA 4NQCA 5BRZE 4F24A 4OJFH 3V5DB 2WQRA 4LRNH 4NZ8A 1JFQH 2XTJE 2XWDA 3V5KB 3WFCL 2MWCA 4OLWH 2JKSA 4XPFL 1I8LA 4JFPB 1ZSDB 5DJXA 2EH8H 3P3UA 1FO0A 4U1IA 4YSSA 1LNUA 3R06A 4OD2B 2OJEB 4K94C 2NQDA 4X0KB 3CZUB 4G7YL 2QVMA 3I02A 3GXIA 2W0KA 1V7NL 4L8CB 1K4DB 4JRXD 4K7PX 4UOJA 1FFNB 2BZCA 3GM0A 3HC2A 4M7LL 1VADB 2BINA 2VXTH 4LOFA 4KRNA 1W8NA 5M94B 3GSNH 3CBRA 3GUTA 3GPSA 4JQVA 3V4PA 2KPNA 5IVZB 2YXMA 3KVDD 1FDLL 1I3GL 2J6EA 3TTSA 2V2TB 2VH5H 2VZOA 4M1CC 3VFVB 2HMID 1Z5YD 4XNYH 2X40A 2PCPB 4QRRA 1A14H 1CXFA 1R4XA 2EDNA 4LKCB 1BHGA 4F2FA 4HXBH 3KXFE 4OJEH 5J3HD 2X4QA 3MNDA 5IEHB 5HI3C 5IBTH 5B1JC 3FUKA 3UGUA 2A9DA 1DFBH 2BWDA 3CFJA 4HS3B 2PPCA 4MJIB 1YN6A 3WY2A 2VSKB 5F72S 1IGJA 1OAYH 4JKMA 3TA3D 3UROR 1K5WA 1XSKA 5KAQF 1I9IH 3CJJA 4WFFD 1U58A 1BZQK 5E00A 1IEBB 3KL5A 1I7RA 3P0GB 3WMPA 3A67L 1MIEL 3BP6A 4UILL 4PGZA 2H32B 4P46C 2CRYA 4PS3A 5J06A 1N6QH 2FO8A 4JQXC 4X6BB 1MH5B 3BLPX 4GAFB 3KGTA 3PWVB 2CLRA 4NNXB 4U1SA 3BRFA 1XV8A 3DECA 2ENSA 3V6OC 2C8NA 2DLFH 2A6DB 3NYKA 2AHIA 1H3XA 3QZMA 1LK2B 4YR6B 1GR7A 3IN0A 3QIUA 3BVVA 3JVFC 1UZ8B 4WHYH 8FABA 3F2LA 3MRLB 5C0EB 1A22B 4OSUH 4UTBH 3V4VH 4FXGC 1AOZA 3QCUL 1ORSA 4X4XB 1DVFD 4M7JH 1ZA6A 2B59B 5D1XD 2BSED 1NCCL 1SVZA 3BVUA 4U1LB 3LKOB 3NJMA 5B3NA 2PETA 1S7QB 3D12B 4JDEB 3II3A 3B2UC 3V5HB 5B1CA 1AR2A 2JWYA 4JO2L 1CLVA 3QULA 5KN5A 2XACC 4CMHC 5IREA 2ZKMX 1KIPB 2PR4H 4PN6A 1NGXA 4XNMA 4W6YB 5JIKA 1DFXA 4O58H 5DD1H 1R5WB 2XWCA 4Y9EA 5JW4N 4JM2A 4I9WE 5FXCH 3VNZA 4YNYB 3QS2A 3L3DB 1NDMB 3G5ZB 4CVZB 4FYQA 4PRHE 3TWYA 2CXGA 4FQ2L 4P59H 3V7MA 5F7BA 3VFPB 4MZ3A 4K7PY 4LBEB 1LQBC 2HG0A 2K7QA 3CN3A 4ZW5A 2PO6C 5AB0A 4NXSA 4DQOH 2OYPA 3I85A 4D0BA 1NFKA 3K1DA 2AQRA 2GEQA 3VH8G 4YX2L 2EO1A 3FUDA 1MQKL 4DVBB 5HY9A 3WNPA 3HMXH 4K8RL 4NJ9L 3CLFL 1U0QA 3C2SA 3RU8H 1CICA 4RRPG 4WNSA 3ZDYB 2AQPA 4X4KA 1CGSL 4WU5B 1TSHA 3PP3H 4FQXC 5LCVH 5DC9B 1YMMB 2IANB 1ASPA 1NJ9B 3L3IB 3OHXB 1JZJA 3U36A 5KS9B 2ZOLA 4PRID 5T1MA 3G6JA 4Z5RB 2AQ2A 3WTUA 3B1UA 3DSFH 1GYAA 3CVHB 3MZGB 4OQTL 3W11C 4PGBB 3WLBB 2VL4A 2OMBA 2AAVA 1HSBA 3DC0A 2VKXA 3HPLB 5T5FL 4KTDL 4PHZA 1ND0A 2LLGA 2APFA 4R8WL 5D70L 2GT9B 4G6KH 4M5ZL 1ZHLA 3I2CL 5DEJA 1Q9KA 3S8GB 3DO7B 5I1EL 5D8JL 1X5YA 1EFQA 4UMGA 1AI1H 2A9NH 2C1PB 2Z4TA 4IDJL 4P2OC 2VZTA 5B8CB 1RPKA 5LBSH 5F6HJ 4F8LA 2Z93B 3F5WA 3NPZB 2Z34A 2FLRT 1ZLEA 2QL1A 3BQUB 4JDZA 4V2CB 1F3JB 3LH8A 3VU1A 4PJHE 4TVPD 2EC8A 3KBFA 2BC4A 4I48A 1DJGA 1IGFH 2IH8A 5J6GB 5L2KB 1ZK5A 4RESB 2PPDA 2XY1A 4JFQA 2CO7B 3K6SA 3U4KA 3C87A 3RTQD 4XH2A 1GZHA 1KCLA 4OGAC 1EHXA 1EO7A 1F8TH 1TVHB 4KROC 4MQ7A 3S3CB 3CZFA 3IRZA 1NOAA 1CE1H 1HKFA 2OCFD 3J8F7 3V0VB 4H0GA 2NY3C 4P4KB 3VXRB 4PW9A 2ICES 2X0VA 4HP5A 5GIRB 1KTLA 1A7RL 2H41A 1J11A 2YK1L 3V4VA 1WT5A 2HG5B 4UTBA 1QHPA 1AGDA 4NFBA 3B2PA 1HIML 3QUGA 5F21B 2BOLA 3C5JB 5CJXC 2VMCA 1D5BB 2J21A 3X13B 2YPKB 1GRWA 1E30A 2VWEC 3GDBA 3GSVB 4MNGA 1I3RB 1YDPA 4KAQL 1OAZH 3DOHA 4X4ME 1BDYA 1SJVA 5H2BB 3UO8B 2VMDA 5I24A 3T2OA 2WCSA 5EEZA 5AZUA 4R3SA 2FR4A 3IBEA 3ZL4H 4ELMF 1JK9B 4X6DB 4OB5L 1CLYH 5ISZA 3V0JA 3VRLE 2RACA 2XIDA 4QHKI 2WXFA 4EDXA 2XCMC 4FFYH 3TBBA 1IC4H 1DLHB 4HIEB 2CGRL 3CFDB 1GL4B 1RZIA 3MACH 4QXUH 2XPGA 3WNLA 1BFOB 1IKOP 3ZDWA 2UUDH 1FZMA 5E4AA 5F0PB 1KIUB 1I9RL 4ZXBD 4YFEA 4K5OA 2F53D 3IJEA 2FT7A 4TLTA 4Q4IA 5J9PB 2MNJB 4GBXC 3HMXA 4XTRC 5DD5H 3G6DL 1DSFH 1U36A 1NZRA 1RUPH 4XBEL 2O30A 1EA9C 1TJHH 3AT9A 4BUGA 1XB8A 3RJQB 4KKLC 3VI3F 2OR9L 3Q05A 3IGLA 5CGYC 5T1KD 3FU9A 3D85B 3N40F 2NY0C 3PQYB 5HSFA 1E4XL 4JO3L 1GKOA 2AFNA 4IBYA 1I8UA 2G2RA 3PGDA 4AJ0A 5LCVA 1W72H 3L4WA 2HJLA 1IQDA 3ARUA 4PJ8C 4FHJA 4AYEC 3ZE1E 2QDWA 4LCVA 1E27A 4ZFFB 4BKSC 1Z66A 3NFNA 5L2JB 4MQSB 1OOAA 3RKDC 5BV7B 3FCTA 3FSZA 2FO4A 5HHXH 1YEJH 3ARGC 1KZYA 3UZQA 3KHOA 3ZKQD 1J5OH 1BV8A 2B77A 2PTVA 3B56A 4IK6A 1CTMA 2EYTA 3C5ZC 3OXRA 3HN8A 4UQIM 3JUYA 2WCGA 4Q0XL 3DUHA 4DOHB 4APQA 3FN0L 2VB5A 1RULH 1EWHA 2XFXB 4EIZC 4L48A 2V8MA 3CFEA 3ATEA 5I1KL 2ESVD 2IGFL 4N90D 5C0FB 1I9JH 1P5VA 4RSVA 1J87A 1VF5C 5TGBB 3MLWL 4JPVL 1OVZA 4W9DC 4TQIA 4YUEH 4JVWA 1NM9A 1SJMA 1X4XA 1JGLL 2CXKA 2J72A 2MOVA 3CIAA 4BRJA 5G55A 5DHYA 3L3KB 2BSBA 5EH1A 4W9CC 3SPJA 2BSSA 1ZK9A 2HMIC 1BLNA 4N2EA 3E6FB 1Z3GH 2V5RA 3MLRH 3BPOB 4RFOL 1IGCH 4YDVA 3T2LA 3OLEA 2AW2A 4JEGB 3EO1A 4N8PA 4B0MM 2NDFA 2K4WA 4Z7NF 3FT1A 4B9FA 3QUXD 4OZHE 1XIWD 3CBJB 2OTUB 3BPLB 3TA3C 2X28A 4I88A 3TO2A 3WSQH 1CFMA 3OKYA 4X6DF 2XN9E 3CSGA 3FO9A 1DQJB 3PWJA 5KTEL 3EFOB 3SY0A 1VACB 3F7LA 3SOBH 4BDVA 1TQBC 5DURB 1CF8H 2XICA 4JR9H 4H7VA 5EMYA 2PLTA 4NGHL 1N4XL 2IPTL 3BDXA 4LESA 2DYPD 3QZWG 2X4NB 1SGKA 3DURA 1DBBL 3QJUB 3MBEA 5HHOD 1QWNA 1OTTC 5HHPB 3D87B 3LPFA 1M7IB 3I75A 3SDAB 4FFYA 5FOBB 5I75B 1OTSD 3ILPB 4QYOB 4IMKC 4HJGA 4XR8C 2R8SL 1AANA 5A40E 2ZONA 1U8JB 5FDWB 1S7XB 1KYUA 2ZQKA 4LPCA 1K6QH 3HVDA 1ID5I 4PRNB 1JFHA 3RVWD 4AEIL 5AOKA 2VLKD 4FQCL 3L4ZA 1DVFC 4N8VA 1T21A 2GJRA 2VLRB 2F0CA 5FA3A 1CT8A 5TE4H 1BYOA 3LVTA 4HU8A 4ZJ9A 1GAFL 2FH6A 4IMLB 5C0BD 1NKRA 2HJFB 3UPCA 3SKMA 3CMOH 2LQRA 3LAFA 1U95B 1TITA 3T77B 4FQQA 5CHNA 4FFTA 4W68A 3S37L 2BVUA 1T1ZB 3ZX1A 4OLVL 4A7VA 1I8KA 4U7SA 5EO1A 4JBSA 3EF7A 1G9MH 4IBUA 2Q3AA 2XZCH 1LEGB 2I9LA 4LNRA 1NA8A 5DUMH 4BFGA 3CBKB 4OUUA 5C0DA 3UTSD 2HZHA 5HYJA 5SWQB 3SGEI 4EI0A 5HDBB 1E6OH 4RMRA 3TEYA 4NRYB 3GIVB 3OR7A 3ASWA 1VRSA 3E3QE 4PJDE 3LX9A 3UYRH 3TF4A 4M43H 4XAKE 1QRNE 4BSWA 3QFGA 5I1IL 3CUPA 3QUYA 4BE5A 3LCYA 1LO2L 1NGPL 4U1MB 4C83B 2WQWA 4Y5XB 5DRZA 2LTQB 4JPKH 4L9LA 1KBGL 5E4OA 3X11B 2WBJA 4JKPL 3TNMB 4MDJB 1WF5A 2RCSH 5C70A 2P8LB 4FHKA 3UC2A 1NEZB 3Q01A 3QIUD 5KJ7E 3IMWA 4KZEL 4J3UA 4P4RA 4FA6A 4YEFA 2BVOB 1K3IA 3HN5A 4DP1X 2DMCA 4P3WA 2AC0A 5C0RL 3CFCH 1X6LA 2JB6A 3W0WD 1MOEA 1XSJA 4RGOL 4D9LL 2YAMA 5IV2A 3WKYA 1KJ2B 4YXLL 1DVZA 4ALAH 3ISWA 1BXVA 3HS0A 3FCUB 3G5XB 4UU9A 4X6CA 2WB1A 1KN4L 4DKAA 5L8LB 3U6XA 1OGTA 1GGBL 4JFXA 1GTNA 1IGIH 3B9KB 1SEQH 5BUPA 2XZQL 3BEVB 2K1MA 1FVDA 4RFNB 3MFGB 2F74A 2ROXA 3O2DH 2V4LA 3APNA 1OLZA 1XH2A 3P77B 2DQIL 3MJ6A 3HPJB 3L2MA 5FGCB 4LLDB 3C75A 4Y1AB 3UPRA 5HHME 1AO7E 3KPQA 4D9RD 4NQSA 3F62A 1SXBA 2YEZA 1QEWB 4BFJA 3AY4C 2XVKA 3MV8B 2F54B 1KIRA 5TD4A 4YDLB 3FOMA 1UZ6E 4NCC2 3BI9X 3RTQC 1KB5B 1AKJB 4H1LA 2XC8A 2PYEB 2X70B 3VTAA 2GJZB 1ZGLB 1IO4C 3G08A 4PJBF 3CDZA 5KSBE 1YNLH 5I1LB 5DK2A 5ESAB 4F8NA 2VLJE 1UA7A 3EYOB 4JVUA 3NFSL 3NP3A 4POZD 4IRJA 5DI8A 3NIGB 7TAAA 3TH4T 2OCJA 1MJ7L 1ZVYA 4K7PH 1SHXA 2IMMA 2OMWB 3S35L 5FO8A 4PGEB 2XWBA 3TBWA 1TTCA 4FQJH 2IFGA 4FHBD 1IFHH 4BZ2L 2Y36H 3T6WA 3ULVE 4ZX6A 2R0LL 1TT6A 4GMTL 4QD2E 1BQ5A 1RZKC 2DKSA 5GGVH 4OR1A 2VR3A 4G59C 4IOFC 4PJCB 1O5PA 1SBSH 2OS7A 7FABH 2XIBA 5HDBF 1R3IL 1JF1B 4X9YA 3NZSA 3OMAB 1Q94B 1D5ZB 2A4CA 3FQRA 5EU5B 4N87A 3VTMA 1MRCL 2GC4C 4KKPA 5C1MB 4WU7B 1O6VA 1RIUH 5AYQA 1H9VA 2IF7A 4E41A 4OF8A 4C56A 1OD9A 1QLRB 5G4NA 3WE6B 1W15A 4RMWA 4JFWA 1QUNA 2BIHA 2IH1B 4HALA 1X7QB 1T7VA 2CGZA 1W8EA 3QIBB 5F7WC 4F91B 4Y0GA 1EDQA 5BMFL 2BHUA 2K45A 5JXED 3QORD 2DF3A 4KJYA 3OAUH 4QOKE 3ZKMD 1SLUA 5IROC 4CVXB 5DFVD 3RDTA 1AZZC 2ICWB 1A0QL 4OM1L 5AB1A 1KUMA 3NEOA 1N3NA 3LZQA 1UACH 1PKQA 2JKWA 4LP8A 5CLTA 1ZLUK 1MRDH 2EH7L 1B2YA 3BPCB 3TPKA 3VVWA 3GTNA 1AG0A 5IF0A 3CFMA 1IUZA 5D1QA 2P5EE 1EXGA 1IAIL 4FQHA 4XBGB 1UADC 3EJZC 4YC2C 4IRSD 4HH9B 2PXYA 2GEEA 25C8H 4Y16C 5GJTH 4FE9A 1WZ1L 3PHQA 4WEEA 5A2AA 1BVLA 1KENH 4PWFA 1S6NA 3KPMB 2I32A 4XP5L 2UX6A 3TBCA 1MCPL 3V0HA 4FF9A 1GS8A 4PRAA 3K6OA 4M8QB 5LUMA 4NZUL 4XP1H 5JQ6H 1I1AD 1FYTE 3WN5A 5BO0D 1MXGA 3ESNA 1QSEB 1TZHA 3BZEA 4ATWA 4BXSV 2CDEA 2AEQL 5K5YA 4JGNA 1NCBH 5J11C 2X2JA 5SWZA 1S5HB 3T2NL 5FHAH 32C2A 5DJAB 3VFWB 1GMIA 4PGCB 2EDXA 5E1IA 3CGTA 1UZGA 3E9UA 1GCFA 2V7NB 2H3NA 3HG4A 5I66B 5E6UB 5H8DA 3A23A 4GSQA 1T3FB 5DHVB 1X5FA 2DQUL 4JFZH 2OMZB 1EEUA 1WO2A 2ZCKL 4NSKB 4WSJA 2MCPL 3C5SA 5C0CB 3K7UA 4BFOA 4Z3TA 4RQQA 4DPAX 3K80A 3AT8A 4FFZL 1YJDL 2YMXH 3SDDB 3QUXC 3TEUA 3V8CA 4TQEL 1UM5L 1XIWC 3OAZK 1FGNL 1KTCA 3TNNA 4V1DB 2XBZA 2XSKA 4HCIA 2X4OB 2XWEA 3FH7A 3ZMRA 3UABA 4NAJA 4ELDA 3SBWA 4G72B 5D2LA 4OZGA 3MRHB 1HNYA 4MJIE 2Q7YB 1K4CB 3BEWA 3S96A 4AMKL 3CC5B 3HZYB 1N7MH 2ZIDA 3KLAB 2VW7A 4CN4A 1JZEA 1AG6A 1XQ4A 3R8QA 3MA9H 5I18L 2IQAB 1OTSC 3EO0A 4HUXA 4APQD 2J8OA 5GS0H 4RMQA 1I8LC 2FO1A 4LLWB 1BLIA 4MBOA 2L04A 1UD6A 1KYAA 5KYXA 1DBMH 5FM5O 4JMNA 1EHNA 1UH2A 3IDIA 3GLZA 3P69A 3RVWC 1GJUA 4RISL 1BP3B 1G6VK 2W9EH 1PSKL 1AQDB 4N0FA 4WHTB 4D9QE 3QPXL 3VRJB 2DL2A 2WJ5A 3MRKB 1P5UB 5I8CA 5K59E 5EB9A 5MENA 3BKYL 2AK1H 3SZKC 3RI5F 3VCLA 5IR1A 4NO0A 2QZQA 1MG3C 3NJGA 4NRXB 1YEKH 5E6IA 1RKRA 1A7NH 3OZ9H 4JQVC 4YHNA 4YVNA 1S5IH 3LQAH 4NQXA 1JGVH 3CMGA 1OY3B 2ZUWA 1JCVA 2R2BB 3OJDA 1I82A 1WRFA 4FYSA 2VDLB 1ZXKA 3NCWA 3T3PB 3ARDD 2ICEA 2ZP8A 3NVQA 4K3EL 4XMXA 4X5XB 1P4IH 4G9DA 2EXTA 1WWBX 2VMJA 5DZVA 5DHEA 1N0LA 1R5IA 4X7TA 4TRPH 1ES0B 5K9JH 1SXNA 3FL7A 3DKHA 5DJYA 2WUCL 5C08B 2NPLX 3FQXA 3EBHA 4P5RA 1BZDA 3DDGA 3OAZH 5KYUA 4LCWD 1LE5A 2Y7LA 1D2OA 1QKZH 2B5IB 4PG9A 3EXLA 3SB3A 1CXIA 4OCXL 2CKBL 2ENQA 5FGSA 1IRAY 4WEUD 4R0LB 5KSUB 2VXUL 3PCYA 3Q13A 1G87A 4LPVA 2ATPA 3CZGA 4CMMA 3LQMA 1X9LA 4XO8A 5TH2B 1T1YA 3QIUC 4UDTA 2G3XA 4J28A 1BM7A 1G7JB 2LAAA 3ZDYE 2OK0L 3TVMD 2E76C 2W9DH 4G70B 2X4UB 3PWUB 2FJFA 2X88A 3QZBA 5I1JH 4FADA 1VZHA 1YMME 3NA9H 4TPRL 2FT6A 3AFLA 5CJ5A 3IGKA 2DQTH 4J2QA 2IANE 4LU5H 4AQ1C 5KS9E 3CVHL 3PXLA 3QAZB 1FVEA 4HHWA 1SOKA 4H20H 1ONQA 1R3JB 3FTYA 1XWVA 5DR5H 2PCXA 2ZOKB 5F1OB 1CBJA 3QIWB 3VXUD 3J2PA 1JD7A 4TULL 1A4KA 2BDNL 3BRGC 4ZUSB 5D5MB 4O2CB 3IPBA 2WLZA 3AU1B 2RQ8A 1BJ1J 4JFFA 2Q7AA 4YS4A 1PQZA 1ASQA 4NRZA 5EU3B 2Q8BH 1S78D 2Y7QB 1TVBB 2Q76B 4JM2C 3TC9A 4DGUA 4GP8B 1NKOA 5IHWA 4F7EB 1LO3H 2IG2L 3SJVA 2CUHA 2W94A 4XZUB 1F56A 3MV9A 4G8GB 5HYJD 2JK5B 1RZQA 3GSRB 5BS0B 1ED3A 1JHKH 3GJFB 5E2WL 3ZKNC 4ZDHB 1PF3A 2ITCB 1Q8MA 5JOFB 4LCYB 4ZW7A 1SUJA 1HSAA 4TSBL 3KDMB 1XR9B 3HRZB 1SN5A 5DHMC 3QCVL 3U4EB 3UBGA 3B2DC 1E7UA 5L2KE 1CICC 3DI3B 3QGVA 2Y23A 4POZC 1UKQA 1U8PA 1YAIA 3IDNB 4ZMAT 4NKMB 2VW6A 1VPOL 3RL1A 1E9OA 4LVEA 3TZVA 4CW1A 3VRIA 1UJ3C 2JI2A 3WXWH 3VXRE 4DP0X 4MJ2A 1A4JA 2E27H 4G9FA 3KJ4C 5DK3A 1V3KA 3K2IA 4M03A 4P9HL 4X9FA 2CGYA 3SQOH 4JPIB 1JHLL 2A6IA 3RQ3A 2OM5A 1ANUA 2BVPB 4X42A 3TH2T 3ZPDA 4ZNEE 4P9MH 4G5ZH 5DD6B 3OC5A 2ZOUA 43CAB 4LAJH 3S2CA 1K8IB 3QE5A 4ZZFA 3S48A 1E40A 3QCTH 3H55A 3US9A 3O8XA 2WLLA 2K0RA 5FECA 3V4UH 4XCEA 1C7SA 2QGBA 4X6DE 4UM8A 2ALWA 2J25A 4Y4FB 1AIZA 2ADIB 4A7UA 4HK3N 1T0PB 4YBQD 5JXEC 4TVSa 2SODB 3QORC 2EIKB 3OKOA 3WG7B 3WFEH 2D3NA 2KDGA 2OMYA 3ZKMC 5DDHB 4B9IA 2BW5A 2JKLA 35C8H 5DFVC 1MI5D 2Q5BA 4MD5A 1NCNA 2GKIA 3VGDA 1ZS8B 2AVFA 1BXXA 1FORH 4IJ3B 1H0DB 1OT4A 4NQEA 2O6EA 1P0SE 1IVLA 4KRPD 4AQZA 5JOPD 4N3TA 3ZMNA 4NQDE 3NEEA 4PW3A 4PCKA 4MA8H 4PRBA 1A5FH 4JE0A 1HKLH 3PQYE 2NX5A 5CZXC 4FOMA 4O2FB 2YGOA 3TPUB 4TUOA 3MSPA 3EBAA 2PPFA 5IQLA 2DIAA 3HNVL 5BV7L 2WTRA 3Q3GB 1C5DA 1EXHA 4ZQKB 3GI9L 5CINH 4NI6A 4TVPH 1MPAH 2OLDA 3EFFA 3LZFL 4IDLA 3T9WA 4AYFA 4JFDB 5D7LB 2HKFL 1E9QB 4HGKC 1I1AC 3IU4L 3WNIA 2PWGA 3BKJL 1AGFB 3T8VA 2APBA 4MKTA 3ZR5A 2NYZA 4GKOA 5HTSA 2FEEI 3BVXA 3DYOA 4AH2B 3KPRA 3QFJB 1T2XA 3WHE0 2IOMA 1C9SA 3HBZA 4DOHE 3MR9B 5K1JA 2OMUB 4L1HA 3KR3L 3TBVB 4EPSA 4PJ5A 4GY4A 1E4WL 3ZQWA 1PKOA 4E41D 4M62H 2A74B 4X98A 5IB5A 5C6PB 2OR8A 4YWGL 2E7CA 4EDWL 2HVKA 5H37H 2NNAB 3JWNG 3IJ8A 3FT3B 3JWNE 4IGBB 2WLMA 1JPFA 1CFBA 5AVXB 2A77L 3ARBA 3M45A 4PJAA 4MS8D 4GG6B 3GIZH 3EH1A 1XCQB 4MRCA 2ZTBA 2BCMA 3RWFA 2YFNA 1SVCP 1YLBB 4Q52A 3DX6A 4PAZA 1A6ZB 1DQMH 2HKHH 3IJSA 3PXJA 4N5UA 2I9TA 4H8HA 4XP4L 1XCXA 3NJFA 3QEHB 4GYBA 4K3DH 3UP6A 5FGBC 1TUPA 3EJUA 4Y2DB 3PWPA 5EG6C 2V17L 1ZVNA 3N50A 1AJ7L 5JPNB 3FN3A 1KCRH 4ZOAA 3IE9A 1P6FA 4J8RB 3ZHKA 2H0PA 1CQYA 2X12A 4APQC 2OXHB 2VDNH 1UEYA 2CRMA 3IS0X 3K72B 1E5ZA 1WZAA 3L48A 1ZA3A 2DH2A 4HWBL 3WD5H 4R2GB 4NO2A 3G7TA 3UTPD 5FYJU 3TLRA 4D8PA 4I9XA 4E42B 3O6MH 1BD2A 2PWEA 1ET7A 1DANU 5FO7A 1YPZA 1BMWA 3VD9A 5C07D 3HC4L 1F6AA 1GC1L 4PJIA 5JYMA 5GGQH 2IPKB 1NFDF 2EYSA 1P9MA 4FD0A 4NN6B 1PW3A 3L7EA 2V5MA 4ZO9A 2WXLA 4Z0XB 2MTAA 2ZCLH 3H56A 4DW2H 2VLRE 3A6CH 3VFUB 1E8XA 1YEDB 2CO4A 3JV4B 1J1OH 2FT8A 4LDCA 3O45B 1JZ8A 3NIFF 5IHUH 1QASA 1GTFA 1F2QA 3AG4B 2FJGB 3HIZA 1FBIH 1IC7H 5DD0L 3KD4A 1KCWA 4GFXA 2IWEA 3U2JA 3ARPA 2EDOA 2JJUA 1T5WA 4PMFA 3GHBH 5IB2A 4JM0A 4FFVC 1S3RA 1XZWA 2RB8A 4JFEB 1SY6L 3EGXB 3FQUB 3LKRB 3TL5A 5ENWA 3AITA 1NUFA 3RWDA 3MFFA 5MEOA 2R23A 3GXPA 5SV3A 3MREA 3NG5A 3WO3B 3MBEC 4GUPA 4J6IA 2GCYA 5HDBE 5EBWB 4GXVH 5J57B 1V8HA 2WNGA 4HXAH 5DJ0A 4R4FH 2NY6B 1U8NA 4YHLL 2D7PA 2ZKXA 4LQ1A 4M5YL 3FXIC 5DT1H 1A7OL 3EJQA 1KN2L 2O4EA 2AQ1A 3GT6A 3CNKA 1BZOA 1MCBA 3DV4A 3Q06A 1GMEA 4KKRA 3AS1A 3D2UA 5TPWH 1M05B 3P4LA 4MAYA 3UBXI 4ANVA 3R06B 3D0VA 1G43A 5MEND 5I17B 3VJ6A 1IIIA 2QKIB 4MX7B 1KJ2L 4U6XB 1OCRB 4QRPA 1M9WA 3FFCD 2JQZA 4E2OA 3HKFA 3L3JA 3TN0A 2YPLE 2MJWA 2GJ6D 4UUJA 1S78C 3US0A 1DQLH 3V4PB 4LSVL 1U8MA 1U3HD 4YIQA 5ERWB 2F58L 4HMCA 3CQPA 5I1AB 1ETJA 2XIIA 3CH1A 3DHPA 4TNEA 3EDEA 1IL1A 1RZJH 2R69L 2AITA 2CHZA 2IALA 5IVOA 2PCFA 3QHFL 4WW1A 1LGVA 1SEBB 2HTLC 4U1JA 2OZ4H 3FCSA 4Y1AE 3JV5A 1IBFA 3CFJB 2AJXH 1OARL 3ZLQC 1IGJB 3FH8A 2YQ3A 4BKLB 4EE2A 2OYKA 2FQGA 3VXSB 1FHNA 2ERJC 2IADB 3QUYC 3MV8E 3C60D 4Y2OB 5KBMA 1KB5L 2DLGA 2ZP0T 3AXHA 4XN5A 4DF9A 4PH8A 4WCYH 1DBKL 4GPVA 2PYEE 4BQ8A 4HT1H 4JZNB 1QX1A 5FCUH 3SOTA 4IRZL 5FO9A 5I5RA 2P52A 3KPSB 4QHPA 1NGYA 5IOPB 4NAMA 1D6EA 1CF1A 2R2EB 3LTVA 2K7PA 4F7PA 4Q9RL 5GRXG 2OW6A 3V9CA 3FO0H 1XGUB 4YK4C 1NL0H 3NIGE 2XDHA 3HS0C 1TCRA 1A7BA 4FQIH 4OLEA 2VCOA 1XBDA 1AHWB 1ORSB 4HUKB 2IOIA 3OLDA 4NZTH 4HPHA 4TNFA 2GTZA 3VGAB 1WAPA 1XH3A 3FOLA 4ONHA 3MODH 2BWIA 1DN0B 1I1YB 2DQCH 4YDMA 1QSFA 3ZBMA 3BT2H 1PZDA 4KGJA 3K8LA 3W5NA 3VU2A 4WTQA 1LP9A 1MIMH 2WXKA 3RJDA 3UC0L 1PZBA 4OU3A 4YHYB 4LSPH 1NH6A 1NSNL 1YYLH 3BFWA 1HL5A 5F0JB 3VG9B 1HEJC 3O11B 2BRRL 3CPLB 1WBZB 2ZPKL 4I0PD 3IE4A 1XZ0A 3DRTB 4KZCA 4F3FB 5AW8B 4OZIA 2Z8WC 4ZO7A 1HINH 2V2WA 4UT6L 1RXLA 1JNNL 3MNMA 3HKZA 4HPYL 1N26A 2HAZA 4U4BA 3RWIB 1MJUL 3W39A 2ZKWA 3AABA 5I5IA 3EFDH 4IRJC 4KXZH 5EC2A 5EUOB 3D7PA 4D0CB 3TO4A 4YHZL 2W80C 1EVTC 1Q38A 5AW4B 4PCTA 4HPOH 1HXYB 4AKQA 2WXGA 2Z7WA 3UADA 1J88A 1F4WH 3GMRA 3D25A 1JUFA 4DO6A 2BP8B 4LSDA 1FHGA 1P4LA 2DLIA 2E6QA 3U36B 3OKDB 1NBVH 3WGUB 4NKQB 1PLGH 2A1WL 3WIFA 1N5YL 2F8OA 1S8DA 3V6ZB 3OJVC 3NFPA 3CX5J 1XF3B 4GMSH 4JZOB 2VE6B 5DWUH 2JKRM 5HGAA 1IX2A 4APXA 5JIQA 3GSNB 4NC1C 3LYRA 4IOSD 5I15L 3KYKL 3S8WA 2NW2B 4GG8A 4PJ7B 1JNJA 2BP0A 1ND0B 2FJSA 1GYUA 2J1XA 3QXDA 1VEOA 2GFBB 3O8XD 1QSEE 2HH0L 4YDIH 1OQOA 2XTSA 3U0WH 2VDPH 3JYBA 3DUSA 4PJ6A 4XMLH 1M3IA 5FB8A 2G3MA 4NWTH 4R7VA 1RZGB 5F96L 3AXLA 4K9JA 2KZ1B 4HX1A 1ACYH 2G9HB 2R7EB 3S5LB 1AXSB 1F6FB 1N0XL 4PIRF 1KEGH 1JZGA 1JZ4A 4EI5B 4ACTA 3KYAA 1P7QB 3L7FA 4Q56A 3NH7L 2AJVL 3MDJA 4U1NB 4PV8A 5ABZA 4PTTB 4JFQB 4AQOA 1YC8A 5L6YH 2C3XA 2HLAA 3BSZH 5C0CE 1Z3RA 2LFEA 3B83A 2MH4A 5F7MC 4KITB 2QSCH 1OCOB 2G5BA 2E7BA 4H4NA 3UTQB 2NX5D 5E1AA 4JHAH 5D1QC 1J1XH 1U8LB 1A02N 1AS6A 1BX2B 1C7TA 1OGAD 2P8PB 2AJZA 3BW9A 1OGSA 4V1DE 4NUPA 4QY8B 4V11A 2F5AL 5HYSA 4F1SA 4K15A 4F2EA 2J8UA 4KPHL 3VWJB 4GAJH 4GOSA 1C16A 4LQFL 4KU1A 5EO9A 5DUPH 3WN5C 3K6FA 4NS0A 4AZ8A 4N4YB 4TNVF 1IFRA 3G6AA 4R3SB 3KLQA 3WFCH 3KPRD 4XWOD 5INDB 1LK3L 4RA3A 3K1KC 4XPFH 5AW3B 4A6YB 3KMDA 5I5MA 4LOUD 5AOMA 4LHUB 3N9GL 1JNHA 3QISA 1AC6A 2CJSA 4ZK8A 3NJVA 3DGDA 1GGIL 2XPGB 3AMLA 3BLBA 2QPSA 4G7YH 4WK0B 1CDCA 1KG0B 1V7NH 5GS1C 4UZSA 4KNQA 2P48B 2C5DC 4GJTB 3S35X 2DD8L 2QGDA 1EEYA 3CV5A 4M7LH 4N2AA 2EIZA 1T04B 2HT3C 1NUGA 5I8OH 2BM3A 2X4SA 3L08A 4FKHA 1W8OA 4XNQA 5F3HB 3O4LB 4L8DA 4XGZA 2RFXA 3P30H 1I3GH 4HOZA 5CBEA 4YHPB 4QXVA 3PIQB 4NN7B 3T4YA 1IQDB 4PJ7F 3T3PE 2Y5EA 5JHLA 2Q6WB 4XE5B 5EF0A 4DUWA 1EXUA 2QDVA 3B1TA 3BVDB 3T6QC 2VZ3A 4JN1L 3UG3A 3FCTB 5C08E 3WIIH 4UQEA 2E8ZA 3ZGIA 2WWOA 5AAPA 1MIEH 4JLRA 1EMTL 3H2QA 4BK4A 5HGBB 3OXRB 3UCRA 2YXWA 3CSYA 4S1QL 3ZTDC 5A2JH 2X3AA 4UQAA 1A25A 3C6LD 4DEPB 4GQ9L 2BSDA 2J2ZA 3ETSA 2ZUQB 3IDGB 4FDWA 2CMRH 3Q8EA 4KK9D 4BIKA 2ZAGA 1HWWA 1TQUA 3MLTA 1XAUA 1KTJA 4PR5A 2IO5A 1TO5A 2XQYG 2XXMB 5I16A 1SN0A 5AAMA 2ZP9A 2EUXA 1KLFA 4JPWH 3U7WL 3WO4C 1W6WA 4A7GA 1TQCB 2A9BA 1OAUL 2ZOTA 5E6IC 4JUSA 4LPXA 1WISA 2Z0BA 2OPCA 3PNWA 3UCQA 1FG2A 1NCCH 3GI8H 4CAGA 1J1PL 1FL6A 2ID5A 3MU3A 3QDJA 4OF7A 2ICEC 2ZSVA 4EQ3A 1J0JA 5T3XL 4ADIA 1CR9L 2FECI 2O6FA 4JO2H 3KLDA 1AOHA 4WDIB 4L1LA 4P5KA 2NT0A 5D5ME 4M4RA 5IHLB 4PRPD 4DAGL 1JGEB 3P4OB 3FONB 3IMVA 5IOKA 2VDML 3MVSA 3TBSA 4HU2A 3ATBA 1Y1DA 2BSCA 3U4BH 2CKNA 4OT1L 5JZ7D 1E0OB 3ARQA 4U3HA 2O5XL 4PP2B 4HKZB 2GUOB 3K6IA 3FO9B 1XH0A 1IKNC 5BRZA 1KCBA 2B9AA 3QQNA 4G8GE 3VMNA 4WUUD 4EIUA 4MQTB 2IDCA 2OMTB 2GUYA 3BVNA 5DUBA 5K39B 3CZLA 4RMTA 1F11A 5BS0E 1JDDA 1Q72L 4QHUA 5FK9A 4ZAKB 2XZZA 3GLEA 3RL2A 1HCVA 3UMNA 3X1FA 4YX2H 1YNTB 1MQKH 3RUGB 4PWKA 1K8DA 3MNVB 4K8RH 2G2NA 1NINA 4NJ9H 3PUCA 4GIOA 1TEGA 4P5TD 4WK4B 4PD4J 1NBYA 3K2MC 3NN8A 4JM4H 4ZO8A 5DRNA 3G5YB 5AVWB 2HX8A 3RPIA 2LABA 3HS9A 4Y4HD 4G42B 4O51A 2YRBA 1X9UA 3Q2CA 4ORGA 4DEUA 4GEJA 1Q1JL 3VFTB 1YEHL 3ISYA 5IVNA 4IHOB 2A4EA 2CUAA 4N8VB 4KI5F 2MPAL 5C0JB 4OQTH 1Q9OA 1CT8B 1MW3A 2ZXEB 1QLFB 3P2TA 2WIMA 3M7OA 1QG3A 2CBTA 3WAJA 3O3BA 4JKKA 3KXFA 2ZWYA 3PFUA 2ITDB 5D1ZD 1SJHB 4KTDH 3QRBA 4HUMB 4R8WH 3SKMB 1W72B 4M5ZH 4L3CA 1QNIA 4IKLA 1BIIB 2R0WL 5I1EH 4MCYB 4GRLB 1ZHBA 3SE4C 2Z9TA 2XX1A 3IAGC 2JMRA 3U7YL 2ZWKA 1N2RB 3UMTA 1IGYB 2BS9A 1RP8A 3EDJA 1OM3L 3SQRA 3GMNA 2YGQA 3FFDA 2WBXA 2MHAB 5KW9L 4P3DB 3NBNA 3X14A 5ICZB 4NX0A 2I9LB 3EIFA 5LAXA 4U3SA 4DERA 2C7UB 2ZXCA 3TFBA 1BBJA 1R33A 3M07A 3L1OL 4RWYH 1NKGA 4QRSB 3IB4A 2O6DA 3P4NA 1L5GB 3S34L 3E7JA 3P9MA 3DVGB 1ZJAA 2BNUA 3ZTNL 1AZBA 3BSHA 3TZVC 5GRJH 4GINA 1SF3A 5CEYA 3U6RB 5CSZA 2K8QA 1MDAA 3MRQA 4QF1A 5LO7A 5FA4B 2WBJB 3P4MB 1LD9B 1A7RH 5CU5A 1OQXA 2YK1H 2J1ZA 3KW8A 3VXPB 5CMAB 4ODXB 2CK2A 3JWOC 3KYNA 1AACA 4B41A 1HIMH 1XF4A 1DDHA 2C34A 2H8PA 4JHUA 1ZPUA 3UFIA 1BZ7B 3KJ6L 5EIIA 2F1EA 3H85A 4FXLA 4KAQH 4M61A 4MMYA 4UU9B 5DQ9B 5ICYB 4MQXD 4JFDE 1OGTB 1DUZA 5JXAL 5D7LE 3FK3A 2J8HA 5FKPA 3RWCA 3O6LL 1E50A 4GP5B 3O8XC 4GSDL 4M1GL 2X05A 4MNQB 4EVNB 2BVQA 3HCVB 3TF7C 5JW5B 4I5BA 2XKNA 3EDFA 2IAMD 5I0DA 1FFOB 1QBML 3F58L 2VERA 1E8YA 4OB5H 3W37A 4PRHA 2JCCB 2E4TA 3LNDA 5DJDB 1AS8A 4H5SB 2CGRH 3GBML 1PNCA 5I1HL 5IEKA 1URLA 2ZKYA 5C86A 4JY6A 1OCWL 1XGTA 3WS6A 3RFZA 1GOHA 2VLLB 4KXAA 3NZHH 5IQ7L 3ARZA 3LIZH 1C1EL 2H7WA 4TUJA 1RMFL 4S2SA 3VH8A 4B9CA 5LLIC 1MRFL 4WJ5A 3GUFA 2WZ6A 4AT6A 2FK9A 4YXKH 1IZJA 4RX4D 4DP4X 5L88L 4NKDA 4RRPA 1G7LB 2VM4A 2OR9H 4UZUA 5JDSA 2FJUB 5EPMA 4GG6E 2EUZA 4RGMC 1E4XH 4JO3H 5EFIB 3UXFA 1XCWA 5DMKA 1WHOA 3ABLB 2UVEA 3T4AA 1G7HA 2NQCA 1QBBA 4BFIB 2DN7A 4IU2B 4NNPL 4UM9A 1D9KD 4D0DB 2FHCA 4ORZC 4W70A 3WEMA 4AYBA 3F85A 2WINB 5DMJB 3LN4B 1SHMA 4OQTA 3QUKB 5KJRL 1S7SA 1G7MA 4G8AC 4BQBA 1RZ8B 5JORA 1SQ2N 4HEPA 4HF5L 5T5FA 2MRYA 3CG8A 1AGEB 4BK5A 3LSOB 1D6VL 2HPTA 5EBMB 4Q0XH 1B4RA 3HOGA 2PW1A 3KEDA 3VB8A 2XG4B 1H6TA 4OCLC 1PYWA 2X1PA 4ZMOA 2CWRA 3D09A 1E4JA 2ZOOA 1F02I 1UWEH 3DHJA 4RETB 5KJ4A 5I1KH 3GMQB 1XR8B 3R4RA 3L2NA 2XWTA 4PJHA 3VD2A 2YO3A 3IU3B 4QI3A 1WFTA 3MLWH 3WNNA 3VXNA 4JPVH 4ONOA 2DM7A 1QUNB 4BEIA 2DMKA 1K5NB 1U8CB 1JGLH 5LGJB 4FLRA 2GITA 1MW2A 2I7OA 3DXAE 5GZOD 3LH2L 3SYPA 4CC0A 4EO5A 3DK2A 3LZOA 1AR1D 2HVJB 1NCIA 2YMTA 5K1VA 4X83A 1I4FA 1OO2A 4H8WC 3ASOB 4RFOH 1SOXA 3LEYL 3O0LA 2DL9A 1ILSA 2CPUA 3FT0A 3TV3L 3DMMA 4AC4A 1JTTA 1FAKT 1TSRA 1S7WA 3OHMB 4JCMA 2UY7A 4TL5A 4KJWD 1GGCL 3NMEA 4JRYD 5F7NC 4FP8L 1DUYB 5KYYB 4LF3A 4OAWA 1JK8B 1UATA 3N1QC 4AENA 4AITA 1R0AL 2IBZX 4MJ5B 1FZOB 3O4OC 3UTTD 4ZYKA 4FNQA 5C0GA 4E9SA 5KTEH 5F1IA 4Z23A 2PXYB 5TQ0L 2O5YL 4FL4C 4NGHH 1N4XH 2IPTH 1NUNB 4S1RL 1FGVL 3DX9B 1YEEL 4JKNA 1DBBH 4P3CH 4WNQA 5CGMA 1OP4A 3AMKA 3BFOA 3I6GA 3LKSA 4I18B 1AGCB 1PEZA 3RWEA 1DQDL 1CGWA 3REVA 1T89A 5FUZH 3N85L 2ADJA 5EDSA 2CA3A 5CN2A 4OV6F 3KEHA 2B1AL 3PY9A 2JI1A 4YSDA 5EEYA 3QNFA 3UX9B 2B0SL 3F7YA 2V7HA 2FUTA 1OPGL 1BGXL 4UQDA 4AEIH 4W93A 4FQCH 2HWZL 2H45A 3E80A 3JTTA 1Q0YL 3OKNA 2WXHA 2WXNA 2CHDA 4HC1L 3D30A 3THMH 5CP7B 4HSAC 1GAFH 1MHHB 3X3GH 1HHIB 1KPVA 3HR5A 4R9HA 2EIJB 5DJ6B 1IARB 1CFTA 5IBUB 1YG9A 2O5ZL 3S37H 5MEQA 4Y5YA 4ZFOB 2JELL 1S9KC 4A55A 1F4YL 3ALPA 4LDLB 1L0YA 7PAZA 2Z65C 4J3OF 4NUJA 5JZ7C 5FYLD 2N59A 4U6VH 1HAUA 5HHVL 2E9GA 2A83B 2R2HA 3NDYE 2WMPA 1AD9B 3F6IA 4MLIA 3ULUD 5JW4R 1KFAL 5DJCA 4M8VA 3MUHL 4U6HA 4B0MB 3L4VA 1SRDA 4ONFH 1TKWB 3T0AA 3SKOA 3MROA 5F6IB 1XL6A 3L5JA 3H2PA 3LN5B 2F7QA 2APWA 1BVNP 2GK0A 3KBEA 3CPUA 5HJBA 3VXSE 5I1IH 2XQ0A 1LO2H 1NGPH 5HVWA 2JKNA 4NFDA 1XXFC 1F4AA 3ABKB 3C6SB 2NXYC 5KVEL 1SFDA 1OGPA 3MBWB 5KVEE 4OH2A 5FW6A 1HE8A 4JKPH 3Q6GL 4PLJC 4MAYC 3RE0A 2NY1B 1E8WA 2QGEA 3KPSE 4HIHB 5GPRA 1EJOL 4HUCA 1FYHB 3D07A 4JREB 1IC5L 4LAQL 4QXWA 4D9LH 2Y22A 1R5VB 2IDTA 4YXLH 1KULA 1BM3H 4LSSH 5KSAA 2WYIA 5TQ2L 3VCLB 3TN0C 1U91B 1RVFH 5D1ZC 1KN4H 3C6EA 1GGBH 3HW7A 3U25A 3O3DA 4WW2A 4MNHB 5ELIA 5A3ID 4Z7UB 4TYUA 4OZHA 3T6XA 2ATKA 2N0MA 3T0EB 2XZQH 5EZJB 5HGDB 4QHMB 5DS8B 4EN3A 2XN9A 2XG5B 4Y8AA 4L3AA 3TJEL 3IDYC 2WSPA 4JFHD 1I85C 4WFHE 5ANHA 1BEYL 3A21A 2G0KA 3EH3B 4X7TB 5IMLB 1OSZB 3MCYA 5IK3A 3D05A 4OLXL 4WHCA 5JMOC 5C0ND 2X4PB 4YBLC 3W9EB 5MP6L 2H9GA 1H8SA 1INDL 4XB8A 2WW8A 3SD2A 1CDIA 3T0XA 1G9NC 4BYHA 3B2VL 4JKWA 3RVTC 4YO0A 4LRNL 2DQHL 1JFQL 3FQNA 2NY4B 4KJQD 4YSOA 2NYYD 3UACA 1B3IA 4NP9A 4OLWL 3T3MF 4UZGA 4DN3L 1M4KA 2DMGA 2VR9A 3NFSH 3EGDB 3BAJA 1HCZA 3UJTH 2KDYA 4MB3A 2HUHA 4LDEB 2HUEA 1E3FA 5EUOE 5DC0A 5F3BA 5C9JA 4FS0A 3K0WA 4UDUB 2Z4QB 1UENA 4KDVA 1MJ7H 4XT1C 3S35H 3DA0A 5KBDA 4U6YA 3KPLB 3OMNB 4TNWF 4BZ2H 1RD6A 4CJ1A 3ECWA 4OGYL 2R0LH 4H8VA 1E6JL 1RUQH 3UYPB 3RZCD 2DKMA 4GRMB 4GLRI 3GSNL 5SWSD 1T0MA 2IIJA 3MO1B 5F88B 5EV7A 2IAMC 5I9QC 2VH5L 1IM3D 4FQLH 1R3IH 2NZ1A 3NJXA 4PJ7E 2E6JA 1PJ9A 5FUOL 4HXBL 4JFFB 3MRDB 4FQPA 1MRCH 3HZMB 4M02A 1EV2E 3CX5K 3O6FD 3QDGB 4HHAB 5IBTL 2JV6A 4ZT1A 3DPBB 4E9TA 3EAKA 1D5XA 5HYQB 2EE0A 3BLKA 4PJDA 1OIOA 1HVXA 2GG1A 4GQRA 3UTZB 5DJ2A 2BLFA 1IAKB 3CCHB 4MWFA 2F7OA 1QRNA 1AQKL 3FT2A 3REWA 1I9IL 5BMFH 4L29B 3QJFB 1BFVH 2OX5A 3B5HA 4HIIB 1EH9A 3S5LG 4G1EA 3PHOB 1J0IA 5LWYH 3II2A 3K0YA 2DLEA 2G30A 4GBXB 4D2NA 4NZRL 3ZYIA 4AQEA 3QRFM 3SCMA 5FYKL 2CHXA 2GSMB 4OM1H 3WFBH 1NQBA 4IIQC 2YARA 4ANXA 1CDYA 4XVSH 4XNZB 2D73A 4MDIB 3U1QA 1J05A 1QFUL 2WB7A 4G7SB 2EH7H 1JBJA 3WHXB 3T65A 2AQNA 5DRXB 2EZ0D 4WWKD 4KK5D 4Z7UF 2Q10A 4ZX4A 3V6BR 1BEXA 4WHYG 3S3JA 2W1NA 1ZD6A 1PLBA 4Z3FA 1YSOA 2CPCA 5HI4D 4OSUL 3HAEB 1IAIH 4AIXA 3D39D 4G9FB 1DVUA 4M7JL 1OWRM 1U42A 2QZ5A 2O26U 2DM2A 2P46B 1WZ1H 4HGWA 5ECGA 1EEQA 4CNIB 1MCPH 1QFOA 4NZUH 3ZE0B 1VSCA 2XJKA 3B9AA 3GSWA 4ODWA 4AYSA 2WSDA 1TETH 3I6SA 1T1WA 2I5YL 1EJFA 1LEKB 1AO7A 1ZHNA 2EADA 2WTPA 1G6RH 3UZVA 4QHLA 4M93C 4A6YL 2QQKH 1YN7A 2BJML 3FTVA 4Q2ZA 1SXZA 4LHUG 1FUNA 1IM9D 1KIQA 4F7TA 3RX9A 1LO0H 4UM8B 4AVHA 3GDCA 1I7TB 3G9VA 4HZAA 1AAJA 1CZ8L 4M8RA 1DCLA 4P59L 4JRXB 4X6FB 3UIYA 3UEQA 3VM5A 4DKTA 1JPGB 4UOW1 2KH2B 5GZOC 1L7IH 5C2BH 5KSBA 4ZOEA 4DPRA 2ZCKH 1NMAL 2WAQA 1AR1C 5GRVK 2VLJA 1SMDA 2WXQA 5F93C 3D6GA 3GMPB 1CLOH 1JRHH 3U9UB 3FS9A 3FPYA 4KK8D 4BE6A 3RU8L 2E9WA 4FFZH 4OKDA 2PYFA 3O4LE 4KJWC 3G3LA 1NIDA 4DNLA 1UM5H 4PRBB 5BO1L 1FGNH 3BUBA 4OTXL 3NCJL 5FFGA 8PAZA 4KY1L 4N0UB 1A1NA 2WYZA 3T8MA 4BZ2A 4KI5E 4GS7C 1CYGA 1PD0A 2EDDA 1U8QA 1J9QA 1KCKA 2UXFA 3KPOA 2QQNL 2ADGB 1R24A 5DVKA 1N70A 2LR4A 1J5DA 4DGWC 1E2VA 1EUUA 1DDTA 5E8DL 4L8SA 5I18H 1JYWA 2VISB 3HI6L 2F7RA 1PJWA 4G6KL 5T3XD 3MLYH 4HAFA 1JDAA 4JKLA 1A66A 2V2XA 2IBGA 1G1OA 4GKNB 1WE5A 1UB5A 1BAFL 5J1AA 4OCNC 4GO8A 5IW3A 3W2DL 2UXTA 4CJ0A 1PSKH 1CL7I 3QPXH 3MRNB 4ABQA 4QOKA 3EYUH 4J7RA 2DTMH 4V2BA 5I76B 3BXNB 2HVKB 1DVFB 3BKYH 3AWGA 5D1XB 4BH8A 3SQBB 5K9QG 1FNGB 2ZAIA 3STZA 3ZUNC 1W0YT 1AC0A 2DWDA 4LLVB 1OP3K 1F8TL 3KLHC 3S4SB 5EUKA 1AQ8A 2I69A 2TRHA 3TJHC 4WUKH 3PFQA 2FJHB 1IT9H 3ZZ1A 5JHDD 1NCGA 4K3EH 4Q6KA 5GSRA 2P5EA 1GGTA 2Q7NA 5HHNB 4L1DA 5F8RC 1NMCB 3HZKA 2LE9A 1TOXA 3BGMA 3ULUC 2WUCH 2QR0B 4DKDC 3V9EA 2WKOA 1FZKA 3GRWA 4WGVB 4XN7A 5HYEA 5A6MA 5ALCH 4D3CH 2AJ3B 3GLAA 3ROOA 4RIRB 1FYTA 4QWWC 1UWFA 1KPRB 2BCKA 3V9FA 3ZSTA 5CBAA 1OAZL 5IQMA 2CLVB 3NZUA 1B0GB 1NBQA 2CKBH 3JWDH 4OCXH 4QJ4B 1EHLL 3DARA 4X6EB 3V5DA 2VXUH 3PABB 1A3ZA 1Y6KR 4JFPA 1WAAF 5A2KH 2BO0A 4QRQB 1CE6B 5ACLA 1ZSDA 3RUGE 1KT2B 1P7KB 4AVKA 5EC1B 5GGSY 1IC4L 4LZKA 4UCFA 4FEIA 4PCYA 1E5UI 3W5MA 1XGRB 4P2RD 1BD2B 5FO7B 4DZ8B 4XC3L 4KZDL 2CO3A 4NO5B 5KBPA 2OK0H 2CLZB 4M1DL 4PRIB 2WLKA 4GXUM 1WD8A 4L8CA 1K4DA 4ZW8A 5FWQA 1FFNA 1BVKB 1MLBB 4FG2A 4PD4K 4JHVA 1VADA 4HS6B 4S1DD 2ZUTA 4LARH 4N8VG 3GPEA 4KKQA 5C0AD 1DSFL 4HWZB 2XBTA 4FFZA 1V10A 2G5RA 2AEWA 3QUZD 3QZNA 5F9DC 5IVZA 5INCB 3SDCD 2V2TA 4TULH 2BDNH 5EBLB 2EYRB 3VFVA 4QIRA 5JTWA 4LKCA 1Z9MA 1ZLDA 1W72L 4MXWH 4HCRH 4P23D 4QRFA 4YL4A 3GEWB 5SX5H 4CN6A 1JIBA 5I30H 5BOPA 4N2LA 3M1BB 3ATDA 4HS3A 4MJIA 5D6CB 1URIA 2IG2H 4OLUH 4WFEE 2X4RA 3QHTC 4TMPA 5IB3B 5C3LD 1A9EB 5HHXL 2NY2C 1ID2A 3SD5A 1YEJL 3BVTA 1IEBA 1XTMA 2XTJC 5ENWB 1J5OL 1BPVA 3Q7JA 1J12A 5E2WH 5E08L 1JG9A 3EDKA 2H32A 5DZLA 1Y18B 2X87A 3JQOB 4TSBH 5FC9A 5GRYA 2NY5L 2JB5L 5GS2D 4X6BA 5FDWA 1MH5A 4GUPB 4KJQC 4PB0L 4FERA 1QWUA 3QCVH 1QFWM 2P8MA 3QA3A 3PWVA 1RULL 4NNXA 2FX8L 3VFOB 3QJVB 5E9DD 2A6DA 1U8NB 1VPOH 4JO1L 4YAQB 4WWOA 1TZGL 1J18A 1UZ8A 3FQTB 4J3XA 1ASOA 2BW4A 1N59A 3MRLA 5FHBL 5C0EA 2F7PA 3EJJX 3BGFC 2JJTA 3TEZA 1NBZB 2A6KB 4X4XA 3D0VB 3RZCC 3NJKA 3D06A 1PY4A 5C09B 4D7BA 5JDJA 4WI6A 2XRAL 3VJ6B 4U1LA 5FV2A 3LKOA 4PSPA 5KSAD 5CGTA 1S7QA 3MV01 3IAQA 1ZLVH 3GXUB 2N1TE 1F90L 3F01A 2R4SL 4UV4H 3V5HA 3DX0A 1T6VN 3FUMA 3SPCA 4ONGH 1UWXK 1ICTA 3S3DB 3X2QB 2NYKA 2V5TA 1SHSA 1CGVA 4YIQB 3UBXB 1IVTA 1R5WA 1NAML 2XJLA 2XN9D 4MNQE 3RX8A 3Q9QA 1VKXB 5ITFB 4YNYA 3L3DA 1NDMA 4HYTB 5E6ZA 3G5ZA 2X1QA 4CVZA 1IGMH 4W9IC 2JCCE 1ZE3H 3PREA 2IALB 2TSAA 4Z3IA 4Y9CA 4ZXBB 3VFPA 3KWTA 4LBEA 2E7DA 2F53B 4KDTC 1CF8L 1PCXA 4CN1A 1FV1B 3Q8FA 2VDNB 4U3CA 3VXMD 2D03L 1AS7A 4DVBA 5DC4B 1SYVB 5T1KB 4IEFB 3Q5YA 4ZUVB 5I1GL 5J13C 2AJYL 2FQEA 4Z77B 4WU5A 2N7BA 1EJ6A 3V7AG 3ZQ9A 1YMMA 2XN2A 2QV2A 1Z9SB 4WJG3 3TONA 5IB1B 4MSWB 2IANA 1KGYE 1NGYB 4NHCH 1NJ9A 3L3IA 5HI4C 1CI5A 5KS9A 2Y3NA 5HDQH 2VR8A 2BXZA 5DFAA 4Z5RA 3VI3A 2BVYA 1WFNA 3KNBB 3CVHA 3HNVH 4HIXH 5BV7H 4B9KC 2XY2A 3RVUC 5FM5M 4PGBA 1C08B 3GI9H 5EU6D 3GMLB 2P47B 1E5BA 4TTGA 3LZFH 2F2HA 3BIKB 4HJ0C 3VE0B 2FWOB 2PWFA 2HKFH 2G3ZA 2N7SA 3HPLA 5HDWA 4BBWA 2D0FA 1HEHC 2GT9A 3CMOL 2CRZA 3QI9D 4U2ZA 4JUTA 3DO7A 2A2QT 2C1PA 3VFSB 2YHGA 1DJIA 5BJTB 5B8CA 2VUOA 4J3WA 2MNUA 2ESVB 4Z3HA 4PGDB 1OCCB 4BH7B 1E4WH 3WS6C 2Z93A 4QPEA 3RFZC 1P7BA 3BQUA 4AX3A 3ZIYA 2Z6FA 2EICA 4KH9A 1UWXH 4EDWH 2DPKA 3WHE1 1QPPA 1UGNA 1WGVA 4AJVA 2GC7C 4Z7OB 4K94L 5L2KA 5J6GA 1E6OL 4XMWA 2EEXA 4R4ND 1MN4A 2CO7A 1TZAA 3HG3A 4M43L 2A77H 4KK8C 5AOLA 1HILB 1TVHA 2Y24A 4F8OA 2H2SD 2IPUK 2HLFD 3V0VA 4ERSL 2A9AA 3W39B 1QFPA 4P4KA 3VXRA 2I07B 4LVNB 4M5SA 3QUXB 5GIRA 3WN6A 2RCSL 2IFFH 3VACA 2HG5A 4X7DC 2J1WA 4P2QD 5KVMC 3CHRA 5H4ZA 4E9VA 3LZRA 3C5JA 4ZNEA 5HBBA 2YFOA 3CZEA 1D5BA 1G7QB 3X13A 3QR1A 2YPKA 3GSVA 4ALAL 1I3RA 3QXVA 1RFDH 2MQ0A 3S98A 4BK5C 3APFA 3QWRD 5KOMC 4BGDA 5HHOB 3NGBC 3X1GA 3ZO9A 5HGAB 3NRFA 4APXB 1MCOL 1XF1A 2Z91B 2ICCA 1JK9A 1UXWB 4X6DA 3HUJF 4HWBH 3KWWB 5HHMD 4U05A 5D1ZI 1L0QA 1NC4D 3AW5A 1QI4A 1DLHA 1JXKA 3K4DA 4HIEA 3CFDA 1BFOA 1NFIB 2VLKB 3FAXA 3HC4H 1GC1H 3UAJA 1KIUA 4JE4B 2A9ML 1W91A 5FDYA 4Z7VB 3D18B 4PJ9D 1WA1X 4BQ9A 5J9PA 5HJGA 3RBGA 1QFWH 1MFAH 5E70A 4KOBA 1FFPB 5IKCA 3DVIA 4A2HA 4NQDA 3LNEA 5FPIA 1O7DC 1DLFH 5C0BB 3D85A 5I0XA 1KDIA 4L3FA 3PQYA 4TQHA 3DMMC 1UURA 1XEDA 2DBLL 3MV7D 3WE1A 3RGVA 2P5WD 5DD0H 4NT6B 4ZFFA 1M6OB 4N0CC 4QGYA 4ZFOL 4R26H 4ZX3A 5L2JA 1BAWA 4Y1SA 3CC1A 3ULVD 4MHHI 2Q20A 3IMRA 3UTSB 3JTSB 4K7PL 1SY6H 1REIA 2VW4A 2AJZB 3E1ZA 1IFHL 3LS4H 1QUPA 2XT1B 4LCIL 4R96B 5BUAA 5HYFA 2J8UB 1RJZB 2BNQD 2Z8RA 1PD1A 1JI2A 1PZCA 5GGVL 2WXPA 4WRLA 4MD0B 2VLMD 1ROWA 3TT1H 5PCYA 2EQDA 4AZ8B 2XFXA 2DI7A 4JHWL 2C9XA 1AQMA 2SEBA 3G6AB 4GXFA 5HPMB 3BYTA 4M5YH 4I3RH 1O6TA 1WGOA 1RIUL 5C0FA 1YEFL 1ET8A 5TGBA 4UI2A 1L9PA 3DIVA 1ADQL 3QJTB 2W65B 2GJJA 2A38A 4KX8A 4ZMQA 4S1DC 5D71L 3HN3A 2KL6A 4NYLB 2JI3A 3L3KA 3MV11 1ZHKB 2IGLA 4AQ1B 1KJ2H 3QUZC 4IS6B 1DSWA 1KLGB 5B1KA 4KNUA 2FSEB 4Z7QF